1ZAOA

Crystal structure of a.fulgidus rio2 kinase complexed with atp and manganese ions
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
282
structure length
271
Chain Sequence
MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVGHTKVKEFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Autophosphorylation of Archaeoglobus fulgidus Rio2 and crystal structures of its nucleotide-metal ion complexes.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Transferase
molecule keywords Rio2 serine kinase
total genus 93
structure length 271
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zaoA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zaoA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zaoA02
1ZZ2A 3RMFA 2RV8A 4E6DA 4X0MA 5AWMA 2W1GA 1MDMA 5GNKA 4XV9A 4CMOA 1I5ZA 4IC7A 3FX3A 2FGIA 4IEBA 4YU2A 2Z7SA 3K5UA 5DVRA 4I20A 3TI1A 3HNGA 3QWJA 4FTMA 4G9YA 4FV7A 3TUBA 4X7QA 4ANLA 5DGZA 2VV9A 2C5NA 3I7BA 4RJ4A 4Z7HA 3BPRA 1IN6A 3PVUA 2L4MA 5BQ0A 3RYRA 2ZMEB 4HBLA 2ISZA 3GU5A 2VTOA 3ZH8A 4HVGA 5BPDA 1ON2A 4XMOA 1B59A 5M07A 3TV4A 2XM9A 1SFUA 4RWKA 5DH3A 5C8MA 1GNGA 3BHHA 4IWOA 2OIDA 1RDQE 2HY0A 4O83A 4YFKF 5I9XA 3C5IA 4ZYEA 3NUAA 3D2KA 2HZ4A 4J8MA 5EHOA 4DEGA 4IQ6A 5DRBA 2WELA 4IJ9A 1Q4LA 1UVRA 2O2UA 1T2KA 4E5BA 3KREA 1ERKA 5LHIA 2YZAA 3G73A 3FXWA 1Q8ZA 2I40A 4M66A 2M1BA 4BXUA 4QOXA 4GCJA 1MGTA 4IZYA 2GHMA 3EQPA 2CSNA 3DAJA 3ZC6A 3OCTA 2IP2A 4HF2A 4XOZA 2ZKZA 4A0ZA 5E1ZB 3TIZA 1P4XA 4FKGA 2COMA 4R3PA 3DPTA 4LL5A 4F7LA 2Z02A 2ZO4A 2JKQA 3EN4A 2DW4A 1ZG3A 1M52A 2EA4A 3CPCA 3O71A 3PRFA 4RX9A 4QMWA 2QONA 4ZYDA 1WBSA 5AUYA 1MDMB 1H0VA 1FY7A 5M55A 2REIA 3G51A 4B7TA 3FE3A 5E8IA 2WQOA 3ZFYA 4FZ6A 2JKOA 4NCTA 2XK6A 3TKYA 3KVXA 3V04A 4EOLA 3Q04A 1EH6A 4L68A 1XBBA 2WC2A 1JSVA 1S29A 3BJ6A 4BHCA 1NXKA 2GWRA 3MYGA 3R7UA 1SYKA 5IEVA 4FTTA 4X2JA 4C4GA 4HGLA 2GXBA 4FGRA 1SFXA 3GGFA 3ZHPC 4QP1A 2ETRA 3M42A 5M57A 2K27A 4IW0A 4CV9A 2QQ9A 3QRJA 4UWBA 1DDNA 1HOWA 3KXMA 3KL8A 1MRVA 3KMWA 4CNHA 3CQWA 3BPXA 3ECOA 4NIFB 4EH8A 3MVJA 4X3FA 4JAIA 1BI1A 3DK6A 3GENA 2JFLA 3COHA 1T46A 4QMLA 3OXZA 5D41A 2FA5A 2HZNA 1R0PA 4QP4A 4NWMA 4O5VA 4C7TA 3R83A 4KB8A 4KT5C 2RGVA 4FMQA 3POZA 3CKWA 2XAGA 2QKRA 5A4LA 2IW6A 3EQRA 2HQRA 3J81Z 3LQ3A 4M68A 5CASA 1OECA 4UXLA 2F57A 3F69A 5HD7A 3DZQA 3KCKA 2PVHA 3WU0A 4F1TA 3MI9A 4W4VA 2X9FA 4YO6A 3RAKA 1K78A 4ARKA 2XK9A 3P78A 4IB3A 3FJQE 3N51A 4CYIA 4BC6A 4EORA 2F5CA 3I71A 3NVMB 3I59B 5EM5A 2J50A 3OG7A 5EW8A 3AC8A 5HE0A 2BZKB 1SMTA 4NU1A 5HDKA 1P4AA 3DDQA 4JDJA 3A7IA 1Q8TA 3ULIA 5JZJA 3R9NA 1U78A 4D2SA 3VNTA 2DFIA 3UO6A 3Q5ZA 4MF1A 3VS1A 2ZV8A 4D2WA 4BHPA 3TNIA 3FV8A 1JKKA 4TT7A 3ZONA 3M9AA 2GCDA 3ALOA 4BCQA 4XHKB 3ZPLA 3QUDA 2H9VA 2HZIA 2IPQX 4MEYF 4DFYA 3PSCA 5BUIA 4BDDA 2G9XA 2VWUA 5DYMA 1YDSE 5KMLA 1XD7A 4H3BA 4ZTHA 1W83A 1K9AA 2PVYA 4BDAA 4RVLA 4IWPA 2W9FB 3FMHA 3LFQA 4I7HA 5CU0A 5M4FA 1U5TC 5IA0A 3GBZA 3PLAE 3WF5A 2Z3YA 1ZRFA 4Y73A 1HCKA 4EM2A 2D1VA 2Q8KA 2F7ZE 2NPQA 4O0VA 3ID6C 1P2AA 4CV8A 1OR7A 4EVIA 2B52A 2CJMA 4LG0A 3LHJA 1IR3A 2BDWA 4FZFB 5DCMB 4WWCA 4MNEA 1DPUA 2PVNA 4O7YA 3EHAA 3P08A 5CNNA 5FTQA 3I6WA 3F21A 2G1TA 3QU3A 1LEZA 3K0LA 1BL6A 4EH5A 3MB7A 3PDTA 4I5HA 1BI2A 5LVNA 3BPVA 4XG8A 2YAAA 4KMUX 4KIFA 1XQZA 1C0WA 2Z7QA 2MLKA 2WMBA 5DOSA 4HYIA 4DNCA 3SGCA 1W82A 4E93A 4ENJA 2PULA 2WTJA 2Y0MA 4YJTA 3WIKA 4GGGA 1LDJA 3LE6A 3EN7A 4PMPA 1WFCA 4GFOA 3FQHA 3J80K 3GC0A 4L7SA 2XAJA 5CSVA 3NIEA 3CBLA 4IE9A 3FWEA 3C4ZA 2HYGD 4OMZA 3PJCA 1O3QA 3WE8A 2H94A 4S04A 3CS9A 3RPQA 4U8ZA 4O7VA 3DDPA 3D5LA 4AN3A 5D7AA 3OOPA 3FLWA 4FV4A 3PQJA 2PK9A 3V5PA 5EEGA 5J1VA 2IVTA 2C3JA 2B53A 4GV1A 2C5YA 2RNJA 2K86A 5KVRA 2I1MA 4MH7A 3KEQA 3CIKA 1BC7C 4RGXA 4BZNA 2XYNA 2P55A 2Q0NA 2W96B 4JQ8A 1PMUA 4D55A 5AM6A 5JZNA 4GK3A 3KXNA 2VTAA 1VYWA 3MSSA 1GZNA 4FNWA 2W5BA 5TF9A 3W2CA 4AN9A 4JLCA 4QLCU 5IQBA 4FV2A 3HUBA 3NCGA 5FM2A 3PA4A 3W6KB 3LXKA 2UZUE 1Z6RA 3DXQA 4D9UA 2M45A 2VC0A 4FOBA 4CKJA 3QUPA 3D14A 3A62A 3ENMA 3FLYA 4LGGA 2J5PA 4TN6A 3AMBA 2FSOX 3RAHA 2L54A 4ZY4A 4ZLOA 4ZEGA 3PFIA 2EV6A 5J8IA 3OUNB 4TWPA 3BYSA 4R8QA 2GNJA 3ZMDA 1S3JA 1M2RA 4R1HA 4EONA 3GFJA 3ERED 2HDCA 4PDPA 5AAEA 1DPRA 4BYIA 4FL3A 3D15A 4C37A 1WKMA 2HYFA 1ZYRF 4ALUA 3EMGA 4UB7A 3GOPA 2J0IA 3O7LB 1UKIA 3RZBA 1B38A 5HE1A 1NVQA 3RI4A 2C6LA 5AA8A 4EL9A 5CEOA 4CFVA 3LZBA 4DG3E 2R3GA 3VJOA 4EH4A 5KX8A 1FBSA 3PIXA 1R00A 5HE2A 4BCOA 3U9CA 4CKIA 3AD4A 4Q2AA 3EQCA 1W0XC 2IW9A 3NYXA 2QD9A 4O6LA 4GS6A 4RWIA 5AP2A 4UMPA 2YCRA 1YHSA 1XGMA 4O84A 5LHHA 3FC1X 2F7XE 3FMMA 2JDOA 2VTSA 2QG5A 3GVAA 5CEPA 2Q0OA 2XK3A 4R3CA 5M06A 2XNBA 4ACDA 1R1VA 3TZMA 1H28A 3R8PA 3OS3A 4EQCA 3WTYC 3ZUTA 3ELKA 5EQPA 5LRSA 2GNLA 4CDGA 1R39A 5ANKA 2QURA 2PE0A 4LQMA 1IZ1A 1Q41A 2VTTA 2WGJA 4TW9A 3PWYA 1FBNA 3FKNA 5JEBA 3IKVA 5HQ0A 5DD8A 1XCVA 1PKDA 4J53A 4YZNA 3ZU7A 4E20A 4ASXA 4FIHA 4UMRA 3T3VA 2FSTX 4C2VA 4Z16A 4F0GA 3LIJA 4GCVA 4IWQA 2E9UA 4XLPF 5HE3A 4YNEA 2O5KA 4JBQA 3F5XA 3MH0A 5C9CA 4KKGA 1KU7A 2XCHA 4FVQA 3ETAA 3KXHA 1XR1A 4PX6A 5HDNA 2BHEA 1CSNA 4F9AA 4F7ZA 1FVVA 1Z1DA 4FIFA 2E7WA 3N4TA 3VBVA 1PXIA 2X2KA 3TOAA 4L18B 4UZHA 