1ZAOA

Crystal structure of a.fulgidus rio2 kinase complexed with atp and manganese ions
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
282
structure length
271
Chain Sequence
MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVGHTKVKEFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Autophosphorylation of Archaeoglobus fulgidus Rio2 and crystal structures of its nucleotide-metal ion complexes.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Transferase
molecule keywords Rio2 serine kinase
total genus 93
structure length 271
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zaoA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zaoA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zaoA02
1NHAA 1S9JA 4L5IA 2JTVA 3MFTA 4YIFA 2H8HA 3FLZA 1ZH5A 5E8XA 3UMXA 4AZFA 5FD2A 4C3FA 3EETA 2GNGA 3LQ5A 3DAJA 2VTSA 2XA4A 3QQGA 3ZO3A 2KJCA 3JSPA 1FSEA 4CZUA 4YJOA 3D2KA 3HDMA 5EW9A 3QKMA 4IWQA 3GQLA 1NT2A 2OXDA 4E7WA 2CNUA 3HA8A 3P78A 1PP7U 1OMIA 3KEXA 4F6WA 3COMA 2NRUA 4AN2A 2YDKA 2H96A 2WTVA 1OKRA 2XBAA 3R7EA 3BU6A 2CKOA 4DITA 1H1QA 5CSHA 3PY0A 1KQ8A 4P9FA 3T1BA 4PDPA 1XMKA 4PL4A 3HUGA 5A14A 3K9TA 3EQBA 1FOTA 2QODA 2QQ9A 1ON2A 3WILA 4BXUA 5HCYA 3MZYA 3IC7A 4N9IA 2VWXA 1BC7C 4CKIA 5IISA 5AV1A 4IZ7A 2I6LA 4K6ZA 3VW6A 4DLIA 1Z6RA 2L02A 3KK9A 3P9KA 2GNIA 4G6LA 3FM3A 3V8LA 4O27B 2W17A 4XG2A 2UW5A 1H26A 2G1TA 4ZSGA 1BLXA 5IKWA 4MYGA 3BGPA 2OKRA 3C5UA 5D7AA 3KCCA 3E5AA 1L3LA 3KMWA 3A4OX 5CZHA 3WU1B 3MS9A 3TUDA 5DEYA 1UNGA 5LJJA 4AWIA 4FV4A 5DCMA 2XKDA 4HW7A 4KUJA 4XG8A 5HS9A 4FBXA 3SC1A 2GA2A 4C62A 1UWHA 2XIGA 2KJBA 3LQQA 1GAGA 2ZDTA 1KU2A 2W05A 3L8SA 3OOGA 3VS1A 4XS2A 3IQ7A 4I2OA 2GZWA 4KMUX 4MD9E 4IFGA 4L52A 3FMKA 2OH4A 4CHUA 3BYUA 3IKVA 4DEBA 4E6DA 2HTSA 4UWBA 4DFBA 3O7LB 4FKLA 5DH3A 5FQDC 5AP2A 3WF6A 2OFUA 2YM8A 3TNQB 3CPCA 4I93A 1PHKA 1Y0UA 4QMVA 3KMUA 3TUCA 4HQMA 4KIFA 4D2TA 4PTEA 1BN5A 3VF9A 4I22A 4EL9A 1A04A 2WTKB 4QP6A 4YLJA 4M9SA 1ODDA 2FSWA 2PL0A 4FKWA 5AR5A 4RX7A 2BAJA 3I79A 5EEHA 4DINA 1CF7A 2C6YA 1O6KA 3OROA 4G2FA 4YJTA 3NAYA 5FRIA 4DTAA 1Z7UA 2VN2A 4CYIA 1XH4A 3HGKA 1J91A 4HOKA 3LLAA 2F2UA 3H9FA 1KYZA 4AA4A 5A4TA 3Q2MA 3W8QA 3HUBA 2M45A 4NZWB 2W25A 3K1PA 5HOAA 2JKOA 5HIBA 2HEOA 2FU4A 3MDYA 3RHXA 5DV5A 3MI9A 2C6EA 4CD0A 3FI3A 5EH0A 5DPVA 3UG1A 5BYLA 4XG3A 5IUHA 1BI7A 4MH7A 5CEQA 4UHTA 4M7IA 4JQEA 2RFNA 2B54A 2WC2A 4QQ5A 1YHWA 2JDOA 4A4OA 4JQFA 3JR1A 2YN8A 2CNQA 3ZC5A 1PP8F 4RG0A 3F8BA 4S30A 3AXWA 4WXHA 1PMNA 2VO7A 4KA4A 2XBJA 4DBXA 4DFUA 4L67A 4AOTA 3EYYA 3MFUA 4XMOA 4IBMA 3FZ1A 4I41A 2WMSA 2LGCA 5L8JA 5F20A 3F2AA 4Y83A 4ZIMA 3A62A 5EM7A 3MA3A 3V3VA 3RGFA 5L3CA 3ZMUA 1MZBA 4J1RA 1STZA 5BX0A 3LCDA 2HDCA 1Q1HA 4UMRA 2C6TA 1V0BA 5TR6A 1O3RA 3SA0A 4BBEA 3LXLA 2H6BA 3T8TA 1S9IA 2JKMA 4G6OA 2BALA 4YR8A 1XN7A 3NUAA 4U40A 4IJPA 1R22A 5I0BA 4XP0A 5CI6A 2YX4A 4P90A 4EOQA 4KMFA 1YWRA 3GEQA 3NYVA 3DU8A 3UQFA 2CO5A 2VUWA 2DUVA 3PP1A 2IA2A 1IASA 1W4MA 4MAOA 3U6IA 4FG7A 2XNPA 5D4SA 5D11A 4HV6A 2L54A 3NNUA 4ZY4A 3VVHA 3ZFMA 2OLCA 3DJ5A 3MPMA 3HEGA 2VO3A 5JK3A 2R3FA 4N0SA 3ZLWA 1OL1A 4BCIA 5IEXA 3ZO2A 4G94A 1GZOA 3NNVA 2XKFA 4F6UA 3RK7A 2QO9A 3LVPA 2WV0A 3E8CA 3LCTA 3CS9A 4FX0A 3K1MA 4DEIA 1JQHA 4DFXE 4O0YA 1OPJA 3QA8A 4CZYB 4XHKB 2KKOA 4PGHA 4BVUA 2CGWA 4AP7A 4OBQA 4AA5A 3CCNA 4MD7E 4BQAA 3V5QA 4EOSA 2BAQA 3DPKA 1MP8A 1TNSA 4AT5A 4E26A 3FLQA 4EOKA 1YWVA 1V4RA 4TWOA 3HLLA 3WZDA 1G8SA 4DGOA 3QAHA 4LRJA 2Z5UA 4A9RA 1G5SA 4PNKA 3D94A 3IW6A 2PI0A 3VO3A 2R3QA 3TOBA 3FL4A 2A27A 1UHMA 3VHEA 4J8MA 4BCGA 2RC4A 5HLGA 4QNYA 4MTAA 3FC1X 1FGKA 2OSCA 2UW3A 3V6SA 4RA4A 4QO9A 2ZMCA 5DT4A 3A60A 2J4ZA 4UMUA 4X6RA 1RE8A 3DY7A 4GEOA 2WTWA 4Z7HA 1AOYA 3TZ7A 4EHGA 4ZTMA 1PMVA 3TXOA 4I4EA 1W84A 3MY1A 5GJFA 2FBHA 1U5TC 4MHGA 3QKKA 4P5QA 1WBPA 3E8EA 5DI1A 2ZMDA 4JDHA 5AAFA 1IA9A 4P2KA 5JVTA 2RSVA 4YPDA 3NR9A 4CG9A 4BRXA 3KZYA 3VUDA 1XH6A 4FNZA 1SVHA 4D9TA 3OXIA 2FRHA 3PSCA 3FHIA 2WD1A 5CZIA 4JIKA 3RBWA 5HTIA 4PPAA 5FDPA 4EQMA 3M9AA 3GXLA 1XDUA 5IQEA 4RB2C 4RVLA 4LD5A 2O8XA 3EN4A 4B9DA 5G1XA 3LLTA 1H25A 4BCQA 4A0ZA 4DF3A 5DIAA 1DS5A 3Q9WA 2XNNA 4IC8A 4BBFA 5JFVA 4FKQA 4A4LA 5FXSA 2JPBA 4NYEA 3P23A 3ZN1A 2IVVA 5FDXA 4X3FB 4TNBA 2Y4PA 4LGWA 4FTQA 3T8RA 4C34A 6PAXA 4BDCA 2WMTA 1LEZA 1FZPB 5F6FA 3ZMDA 3CXWA 4JR3A 1OBGA 4R1HA 2XGXA 4GV1A 2AXLA 5IU2A 4RIXB 4V04A 4JBQA 4LGDA 5J79A 3TUBA 3K3JA 1SAXA 2XAJA 3W16A 3P79A 2RFSA 4FKGA 3BP8A 1RQQA 2BILB 3GZ5A 1S3JA 4E6QA 3GI3A 2FEZA 1REPC 2G2HA 4A5NA 2PUPA 2GHMA 3REOA 3MWUA 1BI1A 5ETFA 3ZS5A 4GVAA 5KCVA 3TNPC 2IW9A 2HYGD 3CJGA 1IZ1A 4OBPA 3GCQA 1OL2A 3GNIB 3VS4A 3WODF 5FLXK 3L9NA 3KN5A 1ZLTA 3PE1A 1K2PA 5C4KA 5HVQC 4A9YA 3MTFA 3IPHA 2JKKA 5L2TA 1WZYA 1X8BA 4BZDA 2F7EE 3CP9A 5HIDA 3F23A 5IQIA 2ITPA 5FTQA 4CYJA 2GMXA 2V7AA 4FTOA 3PPZA 3ZCLA 4HZFA 4UMPA 3HTSB 4W4VA 2UW6A 4RB3C 3U9CA 3SAYA 3ZU7A 4I1ZA 2RNJA 4CKJA 3BWGA 4W4YA 5CNOA 4BWXA 3DTWA 3SOCA 1P4FA 3R9OA 2C6IA 3QUEA 4L45A 2QOKA 5B7VA 2OWBA 4HF2A 4PDKA 3FSKA 3OD6X 3LKMA 3ECOA 1F5QA 5JRQA 4EHZA 2ZV7A 2PMUA 3B8RA 3BX5A 4HYHA 1XH5A 3OWLA 4RGRA 4HCUA 4E5AX 3F82A 4RIWB 3GUBA 3C4CA 4CFFA 