1ZAOA

Crystal structure of a.fulgidus rio2 kinase complexed with atp and manganese ions
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
282
structure length
271
Chain Sequence
b'MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVGHTKVKEFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rio2 serine kinase
publication title Autophosphorylation of Archaeoglobus fulgidus Rio2 and crystal structures of its nucleotide-metal ion complexes.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Transferase
total genus 93
structure length 271
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zaoA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zaoA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zaoA02
2CW0F 2PE2A 2JKMA 4AFEA 4XG7A 2V6CA 1S7OA 4LGHA 3RBWA 4PDOA 3LA2A 1M2QA 3I53A 5J5TA 2O3PA 1IXRC 1OMWA 3W2SA 4B09A 2J5PA 4EM2A 4ZZNA 3T9IA 2H6DA 4ZTSA 4HVIA 4IJAA 4YJTA 1YW7A 3FMQA 3U6HA 3R01A 2B9JA 2VX1A 4X2KA 3M2WA 1O3QA 2O5KA 2W06A 4ZTQA 4ZXTA 3SQNA 4BDCA 4W4WA 3OOPA 4C2VA 2BDWA 3ENMA 4G3FA 1H1SA 4EH9A 3MV5A 4G6NA 3R4KA 3DP7A 4F7ZA 4A07A 3ECHA 4Z16A 3VOEA 1G8AA 2QO7A 4GKHA 5DEWA 1A9UA 3OW3A 3TV6A 4HGLA 4O0WA 3M9AA 2PVJA 3CLYA 4ERWA 1S9JA 3BV3A 1PXKA 4AZTA 3RZBA 5HCYA 5E8XA 3V6SA 3EN9A 2HGCA 3EWHA 4EUUA 2L01A 1G4DA 4UWCA 5BVEA 4HQMA 4D5HA 2X6EA 2VTLA 4BHCA 2D1HA 3F7WA 4KYWA 4A9YA 1GXPA 3QKMA 2X8IA 2CHLA 1FMOE 4XG4A 4QMQA 5JK3A 4WXHA 4FKVA 5M53A 5GJGA 4ZTLA 4E93A 1FYMA 5HDGA 2GXBA 4D1SA 4EH6A 4FKQA 4N9HA 4OW8A 5AFVA 2ZKZA 3EFLA 2BAKA 4I5PA 4RQVA 3OV8A 2GZWA 4XBRA 3ATTA 2RF9A 4NIFA 3V01A 5GIOE 3FMHA 1JAMA 4FNXA 3GYHX 4FZ7A 1APME 1W98A 2RFEA 3TZ8A 2GNHA 2XK4A 1NVSA 3FLSA 3E3PA 2R4BA 4P5OA 4KRCA 3AT3A 3LIJA 4IRIA 3HMOA 4HVHA 2A6EF 4KUJA 5BX0A 5TO8A 2XIXA 5LWNA 2WMVA 2Z5UA 4QMTA 4KT5C 3NX8A 3H10A 3TIYA 3EHAA 4WT6A 1L3RE 4UYAA 3UMWA 2VO7A 2PMIA 2LKPA 2BTSA 4UZDA 3IW5A 5E8YA 5K0KA 4EGZA 1ULYA 3PY0A 3IPHA 3M8FA 4D4SA 3C5UA 4EK8A 2PVFA 1IEPA 5HQ0A 4H36A 5EDQA 2X9FA 4QMPA 4YGAA 4RA5A 2FF4A 4X2GA 