1ZAOA

Crystal structure of a.fulgidus rio2 kinase complexed with atp and manganese ions
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
282
structure length
271
Chain Sequence
MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVGHTKVKEFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rio2 serine kinase
publication title Autophosphorylation of Archaeoglobus fulgidus Rio2 and crystal structures of its nucleotide-metal ion complexes.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Transferase
total genus 93
structure length 271
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zaoA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zaoA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zaoA02
4AIKA 3BJOA 3HMNA 3GCUA 5J1WA 5E9EA 2BRBA 4UVCA 3KULB 4YHFA 4FX4A 4HYEA 4O83A 2DU9A 1SD5A 4BI0A 4A5NA 1D5VA 5DT0A 3IKAA 2CCHA 3IWZA 1W5SA 4FG7A 1Z9XA 3ORPA 4HLYA 3PVWA 5IQIA 3TNWA 4DH8A 2WTCA 5GIOE 3KLOA 4UZDA 5IQDA 5HS9A 5FGKA 1BLXA 3QRJA 5HIDA 5BVOA 4JBOA 4PDKA 5ED4A 4DYMA 1SD7A 4IMYA 2RV8A 4LRKA 5E17F 1P4WA 1XR1A 3MWUA 3HKOA 1R39A 1FYKA 3MVMA 2C6LA 4QTBA 3RAIA 5CZIA 2GNJA 4LYNA 5I3OA 4ZXTA 2QCSA 4J97A 1Y91A 1STZA 3BHHA 4CZYB 1G4DA 4U42A 3EYHA 1ZMWA 2ITXA 4YLLA 3QA8A 2RKHA 4FTNA 5CLSA 4LGGA 4UV0A 4H05A 3MWMA 2XK6A 2JT1A 3A7JA 4HX8A 2EVAA 2Q0BA 4FGBA 1YWVA 2OF2A 5LMKC 5EI8A 4BGQA 2VTJA 3FMQA 3QX4A 2F57A 2PK9A 2QQBA 3FXZA 2GFCA 3SGCA 5CVVA 3VUKA 5EQYA 3DJ6A 2GNFA 4IDVA 3QTSA 1W7HA 4XV3A 3IQ7A 1GNGA 2SRCA 4TZRA 3OOPA 4BICA 4CCUA 3LMGA 3AAFA 3MH0A 3ORNA 4AD9A 3BGZA 2CGWA 2IZUA 2QOCA 4PMSA 4AW5A 3E97A 2XAJA 2IVUA 2Y6MA 2PUIA 3NW5A 3VW8A 4RC3A 4TPTA 2M5WA 5KMIA 1YLFA 5KMOA 2PJPA 1F9NA 3LM0A 4BCKA 2XUUA 2NRAC 2JD5A 4UMTA 4B7TA 3CLYA 5AAGA 2VC1A 2VONA 4QMVA 4FV2A 2OH4A 3MJ2A 2X4HA 5CVUA 1K6OA 2J0KA 3SW4A 2ETRA 1G3NA 3WG9A 5BX0A 3UC4A 4YJRA 5GJFA 3D7TB 3K3JA 2CMWA 2D45A 1YWRA 4DTBA 1S9IA 3VUDA 1GZKA 5C8KA 2DYLA 2WAJA 2Y48A 3MB7A 4NFMA 4ONAA 2XM9A 4MNFA 1IXSB 1BM9A 4JR7A 2WIPA 3KXMA 4IWQA 2BTRA 1OL6A 1ZYCA 2PWLA 5J7BA 3FZ1A 4R77A 3ANQA 4AXAA 1KU3A 4FTAA 3BHUA 4X2KA 4IC7A 2HYGD 3AGLA 3PXFA 3DY7A 3CTHA 4FZ7A 2CKOA 4KRDA 4E6DA 2M1BA 2UWMA 4RA5A 3W55A 5IISA 2BR1A 5ICEA 3KETA 3DBEA 3L8PA 3BCEA 5CSPA 4QYEA 5HNIX 4ZSAA 2O0UA 1O3QA 3Q9WA 3MFKA 4EONA 3FXXA 1WQ2A 3DXNA 4BXUA 4HYUA 2BRHA 4N6YA 4EQMA 4AIHA 1MDMB 4F0GA 1Q99A 4IX3A 5D11A 2YCRA 3M9AA 4G31A 3MIAA 5T3QA 4AFEA 1U54A 2V1UA 1ZYRF 2WQMA 2W25A 5HDKA 4F1TA 4DBXA 3QX2A 4FVQA 3BP8A 3V4GA 1CKJA 3I81A 2IO6A 5AP1A 2F2CB 3DPKA 5JZNA 1G3SA 4UWCA 4G9RA 2YDKA 2BPMA 4IZAA 3O50A 3R0AA 4NSTA 5HKMA 3VUIA 3GB2A 2ZM1A 4AT4A 2WHBA 5CAPA 4EWHA 3RMFA 2XKEA 4CGZA 4E26A 4IZ7A 3F21A 1YXUA 4L3PA 2VTRA 2YWVA 5ANDA 4HA8A 1IR3A 4CDGA 1J7UA 1OZ1A 1UWHA 2QI8A 4K2EA 4TYHA 4U7ZA 4AT5A 3CR0A 4KT5C 1NXKA 2E7XA 4HV6A 4ZMFA 3UE4A 3ZMTA 1KGSA 5DRDA 4BI2A 3AD4A 4XLVA 1R1WA 2R3RA 3PIYA 3P9KA 4G1WA 2CWEA 4F08A 4LUEA 1Q41A 1TTYA 1H07A 1U5TA 4I21A 2CN8A 4QMMA 3WF6A 3FLSA 2L01A 3NCZA 1XGOA 1FMKA 3PE1A 4CKJA 4E4XA 4ZTMA 4AG8A 5LVNA 3C1DA 4O7YA 5BNJA 3BV2A 3B8QA 2XBJA 4NCTC 3LMIA 4D5HA 3KF4A 2G9WA 4M13A 2J5EA 4AW0A 3DBFA 4I5HA 4ZZMA 4GYGA 3RPRA 4KS8A 3DPLC 1KU2A 4YZBA 3PXZA 4XS2A 2STTA 4YSJA 3LFQA 4C35A 4O84A 4A7CA 4ZIMA 4ASNA 3R22A 4IAZA 1H08A 3WIGA 4FT5A 4RQKA 4ZJVA 3G0EA 1SD4A 1GZ8A 4R8HA 4JG7A 4HVIA 2JEDA 2EXEA 4FMQA 4QMWA 4X3FB 3LQRA 3L09A 4Q9SA 4PL5A 3R2BA 3DBDA 1KQ0A 5HCZA 3DXPA 2XAGA 3ULIA 4JQ8A 3SKCA 1Q1HA 3BEAA 1B6AA 2B9FA 4U80A 2I0VA 2ETHA 4H1JA 3QQFA 3EYYA 4ANOA 4R5YA 4EJVA 4IACA 4XHKB 1PMVA 1V4RA 4UMRA 4YG2F 2A6HF 3FSFA 5CVHA 2E9NA 1YOLA 3G90X 4I5MA 2XIRA 4EMSA 3P23A 4E3CA 5IDNA 2GTMA 5IA5A 3EQRA 4F9YA 5C1QB 2OSCA 3FXWA 2J51A 1Y6BA 1M2PA 5J95A 2HTJA 4MHGA 1S7OA 4I6BA 4N9HA 3C4WA 2RF9A 2Z2WA 2CNQA 5E1ZB 2EUFB 4EC8A 3TUCA 5KX8A 2FXAA 3DKWA 1UNHA 2IZSA 1JHHA 3IWFA 4C2VA 3HIFA 2WIHA 4WRGA 4J1RA 1KE7A 1SM2A 3DV3A 4AOJA 3UBDA 4GS6A 4KIKB 1RZ4A 4DBNA 1XHAA 5IH5A 3FQHA 3G73A 1DAWA 2VE8A 3M42A 3COIA 3QYZA 4JI9A 5E8SA 3V6SA 4JBAA 4PP9A 4ASDA 2XRWA 2YM4A 5CVIA 2WOUA 4F63A 3NW7A 4CNHA 4DH3A 3E64A 2WMUA 2QU5A 4BDCA 1PYXA 1OL7A 1U2WA 3SG9A 3U1DA 3V5PA 3G33A 4GEOA 2C5NA 3FPQA 4DGNA 3I6WA 5FTQA 3F3ZA 2YR2A 3ZO2A 2UZDA 2G9XA 1VJYA 4WG3A 2H6CA 5FTGA 1W4MA 1EH4A 1QPCA 3FI4A 4RIXB 4RGUA 4M0ZA 3OXIA 5EEHA 4EH3A 5AFVA 3ZM9A 4OUCA 2X2MA 2B1PA 4FTIA 1PHKA 4MQVA 5HS7A 2C6KA 4X0MA 3SXSA 5HLNA 4ZS4A 3Q52A 3N51A 2GXGA 4KUJA 5L8JA 1WAKA 5LXMA 2NYXA 2I7QA 3LPBA 3VS0A 3Q4ZA 1YW2A 3FZOA 3G6HA 4FKGA 1OPLA 4CFUA 4RJ7A 2M45A 2BIYA 3O0GA 3EL8A 5KHWA 4I0AA 5AADA 5M56A 5DVRA 1K2PA 5KK1A 3OWJA 3OVVA 2V1XA 3PRFA 4ZTNA 4BHPA 2PVLA 4FKWA 3ZO4A 4TT7A 4XV2A 5C26A 2NRYA 4UX9A 1B1BA 4FIHA 3U8WA 3PJCA 2QOFA 4ITIA 2WZJA 4FT9A 4DITA 3SVVA 1RUNA 5HTCA 4E93A 4QP6A 4YTCA 3AC3A 4DGMA 5EDPA 3OUNB 4V04A 1U3EM 4JIKA 5L2WA 2HZNA 3OY1A 3D14A 4MXOA 1SMYF 2A4LA 3NR9A 5E90A 4YZCA 5K5OA 4LFUA 4PDYA 5M09A 4ALWA 2ZB1A 2PMLX 4XNEA 4RBLA 3UIUA 5TR6A 2AXLA 4AN2A 3V3VA 3BGQA 2CPKE 3VUGA 3E92A 2UW8A 3IDCA 3E87A 3ERKA 2W1HA 4D2SA 5B2LA 3IG7A 2XBAA 2OICA 4BGGA 4LB6B 1IAHA 1OKYA 2WTWA 2ITNA 3BPRA 