1O3TA 2IT0A 2G7UA 3T5XA 1R39A 3O8TA 4EM2A 4N57A 1URCA 2XIKA 4TV7A 5LEKA 5LXMA 3NMUF 1KYWA 4XLPF 2ZVAA 2EXCX 3OVVA 2VGOA 2IJLA 4ZTSA 4H39A 1FMKA 4C4GA 4WUNA 4K0YA 5A4EA 3E8DA 2Z99A 4FYNA 2BROA 4FGBA 3B8QA 4NW5A 4B4LA 2VTOA 1M17A 4EOMA 3D7ZA 2BR1A 3GT8A 3EL7A 4H05A 4KINA 4EZ5A 5CLSA 2GFSA 1J3HA 4FL2A 3FZPA 4AZWA 4IWPA 3ACJA 2D2WA 3CPBA 3GFMA 3S2PA 4KBKA 4KKEA 5B0XA 2VODA 3QZGA 5TJJA 4RA5A 3E3PA 4RIXA 1QPDA 3LM0A 3RWPA 4RFYA 2I7QA 2WTCA 3KF7A 4A06A 4O0UA 1OI9A 3IOPA 4ZJVA 4GUEA 4J95A 3HZTA 1M52A 3DJ7A 2XCKA 5F1ZA 2XK4A 4A2UA 1USTA 3BYMA 3RJCA 1YW2A 3F3WA 4EKKA 1C0WA 5AM7A 5IH4A 2E9NA 4RJ6A 5AA8A 3DBCA 1UHWA 3B2TA 2VWYA 1B38A 2O6GE 2WELA 1FOKA 4KBAA 2DBBA 3ZMSA 5LLQA 3OP5A 4RQVA 4OTRA 1OKZA 1CSNA 2FMYA 3SRVB 3NSZA 3Q9ZA 5HX8A 1YI6A 4O7RA 2HKXA 5DR9A 1Z9CA 4L68A 2PULA 4RLLA 4EKLA 3U4WA 2QBYA 2ZMEA 5EW8A 4QMNA 4EYMA 3MFRA 2DQRA 3RZBA 3AMAA 3ORLA 4R8QA 4GG7A 4F1MA 2W1HA 2VWUA 4ETSA 4AWXB 2Z7LA 2JKQA 3DXJF 3HVCA 2H94A 3E87A 5KZ0A 5CVGA 4MVFA 5E1XA 2VWZA 5E18F 3V7CA 4Q5SF 3OTUA 2HZ0A 3PE2A 3MQ0A 4GFGA 4DEGA 2OQGA 2FF4A 1IRFA 3NYNA 3P08A 4TKSA 2H6CA 4G6DA 4BFMA 4OR5A 4CCUA 3AC1A 4F7NA 1JGSA 3NVKI 1CTPE 3UMWA 4FNXA 5HICA 4ACGA 1R1WA 5HDNA 2A19B 2HENA 4M12A 2BTRA 3HMNA 4KFCA 4ZTRA 1AGWA 3OBJA 2JLDA 4YZCA 4M84A 4MNFA 4BTFA 4F70A 4TN6A 5ILUA 2W9FB 3EKNA 3QCYA 3PA5A 3V5PA 4QMLA 3WE8A 4BGQA 3PYYA 3TDUC 2GS2A 4FEWA 4FKOA 4E8AA 3OWPA 1S7AA 5LRRA 2K86A 4IWOA 3V04A 3KF4A 2EFWA 5AR2A 3UE4A 3Q6UA 4ASXA 5LMKA 2W0JA 3L9FA 5BVOA 2HYFA 4U41A 3EQGA 4IXAA 4IB0A 4G16A 2WQBA 4WRSA 3PDTA 5T68A 4C33A 3ZMZA 3R01A 2BZIB 4HX8A 3G9LX 4UALA 5HBJA 2L3DA 3KN6A 3VIDA 5J8CA 4KIPA 3LFDA 4J97A 4FEVA 2VOPA 2R3OA 2R3JA 4L3LA 1Q8YA 4CG8A 4DBNA 5H9BA 5BUEA 4E4NA 2BHHA 4A0XA 4Q9ZA 4CGAA 3NVMB 4OTFA 4YURA 4CQEA 4DNCA 5HO7A 3VN9A 4RVMA 5IT3A 3K1NA 2GPHA 2UZEA 2PMOX 4KAOA 3KL8A 1PUEE 1B6CB 3CC6A 4C58A 4U44A 3W33A 3I0OA 4JG7A 1BM9A 4NEUA 2QOOA 3LFEA 3PXZA 2JZYA 1MQBA 4FUXA 4AS0A 4G9RA 3MY0A 5CWZA 1HKTA 2VWBA 3UO5A 4G17A 4J7BA 4XSZF 4G6QA 3WTXC 4AIJA 1JWHA 2ITZA 3LFCA 4YZMA 3SG9A 3E6BA 5AIPA 1PDNC 4NWMA 2B53A 3ZM4A 2XS0A 5J1VA 4W4WA 4WWCA 1Q62A 4RMZA 4F64A 5HKMA 1CMKE 3HMMA 3UNKA 1TTYA 1TLHB 5DLSA 3LQ3A 4QP1A 1ZYJA 2RFEA 1Q5KA 1YXXA 4GSBA 5AONA 2PVRA 3CLYA 4M69B 2XJ1A 4KRDA 1S29A 4AZEA 3R7IA 5JT2A 2XJ2A 1DI8A 4GMYA 1H28A 3KE2A 3TV4A 4IAKA 4RB0A 4YJNA 2P4WA 4LG0B 3QU6A 5H2UA 4C4HA 1T38A 2QVSE 2XF0A 3WTYC 1KE5A 4C36A 3DAKA 4HGEA 5FG8A 3TI1A 1GVJA 3G5DA 3ORKA 2QG5A 4KKGA 2Y0AA 2OXYA 2RKHA 5L3AA 4FTRA 3HRUA 3I54A 2O3FA 2HY0A 3RM6A 1CM8A 2ZB1A 4ARKA 2CYYA 3RPVA 2VE9A 1ON1A 2WQOA 5E17F 3VJOA 4S04A 5JSMA 2PVNA 1UU3A 3PJCA 2ETHA 2F57A 2PVJA 5D41A 2VAGA 3C7QA 2W4JA 5AAEA 2JRTA 2XKPA 4CCBA 4R7BA 5M08A 2IPXA 4ZXTA 3LW0A 3QZHA 3VC4A 4LFIA 1ULYA 1E2XA 4C35A 3DKCA 3C4XA 3N4VA 3SHFA 1YVJA 4L3PA 2PU8A 2YWVA 5ETAA 2QKWB 4UWYA 4DH8A 5EEGA 3MIYA 4LOOA 3TT0A 1MUOA 4M8TA 2IVUA 3I0TA 5AV4A 2B1PA 5CSPA 3Q96A 1SVEA 5AR7A 4BCOA 3QXPA 2ITQA 3W1FA 2ITNA 3DCVA 4XBRA 3OOMA 4ZAUA 1Z05A 4OUCA 2R7BA 3AGMA 1KWPA 4O7WA 4EK3A 3PFQA 4M0ZA 2XYNA 4KSQA 3C7JA 4ZYEA 4IEBA 4EVIA 1NW1A 4U88A 2QQBA 5DT0A 4EWHA 4CXFA 2UV2A 1WI9A 5E1ZB 4LMNA 5EQPA 4H0EA 1REJA 3UDBA 4QMMA 3O0GA 2PN6A 3PQKA 3H9RA 4FT7A 4FKPA 3LFFA 3AGLA 3EQPA 1W7PD 3KFWX 4RC3A 1BIAA 5IQAA 3OMVA 5ANGA 5K5NA 1P5EA 5DNRA 5LHGA 4JRVA 3S2WA 5C4LA 4AGCA 3T9TA 1P92A 2LF8A 2OJJA 4FR4A 3FMNA 5M4IA 3HAVA 3KRWA 4FG8A 2XNBA 1VYWA 4C8BA 5EKOA 4H1MA 1ZG3A 2EA4A 4EH3A 5A3XA 3OW4A 3GC8A 2CNVA 2EV5A 2CN8A 2VZ6A 3TKHA 2R64A 1EH8A 3B2WA 3FMSA 1HQCA 3UOLA 1BYGA 4U7ZA 3OT8A 4GL9A 4L7FA 1USSA 2CGUA 3H0ZA 4ESJA 2ZM3A 5IZFA 2ZJ2A 3PSDA 1XQZA 5TF9A 3R8MA 2FNPA 4U0VA 5JZNA 4FTTA 3KK8A 3MCZA 3VFZA 4L0ZB 2WFYA 3F3TA 4ON0A 2XM9A 1S8NA 5IDNA 3RK9A 4WG3A 2DT5A 1IXSB 4ZSAA 1PXIA 4ENNA 2UW0A 2R7FA 4M68A 2Z7RA 2X8IA 2GHGA 4YP8A 2F7ZE 3G6GA 1U54A 4K77A 2QLZA 5TOZA 3DKWA 3M1SA 4PWNA 5I9ZA 1MD0A 2C0OA 1KE6A 4LB6B 5EOLA 4PTCA 3KU2A 3H3CA 4ZZOA 2YIRA 4EI4A 2Z3YA 1YWNA 4D1XA 4XRFA 3NW5A 5AUUA 4QYYA 5DA3A 4DHFA 4DH5A 3DQWA 4U3ZA 4JX3A 5F4NA 2WMQA 2A6EF 3EDPA 2CG4A 4EOJA 3HDNA 2PBIA 5ITAA 2O61A 4MXCA 5CEKA 5CEMA 4UUVA 2WU6A 3ABUA 3KRRA 3T0YA 1GIHA 3ZEPA 1UVRA 1WCCA 2I0YA 3R2BA 3QL8A 4ASZA 4YIIA 4NTTA 4YO4A 4OIQF 3E6DA 3PRFA 4YSMA 3IECA 5DBXA 4WSYA 3HAMA 3SKCA 3NPCA 4M14A 4RBLA 1BC8C 3KMMA 4ZZMA 3L09A 2OU2A 1T6SA 4MBIA 1ZMWA 5CEPA 4LFUA 3RAHA 2VTAA 5GZ9A 1IRGA 4O7SA 3BRBA 3MVLA 5F64A 4DFZE 1YXSA 4USDA 3I53A 2GSFA 5HVYA 3AAFA 4OTPA 2FXAA 3ITZA 5EI8A 5FO5A 3G0FA 4D2VA 2WTKC 4U0IA 3F2RA 5AJQA 3JTGA 4O3MA 2A6HF 3MVHA 5DN3A 4JAJA 3CR0A 4ZK5A 2P0CA 3QTXA 1R00A 4RJ7A 4G3CA 3WTZA 4RRVA 3LXPA 4AA0A 1J2XA 2X4ZA 4RGXA 2EV6A 1PXOA 1Y6BA 3QA0A 3S0OA 4FT5A 4KB8A 2XYUA 3E8NA 3JUHA 5AP5A 2M8EA 4FV7A 3R8PA 3CY2A 1FC3A 5ED4A 2ITOA 1M7QA 2QO7A 4O82A 4S31A 3SXFA 3LA7A 2XZSA 3R0AA 2YIQA 3UQCA 4K33A 2WQNA 2OF2A 3FJQE 3O96A 1ZOHA 3Q4CA 2M5WA 3VB2A 4L00A 1KU3A 3FHZA 2ZBKA 5LCJA 4E93A 3HRMA 1AD5A 1Q8UA 1OL7A 4M13A 1R0EA 5IA3A 3EZRA 4KIOA 3NRVA 5IT9Z 2CCIA 2ACXA 2ZV8A 4IX4A 1PF8A 2UW9A 3G90X 3RI1A 2WEIA 4BYIA 5D12A 2YX7A 3UQGA 4EH8A 4RGSA 4MQ1A 