1ZAOA

Crystal structure of a.fulgidus rio2 kinase complexed with atp and manganese ions
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
282
structure length
271
Chain Sequence
MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVGHTKVKEFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Autophosphorylation of Archaeoglobus fulgidus Rio2 and crystal structures of its nucleotide-metal ion complexes.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Transferase
molecule keywords Rio2 serine kinase
total genus 93
structure length 271
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zaoA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zaoA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zaoA02
4D2RA 2F2UA 2PBIA 2V55A 4DH7A 4ASZA 3NUXA 1KU9A 5CF4A 1YOJA 3TDVA 1H26A 3DDQA 3WIKA 3R04A 2CGXA 4ZYDA 1DUXC 4IZ7A 3NEUA 3BQRA 3ERKA 2QO2A 3R30A 5TJJA 3L9MA 5FG8A 2ADUA 4F0FA 2QU5A 5CLSA 3PVUA 1E1VA 4H36A 3DZOA 4RVKA 3SG8A 1LEZA 3NX8A 5HS7A 3EQLF 2RKHA 2XM8A 2VO6A 4ZP5A 4KNBA 3O50A 4O7YA 5AIKA 3WZKA 4A9UA 3N97A 5CAUA 4PQNA 3V3VA 3RI1A 2WTVA 3HMPA 4EH3A 4S34A 4V01A 4PGGA 3NWWA 5AR2A 5BVNA 2KJCA 3HUBA 3U8WA 3RAIA 4E4MA 4DEIA 4EBWA 4IRIA 3LSTA 4HYEA 3LFEA 3VHEA 4XG3A 3QQHA 2C1AA 4KMUX 4WXCA 4B99A 2QBYB 4A4OA 3Q5IA 4R1YA 2STWA 1IA9A 2FQ3A 1O9UA 4KNYA 2FBHA 1ZMUA 2EFWA 4ALUA 2C5OA 3CCNA 3ROYA 1H9TA 1DPRA 2W4JA 4B4LA 2WTDA 2XHKA 2YHVA 5FBOA 3OF0A 5IQHA 4PNKA 5H9BA 1RUOA 5JK3A 3LW0A 4AT3A 4M8TA 2UW0A 2PE0A 3RTPA 4D2VA 3W33A 3SKCA 4AGDA 2P3GX 1P92A 4G6OA 4H05A 4NW5A 1PUEE 4DFUA 4KA3A 5HU9A 4MX9A 1B9MA 4JBPA 4NIFA 4RGXA 5CAVA 3CPBA 5L3FA 4Z2YA 1LVAA 2Z7QA 5A4TA 5IH4A 3CY3A 3FHZA 4CD0A 2FBIA 1OPLA 3GFMA 5L8LA 2I1MA 5ILUA 2EXCX 4HGTA 2DPUA 3TO7A 2O0UA 1NHAA 4N4SA 3H3ZA 1KA8A 4G6DA 4FV2A 3EHAA 4GIIA 5AIPA 3QHRA 1DDNA 4XG6A 1ZY4A 3VS3A 5D8KB 2DFIA 4U97A 1OL2A 4RGUA 4D28A 3VUIA 4L7FA 3GGFA 1RIOH 2OD5A 4LOQA 2C47A 4UN0C 5GJFA 4FG7A 3CLOA 4I94A 4RX7A 3AC2A 4JDIA 4NM0A 4D2TA 4DT9A 4EC9A 1PXPA 1XDUA 5HIDA 4EH6A 3IGGA 4EH9A 1KUTA 3ZMMA 2DUVA 1YXVA 2WQEA 2EA2A 3PQKA 3F8BA 5HIBA 3QPTA 3FZOA 2UXXA 4ESBA 3E6DA 4PL3A 5F6FA 4IVCA 4F65A 4L46A 2V1UA 4PRJA 2CGUA 4PDPA 5GIOE 3ZS5A 3Q6UA 4WCGA 4FL3A 4KAOA 2YM6A 5CEMA 5BVDA 5HHWA 5CU0A 3WZJA 4F6WA 3R8VA 4ACGA 4ZYHA 5HD7A 3WZEA 5EI8A 1MUOA 3M9AA 2HFHA 1T6SA 5K5NA 5CI6A 4DCEA 1E2XA 5M09A 5CEQA 2W4OA 3WTXC 4XUFA 2CGWA 3PXYA 4E93A 4N6ZA 3Q2MA 3QBNA 2BUJA 5K5OA 5L4QA 4OTQA 4UXQA 3OXTA 3HHHA 1QPMA 1KU2A 2XYNA 3ERED 4MK0A 1W84A 3PA5A 4EJVA 5C8NA 4OTHA 4RLLA 3VS7A 3OHTA 4LG0B 2QODA 5BUIA 4RBLA 4U41A 1IAWA 3E6MA 4O7VA 1XWSA 4CMUA 2WAJA 4IJPA 2OZ6A 4J99A 1LQ1A 1MRYA 4HOBA 2PTKA 5D5UB 2ZV8A 4I93A 4IX3A 3NDMA 4RMZA 1PJKA 1Q8WA 4AGWA 4N0BA 1YHWA 4EH2A 3SG9A 5F1RA 4IM2A 3F5XA 1WBTA 3DP7A 4DLIA 2VGPA 2OBJA 5L2SA 4Y5HA 4LV8A 1VYZA 5BQ0A 1I1SA 5EI2A 3PWDA 3TIYA 2JDRA 4A7CA 4RLKA 4NM3A 4UXNA 3R2BA 2I0HA 2HWOA 4IX4A 2IW6A 4NW6A 1OIUA 2JC6A 4UEUA 3VBVA 5DG5A 4YJSA 4JQFA 5FLXZ 3QRKA 1FP1D 3F3XA 4JDJA 4W4XA 3MBLA 4OIOF 3FSFA 4AWXB 3UVQA 3OW3A 4P7EA 5DVRA 3BIZA 5ETFA 1CDKA 2QC6A 4PF4A 3TGNA 3E8CA 5HE3A 4D5KA 2W17A 3T8TA 4ZSLA 4JQ8A 4C61A 4EZ3A 2BBYA 5M4CA 4IWOA 4HX8A 2BE5F 2M45A 2ESMA 2FO0A 3TDZC 2WMRA 2DLLA 4L68A 3ODZX 1FYLA 4P9FA 4K18A 3LLAA 4DYMA 3MB6A 3QX2A 2E1CA 2HZIA 2QHMA 1XSVA 4BYIA 2E7WA 2QOQA 3VS4A 2GNHA 4DEHA 5HTBA 3R7OA 3V8LA 4EOSA 1U2WA 5TOZA 4MXZA 4OT6A 4AZWA 2J0MB 4MQ2A 1ULYA 3RPQA 5ACBC 3VEPA 4HX7A 1YHSA 3BWFA 4XRJA 4U44A 4M7IA 4FIEA 2LNBA 3F6OA 4D2PA 3OFMA 3TDWA 4NFMA 3FMLA 4JR3A 2YPRA 2ETMA 4Y72A 4QP6A 3AD5A 4W4WA 1H27A 2AYPA 3ETAA 3UG1A 4CICA 2QHNA 4RAZA 3NUNA 4R7IA 3EZVA 1H1SA 4DGNA 4MBLA 4DFBA 4KBCA 3AT2A 3DKWA 2H34A 4RIWB 1FBNA 2BRGA 4C0TA 5M06A 4HZRA 4Y17A 4A5NA 2GZWA 4L67A 4ZH4F 4YC6A 4R3PA 3TV4A 1GOLA 2XAQA 4ZJJA 3GFJA 1J7LA 2KRFA 4AIJA 2VE9A 5K3YA 5AP1A 2QO7A 2QKWB 2DQLA 1RUNA 3BQCA 3ZUTA 4O2PA 5J8IA 3HA8A 4KRCA 4U81A 3F2RA 3G6HA 4MWIA 2ITPA 3ODYX 2A61A 4BHNA 3PZEA 3RMFA 4UYAA 3IONA 1CSNA 3A4OX 5JGAA 3UBDA 1NVSA 4MD7E 2VWWA 5FP5A 3LQRA 3K0LA 3KEOA 5J8FA 2VOPA 3SW7A 4FTMA 4RQVA 4L9TA 1G3YA 3PFIA 3DY7A 3F3ZA 5FFXA 4I6BA 1K3AA 4AOTA 4BDIA 5H6RA 3EN7A 1UNHA 1Q41A 2VN2A 1A04A 3KETA 4AIHA 2XAHA 3MFUA 3NEWA 3DXPA 3BP8A 3MZHA 4FSWA 4P4CA 5IF1A 4G6NA 1ZRDA 4FMQA 3FXXA 5CVIA 4HDVA 4HVGA 1WCCA 5HO8A 1STZA 4FNZA 3RPOA 1XB4A 4O27B 5KMLA 3VFZA 2HEOA 2VX1A 2ZDUA 3ORTA 2QONA 3T9TA 3BLRA 1FY7A 3E8NA 2VWXA 3C4FA 3ZEPA 4I5PA 3II5A 3PVBA 5FQDC 2XJ2A 2ITTA 1U54B 3DBDA 4BCFA 4H1JA 1S3JA 3EQCA 4YTFA 3D0EA 2C6MA 5AP0A 4KIKA 3R8PA 4BH9A 4O82A 5DV5A 3CXWA 2DAOA 3WILA 5H8EA 5BUEA 3MPTA 5I3OA 4W8DA 2UZBA 5CF5A 3FBVA 3ZO4A 3C4CA 3F3TA 4KYWA 1IN7A 3LJ1A 3O8PA 2X2KA 4AS0A 2EWAA 2X9FA 2FH9A 5HLPA 4UVCA 4CT2A 4CYDA 3NW5A 1RQQA 3D5WA 3S0OA 4PMTA 2C5NA 3ZMVA 2C3KA 4CLJA 1UNLA 4GH2A 3M2WA 3LXKA 2JEDA 3GWZA 2VWIA 2J0JA 1QZYA 3E63A 4YPSA 4NUSA 3NUPA 2HZTA 2J51A 2JDTA 1JKLA 2WEVA 4YO4A 4AT4A 1XH9A 5HLGA 2WOTA 4PPBA 5IDPA 4DHFA 4L9VA 4XBFA 5HG7A 4YHTA 5EM5A 3UQCA 5HS9A 5E17F 4QQ5A 3GVUA 3KCKA 3LVPA 4CFXA 3OUNB 1SVEA 2GNGA 3I7CA 2YR2A 5M53A 5LRRA 3WZDA 