5K5QA 4ZSJA 5L3CA 3L9FA 1T45A 1KV2A 1RNLA 1E1XA 1XBAA 1PXOA 3J7AO 4RGJA 2G15A 2JRTA 3P9JA 2YITA 1OUYA 4J53A 2KRFA 3WZKA 3C4XA 3QZGA 4XSXF 4EV0A 1JKTA 4W9WA 5LMBA 1JOWB 5FLXK 3QD0A 1J9IA 5E8VA 1XBBA 3E63A 2B55A 4CG8A 4CZZA 4UUVA 2JAMA 3JPVA 2JTVA 2VO6A 2ZVAA 5IMEA 3G6GA 4KKGA 4LI5A 3WOWA 4FIJA 4A4LA 2RFEA 3LWFA 3UOHA 3NUPA 3D2KA 4G3CA 4BDDA 2ESHA 1MRVA 2VWYA 2F9GA 3U6HA 3RP9A 2IVMA 5AR3A 2PHKA 3COAC 3F6VA 2EFNA 4V0GA 4XLIA 3FE3A 4F1MA 2XNEA 2E9VA 4CXAA 3VS7A 2CKQA 3TOBA 4RVTA 4MBLA 5H9BA 3I0TA 3DFCB 3WZEA 2P7VB 4BDHA 4X2NA 3RK9A 2BALA 3EL7A 4YZDA 2OJJA 3Q5ZA 1XKKA 1YVJA 3OF0A 1FVVA 4UMUA 4CCBA 5AP3A 3QU6A 5HBHA 4MXCA 4I4FA 2ONLC 1U4DA 1LDDA 3MFRA 3LIJA 2H09A 3FX3A 3AGMA 4ZMEA 4NIFA 1T98A 4FTKA 2BILB 2DUVA 5M44A 5CU3A 2YABA 4JXFA 2EA2A 4NW5A 1GZOA 4FEXA 5CXZA 2ERKA 4C4GA 2B0QA 4L45A 4QPAA 1NVSA 2QG5A 1E2XA 3ANRA 3K0LA 4FA2A 2G2IA 4WBOA 3LXNA 2O5KA 4CZUA 4IVCA 2JIIA 5FM2A 1C0WA 4U0IA 2PPQA 4PDPA 5EM6A 4HPUE 5K5NA 4JLCA 5IA2A 1GVJA 4AOIA 3CUQC 4AA5A 5GZAA 3WTSC 4MHAA 3FBVA 2BE5F 2MA3A 3LFSA 2R3HA 1YXSA 2HXQA 2V55A 4O2ZA 4JDJA 3BWGA 4KIOA 5LQFA 3I5ZA 3KC3A 3WF5A 4I23A 4Q2AA 3KVWA 2A07F 4X3JA 2WMQA 2VTPA 3ETAA 3FZPA 4KMFA 3UVQA 3K9TA 1YXVA 5I9ZA 1UU7A 1S6LA 2J7TA 1Q3DA 4CYIA 2GHLA 1XO2B 3GC9A 4NM0A 4RGRA 2ZOQA 4OIOF 3LHJA 5KMNA 3TZ8A 2OZUA 4GKIA 5JFSA 2FA2A 4FKVA 4HW0A 3ET7A 5I5ZA 1OMWA 2VWUA 3ZO3A 3C9WA 2IPXA 3T8TA 5LOHA 1R1UA 4BCMA 3QCYA 2QOOA 4QPSA 5FDXA 1J1BA 3VQHA 4RFMA 4XEYA 4A9YA 3F2RA 3U87A 3GU8A 4YIFA 3ZEWA 1TLHB 5FG8A 5EI2A 5L6PA 2JC6A 2ETKA 1WBOA 1IXRC 4I6HA 2BYVE 4FK3A 3CEKA 3C4CA 1DPUA 3V7SA 2HIWA 2W05A 2OJ9A 2X0LA 2HZIA 4XP3A 3WTVC 3FLYA 3Q60A 1SFEA 3VAPA 5JT2A 3DKOA 5DCMA 1BIBA 4LB5A 5ANKA 3GZ5A 4MNEB 4HOBA 3FM3A 3NAXA 2B7AA 2OZAA 3JSOA 4RJ4A 1W82A 4YPSA 3CP9A 3OCBA 5CALA 4FL2A 3VBYA 3Q9SA 3G0FA 4Z2YA 4A4XA 4ZTRA 5DD4A 4TYEA 4UMQA 4P2KA 3VQUA 3FMKA 2HKXA 4XOZA 1ODDA 2STWA 3EKNA 3RK5A 1ZHFA 4FX3A 2UZKA 4RWLA 4JBPA 4WXCA 4TYGA 4KINA 4M0YA 3P7AA 4P55A 4KYWA 4EHEA 4I94A 3WF7A 4PF4A 4NKAA 3WIKA 5LJJA 3G3ZA 3IK3A 3RJPA 3LJ0A 4DCAA 3QTUA 1SD6A 5LHHA 2PVJA 4O7SA 4KRCA 1FBSA 2EXCX 5JFVA 1JKSA 4FV7A 3G9LX 5KZ0A 4RIYB 3DQWA 1ZAOA 3OWKA 3PZHA 1PF8A 3A8XA 4Z55A 3OT3A 5LGNA 4GU6A 3PP1A 3GWZA 4PMMA 5B7VA 3FLWA 4HGTA 3RKXA 2FSLX 3M8FA 4O7TA 2RL5A 4JQFA 3H0ZA 4MQ2A 4YSMA 3GOPA 2VTQA 1HQCA 4E20A 4D2RA 1MGTA 3QTQA 3RTRA 4R7HA 3V7RA 5TT7A 2WQOA 4EHVA 1P6RA 2QBYB 5J87A 3UIMA 3LJ1A 3TKUA 3HDMA 3O8TA 3IDPA 3F23A 5J9LA 2PQ8A 4J7BA 3CQEA 2VOPA 2PL0A 2VTIA 3BE9A 3DTWA 4BDJA 5EHOA 4N57A 3A7HA 4FSZA 2EFWA 3SQQA 5EYKA 1XMKA 4C62A 2EU9A 4MTEA 4O1PA 2X0GA 4LGHA 4GKHA 3PSBA 3HRUA 3P1AA 3ZSIA 3DTCA 1FY7A 5M07A 3KCKA 4WSYA 1SFUA 2ZB0A 2B9HA 4YJTA 4AVPA 1F0QA 2FO0A 2GTNA 2XRUA 4O0VA 2Z7LA 1XSDA 4S31A 3D5LA 1NA7A 3Q6WA 4ZK5A 2OZOA 3V5JA 4AA4A 4HX7A 2WMXA 3W2RA 3ZC5A 5JGDA 5D7AA 3F5UA 3FHZA 4CRSA 1BBYA 2WTKB 4GVJA 2BRMA 3ZP5A 1YHSA 2XK4A 3E3VA 4ZZNA 4OBOA 2BRNA 3ZUVA 2F2EA 3BGPA 4UWBA 2GHGA 3ODYX 2L4AA 4IANA 3ULQB 4D1ZA 3UNZA 2X8EA 5A14A 4J99A 4C36A 3LLAA 2FNAA 2YIQA 2I0HA 2UUEA 3FY0A 4M73A 3SXFA 1Z7UA 3I1AA 4MXXA 5JH6A 1FBQA 4BHZA 5EM8A 4OAVB 3EN5A 4NUSA 4FIIA 3WYYA 1IN4A 4PGHA 4ETSA 2VNYA 1H25A 4GT4A 4G3GA 4RC4A 3TZMA 3U6JA 3D4QA 3OCGA 4XSZF 3UDBA 3OHTA 3LXPA 3VBXA 4XV9A 1STCE 2JDVA 3DDQA 3TACA 5I9UA 2MLGA 3QD4A 1QPDA 1APME 4QOXA 5L3BA 1PKGA 2HOEA 4B0GA 5DEYA 4ITJA 3KK8A 4ZYGA 3PY1A 2UXNA 1OITA 4BCPA 3DKFA 3L9MA 3GU5A 3R7IA 2H96A 2BFXA 5HBEA 5M4CA 4Y85A 1YQJA 4OTDA 5EHYA 4WOVA 4YP8A 1S8NA 4GFOA 4UWYA 1I1SA 3HV6A 3KP7A 5DN3A 3E3BX 2A1AB 4XG7A 2W0JA 2UZNA 4XUFA 5KMMA 1PXJA 5BPIA 1QBJA 2MLKA 5C8NA 4HDVA 3R7UA 4BCGA 4G6OA 1ZOHA 5CYVA 4B09A 3UPZA 3CKXA 4U43A 5HE0A 1RI7A 3ZUUA 1B9NA 2KIMA 1DUXC 4M3QA 4RLLA 2Q2EA 5AP6A 3AC8A 2CNUA 2R7FA 4WBBB 3N4MA 2IVVA 5FLXZ 2I1MA 3L9LA 3LQ3A 1CMKE 3UMXA 3RHXA 5GIPE 3TQNA 4I92A 2NS0A 2VGOA 2BHEA 2P3GX 4CG9A 1XDSA 1X3UA 1R78A 3G51A 5ANEA 2ADUA 4LG0B 2X7FA 5ETCA 4D1SA 3VBQA 2IJMA 5HDGA 3F6OA 1FSHA 4RX9A 4XBUA 4OINF 1YOJA 5AA9A 5CWZA 4XCUA 1H9TA 3BHVA 3GYHX 4RX8A 4QLCU 2O61A 5B0XA 4I6QA 4HJOA 3AD6A 4DFXE 3E62A 4QMUA 3Q3BA 2YCQA 2W1FA 1ZRZA 1SVEA 2UZVA 1FSEA 2MBFA 1ZXEA 2QQ9A 3BI6A 1KOAA 2ISZA 2IN6A 3O6BB 3F2NA 3U51A 3K5VA 2VBZA 4IAFA 4BCFA 4N0BA 1OIRA 1XN7A 4O82A 2QKRA 3F72A 2CN5A 4USEA 3C18A 1G3YA 4XG2A 2VT2A 3DS6A 4HX4A 2X7OA 3HAVA 1Y8YA 2WC2A 4I0TA 4M6XA 1T0FA 3A99A 2VC0A 3GUDA 2IP2A 4PX6A 3DQXA 3GFLA 1NVRA 3PUPA 3WBLA 4ALVA 1CKPA 1XBCA 1EV7A 3FMMA 4AZFA 1LB2A 2PVRA 5CF6A 4O6JA 5IG1A 3DXJF 2BDWA 5AUUA 3HOTA 5A4LA 3SC1A 4WG4A 4X6RA 3SOCA 1ZG3A 2ZV2A 3A4OX 5DT4A 4D55A 2MD5A 3HHGA 2VN9A 3KP3A 4NZWB 4QMLA 5FM3A 4FTOA 3CUQB 3OY3A 4U81A 1JHFA 4NKSA 3I6UA 3LW0A 5J6XA 2YDIA 2YZLA 3E8EA 3SA0A 2CGVA 3GQIA 5IH4A 4L9NA 2DWBA 4AUAA 4DLIA 3PXKA 1XWSA 2RFDA 3H3UA 2XIKA 3WILA 2O3FA 1TVOA 3NNWA 3RCDA 2EV5A 1M2RA 1YW8A 3N4VA 4HYSA 3NYNA 4I2OA 4BR3A 4MH7A 3HVCA 3NLBA 3JAMK 2GXBA 4MQ1A 4L0YB 4FL1A 3CUOA 2WEVA 4ZY4A 4P7EA 4DFZE 4DF3A 5LVOA 4HF0A 5AR4A 3CD3A 3J80K 3I7CA 3OC1A 1IA9A 4RJ3A 4C4FA 2GIVA 3R60A 2BEOA 2VGPA 4Y72A 4F09A 3HYHA 2HYFA 4HNFA 4QP1A 3KY2A 4XBFA 