1ZAOA

Crystal structure of a.fulgidus rio2 kinase complexed with atp and manganese ions
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
282
structure length
271
Chain Sequence
MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVGHTKVKEFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Rio2 serine kinase
publication title Autophosphorylation of Archaeoglobus fulgidus Rio2 and crystal structures of its nucleotide-metal ion complexes.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 93
structure length 271
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zaoA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zaoA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zaoA02
3DFAA 2OGVA 1KGSA 3RHXA 1QL6A 3V8LA 3GYHX 4J52A 2B7AA 4RX7A 2XUUA 3KXXA 3GQIA 3H9FA 3H3UA 4LMYA 3P9CA 3PJ2A 4RAZA 3MB7A 3CTJA 2R3PA 4IX4A 2ZAZA 1URWA 4FT9A 4L3JA 3BV3A 4X7QA 3QUPA 5E8WA 4PF4A 3SGCA 5HHWA 2C3KA 3PQKA 2CPKE 4AZSA 5EM7A 4R3PA 3V7SA 4EC9A 4G8XA 4RLLA 5BVFA 4ASDA 1BIAA 4YP8A 3UG1A 3UOHA 3COIA 3FMNA 4R3CA 4G6NA 3PXQA 1OZ1A 4O7WA 4LGWA 3FZVA 2I0YA 4CO8A 4LFUA 4YJVA 4MYGA 1K79A 1IZ1A 3HOTA 1HW2A 3AC1A 2DAOA 5LRRA 2G2FA 3VIDA 4G7HF 2YITA 4YPDA 4MGRA 4OTHA 2WMBA 2NNWB 3J81Z 4U0WA 1OPJA 4LGGA 5M4FA 1YLFA 4NL0A 1EH7A 3PP1A 4DT9A 2ITPA 3ABUA 4G17A 4EONA 3N4VA 4U0YA 1S29A 2WFYA 2ZJ2A 1VTNC 2XK7A 3IQ7A 2PL0A 3NEUA 4L5IA 3ZMDA 5JFWA 3B02A 1V0BA 4BDAA 4KYWA 2XJ1A 3CD3A 2CN8A 4YLKA 2OZAA 4QQ5A 2YWVA 2H6DA 2XIYA 1B4AA 5J7BA 1JOWB 3ACKA 5JRQA 4N57A 4AU8A 5TE0A 5AX9A 5I9VA 2UZKA 4KNYA 2OLCA 5HLNA 4C4GA 4XV3A 4CTBA 1OIUA 3KK8A 3SZTA 4IHPA 5K5QA 4DAWA 5IH6A 3HSFA 3DOGA 2VWBA 2BRMA 1YQJA 1G5SA 5E8ZA 3U2RA 3WTZA 4RC3A 2AXLA 5ETAA 4I23A 4AIHA 1WVWA 4DBXA 3VWAA 3HMOA 5AUZA 2YFXA 2VOOA 3LFFA 4EL9A 4JI9A 3MV5A 4OTPA 1GIIA 2VTOA 1ATPE 3UDBA 1HSJA 2C5NA 3PIXA 1YG2A 4WRSA 5A4TA 1OL1A 4W4VA 4Q5HA 4EC8A 2BBYA 2AS5F 4AA4A 5J1VA 3PIYA 1H9GA 3HMMA 4AZFA 4XBFA 1YDRE 3PVUA 3H0YA 2YCFA 4FV3A 2J6MA 4M12A 2R7BA 3GW2A 2XNPA 5M57A 3SW7A 2X2KA 3Q9VA 3UPXA 4A0XA 2O0UA 5HG5A 4CHUA 3ZRKA 5HNIX 2PZIA 1LPUA 3EMGA 4FC0A 2EA2A 4EMSA 3LFSA 2B4SB 3J80K 3K2ZA 1S7OA 4JS8A 4RIWA 2O5KA 1I09A 5K1YA 2DW4A 1F5TA 3ZS5A 3QALE 4Y5QA 3DEUA 5A4CA 3A62A 1BL6A 4HF2A 2A2AA 2DI3A 3R30A 1UB9A 1OUYA 3SXRA 4AP7A 3JVRA 1DI8A 4LMUA 2PWLA 4MNUA 3F9NA 3FLZA 3MA3A 3MFRA 2P5LC 2G9XA 4IB0A 4RJ4A 3VBTA 2XRNA 3IWFA 2WAJA 4N6ZA 5HG9A 4EKKA 3FXRA 3I1AA 1U6GA 1Y0UA 5FP6A 4L52A 2EFPA 4CFUA 4H3QA 3R9RA 2BCJA 4USDA 2JZYA 2Q0BA 3T8OA 5CSVA 3MZYA 2JKOA 5E8VA 2W0JA 1UU9A 2P6SA 1GXQA 5LWNA 5CALA 4DNCA 3ZUTA 1QPDA 4KIKB 1XH6A 4E6AA 3BROA 5E8SA 5AV4A 4I0TA 4RMZA 3PPKA 5IQBA 2JSCA 2XK4A 2M8EA 2VC0A 2OXDA 2EWNA 1GZNA 1E2XA 3F6OA 3RKXA 4M6XA 1P4FA 4WG4A 4YHFA 2F5DA 2C4GA 3PG3A 2E9NA 4CFWA 5CSWA 1GIHA 4F0FA 3CIKA 3H9OA 4O1PA 3FL5A 3HEGA 1H1WA 2Y6MA 5L2IA 2XAFA 3O96A 4NCTA 5D4SA 4RJ5A 4W4YA 1E1XA 1ND4A 4YHJA 3EOCA 2C5XA 2V79A 4JR7A 4O27B 5AP5A 4QTEA 1Q8TA 1H28A 3L09A 2H94A 4U88A 1PXIA 5IT9Z 1BX6A 5HCXA 1YW8A 4QQCA 2L3DA 5H20A 4GJ2A 3FXZA 1IR3A 3W1FA 2D1VA 4MEYF 4DG2E 4QNAA 4C7TA 1R5GA 4RWJA 1PXJA 5HTIA 5CYIA 4WD5A 3F69A 3AC4A 3VODA 2WU6A 3CQUA 5IA0A 5DA3A 3EKNA 4XV1A 2WD1A 4IB3A 4FKLA 2Y4PA 4GS6A 3K2LA 1IAHA 2HW7A 4EJNA 1H27A 3TTJA 4RRVA 2OK1A 1DAYA 1KE6A 4D2WA 5H6QA 2QOOA 2VX3A 5CVHA 2PU8A 5H8EA 2KIFA 5B2MA 4GFOA 4ENNA 3ACJA 4A06A 4E5WA 4YZBA 4FUXA 4GYIA 4MNEA 1C0WA 3TO7A 4DEIA 5J79A 3ZC5A 2XKCA 2PZ5A 2HWVA 4GU6A 3KB7A 4CNHA 3GENA 4M14A 3MBLA 3THBA 3R04A 3S0OA 1ZMVA 1YW9A 3MY0A 3R2BA 4KFCA 2OF4A 5CEPA 4QMOA 2ZB0A 3HV4A 2UW0A 4AZVA 5HVYA 2C1BA 2AUHA 1UCRA 3FHZA 2V0DA 3MI9A 4D2RA 3DXNA 3JVSA 4AIKA 3DB8A 2IW6A 3DB6A 3PZHA 4WSQA 4CLJA 3MPAA 3AMBA 2UZDA 2WB8A 1H4LA 2UZLA 2XEYA 1LP4A 1PXLA 4YIIA 3HAMA 5EW9A 3E5UA 3UQCA 3QGYA 1CKPA 4U3YA 4BI1A 3RBWA 3T0YA 3PE1A 3A99A 4I0AA 4WBBB 3RI4A 2J5PA 4YR8A 4O7YA 1KV2A 1S9IA 4QMSA 2L4AA 4EWQA 1UKIA 4YC6A 2FU4A 2UZBA 4EH5A 4KWPA 3KXZA 4QP9A 4AOJA 1BM9A 2BIKB 3A7HA 1IA8A 3TZ7A 4FVPA 1R22A 4IRHA 4LG0B 5GJDA 1WBVA 4DEDA 3V8TA 2PUUA 2JAVA 3RINA 2OF2A 3FKLA 4TYHB 4CQGA 4I5CA 3VBQA 3OROA 4RA5A 5CAVA 1TLHB 4IADA 2BVAA 3U8WA 4EK3A 4HZFA 2VWXA 3HSEA 3GUBA 5K9IA 3U9NA 4PTGA 1OL6A 4FL1A 3FZTA 4UWYA 3U55A 2UUEA 4L18B 2O61A 4EH3A 4USEA 1K7AA 5HLWA 3DPLC 3CJGA 3S1HA 1EH4A 2C0TA 4FT5A 5LMBA 4ON0A 4M9XA 4FI1A 2C5VA 4TWOA 3G0EA 1XWSA 3TV6A 4A4LA 4Q48A 4CKJA 3D5VA 3SOAA 1BIBA 1QPEA 4BBEA 5J9YA 1O9UA 3TO9A 3M42A 3BWFA 1BI8A 3Q3BA 2Y48A 3B73A 1MDMB 4FSMA 2FSTX 4FV0A 4NCTC 3ZMUA 3VQUA 3C51A 5FXQA 3RGFA 4IDVA 4EOPA 4ENXA 1R23A 5AADA 4OGRA 5HVJA 4E5AX 1YIOA 1H1SA 4EK5A 2YIXA 4EV0A 4D0XA 4X2NA 3UNKA 2W1ZA 1PMUA 4QP8A 3NNUA 2CHLA 5BUJA 4O0XA 2QBYA 4OT5A 4GG5A 5J8FA 2J90A 4YNEA 3ZC6A 4HCUA 5C27A 5K5XA 4FNYA 3GOKA 3QPHA 1ZREA 3K1MA 1YOMA 3HMNA 4O0TA 2QVSE 4FEUA 1Q3WA 4I0SA 5JQ5A 1K78A 4DLJA 4R3RA 4D55A 2X6EA 3QRTA 5HLGA 4RJ8A 2C6LA 4O0SA 3GB2A 1FINA 2GS7A 1CKIA 5J95A 4BDIA 3EQFA 4FTLA 5KHXA 5DUKA 4GL9A 3FLQA 1WWXA 4JRVA 4F9CA 3MEXA 5HIBA 2PTKA 2P3GX 5KNJA 2P0CA 3R22A 5BPIA 4F70A 4JDJA 2P8TA 5TF9A 1YI4A 3I6UA 3RTRA 5CVVA 1G3WA 