3LA2A 1PP7U 3C50A 3P79A 5GZ9A 5IEYA 4IACA 1L8TA 4K11A 4L3JA 2IWIA 1H25A 4FTUA 2ZV9A 2CKEA 2H27A 2CKOA 2HS5A 4WSYA 4TW9A 5HCZA 1BI0A 5HE1A 3QQKA 2C5XA 3E5QA 2A69F 1K2PA 4TYIA 5IQBA 2WZJA 3KXHA 4HQEA 3O71A 1H00A 2OQRA 2PHKA 1HKTA 2Z99A 3DB8A 4EZ7A 4HVSA 4QT1A 4BZNA 2CN8A 4GG5A 4JNWA 1KOBA 4LGWA 1Q5KA 4HYIA 5AR3A 4AUAA 1S8NA 1HW2A 5CXHA 3BV3A 4MEDA 5HVJA 5FWKK 3RJPA 2BHHA 5HVKA 5JH6A 3WOWA 3UG2A 4TWCA 2FBKA 2FNAA 1T45A 4HZFA 3ZRKA 3TT0A 3OOPA 4J98A 3QQUA 3ORKA 3ORNA 3DS6A 2VTOA 5LHGA 3DQVC 3TUCA 1OBGA 1YWNA 1GJOA 4PDYA 4GMYA 3ORZA 5J7HA 1YHVA 3EYGA 5K0KA 4DFXE 4IVDA 5EFQA 5CSPA 2REIA 5GJGA 3F61A 2VWBA 4V05A 5F94A 2IZUA 2VTHA 2QLZA 3ALNA 3H9FA 2EWNA 5CYVA 4NTSA 4FSQA 5F20A 2J5PA 4FL1A 5D6FA 2VX3A 4FTLA 2ZKZA 1TQIA 2I6LA 1OL7A 5BVEA 3I79A 3LCOA 2V9VA 3SAYA 4LV5A 3EFWA 2W9ZB 3AOXA 3QZGA 1U5TC 4FTKA 3K1PA 4QOXA 4WG3A 3RCDA 3CTAA 4CCUA 4AACA 3DXJF 4BTFA 5DFPA 4BHPA 1USTA 2M30A 2C69A 3HUCA 3O8TA 3H10A 2VT2A 5DR6A 1VYWA 5AUXA 3HRMA 3DAEA 1R5GA 4M9ZA 5TF9A 4PUZA 2LF8A 1W83A 3L8SA 3LZBA 4EOIA 1V1KA 4C4JA 3WYYA 4F0GA 4UHTA 4A6DA 3ZC6A 3R02A 3R71A 4XP3A 4CXAA 3HTSB 1F1ZA 3LAUA 4I5CA 3UNZA 1F0QA 2BROA 3KGAA 2R7DA 2J5EA 2WEIA 3WTVC 3QTUA 5E1ZB 4L5JA 1FVTA 2OU2A 2XKOA 1FQ1B 2CPKE 3VN9A 2GHMA 1PYEA 3QU0A 1CMKE 1HKSA 2UZWE 5EW8A 3DAJA 3RZFA 4EJOA 3OEZA 1WSUA 5HGIA 3CGOA 1FT9A 4A9SA 4I0TA 5J5SA 2PZIA 3GFIA 4O0TA 3L9FA 4QMPA 1CF7B 2XB7A 1BYGA 4YJRA 5B2LA 5ETAA 4AZEA 2R9SA 1QPDA 3GCVA 3CUQB 3KVXA 3FYJX 3P9CA 3DV3A 3GEZA 3HLLA 1SFEA 3ZOSA 1XSDA 4O7RA 3PZHA 3SHEA 5KE0A 4KDPA 1I09A 4ENMA 4RA5A 1W0XC 1SD6A 2A0CX 3NCZA 4UMRA 4FL2A 5A4CA 1P2FA 2DQ7X 1IW7F 4I20A 5BYLA 1WMKA 1H28A 4WWCA 3LM0A 1AD5A 4EKLA 4M9XA 5BOXA 4NEUA 2PULA 4EH5A 5FDPA 1LDJA 2QQAA 4WXHA 3QZIA 4FV6A 3QD0A 3GEQA 1ATPE 3RWQA 1D5VA 2G15A 3FLQA 5E4HA 1YQJA 3LWFA 3EQGA 5KCVA 4MD8E 1O7FA 4C4IA 5EYDA 1ZLKA 1JBPE 3VJNA 3KMUA 5JMSA 4DT8A 3CEKA 1SVGA 3NW7A 2P2HA 4J8MA 1G5SA 4YFNF 4Z7HA 4DQ2A 2K4BA 1H08A 3TZ9A 5EQPA 3FZRA 4HDUA 2CN5A 4CSVA 5DEWA 1PRYA 1HKQA 1Q24A 4FIIA 4FV5A 3I53A 3GCSA 3BYMA 2WELA 4HJOA 4JX7A 2W1ZA 2ITWA 3BDDA 4USFA 4IWQA 2UW5A 2XIZA 3ZO2A 5DGZA 4WNMA 4BI1A 4XH6A 4BTKA 5AM6A 4YR8A 3U6JA 3UOKA 5C8KA 1K78B 5E1WA 1WQ2A 3R1YA 3ULQB 2QOLA 4FI1A 4D1SA 3BI6A 1ZG3A 3MJ2A 5AEPA 1OVEA 3BCEA 4Q5SF 2PMLX 4WXDA 4RIYB 3BBTB 1D3YA 4MTEA 3MEXA 4OTDA 5LCJA 2V22A 4F1TA 4AXAA 5IT9Z 3C7QA 3PJ3A 2BCJA 2C68A 2FVDA 2X8IA 5HX6A 1Q3WA 4I1ZA 3MTLA 5JEBA 3I81A 4PGHA 4A4LA 1RE8A 3QP6A 2OAZA 1YO5C 1CF7A 3GQLA 4QP8A 2H9VA 1UWHA 2FNPA 3COMA 2UZEA 5C01A 3V8SA 3PA4A 4ACMA 2G7HA 5LMAA 4DE4A 2OZUA 4BKYA 4G8XA 2DYLA 3I5UA 3MA6A 2WTCA 3IOKA 1LP4A 2XRWA 3VODA 5AA8A 2O8YA 1P5EA 4FNXA 4HGLA 4X3JA 3KK9A 3QQLA 4QMQA 3P9JA 4KN7X 4RGRA 4H3BA 2A68F 4QMVA 5CNNA 3R0TA 2R2PA 4RB1A 3V8JA 3AT3A 2HTJA 4G5JA 2XKFA 5DWRA 5AX9A 2K7LA 1FBUA 4O6JA 2XNPA 3TZ8A 3MFRA 4FTAA 4NJDA 3GCUA 4EUTA 3FI8A 4AZFA 3OWKA 5ERIA 1BN5A 4ENXA 1OL1A 2DTRA 4H1MA 2VAGA 4EVIA 2J9MA 3S2WA 2RFNA 3G33A 4CFUA 5IU2A 3TKYA 2JKOA 1ZZ2A 4E70A 3PIXA 2YISA 5TRDA 4BBEA 4K6ZA 3QU3A 4FV4A 4QPAA 5GIPE 1AOYA 4NM7A 3O2MA 2BZKB 5HLIA 3HDMA 3VOEA 3DKGA 4FX3A 3LIJA 2XK9A 4OTPA 4JG7A 4FEWA 3CE3A 3CIKA 4UNOA 3CGFA 4U0YA 4MXCA 2IG7A 1PMVA 3VBWA 5CVJA 2QLQA 3C51A 3I54A 2YDIA 5DPVA 3I1AA 4OOIA 5HQ0A 2HK5A 3UIUA 1NT2A 5FLFA 5DBXA 3VQHA 3EN9A 2JTVA 1SD5A 3F21A 3FM5A 3QU6A 4IB5A 3BZ3A 2WKMA 4USDA 5BMZA 2IW8A 3T1BA 2XF0A 5A4LA 2YWVA 2C5YA 1IZ1A 3LFNA 3QLGA 3ZM4A 4ZY5A 3LFFA 4BNCA 3GFEA 2QO9A 3NNUA 2F5EA 3M42A 1H24A 4EKKA 4F1MA 1BI8A 3NUAA 3KP2A 3FM3A 4P90A 4BR3A 4RC3A 4O22A 5FBNC 4PDSA 3DZQA 5I9XA 3P7CA 4M66A 3WBLA 4FKLA 4DEAA 3IKVA 3Q4TA 1PMNA 4FTJA 4E3CA 3L7WA 5B7VA 1FNNA 4LLGF 1P4FA 4CT1A 2H8HA 4JIAA 4L9NA 3A7FA 1U5RA 1U8RA 4XV3A 1IN5A 4KUMA 5HG8A 1BMKA 2VN9A 2R3QA 2Z60A 2OJ9A 1TBXA 1U59A 2J0IA 3U4WA 1LNWA 3PXRA 1DAWA 3DK3A 4WNPA 4NKAA 2QG5A 5IQIA 4AA5A 4ANNA 2XBJA 5HESA 3V01A 3V5WA 2WMAA 5K4JA 2WWYA 4IANA 2B53A 3A61A 4O38A 2OF4A 3PIYA 3R8UA 3D7ZA 3MY0A 4LMNA 4EJWA 4FTQA 4GJ2A 2XAFA 1FYMA 3PY1A 1IR3A 2RDPA 4M0ZA 4FEQA 2FEZA 1HSJA 2YJSA 2XRNA 2F2CB 3MPAA 4KS8A 2KIMA 2ZMCA 5DH3A 1H0VA 4IAIA 3PA3A 4DITA 1KQ0A 3HVCA 5FD2A 3U6HA 4RJ4A 2X9EA 3AG9A 2UZKA 5LVLA 2ITYA 2XMYA 5A6NA 5FD5A 3GU7A 3R6XA 5JFVA 4MBIA 4GT3A 4AGCA 3QOPA 3FI2A 2JZYA 3RM6A 3MV5A 2B0LA 2Q0BA 5KO1A 3BYOA 2P7CB 1MGTA 1JXSA 3OV8A 3SHFA 2P7VB 1REKA 3S3IA 4UVAA 2XROA 2VONA 3RNIA 4UVBA 1SFUA 4AZSA 2J0LA 4O5VA 1SNXA 5GINE 4R8HA 2D1HA 3A7GA 2WNTA 2W0JA 3NNXA 1X3UA 1W82A 3KRJA 2WGJA 3OROA 4BDHA 2UVZA 4H0EA 1Q8TA 3P9IA 5EM7A 1H8FA 4AG8A 4BN1A 1ZYLA 4G3EA 3F2NA 2JIIA 3IWFA 1J5YA 2NRAC 1IAHA 5EDQA 3QC9A 5BVWA 3CJGA 1ZRCA 4FSYA 4FTIA 4YZBA 4K77A 2BAQA 5IQCA 3RTRA 3TOAA 3C3WA 3T9IA 2B52A 4L5IA 4RA4A 2WTKB 5CZHA 1QCFA 4TZRA 3R7YA 2MLKA 1WBPA 1W7HA 3GENA 1R0PA 2BRHA 1PHKA 3W2OA 5CXZA 4CFNA 4XLVA 4U9AA 3KK8A 2PVHA 4BRXA 1BM9A 3T3UA 1ZN2A 4OT5A 4DH1A 1STCE 3ZZWA 4OR5A 2GMXA 1OKWA 4M68A 2W99B 1MZBA 3K3JA 3HMNA 3MN3A 4N57A 4CVAA 4RWKA 5M44A 4HPTE 3VO3A 3CUQC 5ITAA 3UO4A 3MQ0A 3Q4UA 3BGZA 4K33A 2WMUA 1NY3A 1ZYSA 3PPJA 5LLQA 4UWBA 1CTPE 2PVKA 5I9WA 1T46A 4ZTNA 