3QALE 3WODF 2X9EA 2A0CX 3FDNA 1RJBA 2MH2A 1SVGA 3ZZEA 2VWWA 2WMWA 5D10A 1KSWA 3K2LA 3R8VA 5I9XA 2DW4A 2GDOA 4OU0A 4RAYA 3O23A 3R1NA 3QGWA 5FWKK 1ND4A 5HTIA 4EHGA 2XV4S 3HECA 4ESJA 5HESA 2FMYA 2JSCA 4RGXA 2J5FA 2QLQA 3TDWA 4KIGA 2K02A 3KRRA 1Q8YA 4AWIA 2R3FA 3ODZX 1P4FA 4R8QA 4QP7A 3VBVA 5A2QK 3C13A 3TDVA 2F5EA 1E1VA 4H1MA 2XKDA 5FXQA 2ZBKA 3O71A 4C4IA 3TTJA 1V1KA 3L1SA 5TF9A 3UOKA 4YBJA 2CJMA 3MCZA 5D5VB 3QQKA 2FQ3A 4EK8A 3U9NA 3E8CA 4KICA 4F0IA 1P4AA 4QYGA 3D5WA 5AR7A 4MEXF 2XASA 1OPJA 3GT8A 3MY5A 2C6IA 2K4BA 2IRFG 5C9CA 2C47A 1OYYA 3FMRA 1H27A 3COMA 2W24A 3BX5A 5EYDA 3C4ZA 4U8ZA 5LWMA 3COHA 1H00A 4R3CA 1JWHA 5EQEA 3UG2A 3OCSA 3QXOA 5BMZA 3HTSB 2WXVA 4NFNA 3A61A 1OI9A 1YWNA 3UO5A 5BVEA 3QWJA 4HYHA 5GJGA 2EV6A 5D6EA 2BZJA 5CEKA 3UC3A 2RG6A 3VF8A 4NHJA 2D1VA 4USDA 5H8BA 1H1SA 2GU8A 5JRQA 4ZP5A 4AGCA 4FKTA 2GCDA 4WX9A 1Z1DA 5DGZA 5KKRC 3I53A 2IW5A 3LKMA 2PBIA 2W1EA 5A46A 3AC2A 4EWQA 5BPYA 3LFKA 1VYZA 4RT7A 4QT1A 2OIDA 1LR4A 1SVHA 4IEBA 4BCJA 2R3IA 3ZMMA 3CE3A 1BI1A 1JNKA 3NPCA 3DLZA 3MV5A 1H26A 5AP2A 1U46A 4M68A 3EIDA 3R02A 3BRBA 1FGIA 3DOGA 2WD1A 4UB7A 2YX7A 2EB7A 4PCQA 2V9VA 4D2PA 5E8IA 4XJ0A 4LJZF 3FL5A 3IOKA 3WTWC 3IW4A 4G9YA 3R9HA 4KB8A 2IZRA 3KL8A 1OL5A 2WV0A 4GV1A 2HFHA 2H34A 3OW3A 5EYMA 2OD5A 4G3DA 4HF1A 3ORKA 4YGAA 2JDSA 1U54B 4TN6A 4ACMA 3CO7C 1VR2A 4FIGA 1IEPA 2C30A 4UXLA 2Z99A 3EQBA 3AT3A 1ZGAA 4W9XA 3QTZA 3I4PA 2AC3A 3DT1A 5E8GA 4A0XA 3MH3A 4JG6A 3DV8A 4HZSA 2BRGA 2CGPA 1K78A 1WMKA 3EJ1A 2ITTA 4Q4ZF 2W17A 5AP7A 3EFJA 1KWPA 4PPAA 5IQCA 3W18A 2QURA 3VF9A 2XYNA 2QYOA 4FIEA 2KJBA 4ZYHA 2BDJA 2PZYA 4JQEA 5FP6A 5HO6A 1WZYA 3K1PA 4P5OA 2VX1A 4CSVA 3JY0A 3TDZC 3MZYA 3D94A 4ZTLA 4QMNA 3BLQA 3TM0A 3LAUA 4II5A 4CLIA 4NEUA 1K9AA 1B9MA 3GO5A 3A4PA 3UQFA 1HW5A 2EB2A 4HVHA 1LJ9A 4P5ZA 4XRFA 4LLNA 2G01A 4IX4A 4C3PA 3IL2A 3R28A 1U5TB 1F4KA 4JJRA 4V05A 2B0LA 3KN5A 4Y8DA 3BLRA 5BVKA 3DXQA 4KDPA 4F7JA 5CVFA 5BVWA 1UFMA 1FZPB 4UVBA 4UXNA 3LA3A 1U5QA 1P4XA 3BIZA 4C3RA 3I64A 4GFGA 3QQLA 5LRSA 3G5DA 1BL7A 3QPHA 2X39A 1OPCA 4C4JA 3QGYA 4S30A 4KFCA 2C6MA 4YC8A 1ZOEA 4FZAB 5DYMA 1BI7A 2IW8A 3QC9A 5LHGA 3SD0A 3BYVA 3NWWA 3NVMB 4JVGA 2XS0A 4FKOA 2QQ7A 4KIQA 1XH7A 4QP8A 1W7PD 2C3IB 3DB6A 4CEGA 3OCTA 3QXPA 1BYGA 2XUBA 4D5KA 1NVQA 4JNWA 4FT8A 1L8TA 3POOA 3NUNA 2H8HA 3ZUTA 2Z7RA 1I5ZA 2ZYBA 4FTTA 4TTHB 4O96A 4U79A 5EOLA 1UKIA 4D2WA 5D5XB 3U54A 4IVDA 4J8MA 1TBXA 4TW9A 4EBVA 1GHCA 4S04A 2R7BA 5DH3A 1IAWA 2CKEA 3MH2A 4BKJA 5HOOA 4Q5SF 4JX3A 3C7QA 4GMYA 3PXYA 4PZJA 1Y6AA 2BMCA 3IO7A 4WSQA 4D0PA 3BELA 4MYGA 1L3RE 3DP7A 2PMIA 4C37A 4I5CA 4EQQA 2WTIA 3SZTA 4OTRA 2DFIA 1DM2A 3A8WA 5JVTA 3UO4A 5FBOA 4ERWA 4EOIA 4EH6A 3W16A 1XSVA 2BBYA 5KMLA 3R8LA 4IJPA 4E6AA 3FMSA 2MH9A 4HGSA 5HEZA 4WKQA 4FG9A 4FSYA 1JSTA 4UEUA 1H8FA 1FT9A 4O22A 5C4LA 4M15A 4YPDA 3NUXA 3WE3A 2GA2A 3DFGA 3B73A 3LLTA 2J0MB 4E1ZA 4EJUA 3CBLA 4MK0A 5L8KA 4FE2A 4QYYA 4EC9A 4OIQF 2QU6A 3MVJA 2XK3A 3D7TA 2Q0NA 5BOXA 3HUGA 3LFBA 4R1YA 2XKPA 1JLUE 4FG8A 4C4HA 4ACGA 4RIWA 5HHWA 3VUTA 2XIZA 2A2AA 2W4OA 4RMZA 3DJ5A 1Z9CA 3WF8A 3AXWA 3JAMZ 4HPTE 5AUXA 2VTLA 5EI6A 1OBDA 4P4CA 2VD5A 1VEBA 2RNJA 4CLJA 1UNGA 3FI8A 2WKMA 3K54A 2XAFA 2ZNYA 3OOMA 3VHEA 4APPA 2WQNA 3VNTA 3ELJA 1REJA 3IW5A 3J80Z 4IJAA 3JVRA 1O57A 2WB8A 4YTFA 3VULA 5HLGA 3T9TA 1HSTA 3PQKA 1QGPA 3U55A 2R3JA 2W1ZA 5IEVA 5AA8A 2GS7A 2VUWA 5M55A 2QOKA 5DFPA 4YJSA 3II5A 4R6VA 3QLGA 1AWCA 4D4VA 2JIUA 2PLYA 4UNOA 4UY9A 1MDMA 3ZLWA 4MVFA 3JW4A 3FSKA 4LUDA 3NMUF 2JFLA 3R00A 2YCFA 2C5XA 5DR6A 3R0TA 3UIBA 4YJOA 3LFFA 3ATSA 3M8EA 3SZPA 5JKGA 3NUUA 2ITVA 5KNJA 4GIHA 2EWAA 4ON0A 1OKZA 1S9JA 4TNBA 3ZS5A 2EFOA 1WBPA 2OIBA 4RFYA 5HG7A 4RJ6A 3RWPA 4D0XA 1YS6A 2W7XA 3BE2A 3FI2A 4ENXA 4FZ6A 4C38A 4KIFA 5KO1A 3H0YA 3PA3A 4BTKA 3O2PE 4DFUA 3F3XA 2WMTA 1J7KA 4CKIA 4GH2A 3C4EA 4BZOA 3BU3A 1DP7P 5BQ0A 4AW1A 4OTGA 4AS0A 1OM1A 2WMVA 3PE2A 4A12A 3WZDA 1TQMA 4JL9A 3HGKA 2OKRA 2UW5A 3RTPA 1W84A 4AW2A 4CXFA 4Y15A 1SYKA 4CV8A 1ZYSA 4AGWA 2OJFE 5CLPA 1JQHA 1FOKA 2BCJA 4XG6A 5DV5A 4M7IA 2W57A 4ZLZA 2GSFA 4FKQA 3V5QA 5IQGA 5DIAA 5AUYA 2O8XA 4ANLA 5TO8A 2HZTA 4ZTQA 1LDJA 2QOHA 4CICA 3PG1A 4QNYA 3HOSA 3VRYA 4NU1A 3JSPA 3OG7A 2Y0MA 3TJDA 2Y75A 4G7HF 4Q47A 2X2LA 3H4JA 4BWPA 5FEDA 3V6RA 4NK9A 3TIYA 3REPA 3E5QA 5CVJA 3OWPA 4K77A 2H6DA 4IHPA 1LEBA 3HV4A 3NVKI 5DDGA 5AR5A 4X3FC 4CZTA 4K8AA 1PMUA 4V0GB 3PA4A 3Q9ZA 3KLNA 3VC4A 4DN5A 1H1WA 4OLIA 2J9MA 3NQOA 4NT4A 4HLXA 5BYZA 3F8NA 3SX9A 3EFKA 3NRVA 1YQAA 3IKTA 3HSEA 5ETIA 1MRYA 1WBNA 2PMUA 4FSTA 5D4RA 3FC2A 3VUHA 3GFMA 5M53A 5A4QA 4Y95A 4M71A 2UZWE 3RWQA 2RC4A 5LHIA 4P96A 5FO5A 2UW6A 4NIFB 5DMZA 3Q2JA 3GW2A 4ENMA 3WTXC 5C03A 3GBZA 3LFCA 5F94A 3KFWX 2QD9A 2LKPA 2R4BA 5HS8A 2R9SA 2ESNA 3UZRA 3S2WA 3HX4A 3FMJA 4AP7A 4JAIA 5CYIA 3R63A 4BN1A 2EV0A 3G9NA 1CTPE 3O2MA 4KKHA 5BYYA 4AE9A 3IONA 4XP0A 4HCUA 4MCVA 4EKLA 2VX3A 4O7RA 3GLXA 2PVFA 2PY3A 2ELHA 2IVSA 4BCQA 2JKKA 1G3WA 2CYYA 4GW8A 4U45A 2WWYA 3DF8A 4JBVA 3VRZA 4YO4A 3PFIA 5DPVA 4QMOA 5HNGA 2JBPA 4IB3A 2OH0E 4MEYF 5HU3A 4CYJA 4I0SA 4FGRA 1U78A 2GMXA 1IRKA 3CLOA 3W6KB 4F7SA 5AX3A 2H94A 4MXAA 2UW9A 3TUDA 1Q3WA 