3KF7A 4KKHA 2Q2EA 4WXDA 5HIEA 5IMXA 4ITIA 4E6QA 2I1MA 3NEWA 3MIYA 4R1VA 4XG2A 3MWMA 1PXKA 4O81A 4FX4A 4UBAA 3MPMA 1O7FA 1XSVA 4UVAA 4CT2A 3QCXA 2WIHA 3IKAA 3G90X 4HGTA 5BVKA 4C3FA 3DY7A 3ZO4A 3VC4A 4TYEA 4YPSA 4IM2A 2RG5A 2ZMEA 3FPMA 4FBXA 2PVNA 2QODA 5AR4A 1CM8A 4TNBA 5HG8A 2UW5A 3TJCA 3TXOA 4FV6A 3CGFA 4RWIA 4TW9A 3QWKA 3GFIA 1YHSA 3IRRA 3F3TA 2Z9OA 3MJ2A 4MXAA 3EYYA 4RQVA 1OKRA 2XGXA 4GVAA 4G34A 3UNZA 4H0EA 3LFEA 3FYJX 3FKOA 4F9BA 3QYWA 2QONA 3NCGA 3K9TA 1F0QA 4GH2A 3OEZA 2QURA 5IDNA 4RAYA 3I81A 1Q62A 2OU7A 3D94A 3QZGA 5FWKK 3ECOA 3K1NA 3CE3A 5I9XA 1W7HA 3NS9A 3N4UA 3L8PA 1MQBA 3NNVA 4AA0A 1OR7A 2JPCA 2IPQX 2STTA 5J9LA 3IKTA 3FXXA 2YLEA 4BB4A 5H9BA 5HO7A 2WC2A 4LOPA 5LARA 3TDUC 2VO7A 3QKMA 3JTGA 5KK1A 1FSHA 5TRDA 1MP8A 4HW0A 1OB3A 1JPAA 2B53A 3VW6A 3E8CA 5AUXA 2H96A 3Q9YA 1K6OA 1IN5A 2WTDA 3DKCA 4LD5A 3MTLA 3COMA 4FZ6A 3ZXTA 2R3MA 5C26A 3KMUA 4YJSA 3I71A 4Q47A 3TKIA 4QYFA 4BYIA 4NIFA 4RIXA 4LGHA 2YM4A 5EYKA 3C5UA 2OI4X 1R39A 5DD4A 4FE2A 5FTGA 5K4JA 2XIRA 3ORMA 4YU2A 4JQFA 1V1KA 4NM3A 2VX0A 4GT4A 2JGZA 2OJFE 1OKYA 3EB0A 3ANRA 3EQIA 3D15A 3EFWA 4FTOA 1E1VA 4RVMA 4L68A 4L9JA 3MGYA 1ZXEA 4ZSEA 2IT0A 4YFXF 4C0TA 3P08A 2VBZA 4BDDA 2HXLA 2D45A 3CUQA 2CGXA 1PKDA 4BDCA 3FWEA 5L3BA 4EUUA 5EQEA 2M30A 5HLIA 1Z6RA 3BJOA 2ERZE 4CQEA 3BV2A 4RIWB 4IVNA 2RSVA 3CC6A 4GT3A 4ZY6A 3G6HA 1TBXA 5EDQA 4BGHA 4BTKA 3ORLA 5BQTA 2XM9A 3F66A 3OOMA 2OU2A 2VTPA 2F4JA 3IW5A 2QNJA 4E6DA 1XMKA 2HGCA 2OQRA 3QKLA 2BZKB 2W06A 3E3BX 4IW0A 4XRFA 4XUFA 3Q60A 4O7VA 2XAJA 4Y95A 2L54A 3PPJA 2C30A 3TO6A 4ZLOA 3HYIA 4I0BA 3F3UA 3PSCA 4PGGA 5CT7A 2FXAA 3Q5ZA 4M66A 3FC2A 4M69B 2W5AA 3VS1A 3KA0A 3KP4A 5FEDA 4EH7A 3QHWA 3EZRA 5BUIA 4KBCA 4D5KA 2VWUA 4ESJA 3ORKA 4IB5A 3CO6C 1Y91A 5LJJA 4CGZA 4UMPA 3BU6A 3HP5A 3S2PA 1R1TA 3WTVC 5CQWA 4P7EA 3TNHA 1UNGA 4EJ7A 1SD7A 4AIJA 2OJIA 4C3RA 3DKOA 1SM2A 5JFRA 5HLPA 3R8LA 4BCPA 4HVIA 2XA4A 2VBXA 4IWPA 4YJQA 4QTDA 1Y8YA 4EH2A 3W2OA 4PY1A 3MZHA 2E2BA 3JUHA 1XH7A 2NNYA 3GU8A 5D1JA 4YMJA 4I6FA 4PP7A 3PSBA 3UP7A 3UVRA 3QRIA 5M09A 4Q5EA 2BHEA 4WOVA 3H4JA 4WO5A 3OP5A 4ANQA 5CF4A 4CFMA 3BYVA 1SVEA 4O7NA 2FSWA 4F08A 4D1ZA 1BI3A 2W1HA 2P4WA 3A2CA 4I02A 3U6IA 3U4WA 5AONA 4PX6A 2PJPA 1FPQA 1ODDA 5DCMA 3NWWA 3BEGA 3CUOA 5DT4A 5H8GA 4YURA 1OYYA 3OY3A 3KP2A 4QMUA 4EBVA 1RI7A 5ERIA 3HUGA 3VEPA 2X6DA 5HS8A 4ZSAA 2M1BA 4MAOA 1R0PA 3U54A 3Q6UA 2PPQA 1JVPP 2ERKA 2C6KA 5L3GA 1SMTA 5LOHA 5BYLA 4RFYA 3QC9A 2XCKA 3WIKA 3NUYA 3PJCA 2WTVA 3WZEA 1CGPA 2PMIA 4ANNA 2Q0OA 3O3KA 3UYSA 4XS2A 4AN3A 2VN9A 2F7ZE 1B6AA 5EK7A 3LFQA 1ZG1A 4P9UA 5HLHA 2IZTA 4ORKA 4FMQA 3BWJA 2ITQA 3TNIA 3W8QA 5AV3A 4GK2A 5CVRA 4YFNF 3VO3A 3OBJA 3PVWA 3FHRA 4CZZA 3CUQC 3HDMA 5G6VA 3O2MA 3GVUA 2A27A 2ISYA 2EUFB 2MLGA 3HUBA 5CZIA 2XRUA 5CAPA 4UUVA 4AT3A 4TWPA 1BOAA 2GNLA 5DFPA 2P33A 2C3IB 3VS6A 3N4MA 1P4OA 3DBCA 2NYXA 2OIQA 2R7IA 4KSPA 3VRZA 4GXOA 5KE0A 1BL7A 2BZIB 2KTYA 3UZRA 4WNKA 5JGBA 3ORNA 5ANEA 5EDPA 5AX3A 3A7GA 4RVLA 2WIPA 4JRNA 4IAFA 3NYOA 3T8TA 3QZFA 4ZZMA 4FK3A 4CMOA 3PYYA 5A2QK 4DN5A 4Y72A 2DPUA 3KQ7A 3L9PA 4IVCA 3KY2A 2LNBA 4F0IA 2JIVA 2YIWA 5IG1A 2Z33A 4NJ3A 2XVDA 1GZKA 4LLNA 2V22A 3SXYA 4MEXF 2DPDA 4RZVA 2VWWA 2V5QA 2DWBA 1H0MA 2YHVA 4L45A 5JZJA 4JBPA 4MF0A 4O96A 3E87A 3BHVA 5IKWA 5AR3A 4OR5A 3FZ1A 3DPTA 4DEGA 4UYNA 3C0IA 4AZTA 3CDHA 3ZRMA 4NHJA 1Q97A 5T6KA 5A54A 3ELKA 2CG4A 1CMKE 4L7SA 4YZNA 3P23A 2C0IA 2IW8A 3E8DA 4CFFA 3ZSIA 1P5EA 3ZDIA 5KMJA 4YC8A 1W83A 4Q9ZA 3WZJA 4LB6B 4HQEA 3NYNA 4ENJA 4HQMA 5AUWA 1XBCA 3R9NA 5A3XA 3BELA 3ZBFA 4I2OA 2CLQA 3F23A 4IFGA 3W2PA 3BLRA 4BY9E 2W96B 3S2WA 3A61A 2R3FA 3D0EA 2HFHA 2EXMA 2GNHA 2YX4A 2VGOA 3FMJA 2UZNA 3MY1A 4NEUA 2WTWA 3CCNA 3H3CA 5ED4A 4O7RA 5JI6A 4YFKF 4BWXA 3K3IA 1P4WA 4XV2A 2EXEA 2MBFA 3WODF 2R3LA 4I5PA 1JKKA 5CI7A 3TIZA 1PJKA 2YM5A 4CFVA 4JAIA 2PZRA 4FT8A 2F5CA 3JW4A 4MBIA 5CZHA 2QOIA 4O6EA 4O82A 4MXOA 1LB2A 5LMKA 1K78B 4Q2AA 4YGAA 2J50A 4YTHA 3PE2A 4ANMA 4AT5A 5HIDA 3GUDA 3TEIA 4AGWA 5GZ8A 3L9NA 3QCYA 1ZRDA 3QZHA 3BE9A 2W05A 4LG4A 4YJOA 2VTMA 4A9TA 5M53A 3DF8A 1O3QA 3TACA 3WTSC 1APME 3OT8A 2B9IA 3UVPA 2Z8CA 3QFVA 4I4EA 4IBMA 4BKYA 4L42A 3IW7A 3PWYA 2UWMA 4IWDA 3SC1A 3UC4A 3F22A 4U44A 3UMXA 3R7GA 3V8KA 1MUOA 3LQQA 5T68A 2CDZA 4N0BA 2W5BA 3HHGA 3R9OA 4N9IA 1S6LA 3KL8A 2IPXA 2JPBA 4FTQA 5LMAA 2JDOA 4LRMA 2BV6A 4EOSA 5LWMA 2VE8A 4U7ZA 3MVMA 3QF9A 2QUFA 2ACJA 2WU7A 3BIZA 5FD5A 3I54A 2GSFA 5DN3A 4D2VA 1FBQA 1F4KA 4I5MA 1P2AA 3PP0A 4XEYA 1UU7A 2ZMEB 2WELA 3OWPA 2W1FA 3WE2A 1FBNA 2ETMA 1P14A 2RFSA 1UWHA 4YHTA 3ODYX 4R8HA 5BVWA 5C1QB 2BTRA 3FL4A 5C4KA 1CF7A 4TN6A 4NYEA 1PW2A 2HK5A 1YDTE 4FV2A 2HS5A 1T39A 3GXOA 3Q32A 5DGZA 3HZTA 3FPQA 3F8NA 3B8RA 3GP0A 3ZLWA 4WUAA 3BU3A 2J0LA 3KXNA 4UB7A 3U1DA 4GSBA 5AP6A 2Y8OA 3F72A 3QRJA 2VBYA 5CU3A 3SX9A 5M56A 3TNPC 3KVWA 3SOCA 1K3AA 4HCTA 2V6CA 2VODA 4JQ7A 2X4HA 4D9UA 4RX8A 4B4LA 5HVQC 3IO7A 2LGCA 2W1GA 1O3TA 4F7LA 3OXIA 4DH7A 4HW7A 4O0UA 4IXPA 2CSNA 2DT5A 3I60A 4UZHA 4FKJA 4W9WA 3KFAA 4E3CA 4FEWA 4S34A 3LCDA 5D11A 4E5BA 2C6EA 4IFCA 4XG3A 4Y13A 3O17A 3WF5A 1U54B 2X7GA 3CQEA 1G6NA 4QP3A 1RDQE 5LRSA 3F61A 1QGPA 2WV0A 