2UZNA 4KSPA 3MV5A 3T0YA 5AUTA 1GY3A 4DFBA 4N57A 2E9OA 3ODYX 4RA5A 4KFCA 2Y7JA 3DKGA 2R3JA 3AOXA 4P2KA 1XSVA 4ONAA 4BVUA 4L0YB 3FMDA 2CGPA 5ACBC 4E4XA 4ITHA 3T3UA 3M11A 2E1NA 2QOQA 5CENA 2GS7A 2UW9A 5LVPA 4EUTA 4BDEA 2XAQA 3RPVA 4HVIA 1FINA 5C4KA 1P4WA 4M97A 1CGPA 2C3IB 4ANSA 3DBDA 2KIUA 2R3MA 5L2SA 4QYGA 4UZDA 1H1SA 4U3YA 4ZTRA 4QMOA 2CGXA 3B73A 4RVKA 4N9HA 2OJGA 4GK2A 4EH2A 4ZLZA 4N0BA 5AUXA 4UMQA 1JXSA 2C6MA 4I94A 5IG1A 1CF7B 3P7CA 3F7WA 5K0XA 4XG2A 4FKPA 3A8WA 3GEZA 1BJAA 5C1QB 2XAFA 5GINE 1JNKA 3ZDIA 1GIIA 4IB1A 3QZFA 2C6YA 2HGCA 1LPUA 4W4XA 3SD0A 4YJQA 5F20A 4HF0A 1JWHA 3HX4A 4S05A 4JI9A 3PSDA 2XV4S 3C4CA 3CP9A 2BFXA 5CU3A 4FC0A 4P5QA 3P5KA 3CJNA 1ODDA 3KK9A 3W2OA 5GJGA 3T9IA 4GUEA 1V0BA 3AD5A 4KBAA 3BHUA 4M72A 4FSQA 3ORMA 5ERIA 5BS6A 1ATPE 2A1AB 3R01A 4FEWA 1LB2A 4EH6A 1LVAA 4EEVA 4XYFA 2JD5A 3RM6A 3BEGA 2HR3A 4J96A 4DITA 4GO1A 4IAZA 1BOAA 4ACMA 2ZNZA 4LGDA 4ERWA 3DNDA 3UNJA 1M2QA 4RGJA 3BCEA 4D5KA 4UBAA 1GZKA 4JQFA 4FICA 5ETAA 4EC9A 4RFYA 4I02A 1IN7A 1HKSA 4RIWB 4M6YA 1OL1A 1XMAA 3R63A 1U3EM 2MBFA 5DR6A 2CGVA 1R23A 3HV7A 2R4BA 2EJRA 4JS8A 3A4OX 2NRAC 3ZN1A 4YMJA 3RTRA 4KAOA 2DQLA 2LKPA 2FMLA 2WEIA 2OBJA 3QGYA 4ID7A 2BBYA 1LQ1A 4RIXB 3IWZA 4BIEA 1TBXA 3KULB 2CN5A 5CYIA 3NNWA 5BVEA 2M5WA 2R3LA 5JFRA 3F6VA 4R7IA 4EOQA 1G3YA 5M08A 3QPTA 4RC3A 3VAPA 3UOKA 3C4EA 4O0SA 4L3PA 2EK5A 5JI6A 4XV1A 4C35A 2JZYA 2QHNA 5ETIA 1S8NA 4QMMA 2RQPA 3W33A 3DB8A 3IGGA 1H4LA 1Z9XA 4G9CA 5DV5A 4QPSA 3NX8A 4WA9A 2Q83A 4IH8A 4PMTA 4LRKA 1PMNA 1PRYA 4C57A 3LSTA 3LA3A 2V6CA 4L43A 1DP7P 4E4NA 5DCFA 3JAMZ 1O6KA 5FM3A 3QTZA 4C4IA 3TZ9A 4CGZA 4BTKA 5HVYA 1NVSA 4FHTA 3CO7C 3HSEA 3N4VA 4WSYA 4RFMA 3W2PA 5AR2A 3Q9YA 1H00A 3R9RA 2YISA 2OSCA 2UW5A 3KRJA 4LK0F 4NH1A 3QOPA 3QHRA 1HKQA 3I64A 4EOKA 1TW2A 5CEMA 5ILVA 3FLNC 4PGGA 3OW4A 4NK9A 1TQMA 2P6TA 4E8AA 5IQHA 2OXXA 4O2ZA 5FEEA 3DXJF 4ALVA 4E7WA 3Q5FA 4D2VA 3I7CA 4BDIA 4FIJA 4S31A 4PCQA 2OGVA 2X4HA 3ORZA 4FKVA 3MN3A 3CLOA 5IQCA 3L9LA 2OZAA 3QWKA 5AUZA 4PPBA 3G9LX 4HOBA 4J1RA 3QCXA 1A04A 3I54A 2WFYA 5L3AA 3OHTA 1XCBA 2UZKA 1OM1A 3RPSA 3W2SA 3GT8A 4EK3A 2I0YA 3EN9A 5EM8A 2XEYA 3FKLA 3A61A 2BFYA 1LEAA 2GXGA 2OJFE 4GH2A 4DINA 4EMSA 4UXNA 5ICPA 3WTWC 1XN7A 1JGSA 3BLQA 1P92A 4L01A 3THBA 2C3KA 1ZLTA 5A2QZ 1OPKA 3HKOA 3I5ZA 4HV5A 3VUDA 4XP3A 2P2HA 3UC4A 3E8DA 3ZXZA 3HP5A 3DJ5A 3OBJA 4HF1A 4QMUA 3NWWA 4CTCA 2PVLA 4GT3A 4R6VA 1UWHA 4IAIA 2YM5A 2VWYA 4G3EA 4IDTA 5FBOA 1TQPA 1ZYCA 3C5UA 4O21A 2DUVA 3FI8A 4OTIA 2MH9A 1U59A 1PMVA 5FGKA 3T8RA 1SNXA 2YU3A 3MZYA 1H27A 4QTAA 1OBGA 5AR4A 4Y5QA 1ZARA 2OKRA 4OTQA 2YEXA 3D0SA 5HHWA 2FSMX 1UCRA 2P33A 5BVOA 2Y75A 3G2FA 2JKMA 5KMJA 2RFDA 2DPUA 4W9WA 4DGNA 2IJLA 3MJ1A 4U3ZA 1ZG1A 4WG3A 4D0XA 5EYDA 1PKGA 4MNFA 1YG2A 4IX6A 3CTAA 5CVRA 2G15A 4KUMA 4DGOA 4E6AA 5H20A 2MC3A 5FD2A 5F6FA 5LGUA 4XBRA 1R1TA 2X8DA 1ZWSA 3DLZA 5F4NA 2FQ3A 3LW0A 3WOWA 4QQ5A 4HYSA 1YXTA 3BHTA 2IVVA 4BDCA 2X7OA 2O63A 2W1FA 4O81A 4TY1A 3IRQA 3VVHA 2CLQA 4A6DA 4HNIA 5LCKA 2YX4A 2VWBA 2CNUA 1REKA 3K1PA 4ANOA 1YWRA 4E70A 5J8FA 5EDRA 3NQOA 4KS7A 1TNTA 5H9BA 2VO6A 5TOZA 4DFNA 1YKRA 3FXRA 4DEEA 5CI6A 2X0GA 1U5TA 2XEZA 4YUQA 4EOMA 3QU6A 4IRGA 1OB3A 3HMPA 4BICA 3BZ3A 4Y46A 2IT0A 3KETA 3UMXA 3PXRA 1ZYJA 3N9XA 2EVAA 2PUIA 1E17A 1H1WA 4HAMA 3DCVA 4A5MA 3CSVA 4F9CA 3MH1A 1RZ4A 3GZ5A 2R3NA 3FI2A 2YCSA 3KB7A 4BDBA 4OMYA 3EQDA 3U55A 3KZYA 3EFJA 5KHXA 1JKLA 2IWIA 5T6KA 5CVJA 3UZRA 4AIJA 1BIAA 3ZBFA 3ACJA 4LG4A 4ZAUA 3OXTA 1ZMUA 1E1VA 4IVBA 1BX6A 3R7YA 3BZ6A 4M71A 5CT0A 3E62A 4HA8A 5I4NA 4RA4A 1CKPA 1MQ4A 2ITVA 3ZO1A 2FSWA 4AFJA 4P9UA 3P9JA 3U87A 4EGZA 3WZJA 4D2PA 3DGKA 1L8TA 3CD8A 4JRNA 2XKCA 1QO0D 3TO7A 3L8SA 4LOPA 3ZO3A 3RGFA 3AMAA 4BI1A 3C50A 5IPJA 2YM8A 1NHAA 3JY0A 2VWZA 4G6OA 1WQ2A 3T8TA 2IO6A 3NUXA 5HTIA 3E5XA 3EH9A 2YX7A 1A48A 5C4LA 4BBMA 1MP8A 2I0HA 2QO2A 2UZVA 5LARA 4D1SA 4YFXF 1A9UA 3E92A 3K69A 5TJJA 2VWVA 4FIGA 3PJ2A 3N97A 2BRMA 3R0JA 5AP4A 4FKTA 3KQ7A 4CQEA 2W0JA 4O0XA 4XG7A 4J99A 2CSOA 2OQGA 3NW5A 3ZSIA 2B9FA 4G7ZF 3MFKA 1BBYA 1CTPE 3UVPA 3DK7A 2XBJA 3QKLA 4TWNA 1PXOA 3QD4A 4GKHA 3CTHA 4QMZA 3HRFA 4OBQA 3UQGA 2VT3A 2P6SA 4BN1A 4GU9A 1L3LA 3NSZA 3ZZEA 5EKOA 4PTEA 4WNKA 5AMNA 5CLPA 4FODA 3FXUA 3FZ1A 4FV5A 2JRTA 3NUNA 1KOBA 2D45A 2VWXA 4XP0A 1OL2A 3TT0A 1ZG5A 2M8EA 4OUCA 5E8GA 5AUVA 4IZAA 5E7RA 2XIZA 4IAKA 3I81A 4CT1A 1MUOA 4YFNF 3F23A 5JKGA 2VGPA 4EOPA 4KIKA 4KD1A 2ITPA 1IN5A 1FP1D 4EC8A 2JBPA 3F61A 2P5LC 1USTA 3QPHA 3UODA 3UQCA 4RIYA 5HBEA 4CSVA 5FXQA 1WSUA 5A6OA 4G3DA 3PE1A 4EZ3A 3G6HA 3P86A 2VONA 3PPZA 2XGXA 4I41A 4BAYA 4G94A 2QOLA 1IN4A 4W8DA 2PZRA 3KN5A 3KFAA 4TPTA 1GZOA 1MQBA 4QTEA 2ERZE 3DEUA 5CZIA 1YXVA 2Z5UA 4PQNA 1I1GA 4IRHA 1AQ1A 3QZGA 5HU3A 4O6JA 5DPVA 4BNCA 5E90A 4GRBA 3D7TA 4EWQA 4BKJA 1U54B 3PXYA 4WUAA 5J9LA 5LWMA 5HS7A 2WTWA 5E17F 3RDIA 4KIBA 1XH6A 3OCGA 4YC3A 2IN6A 4FTKA 2OU7A 3FMRA 3IW6A 5FFXA 5B2MA 2OBPA 3BYMA 4RX8A 2ZMEA 4RLKA 2WTIA 3JUHA 3S0OA 2YIYA 5CLSA 4I2OA 1KYWA 2AC5A 3FZVA 3FBVA 5DNRA 2C47A 3BQCA 2A3SA 5LVMA 2BALA 2W4KA 4U41A 5A4EA 2NRUA 2UW4A 3ZO2A 4RIOA 3LKMA 2FUMA 2C4GA 2WMXA 3FKOA 4MF0A 3DFCB 2R7IA 2XKPA 4I6HA 