5CI6A 3Q4CA 1I27A 4BIDA 3RPSA 4FNZA 2OW3A 3F9NA 4HVDA 4DQ2A 2DAOA 1R0PA 4A5MA 2O0YA 4KIKA 4QMSA 1LVAA 4HYIA 2PN6A 2BAQA 1ZZLA 4M84A 3NZ0A 2IPQX 3PLAE 4BBEA 2YWPA 3F2AA 4TWNA 1G8SA 2UW7A 5FP5A 2PZ5A 4U97A 3R8ZA 4FOCA 3VN9A 1W5TA 1M7QA 2V79A 4MD7E 1GIJA 3V04A 3TXOA 5I9VA 2RKUA 4ESFA 3PIXA 2YPRA 2ACJA 5CEIA 3IS5A 2ZMEA 3G2FA 4KSPA 3LA2A 5ILSA 2R0UA 3BKBA 3NNVA 3KEQA 5ANOA 5E18F 4ZY5A 2FSMX 4DH7A 2NPQA 3HP2A 2KULA 2OQRA 4RIXA 5DT3A 4YFKF 2G7HA 3M2WA 4BDBA 2VO3A 3JXWA 3AMAA 4MBJA 3ITZA 4KSQA 5DCMB 1O7LA 2Z60A 3OFMA 5K9IA 3DQVC 3UPXA 4O86A 2IW6A 4B4LA 3RI1A 2YDJA 2OZAB 4EM0B 3NDMA 4YC6A 4DCEA 1OBGA 2Z33A 5EM5A 2XHKA 4U7DA 1J2XA 4BWKA 1SFXA 4LM5A 4C2WA 2YU3A 3E6BA 4NQWA 4IB1A 3V8LA 2XKFA 2QOBA 5T68A 4G2FA 3ZLYA 5DR9A 4MEDA 2QC6A 4EH7A 3CY2A 4G6NA 4YIIA 1HSJA 3QL8A 5A9UA 3LXLA 4NW6A 2XP2A 3WU0A 1Q5KA 4HNIA 3IOPA 4A4OA 2DPDA 4L9JA 3BYUA 4DG0E 1DPRA 1YI6A 2ZM3A 2ITOA 3U2RA 4OBPA 5JQ8A 3BY6A 3QP6A 3VVHA 4NM3A 1V0OA 4Z9LA 3PXRA 3D2IA 2QVOA 3GCPA 3P7NA 3OWLA 2IG7A 4L6QA 5EH0A 3RNIA 2ZFWA 4F6UA 4JT3A 5LMKA 2UW0A 4B6LA 1XH6A 5FD6A 3F82A 4AFJA 4O0UA 4PL3A 2QHMA 3IW7A 1T38A 5AONA 3K3IA 2XK7A 1U6GA 2EFQA 4BF2A 5H6RA 4MF0A 4UYNA 2FMLA 3CXWA 3HRBA 1JSVA 4R7IA 4MXZA 4BFMA 4OTIA 5HICA 5J79A 4DAWA 1JPAA 5GINE 4O0YA 3MI9A 5F9EA 5H8GA 4AWXB 5IMXA 1F3MC 3KB7A 5CEPA 5IQEA 4DT9A 5G1XA 3PWYA 3QU0A 3Q9XA 5HDNA 1PYEA 3NYVA 5L4QA 2PUNA 5LRRA 2OXXA 2W5AA 4X2GA 4FVPA 5BQTA 1VTNC 4HF2A 4IBMA 3BYOA 3ZMDA 2X4FA 3CTJA 2BZKB 5HZNA 1BI8A 4FSWA 1Z57A 5LCJA 3LM5A 4FV0A 3MBLA 2HQNA 1KQ8A 5CSXA 4WRSA 2JFMA 2VWIA 2C0OA 4WD5A 1W98A 4BY9E 3ELKA 4IIRA 4E7WA 2BDFA 1BUHA 4BHCA 4W8EA 3HUBA 3C0HA 4USFA 2VBYA 5HVKA 3ENHA 3HMIA 4IM2A 1HW2A 4JQ7A 2VZ6A 5H3QA 2F5DA 3QKLA 3VO3A 3ROCA 5LGTA 4LK0F 3T5XA 5EDRA 1H4LA 3HTUA 5HLIA 1IG1A 3E5AA 3KEOA 2PVYA 4G16A 3NIZA 2XM8A 5A6NA 4C33A 2JITA 4BDFA 4D0WA 3AC1A 5M57A 1MUOA 2IWIA 5E1WA 4GG5A 4GCJA 2Y4IB 4NL0A 4RZWA 2LF7A 3R9OA 4K1BA 1REPC 2PEXA 3RGFA 1J1CA 3HV7A 2P55A 2F7EE 5J7HA 4FF8A 2QG7A 4PV0A 3FWEA 4FKIA 2WQEA 2VXZA 3QHWA 1ZY5A 5DD8A 3NIEA 3CGFA 3QFVA 4JG8A 2CO5A 3ZHPC 4CFFA 3DNDA 3F61A 4HDUA 3E6MA 3BU5A 4RC2A 4YFXF 3QWKA 4EVIA 2XB7A 3ZPLA 2HTSA 4BRXA 2B9JA 4LGWA 3QTXA 3TV7A 4JDHA 5IUGA 4PQNA 2YJRA 3UIXA 3LAJA 4WT6A 4QMYA 4DG3E 4EI4A 3DKGA 3R9RA 3WZUA 2XKCA 3ZYAA 3EOCA 2QLUA 4I3ZA 3PRIA 2OWBA 3RAWA 5JEBA 4F70A 2XNNA 4ANBA 3KGAA 3C7JA 5BYLA 3FQSA 3NUAA 3DK6A 3MFUA 3BPXA 5IEXA 5K3YA 2WU6A 4ZOGA 5ICGA 1R1TA 3FYJX 2A6EF 4K9YA 4O21A 4GK2A 3W8QA 4FT7A 2OBPA 3CJNA 2C3LA 2PUPA 4DA5A 2LDUA 1H0VA 1OL2A 3QZIA 1CM8A 5DOSA 2VTNA 4NM5A 3KZYA 2PZPA 2VOOA 5D8LB 4M97A 3AT2A 2D2WA 1E17A 3QP5A 2NO3A 2QODA 1QO0D 2Z8CA 2J0IA 4IB0A 3R8UA 5HVJA 4DTAA 1MZBA 2WOTA 3MTLA 4LK1F 4QWQA 4IB5A 3O51A 3N97A 3AOXA 3S2PA 3W2CA 3U6IA 1Y0UA 4NCTA 3T0YA 3VIDA 2IVTA 2FBHA 1FYLA 2MC3A 3W2QA 2QO2A 2YIRA 2ERZE 5HVYA 3F5GA 3AMYA 3D0EA 1IXCA 4YJNA 5CANA 2HY0A 5IQBA 1BMKA 2VO7A 2XEZA 2JPBA 1KYZA 2DO7A 5EW8A 1Z05A 4YR8A 3ZCLA 1ZN2A 2J0JA 3E3PA 5AP5A 4O7LA 2Z7SA 5L3AA 2E7WA 3VODA 4XRJA 2P4WA 2VODA 1RUOA 2V7AA 3HRFA 4ZLOA 3GGFA 1XH8A 4DFYA 4GIIA 3QZFA 3KVXA 3QUPA 4ENKA 2AUHA 3MFSA 5BPDA 2LGCA 4O3MA 3GC8A 2LAVA 3ZOSA 4L52A 4E70A 4WK8F 4BBMA 5DEQA 4RA4A 3I0QA 4BNCA 3C1XA 4S34A 2YHVA 1JXSA 4EZ5A 2QR7A 3O96A 4TWOA 4AZSA 3L8SA 2Z9OA 4AQCA 2GZWA 2RDPA 4IWOA 3D7ZA 1RE8A 3SRVA 5J8FA 4G17A 3RPOA 4C3FA 3QYWA 3ZRLA 2LNBA 1KA8A 3ZFXA 4GVAA 3C3WA 3GFEA 4FNWA 1OKVA 4LGDA 5TOZA 2XKOA 5FXRA 2R3SA 3HEGA 4KN7X 4ZZOA 1LUFA 4V01A 2CFXA 3R71A 4BTMA 4Y17A 3DEUA 4K18A 4MWIA 3TI1A 5LEKA 3TO6A 4BKYA 5LGUA 5CX9A 4OTQA 4RVKA 2WTKC 5E8UA 4QMXA 5IEYA 2FB8A 3S95A 4DINA 2EWNA 4OTPA 5EM7A 3UVPA 5L3FA 3QPTA 5JGAA 3WTZA 4G3FA 3K1MA 4XP2A 2HDCA 5K0XA 3VUMA 3VFZA 4RZVA 2XRNA 4KABA 3RM6A 3O8UA 3Q5IA 3ZFMA 3PWDA 2BAKA 4YNEA 5IA3A 4EGYA 3T8RA 4BYJA 2PG4A 3RALA 3LSTA 2OIQA 3PPJA 4FV1A 4BTFA 1IUYA 3AG9A 1K3AA 1T2KA 4FTJA 4CO8A 3FKNA 3W10A 3T3VA 4IHTA 4IRGA 1Q8WA 5D41A 4U40A 1IN6A 5A4EA 4E4MA 1RIOH 5HG9A 4IWDA 3V5TA 5ICPA 5JFXA 5IKWA 4M66A 5GJDA 5IZFA 2VWBA 1BI3A 2E1NA 1YHVA 3QRTA 5H6QA 3W8LA 3SXRA 4F64A 1PXNA 4BQAA 4DNCA 5AX9A 6PAXA 4QP9A 1XCVA 3W2OA 3ZSGA 4D4YA 2X81A 4RG0A 1R36A 3RKYA 3ORZA 1FNNA 3VS5A 1OYWA 2M87A 1WBWA 2ZV7A 3PJ2A 3ZC6A 4MNUA 3KXHA 4L68A 1GXQA 3WU1B 2OU2A 1KE5A 1G5SA 3B2WA 1OVEA 2ZNZA 3GC7A 3KCCA 1UB9A 4ENNA 3V8SA 4DFLA 4IQ6A 1WWXA 2DQRA 4EM2A 4FTQA 4G34A 4C59A 4EYJA 4EQUA 2G1TA 2C1BA 3FLZA 3BQCA 4J8NA 4AZEA 1LP4A 1R1VA 3ML6A 3KEXA 1A48A 2ZKZA 4RAZA 2GS6A 2R3MA 2RGPA 3CJFA 4J98A 3R01A 2VRXA 3D5XA 5ACKA 4FEVA 5IA1A 1IA8A 3O7LD 1ZG5A 4D58A 2H6BA 4ZYEA 2W4JA 4FSRA 1CDKA 2ZV8A 2YX4A 4EH2A 1MD0A 5D6FA 4N6ZA 2P5LC 1OUKA 2UW4A 4CFMA 2VTAA 3OT8A 2HWPA 3HDNA 3Q96A 5FD2A 5DYJA 1R3CA 3R8MA 2C69A 1O9UA 3PZEA 2K7LA 1Z6TA 3D15A 5DA3A 1IN5A 2X7GA 3FMHA 4UMPA 2RQPA 5EFQA 3LFAA 2W9ZB 5D9HA 3KP5A 1BI0A 3THBA 1A9UA 3HMMA 5L2IA 4RB2C 4AGDA 1BOAA 5EKNA 3PPZA 4FZDB 2VBXA 1R22A 3EDPA 3NNXA 5GZ9A 3I60A 3C51A 4S2ZA 4BKZA 3P0MA 1GZNA 3UGCA 3TG1A 4ID7A 2C3JA 4BZNA 2P6TA 1U59A 1LQ1A 5KMKA 3CTQA 4YZMA 1ATPE 2HOGA 1NY3A 5E8WA 2C5OA 4FT3A 3HV5A 4L53A 2OF4A 