3MH0A 4DFUA 3P79A 2QOBA 3CXWA 3ZN0A 3IGGA 1USTA 3BKBA 4EGZA 4QOXA 2R3HA 4ASZA 5E91A 4QP2A 4XHKB 2C6DA 3D2IA 4HGSA 2X1NA 3DA6A 3LIJA 4ALVA 4F1OA 4FEVA 4FSTA 5LGTA 3KREA 5IDPA 2OQGA 4AVPA 5CENA 2FOKA 4Y73A 4YC3A 5FTOA 3DK7A 1ZYLA 4RFZA 1KUTA 4I09A 4AT4A 2GNFA 3C7QA 3DNEA 4XG4A 4ZP5A 4X6QC 3C1XA 3DCVA 1LEAA 5H3QA 3PXYA 2QKRA 1PMNA 4LRKA 4TT7A 4TYJA 2IZUA 4FNWA 5KKRC 3EHAA 4BDGA 3HUCA 1MD0A 5AV2A 2XEZA 4Y15A 3R6XA 1DUXC 4EGYA 3KEOA 2XIXA 4E26A 5LMKC 2X9FA 2GA1A 2QHNA 3DXQA 2GTNA 1SZMA 3RJPA 5HX8A 1KU2A 5HE1A 3UQGA 3RHKA 4ZTMA 3QHRA 5FLFA 2QLUA 2R3GA 4CRSA 1QO0D 5ICPA 3V51A 4BCJA 3F5GA 4BCQA 3LOKA 2WMAA 3R9HA 3V3VA 2GPHA 4L00A 5L2SA 4L5JA 3CPBA 3VNTA 4R5SA 3ZMSA 3EQPA 3DXJF 1VEBA 3IPHA 4RGRA 2YIQA 3OW3A 5M4CA 3HP2A 4F63A 3FHIA 2JLDA 4B9DA 1FVTA 3FLWA 2QR7A 4PWNA 1H8FA 5LCKA 4FG8A 4Q9SA 3D0SA 3MFSA 2IA1A 2ZO4A 2BRHA 3JR1A 4DFBA 3HRTA 2GU8A 3I4BA 1TW2A 4CZTA 5FEEA 2QR8A 3LE6A 4H58A 4NFMA 4UWCA 5CAOA 5EHYA 3LCTA 1LVAA 4I0RA 4XG9A 3BJAA 3TZ9A 2WGJA 2Y75A 1H01A 4U81A 5DCFA 1GZOA 4RX9A 3P78A 4AE9A 4FKTA 3R7VA 2EV0A 4YO6A 2UVZA 4G9CA 4R78A 4M71A 3OVVA 4M84A 4FSWA 1Q41A 4EK6A 4ACDA 4Y17A 2CQKA 4KIFA 2RNJA 5HE3A 3HV7A 3VHKA 2JDRA 2MH9A 3IK3A 1YXVA 5ANKA 4HV5A 4B6LA 2Z60A 5CWZA 5LLQA 5C01A 4HYSA 1XCVA 2WQOA 5CS6A 2J0MB 5CSHA 3V5TA 4ASEA 5M07A 3WZKA 3JSOA 4R79A 3FZPA 4N9HA 2A3SA 3ABTA 3PFQA 3OEFX 2P2IA 5HG7A 5E20A 3F8BA 4AWXB 4KKGA 4S05A 3TDZC 4UMTA 1B39A 3TZ8A 3AC2A 2WQMA 3RPUA 1FOTA 4RIYB 5E8TA 2OAZA 1YS6A 3KMMA 3I0QA 1UNLA 2O0YA 2BILB 2G9WA 1JXSA 3ULIA 3OC1A 1I27A 2HOGA 4APPA 4XOYA 4NM0A 3RM7A 3ZRLA 4K8AA 2R5TA 2HDCA 5ETFA 4J8NA 5IUGA 2XNGA 4L7FA 3NSZA 2ZJWA 3PXRA 4GG7A 4IHTA 1ZG3A 3MA6A 4BGGA 3M1EA 3OBGA 4YIFA 2CMWA 3FUPA 3H10A 1OECA 3DAJA 1Q8UA 4EOQA 1CDKA 2J9MA 3OCGA 1JQHA 4DFLA 1U3EM 2YM7A 2PI0A 5DWRA 3E7OA 5AUUA 1MGTA 4XG6A 3UZPA 4CGAA 2JEDA 5DRDA 4DH8A 2QO2A 1JKLA 4DG0E 2A6HF 3KRJA 3T1BA 5HORA 4HLXA 3W16A 3FMRA 3EQDA 2I7QA 3BHTA 4JQ8A 2JDTA 4NU1A 4U80A 5ICCA 3CQWA 4KIGA 4KA4A 4DT8A 1VJYA 2OBJA 3Q53A 4HVDA 4AOTA 4XP2A 3E5XA 5CEKA 4PDPA 3QWJA 1WQ2A 4HNIA 3HAVA 4UY9A 4MH7A 2QU5A 4EOOA 1SFXA 2BHHA 1J3HA 3FLYA 3LAUA 3HTUA 1STZA 5AWMA 1YW7A 4F9WA 5CF6A 1JSUA 3VF9A 2YM8A 1YS7A 5HDNA 1W8CA 4DCAA 3RTPA 4C58A 3CS9A 1Z91A 2PG4A 2QQAA 4S04A 3CP9A 4L8MA 1REPC 3D5UA 4O0RA 1KOAA 2K4BA 2BGCA 2XASA 4XRLA 3KC3A 4D2SA 5FRIA 2FH9A 4PMTA 1DPUA 3HA8A 2G2HA 1Z9XA 3P1AA 4A6DA 3GO5A 2VO3A 4XLVA 4R7HA 4HDVA 4O1OA 1E17A 4G3DA 2XS0A 3L8XA 2E9PA 4E73A 3KK9A 2A07F 2J0IA 3F8CA 1JAMA 3R4KA 1BBYA 4KIQA 1FY7A 4FVRA 5AA9A 3PLAE 3TGNA 3WE8A 4O2PA 2M5WA 3HRFA 1U78A 4FTAA 5I9YA 1F3MC 4QD6A 4LI5A 3OWLA 4UMUA 1OUKA 1NXKA 2I0HA 3LZBA 3P0MA 4ZLZA 2OG8A 3UC3A 4QNYA 5EH0A 3C4WA 3OG7A 3DKWA 5LEJA 2WMQA 3UODA 3T3UA 4YBKA 3BQCA 2B55A 4R77A 4GK3A 2UZWE 4KIKA 3MESA 2O2UA 5AV1A 4UVCA 1BMKA 3UOKA 4A9YA 2ESNA 5CVGA 5HI2A 3QX2A 2GHGA 2GS6A 5JR3A 4DTAA 4P5OA 3MFTA 4IH8A 5B7VA 3RPVA 5EOBA 3OXTA 2IWIA 3GEZA 1R7JA 2WMUA 1DS5A 5F64A 2HENA 5DOSA 2V7OA 4I1ZA 5LVOA 3ULQB 2QO7A 4EK4A 1Q4LA 4FG9A 4F7JA 2VNYA 2D1HA 2UZVA 3VS5A 2VC1A 1GY3A 4M13A 3VBXA 3HYHA 4BTMA 2ITUA 5FM3A 5JMSA 4R6VA 1B59A 3GCVA 4JQEA 1YXTA 2ZV7A 1ZYCA 2OBPA 1O6YA 5CEOA 2DFIA 2CSOA 1NA7A 5IMEA 2Y6OA 4JK1X 2E9UA 3I79A 3GFEA 3DK3A 4EJUA 4NWMA 2HOEA 5DRBA 2VWZA 1R5HA 2G2IA 2REIA 4P5QA 3RZBA 4TPTA 5LXMA 3ORTA 3GCPA 4RT7A 1URCA 3NW5A 3CGOA 2XK9A 4ESFA 4L6QA 5F20A 2DBBA 3CY2A 5C8NA 4NK9A 3WBLA 4WG3A 1E9HA 2W7XA 3FJQE 3ROYA 4DGGA 1TW3A 1UNHA 3AD4A 3QL8A 1J1CA 3RNIA 5FDPA 4AW2A 1PY5A 4DEAA 3PXZA 2DS1A 4IC8A 1LQ1A 5D5VB 4ZTNA 3RCDA 2RGPA 4ZTLA 2GHLA 4IDTA 1L3RE 3BX5A 2EU9A 2YDKA 4CYJA 4FT3A 3AT4A 3WYXA 4NM7A 4U40A 3WARA 5IF1A 3V01A 3FBVA 4FGRA 3RAKA 4LJZF 2YISA 2XM8A 4O86A 2PBIA 1XB4A 2UVXA 4X6RA 4D58A 5I5ZA 4BTFA 5BUEA 3DTWA 1CF7B 5LGUA 4UYAA 1G3SA 1R1VA 2GFSA 4KN7X 4ANLA 4ZYDA 4IAAA 5A6OA 3LSTA 1XJDA 5E7RA 4ZYGA 4NW5A 4ZTSA 3C50A 1BI1A 5L6WL 2VOPA 1PP8F 2ZV8A 4QT1A 1FBSA 1WBOA 4FTCA 3WTXC 2W17A 2B54A 1KQ8A 3VS4A 1ZARA 4RWKA 1WVXA 4AUAA 3TN8A 3QQGA 3K5UA 2V1UA 2VUWA 3DAEA 5EI6A 5EW3A 4O3MA 4KSQA 2PVYA 1QPMA 4Y46A 5KBRA 1J59A 2QI8A 4TYHA 3PQJA 2XBJA 3DJ6A 3WTUC 4L9IA 2ZFWA 2XKPA 3C7JA 4X0MA 1NVQA 4C4FA 3RK9A 4KAOA 3BOQA 2BROA 2ETRA 4ARKA 4HX4A 5ANIA 3LMIA 4MQ9F 1M2RA 2FSLX 1WCCA 4PMPA 1FQ1B 3DZOA 3PRIA 2WXVA 3BPXA 3R1NA 2OZUA 3E6DA 3VFZA 2HKOA 3DU8A 4K33A 4ACCA 4QMQA 3ENMA 3JPVA 5ANOA 2C3JA 4KDPA 4ZJVA 1SD5A 2Z02A 3OMVA 1DM2A 3B2TA 4E70A 3L9FA 3W18A 3M8FA 3H92A 3BYSA 4O22A 3TOBA 1MDMA 1LEWA 2WTEA 3C9WA 4BCNA 3QZIA 1IRFA 3BYUA 1KSWA 2OO8X 1A06A 3GGFA 1QPJA 4DEBA 4JIKA 1P92A 4J97A 3NAXA 4JXFA 4LFIA 4MHGA 2F2CB 4OIPF 3LJ1A 4AFJA 4YBJA 3BWGA 5IPJA 1H24A 2WTKB 5DEYA 5BPYA 3RAIA 3ZH8A 3QQUA 3MYGA 4JDHA 1XKKA 4YJNA 4WRGA 4EBWA 3IHUA 3EFKA 2UVYA 1XSDA 3SLSA 5HO8A 1IXRC 2RC4A 2JBPA 1VZOA 5D5XB 1B9MA 5AIRA 4FTNA 3IW8A 2FO0A 4X2FA 4U41A 4GCJA 2I0VA 5AP2A 1TNTA 5E92A 1D8JA 2FA2A 3Q96A 4CYIA 4PDYA 4QMNA 3RNYA 3ANQA 1ZMWA 4EZ7A 3ORIA 1U59A 4R8QA 4AS0A 2PUPA 4GGGA 4I41A 5F1RA 5IA4A 3LWFA 4C62A 4M8TA 3QD2B 4FHTA 4RVKA 2VO0A 2GDOA 1WVYA 4XJ0A 1BI2A 4S31A 3QOPA 3MPTA 2IVUA 