3G0EA 4KUJA 3F72A 5L2IA 3R6XA 2ONLA 3R22A 2ZV7A 4HVDA 4AIHA 2UW3A 4E5WA 3MY1A 3P4KA 4KIKB 4TXCA 2B1PA 4XRFA 4FI1A 4EK4A 2D2WA 3IRRA 1X8BA 2IA2A 4CCUA 3EWHA 3LFFA 5EHYA 4UWCA 3HRMA 2YM3A 2QO7A 2HAKA 5C01A 3ZEPA 2VTQA 3A7JA 2C5VA 2WQMA 5A4TA 3SKCA 3F2NA 3R0AA 3KCFA 2DAOA 4U45A 1PY5A 4FKWA 4UMTA 3R8UA 2WU7A 5AIKA 4J52A 5JGDA 3QP5A 2GTMA 3RKYA 3KRXA 4FSTA 3RK7A 3DKOA 2JIUA 3E8CA 2VOOA 1LEWA 4PPAA 3UIMA 3L1SA 2WOUA 4DGMA 4EKLA 1QBJA 2HIWA 3ZSHA 4UVBA 2PZ5A 4EQUA 3GCVA 2YR2A 1J7KA 1UNLA 2DWBA 5FO5A 3NYOA 1WBNA 3SXYA 1VEBA 1B1BA 4BTFA 3CGFA 5H8BA 1P5EA 4MBLA 1PJKA 3H30A 4FV0A 5HCXA 3RK5A 2YN8A 5BVNA 4BCFA 4KMFA 2XKOA 4IM0A 4FKLA 2BRNA 3L8XA 5BVDA 4QNYA 2V9VA 5K5NA 4D1XA 3LM0A 3OVVA 3AG9A 4ZSAA 5BPIA 4PDYA 3OXIA 1NA7A 5M44A 3QZIA 5JFWA 2QQAA 4NCTC 2VTRA 4CICA 4RJ8A 4NSTA 3GEQA 2ZJWA 2XA4A 4AX8A 4OIQF 3OY3A 5LOHA 2C6DA 3BU3A 4U40A 5KZ0A 2XUBA 3R9OA 3AMYA 3T9TA 5I5ZA 3ANRA 3BE9A 4FX4A 3Q9ZA 1I44A 2QBYA 2W05A 3I6UA 3I53A 1OPLA 4Q48A 2GZWA 3TUDA 5DUIA 3QXPA 4E4LA 1WWXA 1KU3A 4ZYHA 5IUHA 4RVMA 4IAAA 4PV0A 4X21A 3FPQA 4TYGA 3NNUA 4MTDA 2E9VA 5C27A 2DTRA 2F7EE 3PJ1A 2KRFA 4YIIA 3R60A 5HVKA 1V4RA 3SOAA 1YS6A 3F8NA 3ORKA 5I3OA 2A68F 2ISYA 3CC6A 3F5GA 4MXZA 4PP7A 3I59A 5E8WA 3AT4A 3PXZA 2YAKA 3UO4A 4S2ZA 3COMA 4HCVA 1OMIA 3AAFA 4YZDA 2BE5F 5E4HA 3Q9WA 3TNWA 4EZ5A 1ZXEA 1K6OA 2VX1A 2XNEA 3VBXA 4PDKA 3MPTA 5GZ8A 1VJYA 2AS5F 4TV7A 2ITOA 2UXNA 4DT8A 3ZMUA 3LFEA 1YW8A 1SFEA 3D9VA 5I9YA 1G4DA 2UW0A 4AT5A 4EUUA 4CLIA 4BKYA 2WMAA 4I5PA 4NFNA 2XIRA 4G31A 3HMMA 4QQTA 4F09A 3KXZA 3KRLA 3VS7A 2BILB 4M15A 5HIDA 4IVDA 1SVHA 3E8EA 3HV3A 1AD5A 4BIBA 3FUPA 4QP2A 4USEA 3R02A 3ATSA 4MX9A 1KE5A 4HCTA 4A9TA 3RCDA 4CZZA 3ULZA 3UBDA 4CKRA 3B2WA 2TDXA 4O96A 2OJ9A 3BU6A 4AA4A 3RYPA 4FTRA 3QRIA 2G2FA 3MW1A 3UNZA 4C3RA 1ZOGA 3FEGA 1YW2A 4QMPA 4LB6B 2EWAA 3LQQA 4Z2YA 3EL8A 3F3UA 5L3BA 4YJOA 2DT5A 4DH8A 3ZCLA 2FBKA 4IJAA 4BZDA 5IDPA 4ZP5A 2PFBA 5HI2A 2FA2A 1EV7A 1XBCA 4XG6A 3HA8A 1H08A 3W8QA 4WKQA 2UZTA 5FWKK 3KP4A 5T68A 5JN2A 4ESBA 5HIEA 3F22A 1KSWA 4LMUA 3NNXA 5IA2A 4FR4A 3CUOA 5HG8A 3VJNA 4BHBA 2X2MA 2ZDUA 3A7GA 5K5RA 4FTNA 4I0BA 3HSRA 3I0QA 5ETCA 1GIHA 1PDNC 4MAOA 3MIAA 3PXFA 1URCA 3WBLA 4KIQA 3RJCA 3SOCA 2VBYA 2J4ZA 4PPCA 2OJIA 3VN9A 4EH7A 3I58A 4I5MA 2C1AA 3BI6A 3L8PA 2W24A 5IT9Z 2BV6A 4IF4A 3NEUA 4LJZF 4DGLC 2J90A 1UU8A 4IACA 3EFLA 3WODF 3BDDA 2PG4A 4D5HA 3HAMA 3HAVA 1BIBA 3LAJA 2RFSA 4L7FA 2A07F 4I24A 2ELHA 4TYHA 5DEYA 3POOA 5HLGA 2VBWA 2WQBA 3QYWA 5TR6A 5HX8A 2HZ0A 4C33A 3EYGA 1QPCA 2GPHA 4CYDA 2RG6A 1LNWA 4FA2A 1Y8GA 2QOCA 3VB2A 4NZWB 2ZAZA 4JOAA 3E97A 1DAWA 3TZ8A 4FTOA 4FT3A 2BTSA 4RB0A 3SW7A 1FX7A 4BCGA 2PQ8A 3KP2A 3VWAA 4JK1X 5HS8A 3PFQA 4P90A 4FK6A 3UIUA 4PY1A 3QLFA 1ZOHA 3FWQA 4I09A 3DK3A 5J9ZA 2GSFA 5G6VA 1YS7A 4A06A 4KBKA 3FAAA 4MXCA 3Q6WA 4FBXA 5HOOA 3R9HA 1OKYA 3HTSB 5C03A 2PMLX 2UZEA 3UDBA 2PHKA 3V51A 5IEYA 5ANIA 4PDSA 5HGIA 5BVKA 1W7PB 2J0JA 4JDIA 5CF6A 4PMSA 2I0VA 4P5OA 3DF8A 3CJFA 2C6EA 4JG8A 3VULA 1PF8A 2UWMA 5ICEA 2VD5A 3ODZX 4UUVA 2UZWE 4PDOA 2CFXA 4BGHA 2O65A 3QRKA 4DFUA 4GG5A 4UHTA 1F1ZA 1OMWA 2QQ7A 5CU4A 1SD4A 3OBGA 2YM7A 5ED4A 3O6BB 4H58A 1Q8WA 3R0TA 3NIZA 3UVQA 1RI7A 2FBIA 4YTHA 5M53A 4M69A 5JH6A 5CANA 3HOSA 4C4EA 4RB1A 3GCUA 3O0GA 4YJSA 4QTCA 4I21A 2IVSA 3MA6A 1QQIA 4K11A 1ZGAA 5CAVA 4C59A 3DA6A 3LQRA 4HDUA 2CKQA 3TIYA 4ZY6A 1BM9A 4Y85A 4EHGA 3D4QA 4RC2A 1G6NA 1U8RA 4BDGA 2R64A 5DG5A 2X4FA 5CSPA 1IW7F 4M67A 3LJ0A 3SG8A 3RCJA 2W1EA 2XUUA 4F63A 4RIWA 4FUXA 3MFUA 5CYVA 3QKMA 2DQRA 4XNEA 4JG7A 2VZ6A 3TOBA 2OG8A 4V0GB 4L0ZB 4WNOA 3UYTA 5KMIA 4ERKA 4HYEA 4FYNA 1HXDA 3EQLF 4KS8A 3BOQA 3VBTA 4FTLA 3VEPA 4WRSA 3Q9SA 3DU8A 3U8WA 5KCVA 4L53A 1XHAA 3QZHA 3ZRKA 3UJGA 4U43A 2A0CX 4XV3A 2VBZA 5HOAA 4BCPA 5BVFA 4L6QA 4QMQA 4BTMA 2PZYA 3DLSA 2GNGA 3BYVA 3TG1A 4F99A 2V1XA 2EV5A 3QBNA 1Q62A 3V6RA 1BUHA 4FK3A 2VWIA 3CKXA 1U5QA 4F7JA 1O6YA 5L8LA 4UV8A 2EUFB 1G3SA 1W84A 3KFWX 4YLKA 3DY7A 4J95A 4JT3A 1S7AA 2CNQA 3TN8A 3R1SA 1FOKA 1FBQA 2CO5A 3IL2A 2C6IA 4QMSA 4I0RA 1HSJA 3M8FA 3QX2A 4D2RA 3H9RA 2QCSA 2LF7A 4R5YA 4A0XA 3FLZA 3F8BA 2BAQA 5GHVA 1GVJA 5CAQA 5L3EA 4OBOA 1JAMA 5CF4A 2GU8A 5D1JA 5CJ9A 3AC3A 4EM0B 4KKEA 4FE2A 3GLXA 4E6QA 3WI6A 2LF8A 1SZMA 3BKBA 3ZBXA 2X81A 5EM7A 4EH3A 4XSXF 3PY1A 1FQ1B 3Q53A 5HG7A 5D5UB 3VO3A 3JSOA 3RKXA 2IVUA 4MEXF 3CY2A 3EFKA 1MJBA 2QR8A 1TVOA 3IOPA 4JBVA 5AV0A 5AIRA 4L9JA 4JG6A 4HGEA 4YLJA 3IGOA 2YDJA 5IQFA 5ETFA 3IQ7A 1M2PA 2ZDTA 5HCYA 3DBEA 4DQ2A 3TDUC 1R0EA 1QPDA 3GFMA 4DBNA 3BQRA 2VN9A 4OTGA 4D2TA 4MTAA 2OA4A 5JR3A 3LFSA 1FLIA 4IAYA 4GJ2A 2XK7A 1JKSA 4LMYA 5HICA 3FMQA 1XMKA 1DS5A 4FOCA 4Q4ZF 4F7NA 5DLSA 4O1PA 3H4JA 2PMIA 4JBAA 2WIPA 5HG5A 3E5QA 1FBUA 3PY3A 2R0IA 4ASEA 1KU9A 2JITA 2WMSA 4O1OA 3IW7A 3WTUC 2XASA 1IXRC 2QC6A 4PF4A 3U4WA 2C6KA 1PUEE 2HFHA 3A4PA 4R79A 2JLDA 4EHEA 2YA9A 4NM0A 4C38A 3C13A 4ZJVA 3E7OA 3V8WA 4PWNA 2O3FA 4CO8A 1UFMA 4U44A 1YW9A 3V6SA 2R3HA 2PWLA 4BZOA 4IVCA 4QO9A 3Q2MA 2CCHA 5K0KA 4QYFA 5E8XA 4IIRA 3G33A 1CDKA 4O82A 4FTJA 3JW4A 4GUBA 2H6BA 1OL6A 2QYOA 5E8VA 2H6DA 3TZ7A 5L3FA 3ET7A 4YGAA 2CLXA 4U5JA 2WQEA 4L8MA 4Q9SA 1YHWA 