3FPMA 5HLWA 4YJPA 3UO4A 3H10A 3DKOA 5EQEA 4I02A 4IQ6A 2BRHA 3IO7A 2P2IA 3MVMA 3R61A 1XDSA 5DHJA 2WMXA 3QD2B 4Y72A 5E8WA 5E8ZA 4JLCA 4C4EA 1GZ8A 1OKVA 4ANMA 2XCHA 1QPJA 1LDKB 4NIFB 5M4FA 3LA3A 2EXMA 2YAAA 3GVUA 1K78B 4K9YA 3H4JA 3LFNA 1R1UA 1FPUA 3TO9A 3OZ6A 4O0SA 4L18B 1IA8A 4E5BA 4AAAA 2PPQA 5D7VA 4JX7A 5L2WA 4LUEA 2VN9A 4X2NA 2WMRA 2V1XA 4C4FA 4ZS0A 1EH6A 4CQGA 2C3IB 4TTHB 3TQNA 3PZHA 2VTHA 3ZSHA 1H01A 2UVZA 4BKYA 1YOMA 4G3EA 4AT3A 3UYSA 4D55A 2NYXA 4IJAA 4TWPA 3GFWA 3OCGA 2A4LA 3ORZA 4TYGA 3UIBA 4RFMA 1LEAA 4AGUA 2UZTA 3TKYA 4B99A 2HTJA 2VWWA 2CN5A 2ZXJA 5FFXA 2AC5A 4FSRA 3A7GA 3VW8A 5M56A 3K2LA 3E5QA 1FYKA 5HESA 2RVCA 2PFBA 4Z3VA 1SZMA 5FB2A 3FKNA 3EQFA 2C6OA 4GKIA 4FUYA 3GCSA 3RVGA 4BDHA 3TKIA 2GU8A 4L53A 4E4LA 3PG1A 4RPVA 5AP1A 3D0SA 4O83A 2P55A 2C6MA 2TDXA 3BPRA 1IW7F 3D9VA 5CSWA 3ZONA 1Y91A 2IW8A 3F3UA 4ZTNA 2A1AB 4XRJA 3ODYX 4J96A 4KBCA 3PVWA 2RIOA 3QGWA 5ANKA 3TDZC 2C0IA 4FIGA 2OAZA 2R7IA 3P5KA 4R5SA 1ZYRF 3JTHA 3QBNA 3ZHPC 1SM2A 4NL0A 4NM0A 1QGPA 3JS2A 3HV3A 3MPTA 4Y95A 3WZEA 4I0BA 3LMIA 4LQMA 2WIHA 3BYSA 4FK6A 4J98A 3WTTC 1SVGA 3L00A 1ZRDA 3RPQA 3M11A 2PG4A 3OCTA 5JZJA 2PLYA 5KBRA 1KOAA 5E8YA 2YLEA 2PMLX 4F63A 3ULIA 4PMMA 3OOPA 4EH6A 3Q5ZA 5A2QK 4D4YA 3WGGA 5HORA 5JQ8A 4X21A 5HE2A 2YCSA 3DFGA 4DE4A 4JQ7A 2QHNA 4HF1A 5M4CA 3PIXA 1ZZLA 4O7ZA 4CFWA 3G3ZA 1PRYA 1XSXA 3DXQA 3LZBA 2HYYA 3BI6A 4U9AA 1ZARA 3COKA 3P7BA 3EYIA 3O51A 1BX6A 5EYKA 4ZEGA 5A4CA 5AR3A 4CRLA 4RS8A 5CU2A 5A6OA 3II5A 1DI9A 2ITUA 2WO6A 4PPCA 4YC6A 3DT1A 2OZ6A 2FSLX 5J9LA 2ITYA 2QENA 1ZG1A 2YZAA 4YFNF 4MHAA 4YZNA 2O8YA 2BDFA 4MGRA 3IW5A 5EDPA 4L9TA 2WMVA 1OBDA 1IN8A 2I1MA 3JVRA 4WG4A 5AP6A 4BDDA 4Q5HA 3I59B 4H3PA 4OBOA 1YKRA 4CO8A 1Z6TA 4RIYA 4UV9A 2Y7JA 4KNYA 3EQRA 4HQEA 1JKKA 2YIYA 4DT9A 5HTCA 2ETMA 2OA4A 3KZZA 5ICCA 4QTCA 5F9EA 4IH8A 3QX4A 4IE9A 4QP2A 2NRAC 3H3ZA 3QTUA 5JGBA 4JI9A 2XAFA 3C51A 1IUYA 4EQCA 3RMFA 4YJUA 1HCKA 1H9GA 3EH9A 5CASA 3FYJX 5HBHA 1ZYDA 1TQMA 5L3GA 3TZ8A 1RNLA 5LGUA 3TNWA 3BQRA 2OXXA 1RUNA 5CYVA 4IRGA 3DXPA 5D5WB 3GOPA 3UTOA 3RKBA 3OBGA 1U5TA 1H0VA 1HBXG 3V7SA 2J0JA 4ITHA 3ULZA 2YCRA 3R73A 2C69A 2XNMA 2QCSA 4BH9A 2G2IA 1FLIA 5LVMA 1LR4A 3KB7A 4RWIA 2VBWA 5FEQA 4USFA 4BCJA 4O7NA 4NFMA 3NGAA 2IO6A 5H3QA 3I1AA 2HK5A 4L5JA 4BN1A 3RALA 3IDPA 3TIZA 3LCKA 5L3EA 3FSFA 5CEIA 5KMIA 4M0YA 2UXNA 2F4JA 5JGDA 4I4FA 4HV5A 1YXTA 4AW0A 3GENA 4BGHA 5IT9K 5AR8A 5B2KA 4O0XA 3IW4A 1JKTA 3FE3A 3NS9A 3C3WA 3GU6A 4IAYA 3V8SA 3R63A 3MPAA 2L4AA 1K7AA 3F8FA 4FX4A 1DP7P 3CGFA 3EMGA 4R6VA 4K8AA 2WQMA 3V6RA 1LP4A 2BDWA 3VWAA 4L0YB 3A99A 2JFMA 5TE0A 4EHVA 3PLSA 2WB8A 4ZSEA 3MH3A 4M67A 2KIMA 2J5PA 4M6XA 1UKIA 5BYYA 4NIFA 3IW7A 4ALVA 4FIHA 2Y6OA 4FK3A 1Q8WA 3GCVA 3A61A 3FUPA 4BICA 3PPKA 3KP3A 4PP9A 1Y57A 2YERA 5HCXA 1XSDA 3KRLA 3VUGA 4AW2A 1DM2A 3SX9A 2OZAB 4O7YA 2IP2A 5LOHA 1FMOE 3VULA 1FQ1B 3OTVA 2JC6A 4P7EA 5C8KA 5AUZA 2PWLA 1IN7A 2FVDA 4FTKA 4EOIA 3F5PA 4HVHA 4R3PA 5CANA 4BTMA 1GIIA 5CVVA 3FI4A 5CT7A 4XV1A 5H8BA 1PW2A 4YC8A 2Y6MA 2W1EA 4EK4A 2QOFA 2Z02A 3HUCA 1RUOA 3THBA 4M73A 5M06A 2X0LA 3TL8A 4CNHA 4O7VA 5CVIA 4I09A 4M9XA 2HKOA 3REPA 3R8ZA 3VS3A 2W7XA 4O0WA 3VBTA 4DYMA 4PMPA 2XH5A 5L3FA 5EHLA 3PWDA 3D83A 3ZZWA 5I9YA 5M4UA 3GC7A 1OYWA 2GNJA 3C50A 2C6LA 4D2SA 4L43A 4QP3A 4EH9A 3O8PA 4DN5A 4CZTA 2J6MA 5CLPA 1K3AA 4YJQA 2BCJA 4M72A 4HA8A 4BKJA 2IW5A 5LVPA 5C03A 4WKQA 2O64A 3VF8A 2UZNA 4FE2A 3HMOA 1VTNC 5HOOA 1HCLA 3EN9A 3NCZA 4AOIA 4FV2A 2AC3A 3IL2A 4M15A 4IVCA 2K7LA 3N97A 2EJRA 1W5SA 5DRDA 5AUTA 1H4LA 4WUAA 1P4OA 2G9WA 4O38A 4IIRA 2JIUA 3UG2A 5AIRA 4JOAA 4D0WA 2B9HA 3BLQA 1E1VA 3N9XA 2EFQA 4WK8F 1PXLA 3QQUA 2GNFA 3O17A 1QCFA 2O65A 4TL0A 5D5VB 3OY3A 3PLAE 2WOUA 4RIOA 4RIWA 4JQ8A 4BB4A 1YW8A 2GAUA 3E5UA 5E8GA 3L9MA 4GGGA 3GC9A 1Q3WA 4BIEA 1ZY5A 2B9FA 3E6MA 2OH0E 4ZJJA 2P8TA 1U8RA 3I7CA 4BHNA 4EQUA 2XK9A 3PZEA 3BBTB 1LNWA 3DNDA 3G33A 3POOA 2RKUA 2LSOA 5AA9A 3H92A 4MD8E 2X8DA 3FQEA 4AGWA 2P7VB 4UMTA 3ABTA 5M09A 3W2OA 2YAKA 4RGUA 3NQOA 1KU9A 4EH2A 2ITWA 1H1RA 4DLJA 2ESMA 1IAHA 4EMSA 4EJOA 3GYHX 2EFNA 1FBNA 4ZOGA 4FV3A 5IPJA 5HU9A 4EOPA 3O71A 3NIEA 2WEVA 3C4FA 4QMSA 3R30A 1ZLKA 3U54A 4I5PA 3RPYA 4DCAA 2X39A 3FYKX 2VTRA 3ERED 3LXNA 1HSTA 3PPJA 3WTSC 1IN5A 3KA0A 3LWFA 1KGSA 2YCQA 4I98B 3PXFA 3SVVA 5LHIA 4UXLA 3D5VA 5D8LB 5J7HA 3M1EA 5FP6A 3N4TA 1H24A 4J8NA 1YW7A 4Y5HA 3LFBA 1KSWA 4UYNA 2X0GA 5D8KB 1WBOA 2YISA 1O57A 4EJUA 4DQ2A 3RKYA 2JDVA 3BHVA 5KMLA 3B73A 3ZOSA 4I01A 3CTHA 4O96A 3RAKA 4XCUA 3LAUA 4JAIA 1OM1A 3A7JA 5AMNA 3DPTA 1J59A 1F3MC 2XVDA 5B2MA 5GINE 3NEUA 3COIA 3L2CA 2IZTA 2XUBA 5TRDA 4FSNA 4DFNA 4M71A 3OY1A 1ONVA 4OTWA 4L7SA 1Y6AA 4BHZA 1HXDA 4O7TA 3IWZA 5FXRA 3UOKA 4FT3A 4WNMA 1SMHA 4X6QC 1A9UA 2OICA 2XEZA 5D5XB 4FODA 4A5MA 4WNKA 2CLXA 4FTIA 2ONLC 1BI8A 4FIIA 1JKLA 4GCJA 3ZYAA 3HYHA 2ACJA 3TTJA 4ZLOA 5M55A 3MB6A 2PVHA 4TYHB 4HNIA 1XMAA 3BHTA 3R83A 3ZMVA 1H1SA 4W9WA 1TVOA 1VZOA 3U9GA 2YDIA 3MY5A 3DKFA 1J7KA 2QWWA 5TKDA 4C3RA 3LAPA 1GOLA 2JDRA 4E20A 4I24A 3BWJA 2GNHA 3RWQA 2K02A 2C3KA 2FUMA 2R5TA 3CKXA 5HQ0A 3S00A 3KULA 2QOLA 5BUJA 5HGIA 2XNOA 5CX9A 4FV8A 3GX4X 5D6EA 3QRKA 