4L53A 4N4SA 3RPOA 4FSYA 1R58A 3OOPA 3BCEA 5LGNA 1JNKA 2FNPA 4RB3C 3ZDUA 3TUCA 2A0CX 3UOJA 3ZUVA 4CXFA 4AQCA 2ZOQA 2EWAA 3R7YA 5FDXA 2PVMA 4IXAA 4AN9A 3POOA 5CAQA 4RGXA 4NKAA 1UVRA 1HOWA 5DUIA 1OPKA 2IZSA 1A04A 1GAGA 1JSVA 3TKHA 2YCSA 5JZNA 3NUPA 4OINF 3HRSA 2RIOA 3VB2A 2UW4A 3VF8A 4CEGA 2ITVA 3TM0A 3Q4ZA 3MVLA 4TWCA 3E6BA 3MVHA 4BCGA 4AACA 3C5IA 3KXGA 4J95A 5GZAA 3LM0A 2CWEA 2A69F 1GXPA 3GU4A 3D14A 3FMDA 3V5QA 4D4SA 4WHZA 5FEQA 4AA5A 2WEVA 3E6CC 4BHCA 3M2WA 1Q8WA 4IWOA 4FIJA 4U7DA 2X7OA 1W5TA 2FSOX 3QU0A 4BL1A 2VTLA 4CLIA 3NYXA 4Y85A 1S3JA 4G6OA 3T8RA 2CCHA 5H2UA 3HSRA 2QOFA 4WXHA 4TWNA 1Q61A 3QRFF 3WZDA 1P4AA 2Z99A 4FV4A 2C6OA 1J7IA 4EHZA 2EK5A 1O6KA 4FOBA 5J6XA 2P2HA 5ILUA 4PPBA 5FLXK 1J0RA 4BCOA 5HD7A 3OWKA 4BDHA 1DP7P 2G7UA 5CLPA 2Y4IB 1AGWA 3L7WA 3IC7A 4OTIA 4BDEA 4BTJA 3AOXA 4BN1A 4OTQA 3HTSB 5JFVA 5IQGA 2YM3A 1NVSA 3QCSA 2XROA 4M3QA 1UA2A 4GK4A 3EN5A 2OH4A 2W4OA 4KBAA 3U9GA 3UNJA 4KINA 1YTYA 1W7PB 2HXQA 5TR6A 5CAUA 5IEXA 2X2MA 4U0IA 5E8UA 3P9IA 4TY1A 3DV3A 3SAYA 2ZCWA 2VTNA 3U9CA 2XJ0A 3BU5A 4DFXE 2JFLA 3EYGA 3WYYA 3CJFA 3FX3A 2HWPA 4PP9A 5ICEA 4DEHA 4ANOA 3OXZA 5ICFA 4A9SA 2Y7JA 4IJAA 3LQ5A 1FMKA 2EB7A 4PGHA 2OFVA 3MIAA 4QRCA 1Q99A 3AC5A 2R3SA 3CJNA 3WE4A 3FQSA 4ZS4A 3EIDA 3F7ZA 1XGOA 4I01A 2WTJA 3ENHA 4DEEA 5D8LB 3V8WA 3UOLA 3LXNA 1MRYA 4OW8A 4H05A 2ITTA 1D5VA 5KCVA 5JHUA 4XOZA 3K1PA 1Q3DA 4QMXA 2CGPA 4UZDA 2GQGA 1ZRFA 4PTCA 3O2PE 2FMLA 3F88A 5AAEA 4BKZA 2CN5A 5F9EA 2ZYBA 4GIHA 3R2YA 4G5PA 1O57A 3SV0A 3SZPA 2VD5A 3MSSA 3RK5A 3DFGA 1AQ1A 3N4TA 1JLUE 5AJQA 3IS5A 4OOIA 4CFXA 3UG2A 4LL0A 4QMWA 1FX7A 4QYYA 1X3UA 2A4LA 3CTHA 2PK9A 4AD9A 3FMMA 4HPTE 4UVBA 4UN0C 5J5TA 3O23A 1MRVA 4M69A 3SRVA 1W5SA 1Q8YA 3V6RA 1PMEA 4BH9A 2HW6A 2PE2A 4RC2A 2GWRA 3F7WA 1SNUA 4D28A 3DLZA 3AMYA 3E92A 5HVKA 4KMUX 4MD7E 3MB6A 2X81A 4RGUA 3VBWA 2G01A 4JNWA 5AMNA 2A6EF 2H8HA 5BVDA 4GW8A 5JT2A 3SXSA 3R6SA 3VW8A 2M45A 3ZEWA 4IVDA 2OFUA 1R36A 4S33A 3KP7A 2R7DA 5DT3A 2BMCA 4YZMA 4I3ZA 2ZBKA 2R4BA 2OWBA 2DO7A 4ZOGA 3LCKA 3R1YA 1FYMA 4PNIA 4CXAA 5FGKA 3ZLYA 4Y5HA 4PCQA 5JK3A 4M97A 3ORZA 2W5HA 3HECA 5J1WA 4H1JA 5CJ9A 1O3SA 4EJWA 4L0ZB 5J9ZA 3T9IA 2CKOA 4DGOA 4UWBA 3O51A 2PYWA 4AW1A 3MH1A 1RZ4A 3EDPA 3QLGA 5J8CA 3A8XA 2GCDA 3S00A 4BAYA 3OTUA 4C38A 5E17F 1U2WA 4OMZA 3FI3A 1Z7UA 4PMSA 5T3QA 3I0TA 3QQJA 5AM7A 4KIOA 3QXOA 3M7GA 4YJTA 2VTTA 3GWZA 4GU9A 2EV6A 5FD2A 1JE8A 4C36A 4BCFA 1ZN2A 3D7TB 3C18A 3REOA 2IA0A 4ONAA 4EWHA 3LAPA 2JTVA 4LLGF 2JRTA 1ZLKA 2HELA 2ZXJA 4CZYB 4RB0A 1R3CA 3W10A 3Q5IA 2J5EA 3PY3A 4ALWA 2FF4A 4ALUA 2M87A 2XZSA 4C35A 3SQQA 4U3ZA 2P6TA 3C3WA 3NPCA 2PE0A 2NS0A 2GXGA 1RNLA 2CNQA 2W99B 3BJ6A 2YAAA 3ALOA 4JG7A 3N97A 1ZLTA 1ZRCA 2EVAA 3GU6A 1W7PD 1RE8A 3VRYA 1NHAA 4RLKA 3I6WA 2C47A 4F6WA 4A07A 4F65A 1XBAA 2EB2A 3R0AA 4FKOA 4FSZA 3GC8A 4YG2F 4I6QA 4HGEA 1G8AA 2RFDA 5HBHA 3TV7A 1H9TA 4S30A 2KIMA 2HYFA 2R3IA 1V4RA 4BXUA 3EQRA 5J87A 4ZXTA 5AIKA 5FD6A 2CGWA 5LHGA 2TDXA 2PQ8A 5D12A 5HU9A 2QU6A 2YZAA 3I58A 4CV9A 1IN8A 4PQNA 1FBUA 5KMOA 5D9HA 1I6XA 3SW4A 4AAAA 1H1RA 2R3RA 1ZYSA 3RP9A 4G1WA 3UTOA 4V04A 2VWYA 1J2XA 2XIZA 1JWHA 4H1MA 2H6CA 4BICA 4R5YA 1PUEE 2DYLA 4RQKA 1XSXA 4EUTA 2WMXA 4YTCA 2XF0A 3SVVA 5K0XA 3FYKX 4EYJA 3FMSA 3E6MA 3V4GA 4P55A 5IA2A 3KEXA 5IQCA 4FIGA 2HIWA 3Q5FA 4N70A 4R7IA 2COMA 2J5FA 1ZGAA 2CGVA 3R1QA 4ZTHA 2YEXA 1EV7A 4DA5A 1WBWA 5EI2A 4FV9A 2YU3A 3BRBA 2PN6A 3FXWA 5K5OA 1Y6AA 3Q04A 1ERKA 1I1SA 5HU3A 3DT1A 2DQRA 3SG9A 5M4UA 4UXLA 2ZKZA 5CXHA 4C4JA 3RPSA 3FLSA 1CKJA 5J7HA 2X2LA 4E4MA 4C4HA 3BQRA 3JAMK 5KZIA 4CYDA 2WMRA 3BHUA 2A61A 4X2JA 3E64A 5JQ8A 3FM3A 3R8PA 3ZXZA 2PVKA 4F1TA 2YX7A 3UQFA 3J80Z 2IJMA 2DTRA 5I9ZA 2OA4A 1M7QA 2JAMA 4AZWA 4LV5A 4PL5A 2O65A 5E8YA 5CNNA 3OT3A 2E9OA 3I5UA 3ETAA 3FLNC 4E4NA 4MBLA 3KP5A 3LA3A 2C6YA 4CVAA 3PG1A 1Q24A 3NGAA 1ZY5A 1QQIA 3I64A 3SHEA 4FKIA 1XGSA 5DT0A 5DHJA 4IX6A 4FV7A 2BAKA 3FZOA 3ATTA 4U79A 4K18A 3VUMA 4NH1A 4I20A 3AMAA 4YLLA 1YWVA 5L8JA 5HDKA 4EH9A 2OZOA 3UYTA 5CU0A 5HESA 3TCPA 4MBJA 3F6VA 4XMOA 4C59A 5BS6A 2QOKA 5L3FA 4EH4A 3LKMA 5IA5A 4FODA 3ODZX 3O71A 4ASNA 3LXKA 5DR6A 4FYOA 3J81K 5CSPA 4WA9A 4KT5C 2HZ4A 3PY1A 3BE2A 4NFNA 3LFKA 3EL7A 2IVTA 2CNUA 2W1DA 1T46A 2G15A 2PEXA 3QUEA 4DFZE 1SFEA 3IOKA 3L8SA 2D2WA 3CPCA 1MJBA 5F4NA 3G5DA 3QTRA 5IEYA 4EOJA 2ZMDA 4HYEA 1IRGA 3IDBA 2GNGA 3DDQA 2X4ZA 4ZJIA 4L9VA 5AP4A 4NM5A 3G9LX 4QPMA 3WIGA 5A6NA 4PPAA 1QPCA 2VGPA 3R7IA 3VBYA 3MJ1A 5EEHA 1T98A 3E5AA 3ZMTA 1KYWA 2VTAA 5DNRA 3NUXA 4AZEA 4BWPA 5AIQA 3IGOA 4LM5A 1FMOE 4EK8A 2X8EA 2NRAC 2DQ7X 4LUDA 3C4EA 3V5JA 3NLBA 4EI4A 2XK6A 1KE7A 2ITXA 3WTWC 5EHLA 3E5QA 3I59B 3QU3A 1LJ9A 4BDBA 4FKWA 4N6YA 4QP7A 2J5OA 1IRKA 5JEBA 3ZFYA 3RJCA 5C4LA 4FTMA 5DH3A 4XRJA 3ZO1A 4LUEA 4I22A 1XGMA 4KRCA 2MLKA 5DYJA 4U8ZA 5EQYA 1BYGA 2I6LA 4G16A 4UMQA 3UO6A 5EOLA 2R2PA 4FL2A 4FZDB 2KULA 4I7HA 4M0ZA 4OU0A 3O50A 3UVQA 4BYJA 3BLHA 4DGMA 3P7BA 4RX5A 1LDDA 2MA3A 1H1PA 4LYNA 5F94A 5DI1A 3WGHA 4BQAA 4GV1A 4P2KA 4EYMA 3MFKA 5AP7A 1M52A 3QD3A 2P5KA 3W55A 5LVMA 3A60A 3V5LA 1V0OA 2OIDA 5C8MA 3MW1A 3E3PA 2QM3A 3C4ZA 3PJ3A 2X4FA 4BHZA 1OKWA 4O83A 2OXXA 2L4MA 