2NYXA 4QRCA 4HW0A 3VS0A 1QPMA 4MWHA 5L3GA 2BKZA 2BPMA 2FRHA 3UPZA 1KA8A 4ZZMA 2F5EA 3L9NA 5TO8A 2VT2A 4JR7A 1ZZLA 3UE4A 4G6NA 3HECA 4E26A 3KA0A 1J2XA 4RGUA 4FIEA 2VOPA 4ZH4F 2YITA 3OV8A 3WGIA 4BHNA 1Q24A 4QT1A 2OO8X 1K2PA 3Q3BA 3SHEA 3C7JA 3WF8A 5HNIX 4RT7A 4BBEA 4I5CA 2G01A 4HVHA 3FZPA 3COKA 3CTJA 3L00A 4A4XA 4AOJA 4F9WA 3NGAA 1OVEA 2FE3A 3QD2B 1ZH5A 4R7HA 2OW3A 5EHLA 3V4GA 5JFXA 4U97A 4OINF 2P8TA 1O3RA 2VWWA 4RGRA 2QOOA 5IT3A 1CM8A 4L67A 3ORIA 2G2IA 3EYYA 3HVCA 2EXEA 4UWYA 2C5XA 3QQJA 2BDJA 1PXLA 4BY9E 3UO5A 3DNEA 3UOHA 5E1XA 4XLNF 4CCBA 4CQGA 2PMNX 1YDTE 4CT2A 4LV8A 5IH6A 1W98A 4IMYA 2C0OA 4CXFA 5F94A 1GIJA 4OIOF 3R61A 1FVTA 5ITAA 2YLFA 5E1WA 5FGMA 5K5QA 2X1NA 3BE2A 4DEAA 1EH7A 2QOKA 2WKMA 3MQ0A 2P0CA 1YLFA 2PPQA 1Y91A 3U6IA 3HA6A 2C0IA 1WAKA 1H07A 3ERKA 1ZN2A 1UHMA 3R00A 4EBWA 3P9CA 3S2PA 4FV3A 4O7SA 5D6FA 1ULYA 4Z3VA 1W7PD 2PE2A 1ZYSA 3R2YA 2JDVA 4M3QA 2Z60A 3PJ3A 3GP0A 4V04A 3QQFA 3E6BA 4FV9A 3PTGA 5J79A 4IHSA 3LFCA 4H3PA 2CW0F 4FTCA 3W32A 2EXMA 4J8NA 4AT4A 3RZFA 5K5XA 1G3NA 1R5GA 4R8HA 2RDPA 4O7TA 3LXLA 4AOTA 5ICGA 3UMWA 3FMEA 1YXXA 1YI4A 5ICCA 4IRIA 2RFNA 4EJWA 4NTTA 3G3ZA 3W8LA 5J95A 5FLXK 5M09A 4KBCA 2A69F 2XJ2A 1M17A 3IG7A 1UHWA 5E1EA 2JKKA 4F08A 4OBPA 1YYVA 3PSBA 3QUEA 2PMOX 2Y6MA 3S00A 3EKNA 2J0MB 4HZSA 2EFPA 4MBJA 2QO9A 4BFMA 2PZPA 3E6MA 4L46A 2ITZA 2BTRA 5IMXA 2QENA 2A19B 3DJ6A 2YFXA 3ANQA 1JKTA 5BOXA 5D4RA 3BX5A 5ANOA 2NNWB 2HY81 3ZN0A 2XJ0A 5LQFA 4X6RA 2GNHA 2A61A 2W7XA 4AFEA 3A8XA 5J9YA 4WBBB 3GU8A 5H8EA 1IEPA 4NIFA 3M1SA 3R04A 2BRGA 2BMCA 3RAWA 4FF8A 5LGNA 2Y8OA 1SD6A 4IWDA 3FDNA 1Q8YA 2YSRA 5E91A 1JLUE 5A6NA 4EJVA 4BL1A 5H6QA 4LLGF 1ZLJA 4O91A 4WCGA 3BJOA 1I27A 4YJNA 4IVAA 3DT1A 3JR1A 4X6QC 3I5NA 1O9UA 1OI9A 3MDYA 3K9TA 3DOGA 4F64A 2WMWA 3LFDA 4AS0A 1ZREA 4AD9A 3ZMSA 3WE4A 3H0ZA 3GQIA 1ZAOA 4R1YA 1PXNA 5F1ZA 3IPHA 4HVSA 1QMZA 3FSFA 3UG2A 5HU9A 2ONLC 2W1HA 4A9YA 4DA5A 4OIRF 4DH1A 5EYMA 4YIFA 3FZOA 3VF9A 5KHWA 1FP2A 2QOBA 3FZSA 4LRJA 4K6ZA 2OF4A 5L6OA 5KZIA 3RKBA 1BYGA 2IA0A 4P4CA 4Y13A 3CCNA 2HTJA 4LLNA 5JK3A 5A9UA 1LEBA 4MVFA 3D7TB 2WO6A 3BV2A 4XRLA 4DT9A 1DM2A 2ETMA 1U54A 3VFZA 3OUKA 4YPSA 4D4RA 3RAIA 2JAVA 3HLLA 4P96A 3ECHA 3DBQA 2JIIA 3TNQB 4F9BA 5EW9A 2W9ZB 3FQSA 3RALA 2BEOA 5EK7A 1LUFA 3P9KA 5DWRA 4O0UA 3HEGA 4ZZNA 2FSLX 5DUKA 2RC4A 4HYUA 1ZGJA 1GXPA 4IM2A 3GVUA 4GW8A 4IX3A 4M74A 3DJ7A 4G6QA 1OZ1A 3NRMA 4CMUA 2UXXA 2PEXA 3FMSA 3VS2A 4S34A 3DTWA 3R7VA 2GS6A 5KE0A 2B7AA 4ACGA 4X3FB 1R7JA 4O7ZA 4CFMA 4DCAA 2WQNA 4BF2A 3PYYA 4MNEB 2V55A 1OBDA 4W4YA 1BI7A 2NAZA 3OWKA 5EFQA 3HP2A 3QC9A 1YOJA 3CR0A 1Z7UA 5DYJA 3F5PA 4O0YA 4C4JA 4ENKA 1O7FA 5HX6A 4W8EA 5EI6A 4RX7A 2P4IA 4AWIA 1KQ8A 1DAYA 3NAYA 2IA1A 3ROCA 3PLSA 4NM5A 3U4UA 4ZYGA 4LGHA 4FEQA 4PUZA 4XUFA 1RE8A 3O7LD 4X3FC 3UIXA 2YIWA 4ESFA 4B4LA 5CU2A 2C3LA 4QPMA 2FNAA 1GHCA 4RPVA 1G5SA 4BB4A 5M4IA 4CG9A 4LLLA 3QGWA 4K2EA 3IO7A 4XSZF 4ENMA 4AE6A 2DK5A 3ALNA 5LBQA 2IJMA 4HLYA 1ZRCA 4LFUA 5CEQA 2OH4A 2Z8CA 3PUPA 3D5WA 4M84A 3I5UA 4HDVA 1YXUA 3PVWA 3HOTA 3MAJA 4W4WA 2GAUA 1JSTA 5HDGA 2PZIA 1ON1A 1J75A 4U0IA 2BYVE 1IRGA 2G7HA 4H1JA 1YTYA 3Q9VA 1OIRA 2HYYA 4C2WA 3G0FA 1Z91A 4WIHA 4QTBA 2MH2A 3W2RA 2BZJA 2OIQA 3UVRA 3D5VA 2ZM1A 1OPCA 4XG4A 3I0OA 5E8SA 2CKOA 5IUGA 1XSDA 2R3RA 5AX9A 5FLXZ 3DKFA 5CX9A 4GKIA 3TUCA 4TYIA 3P9IA 2W85A 3WF7A 2OXYA 1R22A 5BYZA 3SV0A 4AGCA 4YLLA 2RL5A 3FXZA 5HVQC 2Y48A 4A6EA 2PE1A 4EQQA 2LSOA 2AYPA 5HTBA 4R5SA 2PJPA 2QU6A 5KNJA 3MPAA 4IAFA 1FZPB 4QMYA 4EHZA 4I4EA 3GYHX 2J9MA 5FEDA 2VO7A 3CO6C 3AT3A 3VQHA 4G3FA 4MEDA 4XBFA 3VC4A 2OLCA 1O7LA 4BWKA 2RIOA 5FEQA 3I1AA 3LCSA 3SQNA 4IVNA 3K2LA 4JRVA 2J5OA 5HG9A 3IONA 4E5AX 3ROUA 2F2CB 3EDPA 4EQMA 2W4OA 1A06A 2XNOA 3QHWA 2WD1A 2ESHA 2L02A 3F2AA 2EB2A 5KKRC 4DFLA 4H1MA 4AGWA 3EOCA 4DH5A 4QTDA 2XK8A 4DH7A 1I1SA 1ZLKA 1Z05A 2DK8A 2R0UA 2Y0AA 2PU8A 5FUTA 1BLXA 3FL4A 3V8TA 2OZOA 4IFGA 2B9IA 2EU9A 1LP4A 3R2BA 5H6RA 3UNKA 3F3XA 3QCQA 3CGOA 3WE2A 3ZMMA 3HHHA 2CWEA 4QD6A 4IDVA 4OLIA 2DBBA 3ORNA 1PYEA 3D5XA 4DTKA 4JNWA 5E8ZA 3CY3A 5LGTA 2YDIA 4NKAA 2XKFA 3DXPA 3ZFXA 3ZRLA 2XNMA 1YO5C 3VODA 2QI8A 4U42A 2F5FA 1WZYA 3TEIA 4EJ7A 1D3YA 3P7AA 1M14A 2OF2A 2PMUA 4L9NA 4YSMA 3LQ5A 4O7NA 1IN8A 3N4MA 1PXMA 3OW3A 4JBPA 3QQLA 3RNYA 5IQEA 1D5VA 2FOKA 3ZM4A 3AGLA 4BCIA 5BYYA 1RJBA 4B8MA 2OH0E 4ZTLA 3KXGA 4LGWA 3L9PA 3QX4A 2AUHA 4BCKA 1O6LA 3FMLA 3G9NA 3FI4A 4LUDA 5LMKA 1IXCA 3FPMA 4G17A 5IKWA 4YBKA 3ZUUA 1VR2A 2E7XA 4O0TA 3RWPA 4EOOA 4MQVA 4XCUA 2RVCA 3RP9A 1L0OC 2QLQA 4L5IA 2BAKA 1FT9A 2YWPA 3EZRA 5HLIA 3C4XA 2O0UA 2VUWA 5DRDA 1Y0UA 4ZTNA 3OT3A 4DC2A 1U4DA 4WT6A 4RBLA 2UV2A 2IW8A 4EZ7A 3AXWA 3JVRA 3PIYA 1L3RE 2W1CA 4EYMA 2YERA 4XOYA 2GTNA 5AX3A 4WBOA 3KRWA 3QRFF 5DIAA 4X2NA 4CFNA 5ANGA 5AP7A 2NS0A 5KK1A 3QU0A 1IA8A 3O96A 3C4WA 4JX3A 3OROA 3TJCA 5FRIA 2BZHB 3FLQA 3HRSA 4ON0A 4XX9A 2R3IA 2WZJA 4IXPA 2ZM4A 1OUYA 1FC3A 3RHKA 4II5A 2V1DA 5CI7A 2XROA 2AXLA 3Q2JA 4AOIA 4DEDA 3F66A 2R3FA 3PPKA 3OMVA 3MH2A 1STZA 4KN4X 4RZVA 4C4FA 3ZSGA 3S4QA 2QM3A 4XRJA 1J91A 3ZLXA 3C51A 4M6XA 3R7GA 1ZYLA 5IU2A 1R58A 2YJSA 2KULA 1RUNA 4YPDA 2B55A 5JSMA 2I0EA 4GK4A 4WSQA 