4Q48A 2JGZA 2P3GX 2QC6A 3E63A 3KP2A 4GT3A 5KMNA 4KDPA 2ZM1A 2B52A 4F1TA 2QBYB 3QFVA 1OR7A 4PPBA 3HRTA 5J7BA 3F22A 5E92A 2CPKE 2PZRA 3ROUA 2DU9A 1WVYA 4XP3A 3WTUC 4AW1A 4Y85A 2IW6A 1MDMA 1IF1A 4HZSA 3D4QA 2MLKA 1MJBA 3TO6A 3KC3A 4GT5A 1OPLA 1FY7A 3CD8A 4APCA 3COAC 3P9IA 3ORTA 4XEYA 4R7IA 3DLSA 1G3TA 3UNZA 4U81A 4NJ3A 3BZ3A 3Q9YA 5HO8A 4DFYA 1XKKA 2JIVA 4UVAA 4YFKF 4MNUA 4RVKA 1MKMA 5L6WL 5JFWA 4ITJA 3W2QA 4IZYA 1J5YA 3ULQB 2GQGA 1F0QA 2B9JA 4ESFA 1BKXA 1YG2A 4CV9A 4GFOA 4FEUA 3ANQA 3NUPA 1URWA 4OU0A 3EYGA 3DB8A 2P4IA 4U43A 1EH7A 1PMUA 4HAMA 3GFIA 4WG5A 2DO7A 4HVIA 2QLQA 4D0PA 4CLJA 1XH7A 1PXKA 5K5XA 4JDKA 5D10A 4R79A 5FWKK 1FP1D 4V01A 2UW8A 1Z5MA 3D5XA 4EJ7A 5H20A 3WI6A 3SXYA 1XH8A 4Z2YA 2X2MA 3RAWA 4AN9A 3O7LD 3QLFA 3LJ1A 4KS7A 3IGOA 5TT7A 4HJOA 4YHTA 4GO1A 2OZAA 5KVRA 2KRFA 3C18A 1HW5A 1SD5A 3UNJA 2J0MB 4LGGA 4FKTA 5IA1A 1UFMA 3U9NA 4YTHA 4D1ZA 1B9NA 3F9NA 2A69F 4YZ9A 3QXOA 2CKEA 2V79A 3VS6A 1ZYSA 2E2BA 4TW9A 1U78A 3MIAA 2XRNA 4HBLA 5AIQA 5GJDA 5HE0A 3WBLA 4I0RA 5ICFA 5J8FA 3K0LA 2UZLA 3KXNA 2DK5A 4RB1A 3UYTA 3I5ZA 2ZAZA 2H6DA 4GUBA 1Q8ZA 5ACBC 2P6SA 1LPUA 2CLQA 4FGRA 4QWQA 4ERWA 3VUTA 2YLFA 1G3YA 4LK0F 5CS6A 2VTTA 4F9BA 3BE2A 5EK7A 1WQ2A 2GXBA 3M2WA 4C3PA 5CXHA 2DS1A 3PIYA 2C30A 1FWZA 4JXFA 3PXYA 2ITVA 1D3YA 5CF6A 5DCMB 3DQVC 3CGOA 3QQJA 4HVSA 2OGVA 3SRVA 4LG4A 4ZLYA 3R8LA 5BMZA 2SRCA 1H8FA 1V0OA 3NRMA 3HRFA 4EV0A 2C68A 1YDRE 3U6HA 3ID6C 2QU6A 2PJPA 4JJRA 2JIIA 4AUAA 1KV2A 3CDHA 2BUJA 3CEKA 4FKRA 2ZCWA 4PZJA 4QQTA 4RT7A 4QRCA 3LSTA 4LI5A 4KIQA 4HGSA 2CKPA 4IXPA 3ZQ7A 4ZP5A 3R1NA 5BUIA 3RNYA 3B02A 4IB3A 5FFZA 1KE8A 3ZRKA 4F7ZA 1J1CA 5C26A 3VUMA 3L8XA 1DAYA 4KYWA 3IW8A 4FTJA 4FX3A 4QMXA 4X3FC 3R22A 1L0OC 4O0TA 3WF9A 1ZOGA 3CY3A 3HSEA 2FSTX 1OL6A 5GHVA 4ESBA 3WIKA 4A6EA 3U2RA 3KXZA 3IKAA 4E6AA 1KE7A 3GWZA 3PJ3A 2IRFG 3WE3A 3CE3A 1YHVA 3FX3A 4XBFA 4R1YA 2JEDA 5LCKA 2JAVA 4QMZA 1NXKA 2PZPA 3LFQA 4R1VA 2EVAA 1HW2A 2I0EA 2MD5A 5B2LA 4GVJA 4I5HA 4JRNA 4RWLA 2OG8A 2UZBA 3I0QA 3NEWA 4IHPA 4NU1A 3KRXA 1SD7A 2XAQA 4JG6A 2VBXA 2F7XE 3GVAA 4MQVA 5JMSA 3NDMA 3G6HA 1OIQA 1IN6A 1U5TB 4TPTA 2X7FA 3ELJA 4RSSA 4LRKA 3ODZX 1OITA 2ESHA 1WBSA 3OF0A 1ZGAA 3QKLA 3EKKA 2QM3A 5E1EA 2BKZA 4MCVA 3I5NA 3R21A 4MXXA 3PQJA 2W96B 4CMTA 4PMSA 2STWA 3OUKA 3NNXA 4FSTA 4O6LA 3PVBA 4TRLA 1O7FA 4C37A 4I6HA 5HCZA 4YJSA 3ZO4A 4QP7A 2VD5A 3MYGA 5K0KA 3FZSA 4B8LA 3DP7A 3EFWA 2D1VA 2HXQA 3HL7A 4D2WA 4I6BA 5DD4A 5M53A 3AC3A 2V5QA 2OK1A 1JBPE 3EUHA 5DR2A 1ZY4A 4ASDA 4G31A 4EJWA 2R9SA 3TV6A 2M30A 3V5LA 4KSPA 1U6GA 4XLVA 1F9NA 1XB4A 4JR7A 3VS0A 1FBQA 5EHYA 3ZN0A 4G9CA 4EC8A 2MA3A 4NM5A 3AT2A 4IAFA 3D5LA 5E8UA 4QMWA 4DGLC 1UNLA 1W8CA 2P7CB 2UUEA 4ENXA 2NO3A 4CEGA 3AC2A 4MTDA 3UZPA 4WCGA 4NFNA 3BGZA 1Q99A 3TZMA 2EWNA 5L6PA 4EK5A 1XGMA 3UIUA 5AUVA 4FV0A 5HBEA 5FTGA 3PSBA 4N6YA 3FKOA 4ENKA 2OBPA 2OW3A 4NB5A 4D28A 2BRGA 2GQQA 4BCHA 3ZXZA 3MH1A 2E7XA 3FMRA 3RTRA 3D7TA 4LOQA 4FG9A 3ALNA 5M07A 4AFEA 4QMYA 5HS8A 4ZH4F 1OUKA 2JAMA 4ASNA 1E9HA 3P4KA 4F65A 1WBTA 3DB6A 3PA3A 1OYYA 4EUUA 2RDPA 3QP6A 3WZJA 2JSCA 4C2VA 2J51A 1P6RA 5ICPA 3GQIA 3T3UA 2H09A 2GS7A 4D2PA 3R6SA 3ELKA 4FTMA 4KWPA 1OKWA 3OHTA 3Q4UA 1YHSA 3KETA 4EJNA 3TNIA 4GRBA 2OIDA 3V5WA 3HOSA 4A4XA 5FUTA 1ZZ2A 4PDYA 4K18A 1YLFA 1A06A 1B39A 3TNHA 4YG2F 2UZWE 4IRIA 2R3KA 2O03A 1O3QA 1PKGA 3RZFA 4R7HA 4R78A 3ORXA 4YGAA 1OIYA 2WWYA 5JN2A 4LLGF 4IM0A 5IDPA 3EFJA 2Q0OA 4L42A 2EU9A 3FDNA 2H27A 4HLYA 5LVLA 4YU2A 1E17A 1NVSA 3U8WA 4IPAA 1MDMB 3QHRA 5DE2A 3ZMMA 4NSTA 2B0QA 2DPDA 3BROA 2EXEA 3VNTA 4PDOA 1G3NA 2HOGA 2QOIA 4OIPF 1QL6A 1REKA 4BZOA 3LFSA 2VBYA 1G8AA 3UOJA 4BI0A 4OMYA 4AE9A 3CTJA 2RQPA 3M7GA 5E4HA 4IRHA 1PXNA 2C0TA 5IMXA 3FMHA 1W7PA 5AADA 3PXKA 4OTIA 2W24A 4M6YA 2EB7A 1R0PA 4BHBA 2GFCA 4R8HA 4IX6A 4OTDA 2NNYA 2VGPA 4HPUE 2VC0A 1U2WA 3VBYA 3R00A 5IQFA 5GZAA 3RDIA 3R4KA 2ONLA 3ZFYA 3R8UA 3D2IA 3DZQA 3UVQA 1EH4A 2D1HA 5I3RA 4I6FA 5HX6A 2UZOA 4IANA 4TYJA 4BCMA 3BHYA 3H9OA 3QTIA 1IXCA 1F4KA 2DWBA 2X9FA 4BDGA 1ZWSA 3Q04A 5HZNA 2J90A 3JXWA 5KMMA 2R3MA 1W7PB 5LVNA 4D4VA 4UVCA 1E1XA 2BKKA 3GB2A 3HHGA 3HV7A 1OPCA 4ACHA 4ZMFA 2ETKA 2E9VA 5CSXA 4F7JA 3SZPA 3IRRA 4EYJA 3VS5A 3IS5A 4U3YA 3ROYA 2YA9A 3QD4A 1Z9XA 1NY3A 3EWHA 4XLIA 1B4AA 2WNTA 4GW8A 4ZYDA 3A4PA 4Q9SA 4EHEA 5KHXA 3BU5A 4JK1X 2OO8X 4FZFB 3MFKA 3KCKA 2W5BA 2ISYA 2C1BA 2UW7A 3OEFX 3BIZA 4QPAA 3E97A 1T39A 5EKNA 4XOYA 2YEXA 2C3JA 4H1JA 3H0YA 4XH6A 3F3XA 3M42A 4FSQA 3QALE 4OLIA 2H34A 4MXAA 3SW4A 1WBNA 3RKXA 2FOKA 1QMZA 4MQ2A 5I9WA 3D5WA 5J5TA 3QTQA 3FY2A 4HYUA 2XROA 3VBVA 4X0MA 4F9WA 3GC0A 2Q8KA 5IUGA 3CTAA 4U0YA 2VE8A 1LJ9A 3ISPA 1TW2A 2C3LA 4C4JA 5IH6A 2IG7A 3CUQA 3QRTA 4UV8A 4ZY5A 4FEXA 1WFCA 3HV6A 4Y8DA 3QRIA 1XCBA 2ZYBA 4HDUA 4BCPA 3DAEA 2ZM4A 2B9IA 3QRFF 4O84A 4O5VA 5D5UB 3E92A 2J0LA 4I94A 3ZUTA 3W10A 2WTJA 4MWIA 3Q3BA 4BNCA 2QZ8A 4LMYA 3E62A 1YXVA 3GFJA 4YBJA 4CZZA 3V7RA 2GCDA 4P5ZA 2X6DA 4AF3A 2A61A 3R8VA 3T8OA 1ERKA 3A8XA 5FGMA 2GTMA 2WIPA 1ND4A 2QG7A 5GZ8A 3CO7C 2W84A 4S05A 1Q3DA 2UVYA 4QYFA 4FTLA 3ZLYA 1WKMA 2VTJA 3WIGA 5JFRA 3VBXA 4CFMA 2ITXA 4E70A 3AC8A 4RC4A 2BVAA 4D5HA 4FIFA 2H9VA 2OZOA 