4JS8A 3P7AA 3I59B 4EQCA 1E17A 4TPTA 5KHWA 3HRUA 1KU3A 3ZLYA 4DGOA 4R8QA 3KQ7A 4LFIA 4FZAB 4CZYB 4Z55A 5AUTA 2UW3A 3UZPA 3IGOA 1SMHA 3MH1A 2MLGA 3LMIA 4Y95A 4MNEB 2WD1A 3V5QA 3A60A 3O51A 3DPKA 4GO1A 4RFYA 2CW0F 4DGLC 5AAGA 3GCPA 3QTSA 2DO7A 3IDCA 5ICCA 3VBQA 2WQBA 4PMMA 4CFWA 3WE8A 3VW6A 5L3AA 4UV0A 3BPRA 1G8SA 4E5WA 2CLQA 4MXXA 3V7RA 3U1DA 4I6QA 4IMYA 3TOBA 5AUYA 1IXSB 2IJMA 1O3TA 2CHLA 4GCJA 3NIEA 4ACCA 3FHIA 3FKOA 3AC3A 1Y8GA 4R1HA 4CXFA 4NM5A 2ETRA 4IBMA 2QURA 3TXOA 5LJJA 2Z3YA 2RIOA 1XH4A 2XCHA 2HWVA 4CRLA 5HG5A 1QQIA 3GQIA 2PVJA 1K7AA 3V8KA 4DA5A 2HQNA 3CBLA 2VO7A 4OBOA 4EH4A 3GI3A 5DYMA 3R8LA 3HHGA 2HZNA 2YZAA 3G9NA 2BYVE 1KE7A 4EEVA 4CRSA 1U54A 3PSDA 4GUEA 2JD5A 2UZTA 4GCVA 2XKEA 3WGGA 2HY81 4G7HF 3EB0A 3MH3A 3VJOA 4RX5A 3B2WA 3MDYA 2ITNA 1T98A 1CM8A 2UZLA 4BDEA 3E5AA 3SZTA 2V1XA 4BTMA 4JDKA 5D6EA 5I3RA 1CGPA 3TCPA 4NYEA 5J9ZA 4DH3A 4U80A 5E8GA 1GHCA 1CKJA 3NYNA 3SXFA 4FUYA 4HW7A 3V6SA 2NNWB 4ZSGA 2G1TA 2FSWA 3MZYA 2V0DA 2ZYBA 3DV8A 3SXYA 4FT8A 1YXUA 3SC1A 3EUHA 2W7XA 4FODA 1PP8F 3OP5A 2XCKA 2GNLA 2JDSA 4RJ7A 5IMXA 3R9DA 3BGQA 4ZS0A 4UYNA 4D1ZA 1JLUE 3VUGA 1TW2A 1REPC 2NS0A 5JFSA 4YPDA 4BAYA 1OUYA 2YAKA 1ZG1A 4CZUA 2MD5A 3KULA 4NTTA 1S29A 3E7OA 5EK7A 4M71A 3D14A 5BYYA 4MHGA 3LM5A 1J9IA 5LWMA 1QBJA 5HE2A 4C59A 4IM3A 4K2EA 4NZWB 1ZARA 3KB7A 4BDGA 3I5ZA 4LB6B 3MTFA 4RB0A 5LHHA 2GU8A 3FZTA 3HA6A 1Z57A 3MYGA 4XP0A 4I2OA 5L8JA 2IVVA 3CJNA 2X8DA 4BBMA 3Q9XA 4IZ5A 4LM5A 5ACKA 4ASXA 4QPSA 3JXWA 3OBJA 4GVJA 3RK9A 1Q8YA 1GIIA 5LVOA 4RSSA 2PMUA 3ZFYA 3A7JA 1PDNC 4NSTA 3BPXA 3HRFA 3ZLWA 1YW7A 2J50A 4R7HA 2WMWA 4U42A 2PU8A 2OLCA 1G8AA 3DBCA 3C9WA 2PMNX 3ZUVA 2IPQX 1U6GA 2RG5A 3EWHA 3WF7A 2R3HA 4TYEA 3QXOA 2OJJA 3SDJA 2Y6OA 4XBUA 1NW1A 5FD6A 1U5TB 1KU7A 3NGAA 4ZY6A 1ZLJA 1Q4LA 2RKUA 4XHKB 2E9PA 5DT3A 3VC4A 2WOUA 4AQCA 2IZTA 1J59A 3RALA 5DRBA 4I3ZA 3AT4A 2F5FA 3HIFA 5ILSA 1RNLA 4MHAA 2A1AB 3KKVA 3KA0A 5L3CA 3WF5A 4E6QA 2W1HA 3OTVA 4FUXA 4RAYA 3OOGA 4Y46A 4C3RA 3QLFA 1IXCA 5IUHA 4Z16A 4CEGA 3MIYA 1GIJA 4QYHA 2W24A 4G3FA 3MVJA 5H8BA 4FYOA 4Z3VA 4NHJA 1Z6TA 3FLSA 5DDGA 4ZMEA 2JGZA 2LGCA 5D5WB 4ENJA 4FF8A 5I9ZA 1J0RA 5LWNA 3E5XA 3QTZA 4HX4A 3K1MA 4UX9A 2VBWA 3ANRA 1BX6A 3PY0A 4KIFA 5L2WA 3MB7A 5FEDA 3KXMA 4ZYEA 5BPDA 1YIOA 5CALA 4QNYA 4FKOA 4C62A 1H9GA 3D94A 5E8YA 3L9PA 3AD4A 3CO6C 1JNKA 4J53A 2V7OA 4L44A 4F6UA 4DINA 1IN6A 2P55A 1HXDA 5LQFA 2R3RA 3QYWA 4G16A 3FKLA 2NYXA 4GYGA 4UY9A 3LA7A 1ZYDA 3EQFA 1OIQA 3UIBA 4HOKA 5EKNA 1GZ8A 3R1NA 2K27A 4IX5A 2WO6A 3P5KA 4BB4A 3SW4A 3WTSC 3RHXA 2YZLA 4L3PA 4W8EA 1OPCA 4PZJA 4XLNF 2FXAA 3CQWA 4YFKF 3L8XA 3UNJA 3GZ5A 5AV1A 2P5KA 3PP1A 4RFZA 4ETSA 2JITA 1R1UA 2C0IA 1I6XA 2GS6A 2OFUA 3MCZA 1UVRA 3E3BX 5CY3A 3F3WA 2IT0A 3VNTA 4NK9A 3HOTA 3DBFA 5DOSA 1M2PA 3DT1A 1SVHA 1FPUA 1CKPA 2ZO4A 4EBVA 4IHTA 3KLNA 1GZKA 2NRUA 1QPCA 5HBHA 3PXFA 3QA0A 4F7LA 3TIZA 1M7NA 3BZ6A 5KZ0A 3QRIA 5ANEA 3GO5A 4FT3A 3VHKA 1ZGAA 4BDAA 1PY5A 3VQUA 4UZDA 3ZN1A 4EQUA 4Y5QA 4NCTA 3PXZA 3UQGA 2RQPA 3WE3A 3K5VA 1QMZA 1TTYA 2COMA 1KQ8A 4FV3A 3FKNA 3J80K 4F64A 2R5TA 4CKJA 3NIZA 3TEIA 2XEYA 3CY2A 5ICFA 3C0HA 4TYHB 2QR8A 4O7WA 1YW8A 3FY2A 2VWZA 1A48A 4PX6A 2IW9A 5HBEA 1JPAA 2YM4A 2RV8A 3NVKI 3RBWA 5IH5A 4AT5A 2FOKA 1OYWA 4LL0A 4I0AA 2YU3A 3NYXA 2VOOA 3WF9A 4PCQA 5M57A 4D1XA 3JAMK 5H20A 1DPUA 4KBKA 3L8PA 4ZZMA 5CU4A 3ZMTA 3U6IA 3G73A 2W5BA 4CQGA 4FKIA 3R83A 1ZH5A 2YCQA 3RZBA 3VW8A 3OXIA 1FLIA 1G3WA 5B2MA 4ITJA 4RB3C 4IADA 4AN3A 4FZFB 4XMOA 4U3ZA 4DN5A 2VC0A 3HTUA 4WD5A 1RJBA 2HTSA 1K79A 3R9NA 2FSMX 3ORXA 1FVRA 4XRLA 1J1CA 3FDNA 4YZNA 4GUBA 1FZPB 4R6VA 3VUKA 4QNAA 1XR1A 3ZXTA 3NPCA 4QTEA 4I0BA 3ATSA 4JK1X 3P7BA 1OIYA 4ANMA 3R7GA 4HVHA 3ULIA 2Y7JA 3HEGA 3R9HA 6PAXA 4XEYA 5K4IA 5LOHA 4L8MA 3EH9A 1MRVA 2PMOX 3KE2A 2XIYA 2YX7A 1A06A 3PJ1A 3B02A 2IRFG 3COIA 4I41A 4O3MA 1BJAA 3QCSA 3K5UA 2PI0A 2YIQA 3WE4A 3HZTA 4TNDA 5M4IA 1QZZA 4LMYA 3OCSA 2VNYA 4B7TA 5FUTA 2X7OA 3HSRA 4CKRA 2R7BA 4H58A 4DG0E 4KFCA 2YSRA 4ACDA 4PDOA 1O3RA 2UW8A 5LBQA 1TLHB 1LB2A 5HCYA 4OTWA 2Y6MA 3OT3A 5DEQA 2YIRA 2Y4IC 4RZVA 2ZXJA 3NS9A 1WWXA 5K1YA 1GZOA 4G7OF 3FI3A 4IX6A 3UOHA 3FXQA 4ZLYA 5HU3A 3PSCA 4RVMA 5CQWA 3E3PA 4RJ8A 4C57A 2YIXA 3W6KB 3QTIA 3NRMA 3D0SA 4IQ6A 4AA0A 3BWGA 2XNEA 5M4FA 4Q9ZA 1QO0D 3BJ6A 2IVTA 3IS5A 4RIYA 2UW9A 4G9CA 1TQPA 3IL2A 4IM0A 3RM7A 2BDFA 3MGYA 5A46A 4MNFA 3KREA 4G94A 1O6YA 5HOOA 4DEEA 3WODF 2Q2EA 3QAHA 2KJBA 3ZDUA 4IAYA 3E8DA 3VS1A 1BC8C 1Y91A 3BYSA 4O7NA 4FIGA 3FYKX 2PY3A 3NR9A 4XYFA 4O7SA 4I0SA 4UWCA 2QI8A 3JSOA 4L00A 1ZOEA 4GK3A 4ZSAA 4HYUA 4EM1A 3E5UA 4KUJA 5CF8A 2GHGA 3UTOA 2HW6A 4X3FA 3QRTA 4KIKB 3MSSA 5HDKA 2A07F 2ONLA 1Q1HA 4G9RA 4EM0B 1W7PD 1EH4A 3C0IA 1Y8YA 4NU1A 3DOGA 4F1OA 3UP2A 5KZIA 5LMKA 3RHKA 3IRQA 3AC4A 1YWVA 4ZS4A 2EV5A 2J5OA 1H0MA 5L6WL 4FKUA 2GAUA 4QLCU 1YW2A 1P14A 4FKQA 4OMZA 2J2IB 5FXRA 5E9EA 4KS7A 3QYZA 5J95A 5M56A 2JDVA 3MWMA 4FTNA 3TO6A 4WUAA 4A4XA 3TTIA 3EDPA 2VXZA 3E8EA 1W7PB 5AM7A 2FYSA 5DI1A 1V0OA 1J2XA 2YITA 2Y8OA 3BRBA 4X3FB 2ITVA 4IDVA 3LHJA 5AP6A 3ZXZA 3FPMA 2QBYA 1GZNA 2G01A 3ANQA 4FSZA 2OH0E 4APCA 4EOPA 2O03A 2PN6A 3GW2A 5EHYA 1XGSA 