4FEQA 1P5EA 5KUPA 4O81A 4BC6A 4AZVA 4JBQA 2GA1A 1XDUA 2R7DA 3EQCA 3R9NA 3BZ3A 4ZY6A 4BBFA 3RAKA 5CASA 2PMOX 2VNWA 4GYIA 2XK9A 3GF2A 3BJAA 1Q62A 2I6LA 4CTBA 2QNJA 2LF8A 3JR1A 4DEHA 4H36A 4BL1A 4DT8A 2BIKB 3OBGA 4Z7HA 4LQMA 2R3KA 1JGSA 1OR7A 2OO8X 4UHTA 3GCSA 5IDPA 2XIYA 3QCQA 1I44A 5AEPA 1Z91A 3DBCA 3RPUA 4IAYA 4PPBA 4L44A 3TEIA 1ZY4A 3U9CA 2ONLA 3R0JA 2W9FB 4PTCA 4Q5EA 4QPMA 1QQIA 4L5IA 3KRWA 4O0RA 3E7OA 4F1OA 3CPBA 3ECHA 4YU2A 4H3QA 2FSOX 2H27A 4B8MA 3KKVA 5HO8A 3GX4X 1ON1A 4I93A 3TN8A 3LXKA 4AIJA 2W5HA 5KBQA 4MQ9F 1H1PA 3TV4A 3IPHA 4A07A 3OTVA 2ITPA 2JIVA 3P78A 2WTVA 1FX7A 2UXXA 4RQVA 5LCKA 5AV3A 4UZHA 4RVMA 3CUQA 4A9SA 4J52A 3NW6A 5TJJA 4YTHA 4MD8E 2LSOA 3OMVA 2GAUA 2XMYA 2W85A 5ICFA 4FUYA 2C5YA 2AC5A 2EXMA 3F5XA 2A5YB 2RGVA 1W8CA 2IA0A 3FYKX 4W8DA 4AZWA 4CTCA 5L6OA 2QZ8A 2EK5A 4R79A 3ZSHA 3I71A 1H1RA 2X9FA 3W2SA 2BGCA 3NSZA 3AC5A 2ITQA 4BCNA 4DGGA 3UOLA 1EH7A 3KXZA 4GU9A 3EN9A 1YXTA 4A2UA 2QHNA 3WGGA 1J75A 3ZMVA 3ZMSA 4E5BA 1SNUA 5ANIA 5IT9K 4XRLA 5F6FA 1J5YA 2PU8A 4N9IA 2PMHA 2RFSA 4U7BA 3FXUA 4YJPA 4W4YA 4OT6A 1CGPA 1ZOGA 4C7TA 4W4XA 4JDIA 3BZ6A 4L9VA 4R1HA 5CQWA 1D8JA 4FT0A 4MTDA 5AAEA 5KBRA 3CQWA 1AD5A 4G6QA 4FTMA 3WF9A 2GWRA 4EJWA 3NGAA 2VWXA 4MGRA 4YFNF 3BHTA 4QQ5A 1F1ZA 2BHHA 3ZMZA 4FKLA 2BKKA 3BLHA 3H3CA 2J2IB 3PVGA 3PPKA 5BMMA 5L8LA 4IRHA 3EQHA 2BROA 3MEXA 2P2HA 1TW3A 1B59A 3KN6A 5AWMA 2E9UA 3KQ7A 3H10A 4BGHA 3BOQA 4M9ZA 2P8TA 5HNBA 1PXIA 2PVNA 2O63A 1QL6A 4ASEA 5F1ZA 4L18B 5HLWA 2B4SB 3IHUA 1T39A 2W1DA 4G5JA 3BHYA 1REKA 4IC8A 3KXNA 3ZU7A 3RPQA 5AR2A 3V5LA 2HEOA 1R5GA 4GK4A 3SV0A 4OBQA 1J91A 1OIQA 4EOOA 4LLGF 4I22A 2JPCA 1ZRDA 5IUIA 2DK5A 5CENA 4UN0C 4BIEA 2JKOA 4NH1A 1A06A 1HCLA 4F99A 2O03A 4FKPA 3E93A 1OIUA 3VOEA 4CYDA 1Y57A 4DE4A 1USTA 1KE8A 1U5RA 4G7ZF 1QPEA 3PQJA 4UALA 1W7PB 2VTMA 2R3PA 5KHXA 4A6DA 4QNAA 4O1OA 3NS9A 1QPMA 2FA5A 1ZG1A 4GGGA 2TDXA 5GZ8A 1JAMA 4PL4A 3ZRKA 4CMTA 1MQ4A 1K7AA 2JLDA 4X2FA 4HV5A 1RW8A 4EOQA 1CF7A 2J50A 3R30A 3I59A 2P5KA 2OQGA 4FV8A 2F4JA 5CF8A 4C34A 4Q48A 3GZ6A 4LOOA 3MPMA 3I79A 3QCSA 2PYWA 5C8MA 2JAVA 3FI3A 4RIWB 3GC0A 3Q4UA 3GXOA 1H9GA 2PZIA 3SFZA 3E8NA 3HUCA 2ETMA 3QHRA 5B2MA 2X4ZA 3FF5A 1RQQA 4XG8A 5J5TA 4NTTA 3GI3A 3OP5A 2A19B 2F5CA 4Z16A 3H30A 4H39A 4Z3VA 4AF3A 1TW2A 5L2SA 2I40A 4FODA 3ZZWA 3FKOA 2EFPA 3CTAA 4PTEA 3UO6A 4B9DA 5ICCA 3QD2B 1WBSA 2YSRA 4BTJA 5CVGA 1UA2A 3F3TA 3QAHA 4B99A 1FPUA 3UG1A 2DI3A 4F9AA 3T9IA 1YO5C 4ZTSA 2JDOA 1QZZA 3VW6A 4CGAA 1DI9A 5AIRA 1BL6A 2O2UA 4K11A 3GQLA 4U41A 5T6KA 3I58A 1YI4A 4X7QA 2K27A 4W4WA 3FY2A 4ZLYA 4F7ZA 2QKWB 3V8WA 1NT2A 3N4UA 1IN7A 4FTLA 2Q0OA 1P2AA 4GT5A 5E92A 4YO6A 3KU2A 3LZBA 5FEEA 4EZ7A 5BVDA 2NRUA 1IRFA 1KU9A 4TYIA 3F3VA 1GIHA 3FM5A 3JVSA 5BUIA 3F5PA 3PLSA 2QLZA 3ZXZA 5AM7A 4RX5A 4CQEA 1O6KA 2A69F 1FLIA 2A68F 1LNWA 3MS9A 3R6XA 1PW2A 2L02A 4ANMA 3EUHA 3NEWA 2RFNA 2C6OA 3TNPC 1U5TC 3QAME 2WTEA 4MWHA 3NYOA 5FB2A 2YJSA 4Y5QA 1XH5A 5JQ5A 4LV5A 3QRFF 3LCSA 4BCIA 3ZDIA 2A27A 2VU3A 3HZTA 2PVHA 4RB3C 5L6WL 4BCHA 3F22A 2P2IA 3V01A 5EOBA 4K2RA 5DBXA 1BC7C 2P0CA 4EJ7A 1K79A 2WGJA 2GQRA 5HCYA 1OPKA 2VO0A 5CNOA 4A9RA 5CU6A 1R5HA 2IT0A 2RN7A 4OMYA 3LCKA 2E1CA 1QPJA 4ZS0A 1U8RA 4L46A 2Q8KA 1WCCA 3GFWA 5ITAA 5J9YA 1WKMA 4CRLA 1O3TA 3RNYA 2FU4A 4ANQA 3KP6A 4RRVA 3FXRA 4HQMA 4O38A 4BYIA 2EJRA 4NB5A 3MESA 3ISPA 2ACXA 3OEZA 3I5NA 4FC0A 1SZMA 1PP7U 2FSWA 2YIWA 3GOKA 5ILVA 1Q24A 5FDPA 3EZVA 3IRRA 3FZVA 2WMSA 5A4CA 2YM8A 5TE0A 4Y83A 2C6EA 4P9UA 4ZZLA 1UVRA 5KE0A 3W2PA 2K86A 1T46A 5D5UB 1IF1A 4E6CA 1MP8A 4IJ9A 3CS9A 5KCVA 1YXXA 3VS3A 1IASA 3LA7A 4B8LA 5AUWA 5J1VA 2QOIA 4OIPF 3MYGA 4IM0A 4S33A 3HRTA 3FAAA 3A62A 5K1YA 1MQBA 3OROA 2RSVA 3TOAA 3IGGA 4PMTA 3HV3A 1RDQE 1CSNA 5FTOA 5JFWA 1R7JA 1PUEE 2WTJA 5IUHA 4LV8A 3FHIA 1UV5A 3FUPA 3CJGA 5FQDC 4G6LA 3TZ7A 1UKHA 1P92A 4WA9A 4EH5A 2VTTA 3PSDA 4FV4A 5HIEA 4OGRA 4ANNA 5AV2A 1IW7F 5EEGA 4HVSA 3OTUA 1KYWA 4EH8A 4EYMA 2QOLA 2ZM4A 3BU6A 4Y5HA 4OTWA 4O5VA 4L43A 5L3EA 4IF4A 5HVQC 3GEQA 1IRGA 4C4EA 4RSSA 4AAAA 2GNLA 2XNGA 3VEPA 4AACA 5AUTA 3NX8A 5HX6A 4DEBA 3UNKA 4FX0A 5JK3A 1MKMA 2V7OA 5HIBA 5DI1A 5K4JA 4KWPA 1ZYJA 5M4FA 2OA4A 2PI0A 4ZSLA 3GUBA 3F7ZA 1YW9A 3KA0A 5M4IA 3HL7A 4CHUA 3B8RA 2XYUA 4Y13A 4DTKA 2W1GA 3DK7A 5JGBA 3S4QA 4YMJA 4D1XA 5CSWA 3BROA 5L3DA 4L42A 3K2ZA 4U3YA 3QTRA 2RVCA 3ZXTA 4DFBA 4ITHA 4O6EA 3LVPA 4M69A 3QC4A 3WYXA 5DHJA 3OXTA 3PY0A 3BBTB 4IFCA 4WIHA 4JOAA 4F4PA 2ZMEB 3N9XA 2WTDA 4WXHA 4MKCA 4M67A 2UV2A 4JR3A 5AM6A 1ZARA 5BUJA 1M17A 1SMHA 4KMUX 2VX0A 3F8FA 3DAJA 3W6JB 4GRBA 1ONVA 3ROYA 3NEUA 2C3KA 4YUQA 3FMDA 4QMQA 5IT9Z 2XF0A 3KXXA 2DPUA 4ZSEA 1YTYA 2Z02A 3P4KA 3A7GA 1ON2A 4XG3A 2JDRA 5AV0A 3SOAA 4RWKA 3D83A 2OG8A 3F6XA 3Q2MA 2M30A 4UYAA 1USSA 3ZM4A 3L8XA 5EW3A 5H20A 4M9SA 3D9VA 3GVAA 4O0WA 3ABTA 3PP0A 4DGOA 4D4RA 4GUEA 5HBJA 2G2HA 4F9WA 1XJDA 3QUDA 1FVRA 1ULYA 1T6SA 2C68A 3FZRA 4D2TA 4ACDA 3ACKA 3SHFA 4CMOA 4ARKA 3D5VA 5HE3A 5CAOA 3NUYA 2O65A 3RIRA 3VS4A 5E91A 5CEMA 3UQGA 4E5WA 4BIBA 2CLXA 1UNLA 4H58A 1W0XC 2CGUA 2CLQA 2OFVA 4I4EA 4EOPA 4FV3A 4O7VA 2VWZA 1M7NA 4S32A 3DAEA 1OKRA 5CJ9A 5ETFA 1WFCA 5FXSA 2DK8A 4O2PA 5HTBA 