5B2KA 4HGSA 4QNAA 1CF7B 3EFJA 4FEWA 2RFSA 3FXWA 3M1SA 3M8EA 4LMYA 4O0TA 3WI6A 5KBQA 3CR0A 2Y7JA 4FKSA 4RT7A 2FVDA 1LDDA 4G6OA 5L2WA 3QAHA 5CAPA 4UX9A 2MLKA 5AAFA 4WG4A 4RB2C 3BE9A 4U3ZA 4E6DA 2W5AA 3L8SA 4RVKA 1FZPB 2WMSA 1OIUA 4LK0F 3DEUA 4YJPA 4F63A 3UG1A 3BELA 4BNCA 2RC4A 4XSXF 1SM2A 3JSPA 2QKWB 3R1QA 4GG7A 5FGMA 4ZTRA 4I5CA 4TNDA 4N6YA 5ICPA 2FA2A 3FI4A 5DV5A 2PI0A 5IDNA 1CTPE 3DK6A 2QOOA 2P4WA 4JBPA 4EQUA 5IF1A 4FTMA 5C8MA 2STTA 2W84A 5FD5A 4W9XA 1BYGA 4B8MA 4D9UA 2IWIA 4EZ5A 4E7WA 2NPQA 3MDYA 3DCVA 4Y73A 5HCZA 4ZJIA 5AIQA 3NQOA 2W17A 2ELHA 4NQWA 1I5ZA 5E91A 4BI1A 3HAVA 1ZWSA 4M68A 1GZOA 4PTCA 1LEAA 4YFNF 3KRWA 4NW5A 2XKCA 5T68A 4RWKA 4WF2A 5ILUA 3HV4A 3DXNA 2HOGA 1YW2A 3LKMA 4IZ7A 4OBQA 4DFLA 2WTKC 4A7CA 4XUFA 4OTHA 4FEQA 3JAMZ 2CGXA 3QU3A 3KXXA 2C6EA 3ORIA 4O1OA 2R3HA 1NHAA 3RYRA 3WE3A 2ZM1A 4XBFA 1YQJA 2Z7RA 3R73A 4KIKB 1LDJA 3EKNA 3NRVA 2HXQA 1ZREA 3HUBA 5KHXA 2KIMA 3WZUA 5FB2A 3GO5A 4KSPA 4FSMA 4TL0A 4ETSA 1KU3A 3M7GA 1G8SA 3UZPA 2GTMA 4PDKA 3QKLA 5BUJA 5A4EA 4JBOA 1X8BA 2GS6A 4IXPA 1RI7A 4ZTMA 2QVSE 1Y8YA 3UG2A 2RGVA 2LDUA 5B2MA 4XP0A 4EKKA 3MCZA 1J5YA 1QPEA 2B52A 3POOA 1FPQA 1HSTA 2FSMX 2CSOA 4MVFA 3QPHA 3LM5A 1CF7A 4F7SA 4NSTA 4CG9A 4G31A 4BI0A 3V5QA 4UVAA 3KZYA 4C0TA 4AOIA 1E1XA 4B8LA 5AR3A 4FX3A 3C50A 3A7FA 4IHTA 2QYOA 5CQUA 4RGJA 5IMEA 3ZRLA 2W1FA 2PYWA 1M52A 3ANQA 5IEYA 1B6AA 4YG2F 3Q6WA 2OGVA 4LOQA 3KE2A 3KRXA 4D28A 4GJ2A 4CZUA 4YBKA 4DEDA 2PUNA 3S3IA 3VS5A 4EZ3A 4I20A 4F99A 4EQMA 3HMPA 4C36A 4EVIA 4KABA 4FSWA 4CTBA 3OTUA 5ANJA 3LFFA 5ICEA 1IF1A 3GU6A 4GIHA 4QYFA 3F66A 3Q4TA 4R6VA 5C1QB 3R7EA 3G33A 3C4WA 4U41A 5JGDA 1B9MA 2VWZA 3L9NA 2XEYA 3ZDUA 3HRMA 2HYYA 2Y48A 1IRKA 2IW8A 4PPBA 1QPJA 3L2CA 4O22A 1ZG1A 1Q61A 4AOTA 3REOA 2ISZA 2KTYA 3OXTA 1JBPE 2HXLA 5D5VB 3GT8A 4QMXA 5C03A 2QURA 3JVSA 4JOAA 1FNNA 1FP2A 4BC6A 4ACMA 3FYJX 4QMWA 3ALNA 4PL3A 3UOLA 5AV3A 3IK3A 3A7HA 2EXCX 2YCFA 3RK5A 3UIMA 3ID6C 4ASZA 3EYGA 1SMYF 5LEJA 3NUPA 1ZYCA 5HEZA 4UYNA 2OI4X 4CMTA 3WTVC 4HF2A 5L4QA 3VJOA 2QI8A 