3C18A 4CGZA 4RRVA 5EOLA 2PL0A 3LXNA 2CWEA 4KWPA 3QUPA 2OBPA 4RC4A 5ETCA 2BAKA 1SD4A 3V51A 3ELKA 2WB8A 2QOCA 4WO5A 4HQMA 1YRPA 4Q9SA 1IRKA 2UWMA 4E4XA 1XH6A 3Q9YA 2YIWA 3CKWA 5KNJA 1G3SA 3QGYA 5EYKA 4O1OA 3QTRA 4YZDA 4YG2F 2EU9A 3F66A 3GC9A 4AOJA 3ORLA 4AE9A 3DEUA 2R3IA 2YA9A 3QGWA 4BBFA 2ELHA 1FGIA 1YI3A 4USEA 5EDPA 4U5JA 3QXPA 2VTIA 5E8TA 4IZYA 4MBJA 4BTJA 3JVRA 2BAJA 4EZ5A 3VIDA 4ZSJA 3MW1A 2R3LA 4N9IA 3SXSA 5L3DA 2IJLA 5HVQC 3ENHA 4S2ZA 4J71A 1G3TA 4DF3A 4BXUA 3ZTXA 2C5VA 5CJ9A 4QTBA 2IA2A 2VBYA 3ATTA 3DF8A 1T38A 4MTDA 3T5XA 4X2NA 2KTYA 4H3PA 3UO6A 3UP7A 3SLSA 1LUFA 2XM9A 4FEXA 2R3NA 2M5WA 1SAXA 4UWYA 3I0QA 4LRKA 3KXZA 3KZZA 3COHA 4XG2A 5FXSA 4DGGA 4FYNA 5HI2A 3TV7A 2H6CA 1NVQA 2G9WA 2C3JA 1QL6A 2ZV7A 2QQ9A 5KMJA 5I9YA 2OXYA 2F7ZE 5LVNA 3GC8A 2ZB0A 3QZHA 5FTGA 5G6VA 4FZ6A 3PLAE 2OQGA 3R63A 4IRHA 4TWOA 4XOZA 4Z9LA 1PXNA 4WHZA 4DBXA 2Z02A 4LJZF 2EJRA 1PXLA 4B8XA 5GZAA 2UV2A 2X1NA 3F72A 3FMSA 3ML6A 2R0IA 3R8ZA 4FA2A 4FKWA 5HEZA 4IB1A 4QP9A 1DI9A 3TUBA 4QP4A 3C0GA 3AC1A 4C4HA 2EV6A 3TNQB 4O7TA 4AU8A 1FYKA 3ZDIA 2LSOA 3EQDA 3D4QA 3I71A 2FA2A 2CO5A 1W7PA 3V04A 2LKPA 5IISA 3R1SA 4BGQA 1AQ1A 5CI7A 2GQSA 4K2RA 1XMAA 4ZTSA 3LCDA 3IW8A 3AXWA 3F3VA 1IRFA 4U7ZA 3U4UA 4JBVA 4A0YA 4G9YA 3ZBXA 3E6BA 3DFGA 3ENMA 3ACKA 3Q52A 4I5HA 4RB2C 2GDOA 4ACHA 3DBQA 3KL8A 3QQGA 5ANIA 4C35A 5C8MA 3OVVA 4GJ3A 3JPVA 2VTPA 4X6RA 2HOEA 3TKUA 1YI4A 4O21A 2HXQA 3U55A 5I5ZA 1KGSA 3OTUA 2ZNZA 2EXEA 4C33A 5TO8A 2B1PA 3VS2A 4ZYGA 2WIHA 2OFVA 4S30A 5F1ZA 2O3PA 2E9VA 3VS0A 4X6QC 5LEJA 3N4VA 1YDRE 5ICGA 1FBSA 3PE2A 5D11A 2J6MA 1R36A 3PRIA 1ZXEA 4QYYA 4O7LA 4JG6A 1TQMA 4RIXA 4XCUA 4J52A 2RGVA 4E73A 3CKXA 4LFUA 2D2WA 1Z91A 4ZIMA 2PVLA 4Q4ZF 4FOBA 3TKHA 4EJUA 2PPQA 3OXZA 4D4SA 2FGIA 5J5TA 3LXLA 3I6WA 4KRDA 4AX8A 3RINA 4YHFA 1KE5A 3KXGA 1S7OA 4XG9A 4II5A 4K9YA 2OIQA 4ASDA 2IA0A 3F88A 5CVHA 3AAFA 5CVVA 1U78A 1IN4A 3I0TA 4FSNA 5AP2A 4YLJA 4ZEGA 2DK8A 4OGRA 2XZSA 5FGKA 4U43A 5HDGA 1PW2A 1F9NA 5BX0A 1ZOGA 4FT7A 4MNEA 3L9NA 4GK4A 1JQHA 1KSWA 3R4KA 4GFOA 2PYWA 5J1WA 1WFCA 1UU8A 5LMKC 2JKQA 1W8CA 4PP7A 2OZOA 4JIKA 2F4JA 3L8VA 4G6QA 2OW3A 4EK6A 3CO7C 4IHSA 5H8GA 4CLIA 2YX4A 4ZZDA 2OZAA 3PVGA 4IC7A 1RDQE 3PWYA 3F5UA 1R39A 3O3KA 2P6SA 4A6EA 3FMQA 4L45A 4ANBA 4QPMA 2ERZE 4C7TA 1YS7A 5K5RA 5CAPA 3GP0A 2ONLC 2GTNA 4IWDA 4BQAA 4J95A 5IQFA 4WOVA 5A3XA 3QTXA 4O7ZA 4EORA 5DR2A 4NL0A 3PIZA 2DI3A 2W05A 5H2UA 3ECOA 3KN6A 5LGUA 5C26A 4YZMA 1QGPA 2WV0A 3CJFA 5CVFA 3FMNA 3Q53A 5J1VA 4R3RA 5DT4A 1U4DA 1OUKA 5K5XA 5CT0A 2CCIA 3FXUA 3GBZA 3HOSA 3FC1X 3WIGA 4UXLA 3F8CA 1MP8A 3UPZA 2HKOA 5HBJA 4GYIA 2ACXA 4LGGA 4O0WA 3FLWA 2YAAA 3BHUA 2X2LA 5E1SA 4TL0A 2KULA 4LLNA 4ZTMA 1O57A 3G15A 2P2IA 1FSHA 3W2SA 1ZMWA 1O6KA 2LDUA 4QQJA 4KD1A 2L3DA 3W10A 4UMTA 3MS9A 2W06A 4RGJA 4R5SA 3EL8A 3C7JA 4TYHA 3OMVA 1OKVA 4I02A 2GTMA 5KMIA 1MJAA 4IF4A 3JTHA 3PFQA 3EQHA 5AV0A 3O8UA 2ZV2A 4RIWA 2UW4A 4OTRA 1YOMA 5E8ZA 2GHLA 3DCVA 4KIQA 3Q9SA 5HO7A 4S05A 2UW6A 4TY1A 4CTBA 2JAMA 4CMOA 4YZ9A 5CU6A 4B09A 4FTRA 2BFYA 3R21A 1FPQA 2UZDA 3CP9A 3QHWA 4EK4A 3TACA 1OZ1A 4YSJA 4IB0A 4EYJA 1U5QA 2GFSA 2A2AA 2EK5A 4FC0A 3EL7A 3IDBA 3GYHX 2WTEA 3ORIA 2BRNA 3O7LB 3ZSHA 4BICA 3EFLA 3V6RA 5IA2A 3HUGA 3BHYA 1YLFA 4Y83A 5H6QA 4M69B 5IQAA 3SFZA 1I5ZA 2XP2A 4EC8A 4WX9A 4EGZA 3RJCA 3LQ5A 5M51A 3IOPA 4D4YA 4X2GA 5JN2A 1YW9A 1Z6RA 5AR4A 4QMSA 3FXWA 5AV4A 4IAZA 3GB2A 3POOA 4O6LA 2ZJWA 3QA8A 4EHVA 4GK2A 4JBQA 1XGOA 2XKCA 1VTNC 1KE8A 3F9NA 4A9RA 5KVRA 4UMUA 3EFJA 3DA6A 4MQ9F 3P78A 3V8TA 5DMZA 2OXXA 1KE9A 1IAJA 1JKTA 1Y6AA 3O2PE 2VV9A 2OK1A 3DJ5A 4O0VA 4LK0F 1HCKA 3ORMA 3DPLC 1H1PA 4DH5A 5BS6A 2XK8A 4FGRA 4FIJA 4V0GA 4BWXA 4BKZA 2FE3A 5CENA 3CDHA 5E8IA 2BZHB 2A27A 3J81Z 3WZUA 4RVLA 4ASNA 5IEVA 4LOOA 2YCFA 2MC3A 4BWKA 2VTAA 3DKOA 3TWJA 3FF5A 1XBAA 3LQ3A 3C13A 4FSMA 3QCXA 2A4LA 2FUMA 4PY1A 4KN4X 5D4SA 1LDKB 2HR3A 1APME 3UPXA 4BCPA 5HO6A 4HF1A 5LHIA 5IZFA 4C4EA 5CEKA 5EHLA 3SRVA 3D2IA 4LL5A 4E8AA 4I6FA 5DT0A 5LEKA 5LMBA 4R79A 3UVPA 4KIPA 3HRBA 4RPVA 3C5UA 3HX4A 4G3GA 2Y9QA 4E6CA 4J7BA 4YURA 4Q2AA 4M73A 4F63A 3WGHA 2Z33A 5ETIA 3ABUA 4CTCA 5J79A 2GNIA 2J5FA 3RKXA 2DQRA 5AMNA 3QX4A 5BVOA 3IRRA 3ABTA 4EQMA 4YTCA 4FBXA 1FOTA 3MIAA 4FKPA 2EFPA 2NRYA 4M67A 1FGKA 3QWJA 1ZZLA 2OU7A 2L01A 1KWPA 4FNYA 4JVGA 3MVHA 3EJ1A 3F69A 3V7SA 1YXTA 3JAMZ 1P2AA 1Q8ZA 3LJ0A 5E8XA 3LFKA 2C0OA 5FGMA 1OYIA 5J87A 1T39A 3OS3A 1P4WA 4OLIA 3FMRA 4Y85A 4YGAA 5D9HA 3T8RA 4YJUA 2WTWA 2X39A 4KKGA 5DNRA 4E20A 1CKIA 3KMWA 3GVAA 2I0EA 2M87A 5BVFA 1XH7A 4I21A 3DAKA 3WU1B 1F5TA 1K6OA 4EM2A 1BKXA 4ZLZA 2GS2A 2ZVAA 5EM6A 5HZNA 3FV8A 2HZ4A 3N51A 2DWBA 4JAJA 4FSUA 2YLEA 4I4FA 4QMOA 1M14A 4FV8A 3PG1A 5DCMA 4JRVA 4FKTA 5E8WA 4YLLA 3FMMA 4LQMA 4QMUA 2V1DA 2BALA 2BZJA 4IVBA 4O2ZA 3KP7A 2ETHA 3KRRA 4RJ5A 2L4AA 3VUTA 3IC7A 4QMWA 5CSVA 1Z7UA 3FQHA 2H09A 3VBXA 4NCTC 4ZAUA 5CASA 3KZYA 3LFAA 4X2JA 3Q5FA 2E9NA 2MA3A 2VO0A 2VTRA 2QVOA 2AC3A 4U79A 1IA8A 3IWZA 1YVJA 4BKJA 4DLJA 1JE8A 3N9XA 4EK3A 5EI6A 2PG4A 3LJ2A 3HGKA 2ACJA 4LOPA 4QYGA 3DNEA 2VWVA 1H1QA 3UC3A 1REJA 4RG0A 4DG3E 4QD6A 2Y0MA 2XVDA 5BQTA 3VUDA 5C1QB 3RYRA 4GL9A 3IW7A 