4DEGA 4C8BA 1KE9A 3VS6A 2CQKA 5GHVA 5A54A 2WEIA 5H8EA 4IFGA 5ILUA 4LMUA 4IAAA 3KP4A 2QVSE 3TL8A 4FUXA 4X2JA 4HAMA 2HQRA 4NJ3A 3REOA 3EHAA 2XVDA 4G7OF 4FTUA 3ZRMA 4KS7A 3V8TA 3E8DA 5DUKA 2R64A 4FTRA 2JDTA 1XGSA 4O0SA 4IH8A 4FOBA 4BVUA 4GXOA 5D12A 3U9GA 4D9TA 1AQ1A 2BZHB 3B02A 4KBKA 4XMOA 4MAOA 5CU2A 4BH9A 2HW7A 3TO7A 1XCBA 4Q5HA 4KA3A 2C0IA 3F8BA 3GVUA 1IAJA 1LDKB 3MIYA 2HAKA 2HK5A 4A9UA 3SXYA 2X8IA 4IWPA 3EMGA 4O7ZA 2C6TA 3D5UA 4I09A 5K0KA 4GT3A 4I01A 3UNJA 4WO5A 2J6MA 2V0DA 2VT3A 2B9IA 4N70A 1L0OC 3ZEPA 3R6SA 3PVBA 2WFYA 3MN3A 3BBWA 3LCOA 4ZJJA 4IZ5A 3AMBA 4RJ5A 5CT7A 1DI8A 3R9DA 3FHRA 2YM5A 3EB0A 4XH6A 1ZWSA 1JKLA 4QQCA 4BDKA 5LARA 1G6NA 3TT0A 3ECOA 4RFZA 3LFNA 5E8XA 4F7LA 3PJ3A 5CSVA 1H1QA 5CI7A 3L7WA 3RZFA 4IX5A 3QA0A 3LQ5A 2UZEA 3LAPA 4YZ9A 5HORA 4FEWA 3ZLXA 3FWQA 1YHWA 2BTSA 4EJTA 2OXDA 4WF2A 4F0FA 5CEOA 4IW0A 3UODA 5HU9A 2UZLA 3GCQA 4F7NA 1HW1A 1BKXA 4OIRF 1XQZA 4F9BA 3QBNA 4KAOA 4APCA 3U4UA 4KBAA 3S0OA 5CAVA 3RI4A 2GS2A 3TNQB 2OK1A 5AR8A 4FYOA 2IW9A 1PP8F 4EM1A 4X21A 5FGMA 3V8KA 4GO1A 2OXYA 4L00A 2CKPA 2RIOA 4AOTA 4AX8A 1O6LA 2O64A 2HR3A 4KNYA 3O8PA 4J71A 4TYHB 3F7WA 2QO7A 1JSUA 4Q9ZA 1XMAA 3R1SA 3TJCA 2OAZA 5H2UA 1HXDA 3LFDA 3QTWA 3JTHA 4BAYA 4I0RA 3FLQA 3CY3A 5CAQA 1ZMVA 4B8XA 3SLSA 2BKZA 3R21A 2F7ZE 4K33A 4M9XA 3R61A 4NJDA 4YJUA 5TKDA 5JZJA 1GOLA 1URWA 2XAHA 3F88A 3PDTA 3WE2A 1BJAA 3KULA 1JE8A 3QCXA 3UYTA 1H0WA 2X1NA 3P9IA 3RCJA 4CV9A 1EH8A 3Q32A 2IJLA 3V5WA 2Z3YA 1UU9A 2Q83A 3IRQA 2DQLA 5AMNA 4CD0A 2PUUA 5EDQA 2XNPA 2JKMA 4TNDA 5AJQA 3O17A 4QTEA 1PRYA 3H3ZA 3FZSA 4O7WA 3ROUA 1YYVA 3D0SA 3G15A 3P08A 2HZ0A 4KUMA 1S7AA 3MVLA 2NNYA 3CC6A 1M52A 5E1EA 5HX8A 4O27B 4CT1A 3R83A 1FP2A 1MJAA 4S05A 1XSXA 3F3UA 1ZLKA 2EB3A 4NTSA 3UP7A 3DB8A 1UCRA 1OYIA 2HELA 1LEZA 5EK7A 3E5UA 4EOMA 1Z5MA 3HHHA 4QQJA 4L5JA 4TRLA 3TO9A 3ZBXA 3VBTA 3ATTA 4ZYDA 3I7BA 1FBNA 3GXLA 4PTGA 4ZH4F 5A3XA 4RS8A 4FHTA 4TXCA 3ENMA 1CKIA 2R0IA 2PVKA 2DBBA 4FEUA 3I5UA 4W4VA 2IZTA 3I0OA 4A9TA 4AN9A 4IZYA 4P5QA 2FBKA 5F95A 1I6XA 3IDBA 4WG5A 5BVNA 1OB3A 2FGIA 4ASXA 3KCFA 2FOKA 4KKEA 2F2UA 4YJVA 2BFYA 2FUMA 2XJ1A 2X6DA 4FICA 4EEVA 3MY0A 3BWFA 1YIOA 3C5UA 4IE9A 3FLNC 4ZJIA 4RIOA 4BDIA 2YM3A 3GCVA 3GNIB 1KU7A 3V8JA 2VE9A 3SRVB 3HA8A 4ZSGA 4IADA 5LEJA 1P4OA 4UXQA 1PXPA 4R5SA 1V0BA 1HOWA 2REIA 4KIBA 1A04A 3V7CA 4FI1A 4OTHA 4ENYA 2AS5F 3ZQ7A 3TZ9A 1MRUA 4U44A 2RG5A 4DLJA 3LJ2A 4FSQA 2VBWA 1ZLJA 5IQFA 3IGOA 1TQPA 4I24A 2ISYA 3N4TA 2WELA 3TWJA 2KJCA 1B38A 2PSQA 4H3PA 3ZO1A 3ZBFA 3PJ1A 4RGSA 3TV6A 4FK6A 3L9PA 3VB2A 1HKSA 3TGNA 1YDRE 4NYEA 5ETAA 5A4TA 5AP4A 3KZZA 5L2TA 3PTGA 2Z5UA 2OFUA 5CU4A 2I0EA 2V22A 4UV8A 1H28A 4MF1A 2PVMA 4G3EA 1BX6A 1VYWA 2W06A 1BI2A 3LQ8A 2ZJ2A 1R0EA 3ALNA 4IDTA 4IPAA 5BS6A 1DS5A 4FYNA 3CGOA 4E8AA 3TKHA 1H24A 3L2CA 2PULA 1ZREA 1UU8A 2VTHA 4A6EA 4ANSA 2Y4IC 4M72A 5FRIA 4PRJA 3SW7A 1QZYA 3EKKA 3FXQA 3F8MA 2G7UA 5FEQA 3IC7A 4FL3A 4UBAA 4AZTA 5M4UA 4I7HA 3QOPA 3CSVA 2IA1A 4FZFB 5EW9A 1O3SA 2CHLA 3UOJA 3ALOA 1URCA 4BDGA 4QMTA 4QP4A 4TYJA 4EZ3A 1NW1A 4I41A 3OZ6A 2QENA 5IU2A 3EETA 2FYSA 3GU4A 3R1QA 4IAIA 2NNNA 4CFVA 3I4BA 4GSBA 5M06A 4CVAA 3EYGA 2PE2A 2HY81 3GU7A 4YJQA 1J3HA 4ALUA 3K69A 4JIAA 4R7BA 5IQHA 3ORIA 5LBQA 5EQPA 4LMNA 4EQCA 5DG5A 5C27A 3MB6A 3PG3A 3SDJA 4EJOA 5IF1A 2BV6A 2UVXA 4YZNA 1TQIA 2OZ6A 2WNTA 1UWJA 4IVBA 2XNOA 1AGWA 2WMAA 2R5TA 3EWHA 5AP0A 3E6DA 3BPVA 2X8DA 2D1HA 1WVWA 1KUTA 4L9TA 3WARA 3TKYA 4O0XA 4L7FA 4ZZDA 3DLSA 1O3RA 5JI6A 2OBJA 3ABUA 1KE6A 4ESBA 1WBTA 4RB0A 1LEWA 4KA4A 3C0GA 4EL9A 3LMHA 3CD8A 3MW1A 2YAAA 2HWVA 4OT5A 3RJCA 4G94A 2Y9QA 3MH1A 1HBXG 1FINA 3L9NA 5BMSA 4FV6A 4RB1A 3R7EA 4A06A 5E7RA 4D28A 5FFZA 3P5KA 1QNTA 5M08A 2L3DA 4AT3A 4PWNA 3ZN0A 3CCNA 3ZN1A 1YDTE 1Q4LA 3RDIA 4QMPA 3IW6A 1PMEA 3IW8A 1W83A 4EK3A 5FUTA 4LOPA 3PA5A 2XH5A 3AC4A 4CQGA 2J4ZA 3RYRA 3EQDA 3P86A 4WCGA 3NAYA 1Q61A 3JYAA 5E1SA 5HO7A 3EQFA 3UP2A 4HGLA 2BVAA 2UZBA 5TRDA 4X6QC 4XYFA 3UZTA 3MTFA 4PNIA 3O3KA 4YC3A 4JDKA 3HMPA 3EQLF 4IHSA 3J81K 2EA4A 3M11A 3Q4TA 4OR5A 3EH9A 4KNBA 1IN8A 3P7BA 4OAUC 1EH6A 5DUIA 2WMRA 2V62A 2FNPA 3FEGA 2O3PA 3EFLA 3HA6A 4LL0A 1PXLA 3Q04A 3RBWA 3RVGA 4L9IA 2CGXA 2QO9A 2XJ2A 3O7LB 2C6DA 2R2PA 4GG7A 3C5IA 3Q9YA 3PFQA 3ORLA 4X3FA 5LMAA 4M14A 1QMZA 3PXQA 4FKJA 1I09A 3FJQE 4CFNA 2E9OA 1JVPP 1Y8GA 4NWMA 2HGCA 3ZFYA 2E9PA 3SAYA 3KMWA 4Y46A 1BIAA 3DKCA 4HCVA 3H9RA 2XNMA 3QKKA 3TUBA 1S29A 2WQBA 1Q97A 2XNBA 3EN7A 4O0TA 1UHMA 2ZMCA 4G9CA 4YURA 3VJNA 4HQEA 2C1AA 4TY1A 3WE8A 5EHLA 4FKRA 4JS8A 2R7IA 3T8OA 3B2TA 5IPJA 5E20A 1AOYA 5ANGA 2XROA 5KMJA 3SQNA 4AU8A 1OECA 5LLQA 4QQTA 5HCXA 3WE4A 1DAYA 5J5SA 3FC1X 3LOKA 5I9WA 1B6CB 2YZAA 2A61A 2C6YA 2WU7A 4K0YA 3H9OA 3VWAA 3E6CC 2GNIA 3FL4A 4MX9A 5CNNA 3FV8A 4CFXA 4IXAA 2OJGA 3Q5FA 3HSRA 2F5FA 2V1DA 2YM6A 5GNKA 3F69A 3KRJA 3KE2A 5A6OA 3VJOA 4I98B 5CF5A 5ANJA 5FBNC 4A0YA 4WNKA 4L8MA 2COMA 3WGIA 2QUFA 2R3GA 4HBLA 3TIZA 3WTTC 2ZAZA 3WI6A 2OJIA 3OD6X 5JSMA 3F8CA 3HMOA 1YI3A 2J5OA 2ITZA 2HENA 3BYMA 4U88A 5CXHA 2OLCA 4LD5A 2ESMA 1D8KA 4QTDA 3PVUA 3RKBA 2WO6A 2AYPA 3EQGA 1OGUA 4U0WA 4OOIA 3ACJA 4J96A 3EN6A 4XX9A 3W32A 4EGZA 3UMWA 