4A0ZA 4XLNF 5FM3A 1ZZLA 4IVNA 3SRVB 3R1YA 4KIKA 1YHWA 2HS5A 3VUTA 5TF9A 3MPMA 1SD6A 2DQ7X 3Q9YA 3KQ7A 1YG2A 2XAJA 2WC2A 4LRMA 3TNHA 3KRJA 1PXNA 1OL2A 4NM3A 1HKQA 3SC1A 4G1WA 2QVOA 5ICFA 3SD0A 2W25A 4GSBA 4ZMFA 2IVVA 3QAME 5CWZA 4ZZLA 4AIJA 4BCKA 4DEHA 3LFKA 3MN3A 3TEIA 2RL5A 1H01A 4NU1A 2Y4IC 2CJMA 3HAMA 3PJCA 2XYUA 5ILSA 4BI2A 1ZMWA 5CSXA 4JX7A 2FNPA 5DMZA 5IISA 3MVLA 2ETRA 2WTKB 1LPUA 2ZB0A 4OOIA 3WARA 3D5VA 1WBSA 5H8EA 3TM0A 5LJJA 3R9DA 4B0GA 2RKHA 2GQSA 2B9HA 3IGGA 3EN5A 1YYVA 4LK1F 4S05A 2JITA 3JTHA 3KXNA 5ED4A 1U78A 4ZSEA 1YXXA 4WKQA 3Q53A 5F64A 4LG4A 2FUMA 2X7GA 3OUNB 3VFZA 3C0IA 4KIOA 3QHWA 4M73A 4XRFA 1DI8A 5DNRA 3FUPA 4MD8E 5LVOA 2B1PA 4RVLA 3WGHA 1BI8A 2IZRA 5JEBA 4M12A 4MD9E 4RIWB 3U8WA 2DK5A 3RM6A 3MY1A 3RPYA 1XDSA 2DLLA 2P55A 1FINA 5IT9K 5KMJA 3H3UA 2WMUA 3AC2A 2HZNA 4EHVA 4FNZA 5DVRA 5L6WL 1UNLA 1T39A 2RN7A 5D11A 1ZYDA 2GS7A 1YDRE 4FODA 4CXFA 1B38A 5IKWA 3BGZA 2J51A 3LFCA 5KUPA 5CSVA 2CO5A 1VZOA 4G3EA 2QQ7A 4GS6A 4JG7A 4Q5EA 4IIRA 3RYPA 5L2SA 4BBFA 2R3LA 3BYMA 1IN8A 5HU3A 2MBFA 1OPJA 5CLSA 3BPXA 3TT0A 3PZEA 4ZLZA 3EL7A 2VN9A 4MNUA 1K7AA 4WRGA 3P7AA 4UMPA 2BE5F 2BTRA 2W1CA 5CYVA 2YJRA 4JQFA 2G9XA 3VBVA 1LDKB 1P4AA 1UKHA 3CKWA 3U4WA 4UB7A 1O7LA 3SRVA 5D8LB 4G7ZF 2D45A 2X7FA 3A8WA 5FEDA 3U9CA 3QGYA 2PMHA 2HY0A 2VBYA 4PZJA 2VNYA 1PXOA 5LVLA 5CEIA 4MWHA 4XSZF 4CFUA 4J95A 1UB9A 4K2RA 2HDCA 4AACA 2WMWA 4YZ9A 4CFMA 5A46A 1JVPP 5HBEA 4PPAA 1K78B 1UU3A 1WVXA 1QMZA 3FLYA 2R0IA 2W9ZB 3FLZA 4JLCA 3PPKA 1J2XA 4M97A 3MGYA 3BQCA 3D7ZA 2HZ4A 2ZV8A 1Z9CA 5D7AA 3KCFA 3VW8A 4LQMA 2Z7SA 4BDIA 4CQEA 1Y6BA 4CKJA 5HNGA 4M66A 5AAGA 4YO4A 5E18F 4F9WA 3VAPA 2M5WA 3ZMSA 5M44A 5AP4A 3D0EA 3HL7A 5CEMA 4C4FA 2IW6A 3SAYA 4ENYA 4USFA 3L8XA 5CSHA 5H8GA 5FEQA 3I5UA 5ILVA 5A4QA 2PVHA 5AADA 1CDKA 1SNXA 4AZWA 4RLKA 1FLIA 5BVOA 4NCTC 2OQGA 3NEUA 2CCIA 4RIWA 4CXAA 3FKLA 4I1ZA 2CKPA 2REIA 2RG5A 3MY0A 3BGQA 4HJOA 3R6SA 2Y4IB 5DR9A 3QQJA 2XK8A 3GC7A 2BBYA 3W2OA 3BYOA 3O2PE 3OCSA 4CEGA 4QTAA 3VUIA 5HO8A 2F9GA 5KMOA 1P92A 3MJ1A 