5IQDA 3BHVA 1K7AA 4IZ5A 4ACCA 2FEZA 3JPVA 3GB2A 5J5TA 3BGPA 4GT5A 1KU2A 5F1RA 5AAFA 5L8JA 2PVFA 2C30A 1IUYA 1J59A 5D8LB 4WO5A 3WIGA 2QVOA 3RK9A 1J7LA 4Y15A 3C1XA 5E1SA 3KF4A 4FEUA 4RQVA 2XBAA 4EI4A 1RW8A 5LMBA 3ZMTA 4DTAA 1BKXA 2R2PA 3FMJA 4N70A 2DLLA 4A07A 4ZY5A 4GIIA 4MD8E 1JSUA 2HKXA 4GT4A 4RB2C 4AZWA 3S1HA 3SQQA 2LGCA 3DAEA 1OPJA 2O0YA 1Q5KA 4CFWA 2WAJA 1ZMWA 4YZ9A 2P2IA 5BMSA 3HL7A 4O27B 4YHTA 1GJOA 2JSCA 4RAYA 2UW8A 3VOEA 3I4BA 2JTVA 1JHFA 2YJRA 4IHPA 5AUUA 2X39A 3OFMA 5DFPA 3QQGA 3B2TA 2EB7A 2UZLA 5EQYA 4HYHA 2XMYA 2XP2A 3VUHA 1JE8A 2DQ7X 3PP0A 3ZC5A 3CTQA 3QQHA 2VTPA 5CXHA 1T6SA 1S7OA 4M69B 2H96A 2R3KA 3SLSA 4Y83A 4BQAA 3VBYA 3GXLA 3EUHA 4UVCA 3VF8A 5HLPA 2UVZA 4MYGA 4ZZDA 4I01A 4FKIA 3BBWA 3JS2A 2JGZA 3RPOA 1FSHA 3OT8A 3EB0A 3E5AA 4PGHA 3TKHA 5FDPA 3O2PE 4E73A 5HBJA 3QKKA 4UXQA 2M30A 1BC8C 2GQSA 3HYIA 3KULA 4MTEA 2JEDA 3VHKA 5E92A 3O8TA 5DD4A 3TDZC 4C58A 1Q3WA 4ANNA 4CTBA 5IISA 5DR9A 3EJ1A 2QUFA 4XH6A 5JRSA 1T39A 5E18F 4B8LA 4AA0A 2QR7A 2CCIA 3L9MA 2JT1A 4ZS4A 4BIDA 1P6RA 3LFBA 5AP6A 1KE7A 5CVUA 2IRFG 3NYVA 3BV3A 2DI3A 2RGPA 1CMKE 3G6GA 2VAGA 2BR1A 4FKSA 4L5JA 4NW5A 2XZSA 3U9NA 2QOIA 4GVAA 4JQ7A 2CGUA 3RIRA 3R4KA 4J98A 3BWGA 2VTMA 3O3KA 2UW7A 5L2TA 1XDSA 3ZFMA 4Y72A 4PTGA 3LPBA 4BCNA 5K3YA 4ZMEA 1D8JA 4FEXA 1YVJA 3EYHA 2J0KA 1KQ0A 3FXQA 2UZOA 4EOIA 3H9OA 4Q5HA 2HWPA 5HS9A 3W16A 2QZ8A 3BLRA 4FUYA 3T8OA 2OD5A 3DZOA 3DKCA 5CEKA 5EKNA 5CSHA 1T0FA 4GL9A 2NNYA 1YOLA 3NVKI 3BGQA 2OAZA 1M7NA 1PXPA 4UX9A 5LEKA 2F49A 2WOTA 5FG8A 4NTSA 4IPAA 4CVAA 1G3TA 3PG3A 2QOFA 2LAVA 3AC5A 2OJJA 5IDNA 2FMYA 3QCSA 3H10A 4AUAA 1I6XA 3U9GA 4RRVA 4ENYA 5ICFA 4AQCA 3OCSA 2PVRA 3R9DA 1MD0A 1SVEA 3FXXA 5DT3A 1B9NA 2OQRA 3KMMA 4HGTA 4AZSA 4OTFA 3GC9A 1TTYA 2F4JA 4LL0A 5CZHA 5D5XB 3ORTA 1H0MA 4M9XA 1XWSA 1JOWB 3QAME 2PMHA 4AGUA 3GCSA 4EKKA 5GIPE 2BRBA 4ZJJA 5EI2A 4RJ7A 2X9EA 1R36A 2XIXA 4RX5A 3PP1A 4ZZLA 4OU0A 1OGUA 1I09A 4C3PA 3ISPA 5HNGA 5LJJA 1YOMA 3MH3A 3ZLSA 1OYYA 5HLHA 3MFRA 4JDKA 3DBFA 5TE0A 1PHKA 4WXDA 2F9GA 2W17A 4AU8A 4OOIA 3MY5A 4ALWA 1PYXA 3M7GA 1K78B 2HOGA 5I9WA 2EFWA 2X0LA 3R28A 4KKHA 5IF1A 4RLLA 1H0WA 4IFCA 4YP8A 3VBWA 2FXAA 5DT4A 2IZRA 3EKKA 3GC7A 1QCFA 3K5VA 2R7DA 2CDZA 1J5YA 2V79A 2HW6A 3ZYAA 5FD6A 2P5VA 5CS6A 4GSBA 1XJDA 4AT3A 3RBWA 1MRUA 5KBQA 3FZTA 4FSZA 4XLVA 3R6SA 3C18A 3V7CA 4WNMA 4ANBA 4AWXB 3SG9A 5KKRB 3EYIA 4NFMA 3QD3A 5DDGA 3GQLA 2KKOA 4UV0A 1WVYA 4MD7E 4DAWA 3OZ6A 5JRQA 1H9GA 5LMKC 3JTHA 2Z2WA 3WZEA 4IX5A 5L3CA 2XB7A 4HV6A 4C8BA 3V5TA 3PXQA 2Q2EA 2XS0A 1DI8A 1H1PA 5M4UA 3E6DA 5IA3A 1BMKA 2YIQA 4FNXA 3LCDA 4RJ3A 3EETA 5AV3A 4YSJA 4ASDA 4BYJA 5HLWA 2BHHA 4HLXA 2W5HA 3SW4A 4FSMA 2O64A 2P5KA 4FG8A 3Q4ZA 4K9YA 4FNZA 1J0RA 4LG0B 1OKWA 3KRRA 4I6BA 3QD0A 1T38A 3OP5A 3IWFA 2VTLA 5AONA 4M7IA 2JDTA 1OKRA 3CPBA 3C3WA 4LK1F 4JJRA 3MY0A 1OYWA 3HDMA 3NDMA 4U6RA 5CU6A 3R7EA 1Y6BA 3V7SA 4OR5A 5AFVA 2WTKB 4MQ2A 3LAPA 2Z9OA 2Y9QA 3O17A 3G15A 3V01A 4P55A 3MA3A 4WF2A 1ZYDA 3DQWA 5AP0A 3IDPA 1QL6A 2M87A 4QMNA 1FVRA 2DYLA 4OAVB 2HKOA 4MQ1A 4YJUA 4MXXA 2QLZA 2YM6A 1YQJA 3RPUA 3MBLA 1TQIA 4KYWA 3TV7A 1QPJA 1G8AA 1P14A 2PLYA 5DN3A 1Q8UA 3REOA 5CF5A 2C1BA 5K4IA 1X3UA 3D2IA 4HX4A 2HCKA 2XNNA 1JHHA 1WBPA 5I9VA 3PIZA 4NM7A 4XP2A 2O8YA 4I23A 3TWJA 2W99B 2L01A 4NUSA 3E93A 5DEQA 4EK8A 2ZYBA 3MPMA 4O6EA 5AR7A 2V0DA 1FYKA 4NQWA 3MIYA 3FLSA 4C4HA 2VX3A 2V1UA 5F64A 5L3DA 2R7BA 4UV9A 2ZXJA 4K18A 5I0BA 2J5FA 5CXZA 5M56A 3UGCA 4D4YA 5J5SA 2VNWA 3B8QA 2WXVA 3F8FA 4IHTA 1ZMVA 4TYJA 3U1DA 4FT0A 1XDUA 1U5TB 4EK6A 3DV8A 2FF4A 4AW1A 4BBFA 4X3JA 3CEKA 3GF2A 2CG4A 1V0OA 4KWPA 3TDVA 4B8XA 1O3TA 2ZMDA 5CNOA 1F9NA 3EN5A 3MCZA 4PL3A 1YI3A 3UOLA 3NYNA 4EV0A 1S6LA 3GCPA 4YR8A 1QGPA 1MRYA 2CKEA 1KE8A 4BWXA 4YTIA 3OC1A 2ZB0A 4A9SA 3L9FA 5DCMA 4M13A 4XS2A 2R3QA 4JIKA 4LRMA 3TQNA 2GDOA 3BGZA 4DEBA 2PVKA 4L52A 5GIOE 2ZCWA 4E4MA 2HXQA 3JTGA 4Y5HA 4RJ5A 3MFSA 4GIHA 1SD7A 3E8NA 3OWPA 3GI3A 3DS6A 1YRPA 4M14A 3UP7A 4PNIA 2WHBA 3WYXA 3JSPA 4FX0A 5DI1A 3KGAA 3UTOA 3FY2A 3U2RA 3VUGA 4GXOA 5DHJA 5IMEA 3KKVA 2R7FA 2XKDA 4F6SA 2ZBKA 2VC1A 3MWUA 4OAUC 1UNGA 2VTNA 1APME 1FPQA 5L6WL 3KMUA 1V1KA 4YNOA 2OZ6A 3A7HA 3H3CA 3OY1A 5D12A 4F6WA 4U80A 1RNLA 4ACHA 3DV3A 5K1YA 3UP2A 3K1NA 3EL7A 3VUKA 3SHFA 3SXFA 3AGMA 1J9IA 2B9HA 3MVLA 4AZFA 2X4ZA 2ESNA 2VNYA 3MTFA 3WYYA 2FVDA 3GU4A 5A46A 5IT9K 3QAHA 1KYZA 2E9PA 5B2KA 4HPUE 3CXWA 4M9ZA 3V8SA 4RS8A 3JXWA 4ETSA 3KP3A 5E8UA 3V5JA 4B99A 2ITWA 4M0ZA 4WG4A 4D0PA 4QP9A 2UZBA 4BDKA 3SA0A 4KIGA 4IANA 4M9SA 1OL7A 4LFIA 3WZDA 2XH5A 4ZTSA 3FZRA 2A4LA 1XH9A 4YZCA 3H3ZA 3NMUF 3BP8A 4CEGA 5L6PA 3M2WA 4AW5A 3IHUA 2I7QA 4DG2E 4GFGA 1XBAA 3EIDA 3NEWA 3PJ8A 2ITUA 2W1DA 2WMVA 3DB6A 4GG7A 5D6EA 3TNPC 3TTIA 5IA1A 2J6MA 2VN2A 2XRNA 3SZPA 2IW5A 2WTDA 2ITXA 3E63A 4G16A 2YPRA 4FT9A 3GXOA 4GEOA 3LMGA 4WXHA 2GHGA 5D4SA 3E64A 4NW6A 2BCJA 4KNBA 1S9JA 4OTWA 5C8NA 1K3AA 3IDCA 4F6UA 2F5DA 4RMZA 4ITIA 1OKZA 4EM1A 3R1NA 4YG2F 3ZS5A 4UALA 4I4FA 2VTIA 2KJBA 2BIYA 1MKMA 3HUCA 4A4LA 4HPTE 5CTPA 4G9RA 4X2GA 4GYIA 3COIA 4CFUA 2CHLA 3L2CA 3R7OA 2V7AA 4RQKA 2QBYB 3FHZA 2W5AA 3MZHA 1B6AA 4Y95A 1XKKA 3PA5A 4D4VA 