5BVDA 4RFZA 1YS7A 1OZ1A 2FYSA 4O6JA 5DFPA 4DTKA 4V05A 3NW7A 5C9CA 2ITTA 2BZJA 3IK3A 1G6NA 5D9HA 5AV3A 5KO1A 2R0UA 2YIWA 4AQCA 3C0IA 2XRUA 4U7BA 4WBBB 3MN3A 2NNWB 4ANLA 5BNJA 1U54B 3MFSA 4D4SA 2HZTA 3EYHA 4KIBA 2FSMX 3LAJA 4HGTA 3NUYA 3OCBA 1S6LA 2EV0A 3C0GA 2JDSA 4U42A 3NIZA 2E1NA 4P9UA 5I4NA 4FV6A 4LM5A 4QMQA 1SMYF 2VX0A 4IJ9A 3UVRA 2R3IA 2VO0A 2DYLA 1Q97A 5DD8A 3LFKA 3PVUA 3BBWA 3WGIA 1XGNA 2IA0A 3SG8A 4ACCA 3D5UA 3DXNA 2ZDUA 1LUFA 2NAZA 3DDPA 3I7BA 2ELHA 2XK6A 5ERIA 2YIXA 2O3PA 3QQLA 2VOOA 4UMQA 5KE0A 2HCKA 1BUHA 4TNDA 4G6NA 4FI1A 1P2FA 3BHUA 2QD9A 1YO5C 3F6OA 5AUYA 4GU6A 1Y8GA 4BC6A 3PA4A 3RCJA 3GUDA 3ZO1A 1W5TA 2BFYA 3SV0A 4AT4A 2IA1A 3FXUA 4EGYA 1IG1A 3KCFA 2EFOA 4TYIA 1OUYA 3UPZA 3RKWA 3WTWC 1BI2A 4KIKA 2F5DA 2BAKA 3G15A 2PUNA 3FXQA 2K4BA 2BEOA 4A7CA 3EHAA 3MESA 3QF9A 4GIHA 2P5KA 4M74A 5LWNA 2PVLA 5K5QA 2UXXA 4FKIA 4BZNA 3LXKA 3F8MA 3C5IA 2R3LA 5I9VA 2C5NA 5CYIA 1LEBA 5EDQA 2CJMA 4YUQA 2CKQA 5DUKA 4KIKB 4IDVA 3ZDUA 1STCE 4PNIA 1APME 4O2PA 4XUFA 2YR2A 1WBVA 1IN4A 1SFXA 4P55A 3F2NA 2DAOA 2D45A 3HTUA 2YCFA 4F4PA 4FSWA 5ANIA 3FWEA 3OWKA 5J1WA 3GU8A 3KVWA 4EORA 3GO5A 5EI6A 4C0TA 1GNGA 3FI2A 2YM3A 3O23A 1M7NA 1GZKA 2XB7A 5K1YA 4N70A 4I0SA 4ALWA 1PMEA 4IM3A 4TYEA 3WE4A 4H58A 4C57A 3QTSA 3QLGA 3CD3A 2W06A 1ZRCA 1RJBA 2W1ZA 2VC1A 4FMQA 4RZVA 4QP4A 3C4ZA 4E3CA 3BLHA 4NKSA 2Y8OA 2C47A 3ZPLA 3NWWA 5KHWA 2P6TA 4UBAA 4WIHA 3R7VA 4X7QA 3TGNA 4FVPA 4L8MA 1M14A 1W83A 5CU3A 4UV0A 4WSQA 5KBQA 3O3KA 2YHVA 2A0CX 3L8PA 4LJZF 4TY1A 4FIJA 4I21A 4WNPA 4DG2E 3H30A 1ZXEA 4A9TA 3FWQA 5T3QA 4RC2A 3D15A 2NPQA 2YACA 2GQSA 2DQLA 4IB5A 5EYMA 2V1UA 3EQDA 2FQ3A 1QBJA 4C7TA 5HS7A 2OFVA 2P2HA 2QVOA 3Q4TA 3ZRMA 3BLRA 2C1AA 2ISZA 5JQ5A 2F9GA 3RPRA 2Z9OA 4Q5EA 5AM6A 1UB9A 2I0VA 2VTIA 3SOAA 3JAMZ 4IB1A 5EI2A 2CDZA 3IG7A 3TCPA 4GXOA 5M44A 4M97A 4HX7A 4RIYB 4MWHA 1QZZA 4Y73A 3F7ZA 2RN7A 1UV5A 3WGHA 1UKHA 4QMTA 4YLLA 3QGYA 3RM7A 1XSVA 4II5A 4KUMA 5CXZA 3E7VA 4O81A 1T0FA 3EOCA 2W1DA 5DYJA 5HNGA 3E5XA 4I0TA 2PTKA 1P4XA 1R5GA 2Z7QA 4RZWA 3ZSIA 5HNBA 4FVRA 5CVHA 3PTGA 1ZAOA 1ZG5A 2XIXA 4PY1A 1J7IA 3WF7A 1AWCA 2DQ7X 4EM1A 2IVMA 3C13A 1SFUA 1CKPA 2CCHA 3AMYA 3ZXTA 4IVBA 2J5EA 2VX3A 1VYZA 1LDDA 5CTPA 4PGGA 4B8MA 2X4HA 4X2FA 2VTPA 1U4DA 1UU8A 3IHUA 3VUIA 2AS5F 3DLZA 2RGVA 2F5CA 4F08A 4XYFA 2V22A 4J52A 3TZ9A 4J53A 3LJ0A 5HEZA 2QU5A 4K11A 4IHTA 1WMKA 3K54A 3BJAA 2PE0A 4FIEA 4UWCA 3ENMA 5C8NA 1RDQE 1QPCA 1RZ4A 4DGNA 1YYVA 3CSVA 2MC3A 4J71A 1JPAA 4NH1A 2DPUA 3KULB 4BWKA 5J5SA 4TWNA 3I64A 1UA2A 4RJ3A 1NA7A 1D8JA 2IVSA 4LYNA 5JEBA 2XK3A 3ORIA 1BMKA 3ENHA 3F8CA 3O6BB 4IAIA 1MJ9A 1L8TA 5ACKA 3R04A 4ALUA 2XHKA 3DJ6A 5AUWA 4X2GA 3F8NA 2ZV2A 3ZLSA 1RIOH 2QOQA 3FZTA 2HWVA 4AACA 2WMAA 4NM7A 3OXZA 4I23A 4RX5A 3ZFXA 3HYIA 4ZMEA 4FT9A 2F5EA 4E73A 3QQHA 4XLNF 2GIVA 1YDTE 5FBNC 4F7LA 3ML6A 2A68F 1LDJA 1Z1DA 2FGIA 3RYRA 5CU6A 4DEDA 4NM3A 4RJ8A 1OYIA 4FNWA 2Y9QA 3R1SA 4JIAA 3A7IA 2BDJA 1K78A 5LMBA 3VRYA 4QTBA 4ANBA 3UP2A 3ZZEA 2OJIA 4CKRA 1MJAA 3GBZA 1NVQA 4YHFA 5HDKA 3S95A 4IZAA 1OPKA 2OIBA 4PTGA 2X2LA 4MBLA 1H1WA 3KP4A 1OL5A 2WPAA 4WT6A 3P7NA 2IZUA 5E8SA 4C38A 2PZ5A 4AZTA 4BWPA 5M51A 4EM0B 1GXQA 4IAAA 5L8LA 4IDTA 3HRSA 5IF1A 3EN7A 4HNFA 2OBJA 5DT3A 2UZKA 1FYMA 5FM2A 4E1ZA 1PXJA 1H00A 2V6CA 3E64A 2Q0BA 3DBFA 4DGGA 1ZYCA 2R3GA 2DK8A 5EW3A 1GIJA 4IVAA 3QWJA 2HIWA 4GK4A 3UODA 4CFXA 3CQUA 4FEQA 3QCXA 4FTAA 2UW4A 3G51A 3NUXA 1RI7A 4FL3A 5K3YA 4CSVA 2L4MA 4FV9A 5ICGA 4YSJA 3J81Z 1G4DA 2RGPA 3L8VA 3ZBFA 4ENYA 2BMCA 1CDKA 4B09A 1PXMA 3P9CA 3L9LA 4DH3A 3W2RA 4CT2A 3PUPA 1M2PA 4MXZA 2HR3A 4EK8A 3A7HA 4HF0A 3BV3A 1ZGJA 3QPTA 2R3NA 5IG1A 4FV5A 5CF4A 4A07A 3VODA 4PQNA 1IR3A 3ATSA 4ANNA 3KRJA 3FHRA 2VWIA 5HDGA 3M8FA 1D8KA 3AT3A 1YW9A 3HRBA 4FKVA 5E20A 5IA5A 1I1GA 2ZNZA 3KP7A 2YZLA 1WSUA 3CUQC 1ZMUA 2WMBA 4GT4A 2UVXA 5F95A 2YM4A 4EONA 2XEYA 3SHEA 2BBYA 3L9PA 4WF2A 4FT0A 3VAPA 3TDVA 1ZRZA 3N4MA 2XASA 4RQKA 1P14A 3HP2A 5E8VA 4I0AA 2VT3A 3DK6A 4I3ZA 4JNWA 1IEPA 4WO5A 4CV8A 2JBOA 3A7FA 3R28A 3CQEA 3KP5A 2X7OA 2BIYA 3V4GA 1FNNA 1HSJA 3EQCA 5LMKC 3BPVA 4QTEA 5DG5A 4TXCA 3ECHA 1XJDA 3MJ1A 3T9IA 3UVPA 4TT7A 2FO0A 1XH9A 3JSOA 3CJFA 5BVNA 4YLKA 4LV5A 3LMGA 1BL6A 3GOKA 4EJVA 2CSOA 4Z9LA 3TJCA 3FL5A 5BVWA 3PJ8A 4AE6A 2PYWA 3KY2A 1JSUA 1MRUA 4CTBA 2BZKB 1KOBA 3FI8A 3KXHA 4IADA 3FMMA 3FAAA 5F1RA 2X7GA 2ZO4A 2UZVA 2JT1A 1LB2A 4XSXF 2OZUA 1BL7A 4UVBA 3R1QA 4RX8A 4S34A 5LHHA 4FZ7A 2AYPA 1CGPA 4IFCA 2VWVA 3RP9A 1O9UA 3AD6A 4AD9A 5IQDA 5C27A 2PE1A 5J95A 4FZDB 1FSHA 3UC4A 5A6NA 3ACKA 4U45A 2ERKA 2EWAA 2O0YA 3BGQA 5A4LA 3TEIA 2EK5A 2BPMA 4BKZA 2GQRA 2CMWA 4LV8A 2QR7A 3BJ6A 3TJDA 4IMYA 3RTPA 5TO8A 1K9AA 5DVRA 1JLUE 2Z60A 4DA5A 2OD5A 3HA6A 4U7DA 3LPBA 3F6VA 5BVKA 1I5ZA 3GCUA 3HMPA 1CKIA 2PY3A 3HMIA 3OFMA 2WKMA 4I5MA 3DPLC 4FTUA 5K4JA 2K27A 4N0BA 3OWJA 3EQLF 3HSRA 2HW6A 2RV8A 4I20A 1T45A 2V55A 2WU7A 4GJ3A 1YQAA 4F09A 5CF8A 3ORMA 3IKTA 3GP0A 1H9TA 3C9WA 2C5VA 3N4UA 5DEQA 2QOHA 4KN7X 4FSUA 5HD7A 4ZTQA 5L4QA 4U80A 2NS0A 5HLPA 3OW3A 3Q5IA 1PY5A 5ICEA 2P33A 3GW2A 2NRYA 3S3IA 3RAIA 4V0GB 2YDJA 4OT6A 3GXOA 3C4EA 4G7HF 3RCDA 1NVRA 4LUDA 5A9UA 4BIDA 