4HVSA 3ZO3A 1FOKA 3JTGA 5J8FA 5DOSA 1ZN2A 4OTIA 3BP8A 4F6WA 5AP1A 3QD3A 4QMSA 4U5JA 1I44A 4ACGA 2NNNA 4AGWA 5AUWA 4BGHA 3GC8A 3L00A 2HKXA 4CHUA 4EQCA 3E6CC 4IRGA 4N57A 3GFWA 5BMMA 1GHCA 2PVMA 2VTJA 1SVHA 2HKOA 1XQZA 3E63A 3RKXA 4EJNA 3O71A 4CO8A 4IFGA 5JMSA 3K0LA 4AVPA 4BAYA 2I1MA 3QRIA 2RFDA 4D2TA 4Y72A 4IAAA 4KDPA 4D2SA 3E87A 2XKDA 2OJGA 3NUXA 2QO9A 2F4JA 1XB4A 3FYKX 3UQFA 3F7ZA 3MTFA 1Q1HA 4F1OA 2E9PA 3DJ5A 3H9RA 1JGSA 4QMZA 2P3GX 2NRYA 1M7QA 1AQ1A 4P90A 2DTRA 4Y5HA 3ABTA 3V5PA 2R3OA 3W2QA 2GFSA 4CFXA 5BPDA 4A6EA 3HIFA 3ZC6A 5I9VA 3IKVA 2HENA 5IH5A 2PJPA 4RGUA 1A06A 3UDBA 5JFWA 1K78A 5LCJA 2QOKA 1ZY5A 5FXSA 5HORA 3GVAA 4QMLA 3MVMA 4XG3A 4R79A 1GJOA 3CQEA 4LGGA 4HA8A 3FKOA 1E1VA 5A54A 4LLGF 3MIYA 2C6MA 4LL5A 2LGCA 3A8XA 4FTUA 5EW9A 4EHZA 4EEVA 5IH4A 3WODF 4AF3A 3W6JB 3DU8A 2RV8A 1DPUA 1Z1DA 3KF4A 2XRWA 4ACCA 5FDPA 5D5WB 5L3DA 3ERKA 2L3DA 5KZ0A 4QPAA 4ITJA 3BRBA 2CLXA 4DFBA 3NSZA 2C4GA 4DH7A 2J90A 2VTSA 3Q5ZA 1R39A 5G1XA 1FVTA 1ZZ2A 3TUCA 4FTRA 1P4OA 3UJGA 1KYZA 3THBA 3BBWA 3BHTA 1GXQA 2H09A 2RGPA 3C4ZA 2J4ZA 2XK9A 4JNWA 4QTEA 4EWQA 3ZC5A 4ALWA 4FTOA 1H1RA 2Q8KA 3GZ6A 4MGRA 5AUVA 1BBYA 3NNVA 1NXKA 3MB6A 1Z05A 1I27A 5JRQA 2XCKA 3QA0A 4GRBA 3HRFA 3VS3A 5F4NA 3DNDA 2KKOA 1STCE 4F64A 1GNGA 4M84A 4Y85A 3MVJA 3E6BA 3LA3A 3HV3A 5A4CA 4WUAA 4DAWA 1K2PA 1S9IA 2XKOA 3FY0A 1WBOA 3KCCA 4Z7HA 2QG5A 5IUIA 5J9YA 5IUHA 3K1NA 4I02A 2V9VA 4IRHA 3IQ7A 3H0ZA 1UU7A 2O8YA 4MKCA 4ZJJA 3KFAA 2I6LA 3F5XA 1HW5A 4GG5A 3LFBA 2VTHA 4EYJA 2P6TA 4G8XA 2OXYA 3D14A 3QD0A 3VRZA 2QC6A 2J5EA 2IT0A 3LAPA 2C6YA 1I1GA 1S3JA 2WZJA 1ZGAA 4UMUA 4O7WA 4PWNA 4UMQA 3F5PA 3PSDA 4RS8A 2C47A 2C0TA 5CT0A 2QR8A 4O0UA 4QP4A 3F3XA 3ML6A 4F1TA 2WELA 3ORNA 3LMHA 3ABUA 4FTLA 1XSXA 4WOVA 2BCJA 2ZAZA 3G0FA 3K2LA 1DAYA 2WV0A 3SGCA 1REKA 2BRHA 4Z2YA 2YCSA 2PMLX 4X21A 4WX9A 1XBAA 5FBNC 4M9SA 2VWVA 3TQNA 5D5UB 4NKAA 4FC0A 5HDKA 5FP6A 1H4LA 3G9NA 4HBLA 5DYJA 3M42A 3KN6A 5HTIA 3I81A 1WBWA 2VTAA 4JQ8A 1SAXA 3LXNA 4YLJA 3R1SA 5HESA 2VBWA 2O63A 2YJSA 1PF8A 4B6LA 