1XBCA 2W96B 4P5ZA 4U40A 1XGMA 2K4JA 4NKSA 2BHEA 1UKIA 5M4UA 4QMYA 3LA3A 2EUFB 2WXVA 2E7XA 4WRGA 4M13A 4WNKA 3I4PA 3ZCLA 4FG8A 2P5VA 2W1IA 2JSCA 2XRUA 3MAJA 4CQEA 2JPCA 1S7AA 4MF1A 4XBRA 2HWPA 3PSBA 2QOOA 4IJ9A 2BKKA 4YC3A 1P4AA 4FV0A 4P2KA 1R23A 2EB2A 3W2RA 3QALE 3UVRA 4XX9A 2Z7RA 3EYYA 2IO6A 2YJRA 4IW0A 2H94A 3WGIA 2ITXA 4QMMA 2OH4A 2CNUA 3GC7A 3LFCA 4U0WA 5EW3A 3GUBA 5C03A 3IW4A 3FMEA 1TNSA 4E5BA 2Z9OA 4G3DA 2L54A 3SZPA 2ZDTA 4GU9A 4EJ7A 4KT5C 1MQ4A 3HV4A 3BX5A 2I0YA 3RP9A 5D12A 4BCOA 3FLZA 4YU2A 4BCNA 2PVRA 1MDMB 4DGMA 2IN6A 1JSTA 5L3BA 3W1FA 1ZRFA 1V0BA 3AMAA 4DEBA 3K9TA 2RVCA 2BVAA 4MWHA 4L3LA 2YABA 3ISPA 2YFXA 1KQ9A 3FJQE 2L02A 4U0VA 4BHCA 5AP3A 2Z7SA 1OGUA 4WBOA 4AVPA 3DXNA 2C3LA 2IPXA 4KIBA 2FRHA 3WU0A 5LCKA 4AW0A 1UNGA 3ZMZA 4F7ZA 2QZ8A 1BI1A 3A7IA 4L53A 3UZRA 5D5XB 3WARA 3OZ6A 4CV9A 3RAKA 2EB7A 2F57A 2XASA 3OG7A 1R58A 1O3SA 1KYZA 2QD9A 5BNJA 5AP4A 4U3YA 4BCIA 1IEPA 2W85A 4IH8A 2GWRA 3CQEA 1JKSA 4D0WA 2X0GA 3BHHA 3ET7A 5E18F 3QRUA 5FEQA 3NZ0A 3BELA 1W5SA 5A6OA 4MQVA 3ZPLA 1UA2A 3FY0A 2DU9A 4XSZF 4CNHA 3P4KA 4M14A 4AW1A 3QTQA 3BE2A 3I64A 3KXXA 1U46A 2HGCA 4NWMA 5AR5A 2XJ1A 1PXJA 4RX8A 2WTKC 3I59A 1I1GA 5LXMA 2OI4X 4GFGA 2XV4S 3QF9A 4CMTA 3BU5A 4AFEA 4E4NA 3F82A 3DGKA 4BZOA 4YFXF 2ZOQA 3FLYA 4Y13A 4QMTA 4PTEA 4S31A 2X6EA 4ALVA 1Z1DA 4WNOA 4GFMA 3ZUUA 1XMKA 5CEOA 4AN9A 2GNFA 5EQEA 2IZRA 2JRTA 3R01A 3S1HA 5HICA 3OCGA 5ICEA 3OWJA 2BFXA 3TTJA 3NMUF 3RPYA 3F8MA 4XLPF 2GCDA 4CHUA 5KBQA 2BZIB 4NH1A 2MH9A 2JFLA 5HTCA 2M1BA 3HYIA 4D4RA 3BE9A 2PZPA 5LRSA 1PF8A 3P86A 5EM8A 4L0ZB 3TO9A 5L2IA 3MH2A 3CQUA 3C4WA 4EOQA 4IVAA 3QKLA 4PTCA 3O96A 4BCGA 1Z05A 4ZZLA 4D0PA 3J81K 1GAGA 2R3FA 4AW5A 3A62A 2DS1A 4EK5A 1JAMA 2EXMA 3QTWA 4DBNA 2CDZA 3H3CA 5CU3A 4DEDA 4MQ1A 2DBBA 3QPHA 2D1VA 5BMMA 1YDSE 3KP6A 1IRGA 4FT9A 4IAFA 1DS5A 1LJ9A 5KUPA 5CU2A 3GC0A 4U6RA 4APPA 3ROCA 2E9OA 3I5NA 2YERA 4JT3A 3KF4A 1FX7A 3FAAA 2OZAB 4E6AA 4HVDA 3OY1A 1OITA 5IMEA 2P4WA 3JSPA 3HL7A 3UNKA 3ZFMA 4O1PA 4I23A 4LLLA 4IDTA 2VUWA 5DYJA 2PEXA 3P7NA 2RFEA 5HNIX 3G2FA 4L52A 2VE8A 3WTWC 4X2KA 5L6OA 4G17A 2ZCWA 4ANOA 5JHUA 3H4JA 5CANA 3POZA 4TXCA 3BGPA 1XQZA 4HBLA 3F6VA 1BLXA 2C1BA 4FZDB 4M0YA 5EKOA 2X0LA 4OTFA 4LRJA 3GFWA 2BDWA 3UMXA 3ZM9A 1UKHA 4D0XA 4MYGA 2DK5A 1OMWA 2HAKA 2YDJA 2H6BA 3SXRA 3Q9WA 3KP3A 5E7RA 3E6CC 3UGCA 4OAUC 3COAC 3DTCA 1C0WA 5M55A 4HLXA 3R61A 2ITZA 3R7VA 1ZG5A 2AC5A 3KULB 2ZB1A 5EG3A 5FB2A 1L3RE 1W98A 4JJRA 2ESHA 1FP2A 5DCFA 4BC6A 4M97A 1ZYJA 4YHJA 4ZOGA 2KIUA 3MA3A 5IH6A 3REOA 5A4QA 3P08A 2JT1A 2O5KA 2GQGA 3IW6A 3DU8A 1GXQA 4FV7A 3IK3A 2Q8KA 3W16A 3FZ1A 3TJCA 2I0VA 3UIXA 2HYYA 3HKOA 3LQQA 4F4PA 4GSBA 3CPCA 1HW5A 3P1AA 5CAQA 3A99A 3ZO1A 2O0YA 5BVKA 4EH7A 5ILVA 3AGMA 4N6YA 3PPKA 3I6UA 1LR4A 5A4EA 2QOKA 3HRCA 2RSVA 5ANKA 4OU0A 2FA5A 4LMUA 3BLHA 2HYGD 3TKIA 2V79A 2CFXA 2MH2A 4O91A 5EEHA 3BHVA 3UIMA 2VTTA 2C6OA 2C4GA 4GVAA 4WA9A 2GNJA 2YM3A 3CTJA 2PWLA 2XNBA 1GIHA 3EQPA 4YIIA 3JW4A 4XNEA 3KXNA 1ND4A 1TNTA 2CJMA 4M6YA 3EFKA 4EOKA 2XNMA 5JQ8A 3RNYA 1E9HA 4C36A 3U2RA 2NNNA 1WI9A 2R3OA 2CG4A 3D7TB 5AV3A 5I9UA 4BYYA 3PYYA 4ARKA 5DRDA 2GQRA 4K1BA 3HDNA 2VTMA 1YOLA 4P96A 3PY3A 3LKMA 3TJDA 5F9EA 1U3EM 3WTUC 1DM2A 5AX3A 5T6KA 5D7AA 2BPMA 4UUVA 3UE4A 3ITZA 2V7AA 3F7WA 3LCSA 4EGYA 3QCQA 5FO5A 4BL1A 4EOLA 1U5TA 4ZJIA 3EYHA 4GIHA 3HAVA 5TKDA 2WMBA 2W25A 2A3SA 4YO6A 2GSFA 3ZHPC 3CD3A 1HQCA 4OIRF 3QZFA 4G6LA 4BF2A 4A07A 2XK4A 3HMOA 3KC3A 4YJVA 3H30A 4UV9A 2RG6A 1Q3DA 3EQRA 5IQEA 4ENNA 3I0OA 3LPBA 4BHZA 3QUEA 1OB3A 3CUQA 2FMYA 2W57A 3K69A 2ZMEB 2ITOA 4F09A 1M2QA 4F70A 4XJ0A 4D5HA 2VTQA 3QD3A 1Y57A 1NXKA 4YJPA 3NQOA 3IW5A 2J90A 4MKCA 5LVMA 2VT3A 5IA4A 3NUSA 4RJ3A 3KN5A 4L7SA 4AW2A 5AUWA 1H4LA 4GKHA 1ZLTA 3BWJA 5CEPA 3RKBA 1Z9XA 5ED4A 4ZY4A 5JQ5A 1G6NA 1BI2A 2PVYA 1XHAA 3H92A 4AP7A 1X8BA 5B0XA 2ZFWA 4ENKA 1WVYA 5LARA 4HF2A 1VZOA 4CG9A 2O2UA 2R3PA 3F5PA 3V5LA 3JY0A 4FKRA 3TG1A 2ZM3A 2DPDA 3G51A 3NCGA 4L43A 3IG7A 4HLYA 4OTGA 5CLPA 4OIQF 5EOBA 4BCJA 5IA1A 2R7FA 4ESJA 1BI7A 5JI6A 2I40A 3M11A 2XVCA 3PE1A 4GKIA 3TNIA 1JSVA 5JT2A 4KICA 2VRXA 3S4QA 4CYJA 2QWWA 4K0YA 4ASEA 3UYTA 3E3VA 1R7JA 3RAHA 2W5HA 2KIFA 3BEGA 4PL5A 4WG4A 3ZRLA 5HNGA 2G2FA 3BYVA 1UFMA 4I92A 4AZTA 4NJ3A 5F95A 1GNGA 1T2KA 4JBAA 4DNCA 2VX0A 3OWPA 4F9AA 2G9XA 2F5DA 3MH0A 3WE2A 3P23A 2VTJA 1OPKA 2OWBA 3KCFA 2Z7LA 3AMYA 3W8QA 4C58A 3F5GA 5BPYA 1P6RA 2XYUA 4YZCA 4MAOA 3GU6A 4FICA 2VBXA 4J96A 2PUIA 5FM3A 4IXAA 1TKIA 3IQ7A 1ODDA 4J1RA 1PXIA 2EA4A 4FIHA 3TQNA 2HW7A 4F9BA 5E20A 2KKOA 4D4VA 3Q3BA 4HNFA 4EONA 3FL5A 1R1WA 3BBWA 4U7BA 4CKIA 3NLBA 5LVPA 5FLXK 5E8VA 4LYNA 2QKRA 1BL7A 1F5QA 1OBDA 2C6IA 2VTLA 3EMGA 3TZMA 4GT4A 3DBEA 2PUUA 3KVWA 3L09A 2MBFA 4HCUA 4UBAA 1O6LA 3T8OA 3JY9A 1M2RA 3OCTA 5JFRA 3MFKA 2XK7A 3AD6A 3GU8A 3U87A 2YLFA 4RZWA 1Z5MA 5KKRC 2VZ6A 5FRIA 1WBVA 5DHJA 2XKPA 2RN7A 3EZRA 5L8KA 3OY3A 4MXAA 3BOQA 3ALOA 3DXQA 4I98B 1ZWSA 3HRTA 4YMJA 4EOOA 2JAVA 1R22A 4C38A 2QVSE 5L3EA 4OIPF 3WF6A 2HDCA 4WF2A 4RQKA 3QCYA 2Q0OA 2GIVA 2G2HA 2OXDA 4G1WA 2G2IA 2B9IA 3WI6A 3RVGA 4C34A 4CGAA 4HVIA 2E2BA 5AR7A 3ZQ7A 3UJGA 3LCKA 3V5PA 1PKDA 3A8WA 