2VNWA 4CMUA 3E93A 4J71A 3EQCA 4BGQA 3QRKA 1I1GA 3LFCA 4P4CA 4JL9A 1WAKA 2HZNA 2UZUE 4LK0F 3ZPLA 2YIYA 1WKMA 3IECA 1KU3A 2YERA 4OIQF 4LQMA 2VV9A 4HVSA 1U54A 1MJAA 4Z2YA 3R7EA 3DLSA 2IW5A 3ULZA 3VUIA 4E93A 2IVSA 1WBTA 4EHGA 3ZMMA 4HDUA 5B2LA 2XNMA 2XYUA 3IDCA 3C13A 3BZ3A 4EOKA 2GMXA 4FX0A 1LNWA 5KVRA 3P86A 2FBHA 3CLOA 4UV8A 3EJ1A 3FMEA 1USSA 2R3OA 5LVLA 3FC1X 5BPDA 2ZNZA 3E3VA 4B09A 2ZV2A 2AC5A 3CY3A 5DG5A 5DVRA 1KQ9A 3ORXA 2GZWA 4L67A 3TJDA 2AC3A 4EM0B 2XKEA 1IEPA 5L2TA 2I0EA 4F99A 2JKMA 2ISZA 3DQVC 4KMFA 3NW7A 3CTQA 4BCKA 3ATSA 2R0UA 2ZV9A 4JG6A 4NKSA 4CCBA 4G3FA 4HJOA 5CT0A 2GTMA 4UNOA 1X8BA 4DH1A 1ZOHA 4AF3A 4FR4A 2W9ZB 4WNPA 4IZYA 4PNKA 4BCMA 2X0LA 3UO5A 1Z57A 3LJ2A 3WOWA 1H08A 4O0WA 4WT6A 3DXPA 2QD9A 4HZSA 3HOSA 2YDJA 1T45A 1UWJA 5EYDA 3R83A 3IW4A 3SG8A 4HNFA 5CF8A 4N0SA 4E20A 3FI8A 3WG9A 2CKEA 4PMMA 4HAMA 2GA2A 1RUNA 5K4IA 5IQAA 4ETSA 5IT9K 2CW0F 4EORA 5E4HA 4FSQA 3LVPA 3G51A 5KMNA 3PUPA 4FKSA 3ZSHA 4HOKA 3F3ZA 5HBJA 1G8SA 4W4XA 3HMIA 3SRVB 3A4OX 4KKEA 4FKQA 2B9HA 1IG1A 3F8FA 5IQEA 5AAGA 3KLNA 3COKA 3WF9A 4ZYHA 2WQEA 3C4XA 4USFA 2WKMA 3R71A 4ENYA 2WEIA 4WWCA 4EZ5A 3TQNA 5HCZA 5L3CA 5DLSA 4YLJA 2BRNA 3TWJA 1G3NA 4G6DA 4YJUA 5BYZA 1FGIA 4O6JA 1J7LA 3NIZA 1GOLA 5LHIA 2LF8A 1OIQA 2Q0NA 3BBWA 2YWPA 4U6RA 3DFCB 2H9VA 2LAVA 1MJ9A 3TTIA 3QTSA 1OYWA 2DK8A 4WNMA 3HRCA 1KQ0A 1KE8A 1WMKA 4UMRA 5FBOA 3VS3A 2VTRA 3EWHA 5AAFA 2E9VA 3W2CA 4A9UA 4IB1A 4IANA 2CCIA 4DTBA 4GEOA 3FEGA 3DDPA 3Q4UA 2J7TA 2PUNA 3PTGA 1FVVA 3R0TA 1SD4A 4QMZA 1OITA 2PY3A 1GHCA 2XVCA 2IVMA 3K5VA 4RIYA 5ACKA 3R63A 5CVFA 1KU9A 3NW6A 1IN6A 3ISPA 3CTAA 3PFIA 3RPYA 2PHKA 3SA0A 1KE5A 2YDIA 3UIBA 3QTWA 2W1CA 3TNQB 4IPAA 3FAAA 4EJVA 5AR2A 3MH2A 5L8LA 4YTFA 2P55A 4GCVA 2C6IA 3HL7A 3VUHA 5LEKA 4OIOF 1UHMA 5LVPA 3BZ6A 2XNEA 2OH0E 2K4JA 4RZWA 5FP5A 4DQ2A 4EQQA 2ACXA 4M6YA 5EKNA 5KO1A 3RM6A 1MQ4A 1SMYF 5CVJA 3QYZA 3UIXA 2ETHA 5AEPA 2O3FA 2ZM3A 4IM0A 5C03A 2JKKA 3IOPA 1OPCA 4JR3A 3EH9A 5KX8A 3RI1A 4MK0A 2PMHA 1XH9A 4K2RA 5LHHA 4ZZDA 2A5YB 5KUPA 1UKHA 3NRMA 4LB5A 3IW6A 5EHOA 3PXFA 3PVBA 3OUKA 4RG0A 4ACHA 4IQ6A 3Q6WA 4FT7A 1HSTA 5CANA 3NCZA 3UZTA 1LDJA 1WBNA 2VTJA 2IZRA 2ZNYA 5BOXA 4FTTA 4HVGA 3PIZA 4KIPA 2IW9A 3F3VA 5FO5A 1SD6A 2C1AA 4AGUA 4YO4A 3GU7A 1FP1D 2C5OA 3PSDA 3IWZA 2YR2A 3HV6A 3FMKA 1XO2B 3P5KA 5CU2A 2HYGD 3GNIB 3N9XA 2WTCA 3I7CA 2MC3A 2WMSA 2X8DA 4PDOA 4QYEA 3U6JA 3ZLXA 3Q4TA 5GHVA 3RKWA 1R78A 2QVOA 3SD0A 3QPTA 3W6JB 4G6QA 4OBQA 3BGPA 4BIBA 2IRFG 3RYRA 2BTSA 4C61A 3QQKA 4MKCA 3WE3A 4E8AA 4K11A 1WBSA 3BEAA 4YTIA 1L3LA 2W1IA 4CG9A 5A14A 2BE5F 4CCUA 3W2RA 1OM1A 5HX6A 4H3PA 1Z5MA 2CO5A 2QQ9A 4QMLA 4BZDA 3MQ0A 4OMYA 2YJSA 4BZOA 1MRUA 3UBDA 3GXLA 4MQVA 1FT9A 1T0FA 4AGCA 4Y83A 5E8GA 2X8IA 4AW5A 4BVUA 4EH8A 4WX9A 5KZ0A 3O7LB 4AG8A 3ECHA 1V0PA 1BC7C 3U87A 1D8KA 2KKOA 4C8BA 1I5ZA 4IX3A 3RCJA 3DS6A 2ITYA 2VN2A 3BGZA 5EKOA 1R1UA 5I9WA 4FYNA 3Q9ZA 3Q2MA 3V04A 3NYVA 1HQCA 4FKRA 2IO6A 3RPRA 5HOOA 1ZZLA 1OMWA 2W9FB 3I4PA 3HMPA 2FVDA 3F2RA 3R61A 2QG7A 3Q2JA 4QYGA 4C33A 4WUNA 2VT3A 3R8ZA 3RALA 2RQPA 4QTAA 5E90A 2XAGA 3G9NA 2J0JA 1R0EA 4WKQA 2O64A 4ZLYA 3QQLA 1UV5A 4GMYA 2JD5A 2W4JA 2YN8A 4JLCA 4QYHA 4RVTA 1M2PA 4DINA 1VYWA 4DFNA 1U5TB 3R28A 4NSTA 4OTFA 5IH4A 4G7OF 1YRPA 3M8EA 3E63A 1HKQA 4H3BA 1ZYDA 3DBEA 4NJDA 2BAQA 5DBXA 1JKSA 2WTIA 2P7VB 4B8XA 4MTEA 2GS2A 3MN3A 3VJOA 5K3YA 4X21A 2WOUA 5TT7A 4DHFA 4FKUA 5HE2A 3SFZA 3NUNA 2BAJA 4JBOA 1M17A 4G3EA 3R7UA 4G3GA 5M51A 4F9YA 4HYHA 2P7CB 3NDMA 2WMTA 4DLIA 6PAXA 2KRFA 1XBBA 4V0GB 2JDVA 4F4PA 2GNIA 3REPA 4KN4X 2UXNA 4FUYA 4BDFA 1RJBA 1A9UA 2BFYA 1O7LA 3GT8A 3MFUA 5IQFA 4BR3A 3C4FA 5I3OA 4AFEA 3P7AA 5I0BA 1QZYA 2QOQA 5DE2A 4JX3A 3KULB 4QLCU 4FKPA 1WSUA 5HNBA 4KA3A 4QWQA 5DD8A 4EOLA 3T3VA 3AQVA 4QQJA 4XBUA 4LL5A 4FX3A 3G6GA 2BEOA 1PXNA 2WQBA 3JS2A 4TRLA 3E8NA 4QP6A 1Z1DA 5LVNA 5ILVA 3S3IA 2MH2A 3LFDA 1YQAA 2O3PA 2EJRA 1S8NA 1U46A 3LLTA 4C37A 4J53A 3Q9XA 2UZEA 3DJ5A 2R7FA 3QRUA 4L01A 4TTHB 3IKVA 2K7LA 3VN9A 1AOYA 3D7ZA 1WZYA 3R8UA 2ESHA 4MEDA 5CVIA 3CD8A 2XBAA 3ZOSA 3DK6A 1YDSE 5CEQA 1KE9A 2BRBA 5K5NA 4RJ3A 5D6FA 3D9VA 5L2WA 4C4IA 2EFOA 4J98A 4Z9LA 5EM5A 3NNXA 4YJRA 4OTWA 3ZUUA 3KFWX 3UGCA 3BDDA 1PYXA 4GFGA 5EFQA 2CFXA 1JSTA 4E7WA 5FXSA 2BZHB 1JKTA 4KBKA 2HCKA 2K27A 2F9GA 2W4KA 4PDKA 2ELHA 1LEBA 4FNZA 3F5XA 3R8VA 3L2CA 1XH4A 2YLFA 4G9YA 1L0OC 3HRUA 5DR9A 3VBVA 4X2KA 3IRQA 2VTHA 2PULA 3OWJA 3FKNA 4R1HA 2X0GA 2HTSA 5HCYA 3FI2A 1QCFA 1GVJA 3F5UA 3DBDA 1YOJA 5KMLA 3BHYA 4L0YB 1TQMA 3O7LD 4WXCA 2GQSA 5CX9A 4IX5A 4EQCA 2YJRA 4DGNA 2ZB1A 3JYAA 4AE6A 3DKFA 3R8MA 4RJ7A 2UW6A 4FKGA 4K0YA 2ZMCA 3OW4A 4I92A 3U51A 4ZTRA 4L9NA 3DNDA 5EM8A 5FGMA 1RW8A 5JSMA 1NVRA 2FGIA 3HNGA 4BBMA 3V6SA 4I4FA 1W0XC 2FEZA 3LFNA 4G5JA 1BC8C 4K9YA 1HW1A 3BPRA 3T9TA 1PXMA 2XV4S 5J8IA 4O7LA 2OJ9A 4OAVB 3EFLA 3NUUA 5A2QZ 1H00A 3V5WA 1Y6BA 3PPZA 3PY0A 3LQ8A 1H25A 2Z2WA 3TT0A 2VE9A 5KHWA 1W98A 3ITZA 4J1RA 4JDKA 3ZSGA 5E1EA 4A0ZA 1YYVA 2Z5UA 4ZZOA 4FT0A 5FFZA 2R3JA 3ZMZA 3TOAA 1NT2A 4HX7A 3PLSA 5HNGA 3OY1A 2QQBA 2UW3A 1J7KA 4TV7A 3LLAA 4G2FA 4F6UA 1YVJA 4FIHA 4A7CA 4P5ZA 2PVJA 4UEUA 1BN5A 4E4XA 3M9AA 