4L6QA 5LBQA 5AA8A 3QTZA 4LL0A 2C5YA 5ANGA 4K18A 2PL0A 2YIXA 1XD7A 2EV5A 1CKJA 3OXIA 4PRJA 3QL8A 3EDPA 3RK9A 2D1VA 3UOJA 5IQFA 2WTDA 2XV4S 4EOPA 3ROCA 2V1UA 2NS0A 2XASA 1R23A 3V8SA 2GHMA 3R60A 2NAZA 3TJCA 2UZLA 5JH6A 5LMBA 1ATPE 5BPIA 1KV1A 4C4GA 1BI0A 4I6FA 5EEGA 4AOJA 1WKMA 3Q4UA 5CU2A 4OTRA 1XKKA 2ACJA 2B7AA 2YR2A 2IZSA 2HQNA 4EC8A 5DEYA 1GZKA 3REPA 4G6LA 4CV9A 3LMGA 4B99A 2R7DA 3I64A 3TV4A 4FOCA 5CX9A 4RZVA 3R04A 4ZYGA 3IWZA 4QQCA 1WVYA 2DAOA 1XSDA 3FE3A 5L2IA 2VUWA 4ZP5A 4EBWA 3EQGA 2HWVA 4L5IA 4LV8A 5IH6A 3C0GA 3NAYA 1BL7A 1Q97A 4NCTA 4DH5A 2YDJA 2PE1A 2OKRA 4D0XA 4RJ4A 4ZYHA 5CF5A 2GNFA 4CFFA 3LLTA 1I09A 3COAC 1PMEA 3TOBA 3JVRA 5CAQA 3DPTA 2CQKA 3C1XA 2YDKA 4QP8A 2VT2A 3IGOA 2GQGA 4EH3A 4CLIA 2FNAA 3DY7A 5CXZA 1W7PB 1MRYA 2AYPA 3VS0A 2A07F 2E7XA 3GENA 3QZFA 3RP9A 3GCUA 1W5SA 4GT4A 4FSTA 4DH3A 2AS5F 5CXHA 3U6JA 1U59A 3QU6A 4DEIA 2CYYA 4PPCA 5LRRA 3ZONA 2IO6A 3G2FA 1D5VA 3Q04A 2XAFA 1OGUA 1WWXA 3HP2A 3GC9A 2VD5A 5JGAA 4E5WA 3HP5A 2WMTA 4CMOA 5JVTA 3N9XA 1CKPA 2DO7A 3MA6A 3RHXA 4JXFA 3NUUA 5HLHA 3UPXA 5JGBA 1YXSA 1AGWA 3DBFA 3K5VA 4I6BA 3C13A 4F9CA 3EN7A 3UC4A 4H3QA 4GH2A 1WBVA 3ETAA 2DFIA 4OMZA 4C3RA 1REJA 5E92A 1J7LA 4IACA 3MH2A 3DXPA 3RAKA 5JFVA 3FI8A 4P7EA 4UBAA 4QRCA 5HE2A 3WIKA 2JTVA 3GLXA 5IQHA 2VOPA 3C9WA 3UTOA 2XNMA 5I0BA 5BVWA 1DS5A 2F2EA 2ISYA 1OKZA 2P7VB 3F22A 4RBLA 3BOQA 4FV5A 3KMWA 3NIZA 2P5VA 3CS9A 4S30A 2I0HA 1G3NA 1PXLA 3FZOA 3KU2A 2F49A 2BILB 1YHVA 1XH7A 1IXSB 3P9IA 5DYMA 3PJ3A 3EIDA 3PY1A 2PUIA 1IG1A 1TVOA 2C6TA 3NDMA 2XYNA 3V8TA 4XCUA 4HOBA 1AOYA 4RB3C 4O3MA 4OBPA 2LNBA 2B55A 4DG3E 3RINA 4ANQA 5FQDC 4KUMA 4EJVA 4F0IA 4AWXB 1LEBA 4H0EA 4ASNA 4KN4X 4G34A 1M2RA 4OTGA 3BHUA 2QOHA 5I9XA 2L4MA 4JT3A 2P33A 3IOPA 2W24A 3EYHA 3JS2A 2MA3A 5HOOA 2Z2WA 2DYLA 5F1ZA 4HV5A 2FOKA 3SA0A 5F6FA 5ICCA 2J0KA 1MKMA 3MW1A 3AXWA 3QRTA 4U9AA 1FBUA 1V4RA 1Q8WA 4FA2A 5JT2A 3HHGA 4K11A 4EZ7A 2YSRA 3Q4ZA 4YTCA 5BVNA 3FZSA 1PYEA 3UZTA 3R71A 2QENA 4N0BA 2VTIA 4YLKA 1WZYA 5BNJA 1TNSA 2YIWA 4AT3A 3TACA 1W7PA 