1JKKA 3D83A 5DIAA 5AJQA 1ZY5A 1D8KA 2F49A 5L2TA 5BMSA 5L6PA 3OD6X 5IPJA 3UZTA 4YSMA 2YEXA 4EL9A 2XNGA 4MEYF 3PP0A 3THBA 4BCMA 4IAAA 1JWHA 3RIRA 1YTYA 4ZLOA 3VRYA 5A2QK 4IAKA 2WMSA 5E1XA 4IWPA 4XV2A 3G90X 4F9CA 1GVJA 2K02A 2RL5A 4PDKA 3DQWA 3UDBA 3KRLA 2OSCA 3E87A 3MI9A 3FMHA 1WBSA 2OIBA 5CYIA 4HGEA 1OM1A 3ZEWA 3A8XA 4CZZA 3NNVA 4LRMA 4FTTA 1WVWA 1BIAA 5AFVA 4FKSA 2LAVA 5HE0A 2F9GA 3HRSA 4CFMA 1P4XA 4FKVA 3FZPA 2UZVA 4XG4A 3W2PA 4DCAA 2P5LC 4C4FA 4QRCA 4F7SA 3BYUA 4IRGA 1Y0UA 2EFQA 5IDNA 3ZP5A 1EH7A 4LB5A 4F9YA 5IA3A 4QWQA 4C3FA 4OAVB 4Y15A 3UYSA 1URWA 4L01A 3DKFA 4J97A 4C3PA 2R3KA 1V0PA 2BGCA 3GXLA 4FOCA 3Q96A 1SMYF 1PKGA 5FP6A 3GZ6A 3F8NA 5ANDA 4EK8A 4O6EA 2QUFA 3SX9A 2GPHA 3Q32A 2YCRA 1BL6A 5K0XA 2X7FA 4P55A 5H3QA 5DD8A 4HF0A 1M52A 4H39A 2Y4PA 4QP3A 2EFOA 2YACA 3FXRA 1Q97A 1ZYRF 4R3CA 4BDFA 3DLZA 3GX4X 2ZMDA 4DH8A 4NB5A 3OT8A 2OF2A 4BFMA 4O0UA 4G7ZF 4Q48A 2VNWA 3NSZA 3OC1A 2HZ0A 2CCHA 1R3CA 1OI9A 2NP8A 4B6LA 3VBTA 4BVUA 2F5CA 2YM7A 4AF3A 4D2WA 2W1CA 5M07A 3FUPA 4ALWA 5A54A 2XAJA 3FSKA 2BIYA 4IHPA 3KCCA 1OYYA 3N4UA 2PFBA 4ZZOA 4FG9A 3ZONA 3E88A 5HIEA 2UZOA 4AOIA 1XCVA 1IN8A 4IPAA 4QTDA 4TKSA 5IG1A 5D41A 3CTHA 2J0KA 4ERWA 4QMLA 3V8WA 5GJDA 1WRJA 2BILB 3TM0A 2XS0A 4QP1A 1BUHA 4KSPA 2IW5A 4X3FC 1PXOA 4E4LA 1B39A 4G5PA 2EV0A 3NVMB 4FX0A 5BPIA 2OICA 3C4EA 2W1EA 4JL9A 2JDOA 4MCVA 3LMHA 1Q8UA 2ZM4A 2WFYA 3Q4CA 1MJ9A 3B8RA 4YP8A 5GZ8A 2R0UA 5HDNA 4AIKA 2X6DA 1ZHFA 3SV0A 2AS5F 2JLDA 2M8EA 3KMMA 4ZXTA 3M8FA 4UV8A 2P8TA 2BDJA 4GG7A 2PQ8A 2PE2A 3DDPA 3JUHA 4LGDA 3WTTC 5KX8A 3F7ZA 2FMLA 1SYKA 4G3CA 3PJCA 3PVWA 2QQ7A 2V5QA 1R1VA 1IASA 3F3UA 3V7CA 2SRCA 2CNVA 1B38A 2YM8A 2W1GA 2QM3A 4KABA 4JR7A 2GS7A 3VF9A 1XJDA 3RGFA 2W9FB 3ZC5A 3E7VA 4QP7A 3C1XA 2WC2A 4TN6A 3PLSA 5A14A 5HD4A 3MFSA 4TNBA 3SQNA 5KBRA 4O86A 2NO3A 1OR7A 3TDUC 4C4GA 2PUPA 4IVNA 4HNIA 3QAME 4OBQA 5JFWA 1Y6BA 5I4NA 1R78A 3ACJA 4L6QA 1Q61A 4U45A 3NAYA 3EETA 3RKWA 4I5MA 1JSUA 3KRXA 3D7TA 4GRBA 3B8QA 4JQEA 5JVTA 4YNOA 2WQOA 1FOKA 1OPJA 3ZN0A 3R7UA 1G4DA 3IKAA 4HW0A 4E26A 4TT7A 4BDKA 1XD7A 4EWQA 1H01A 4O0XA 4FV1A 5ANGA 3HAMA 4DTKA 3T3VA 2WMXA 4OTIA 2XH5A 3F23A 3HV3A 2RGPA 5LGNA 5FXQA 5DEYA 4ZK5A 4EOMA 4RWLA 5IUGA 1TW3A 4Y8DA 4QTCA 4O0YA 4IZAA 3KP4A 1NVRA 3QUDA 2XGXA 3RWPA 3U9NA 1Q62A 3IHUA 3RPVA 4KKEA 3ZFXA 4I0RA 4R77A 4MVFA 3GLXA 2CGVA 2RC4A 1YI6A 5DE2A 3EOCA 3LLTA 4CG8A 2CQKA 4BWPA 3NUUA 5CTPA 3CR0A 1B4AA 5EH0A 4GEOA 4EYMA 5FTQA 5DUIA 5EYCA 3A2CA 3HV5A 5FDXA 1W4MA 3RK5A 4ERKA 5AONA 3VAPA 3DTWA 3V5JA 3IECA 4PTGA 2W1DA 4G34A 1J91A 1R5HA 3KY2A 2V62A 1IXRC 4DFZE 3CD8A 4LUEA 3RK7A 2BRMA 3LAPA 4HV6A 3OWLA 2RFDA 4AN2A 1RZ4A 1P4OA 4U0IA 4EV0A 3QL8A 1SD7A 1F3MC 3U51A 4IE9A 2LF7A 2C6EA 4IFGA 3TV6A 2HXLA 4FVPA 3H9OA 4Z7GA 2UUEA 5KKRB 4L0YB 4JRNA 4X21A 3FE3A 2STTA 2ETKA 1W5TA 3GOPA 4ZZNA 5A9UA 2ISYA 3R0JA 2BEOA 4PMSA 1XDSA 1UV5A 2AUHA 2VTSA 5M08A 3V5TA 3HMIA 3FI4A 4N70A 2JBOA 4WBBB 4W9WA 4HCVA 3G0EA 3RYPA 3GU4A 4W4YA 3P0MA 1I27A 2HKXA 2VU3A 3UMWA 5AA9A 3OW4A 5E1EA 3TNPC 2PVMA 3KLOA 4DG2E 4RGSA 3UODA 2XIXA 5EDRA 3BLQA 2XBAA 5EEGA 3OOMA 3C5IA 3FQSA 4MNUA 3G0FA 1FSEA 4A9TA 5CWZA 2XIGA 2VGOA 2PMHA 5F64A 3SD0A 2BIKB 1QPJA 3RPRA 3CS9A 1KYWA 1BBYA 5JZJA 3HV6A 1L0OC 5G1XA 2WTJA 2BR1A 1JOWB 3TL8A 2FB8A 5J7BA 4GS6A 1I44A 1LEBA 2FSLX 1J7UA 4BIDA 3AC5A 4XRFA 2QENA 2Z8CA 4EHGA 2DW4A 2F2EA 1BI3A 3LFBA 4M72A 3R0AA 1OKYA 5D4RA 4OBPA 2XKDA 1XH5A 3EQIA 5FEEA 4I09A 4LK1F 4I22A 3PG3A 2AXLA 4A2UA 2XIRA 5CAOA 2C30A 2HENA 4MXOA 4KSQA 2CSOA 4XG8A 3PTGA 3IPHA 4AFJA 2IVMA 5AV2A 1ZGJA 5CQUA 5AUUA 1URCA 3N4MA 3DJ7A 5C4KA 3B73A 3O7LD 3ZRMA 4EWHA 2ESNA 4FKGA 5BUJA 3D9VA 2B9JA 4U88A 5KMKA 5HTIA 1XGNA 2ZJ2A 4QP2A 5HX8A 2QNJA 5DN3A 3SGCA 4MH7A 3N4TA 2W84A 1B1BA 1ZYCA 4FSRA 3CC6A 1UHWA 5I9VA 4E7WA 4XOYA 4G2FA 4WIHA 4NT4A 3S2PA 4BIEA 3S95A 4O0SA 2YCSA 2JBPA 4B0GA 5EQYA 3ZLSA 1DP7P 4QQTA 3ZSIA 3NUYA 1SZMA 3CLYA 4GW8A 5K5QA 4UMQA 4BI0A 1YDTE 4Y73A 3BU3A 4FT5A 4DEGA 5IQGA 4IFCA 1R1TA 1HOWA 5CEIA 4ZSEA 3HV7A 3K3IA 4B8MA 2C3IB 3VBYA 1F4KA 3FMDA 4IIRA 2ZM1A 4BDCA 4BHBA 2WMQA 4WUNA 4DC2A 1RW8A 3D5VA 2J4ZA 4N9HA 3BJAA 3U9CA 2HCKA 3QD4A 4PNIA 1L3LA 3E62A 4O83A 3RDIA 4QO9A 2PVNA 5JR3A 4M6XA 4ANLA 5CF6A 2ZBKA 4RVTA 4HYSA 4C2VA 1D8JA 1ZOHA 4F9WA 5B2KA 3NAXA 1J3HA 3E64A 5A2QZ 3C4ZA 4PP9A 2UVXA 2C6TA 3EN6A 2R3JA 3TNWA 3Q6WA 3K2LA 3R28A 4RT7A 1K78A 2D45A 3CUOA 2HIWA 4N0SA 3R22A 4U7DA 3FQEA 3Q60A 3TI1A 3MJ1A 3Q4ZA 2W4KA 3BY6A 3ULZA 4LGHA 4GXOA 1V4RA 4TRLA 4OMYA 3LE6A 5GHVA 3TN8A 5C4LA 5D10A 3R9OA 4JG8A 2GXGA 5C27A 4GU6A 3Q2JA 1T0FA 3R2YA 3JYAA 4F6SA 4I24A 1OKZA 4RFMA 1J7KA 4MEXF 2C6DA 4QMZA 1TVOA 5CX9A 2FU4A 3R73A 2O63A 3M1EA 2R3SA 3CTQA 4WK8F 5ANJA 3D5LA 5K9IA 2B0QA 2CLXA 3GUDA 3I58A 1M7QA 3M1SA 1BC7C 1PYXA 1EH8A 2C6KA 2EFNA 2Y75A 1XO2B 5JGDA 3ZH8A 2HOGA 5IT3A 5HNBA 3H3UA 3QQJA 5E8UA 1S6LA 5I0BA 1ON1A 4EUUA 3ID6C 5JRQA 1YYVA 1OL6A 1UCRA 5AIQA 3VULA 2FF4A 4BI2A 1WBWA 3LAJA 4WSQA 4FEVA 3QRJA 2WQMA 1XH8A 4YJTA 2IVSA 4QYFA 4BGHA 1YKRA 2Y0AA 3O0GA 5IEXA 5CVRA 1WVXA 3PPZA 4M74A 1IG1A 4LG0A 2R3MA 3CSVA 4P5OA 2Z2WA 2A19B 4XLIA 1JHHA 1IF1A 3K54A 4GGGA 1ON2A 2UVYA 2XAGA 