2WPAA 5FD5A 4BDJA 4TYHB 3VW6A 3QA0A 4CZYB 3N4UA 2V22A 3LQ8A 4TWOA 5EI8A 4QQJA 5HCZA 3IW5A 2EFNA 3MWMA 4M8TA 5CQUA 3Q6UA 3S3IA 4EOJA 1CF7A 3WTXC 2WIHA 1W7HA 1UU3A 4FT7A 1H25A 2WEVA 3LCOA 5D5WB 1HW5A 1OYIA 3MGYA 2KTYA 3FYJX 3R1QA 3K3JA 3OCBA 3CUQA 3SXRA 4AZTA 4BCHA 4LYNA 2UW6A 2ETHA 3NAXA 3U54A 5CVVA 4ZTMA 2X8IA 3BIZA 3Q60A 2X7GA 1JBPE 2W57A 3FYKX 4R78A 4LOQA 5AV2A 1BI0A 5G1XA 3QTRA 3NUSA 5E20A 2B4SB 4IB5A 4AP7A 4G34A 3Q52A 1XSXA 2CKPA 4HCUA 2YZLA 5D8KB 3S2WA 4HQEA 3REPA 2L3DA 4IZ7A 4YURA 5J8CA 3PZEA 4E1ZA 2BUJA 4OT5A 5I9UA 4CFFA 4DE4A 2PVJA 5BNJA 4MXAA 2PUPA 2VU3A 3IS5A 3IKTA 2WMRA 3WTSC 4QNAA 4I0AA 4MKCA 3AC1A 4M73A 4RG0A 4AN2A 2OFVA 4HNFA 2C6OA 4ZTQA 3K2ZA 2RG5A 3WE3A 4FIIA 2XIYA 4F1OA 4JVGA 5AV1A 5IEXA 2BIKB 3HTUA 4CYJA 5DR2A 1HW1A 4NJDA 4YJPA 3SRVB 3UPXA 5FDXA 1EH8A 2K02A 5FBNC 4QP7A 4B09A 3RWQA 5LVOA 5EM6A 4TWCA 2JBOA 4NYEA 3QLGA 4D0WA 2EWNA 4EHVA 5I9ZA 3ZQ7A 2W84A 3HV4A 4AE9A 1TKIA 1FNNA 2H8HA 4USFA 5HKMA 4BR3A 4MD9E 4BRXA 3VHEA 4C61A 2X6DA 3OEFX 1ZRDA 4PZJA 4APCA 3E87A 4XBUA 3R8LA 3F8CA 4HX8A 3QFVA 3FY0A 5KMMA 5HO6A 3TV6A 3HRBA 4A9UA 1M7QA 3V5LA 3H0YA 5AP1A 3D83A 4GFMA 2IZSA 5FXSA 4YBJA 1Y8YA 3NR9A 5F95A 4GVJA 2SRCA 5LXMA 2HZTA 5CVGA 3PY0A 2GQQA 1P4OA 3ZP5A 5K9IA 2OIBA 3K54A 5HO8A 2C69A 2C68A 1JVPP 1B39A 1E2XA 3LCTA 4DF3A 4BGQA 4YZBA 2JPCA 3GC8A 1ZY5A 4KICA 3F3WA 3DBCA 3WGHA 3OD6X 2WMTA 2CN8A 4QWQA 4G3CA 1KOAA 5ANEA 5KBRA 3Q5IA 3QTIA 1WVWA 5HO7A 4U81A 2Z99A 1U46A 4KNYA 1H1RA 3HGKA 1B6CB 4ENNA 4P9FA 3ROYA 3V5WA 4Q9ZA 3OTUA 5AIQA 3F5UA 4P7EA 3W55A 4FX3A 1FGIA 3B8RA 4ZSEA 4FSWA 2CGWA 3FF5A 2K7LA 5TKDA 2BDFA 3ZDUA 3NNVA 3M8EA 4BYYA 4Y17A 4HW7A 4PTCA 3P79A 4HJOA 4UNOA 1H24A 3NUPA 2C6TA 4OTDA 4MGRA 1ZHFA 2XM8A 2A2AA 1Z6TA 4EYJA 4ZLYA 1DI9A 3OOMA 3F6XA 3MESA 3V8KA 2V62A 3EQGA 4B6LA 5A2QK 1YDRE 1XH7A 2Y4IB 1E9HA 1QZYA 3KY2A 2UVYA 4F1MA 4E6CA 4BI2A 3W1FA 2IPXA 4H39A 3Q4TA 3ZO4A 3D0EA 3EQBA 2KIMA 2PI0A 4FKUA 4DEHA 4XLIA 5AR3A 4ZXTA 5HZNA 1KGSA 4BHZA 4U7DA 3BYOA 2JFMA 4FTAA 4ITJA 1V3FA 1O3SA 4IJPA 5HEZA 3E6CC 5ILSA 3KLNA 2Y6OA 5JGBA 4CG8A 3FMNA 2B0QA 1UNHA 3TKUA 4ORKA 4ZK5A 3CJGA 3DQXA 3VQUA 5LLQA 1LDKB 1IAHA 5BX0A 4C62A 2ETKA 3NCZA 4O86A 1MJAA 4PNKA 4DGGA 3DKWA 5M51A 3NUUA 4B9DA 1W5SA 2C0TA 4KRDA 3VS6A 3NPCA 1SMHA 4HX7A 5DA3A 2Z7RA 5CALA 3I0TA 3BROA 4RIXA 5DBXA 5DE2A 3QP6A 1W7PA 5ILUA 3VIDA 5J7HA 3W10A 2ADUA 3GCQA 1UV5A 3LLTA 3FM3A 1XH4A 1IRFA 3COAC 1PMEA 5L8KA 2PUUA 3KN6A 5D11A 2QWWA 3GX4X 3FSKA 2VE8A 2GS2A 2IG7A 1H1QA 1STCE 5AR8A 4IM3A 1J1CA 4GYGA 5L2QA 4ASZA 2XNGA 4U7ZA 1SD5A 3KP5A 4IX4A 2QOHA 1T98A 1G8SA 3TL8A 3GFEA 4H05A 2O03A 1J7UA 2GIVA 3UIBA 2XVCA 2VTHA 1KE6A 5BMZA 3I79A 2D1HA 2FH9A 3RJPA 3ZMVA 4V0GA 1T45A 3TCPA 4UY9A 3O8UA 4RSSA 4ZJIA 3E88A 4FTIA 5BQTA 4Z7GA 4ZOGA 2BAJA 4MK0A 5F9EA 3PG1A 4D1ZA 4Q5EA 3KCCA 3HMOA 2WTCA 4AW0A 4LD5A 4O0WA 5FB2A 4K33A 3TGNA 3VS4A 2WB8A 1H01A 4B0GA 5JMSA 4NHJA 2DPDA 3VRYA 3F3ZA 3L8VA 2NRYA 3TDWA 2R3SA 4S30A 4DLIA 2EFOA 2ZOQA 2JAMA 3GZ6A 3C7QA 4CGAA 4FZ7A 3DAKA 3G5DA 1BN5A 3CD3A 2OZAB 3GU6A 1VTNC 1P4FA 4DFXE 2HQNA 5ANDA 3TM0A 4BTJA 5GZ9A 4WXCA 3TJDA 3TNHA 1Q1HA 4I0SA 1YHVA 1D8KA 4LMNA 3R8ZA 1K79A 2XAHA 1YWVA 4AZVA 4BKZA 4U0YA 2O8XA 2R3OA 4V01A 3LMHA 2FBHA 4I3ZA 2PSQA 1W4MA 4UVAA 2DU9A 1USSA 4CLJA 2XYUA 4I0TA 3BWJA 1AOYA 1CKIA 4UYAA 2STWA 3KEOA 5FXRA 2PL0A 2UUEA 4ZMFA 5EQEA 2P4WA 5EEHA 1BI8A 1WCCA 4YJRA 2GMXA 4PL4A 1Y6AA 1FYLA 3Q4CA 5KO1A 3HUGA 3KP7A 1KUTA 4AZEA 2YDKA 2B54A 1HW2A 3B02A 4U88A 3BRBA 1XH8A 3PVBA 3CLYA 5CAPA 3FC2A 5ANJA 1YW7A 1HKTA 3IECA 2Z33A 4FV1A 3QTWA 2WMQA 1P2FA 3WF6A 3J7AO 3VS3A 3P7BA 1YI6A 4FZAB 2GA1A 3QC4A 4CHUA 3LXNA 5FFZA 4CRLA 3H92A 2VO3A 3BEAA 4S32A 2XKEA 3GW2A 2BVAA 3U6JA 1R1UA 5CVFA 3M1EA 3RM7A 4WG5A 5CVHA 2Q0BA 3S95A 3ORXA 3CUQC 3F8MA 4DTBA 5EOBA 4L3LA 4FV8A 4Z55A 3KF7A 3P7NA 3ML6A 3DPKA 4GJ3A 2ZMCA 4O0RA 1TNSA 2OI4X 4WUNA 3V8LA 2F2EA 2FB8A 2ITQA 5A14A 3R7IA 4AAAA 2P7CB 2EA2A 5BMMA 3IDBA 4F0IA 3WU1B 1OIQA 1WMKA 4APPA 2QQBA 4O3MA 3K1MA 4KABA 3KXXA 1PXKA 1GOLA 4USDA 3ITZA 2DO7A 4G7OF 3V5QA 2QKWB 1YWNA 4S33A 3HRTA 3QTSA 3FMKA 3PE2A 1OIUA 5HIBA 3H3UA 3EQFA 5M4CA 3CQUA 1HBXG 5C8KA 3ZUVA 3R30A 1VZOA 5HD4A 1KQ9A 2HXLA 3MS9A 4HGSA 3QYZA 1QZZA 4FKJA 3A7FA 5JT2A 3SC1A 2YLEA 3ZLWA 3E3VA 5FP5A 1YXSA 5JVTA 1YQAA 1F4KA 2X2LA 3FI3A 3GFLA 3RVGA 2PY3A 3DFAA 4DLJA 3AD6A 1ND4A 5JGAA 4UYNA 1AWCA 5LRRA 2QU5A 3AT2A 5IH4A 2ACXA 2Z7LA 2RN7A 4LV5A 3QALE 2HOEA 2HELA 5IH5A 1IXSB 3IK3A 4BGGA 1OL5A 4BDFA 4QYHA 2PN6A 3RPRA 4I6QA 3JVSA 4O2PA 3QQKA 4U9AA 2EB3A 1FSEA 1U6GA 3TO6A 3QXOA 1SVGA 2YACA 1OITA 5AV4A 4A2UA 5E8TA 3BWFA 1PW2A 1FWZA 2P7VB 5DMZA 1IRKA 5KMKA 3F9NA 1XGNA 3C1DA 3NLBA 2IZTA 5TT7A 3LWFA 4BCJA 4LI5A 4FYOA 1SAXA 2XJ1A 3U6HA 3KK8A 3L7WA 1IASA 1Q99A 4FVPA 2J2IB 1FMKA 2XNPA 4XV2A 4AVPA 4LB5A 5EYKA 2YABA 4FKRA 3R73A 1ZOEA 4F9YA 4HZRA 2J5EA 4U7BA 2L4AA 3C0HA 4AA5A 5CAOA 2VXZA 3ORPA 1UKHA 3C4FA 2V7OA 2JPBA 4Z9LA 3R1YA 5JQ5A 4CXAA 4FVRA 1ONVA 1XH5A 3ZEWA 1JPAA 4G2FA 3Q9XA 3SXSA 1VYZA 4HZFA 3LXPA 5H8GA 2GQGA 2ZM3A 3F3VA 5EOLA 2YHVA 5J6XA 3R8VA 4JX7A 4RIYB 2E1CA 3GUBA 4MWIA 4G6LA 2H34A 4OTHA 3ENHA 1WBTA 4UEUA 2GNIA 