2BALA 2X4ZA 4R3PA 4CRSA 4U0IA 4QMOA 3QGWA 1V0OA 3B2TA 4FIJA 4EORA 2M45A 2ZMDA 2YABA 4APPA 2XAGA 3T1BA 2C5XA 2XRUA 4F08A 4GT3A 4GYGA 3FZTA 2KIUA 1R00A 4PTGA 3ZO2A 3MZHA 2G2FA 4FKTA 3K3IA 1PMNA 2GXGA 2VWWA 3AMAA 4G3CA 3O6BB 1PJKA 1FSHA 2ZV2A 3NEWA 3G9LX 4OTWA 1Q8TA 4DCAA 2JPCA 1Q8ZA 1V1KA 4LGDA 2ITTA 4I01A 2NNYA 5H9BA 5EYKA 2GU8A 3OWJA 4G17A 5BUEA 1IRFA 2W1GA 4MQ2A 3I5ZA 3B73A 4CFWA 4UNOA 3HV6A 4IDTA 3BKBA 5L8JA 3DZQA 3TKUA 4TWCA 2I0YA 4O0SA 2OLCA 1OPCA 1JLUE 3V5LA 4QQJA 4I23A 4OUCA 3V8JA 1Q3WA 4YPSA 3CKXA 2HCKA 1ND4A 4FV2A 2UW0A 4YJNA 5JKGA 4I5MA 4MF0A 5AA9A 2VC0A 3HRTA 2OO8X 2P5LC 2OA4A 3SV0A 3QD4A 2QO2A 3SQQA 3DTWA 3NRMA 2HTJA 3HRUA 2X0GA 4IAZA 3A60A 4WNPA 4IWDA 3WGIA 1OL7A 3GVUA 2C68A 3TKIA 4AZVA 5I9WA 3IDPA 1H9GA 3FHRA 2GQQA 4Y83A 3PXKA 4HZRA 3EN6A 2XRNA 4NHJA 3ZM9A 5H2UA 1RIOH 3SHEA 5D9HA 5BOXA 3C4XA 3RAHA 3ZYAA 4NJ3A 2JBPA 4JDKA 4HNIA 3UNKA 3PJ2A 1W8CA 3J81K 4IB3A 4NW6A 3PVUA 5HE3A 2EV6A 5AAEA 2JZYA 4RVTA 4DEBA 2V0DA 5DI1A 2QU5A 3U9NA 3E62A 3DPLC 3IW4A 2YM7A 2BAQA 3QKKA 3NW6A 3U87A 3W10A 2M87A 4C4JA 3HKOA 1OL5A 4C02A 2PZ5A 3PVGA 4Q2AA 4HYIA 3W2RA 1XGOA 4O2ZA 4EGYA 5HGIA 3VULA 4G9CA 4E4XA 2WMBA 2YWVA 2R9SA 3QX4A 4KSQA 4R3CA 3ORPA 3BHHA 3JR1A 2R3GA 3E8NA 4K9YA 4KBAA 3I79A 4O81A 5ANIA 4ZMEA 2OJ9A 5CU6A 1OZ1A 1URCA 1OUYA 3DGKA 1YS7A 1T98A 4KMFA 4B8XA 4H3BA 4FT8A 4M0ZA 5HG8A 2VE8A 5IEXA 1EH8A 1REPC 4BXUA 2HW6A 3OHTA 2UW3A 5KMMA 3QQGA 3NAXA 5DE2A 3LFAA 4R77A 5LCKA 3FMJA 4OR5A 2F7XE 1IZ1A 2R3IA 1OL6A 1HKTA 3FSKA 3O23A 3F6XA 2ETHA 3UE4A 4YZNA 1MZBA 3UVQA 3G51A 4X3JA 2C0IA 3O7LD 3DPKA 4UZHA 3RMFA 2F5DA 2X0LA 1R36A 1A04A 5L3CA 3QRJA 3CY3A 3UO5A 2DBBA 2VTOA 3GEZA 1T2KA 4FHTA 4HDVA 2W1DA 5ETIA 3PA3A 1MRVA 4KS7A 3EYIA 5CVJA 4G7OF 5K0XA 4DEGA 4MNEB 4AW1A 2E1NA 3QTRA 2IVUA 4AXAA 4YHTA 2PU8A 4IQ6A 2BIKB 5DBXA 5EYCA 1CM8A 3EL8A 2H34A 3F72A 3QZGA 4BCMA 2ZYBA 4TZRA 4BCOA 1UCRA 4KIPA 3UYTA 5L8LA 4CQGA 5KZIA 5D1JA 1BC8C 5DN3A 3LQQA 3W32A 4WA9A 4GKIA 3KP4A 4BWXA 1H1WA 5HTCA 3ULIA 3ULZA 3KXGA 2W9FB 4FTQA 2OH0E 4D55A 