2COMA 3I58A 4F9YA 1I44A 4S33A 2XK7A 4PDSA 2QURA 2RFDA 2IJMA 1IRKA 5JKGA 4E4MA 5BQTA 2FB8A 4UB7A 4XV2A 3FF5A 2VTNA 3NYOA 1R1TA 3LOKA 1DDNA 1DUXC 1UU9A 4X3JA 2J5OA 2QKRA 2ZKZA 5BS6A 1KU7A 4JBAA 3DK3A 1JOWB 1TKIA 3W2PA 3NUUA 4F9CA 2YPRA 5L3DA 2HQNA 5ETIA 2F2EA 4IX5A 4FF8A 4M66A 4Q47A 2WMUA 3F7WA 2PVKA 4CRSA 1QNTA 3OV8A 5A46A 5JR3A 2RF9A 4DCEA 2BRMA 1R78A 3LQ8A 3I6WA 5GNKA 4HOBA 3J80K 5BPYA 3OS3A 3EN5A 1H0WA 1YDSE 4H3BA 4ENJA 3FBVA 1ZMVA 2LKPA 2WHBA 4IAZA 5E8TA 3F61A 5AIKA 3FZRA 4ANOA 4LK1F 2VNWA 2CQKA 3OXTA 2OJGA 3BEGA 4BL1A 3PVGA 3VUKA 1HKSA 4QYHA 3FKLA 1ZREA 3C1XA 2W4KA 3FLYA 1SMTA 4OW8A 3F5XA 4JT3A 2PQ8A 2W5HA 4E4XA 1FT9A 2QYOA 4HYEA 1Q61A 5BMMA 1R1VA 4FKJA 2OF4A 4OTQA 4C61A 1U3EM 1WAKA 2WTIA 3TV7A 3ROCA 3VOEA 3POZA 4O0RA 5FP5A 3LIJA 2CGVA 2QR8A 4UXNA 3SXSA 3MV5A 4XV3A 3WARA 3NUNA 2PUUA 4QP8A 3V5TA 5DMZA 4AXAA 4MF1A 5EM6A 3WZKA 2B7AA 1VEBA 2L01A 2QLUA 4CTCA 3R0JA 2BE5F 3GF2A 4WHZA 3W32A 3IWFA 2GWRA 4EOLA 3I59A 4MXOA 3BQCA 1BI3A 1IAJA 4ENMA 2OI4X 4WA9A 3TIYA 5K9IA 3KKVA 3FLSA 4MBJA 2XNGA 4AU8A 5IQHA 4HYSA 3SFZA 1SD6A 5JI6A 1XGSA 4XG7A 4D58A 3PJ2A 5DRBA 2MH2A 5ANJA 1BOAA 4L46A 4GIIA 4MX9A 3BELA 4JBOA 3AMBA 4QYEA 4ZZLA 1XGOA 2C5OA 5AV0A 3EB0A 3LA2A 4NHJA 4YJVA 2QOBA 1OB3A 4CICA 2GTNA 1FINA 3J7AO 4LL0A 3NYXA 3E93A 3EFKA 4UN0C 3ZUVA 3F21A 3VBWA 2CGXA 5IA4A 4L3JA 4ZSJA 4OT5A 4M69A 3KREA 3GEZA 4A9SA 3Q32A 4N4SA 3VRZA 3O2MA 4O1PA 2VO6A 3MZHA 3GFEA 3F5UA 2CSNA 2XAHA 3CUQB 5H8EA 5E1WA 1ZOEA 3FQSA 3ORNA 4A0YA 2VNYA 4YZBA 3U6JA 3AQVA 3DBQA 4GYGA 1O6LA 4JBVA 4BHCA 3EJ1A 5LBQA 4I6QA 3R7UA 3UBDA 2HGCA 2PVFA 4MEDA 4BI1A 2Z8CA 5A54A 3UOHA 1BI0A 3SXRA 4K2EA 1KA8A 5E90A 3MBLA 1GHCA 3PY1A 2FSOX 3IOKA 4R5YA 3W55A 2G9XA 4PV0A 1I09A 3W6KB 3V8KA 2E9UA 3ZLXA 1OIRA 4ORKA 4Y15A 2IZRA 2XMYA 4DAWA 3CIKA 2G2FA 4YBKA 2DLLA 2PE2A 3QU3A 3HV5A 2DW4A 4XG4A 2I0HA 2HZ4A 4CFUA 3PXRA 2PSQA 2BIKB 4AZSA 4JL9A 4A12A 4B0GA 4KICA 5FLFA 5LARA 5A2QZ 2C4GA 3TN8A 5JRSA 1A48A 2ADUA 4CGZA 5JH6A 2CHLA 5EDRA 4GK2A 3D0EA 3QYWA 5JFSA 4IVDA 2FA5A 2J9MA 5LRSA 2JBPA 5IEVA 5IQBA 4WBOA 4I7HA 4HX4A 2HW7A 4AG8A 5FGKA 2HZNA 2OIQA 2F2CB 4EBVA 3F66A 4BCNA 4QMOA 2VU3A 5KUPA 2GHLA 3COHA 4D9UA 4FHTA 3BPXA 5IA2A 2C6DA 4GU9A 3Q52A 2V0DA 4D0XA 2YU3A 3P7CA 2HOEA 3DK7A 4QTAA 1SNUA 4JVGA 1OECA 3E88A 3R7OA 4FZAB 4EWQA 3QCQA 4ZJIA 4ASEA 1LQ1A 4L44A 4U6RA 4W9XA 2IVTA 3E7OA 3MTLA 2PUIA 1J1BA 5FD5A 3BY6A 5EYDA 3SD0A 3MH2A 3KXXA 2JD5A 4MTEA 1YI4A 2PVYA 2RG6A 1FVRA 2XM8A 1ATPE 5CVFA 4EH5A 2A2AA 3Q9SA 2CGPA 2UZDA 4G7ZF 3QTRA 3FZOA 4BYYA 2DFIA 2PVMA 3LMHA 3WF8A 2O5KA 3CO6C 3MVJA 1DPRA 3SZTA 3OEZA 2WQEA 3RPUA 2HZIA 4BCKA 1L3RE 3E3BX 2ZOQA 3BDDA 1RW8A 3JYAA 1UU7A 4PUZA 2BV6A 3AD5A 3FXRA 4S2ZA 5L2IA 2W9ZB 1ZRFA 1J9IA 3BHHA 4G9YA 3MSSA 3ZP5A 4LL5A 4AW5A 3GZ6A 4O1OA 3EQIA 1JNKA 4QPMA 3RPOA 3UIXA 5EFQA 2ZB0A 5HD4A 3K69A 5DWRA 2ZV9A 2WAJA 2WOTA 2HWPA 5DGZA 3EQHA 2A07F 3NAXA 3AG9A 5LMAA 4NK9A 4EC9A 4CXAA 4BTKA 3RIRA 2C6KA 4YZDA 2C5YA 3LJ2A 3HNGA 4YTCA 5D4RA 2NP8A 4U8ZA 5CU4A 4L9VA 2C5XA 4BIBA 3AC5A 2X81A 3QP5A 4X2KA 1IXRC 4U5JA 4JDJA 4Z55A 3R2YA 3M8EA 3NUSA 4G3FA 4ZS4A 2R2PA 3NW6A 3PJ1A 4WOVA 1B59A 2OJ9A 4HZRA 3V01A 4WNOA 5ANOA 5L8KA 4JDIA 2G7HA 5FM3A 5KK1A 5L3BA 3QRUA 4HVDA 3OG7A 4XJ0A 5EYCA 4L9IA 4LG0A 2Q0NA 2RL5A 5F94A 5HNIX 1JKSA 1UCRA 3GU7A 4Y46A 4Y17A 4DT8A 4DH1A 3KLOA 2GXGA 4LB5A 3RINA 2X9EA 4GS6A 5D6FA 3G9NA 4WXCA 3DGKA 4F7SA 4U0WA 1YS6A 5J6XA 2STTA 4E5WA 2OQRA 4YO6A 5CY3A 5FLXZ 5DEWA 3QYZA 4ZYHA 4ZZDA 1BIBA 1O6YA 4FSMA 4YFXF 4O86A 4USEA 4YMJA 1VJYA 4ZTLA 3S1HA 5GIOE 4FKSA 5L2SA 4C2WA 1SNXA 2VT2A 4EZ7A 3E6CC 4UYAA 5JFXA 4HLXA 2ERZE 3JY0A 1G3SA 2M87A 2RG5A 2YITA 3PRIA 1XBBA 3AD4A 3DS6A 3LQRA 1V1KA 3I4PA 4O7LA 1EV7A 1FVTA 2VTLA 5HG9A 4WX9A 3QOPA 1U5QA 2HELA 1OKYA 5ANEA 3W8LA 4OMZA 1B1BA 4G5JA 5HE3A 3ORPA 2YJSA 1LVAA 3R9RA 1WVXA 4H36A 3VS2A 4BCFA 4QQJA 1HKQA 3Q5FA 3DQXA 5HHWA 4PX6A 3QX2A 3TKUA 3QZFA 2XP2A 5FBOA 3V8TA 4Q2AA 4W4XA 4L9NA 2J0KA 1FPQA 5HG7A 3FMEA 4JS8A 1DPUA 1M2QA 4PL3A 2IN6A 1R58A 4KD1A 3K3IA 2XUUA 3BZ6A 2AUHA 3J81K 2W1IA 3BV2A 2YSRA 4NKAA 3WF5A 3BWFA 3ET7A 5T6KA 4QYGA 2B0LA 4G7OF 2JPCA 4JBPA 2LAVA 4OIRF 3CLOA 5HI2A 2YM5A 4XX9A 3LFAA 2XKOA 2PZIA 2V9VA 4BY9E 3Q4ZA 2VBZA 2XAGA 3DF8A 4FA2A 3MW1A 3MB7A 2W99B 1H27A 1GY3A 1BBYA 2F49A 3C0HA 2V62A 5AUXA 4I5CA 3I60A 4Y13A 3P86A 1MQ4A 4W8EA 5J8IA 2HXLA 1Q41A 1KQ0A 4CMUA 3BKBA 3CBLA 4RVTA 5H6QA 4N6ZA 5HLNA 3O2PE 2PHKA 4BAYA 2WZJA 4DEEA 1F1ZA 3C4WA 4X3FA 3O50A 3MAJA 5CVJA 3CQWA 1FBSA 3AOXA 2IPQX 3MH0A 3R71A 5AR4A 3HIFA 5CJ9A 5AX9A 3KP6A 4X2JA 1JHFA 3CKWA 2WMWA 2GA1A 3DV8A 5IMEA 1J0RA 5DUIA 3C1DA 5ILVA 2A5YB 4B7TA 3G73A 4ZYGA 2DTRA 1X3UA 5CVRA 2Y48A 2WTDA 2X2KA 2PZYA 4F99A 1QQIA 4GK3A 3FLWA 1I6XA 3PY3A 4AVPA 4UNOA 5DYMA 5IH5A 2Y75A 4CMOA 2R3PA 3FXWA 4DGMA 5CQUA 3ATTA 1QPEA 4LLLA 2VX1A 3JPVA 4EQQA 3O8UA 1XD7A 2PK9A 2VXZA 2K4JA 3FV8A 2BRNA 2QQ7A 3WTVC 4ZTHA 4WD5A 2O63A 4PRJA 2P5VA 4ONAA 3W2SA 5M57A 4QOXA 4LMUA 2LNBA 4NQWA 4QT1A 5I3OA 2VRXA 3I5UA 3FEGA 1W82A 5HG5A 1GZNA 4DC2A 1FX7A 2XIZA 3ZBXA 4CFNA 2WTEA 4RAYA 5E91A 5KMJA 1OGUA 2BHEA 5DOSA 2EFPA 3VJNA 4PMTA 4DEHA 3QAME 3VS7A 4QTDA 