4LK1F 4UXQA 3EETA 2QLQA 5CXZA 2BR1A 3HRBA 3RDIA 4I93A 5L2QA 1O3RA 5CSXA 5HTCA 2ITOA 5JGAA 4ZY4A 4LLLA 2WQNA 4QTBA 5GIPE 2HY0A 1ZZ2A 2YZLA 2CLXA 4G31A 5H6RA 5DEQA 4UV0A 1H07A 4WBOA 1ON2A 4U97A 3EQHA 4JIAA 2IP2A 3TUDA 4U9AA 2DK5A 2VZ6A 2W1EA 3FZSA 3TDWA 4ZSGA 4WNOA 4B0GA 4WIHA 4ID7A 4AGDA 3H30A 4Q4ZF 5IQIA 3G0FA 5HZNA 3WZUA 1PRYA 3AAFA 4ZTQA 2VWVA 3QC4A 3QAME 4C34A 5HS9A 1RIOH 5F6FA 4Z55A 2VONA 5EYMA 3B8QA 1XR1A 3PXKA 2YCQA 4B99A 3O8PA 2RKUA 2VTQA 4S32A 5I4NA 4GIIA 3J7AO 4ZS0A 1ZOEA 5E18F 1KV1A 3ERED 2HAKA 4FZ7A 5A4EA 2AYPA 4I6BA 3D5LA 3KU2A 2YAKA 3HV5A 1REKA 4U7BA 2KJBA 3TKYA 4RS8A 1D3YA 3VS0A 1J5YA 2GQQA 3GI3A 2B52A 4HCVA 5HO6A 2XCHA 3EYHA 3MY5A 1IUYA 3O6BB 4F64A 3Q9WA 3QCQA 4MQ1A 4YJPA 2OZAB 3AT2A 4YUQA 1ZRZA 5CTPA 1PHKA 4IHSA 4C2VA 5DR2A 4IAIA 4ZK5A 1M7NA 5GINE 3PJ1A 4O91A 1PKGA 3LA2A 2WOTA 4FK6A 3F82A 3A4PA 3EKKA 1J91A 3QD0A 3AT3A 2ZDTA 3LQ3A 1GIJA 2OXYA 3BHHA 2UW7A 1QBJA 4U45A 1OYIA 3FV8A 5CY3A 2W85A 4MQ2A 3S4QA 1DDNA 2GHMA 3AGLA 1XQZA 4XP3A 3IL2A 4L3PA 4I24A 3NIEA 5AFVA 3W8LA 3FMQA 3QP6A 1EH6A 5KMKA 5IZFA 3BI6A 3P9JA 2RGVA 1UU8A 1RQQA 2ZM4A 2A19B 4K77A 5IQDA 1J7UA 4KB8A 3WF6A 5ITAA 2UZTA 4BBFA 3KN5A 3DP7A 5FUTA 4JAJA 4HYIA 2W57A 5A4LA 4CDGA 3ROUA 5L8KA 2XAQA 3FZRA 2EXCX 3NX8A 3IDPA 3W32A 4IMYA 3IONA 5KMIA 2Z7LA 4B8MA 4KABA 1NW1A 3O8TA 1W7PA 5BQ0A 3RIRA 3PVGA 5HOAA 3R21A 5AR7A 3V8SA 3RPQA 2XMYA 5L3AA 4CKRA 2NAZA 4FOCA 3LQRA 4O21A 5B2KA 3QA0A 3KCKA 3GF2A 3ZFXA 4MCVA 4CV8A 4EHVA 2VX1A 2XHKA 3VULA 2Z7RA 3E8EA 1LDKB 5D7VA 4ZIMA 4RGSA 5D10A 3AC3A 2HQNA 2RFNA 2WTKC 4O7ZA 2CKPA 3H0ZA 2DLLA 2XB7A 3NUSA 3LW0A 5JKGA 1IA9A 3FMHA 4A9RA 3RVGA 4KD1A 1ZWSA 3LFBA 3KKVA 4D2PA 4D1SA 3CKWA 3VS2A 1ZYRF 1XCBA 3F21A 4RB2C 3FE3A 2EB3A 5TKDA 4BCHA 5DYMA 5AA8A 2EA4A 3O8UA 4P90A 4MWIA 2J51A 4YNOA 4U0VA 1ZOGA 3PA4A 1W82A 1QZZA 1B1BA 3R1SA 3CR0A 4LOOA 4IAKA 4PZJA 3L1SA 4DE4A 3ZO2A 3GC9A 1T6SA 3ZCLA 1M14A 5AV0A 4RIOA 4BF2A 1CTPE 1Q1HA 4E4LA 1YI3A 3GCUA 1OVEA 4AN2A 4LOQA 3D5WA 3NQOA 3BLQA 4MD9E 2XNNA 3OUNB 4IJPA 5L6PA 2F57A 2PUIA 4DYMA 1GNGA 4ZH4F 2OSCA 5GZ9A 3VHEA 3RZFA 5KMMA 4BCIA 2WNTA 2BKZA 4JOAA 4IRIA 5D6EA 3NAYA 5A9UA 4J7BA 5DEWA 4EOIA 4IZ5A 1P4XA 2E1NA 4C3PA 3V8JA 4WSYA 3A8WA 1HW5A 4F09A 4BIDA 5M44A 3K69A 2Y0AA 4C02A 3WGGA 3DAKA 3SKCA 4MD8E 2VO6A 1G3TA 2GNJA 4ZZLA 1U8RA 3V5PA 2OD5A 1TQPA 4FSRA 4BZNA 1HKTA 3HVCA 4W9XA 4E6CA 3PWDA 2QCSA 2R64A 2OJJA 1OMIA 2PE1A 2W24A 4ENMA 2PZYA 3P4KA 3F3WA 4QMTA 5BNJA 3FF5A 5L6OA 2V9VA 5D5UB 1BI0A 2EV5A 4KIBA 4XG8A 5IT3A 1AD5A 4WCGA 1Y8GA 3QAHA 5JGDA 3M1SA 5IU2A 3MWUA 1ZH5A 1ZY4A 3LFAA 1OIYA 2X9EA 2FB8A 3K54A 2QHMA 1W4MA 1F1ZA 4DBNA 4IIRA 1IASA 4X3FA 4BHPA 4ERKA 3KZZA 2Y4IC 2QC6A 3D7TA 2F5EA 4MXXA 3DPKA 3F3XA 3KRWA 1XD7A 3E97A 2B0QA 4BDKA 4FF8A 1SVGA 3CKXA 4BI2A 4MNEB 1ULYA 1Z05A 3QKKA 1K9AA 1UHWA 1J75A 3KE2A 3U6HA 3N51A 2SRCA 5ETCA 1CSNA 4OBPA 1P2FA 1FPUA 2J2IB 2XNOA 2VTIA 5LBQA 4II5A 4IC7A 4MWHA 1IN7A 3KEQA 4AWIA 4A4XA 5ILSA 4CSVA 4KUMA 5FB2A 5FBNC 3QP5A 3JTHA 3EN7A 3GC7A 2JDSA 3CSVA 4Y8DA 1ZHFA 2V1DA 1KOBA 5E8XA 3R7OA 2NRUA 4Q5SF 3ET7A 5M4IA 5A4QA 3UPZA 2QWWA 1TTYA 3QU6A 2DUVA 2FQ3A 1YO5C 5D7AA 3TL8A 3ZU7A 2QOLA 4QMPA 4RB1A 4PUZA 3R01A 2IJLA 3ROCA 2UZOA 5ANGA 1PDNC 3O0GA 2WMVA 4WK8F 4U43A 2Q8KA 2FSMX 3MH3A 4PV0A 3OZ6A 1ZYJA 1H26A 1PXPA 2WHBA 2BDWA 3GC0A 4J99A 4XH6A 2FMYA 3KCFA 4NZWB 5D8KB 3W2SA 1YHVA 2Z3YA 3R60A 4CFNA 4UXNA 3LCSA 1ON1A 3D4QA 4GUEA 5K5RA 4YZDA 4D9TA 2XNBA 4OLIA 3AD5A 1XMAA 2NNNA 3PJ8A 3R73A 1SVHA 4TKSA 5AR8A 4NW6A 2PLYA 4QQTA 3WTYC 4HF1A 3KXHA 4W8DA 4ITJA 3QTUA 3ERKA 4M0YA 1Z9CA 3BBTB 2O03A 5CQUA 2WMWA 2CNVA 4ZAUA 2JFMA 3R0JA 3FSKA 2WWYA 3NR9A 3D5XA 1YWRA 3H3ZA 4HX8A 3EUHA 2QZ8A 2V62A 4KUJA 1V3FA 2L02A 4HGLA 1FNNA 3WGIA 4Z16A 1XH5A 4G3CA 5BMMA 4IAZA 2XIKA 4QP4A 4HVHA 1JGSA 4TYIA 5CEMA 3VOEA 5BMSA 4NUSA 4BIEA 2XRWA 3RKBA 1WBPA 4FL3A 3C0GA 3DZQA 1PP7U 4XV9A 1BLXA 3E88A 3ZYAA 5ANJA 3ZN1A 4WG5A 1WRJA 4O2ZA 3ORPA 2HZTA 5HKMA 2QBYB 5IA3A 1TQIA 2JBOA 3BY6A 4ACGA 3QUDA 5CNOA 3ML6A 2JIUA 2XP2A 3C0HA 2B1PA 4QMYA 3KMWA 3D83A 4FGBA 2J0KA 4CRLA 5LCJA 4FG7A 3ZBXA 2DQLA 5J5SA 4EM1A 4QO9A 3F2NA 5ACBC 5CF5A 5KBQA 2QKWB 3U4UA 2ONLA 4YZ9A 1AWCA 1IW7F 5B0XA 4X3FC 4ANSA 4XYFA 4P96A 1OKVA 3HGKA 1KU7A 4LV8A 5K0KA 1ZG5A 3TI1A 3NNWA 4IZ7A 3PA3A 5DDGA 2OICA 5M55A 1FC3A 2KJCA 2JC6A 2H09A 2VWIA 2YCRA 5CU6A 3FY0A 3RAHA 4W8EA 2BALA 4ESBA 3EN6A 4ANBA 1G3YA 4FZAB 5CVUA 3VVHA 1GJOA 4FIEA 1I44A 4L46A 4D0PA 2OZ6A 2XK3A 4M74A 1MZBA 4JJRA 2O8XA 1HBXG 3ZLSA 2BYVE 3EFJA 3TDVA 2LF7A 1HCKA 4MXZA 3HHHA 4TXCA 4XLNF 1B38A 2RDPA 4HLYA 4FV1A 3L8VA 4NQWA 4IVAA 2FBIA 4NTSA 5IH5A 2IA2A 3EN9A 4OTDA 2ETKA 2RG6A 1XHAA 4DF3A 1XGNA 1SMHA 3A7IA 4ZMEA 4RGJA 1PMVA 3I59A 4KICA 4EJOA 2HQRA 3G2FA 1BKXA 3TKUA 1B9NA 3UMWA 2GXBA 3ZQ7A 4RWLA 2F7EE 4M73A 4L9TA 3LPBA 2R9SA 3NVKI 3WTTC 3H9RA 1WFCA 4FSNA 2EFQA 1O6LA 4IWQA 2QYOA 4GUBA 2L01A 2E1CA 5JH6A 3G15A 5C9CA 1J9IA 4IZAA 3QBNA 3RKYA 5FXRA 2PVRA 4EEVA 5HS7A 4GKIA 1PF8A 2EFWA 3UO4A 4RA4A 2BIYA 3KP6A 5L4QA 4JG8A 2DU9A 3NMUF 5AUVA 4L3LA 4D4YA 4OIRF 3I0OA 2C69A 3HRMA 1H0VA 4IVBA 3E7VA 4HZRA 3SDJA 4C57A 2PVFA 2XH5A 3P7NA 4FV5A 