3QRTA 5ACKA 2ZVAA 3A99A 3U51A 5H3QA 3TKIA 4EWHA 1NVRA 2RF9A 1FYMA 3LA7A 3R21A 1HCLA 4F70A 5AR5A 4RVTA 3EZVA 5FP6A 1Q61A 4DG0E 4AXAA 2RFEA 3TXOA 4ANMA 1WI9A 2ZFWA 1PP8F 3W18A 5HTCA 2CYYA 3NRVA 2HWOA 5CVIA 4O22A 3BU5A 4W9XA 1REPC 3GUDA 4KA4A 2HEOA 4JXFA 4YTCA 4FTUA 3QL8A 2VODA 3LVPA 4G7HF 4K77A 2VGOA 4JBOA 5KMOA 4O38A 4KDPA 1FMOE 3ACKA 4FEVA 2IVMA 3F88A 5FLFA 5EW3A 3P1AA 2CNVA 3F2RA 4G6DA 4A12A 1W5TA 1EH4A 3SFZA 3WARA 2QG7A 3KP6A 4NT4A 3RI1A 3ULQB 2VO0A 3NZ0A 1J3HA 1R5HA 3KZZA 5BUEA 4TNDA 3FM5A 3BELA 4G3GA 3CDHA 4FSNA 1J7IA 5H2UA 4TTHB 1GAGA 3PVGA 5AP3A 2CQKA 4R77A 1XGOA 2WWYA 4I6FA 3VW8A 3E3BX 2RKHA 2XVDA 3OWLA 4K1BA 3L09A 5D7VA 2OK1A 3DP7A 5J7BA 3MVHA 3NS9A 3UQFA 1ZRZA 4RWLA 1TLHB 4J97A 2VRXA 3CQEA 1LJ9A 4L45A 3EQIA 3HDNA 4G5JA 2VX0A 3Q32A 4LUEA 1R1WA 3LMIA 3UZPA 2STTA 2O61A 3HZTA 4FGBA 1XO2B 5HLNA 2OFUA 3V3VA 2HWVA 1FGKA 4NKSA 4EJTA 2HK5A 4I22A 2XRWA 4DBXA 1WBVA 2A27A 4AACA 2QVSE 5AJQA 1IF1A 3WGGA 3ABTA 2JC6A 2WTKC 4R1VA 1SMYF 2VTJA 2HS5A 5CWZA 5FQDC 4ZIMA 5K5OA 4H3QA 4FNYA 3O50A 4WX9A 4ANQA 4OIPF 4NL0A 1UU9A 1JQHA 2H09A 2BGCA 3WTVC 4FG9A 4FKOA 3WTZA 2GA2A 2ITNA 4L9VA 5A4CA 3CUQB 4FKQA 3UZTA 4NJ3A 5IQIA 3FHIA 5DT0A 4YC8A 2XHKA 2R9SA 4MHAA 4G8XA 1IAJA 2RSVA 1ZY4A 2ZJ2A 5LHGA 5HORA 4MQ9F 4BCMA 2DS1A 3P0MA 4M0YA 3II5A 1UA2A 2O6GE 4XJ0A 2CPKE 2YM4A 4PMMA 2WU6A 3OEZA 4L3JA 4GMYA 5IA5A 4RJ6A 4LOOA 4MHGA 3QTUA 3SVVA 1O57A 2J0LA 4KIOA 1WBOA 3GU7A 3QQUA 2AC3A 4N4SA 3PZHA 4A0YA 4IBMA 2Y4PA 4DFZE 3E7VA 2H27A 4V05A 3J81K 5CAUA 4MCVA 2XIGA 2EV0A 1URWA 5BYLA 2BZIB 2W4JA 4GU6A 3SX9A 5HVJA 4AIKA 2ZV2A 4FT8A 1AGWA 2FNPA 2G2HA 2MLGA 1RIOH 2X7FA 5AAGA 2LDUA 1QNTA 4O7WA 5HNBA 5LMAA 5IQGA 4ESJA 1FPUA 5FTGA 5IZFA 3ZOSA 3E5UA 5L4QA 4FSYA 3VS5A 4TNBA 5D5VB 5JHUA 2EXCX 3HRCA 3D94A 2I6LA 4YHFA 5K4JA 4OTRA 3JAMK 4FZDB 3NW6A 5FTOA 5I3RA 4HQMA 4C34A 2NNNA 4MNUA 3IW4A 4QMXA 2OXDA 1B4AA 1BI3A 3QCYA 1YFHA 4QQCA 4YZMA 3LJ2A 1SNUA 2NO3A 3EQHA 4JL9A 4MXYA 3FQEA 2WTEA 3LLAA 2B0LA 4D58A 1H26A 3EFWA 5LEJA 4RZWA 4G1WA 4CRSA 4EJUA 4AG8A 3NW7A 3ELJA 4BDHA 3EN6A 4RFZA 1OIYA 3UOJA 5GZAA 2YWVA 4BWPA 1HQCA 3D7ZA 4JIAA 4U0VA 5AADA 4TKSA 3TACA 3HMNA 4A5NA 4C36A 1GXQA 2PTKA 3ZM9A 2RKUA 4R3RA 4C0TA 5E9EA 1MJ9A 4M12A 4WHZA 4F65A 2YIRA 2E2BA 2GFCA 4QYEA 3WZKA 3BLHA 3HYHA 5JQ8A 4E3CA 2GFSA 3I60A 3Q96A 4PRJA 5HBHA 4O7LA 4EJNA 1WRJA 3KC3A 2B9JA 3W6JB 5DEWA 2F2UA 3VUMA 4O7RA 5CQWA 1F0QA 5TRDA 3PWDA 3MB6A 2HTSA 3GOKA 4KIPA 2C5OA 4OTPA 4A7CA 3I4PA 4EOSA 3OF0A 2O3PA 3MTLA 2JDSA 3DFGA 4FL1A 2PVMA 4EGYA 1F5QA 5CF8A 4FT5A 4DYMA 5LCJA 3T5XA 5CT7A 4WOVA 4PL5A 3C9WA 2WMUA 2KJCA 2IZUA 2ZNYA 3HSFA 4RGSA 3BYUA 4K8AA 4MXOA 2YCFA 2WTVA 4J7BA 3PA3A 4CFXA 3GWZA 4Q5SF 5EDPA 4OT6A 4ENXA 2K4JA 2WNTA 2HW7A 5JFVA 3IC7A 4D9TA 3QTXA 4D4SA 3ABUA 3QRUA 2K4BA 1IG1A 4P5ZA 3QA8A 3IW8A 2A6EF 2ACJA 5CSWA 5CEIA 4OW8A 2XK4A 4WRGA 3J80Z 4UN0C 3IOKA 1PP7U 3PQKA 1WVXA 4DCEA 3HMIA 3SRVA 2MD5A 4WNPA 1KV2A 4YC6A 3OOGA 3V7RA 3A60A 3F7ZA 2FO0A 2XCKA 1KE9A 1CKJA 2LNBA 4TYEA 3KE2A 2EFQA 3Q4UA 4FTQA 4AW2A 1MZBA 6PAXA 3DQVC 5C26A 1F5TA 4JR3A 3GFIA 3KLOA 2GHLA 1HSTA 4QP3A 2YCQA 2J7TA 4TZRA 1G3WA 1V0PA 3LCKA 1NY3A 1TW3A 3RINA 2VE9A 4J71A 1FOTA 3TTJA 5LWNA 1UB9A 1QPEA 3R8MA 4QMTA 2CMWA 1UWJA 5J87A 4I93A 3ORLA 1KWPA 1U5RA 3C0GA 3LFKA 3QF9A 4BI0A 3HIFA 4N6YA 3FHRA 3WILA 4PP9A 4U0WA 3BY6A 3A2CA 4CD0A 4L42A 1Z57A 4IB0A 4KINA 3W2QA 3SAYA 3R71A 5A3XA 4QP8A 4DH3A 4KRCA 2MA3A 2YIXA 5A54A 1WBWA 3F3TA 3O51A 2W25A 2W1ZA 3DXNA 1RUOA 1YIOA 3LA2A 4EBVA 1H8FA 4UMUA 3RHXA 4CZTA 3DPLC 3OWJA 3H9FA 4OGRA 3UC3A 2QLUA 5IUIA 3BBTB 4H36A 3QTQA 3ATTA 4H0EA 2UVXA 3BJAA 2ITTA 2WV0A 1U2WA 5AM7A 1S9IA 4TRLA 2OWBA 4IC8A 3PPJA 4C02A 4DEIA 3LJ1A 3ZXTA 3BHYA 2BRHA 3T1BA 4F0FA 3D5UA 2GNFA 5L2WA 2E9NA 4FSRA 5EYCA 4ZS0A 1F3MC 2P3GX 3LOKA 4EJOA 3OTVA 4IADA 3WTTC 1DUXC 4BH9A 3P23A 5BUJA 4ZZOA 2A5YB 5IA4A 3AC4A 4HOKA 2XIKA 3G90X 4NM3A 3K3IA 1PXJA 1LR4A 3RPYA 4G5PA 5T3QA 3F6OA 3KEXA 3ZRMA 3RNIA 3IKAA 2XF0A 2H6CA 1BL7A 4L44A 4N0SA 5AA9A 4YHJA 3C0IA 4I98B 4RB3C 3KU2A 4EK5A 4FL2A 3MEXA 1J1BA 4N9IA 4YTFA 2OZUA 4KA3A 3VUTA 1KV1A 4QPAA 3O8PA 4AF3A 1Z9CA 5JFSA 4AGDA 5B7VA 3GNIB 2ERKA 3SDJA 5KUPA 3LAUA 4ZSGA 3NUYA 3HV6A 2VBXA 4R7BA 4ZSLA 1GZ8A 1NW1A 4LM5A 5LVLA 5BVWA 3LFAA 1R3CA 3F82A 2FU4A 1OUKA 2NP8A 2JDRA 4CMTA 3E3PA 4JDHA 3VRZA 1RQQA 2UZDA 5EH0A 5IQAA 4RC4A 2Y4IC 4X2FA 1OKVA 2R5TA 4ZSJA 4IXAA 2PUNA 2KIFA 3UG1A 2OICA 3CE3A 2W1IA 4WK8F 5D10A 4MBIA 4K2RA 3AQVA 2J51A 5D9HA 4JQEA 2JIVA 3LFNA 4CZUA 3RKWA 4U79A 5EDQA 1IA9A 2HENA 4A4OA 4F7SA 3VBQA 5B0XA 5BPYA 4A9RA 5HESA 5GJDA 4FG7A 4NEUA 4K0YA 1R78A 1IAWA 4XEYA 2GQRA 3ZZWA 4D28A 3HHGA 4L9TA 5CSXA 3DTCA 3ZMZA 3UYSA 3JYAA 2G9WA 4KSQA 1XB4A 5GJFA 3RTPA 3MVMA 4X2KA 4ASNA 2ITYA 2QODA 3MFTA 3PXKA 2QHMA 5J1WA 2FYSA 1REJA 3GFWA 5CY3A 4RWJA 3LM5A 2ESMA 3O2MA 4QMVA 5EG3A 3SZTA 3JY9A 4XG3A 2BKKA 4I1ZA 5B2LA 4RAZA 3WZUA 4FSUA 4XG9A 1LDDA 4JAJA 1NT2A 2QNJA 4N6ZA 2V5QA 4Y8DA 2OU2A 4L9IA 4NB5A 2X6EA 3ZTXA 2A6HF 2PBIA 1B9MA 3O23A 1Y57A 5AEPA 3TO9A 2X8EA 2ZB1A 4Q47A 5AP5A 1Q3DA 3HV5A 4YO4A 3FL5A 4DHFA 5AUWA 3ZLYA 5E8YA 4DN5A 1E1XA 3PRIA 3WG9A 5KMNA 3V8JA 3MJ2A 2ZV9A 2PYWA 1UU7A 1W8CA 2R3PA 4YJVA 3AC2A 1XGSA 3WF9A 5AIPA 1Z5MA 4FV6A 4WD5A 2XRUA 2G7UA 4F4PA 3KVWA 4L00A 4KN7X 3VUIA 2W06A 1H9TA 1SM2A 2BROA 4EH9A 3GO5A 4C3FA 4QP6A 5A4QA 3HRUA 4I92A 4TL0A 1Q97A 4QYYA