1WWXA 3QUPA 3IRQA 4HGLA 4MK0A 4AN3A 5EQYA 4C4IA 3HECA 4QPSA 4N9HA 2JDTA 2YM7A 5IA0A 2E9OA 4ZSLA 2YM6A 4G1WA 4IM2A 5C1QB 4A9UA 5FTOA 1XO2B 3WZUA 4AGDA 4BF2A 1V0PA 4RX9A 3AT4A 4UZHA 2MLGA 3OC1A 4HYIA 4L9JA 4S32A 5CEOA 3ZMTA 4XRLA 2O0UA 5EM5A 3ZEWA 2W57A 4U79A 4KN4X 4LRMA 3JY9A 3UO6A 4F1OA 1PKDA 1WVWA 3KEOA 1ZHFA 4AX8A 4FVQA 2Y0MA 4FOBA 4R77A 4FOCA 5HO6A 2GNLA 1YXUA 3P0MA 4FKUA 1PXPA 3FMDA 4P96A 4D5KA 4NCTC 4LLNA 2X1NA 2W1FA 2YWPA 4OINF 5AV2A 4XBUA 4RWKA 3PIZA 4ITIA 3KGAA 3EL8A 3I6UA 5HTBA 2XIRA 3P9JA 3ZC6A 2R4BA 2XKCA 4PF4A 2QONA 3NX8A 3SW7A 3K2ZA 4MEXF 4EUTA 4RLKA 2KIUA 5K5OA 3JVSA 4HCTA 4W8DA 4AOJA 2YABA 4Z7GA 5LGTA 3HOTA 3R7YA 4YPSA 2DI3A 1FVVA 1QZYA 3VBQA 1K79A 4BDEA 4O91A 3RI4A 4IW0A 4L6QA 4YC3A 3V8WA 2OJFE 4J99A 4NCTA 1I27A 4GH2A 1YTYA 1W98A 3Q6WA 4FZ6A 4UY9A 4QQCA 4FL1A 3W2CA 1OIUA 1V3FA 3GU4A 5KKRC 3HX4A 4R3RA 2EUFB 1MRVA 3J80Z 3F72A 3BYVA 3SGCA 2BRBA 3GU5A 4YHJA 4KKHA 3HV4A 4UZDA 4B6LA 2E1CA 1MRYA 4MXYA 1H0MA 4MNEB 2R7DA 4BDBA 4HW0A 3G2FA 4P4CA 1R5HA 5FD6A 3F69A 2F5FA 4KS8A 4LGHA 3I81A 4Y5QA 2IWIA 1B9MA 3DDQA 4FT8A 1O3SA 3F88A 2QHMA 3D7TB 1QPMA 4PL5A 5C8MA 2OU7A 2GDOA 3BU3A 4QLCU 5CAOA 4OOIA 4KABA 4K1BA 4FYOA 4B8XA 3TDWA 4XP2A 4XG6A 1H08A 4TYHA 3UZRA 2M1BA 2XNEA 3UZTA 5CQWA 1XCVA 5GIPE 4ANSA 4QP9A 1YI3A 1YIOA 2X6EA 2FE3A 5EM8A 4CYDA 1YOJA 4FTNA 3DNEA 1UWJA 4PCQA 2W1CA 4GKHA 3DA6A 1S7OA 4YJRA 2A3SA 4RWJA 2ZFWA 2FBKA 3ZM9A 4FSYA 2HS5A 1YRPA 4BTJA 4WXDA 4H3QA 2Q83A 1P2AA 4NUSA 2J5FA 2REIA 1XHAA 4FV1A 4ACMA 3FMLA 2R0IA 1T98A 3DTCA 3CTQA 4G3DA 5HVKA 4RGJA 2I40A 4APPA 3RJPA 4KIGA 4AFJA 2GS6A 1XWSA 4F0IA 4L01A 3R02A 5DDGA 2XJ0A 2W5AA 4WRGA 4F9AA 4TWCA 2W1GA 3QWKA 2JFLA 3KXGA 1TW3A 3OCSA 4F0GA 2JITA 5L2QA 5IQCA 3K5UA 3V51A 5KMOA 4F6SA 1FBUA 1R36A 2XKEA 3UPXA 3ZDIA 3Q9XA 4CT1A 2QO2A 3U55A 4FNYA 1H1PA 4NTSA 3DFCB 4AIKA 2E9PA 1K6OA 4UEUA 1Z91A 4D2RA 4IC7A 3VQUA 4ANQA 4C02A 3U87A 4HDVA 2VV9A 3QRJA 1F5TA 3LCSA 2Y4IC 5G6VA 1AQ1A 5AP0A 5CENA 4HVGA 1UNHA 1FYLA 1TNTA 4CFVA 5ETCA 4JG8A 4FICA 4NT4A 4RAZA 1H07A 4BDKA 3MGYA 3BCEA 3EN6A 4IF4A 5CAPA 5FXQA 4IACA 4G5PA 5LQFA 2E7WA 4ERKA 3SQNA 4IVNA 3HP5A 3V5JA 3DV3A 1TQPA 1QO0D 5AEPA 3LHJA 3IONA 3R0TA 3OUNB 2V7OA 4R3CA 1XR1A 4G8XA 3UJGA 1JE8A 4A6DA 2EB2A 3QHWA 4U97A 2Z2WA 3MJ2A 1KV1A 3ETAA 4MKCA 3PXQA 3SQQA 5KZIA 4D1SA 3JW4A 5BYZA 3PWYA 3SLSA 4CVAA 3TOAA 3ZRLA 5J9YA 1YFHA 5K4IA 3DZOA 1MGTA 5C01A 4FSZA 5CSVA 2BZHB 1TBXA 1Z57A 4QD6A 2X8EA 2YJRA 3UGCA 5HG8A 4QMUA 3EFLA 5HLHA 3Q2JA 3F5GA 1CKJA 1ZN2A 5E1SA 5AFVA 1P4WA 3HKOA 4XNEA 2ZMEB 4O22A 2J2IB 4XG9A 2FA2A 4M3QA 2Z33A 3PG3A 3VUHA 4DG0E 2Z7SA 4O0VA 2ETRA 4EK6A 3ERKA 3G0EA 4MNEA 1B6AA 3LCOA 1Q4LA 1T46A 1U5RA 3SDJA 3GCPA 3Q60A 3D14A 1OMWA 2QNJA 3RNIA 3FC2A 2X4FA 4XV9A 3QC4A 1WRJA 3V8JA 3WYYA 3NZ0A 1R23A 1FP2A 1ZYLA 5ANDA 2QUFA 3N51A 3WU0A 5K5RA 3L1SA 3GGFA 3S4QA 4GCVA 4BI2A 2PMHA 2ESNA 5K0XA 2PEXA 1JSVA 5H8GA 3QTWA 3BOQA 3KQ7A 3TWJA 1GJOA 2J7TA 4OAVB 3IGGA 1JHHA 3RYPA 3ZH8A 5LWMA 5KX8A 2B4SB 3I71A 5BVEA 3Q9VA 2VTQA 3P7AA 4EGZA 4BHPA 5E7RA 3QU0A 3FMQA 3QPHA 3HSFA 3RPSA 4BYJA 3QD3A 4XOZA 2FBIA 2P5LC 3R6XA 5BPDA 3W6JB 1O7LA 3WG9A 5D1JA 1OVEA 4LOPA 4ZY6A 3QQFA 3R9DA 3PFIA 4OTHA 4YNEA 3QZIA 2FNAA 2XRWA 2QI8A 3GFLA 3VHKA 3K5VA 2VTMA 1JAMA 3MEXA 4Z16A 3QQKA 2MBFA 1KUTA 1W0XC 5I5ZA 3L7WA 1DAWA 1XBAA 5LVOA 3MWMA 4K2RA 2G15A 3KEQA 5E8IA 5HLIA 5AP3A 5HE1A 3LE6A 2B55A 4KNBA 3VQHA 5AP4A 1G3WA 2FMLA 4KRCA 4RJ4A 4EOOA 4EJTA 3QCSA 1IAWA 1R7JA 3BE9A 1CF7B 1Y8YA 2WXVA 5H6RA 2FH9A 4EH4A 2BFXA 4O21A 4DEAA 3R9HA 3DKGA 2J0IA 5IUIA 5DCFA 4CLIA 3KXMA 5JGAA 2IZSA 3F3ZA 2KULA 3R60A 4QMPA 4ACDA 4UX9A 2HAKA 1PJKA 4F0FA 3FMJA 4EZ3A 4O6EA 5CU0A 4IWDA 2QOCA 2XVCA 5HVJA 5HU3A 5CAVA 1ZLJA 5AP7A 2HWOA 3U51A 1TQIA 3E3VA 1R3CA 1BJAA 4RJ5A 5I9XA 4HCVA 4QNAA 4OTGA 5AWMA 4YTFA 3QD0A 1VR2A 4G34A 3BEAA 4MQ9F 3U1DA 5BPIA 3WYXA 3FLNC 2KTYA 3DBEA 4E6CA 5CT0A 4BR3A 3H3UA 4AIHA 2XIYA 2YFXA 3NNWA 2PMNX 5EHOA 4IHSA 1XBCA 2EA2A 3TM0A 3U4UA 1SFEA 4M9ZA 2J50A 2XK8A 1Q8TA 3GLXA 3F3VA 4BDJA 4Q4ZF 5A4QA 4EBWA 3FZVA 5IEYA 3QC9A 5CALA 2R3HA 5GJGA 5CF5A 2NNNA 5CAQA 3PP0A 5BVFA 5BQ0A 3ZUUA 2W85A 5CI7A 1JVPP 3T3VA 1SD4A 1SYKA 2HQRA 1GXPA 5KNJA 4ZZNA 4KA3A 2LF7A 4O2ZA 2WGJA 3BJOA 5J87A 4GG5A 5L6OA 2KIFA 3FM5A 1M2RA 1U46A 4BDIA 4BDAA 3ANRA 2W4OA 1T2KA 3KLNA 2VONA 3I4BA 3R1YA 4MEYF 4ZLZA 3W18A 3RHKA 3QUDA 2G01A 3IDCA 4ID7A 1KE9A 5FEDA 2R3SA 5E9EA 3F6XA 1W7HA 3JAMK 3EIDA 4HPTE 4OIOF 1D5VA 5KMKA 4AZVA 2R3RA 1YOLA 3BYOA 3ZTXA 3ALOA 3FPQA 3ZSGA 3WOWA 3Q53A 2CWEA 5BMSA 3FY0A 3KVXA 4FTCA 3KFAA 3DBDA 5CNNA 4PP7A 2HFHA 3QTZA 4CDGA 4GYIA 1KQ9A 3FXZA 3OT3A 3DEUA 4D4RA 4I92A 4V0GA 4IZ5A 2BTSA 1P4AA 2LDUA 4TZRA 5IQGA 4IX3A 1HW1A 5EOBA 1J7LA 3TTIA 4KT5C 3LM5A 4EH7A 1HOWA 2O2UA 4MF0A 5DR6A 2CW0F 4FC0A 5I9UA 5LEJA 3IDBA 5JHUA 1YQJA 3P1AA 5EG3A 4YTIA 5J9ZA 3RK5A 5AX3A 2PMIA 3TACA 3CUOA 4G3GA 3HRCA 3MA6A 3FXXA 1JXSA 3TO7A 4DG3E 3TG1A 3UIMA 4NW6A 3DOGA 3NLBA 4BGGA 1I1SA 1J75A 4BBMA 4GFMA 2XV4S 1J7UA 2ZJWA 4UXQA 3DFAA 4OAUC 4DFLA 5FEEA 3A8WA 5CAUA 5BOXA 1LEWA 5HIEA 2V1DA 5CVUA 2BYVE 2Q2EA 5ILSA 3AC4A 4P5OA 2EB3A 4C59A 2UZUE 3R7GA 3R9NA 1FGIA 3UC3A 2BGCA 4YNOA 1U59A 1Q24A 3A2CA 5LGNA 2HY81 3NCGA 3FQHA 3WE2A 2UWMA 5KKRB 3EZVA 1PYXA 1JSTA 2QQAA 4OGRA 4DTBA 2Y4IB 4EEVA 2CFXA 1WBWA 4NJDA 4GJ2A 5AAGA 1PYEA 3VEPA 2MH9A 3HHHA 3CJNA 3UP7A 2ZNYA 4DH7A 4BDFA