4H39A 4NTTA 3ZEPA 4KRDA 5TOZA 1H0WA 4OT6A 1STCE 2W84A 5ANDA 4D5HA 3QX4A 5BVEA 3WILA 4OUCA 1DI9A 3QXPA 1FVRA 2P4IA 4HYUA 4DITA 1OKZA 4P9FA 3COAC 3KRXA 2R3KA 4JBAA 2WPAA 4NIFB 4RIXB 4FA2A 3K0LA 4F7ZA 3VQHA 1H1QA 5EG3A 4DGLC 5GJFA 3DTCA 2VT2A 5D41A 3A7JA 2QQ7A 2XAHA 3ZP5A 1KYZA 2RL5A 4F1MA 3MVJA 2XKOA 5CASA 2C3LA 4QPSA 3FXUA 2Z7SA 2BDJA 3QA8A 5TO8A 1J1BA 1G4DA 4FICA 4A4OA 3HA6A 4BI0A 3FQEA 2G1TA 3AXWA 3CUQB 2YM6A 4PTEA 4X3JA 3ZM4A 2BUJA 1SYKA 2PMOX 3KZYA 2GQRA 5EQPA 4OTGA 4IE9A 4BFMA 3QQHA 2A68F 1BI7A 2PVLA 4QPAA 2QLZA 3C4CA 4FKVA 2F7XE 3LMHA 3I53A 2PZPA 4K1BA 1YI6A 2Z7QA 4FEXA 1OL5A 4XNEA 2ONLC 1F9NA 4H36A 2GIVA 4ACMA 4HF0A 3QTQA 4R1YA 3ZFMA 3FQHA 4XLPF 4M15A 4FTRA 2C6TA 5AM6A 3E62A 3W6KB 3D2KA 4PDSA 4X2GA 1Q8ZA 2QO9A 5CYVA 5G1XA 2K02A 5HICA 4EHEA 2OKRA 3PRFA 2QOHA 4LGDA 4G94A 2CGUA 2HTJA 4K2EA 4EJTA 4Z7HA 4OBOA 4MXYA 5GNKA 5D4RA 2PMLX 3LHJA 1JHFA 4BWKA 3WI6A 4CKIA 3W33A 5JRSA 3JXWA 4J96A 4FEQA 4AW0A 4HV6A 5HGIA 4CZUA 2K86A 3DGKA 2RVCA 3DQXA 1UFMA 2WZJA 4B8LA 2HKXA 3EQBA 3GZ6A 1XDSA 3POZA 3L00A 2IG7A 4PL3A 3ZO3A 3JSPA 3L9MA 2XIGA 4MX9A 5CU4A 4M67A 3LA7A 5F95A 3KP3A 1ZMUA 3GQLA 2P5VA 1KWPA 3GCQA 4M72A 3HIFA 2C5YA 3RWPA 2F49A 3HDNA 2FBKA 4HPUE 4R7BA 1S9JA 1FLIA 3GOPA 5IISA 3II5A 4CG8A 1UU3A 5L3DA 2LKPA 2LDUA 3ALNA 1GZ8A 1QNTA 3CEKA 5E8IA 2XKDA 4A5NA 2HWOA 3ZMVA 1BJAA 5DPVA 1Z6TA 2E7WA 4JVGA 3GZ5A 4M7IA 2JKQA 3LM5A 1SFUA 2LSOA 1BUHA 4FNXA 2NRYA 4GFMA 3PDTA 5HEZA 5H8BA 2GFCA 2VXZA 2PMUA 5ETIA 4EOMA 4XX9A 3KCCA 4FTUA 3MCZA 1HKSA 5E1ZB 1FWZA 1DPRA 3OF0A 2HEOA 4DH3A 3C1DA 4MF1A 4APCA 3VUTA 4U42A 3FM5A 4A5MA 3VS7A 4WF2A 3IG7A 4J8MA 3RYPA 2BDFA 2HY81 5DCMB 3RK7A 5CI6A 1QMZA 2ITNA 3OTVA 3F2AA 1S7AA 5F1ZA 3LXLA 2YIRA 4U5JA 2VU3A 2FNAA 3LAJA 2YSRA 2PVHA 4RFMA 4O7SA 4C4EA 2X39A 4ZMFA 3TV4A 2RN7A 3BPVA 3NRVA 3GFJA 4A0YA 2HZIA 4GO1A 2FA5A 3DV8A 1K2PA 4X3FB 1DAWA 2Y0MA 5AP0A 2BFXA 3VUGA 2QOCA 2H34A 4RPVA 5LQFA 4FIFA 1FGKA 1FOKA 2O63A 4EQMA 4FV8A 2VRXA 1TNSA 4NB5A 3CO7C 3B2WA 4ZZNA 3KN6A 4G7ZF 2V1XA 1TKIA 3F5PA 1XN7A 1Y57A 3ZHPC 3FWQA 1JBPE 1KA8A 2C6MA 2JT1A 4XSZF 3FDNA 4UX9A 2MD5A 5E1WA 1OBDA 4UALA 4M9ZA 1FSEA 4MXCA 3G73A 4F6SA 2F5FA 3EYIA 4GYGA 3A7FA 4O7TA 4FTKA 1B6CB 3RAWA 4AOIA 3WU1B 1OL2A 3K3JA 3QTIA 3MS9A 1U5QA 1R1WA 5E1SA 3MDYA 5M06A 2HZ0A 5FM2A 1L8TA 2O6GE 1YXSA 3COHA 2EFNA 3L9LA 4A6EA 4L43A 2IN6A 4D1XA 4JBQA 4XCUA 4EVIA 2STWA 3DQWA 2R3QA 1A48A 4D2TA 5FLXZ 3QLFA 1T2KA 3RWQA 5GIOE 3GVAA 2YA9A 5GJGA 2BKKA 5EW8A 4ERWA 3HV3A 1VR2A 4OAUC 2YACA 5BVNA 4IAYA 4B7TA 4ENKA 2OIBA 4QTCA 4RC4A 1JHHA 3SXFA 5EDRA 4PL4A 4EM2A 3TUBA 4FZFB 2RF9A 3OHTA 3BP8A 4I6HA 1VYZA 2VTSA 1EH8A 4YZCA 5IEVA 5JFXA 5L3EA 4RJ6A 5M08A 4DH5A 4UV9A 1U5RA 2C68A 1OIRA 1F5QA 3GU5A 1IXCA 3UIUA 4I5HA 3ZM9A 2XJ2A 1SAXA 2A1AB 4O5VA 2H27A 5EI8A 1Q5KA 3WF7A 1T38A 2R3NA 4AXAA 4I98B 2VAGA 5AP1A 3V7CA 4BHBA 1PYEA 4S2ZA 3PZEA 3OS3A 2BZJA 3KRRA 1M2QA 2V55A 4BYYA 3NUAA 3ZZWA 3UJGA 3OOGA 4O84A 4BC6A 2YPRA 3TG1A 3I5ZA 1YOLA 1W84A 3GEQA 5ICGA 4F9AA 2Y9QA 2NPQA 4DC2A 2F2EA 2QG5A 3FI4A 3Q52A 4D0WA 4D4RA 4Z7GA 3QTZA 1FZPB 3FY2A 2X7FA 4BDJA 1OI9A 5BYYA 3AGMA 3I7BA 4I21A 5IQHA 4A12A 3MAJA 3GFLA 4GKHA 2OJGA 3EQGA 4EZ3A 4GJ3A 4MTAA 3GFMA 2JIIA 3OD6X 3DJ7A 3LCOA 2W25A 4DTKA 2OW3A 5KKRB 2UW8A 3ELJA 2ZM1A 3I5NA 2RV8A 4G9RA 3MTFA 4XSXF 4CICA 5C8KA 3VUKA 3EZVA 4BNCA 4YSJA 1ONVA 1OPLA 2BPMA 3S95A 1U5TA 1WI9A 3ZONA 3KETA 4M9SA 4IM3A 1YFHA 1U4DA 1XH8A 4XG7A 5HE0A 4QMMA 5EEGA 5HDGA 4XBRA 5IUIA 1ZAOA 2ESMA 3V7RA 4QP1A 3FSFA 3VAPA 1LEZA 4TYGA 4UHTA 5DIAA 5FQDC 4IJ9A 4TZRA 2B9FA 2XK8A 1YWNA 5FG8A 3QTXA 4A2UA 1IXSB 2RKHA 3DBFA 2RFEA 4LRJA 2IVVA 5BVOA 4F7NA 4RBLA 3AG9A 2JITA 3RMFA 4TNDA 3NVMB 4V0GA 3JY0A 4F0GA 5E1XA 3TIYA 4AX8A 3VUDA 4IF4A 2O8YA 4W4WA 5DMZA 3KGAA 5FTQA 2ADUA 1SNXA 1OL7A 4XP0A 3P9KA 4I94A 4NT4A 3GX4X 5HBEA 3KULA 2CJMA 4FVQA 2G7HA 2H6BA 4DG3E 4MNFA 4O38A 4K6ZA 2HR3A 2E7XA 1ZGJA 4HA8A 2NO3A 4GVJA 4BRXA 3R00A 2F2UA 1FYLA 3HX4A 3AC8A 3P7CA 3OCBA 4D4VA 4GRBA 5JVTA 4EH6A 4FTJA 3R02A 4V05A 1TVOA 4ASXA 3OV8A 4JX7A 1FYKA 3LMGA 3TNWA 2XYNA 2QENA 3DBQA 5TJJA 4PRJA 3LJ0A 3FMLA 1IF1A 3BYMA 4CD0A 3EN4A 1R00A 1HCLA 1YW2A 3EQLF 3GLXA 3F6XA 4ZSJA 2BRGA 4BHNA 4G6LA 5AP3A 2PSQA 3QGWA 1RUOA 2R0IA 3GBZA 4FTIA 3OCSA 4O0YA 2I40A 3HKOA 5DV5A 1IN4A 5I9UA 4KS8A 1HXDA 2B9JA 2HYYA 3CLYA 4E1ZA 3LXPA 5FFXA 4PPCA 1P6RA 4ITHA 4LG0A 2YABA 3KF4A 2FYSA 3KRLA 3AD6A 4ZY5A 2KIUA 4JT3A 5JFSA 5I3RA 3CBLA 2J4ZA 3NZ0A 5AIPA 2B0LA 1XDUA 3UE4A 2FE3A 2GAUA 1YHWA 4MHAA 4FSUA 1LR4A 1YKRA 3PA5A 5EM6A 3OCTA 2UXXA 4IRGA 1ZLJA 3ZTXA 1IAJA 2XUBA 4KS7A 4DCEA 2FRHA 5CLSA 1MKMA 2C0OA 2ZDUA 5AR5A 1YXUA 3G3ZA 1FP2A 3SHFA 5CEIA 2CKQA 3HLLA 5HTBA 4FIIA 3M11A 5BX0A 2UV2A 3R9DA 2ITZA 3W2QA 3GFWA 1NY3A 5HD4A 3DKGA 4L44A 4IACA 5EYCA 5AUYA 4CMTA 2NP8A 4KNBA 3SQNA 1LUFA 3ZZEA 4HBLA 3BYOA 4O6LA 1REJA 4DFYA 3FXQA 3QD4A 2WO6A 4EQUA 3KXMA 4ZYEA 3EL8A 4O0VA 4ZSLA 2UW9A 2PFBA 3UIMA 2Q83A 4JDIA 3T5XA 4C2WA 2VBWA 1OBGA 4HOBA 5D5WB 5A46A 1U5TC 3OFMA 4RSSA 2ITWA 3G33A 4ZJJA 4XLIA 3BGQA 2ZVAA 5JN2A 2CYYA 4GT5A 5AUTA 4QMVA 4CTCA 4ZEGA 4YSMA 5IA1A 1PXOA 3QQFA 5BMZA 4M68A 5E9EA 1IAWA 4V01A 4JBVA 3KLOA 3UP2A 3JY9A 4Z3VA 3Q9SA 3ID6C 4CT1A 3F8MA 1YXXA 3KVXA 4TL0A 3Q4CA 4MVFA 3GCSA 4MTDA 5IUHA 3JAMZ 4F7SA 2V7AA 3WF8A 4EKLA 5HQ0A 2PMNX 4OTRA 3TZMA 3WU0A 1OGUA 2FUMA 4IEBA 4BKJA 2XKFA 4LMNA 3VJNA