4C58A 1OMIA 2J90A 4IVAA 2Y4PA 4GJ3A 5D7VA 3RK7A 3CKWA 2HW6A 3EYIA 5AIKA 5AV4A 3UVRA 4XBRA 2XEYA 2GNHA 3FKLA 2XIXA 4WUNA 2NAZA 1GIIA 3MVHA 4FTCA 1XGNA 3L8VA 4KD1A 4AN3A 4JK1X 2Y0AA 4BHNA 4BWXA 1F5TA 4FNYA 3RHKA 1J59A 3A7IA 2KIFA 2PTKA 3PSCA 5J8IA 3S1HA 1B4AA 2XZSA 4EUUA 1YFHA 2P6SA 3OBJA 4GJ2A 1OKWA 4D9UA 2HCKA 1FVTA 1ZGJA 2ZO4A 3WTYC 3AQVA 2CNVA 1TKIA 3NUSA 1H0MA 4L3LA 3QQJA 1ZMUA 1KV1A 4TWPA 1J7LA 2HWOA 5FD5A 2KKOA 2W84A 4FV9A 1FGKA 4E5AX 4DC2A 2YIXA 3A2CA 3ERED 4LOQA 1PKDA 1SNXA 4BB4A 4DH1A 4OMZA 3EQIA 1S3JA 2FH9A 4QD6A 4ERKA 1FWZA 2GHMA 3ORXA 4E6QA 3RM7A 2PE1A 4GFMA 3RPVA 3EN4A 3RPYA 3LCTA 2PFBA 3P7CA 2VTOA 5KZIA 1YW7A 4IRIA 2P4IA 2GFSA 4CKRA 3SHEA 4FBXA 4WNOA 5CU0A 5I0BA 4HVGA 2YISA 5EYCA 4BHBA 4YHJA 4XG9A 1V0PA 3QD3A 4G6DA 1YOMA 3FPMA 4ACHA 4CT2A 4C0TA 2GQSA 1PXMA 2UVZA 3Q6UA 5IQAA 4LMYA 1LPUA 3R7OA 3KP2A 1PXKA 1IZ1A 2V5QA 2WMBA 4IX6A 3TNIA 2FBIA 5J9ZA 5HOAA 2X6EA 2B54A 2R3LA 3DU8A 3R8PA 1XD7A 4PGGA 4P90A 4A0ZA 3K5UA 1CF7B 3OXZA 2UVYA 3I59B 2GNGA 2YFXA 2C4GA 4EUTA 4XLNF 3QUEA 4DGLC 5L3GA 3JY9A 4PY1A 4JAJA 4QYHA 3HRMA 1HKQA 4EHZA 3KREA 4RWJA 3GFJA 1YRPA 2NP8A 1Z6RA 1WI9A 3MQ0A 5DRBA 2FF4A 4JX7A 2VWVA 3F66A 3UTOA 3IECA 1J7IA 1FPQA 2O6GE 3DA6A 3DAKA 4O6LA 4YLJA 5CT0A 2Y7JA 4FSNA 4PDSA 4WNMA 5D4SA 2FEZA 3DPTA 2C5VA 2A3SA 4EH4A 4D4SA 4I6FA 4FKUA 2FVDA 5CY3A 4U5JA 1KQ9A 3NCGA 2YLFA 2F7XE 1XH9A 5I9YA 1ZZ2A 5AIQA 2PMNX 3GU6A 3PY3A 3P9CA 4PMPA 4I20A 3NRMA 3AD5A 3RZBA 4F6SA 2ITWA 2W99B 4F9CA 2R3QA 1X8BA 3BJ6A 4OW8A 5D5WB 2KTYA 5JHUA 3RAHA 3SG8A 4DHFA 4XV1A 4FNXA 2HS5A 4FSUA 1OL1A 4LFIA 4YBKA 4UVAA 3E88A 4QTAA 5AAFA 2YACA 4XOYA 1YS7A 2JKQA 2HZ4A 4RX7A 4EH9A 2G2FA 3R7GA 3ZMUA 2UW3A 5LVPA 1F5QA 5JR3A 2FE3A 5HE2A 2Y6OA 1E9HA 5M51A 4U3ZA 2ITUA 4M12A 3DZOA 5IT3A 3OUKA 4WHZA 3T1BA 5D8KB 4FIFA 3ZONA 1FYMA 5EKOA 4GL9A 3DBQA 5HG8A 4R3PA 2Z7QA 3T3UA 4I02A 3ULZA 2CDZA 3UQCA 2CW0F 4DG2E 1O7FA 2W96B 4ASZA 4RJ8A 1ZYLA 5DEWA 4QO9A 4FVRA 3MGYA 3W33A 2JBOA 1PY5A 5CZHA 2QONA 5L2QA 4C61A 3WGHA 5DWRA 1HCKA 2H9VA 2VTSA 4G8XA 4M74A 4XG4A 4FR4A 1WVYA 5HD7A 4PNKA 2GQQA 3TNHA 3R7VA 5D1JA 3IKVA 1KOBA 5CS6A 2B53A 1DDNA 4PUZA 5K4IA 1FC3A 2KIUA 3M1SA 2XGXA 4O91A 4ZEGA 5CVRA 3VS1A 4C57A 5F1RA 5LVMA 2OGVA 4EK6A 4IAKA 3QF9A 3GENA 1ZRCA 3U4WA 1I1GA 1H01A 2YLEA 4I5PA 5AUZA 2J5PA 3KMUA 3ZTXA 5CEQA 5K5XA 3WZJA 3J81Z 2DQ7X 3ZLSA 3UYSA 3QQGA 4MNEA 3MA6A 2CG4A 4P9FA 4ZTHA 3P79A 4ACCA 5HLHA 1ZYDA 4ORKA 5HLPA 2P33A 1FBUA 1R58A 2YAKA 1JKKA 5EG3A 3S00A 4QP2A 3OEFX 2UZOA 4QRCA 1GAGA 4ENJA 1PDNC 1XB4A 1JBPE 2NNWB 3VS2A 2QQAA 4EOLA 1TNTA 3DJ7A 1P14A 5CTPA 4Y73A 4U6RA 2W4KA 5IA0A 4DFNA 2CSNA 4NM7A 4ZAUA 4TV7A 2DT5A 3CQUA 3QTIA 4EKKA 1XH4A 4XLPF 2QOQA 4DEIA 2WPAA 4J95A 4H3BA 4RIYA 2DTRA 2UZTA 4CFWA 2I0YA 3HYIA 1ZRFA 2CCIA 5FFXA 3PJ8A 5BUEA 4QMZA 1WRJA 1G8AA 3R04A 4RWIA 5K5RA 2XCHA 4L7SA 4FV5A 1GY3A 5JMSA 2OI4X 1SAXA 5KVRA 3BV3A 3HP5A 1ZH5A 5JN2A 4F6WA 2HYYA 1GJOA 3JS2A 2GPHA 4WXDA 2QBYA 3CDHA 3MA3A 2YEXA 3FQEA 2ZDTA 3R7YA 3Q53A 1W7PA 4LLLA 1TNSA 2ZMDA 1M2QA 4L67A 2YM7A 3TCPA 2ZJWA 4O7NA 5J8CA 4DEAA 4EJNA 3FMLA 5JFRA 4BCOA 5C4KA 3QRIA 2ZV9A 5IH6A 4RVLA 5I3RA 3MPAA 1D3YA 2OU7A 4EOSA 3KRXA 3DFAA 2VN2A 2ZDUA 4M69B 2P7CB 2HKOA 4LRJA 4YNOA 5IA4A 1WBVA 4MTAA 2P5VA 5HE1A 2YCSA 4BI1A 2BUJA 1QCFA 1L3LA 1FMOE 4TL0A 1P2FA 3LFEA 5E8ZA 2GQGA 4R1VA 4EORA 1B39A 3ORMA 4FSMA 1PJKA 4N0SA 2PZRA 3WTUC 3JTGA 3VHKA 2YN8A 3POZA 4QTCA 4U9AA 2F49A 3LCDA 2B52A 2M8EA 3E7VA 5E4HA 3QU3A 5G6VA 4WUAA 3HNGA 2XAQA 3R1YA 4HZFA 3JUHA 3DGKA 3K1NA 4LL5A 3ID6C 1PMNA 3FMNA 1Q8UA 3MFTA 4R3RA 5FLFA 5AIPA 3EZRA 5DCFA 2C0TA 4HCTA 3CO6C 3EFWA 3RINA 4AGUA 4YLKA 4N4SA 3R2YA 2X2KA 1ZLTA 3QRKA 1OIYA 3L00A 2O8YA 4E4LA 3KMMA 3HSFA 2JGZA 5F20A 1O6YA 1YG2A 3Q9VA 4C02A 5F64A 5HQ0A 2BAJA 4IVNA 4LRMA 4TKSA 3FZTA 4U0VA 2K4JA 4RPVA 2QR8A 2VV9A 2DS1A 3KRLA 4MXYA 4PDOA 3MZHA 5A2QZ 1VZOA 3RKWA 3QQHA 1MJBA 1WSUA 2JZYA 4EK4A 3BQRA 3W1FA 3NYXA 4EOJA 1G3TA 2W5BA 3NNUA 4OTFA 4AA0A 3GEZA 4R78A 5DR2A 3TTIA 2YERA 4EOKA 2YIYA 3DK3A 4JRVA 3H9FA 3TDUC 3DCVA 4F65A 1NHAA 4DEDA 3MJ1A 4GUBA 3A60A 2IA2A 5F4NA 1LEAA 1YDSE 3MY1A 4JRNA 4L01A 5ACBC 4IXPA 5HGIA 3LQQA 4QP3A 4M6YA 1V3FA 4KN4X 2XA4A 3R73A 5E8YA 2ITYA 2YA9A 4M8TA 4PP7A 4HW7A 2R3NA 3QQUA 2QWWA 3DZQA 3H92A 5CQUA 1FQ1B 3UZPA 3PIZA 5C01A 4FKSA 4IM3A 5CSHA 5BVFA 5DE2A 4D2VA 3ZH8A 3KF7A 3OS3A 3S3IA 4U0YA 2HXLA 2XK8A 2DLLA 3BDDA 1YKRA 3GP0A 4H0EA 3HLLA 4GK3A 1FP1D 5DLSA 5CF4A 4I1ZA 4LG0A 2XCKA 4BDAA 3OW4A 4EBWA 3OOGA 4MBIA 3A7FA 4MD9E 5AUVA 3E5XA 3I54A 1FOTA 4E4NA 4GCVA 4TWCA 3QKMA 3COKA 4E73A 4BDEA 3KFAA 2QM3A 3KK9A 4BZDA 2L54A 1J0RA 1Q8ZA 4HGEA 3R4KA 4Z7GA 3M7GA 5LVLA 1WVXA 1SMTA 2XVCA 5KKRB 5CAUA 3TKIA 3DNEA 4RLKA 3GFIA 3BWJA 4L0ZB 3HAMA 1GXPA 3C50A 2L4MA 3MSSA 1MJ9A 4EK5A 1UHWA 4PPCA 3M1EA 3F3WA 1M14A 4YTIA 4WNPA 3MDYA 4HOKA 1UU3A 3C0IA 2V6CA 2Y8OA 1R00A 3OV8A 4YHTA 4I0BA 3ZDUA 3DDPA 3ORTA 2FRHA 3MPTA 4L3JA 3UJGA 3V51A 5DNRA 3QLFA 1K78B 5JRSA 4G5PA 4K6ZA 2VAGA 4LG4A 5ERIA 1Q8TA 2J0LA 4QYFA 2UZUE 4CMUA 2W1IA 3MAJA 4AE6A 5HI2A 5AV1A 1ERKA 5HG5A 3BYSA 2ZCWA 3QZHA 4KIPA 1BN5A 3KXGA 3PYYA 2CSOA 4UV9A 5I4NA 2PE0A 3RYPA 3C4FA 1HKTA 1BC8C 1R23A 5E8TA 1XGMA 2ZXJA 3CPCA 3HRSA 3FMEA 2XIGA 4DH5A 4KBCA 3VBWA 2FSTX 3AT4A 3HRCA 2W1CA 3CIKA 5LWNA 5E1XA 4WWCA 3BEGA 2BZIB 4BYYA 3QRUA 5B2KA 2E2BA 2XJ0A 4HZRA 2R3OA 4DEEA 3EQPA 5HD4A 3LE6A