3PTGA 4U7DA 4F65A 2YAKA 2XGXA 5IT9Z 3P78A 2K4BA 3G6HA 4MQ1A 4EOJA 2ZDTA 1F5QA 3UO4A 4M9ZA 3QHRA 3PWDA 3SLSA 3GFIA 2EK5A 2R3JA 3HOTA 4W4YA 3FKNA 3VHKA 4IZYA 5AUXA 3EQRA 5J9LA 3OCTA 3U1DA 3BHYA 2UZWE 3R63A 4O83A 2BZKB 4GJ3A 3DQVC 2O0UA 2RFNA 4NEUA 4U0WA 4XV3A 2ITUA 2JAVA 5AM7A 1MQ4A 2QQ9A 4MXAA 1WVWA 4YTHA 3Q2MA 2IA0A 3RAIA 2HYGD 3P23A 3F3UA 2EFQA 3AC8A 1M2PA 3FDNA 3WU1B 4D5KA 5KE0A 2BZHB 1ZRZA 2RKUA 2XB7A 4L67A 3G15A 3D5WA 2BPMA 2R5TA 4FIGA 2CNVA 5EHOA 2L4AA 2PVKA 5HS8A 4LYNA 5HIDA 1QPCA 3DXQA 3KK9A 2HFHA 5EOLA 2QLQA 2YZLA 4BYIA 1MP8A 2SRCA 5KHWA 5EHLA 3MI9A 2X7OA 2W57A 4TWOA 3COMA 3WTUC 3P9CA 2XK3A 4YSJA 3LXPA 2BRNA 1OVEA 3EQFA 5D4SA 3ZMZA 5I9UA 2X9EA 2EU9A 2V1DA 3TN8A 4YO6A 5BYYA 3MFRA 1GIJA 5BVKA 4WK8F 2ZV9A 4J97A 4TYGA 3LFQA 3HRBA 5M08A 4FV9A 1PXMA 3QCXA 3PA4A 2VTMA 4ZZOA 3WTXC 1XJDA 1E17A 1M17A 1OPKA 4II5A 3NUYA 4E26A 3F82A 1H8FA 4MNEA 4NTSA 4W8EA 3PJ8A 3H3CA 5J7BA 3G73A 1H9TA 3R22A 3LQ8A 3CE3A 3I1AA 2OICA 3GCPA 3WG9A 4NM0A 4QPMA 4UALA 5DUIA 3G0EA 5GZ8A 2UZKA 4UV8A 5D4RA 4R5SA 1P4WA 1SMHA 3TGNA 3EZVA 2J5OA 3VUMA 3A7JA 5D6FA 3FPQA 5AUTA 3MH1A 2BFXA 4CYIA 3BEAA 3H9FA 2CN8A 4DLIA 1KA8A 1XCBA 5CI7A 4E8AA 1TQPA 4OTFA 1G6NA 3PG1A 2O8XA 4QOXA 3P86A 2PMNX 3S95A 3FXUA 4KMUX 2W4JA 5L3FA 2HWPA 1VTNC 2UZVA 1FBQA 3TL8A 3T3UA 4JS8A 3LLAA 3RPQA 3T3VA 1NVQA 1T38A 3MBLA 4PQNA 3BROA 2JAMA 5CVHA 3HDMA 3VS2A 3KP3A 4HGTA 3OF0A 3I4PA 1AWCA 2CCHA 3R2BA 4FE2A 1IA9A 2PPQA 5HLGA 4NFMA 2OSCA 4V05A 2PZIA 3DAEA 4O84A 3DFGA 3I7BA 1ZRFA 5HKMA 4ALVA 4XMOA 3RI4A 4I0TA 2YACA 2VTRA 3ELJA 4QMVA 1KU2A 3F2RA 4G94A 5DRBA 5IMXA 4DITA 3CTAA 1JXSA 1HCLA 2OK1A 3WF7A 1TW3A 4TYHB 2PULA 5AP2A 3ZMVA 3NW7A 3BJAA 3BWGA 4Q47A 1KE9A 3RWPA 4HVGA 4EJTA 4U7ZA 3FM3A 2EWNA 2CDZA 3RZFA 5EYDA 1OB3A 4UVBA 2WMRA 1WFCA 3R7IA 3VS6A 3VF8A 2I7QA 2R3QA 3OOMA 5HIEA 4CDGA 3EB0A 2HOEA 2KIFA 3E3VA 3F88A 4I2OA 3O96A 3VUKA 3W18A 4IHPA 3V8LA 5CENA 4EOMA 4Y95A 3E93A 4HPTE 4RG0A 5CLPA 4WNOA 4NM7A 1GZNA 3FY2A 4ANNA 1H07A 3LCKA 1PXPA 2QWWA 4UN0C 5JN2A 4QTBA 4FUYA 5FDXA 