2JPBA 3R7IA 3Q9VA 5E91A 4AZVA 4ANSA 2X7GA 4L9JA 4AD9A 3QKKA 4M84A 3U9GA 5TT7A 2J7TA 1YQAA 5TR6A 5AWMA 1OL5A 3DLSA 4WKQA 4FHTA 2RNJA 2C6YA 1WZYA 1XCBA 2WMTA 5FFZA 1PXMA 5CS6A 3RI4A 2ISZA 4M69A 3VB2A 2A6EF 5DCMB 3VUMA 3NYVA 5KHXA 4M9SA 3WYXA 1Q99A 3MVMA 3JR1A 2XK3A 3F6XA 2VC1A 1O3QA 4C37A 2QLUA 1OIRA 4ZTQA 3E93A 1IUYA 1MQBA 5CVUA 4W4VA 5CSXA 2YIYA 4MTAA 1WKMA 5HKMA 4EH8A 2ZMEA 1J1BA 4FEUA 1UB9A 4XP2A 4E6DA 3VS5A 3LFQA 2QOHA 5JRSA 4PWNA 2HYFA 1MD0A 2IP2A 3GFLA 1H1RA 2E1NA 1HBXG 2OGVA 3RKYA 4K8AA 3GU5A 3OBGA 1B6AA 4QQCA 2NPQA 3DFCB 4EJTA 5HG9A 3TUDA 3OCBA 2E9UA 2P33A 2PMIA 4TWNA 3BKBA 3FMJA 5JKGA 2Y48A 1DAYA 3E97A 3QC4A 4UB7A 2X4FA 2WIPA 3HP5A 2PZYA 4I6HA 3EN4A 3QFVA 3EN5A 2R7IA 3IDPA 3T0YA 4NFNA 5IA0A 2OJFE 1H1WA 3J7AO 4DFNA 4EOJA 1SFXA 4ON0A 5HS8A 5D1JA 1AGWA 5EHOA 2TDXA 4M12A 5J9YA 2QOFA 4FX4A 2UZNA 5F4NA 2O3FA 4Q47A 4I4EA 3GXOA 2PE1A 1UWJA 2XNNA 3SRVB 4D9TA 4L9IA 4ZTHA 2CMWA 4ZTLA 1A9UA 4FSTA 2ERKA 4EHZA 5HLNA 2GA2A 2ITQA 1SMTA 3IKTA 5BYZA 3HP2A 3DKCA 2B9FA 5AIRA 3AQVA 4TYGA 1SM2A 2XJ0A 3E92A 4KBAA 3ZMUA 1G3NA 3EYIA 4FZ7A 2PVFA 3IO7A 2VWUA 2JKKA 4FR4A 5HLHA 1VEBA 3MPMA 4PPCA 2WTIA 1FVVA 4TYJA 5ANOA 3QKMA 3GCQA 1ZREA 1NA7A 3FPQA 1E1XA 3L1SA 1YXSA 4ZMFA 1ZAOA 3ZU7A 1JVPP 4L42A 4D9UA 4AE6A 3FZVA 4CZTA 1ONVA 4XS2A 5JFXA 5IUIA 1UU7A 4O0RA 5L3GA 4AWIA 4D55A 3GNIB 3FX3A 2PJPA 3LQ8A 4MD9E 1VR2A 2QU6A 1USSA 3F8FA 2P4IA 5AAFA 2OJIA 2WHBA 3QWKA 4S32A 4CFFA 3QD2B 4KKHA 1EH6A 2BMCA 2PZ5A 4V04A 4BIBA 2H6DA 1MJBA 4C2WA 4JQ7A 4ZTRA 1XN7A 2O61A 4EQQA 2WU6A 3FLNC 1UU9A 4YTHA 1FC3A 5T68A 3SOAA 4FT0A 2BRBA 4ITHA 4OW8A 4FVQA 3W2CA 5HOAA 1LEAA 2VO3A 4OINF 2GA1A 2X4ZA 3LOKA 3ZLXA 1M17A 3REPA 5AADA 5C9CA 4JX3A 2FSOX 1YG2A 2VD5A 4ITIA 5E90A 1XSXA 5AP5A 4JAIA 3R6SA 1V3FA 4ID7A 4FTOA 3R8MA 3G9LX 2R3GA 3FHRA 4WG5A 1ZMVA 3P9KA 4BZDA 1WBOA 2OO8X 3H0ZA 5J8CA 5DUKA 3FXZA 1LDDA 3VF8A 3DQXA 4IJAA 4M3QA 4RS8A 3M7GA 2Z5UA 3SVVA 4F08A 3DFAA 2WMVA 4YJOA 3D15A 2HQRA 3VWAA 2GQQA 3NW6A 2H96A 3C4XA 4P9UA 5CSHA 1FMOE 4IC8A 2ZAZA 4DFLA 3PXKA 4RWJA 5KMNA 1WAKA 4C8BA 2CYYA 2B54A 3HSFA 4NIFB 4KA4A 3MWUA 3ZMSA 2CKQA 4IB3A 5DLSA 2UZUE 4FE2A 4XV1A 3QRFF 3DNDA 3FZSA 4JXFA 4YLKA 2K86A 3TNHA 3SQQA 4QYEA 2RFSA 4FTCA 1YFHA 3NNWA 4G31A 4TV7A 4YBJA 3EKKA 4JBOA 4MGRA 2R4BA 2IZSA 4L18B 3LCTA 4V0GB 2O8XA 5D7VA 4KIOA 5KMOA 3UQFA 2WQNA 3ELJA 4RC2A 4CFVA 4KINA 3RAWA 2OIDA 4E5AX 5HORA 2P6TA 3KFWX 4R5YA 3KF7A 3UOLA 3Q04A 2QG7A 3U54A 5JZNA 3UC4A 4H3QA 2A5YB 4IEBA 4PMPA 2UW7A 1KE6A 5FTOA 4R7BA 1FWZA 4YNEA 2CSNA 3D5XA 3O17A 4ESFA 4X0MA 3FL4A 4JI9A 2OJGA 1BOAA 3I7BA 3BROA 3FWQA 4UMPA 4Q5HA 1PMUA 4F99A 4P5QA 4QTAA 3VS6A 3LXPA 5DD4A 3OEFX 4FGBA 3BU6A 2XK6A 3HNGA 3AC8A 1J7IA 3BEAA 3MFTA 1KOAA 1R00A 4EJNA 1RI7A 2WU7A 3UOJA 3OUKA 4UZHA 4F0IA 5IT9K 3PQJA 3RCJA 2X81A 2YM5A 4ORKA 4D2SA 4M15A 1JHFA 5HVYA 2CKPA 2I7QA 4TTHB 4AGUA 3JVSA 3V4GA 1H0WA 4R78A 4U8ZA 4I7HA 2HY0A 4JDHA 4Q5EA 4A0XA 1XBBA 2VTNA 4FNWA 3L00A 4A0ZA 2O6GE 3BHTA 4X2FA 1PXKA 3R1QA 3SOCA 2Q83A 3ZZEA 3KRWA 3K1NA 4HCTA 4BGGA 3FEGA 1J75A 3DB6A 3PJ8A 4HAMA 5FM2A 4A5MA 3TZ7A 3K2ZA 4S33A 3KEQA 4FVRA 4I01A 1ERKA 1PMEA 3AGLA 4RIXB 3F2AA 4DAWA 3HYHA 1Z9CA 3QQFA 4WT6A 1QNTA 1WBNA 2JKMA 5J9LA 1YWRA 1MDMA 2JIUA 3W55A 3VUHA 4C02A 3ZSGA 3R7EA 3BJOA 1SNUA 4CO8A 4MXYA 2YDKA 1MKMA 4TWPA 3HSEA 3ZYAA 5JSMA 4XG7A 4LI5A 5AUZA 4A9YA 3FMKA 3AMBA 4MF0A 3VRZA 3ZO3A 4S04A 4AA4A 3FWEA 4F7JA 2OA4A 1O7LA 4HGSA 2F7XE 3H9RA 3BV2A 2B9HA 3PXQA 4DTBA 1JGSA 3DK6A 4BCQA 5LGTA 2XEZA 1EV7A 2X2MA 4KIGA 5KK1A 4J8NA 2GFCA 3EKNA 4HV5A 2BKZA 2XA4A 2X4HA 3MY1A 2QQBA 4BDJA 4CCBA 4W9XA 2VWYA 2VBZA 1GY3A 2DT5A 4YTIA 4B9DA 4JLCA 4DTAA 4FK6A 1YS6A 3B2TA 2CGPA 4F7NA 1HSTA 2JIVA 4RX9A 2A6HF 2ZNYA 3R9RA 1FBQA 3BPVA 4BCKA 2YWPA 3JS2A 3J80Z 2RF9A 4FV9A 4LD5A 3ORPA 4OUCA 2B7AA 1QPEA 3RPSA 1LEWA 2PSQA 4XV9A 5D5VB 5EW9A 2VODA 1OKRA 3FC2A 2XIKA 1UU3A 3GT8A 1K9AA 3MY5A 1HW1A 1VJYA 2X8EA 4ENYA 5HLWA 3S00A 5E8SA 2Y4IB 2XNOA 2UXNA 2QOBA 1AWCA 3W32A 3LMGA 5J6XA 1BIBA 3R00A 4XSXF 3WG9A 3PRFA 1S9IA 3EQBA 4YBKA 4DFYA 1KV2A 2NNYA 4IXPA 2HELA 4EHEA 3ROUA 3LFSA 5AUVA 3L9LA 4FK3A 3ZBFA 3PJ2A 3Q5ZA 3W6JB 4D58A 5CZIA 3G6GA 3H0YA 3WF8A 1H07A 4BCHA 4PL4A 2V6CA 2QCSA 4HYHA 4JOAA 3COKA 4WRSA 4RWIA 2C0TA 5HCXA 3KU2A 2P0CA 4PV0A 5CNOA 2PK9A 4CDGA 3I4BA 1HCLA 2W5AA 3D5UA 3C1DA 1R0EA 3MESA 5D8LB 2QR7A 5T3QA 1YXXA 1KV1A 4ONAA 4YIFA 3KEXA 3G3ZA 2ITUA 4O96A 4BDDA 2BTRA 4EI4A 1FMKA 3I60A 4O84A 5KMMA 5JGBA 2B4SB 3A7HA 2O64A 4RJ6A 2EB3A 2W1FA 2YN8A 4LUDA 3Q9ZA 3MVLA 2F7EE 5ICPA 3O23A 2CNQA 4FKJA 5AAEA 5CSWA 2R64A 3QP5A 4ZJVA 4A12A 5TE0A 3W18A 5DR9A 3M8EA 4YUQA 1MRUA 4CYIA 1FINA 3GOKA 2L4MA 1OECA 2EVAA 5L2QA 4UALA 3D2KA 4HPUE 5AP7A 4QMXA 3GF2A 2G7UA 4A06A 1LPUA 3EIDA 2BTSA 4BYJA 2FSTX 2QYOA 3UO5A 4E1ZA 4GT5A 1XKKA 3W8LA 3KP5A 2GXBA 5E92A 4YJQA 2PUNA 5IA5A 1DI8A 3F22A 3KFAA 5AR8A 4YC8A 4AAAA 1B59A 4HZSA 2XUBA 3L2CA 3WTYC 4QMNA 3ECHA 3JTGA 4PPAA 2IVUA 5CT7A 2C6LA 2PZRA 3HECA 2WPAA 2XUUA 3DK7A 3O6BB 4O81A 3G5DA 4FIFA 3W2QA 4CV8A 3SA0A 2BV6A 2IA1A 2OKRA 4LG4A 1S9JA 5CVGA 4X7QA 3RPUA 2B55A 2O65A 2JFMA 1ZRZA 1OMIA 3NYOA 4KMFA 3WTZA 3DPTA 4BDBA 2OG8A 3HMMA 5IQDA 2QOIA 1GXPA 5DA3A 3VVHA 4KB8A 2Q0NA 3PDTA 5GNKA 4GV1A 1B9NA 4BY9E 4R1VA 1B6CB 3R60A 5EYMA 3LFDA 4NQWA 4B8LA 2PLYA 4HA8A 3DJ6A 4RIOA 1UHMA 3ZMDA 5IKWA 3NRVA 4YJNA 2NAZA 4EMSA 3PUPA 4ANQA 3A4PA