chains in the Genus database with same CATH superfamily
1ZZ2A 3RMFA 2RV8A 4E6DA 4X0MA 3ZRGA 2W1GA 5AWMA 4LDTA 1MDMA 5GNKA 2AXTC 4XV9A 4CMOA 1I5ZA 4IC7A 3FX3A 5M3MJ 2FGIA 4IEBA 4YU2A 2Z7SA 1K83J 2LG4A 4PK4A 5B66C 2R5YB 3K5UA 5DVRA 4I20A 3TI1A 3HNGA 3QWJA 2BW3B 1B72A 1HC8A 4FTMA 4G9YA 4FV7A 1ETQA 3D5RC 2W1OA 3TUBA 4X7QA 4ANLA 5DGZA 2VV9A 2C5NA 3I7BA 4RJ4A 4Z7HA 3BPRA 1IN6A 3PVUA 2L4MA 5BQ0A 3RYRA 2ZMEB 4HBLA 2ISZA 3GU5A 2VTOA 1QA6A 3ZH8A 4HVGA 5BPDA 2FJ1A 1ON2A 4XMOA 1B59A 2ZFYA 5M07A 3TV4A 2XM9A 1SFUA 4RWKA 5DH3A 2X9DA 5C8MA 1GNGA 3BHHA 4IWOA 2OIDA 1RDQE 2Z16A 2HY0A 4O83A 1WFXA 4YFKF 5I9XA 3C5IA 4ZYEA 3NUAA 3D2KA 2HZ4A 4J8MA 5EHOA 4DEGA 4IQ6A 1XG1A 2P81A 5DRBA 2WELA 5KAFC 4IJ9A 1Q4LA 1UVRA 2O2UA 1T2KA 4E5BA 3KREA 2FUG2 1ERKA 5LHIA 2YZAA 3G73A 3FXWA 1Q8ZA 2I40A 4M66A 2M1BA 4BXUA 4QOXA 4GCJA 1MGTA 2XF6A 4IZYA 2GHMA 4BU2A 1WI3A 3EQPA 2CSNA 3DAJA 3W2VA 3ZC6A 3OCTA 2IP2A 4HF2A 4XOZA 3FXKA 4UB6C 2ZKZA 2CQ7A 4A0ZA 4DYCA 5E1ZB 3TIZA 1P4XA 4FKGA 2COMA 4R3PA 3DPTA 4LL5A 4F7LA 2Z02A 2ZO4A 2JKQA 3UDSA 3EN4A 2DW4A 1ZG3A 1M52A 2EA4A 3CPCA 3O71A 3PRFA 4RX9A 2Y0SN 4QMWA 2QONA 4ZYDA 1WBSA 5AUYA 5FLMJ 1MDMB 1H0VA 1FY7A 5M55A 2REIA 3CCSI 1UAAA 3G51A 4B7TA 3FE3A 1GT0C 5E8IA 2WQOA 3ZFYA 4FZ6A 2JKOA 2YU9J 4NCTA 2XK6A 3TKYA 3KVXA 2F5VA 3V04A 4EOLA 3Q04A 1EH6A 4L68A 1RKTA 1XBBA 2WC2A 1JSVA 1S29A 3BJ6A 1VQMI 4BHCA 1NXKA 2GWRA 3MYGA 3JRFA 3R7UA 1SYKA 5IEVA 4FTTA 1MMAA 4X2JA 4C4GA 4HGLA 2GXBA 4FGRA 1SFXA 2OF7A 3GGFA 3ZHPC 4QP1A 2JA6J 2ETRA 3M42A 5M57A 2K27A 4IW0A 2X0OA 4J01A 3K4NA 4CV9A 2QQ9A 3QRJA 2CQXA 1OR7C 4UWBA 3S1NJ 1DDNA 1HOWA 3KXMA 3KL8A 1VQLI 1MRVA 3HKZN 3KMWA 1VNDA 4CNHA 3CQWA 3BPXA 3ECOA 4NIFB 4EH8A 3MVJA 4X3FA 4JAIA 1BI1A 3DK6A 3GENA 2JFLA 3COHA 1T46A 4QMLA 3OXZA 5D41A 2FA5A 2HZNA 1R0PA 3BL7A 4QP4A 4NWMA 4O5VA 4C7TA 3R83A 4KB8A 4KT5C 1VQNI 2RGVA 4FMQA 3POZA 3CKWA 2XAGA 2QKRA 5A4LA 2IW6A 1FJLA 4IOCF 3EQRA 2HQRA 3J81Z 3LQ3A 4M68A 5CASA 1OECA 4UXLA 2F57A 1V5FA 1A5JA 3F69A 5HD7A 3DZQA 3KCKA 2PVHA 3WU0A 2QSGX 4F1TA 3MI9A 1O4XA 1G8KA 4W4VA 2X9FA 4YO6A 4J00A 3RAKA 1K78A 4ARKA 2XK9A 3P78A 4IB3A 3FJQE 3N51A 3EPZA 2NVXJ 4CYIA 4BC6A 1R4MB 4EORA 2F5CA 3I71A 3NVMB 3I59B 4XLCA 1X1AA 1T8IA 5EM5A 2J50A 3OG7A 5M5YJ 3JRAA 5EW8A 3AC8A 5HE0A 5E79C 2BZKB 1SMTA 2KZVA 4NU1A 5HDKA 1P4AA 3DDQA 4JDJA 3A7IA 1Q8TA 3ULIA 5JZJA 2R92J 3R9NA 1U78A 3IH2A 4D2SA 3VNTA 2DFIA 3UO6A 3Q5ZA 4MF1A 2XPWA 3VS1A 2ZV8A 3OOUA 3HKZA 4BHPA 3TNIA 4D2WA 3FV8A 1JKKA 1VZ0A 4TT7A 3BG7A 3ZONA 3M9AA 2GCDA 3ALOA 4BCQA 4XHKB 3ZPLA 3QUDA 2H9VA 2V6EA 1VQ9I 2HZIA 2IPQX 4MEYF 2IS1A 4DFYA 4FQGA 3PSCA 5BUIA 4BDDA 2G9XA 2VWUA 5DYMA 1YDSE 5KMLA 1XD7A 4H3BA 2CW8A 4ZTHA 1W83A 1W1WE 1J09A 1K9AA 1BW5A 2PVYA 1Z3XA 4BDAA 4RVLA 4IWPA 2W9FB 5J4VA 3FMHA 3LFQA 4I7HA 5CU0A 1U5TC 5M4FA 5IA0A 3GBZA 3PLAE 3WF5A 2Z3YA 1ZRFA 4Y73A 1HCKA 3OYAA 4EM2A 2D1VA 1D1BA 2Q8KA 2F7ZE 2NPQA 1MNDA 4O0VA 3ID6C 1P2AA 4CV8A 2L9RA 3ONQA 1OR7A 4BACA 4EVIA 2B52A 2CJMA 4LG0A 3LHJA 1IR3A 2BDWA 4FZFB 5DCMB 3UDZA 4BXXJ 4WWCA 5E3OA 4MNEA 1DPUA 2PVNA 4O7YA 1GV2A 3EHAA 2K5CA 3P08A 5CNNA 5FTQA 3C2GA 3I6WA 2X0QA 3F21A 2G1TA 3QU3A 4QPOA 1LEZA 3K0LA 1BL6A 4EH5A 3MB7A 1I39A 1BI2A 4I5HA 5LVNA 3BPVA 3PDTA 4XG8A 2YAAA 4KMUX 4KIFA 1BOBA 1XQZA 1C0WA 2Z7QA 1OJLA 2MLKA 2WMBA 5DOSA 1IV8A 4HYIA 4DNCA 3NWSA 3TW6A 4BL0B 1W82A 3SGCA 4E93A 4ENJA 2PULA 2VKDA 2WTJA 2Y0MA 4YJTA 3WIKA 4GGGA 1LDJA 3LE6A 3EN7A 4PMPA 1WFCA 4GFOA 3FQHA 3J80K 3GC0A 2XB0X 4L7SA 2XAJA 5CSVA 2L0KA 3NIEA 3CBLA 4IE9A 3UR3C 3FWEA 3C4ZA 2HYGD 4OMZA 3PJCA 1O3QA 3WE8A 2H94A 4AM3A 4S04A 3CS9A 3RPQA 4U8ZA 4AIDA 4O7VA 3DDPA 3D5LA 4AN3A 4JX4A 5D7AA 3OOPA 3HOWJ 3FLWA 2CFOA 4FV4A 3LSKA 3PQJA 2PK9A 3V5PA 5EEGA 3GTJJ 5J1VA 2IVTA 1ETKA 2C3JA 2B53A 4GV1A 2V1NA 2C5YA 2RNJA 1QHHD 2K86A 5KVRA 3OS0A 2I1MA 4MH7A 3KEQA 5J1YA 3CIKA 1BC7C 4RGXA 4BZNA 2XYNA 2P55A 2Q0NA 2W96B 4JQ8A 1PMUA 1OLTA 4D55A 5AM6A 5JZNA 4GK3A 2GIZA 2CUJA 3DLAA 3KXNA 5EJCA 2VTAA 1VYWA 3MSSA 3DKXA 1GZNA 4FNWA 2W5BA 5TF9A 3W2CA 4AN9A 4JLCA 4QLCU 5IQBA 4FV2A 3HUBA 4XRSG 1P9QC 3NCGA 5FM2A 3PA4A 3W6KB 3LXKA 2UZUE 3H5RA 1Z6RA 3DXQA 4D9UA 2M45A 3CCUI 2VC0A 4FOBA 4CKJA 4UY8I 3QUPA 3D14A 3A62A 3ENMA 3FLYA 4LGGA 4ZDOA 2J5PA 2ZSIB 4TN6A 3AMBA 1ACIA 2FSOX 3RAHA 2L54A 4ZY4A 4IQ4A 4ZLOA 4ZEGA 3PFIA 2EV6A 3SEZA 3HDDA 5J8IA 4PJMA 3OUNB 1MBJA 9ANTA 4TWPA 3BYSA 4R8QA 2GNJA 2LRDA 4CYCB 2WA0A 4AXFA 1MIJA 3ZMDA 1AHDP 1S3JA 1M2RA 4R1HA 3GCMA 4EONA 2LREA 3GFJA 5E3LA 3DTEA 3ERED 2HDCA 4PDPA 4NC7A 5AAEA 1DPRA 4BYIA 4FL3A 3D15A 4C37A 1WKMA 4C9YA 2HYFA 1ZYRF 4ALUA 1DP3A 5HLTA 2VIXA 2EIJH 3EMGA 4UB7A 3GOPA 2J0IA 3O7LB 4BE2A 1UKIA 3RZBA 1B38A 3CMEI 5HE1A 1NVQA 3RI4A 2HPMA 2C6LA 3O8HA 5AA8A 4EL9A 5CEOA 4CFVA 3LZBA 4DG3E 2R3GA 3S1QJ 2HZDA 3VJOA 4EH4A 5KX8A 1FBSA 3PIXA 1R00A 2K9LA 4PJNA 5HE2A 4BCOA 3KYCB 1AA7A 3CP2A 3U9CA 4XM3A 4CKIA 3AD4A 4Q2AA 3EQCA 1W0XC 2IW9A 3NYXA 2QD9A 2BXYA 4O6LA 4GS6A