chains in the Genus database with same CATH superfamily
4IOAF 4AIKA 3BJOA 3HMNA 3GCUA 5J1WA 5E9EA 2BRBA 4UVCA 3KULB 4YHFA 4FX4A 4XN3A 4HYEA 4O83A 2DU9A 4AXCA 1SD5A 4BI0A 4A5NA 1D5VA 5DT0A 3IKAA 1OJLA 2CCHA 4KITB 3IWZA 1W5SA 1W0TA 4FG7A 1Z9XA 3ORPA 4HLYA 3PVWA 5IQIA 4G12A 3TNWA 1R9TJ 4DH8A 2WTCA 5GIOE 3KLOA 4UZDA 5IQDA 5HS9A 5FGKA 1BLXA 3QRJA 5HIDA 1NK3P 5BVOA 4JBOA 4PDKA 5ED4A 4DYMA 4BE2A 1SD7A 4IMYA 2RV8A 1Y8QB 4LRKA 5E17F 1P4WA 1XR1A 3MWUA 3HKOA 1R39A 1FYKA 3MVMA 2C6LA 4QTBA 3RAIA 5CZIA 2GNJA 4LYNA 5I3OA 4ZXTA 2QCSA 4J97A 4NC7A 1Y91A 1STZA 3BHHA 4CZYB 1G4DA 4U42A 3EYHA 5BNGA 1ZMWA 2ITXA 3DTIA 4YLLA 3QA8A 2RKHA 4FTNA 2KLOA 5CLSA 4CH7A 3WHCA 2IF8A 4LGGA 4UV0A 4H05A 3MWMA 2XK6A 3MN2A 2JT1A 3UNGC 3A7JA 4HX8A 2EVAA 2Q0BA 4FGBA 1YWVA 2OF2A 5LMKC 5EI8A 4BE0A 3CMEI 1VQ6I 4BGQA 2VTJA 3FMQA 3QX4A 1I6HJ 2F57A 2PK9A 2QQBA 3FXZA 2GFCA 3SGCA 5CVVA 3VUKA 5EQYA 3DJ6A 2GNFA 4IDVA 3QTSA 1W7HA 4XV3A 4A3IJ 3IQ7A 1GNGA 3BR1A 2SRCA 3OWTA 4TZRA 2X0QA 3OOPA 3U21A 4BICA 4CCUA 3LMGA 4GFBA 3AAFA 3MH0A 3ORNA 2JA6J 2UUZA 4AD9A 3BGZA 2CGWA 4ZYAA 2IZUA 4DBQA 2LOOA 2QOCA 5B1AH 3K4KA 4PMSA 2WV1A 1MNMC 4AW5A 3E97A 2XAJA 2IVUA 2Y6MA 2VI6A 4IOCF 2PUIA 3NW5A 3VW8A 1P9QC 4RC3A 3KYLA 4TPTA 2M5WA 5KMIA 1YLFA 5KMOA 2PJPA 1F9NA 3SEZA 1X3ZB 3LM0A 2ZB9A 4BCKA 2XUUA 2EQRA 2NRAC 2JD5A 4UMTA 3SEQA 2DT7B 2CQXA 4B7TA 3CLYA 2K3FA 5AAGA 2VC1A 2KT0A 2VONA 4QMVA 4FV2A 2OH4A 3MJ2A 5H2FC 3G2BA 2X4HA 5CVUA 1K6OA 2J0KA 3SW4A 2ETRA 1G3NA 3WG9A 5BX0A 3UC4A 4YJRA 5GJFA 3D7TB 4BS9A 2O9LA 3K3JA 2CMWA 2D45A 1YWRA 4DTBA 1S9IA 3VUDA 1GZKA 5C8KA 2DYLA 2WAJA 2Y48A 3MB7A 4NFMA 4ONAA 2XM9A 4MNFA 3H36A 2Y9YA 1OLTA 3UDTA 1IXSB 1BM9A 4JR7A 2WIPA 3KXMA 4IWQA 2BTRA 1OL6A 1ZYCA 2PWLA 2EINH 5J7BA 3FZ1A 4R77A 3ANQA 4AXAA 1KU3A 5E3OA 4FTAA 3BHUA 4X2KA 4IC7A 2HYGD 3AGLA 3PXFA 3DY7A 3CTHA 4FZ7A 2CKOA 4KRDA 4E6DA 2M1BA 2UWMA 4RA5A 3W55A 5IISA 2BR1A 5ICEA 3KETA 3DBEA 3L8PA 3BCEA 1YHQI 5CSPA 4QYEA 5HNIX 4ZSAA 2DFHA 2O0UA 1O3QA 2ME6A 3Q9WA 3MFKA 4EONA 3FXXA 1WQ2A 1QA6A 3DXNA 4BXUA 4HYUA 2BRHA 4N6YA 3DBRB 4EQMA 4AIHA 1MDMB 4F0GA 1Q99A 4IX3A 5D11A 3W6VA 2YCRA 3M9AA 4G31A 3MIAA 5T3QA 4AFEA 1U54A 2V1UA 1ZYRF 2WQMA 2W25A 5HDKA 4F1TA 4DBXA 3QX2A 4W97A 4FVQA 3BP8A 3V4GA 1CKJA 3I81A 2IO6A 1FMVA 5AP1A 3O8HA 2F2CB 3DPKA 5JZNA 1G3SA 1H8AC 4UWCA 4G9RA 2NOGA 2YDKA 2BPMA 4IZAA 4UUSB 4E7ZA 3O50A 3R0AA 4NSTA 5HKMA 4XORA 3VUIA 3GB2A 4YIRX 2ZM1A 3G1OA 3LSHA 2WHBA 4AT4A 5CAPA 4EWHA 3RMFA 2XKEA 4CGZA 1JUSA 4E26A 1QU3A 4IZ7A 3F21A 1YXUA 4L3PA 2VTRA 2YWVA 5ANDA 3AG4H 4HA8A 1IR3A 4CDGA 1J7UA 1OZ1A 1UWHA 3K4NA 2QI8A 4K2EA 4TYHA 4U7ZA 4AT5A 3CR0A 4KT5C 1NXKA 2E7XA 2R5ZB 4HV6A 2BY1A 4ZMFA 3BQYA 3UE4A 3ZMTA 2KRHA 1KGSA 2AO9A 5DRDA 4Y3OA 4BI2A 3AD4A 4XLVA 1R1WA 2R3RA 3E1SA 3PIYA 3A02A 3P9KA 2N8GA 4G1WA 2CWEA 4F08A 4LUEA 1Q41A 1MH3A 1TTYA 1H07A 1U5TA 1VQPI 4I21A 2IAIA 2CN8A 4QMMA 1QVUA 3WF6A 3FLSA 2L01A 3NCZA 1XGOA 3AFHA 1FMKA 3PE1A 4CKJA 4E4XA 4ZTMA 4AG8A 3QPSA 5LVNA 1FTZA 1Z0XA 3C1DA 2VQGA 4O7YA 5BNJA 3BV2A 3B8QA 2XBJA 4NCTC 3LMIA 3DLLF 3W0SA 4D5HA 3KF4A 2G9WA 4M13A 2J5EA 1TZDA 4AW0A 3DBFA 4I5HA 2M2EA 4ZZMA 4GYGA 3RPRA 4KS8A 3DPLC 1KU2A 4YZBA 3PXZA 4XS2A 2STTA 4YSJA 2K9NA 3LFQA 4C35A 4O84A 4A7CA 4ZIMA 4ASNA 3R22A 3NFFB 4IAZA 1H08A 3WIGA 1X4OA 4FT5A 4RQKA 3VSKA 4ZJVA 1VQ5I 3IH2A 3G0EA 1SD4A 1GZ8A 3H0DA 4W1UA 1NK2P 4R8HA 4JG7A 2LY1A 4HVIA 1OFCX 2JEDA 2EXEA 4FMQA 4QMWA 4X3FB 3LQRA 2DA7A 3L09A 4Q9SA 4PL5A 3R2BA 3DBDA 1KQ0A 5HCZA 3DXPA 2XAGA 3ULIA 4JQ8A 3SKCA 1Q1HA 4D5FA 3BEAA 1B6AA 2B9FA 4U80A 1MBGA 2GBYA 2I0VA 4B47A 2ETHA 4H1JA 3QQFA 3EYYA 4ANOA 4R5YA 4EJVA 1V5GA 4IACA 1UG2A 1NG7A 4XHKB 1PMVA 1V4RA 4UMRA 4YG2F 2A6HF 3FSFA 3OYMA 1X1PA 5CVHA 1ITYA 2E9NA 3LOCA 1YOLA 3G90X 4I5MA 3CC7I 2XIRA 3RSNA 4EMSA 4AU7A 3P23A 2M4GA 4E3CA 1U0JA 5IDNA 2GTMA 5IA5A 3EQRA 4Y52J 4F9YA 5C1QB 2H8RA 2OSCA 3FXWA 2J51A 1Y6BA 1M2PA 5J95A 2HTJA 4MHGA 1GVDA 1S7OA 4I6BA 4N9HA 3C4WA 2RF9A 2Z2WA 2CNQA 5E1ZB 4KISA 2EUFB 4EC8A 3TUCA 5KX8A 2LY9A 2FXAA 3DKWA 1ZKGA 1UNHA 2IZSA 1JHHA 3IWFA 4BL0B 4ZJZA 2HOSA 1HDDC 4C2VA 2OUMA 3HIFA 2WIHA 4CCOA 4J1RA 4WRGA 1KE7A 1SM2A 3DV3A 4AOJA 3UBDA 4GS6A 4KIKB 1RZ4A 2OTLI 4DBNA 2LK2A 1XHAA 5IH5A 1JUMA 3FQHA 4XIDA 3G73A 1DAWA 2Y69H 2VE8A 3M42A 2RNGA 3COIA 5IOZA 3QYZA 4JI9A 5E8SA 2VJ5A 3V6SA 4JBAA 4PP9A 4ASDA 2XRWA 2YM4A 5CVIA 2WOUA 3S3OA 1HLVA 4F63A 3NW7A 4CNHA 4DH3A 3E64A 2ZXWH 2WMUA 2QU5A 3H5NA 4BDCA 1PYXA 1SAUA 1OL7A 1U2WA 3SG9A 5DM6F 3U1DA 1BJZA 3V5PA 1E0EA 3G33A 4GEOA 2C5NA 3FPQA 3DEEA 2E1MC 4DGNA 3I6WA 5FTQA 3F3ZA 2YR2A 3ZO2A 2M9HA 2UZDA 2G9XA 1VJYA 4WG3A 2H6CA 5FTGA 1W4MA 1EH4A 1QPCA 3FI4A 3ZQFA 3KZIC 2DOEA 4BACA 4RIXB 4RGUA 4M0ZA 3OXIA 3ESWB 3OYLA 5EEHA 1JT6A 4EH3A 3ZQQA 5AFVA 3ZM9A 4OUCA 2WAQN 2X2MA 2B1PA 4FTIA 1PHKA 4MQVA 5HS7A 2C6KA 4X0MA 3SXSA 5HLNA 4ZS4A 3BR6A 3Q52A 3N51A 2GXGA 4KUJA 5L8JA 1WAKA 5LXMA 2NYXA 2I7QA 2DMQA 3LPBA 3VS0A 3Q4ZA 1YW2A<