chains in the Genus database with same CATH superfamily
1NHAA 1S9JA 4L5IA 2JTVA 3MFTA 4XRMA 4YIFA 2H8HA 3FLZA 1ZH5A 5E8XA 3UMXA 2D5VA 4AZFA 5FD2A 4C3FA 1S5LC 2CQQA 3EETA 1APLC 2GNGA 3LQ5A 3DAJA 2VTSA 1R49A 2XA4A 3QQGA 3ZO3A 2KJCA 3JSPA 3LNQA 1FSEA 4M3GA 4CZUA 4YJOA 3D2KA 2KQRA 2LP0A 3HDMA 5EW9A 3QKMA 2BHZA 4C2UA 4IWQA 3GQLA 3L2UA 1NT2A 2OXDA 4E7WA 2CNUA 3AG3H 3HA8A 3P78A 1PP7U 1OMIA 3KEXA 2NS8A 4F6WA 3COMA 2NRUA 2Y69H 2HOSA 4AN2A 2YDKA 4V19K 2H96A 2WTVA 1OKRA 2XBAA 3R7EA 3BU6A 2CKOA 3HOYJ 4DITA 1H1QA 5CSHA 3CCYA 3PY0A 1KQ8A 3FIWA 4P9FA 3T1BA 4PDPA 4HEA2 1XMKA 4PL4A 3HUGA 1TC3C 3ONQA 5A14A 1WI3A 3K9TA 3EQBA 1FOTA 2QODA 2QQ9A 1ON2A 4BQNA 3WILA 3K4BA 4BXUA 5HCYA 3MZYA 1FIAA 4LITA 3IC7A 4N9IA 2ZXHA 2VWXA 4S0HB 1BC7C 4CKIA 1WJ5A 5IISA 5AV1A 4IZ7A 2I6LA 4K6ZA 4KITB 3VW6A 4DLIA 1Z6RA 2L02A 2OCEA 3KK9A 3P9KA 2GNIA 4G6LA 3CF2A 2KLOA 4BBRJ 3FM3A 3V8LA 4O27B 2ZC2A 2W17A 4XG2A 2UW5A 1H26A 2G1TA 4ZSGA 1BLXA 5IKWA 3DU5A 4MYGA 3BGPA 2OKRA 2XGCA 3C5UA 5D7AA 4LIVA 3KCCA 3E5AA 1L3LA 3KMWA 2NS7A 3A4OX 5CZHA 3WU1B 5GTIC 3MS9A 3TUDA 5DEYA 1UNGA 5LJJA 2WY7Q 4AWIA 4FV4A 5DCMA 1MSEC 2XKDA 4HW7A 1MMAA 5HLTA 4KUJA 4XG8A 5HS9A 4FBXA 3SC1A 2GA2A 4C62A 1UWHA 2XIGA 2KJBA 3LQQA 1GAGA 2ZDTA 1KU2A 2W05A 4F52A 3L8SA 3OOGA 4BEHB 3VS1A 4XS2A 5EZGA 3IQ7A 4I2OA 2GZWA 4KMUX 4MD9E 4IFGA 3K70C 4L52A 2QSFX 3FMKA 2OH4A 2KDZA 4CHUA 3BYUA 3IKVA 4DEBA 1MIJA 4E6DA 2HTSA 4FE4A 4UWBA 4DFBA 3A01A 3O7LB 4FKLA 5DH3A 5FQDC 3RKQA 5AP2A 3WF6A 2OFUA 2YM8A 3TNQB 3J7AY 3CPCA 4I93A 1PHKA 1Y0UA 4QMVA 3KMUA 3ZQHA 3TUCA 4QSHA 4HQMA 4KIFA 4D2TA 4PTEA 1BN5A 3VF9A 4I22A 4EL9A 1A04A 1ZELA 2L9NA 2WTKB 4QP6A 4YLJA 4M9SA 1ODDA 2FSWA 2PL0A 4FKWA 5AR5A 4RX7A 2BAJA 3I79A 5EEHA 4B1RA 4DINA 1CF7A 3KYLA 2C6YA 1O6KA 3OROA 4G2FA 4YJTA 3NAYA 5FRIA 4DTAA 1Z7UA 2VN2A 4CYIA 1XH4A 3HGKA 1J91A 4HOKA 3LLAA 2F2UA 3H9FA 1KYZA 4AA4A 5A4TA 3Q2MA 3W8QA 3HUBA 3QYEA 2M45A 4NZWB 2W25A 3K1PA 5HOAA 2JKOA 2VB6A 5HIBA 3ABMH 2HEOA 2FU4A 3MDYA 3RHXA 2WY8Q 5DV5A 3MI9A 2C6EA 4CD0A 3FI3A 5EH0A 1WFXA 2DFEA 5DPVA 4B3XA 3UG1A 5BYLA 4XG3A 5IUHA 4IL6C 1BI7A 4MH7A 5CEQA 4UHTA 1WJEA 4M7IA 4JQEA 2RFNA 2B54A 2WC2A 4QQ5A 1YHWA 4DJAA 2JDOA 4A4OA 4A3JJ 4JQFA 3JR1A 3HKZA 2LBFB 2YN8A 2CNQA 3ZC5A 1PP8F 4RG0A 3F8BA 4S30A 3AXWA 4WXHA 1PMNA 2VO7A 4KA4A 2XBJA 4DBXA 4DFUA 4L67A 4AOTA 3EYYA 1POGA 3MFUA 4XMOA 3W0OA 4IBMA 3FZ1A 4I41A 2WMSA 2LGCA 5L8JA 5F20A 3F2AA 4Y83A 4ZIMA 3A62A 5EM7A 3MA3A 3V3VA 3RGFA 5L3CA 3ZMUA 1MZBA 4J1RA 1STZA 3JRAA 3LCDA 5BX0A 2HDCA 1Q1HA 4UMRA 3K4MA 4XKCA 2C6TA 2B7EA 5BV3A 1V0BA 5TR6A 3OOUA 1O3RA 3TW7A 3SA0A 4BBEA 3LXLA 2H6BA 3T8TA 1S9IA 2JKMA 4G6OA 3BR6A 2BALA 4YR8A 1XN7A 5E79C 2I5UA 2M3AA 3NUAA 4U40A 3HL2A 4IJPA 1R22A 5I0BA 1WJBA 4XP0A 2X1CA 1XC5A 5F1JA 5CI6A 2YX4A 4P90A 4EOQA 4KMFA 1YWRA 3GEQA 3NYVA 3DU8A 2ECBA 3UQFA 2CO5A 2VUWA 2DUVA 3CCEI 1MSFC 3PP1A 2R5YA 2IA2A 1IASA 3S14J 1W4MA 4MAOA 3U6IA 4FG7A 3G1MA 2XNPA 5D4SA 5D11A 4HV6A 2L54A 3NNUA 1HA8A 4ZY4A 3VVHA 3ZFMA 2OLCA 3DJ5A 3MPMA 2UV1A 3HEGA 2VO3A 5JK3A 1BW6A 2R3FA 4BUPA 4N0SA 3ZLWA 1OL1A 4BCIA 5IEXA 3ZO2A 4G94A 1GZOA 3NNVA 2XKFA 4F6UA 3RK7A 2QO9A 3LVPA 2WV0A 3FK6A 2DA5A 3E8CA 3LCTA 3CS9A 4FX0A 3K1MA 3OYBA 4DEIA 1JQHA 4DFXE 4O0YA 1OPJA 4A3LJ 3QA8A 4CZYB 4XHKB 2KKOA 1ITYA 4E4HA 4PGHA 4BVUA 2CGWA 4AP7A 4OBQA 4AA5A 3CCNA 4MD7E 3C2HA 4BQAA 3V5QA 4EOSA 1SVOA 2E1OA 3A1YA 2BAQA 3DPKA 1MP8A 1TNSA 4AT5A 4E26A 3FLQA 4EOKA 4ITVA 1YWVA 1V4RA 4TWOA 3HLLA 4BE0A 1QVTA 3WZDA 1G8SA 4DGOA 3QAHA 4LRJA 1TZDA 2Z5UA 4A9RA 2JVGA 2CV0A 2IGMA 2R7RA 1G5SA 4PNKA 3D94A 3IW6A 2PI0A 3VO3A 2R3QA 3TOBA 3LSJA 3FL4A 2A27A 1UHMA 3VHEA 4G12A 4J8MA 4BCGA 3AG4H 1XX5A 1E3HA 2RC4A 3L1PA 2V6EA 5HLGA 4QNYA 4MTAA 3FC1X 1FGKA 2OSCA 2UW3A 1SANA 3PIOF 3V6SA 4RA4A 2RREA 4QO9A 2OPTA 4E7IA 2ZMCA 2W1OA 5DT4A 2OTLI 3A60A 2ZFYA 2J4ZA 4UMUA 4X6RA 3ZQIA 1RE8A 3DY7A 4GEOA 2WTWA 4Z7HA 4PK4A 1AOYA 2WB1A 3TZ7A 4EHGA 2VKHA 4ZTMA 1PMVA 3TXOA 4I4EA 1FOWA 4B4CA 1W84A 3MY1A 5GJFA 2XAOA 2FBHA 2CV2A 1U5TC 4MHGA 1W36C 3QKKA 4P5QA 1WBPA 2JJ7A 1PUFA 3E8EA 3KIOC 5DI1A 2ZMDA 4JDHA 4DW6A 2X0OA 5AAFA 1IA9A 4P2KA 5JVTA 2RSVA 4YPDA 3NR9A 4CG9A 4BRXA 2KZVA 3S2HJ 5EGOB 3KZYA 1X1DA 3VUDA 1XH6A 4FNZA 1SVHA 4D9TA 3OXIA 4BU2A 2FRHA 3L2WA 3PSCA 3FHIA 2WD1A 5CZIA 4JIKA 4QTRA 3RBWA 5HTIA 4PPAA 5FDPA 4EQMA 3M9AA 2ID3A 1JKPC 2X0PA 3GXLA 1XDUA 3OYHA 5IQEA 3GLLA 4RB2C 4RVLA 2DOFA 4LD5A 2O8XA 3EN4A 4B9DA 5G1XA 3LLTA 1H25A 2XF5A 3W2AA 4BCQA 4A0ZA 4DF3A 5DIAA 1DS5A 3Q9WA 5FLMJ 2XNNA 4IC8A 4BBFA 5JFVA 4FKQA 4A4LA 5FXSA 2JPBA 4NYEA 3P23A 3ZN1A 2IVVA 5FDXA 4X3FB 2L5QA 4TNBA 2Y4PA 4LGWA 4FTQA 3T8RA 1W0UA 4C34A 2BVLA 6PAXA 4BDCA 3OYFA 2WMTA 1LEZA 1FZPB 3IAS2 5F6FA 3ZMDA 3CXWA 4JR3A 1OBGA 4R1HA 2XGXA 4GV1A 2AXLA 5IU2A 4RIXB 4V04A 4JBQA 4LGDA 5J79A 3TUBA 3K3JA 1SAXA 2XAJA 3W16A 3P79A 2RFSA 2X6OA 4FKGA 3BP8A 1RQQA 2BILB 3GZ5A 1S3JA 5J3LA 4E6QA 2RQQA 4CCKA 4C2MJ 3GI3A 2FEZA 4W97A