chains in the Genus database with same CATH superfamily
3HOWJ 4D2RA 2F2UA 2O7OA 2ZSHB 2BY0A 2PBIA 2V55A 4DH7A 4ASZA 3NUXA 3H36A 1KU9A 5CF4A 5FRMA 3TW7A 1YOJA 1H88C 3TDVA 1H26A 2R5YA 3DDQA 3WIKA 3R04A 1Y56A 1YRNB 2CGXA 4ZYDA 1DUXC 4IZ7A 2K9SA 3NEUA 3BQRA 3ERKA 2QO2A 3R30A 5TJJA 3L9MA 5EZHA 5FG8A 2ADUA 4F0FA 2QU5A 5CLSA 3PVUA 1E1VA 4H36A 3DZOA 4RVKA 3SG8A 3OSGA 5GAEJ 1LEZA 3NX8A 5HS7A 1Z21A 3EQLF 2RKHA 2XM8A 2VO6A 4ZP5A 4KNBA 3O50A 4O7YA 5AIKA 3WZKA 3DTKA 3N97A 4A9UA 5CAUA 4PQNA 3V3VA 3RI1A 4DIQA 2WTVA 3HMPA 4EH3A 4A3GJ 4S34A 4V01A 4PGGA 3NWWA 5AR2A 5BVNA 2KJCA 3HUBA 3U8WA 3RAIA 4E4MA 2N8GA 4DEIA 4EBWA 4IRIA 3LSTA 2IEKA 4HYEA 3LFEA 3VHEA 3I55I 4DZPA 4XG3A 3QQHA 2C1AA 4KMUX 4WXCA 4B99A 2QBYB 4A4OA 3Q5IA 4R1YA 2STWA 2X48A 1IA9A 2FQ3A 1O9UA 4KNYA 2FBHA 2LBFA 1U0JA 1ZMUA 4O4CA 2EFWA 4ALUA 2C5OA 3CCNA 3ROYA 1H9TA 1DPRA 2W4JA 4B4LA 2WTDA 2XHKA 2YHVA 5FBOA 2I5UA 3OF0A 5IQHA 4PNKA 4O4DA 5H9BA 1VQ6I 1RUOA 3LSKA 5JK3A 5C44J 2E2HJ 3LW0A 4AT3A 4M8TA 2UW0A 2TRTA 2PE0A 3RTPA 4D2VA 4QEBA 3W33A 1OJLA 3SKCA 4AGDA 2P3GX 1P92A 4G6OA 2MGQA 3HOZJ 4H05A 4NW5A 4BE0A 1PUEE 3KX2A 4DFUA 4KA3A 5HU9A 4MX9A 1B9MA 3MD2A 2CQ7A 4JBPA 1QRYA 4NIFA 2VL8A 2HU9A 3S32A 2HI3A 4RGXA 5CAVA 2H1KA 2KRHA 3CPBA 5L3FA 2LTPA 4Z2YA 1LVAA 2Z7QA 5A4TA 5IH4A 2W7NA 1D0ZA 3CY3A 3GTOJ 3FHZA 2A05A 4CD0A 2FBIA 1OPLA 5HNFA 3GFMA 5L8LA 2I1MA 5ILUA 3TL4X 2EXCX 4HGTA 2DPUA 3TO7A 2O0UA 1SAUA 1NHAA 1MNMC 3QPLA 4N4SA 3H3ZA 1MW7A 1KA8A 2DJNA 4G6DA 4FV2A 3EHAA 4GIIA 3OYKA 5AIPA 3QHRA 1DDNA 4XG6A 3S17J 1ZY4A 3VS3A 5D8KB 2DFIA 4U97A 1OL2A 4RGUA 2L7MP 1N77A 2WAFA 4D28A 3OSFA 3VUIA 4L7FA 3RQIA 3HJEA 3GGFA 1RIOH 2OD5A 2JUCA 4LOQA 2C47A 4UN0C 5GJFA 4FG7A 3CLOA 4I94A 4RX7A 3AC2A 4JDIA 4NM0A 4D2TA 4DT9A 5E3MA 4ZJZA 4EC9A 1PXPA 1XDUA 5HIDA 1S7EA 4EH6A 3IH4A 3IGGA 4EH9A 1KUTA 2DMQA 3ZMMA 2DUVA 1YXVA 2WQEA 2EA2A 3PQKA 2ZSIB 3F8BA 5HIBA 3QPTA 3FZOA 2UXXA 2DA4A 4ESBA 3E6DA 4PL3A 5F6FA 4IVCA 4F65A 1DQUA 4L46A 2V1UA 4PRJA 2CGUA 4PDPA 1OISA 1VFCA 5GIOE 3ZS5A 3Q6UA 4WCGA 4FL3A 4KAOA 2YM6A 5CEMA 2HDDA 5BVDA 5HHWA 5CU0A 3WZJA 2RAEA 4F6WA 3R8VA 4ACGA 4ZYHA 2XGCA 5HD7A 3WZEA 5EI8A 1MUOA 3M9AA 2HFHA 1T6SA 5K5NA 5CI6A 2JA2A 4DCEA 1E2XA 5M09A 3FKJA 5CEQA 5HODA 3L2WA 2W4OA 3OYLA 3WTXC 4XUFA 2CGWA 3C2GA 2LYCA 3PXYA 1H8AC 4E93A 4N6ZA 3Q2MA 2DOFA 3QBNA 2BUJA 4BY1J 5K5OA 5L4QA 2DFHA 2O8KA 4OTQA 5J3LA 3OXTA 4UXQA 9ANTA 3HHHA 1POGA 1QPMA 1KU2A 2E35A 2XYNA 1QVUA 3HM5A 3ERED 4MK0A 3CC4I 1W84A 3PA5A 4EJVA 3DEWA 5C8NA 4OTHA 3VYSB 2BXZA 4RLLA 3VS7A 3OHTA 2CQNA 1K4SA 4LG0B 2QODA 5BUIA 4RBLA 4U41A 1IAWA 3E6MA 4O7VA 1XWSA 4CMUA 1FJLA 1WFXA 1VQNI 2WAJA 4IJPA 2OZ6A 4J99A 1LQ1A 1MRYA 4HOBA 2PTKA 5D5UB 4RAFA 2ZV8A 4I93A 4IX3A 3NDMA 4RMZA 1PJKA 2XAMA 1Q8WA 1O4XA 4AGWA 4N0BA 1YHWA 4EH2A 3SG9A 5F1RA 4IM2A 4HRIA 2E34A 3F5XA 1WBTA 3DP7A 4DLIA 2VGPA 2OBJA 5B66C 5L2SA 4Y5HA 4LV8A 1VYZA 1I1SA 5EI2A 5BQ0A 4PSXA 3PWDA 3GTLJ 5H2FC 3TIYA 3CMEI 1TZDA 2JDRA 4A7CA 4RLKA 4NM3A 4UXNA 3R2BA 2I0HA 2HWOA 4IX4A 2IW6A 2B7EA 4NW6A 2YU9J 1OIUA 2JC6A 4UEUA 3HKZN 3VBVA 2QF7A 3HXLA 5DG5A 4YJSA 4JQFA 5FLXZ 3QRKA 1FP1D 2DA1A 3F3XA 4JDJA 4W4XA 2M9HA 4M3BA 2I10A 3MBLA 4OIOF 4CSWA 3FSFA 4AWXB 1W36C 3OW3A 3UVQA 4P7EA 1RKWA 5DVRA 3BIZA 3HEFA 5ETFA 1CDKA 2QC6A 2AEGA 4PF4A 3TGNA 3E8CA 5HE3A 4D5KA 2W17A 4IL6C 3T8TA 4ZSLA 4JQ8A 4C61A 4EZ3A 2BBYA 5M4CA 4IWOA 4HX8A 2BE5F 2M45A 4PJLA 2ESMA 5IP7J 2FO0A 3TDZC 2WMRA 2DLLA 2VQLA 3J7YJ 2D5VA 4L68A 3ODZX 1FYLA 4P9FA 4K18A 3LLAA 1X19A 4DYMA 3S15J 3MB6A 3QX2A 1GLNA 2E1CA 2HZIA 2QHMA 4AM3A 1XSVA 4BYIA 2E7WA 2QOQA 3VS4A 2GNHA 4DEHA 5HTBA 3R7OA 3VPRA 3V8LA 4EOSA 1U2WA 5TOZA 4MXZA 3MKZA 4OT6A 4AZWA 2J0MB 4MQ2A 4KT6A 3OYMA 1ULYA 3RPQA 5ACBC 3VEPA 4XLEA 4HX7A 2LRDA 2IGMA 1YHSA 3BWFA 4XRJA 4U44A 4KJZA 3DEEA 4M7IA 4FIEA 2LNBA 3F6OA 1A31A 3OFMA 4D2PA 3TDWA 1YRNA 3H0DA 4NFMA 3FMLA 4JR3A 2IXSA 4C2UA 2YPRA 2ETMA 4Y72A 4Y7NJ 4QP6A 1R5ID 3AD5A 4W4WA 1H27A 2AYPA 3ETAA 3UG1A 4CICA 2QHNA 4RAZA 3NUNA 4R7IA 3EZVA 1H1SA 4DGNA 2K9LA 4MBLA 4DFBA 4J19A 3M4OJ 1FIPA 2NXNB 4KBCA 3AT2A 3DKWA 2H34A 4RIWB 1FBNA 3ZQLA 2BRGA 4C0TA 5M06A 4HZRA 4Y17A 4A5NA 2GZWA 4L67A 4ZH4F 3W6VA 4YC6A 4R3PA 4XQFA 3TV4A 1GOLA 2XAQA 4ZJJA 1EJ9A 3GFJA 1H89C 1J7LA 2KRFA 4AIJA 4E6KG 2VE9A 5K3YA 5AP1A 2QO7A 2QKWB 2DQLA 1RUNA 3BQCA 3ZUTA 4O2PA 5J8IA 3HA8A 4KRCA 4U81A 3F2RA 3G6HA 4MWIA 1B72B 2ITPA 3ODYX 2A61A 2BY2A 4BHNA 2DFEA 3PZEA 3RMFA 4UYAA 5FKNA 1P9QC 3IONA 1CSNA 3A4OX 5JGAA 3UBDA 1NVSA 4MD7E 2VWWA 5FP5A 3LQRA 3K0LA 3KEOA 5J8FA 2OUMA 2VOPA 3KYLA 3SW7A 4Z6YA 4FTMA 4RQVA 4L9TA 1G3YA 3PFIA 3DY7A 2BHYA 3F3ZA 5FFXA 4I6BA 1K3AA 4AOTA 4BDIA 5H6RA 3EN7A 1UNHA 1Q41A 2VN2A 1A04A 3KETA 3B6AA 4CYCB 1OCPA 4AIHA 2XAHA 3MFUA 3NEWA 3DXPA 3BP8A 3MZHA 4FSWA 4AAYA 3OIQA 4P4CA 5IF1A 2EQRA 4G6NA 1ZRDA 4FMQA 3FXXA 5CVIA 4HDVA 4HVGA 1WCCA 5HO8A 1ERDA 1STZA 4FNZA 3RPOA 1XB4A 4O27B 3RQ4A 5KMLA 3VFZA 2HEOA 4A3FJ 2VX1A 2ZDUA