chains in the Genus database with same CATH superfamily
3DFAA 2OGVA 1KGSA 3RHXA 1QL6A 2VKEA 3V8LA 3GYHX 3ZQCA 4J52A 2X1CA 2B7AA 4RX7A 2XUUA 2FD5A 3LSIA 3KXXA 2MABA 3GQIA 3H9FA 2EIJH 3H3UA 4LMYA 3P9CA 3PJ2A 4RAZA 3MB7A 3CTJA 2R3PA 4IX4A 2ZAZA 1URWA 2E2JJ 4FT9A 4L3JA 3BV3A 4X7QA 3QUPA 5E8WA 4PF4A 3SGCA 5HHWA 2C3KA 2NVUB 3PQKA 2CPKE 4AZSA 5EM7A 1LFBA 4R3PA 3V7SA 4EC9A 4G8XA 4RLLA 5BVFA 4ASDA 1BIAA 4YP8A 3UG1A 3UOHA 3COIA 4DBRA 3FMNA 4R3CA 4G6NA 3OYHA 3PXQA 1OZ1A 4O7WA 4LGWA 2X6OA 3FZVA 2I0YA 5JLXA 4CO8A 4LFUA 4YJVA 4MYGA 1K79A 1IZ1A 3HOTA 1HW2A 3W2AA 3AC1A 2DAOA 5LRRA 3GTQJ 2G2FA 3VIDA 1VNDA 4G7HF 2YITA 4MGRA 4OTHA 2WMBA 4YPDA 3J81Z 2NNWB 4U0WA 1OPJA 4LGGA 5M4FA 1YLFA 4NL0A 1EH7A 4NBQA 3PP1A 1VQ8I 4DT9A 2ITPA 3ABUA 1MBEA 4G17A 4EONA 3N4VA 4U0YA 1S29A 3RQIA 2WFYA 2ZJ2A 4M3EA 2VJIA 1VTNC 2XK7A 3G6EI 3IQ7A 2PL0A 3NEUA 4L5IA 2VLAA 2CW8A 3ZMDA 5JFWA 1XMXA 3B02A 3OR2C 1V0BA 4BDAA 4KYWA 4E6KG 2XJ1A 3CD3A 2CN8A 3H35A 4YLKA 2OZAA 2CUFA 4QQ5A 2YWVA 2H6DA 3OS2A 2XIYA 1B4AA 5J7BA 1QHHD 3RSNA 1JOWB 3ACKA 5JRQA 2VQGA 4N57A 4AU8A 4PJMA 5TE0A 5AX9A 5I9VA 4QTRA 2UZKA 4KNYA 2OLCA 5HLNA 4C4GA 4XV3A 2XPWA 4CTBA 1OIUA 4V19K 3KK8A 2BOLA 1VQMI 5B1BH 3SZTA 4IHPA 5K5QA 4DAWA 5IH6A 2IAIA 3HSFA 3DOGA 2VWBA 2BRMA 1YQJA 3C2HA 1G5SA 5E8ZA 3U2RA 3WTZA 3JRAA 4RC3A 2AXLA 5ETAA 4I23A 4AIHA 1ETKA 3OS0A 1WVWA 3VWAA 4DBXA 3HMOA 2MFZA 5AUZA 3FKIJ 2YFXA 3DU6A 2VOOA 3LFFA 4DIQA 2VUMJ 4EL9A 4JI9A 3MV5A 4OTPA 1GIIA 2VTOA 1ATPE 3UDBA 1HSJA 2C5NA 3PIXA 1YG2A 4WRSA 5A4TA 1OL1A 3AFHA 2K9NA 4W4VA 4Q5HA 4EC8A 2BBYA 2AS5F 4AA4A 5J1VA 3PIYA 1H9GA 3HMMA 4AZFA 4XBFA 1YDRE 3PVUA 4RM2A 1M1EB 1I6HJ 3H0YA 2KP6A 2YCFA 1FOXA 4FV3A 2J6MA 4M12A 2R7BA 3GW2A 3SEZA 2XNPA 5M57A 3SW7A 2X2KA 4C2TA 3Q9VA 3DKYA 3UPXA 5IP7J 4A0XA 2O0UA 5HG5A 4CHUA 3ZRKA 5EDNA 5HNIX 2PZIA 1LE8B 1LPUA 3EMGA 4FC0A 2EA2A 4BEHA 4EMSA 3LFSA 2B4SB 1VFCA 3J80K 3K2ZA 1S7OA 4JS8A 1WPKA 4RIWA 2O5KA 1I09A 1ST0A 5K1YA 2LR8A 1S7EA 2DW4A 5B1AH 3LL7A 1F5TA 3ZS5A 3QALE 2HVRA 2FJ1A 2HXOA 3VYRB 4Y5QA 3DEUA 5A4CA 4BXFA 3A62A 2NVQJ 1BL6A 4HF2A 2A2AA 2DI3A 3R30A 4L5EA 1UB9A 1MH4A 1OUYA 3SXRA 3GCMA 4AP7A 1RETA 3JVRA 1DI8A 4AYBN 4LMUA 2PWLA 4MNUA 3F9NA 3FLZA 3MA3A 2LKSA 2L9NA 3MFRA 2P5LC 2G9XA 4IB0A 4RJ4A 1JTYA 3VBTA 2XRNA 3K4NA 3IWFA 2WAJA 4N6ZA 5HG9A 1PUFB 4EKKA 3FXRA 3I1AA 1U6GA 2DN0A 1Y0UA 5FP6A 1D0YA 4L52A 2EFPA 4CFUA 1X1BA 1XS9A 4Y33A 4H3QA 3R9RA 2BCJA 4USDA 2JZYA 2Q0BA 2FOWA 3T8OA 5CSVA 3MZYA 2JKOA 5E8VA 2W0JA 1UU9A 2P6SA 1GXQA 5LWNA 5CALA 4DNCA 3ZUTA 1QPDA 4KIKB 3M07A 1XH6A 2Q1ZB 4E6AA 3BROA 5E8SA 5AV4A 4I0TA 4RMZA 3PPKA 5IQBA 2JSCA 2XK4A 2M8EA 3CC7I 2VC0A 2OXDA 2EWNA 1GZNA 1E2XA 3F6OA 3RKXA 4M6XA 1P4FA 4WG4A 4YHFA 2F5DA 2C4GA 3PG3A 2KT0A 2E9NA 3BR1A 4CFWA 5CSWA 4JX5A 1GIHA 4F0FA 3CIKA 3H9OA 4O1PA 3FL5A 3HEGA 1H1WA 4RLFA 2Y6MA 5L2IA 2XAFA 3O96A 4NCTA 5D4SA 4RJ5A 4W4YA 2IEKA 2DA1A 1E1XA 1ND4A 3JRGA 4YHJA 3EOCA 2C5XA 3HC7A 2V79A 4JR7A 2BVLA 4O27B 2XF5A 5AP5A 4QTEA 2E19A 1Q8TA 5IOYA 1H28A 3L09A 2H94A 4BGDA 4U88A 1PXIA 1APLC 5IT9Z 2M7AA 1BX6A 5HCXA 1YW8A 4QQCA 2L3DA 5H20A 4HRIA 4GJ2A 3FXZA 1IR3A 3V42A 4S0HB 3W1FA 2D1VA 4MEYF 3M4OJ 4DG2E 4QNAA 4C7TA 5IYDJ 5KAFC 1R5GA 4RWJA 1PXJA 5HTIA 5CYIA 4WD5A 3F69A 4F92B 3AC4A 3VODA 2WU6A 3CQUA 5IA0A 1IDZA 5DA3A 3EKNA 4XV1A 2WD1A 4IB3A 2LP0A 4FKLA 2Y4PA 4GS6A 3K2LA 1IAHA 4AYBA 2HW7A 4AAYA 4EJNA 1H27A 3K6GA 3TTJA 4RRVA 2OK1A 1DAYA 1KE6A 4D2WA 5H6QA 2QOOA 2MD0A 2VX3A 3BG7A 5CVHA 2PU8A 5H8EA 2KIFA 5B2MA 4GFOA 4ENNA 3ACJA 4A06A 3A1YA 4E7IA 4E5WA 4YZBA 1ZGWA 4CUGA 4FUXA 4GYIA 4MNEA 1D1BA 1C0WA 3TO7A 5DS9A 4DEIA 5J79A 3ZC5A 3TYKA 2XKCA 4NNJA 2PZ5A 2HWVA 4GU6A 3KB7A 4CNHA 2DOAA 3GENA 4M14A 3MBLA 3THBA 3R04A 3S0OA 1ZMVA 1YW9A 3MY0A 2MG4A 3R2BA 3VPRA 1JJ8C 4KFCA 2OF4A 5CEPA 4QMOA 2ZB0A 3HV4A 2UW0A 4AZVA 5HVYA 2C1BA 2AUHA 2MW8A 1UCRA 3FHZA 2V0DA 3MI9A 4D2RA 3DXNA 3JVSA 4AIKA 3DB8A 2IW6A 3DB6A 3PZHA 4WSQA 4CLJA 1VQPI 3MPAA 3AMBA 1YRNA 2UZDA 2WB8A 1H4LA 2UZLA 3FXMA 2XEYA 1LP4A 1PXLA 4YIIA 3HAMA 1UG2A 5EW9A 3E5UA 3UQCA 3QGYA 1CKPA 4U3YA 4BI1A 3RBWA 3T0YA 3PE1A 3A99A 4I0AA 4WBBB 3RI4A 2J5PA 3QODA 3ZXSA 4YR8A 4O7YA 1KV2A 1S9IA 3OYGA 4QMSA 4QDEA 2L4AA 3OYEA 1UKIA 4YC6A 2FU4A 4EWQA 2UZBA 4EH5A 4KWPA 4YEJA 3KXZA 4QP9A 4AOJA 1BM9A 2BIKB 3A7HA 1IA8A 3TZ7A 4FVPA 1R22A 4IRHA 4LG0B 5GJDA 1WBVA 2WADA 4DEDA 3V8TA 2PUUA 2JAVA 2JA2A 3RINA 2OF2A 3FKLA 4TYHB 4CQGA 4DHZA 4I5CA 3VBQA 4QEBA 3OROA 4RA5A 4F55A 5CAVA 1TLHB 4IADA 2BVAA 3U8WA 4EK3A 4HZFA 2AXTC 2VWXA 3HSEA 3GUBA 5K9IA 3U9NA 3M8JA 4PTGA 3ZGKA 1OL6A 4FL1A 3FZTA 4UWYA 3FKJA 3U55A 2UUEA 4L18B 2O61A 4EH3A 2M2EA 4USEA 3KYLA 1K7AA 5HLWA 3DPLC 3CJGA 3S1HA 1EH4A 2C0TA 4FT5A 5LMBA 4ON0A 3DTKA 4M9XA 4FI1A 2C5VA 4TWOA 3G0EA 1XWSA 3TV6A 4RAGA 4A4LA 2XARA 4Q48A 2X1DA 3QWLA 4CKJA 3D5VA 3SOAA 3S1QJ 1W2CA 1BIBA 1QPEA 4BBEA 3ASOH 5J9YA 1O9UA 3TO9A 3M42A 3BWFA 1BI8A 3Q3BA 2Y48A 3B73A 1MDMB 4FSMA 2FS