3VHEA 3N4MA 1IRGA 2JIIA 4EJ7A 3UGCA 4A0XA 2VGOA 2IA2A 1KGSA 4ZYDA 4FYOA 3OBJA 1J91A 4RWLA 3R02A 2VBXA 3NR9A 2ERKA 4Y13A 2UW8A 5AV0A 2CKOA 3QCSA 3LAUA 2UXNA 1GVJA 5J5SA 2BRMA 4Z55A 3F8CA 3QX2A 2DQLA 3VUGA 3ZSGA 4GW8A 4C35A 4FZAB 3CQWA 1W84A 3FXXA 2IP2A 4IE9A 4JQ7A 4I0AA 5A4TA 4E4NA 4Q9ZA 2JKKA 4ZSLA 1OIRA 3P7BA 2PUUA 5CSPA 1OITA 3QRFF 1IA8A 3EJ1A 3T8RA 4DBXA 5E1XA 3V7CA 1O3TA 4IDVA 4YJSA 2ITVA 4O27B 3WU0A 4BWKA 3H92A 4UHTA 5CEOA 2IRFG 2W1ZA 4M9XA 4BZOA 5HX6A 3GFLA 1FBNA 4Y15A 2YERA 5FEEA 1H24A 4ESBA 5D6EA 5D5XB 3BQRA 2JFLA 3AGLA 3EQDA 5C26A 3E6DA 2V62A 1PMVA 4IB5A 3F6OA 5BQTA 1WBNA 5K1YA 4NT4A 4S31A 3IW8A 2JGZA 2F5CA 4L5JA 2PE0A 4D2WA 4L18B 2XROA 5CF4A 3F21A 3WF8A 3CC6A 3CPCA 5J9ZA 3DBEA 2XH5A 3LQ5A 5IA3A 2ESNA 4LG0B 1OIQA 3IOKA 5CAUA 2XK7A 4J96A 4TYHA 4JIKA 5FLFA 4QYHA 3R8MA 2JDVA 5FTGA 5EKNA 2B9IA 2M30A 3P08A 4NIFB 2WQEA 1MJBA 3ANRA 3UYSA 4CZTA 5HNIX 3O0GA 4QP6A 3PXZA 2X8EA 3QYWA 5E8VA 2X39A 1RZ4A 2F2CB 4AT5A 3ZLWA 4U3YA 5ANKA 1IAWA 3EQIA 4L43A 4CRLA 4D0PA 2IJLA 2BV6A 1IUYA 1P14A 1KU7A 4YC8A 1PXIA 3C5IA 2XAHA 3LVPA 4P55A 2LSOA 4K77A 2GCDA 2ZV7A 4GCVA 4CT1A 2QHMA 1YOJA 2BZJA 4CZZA 1XH5A 2HK5A 3R0TA 1ZAOA 4OIQF 2WOUA 3D5UA 3KEXA 3K54A 4PL4A 3A2CA 4UXLA 1HW2A 5LARA 2CKEA 2VXZA 1ZYJA 4HV6A 4RWIA 4C57A 2E9UA 1O6KA 4F4PA 2WB8A 5ACBC 3GI3A 3IHUA 3E5QA 4M67A 3FMSA 3II5A 4MNFA 4FT3A 2Y6OA 5IZFA 4RX7A 3KMMA 4FKWA 4B4LA 4I4FA 4IEBA 3HYIA 4C37A 4XG9A 3FV8A 2FO0A 3DKOA 1JNKA 1V3FA 2XM9A 3IL2A 2ZMCA 1RNLA 1YLFA 4OGRA 2WMAA 3GNIB 3RPRA 3NNXA 3U54A 5J87A 3PP0A 5BPYA 4ENJA 4R1YA 2VU3A 4BQAA 4MTEA 4KIQA 3T8OA 2R3MA 2GMXA 4Z3VA 3QLFA 4YNOA 4DGNA 1DP7P 1H27A 4RIXA 1J7KA 4F6UA 4C4IA 4CNHA 4F1MA 1TQMA 5J79A 4MHAA 3VBTA 2CMWA 3AQVA 2XNEA 4PP7A 4EOLA 3SOAA 3FI2A 4TV7A 1BN5A 3MH0A 5DA3A 5LHHA 4MYGA 3AAFA 3R9NA 4P5ZA 4TNBA 5LLQA 4WO5A 4XV9A 5HLPA 3PG3A 4JAIA 1GZ8A 3WOWA 3DJ6A 4LUEA 4BHZA 3FMEA 1FQ1B 4QLCU 3FZVA 3O51A 3WZJA 3KF7A 3AC3A 2K4JA 2HWOA 4U44A 3AC1A 5EI8A 4LG0A 3BGPA 4G16A 2Z7QA 5IA1A 2HQRA 2WHBA 2R7IA 1ON2A 1SD5A 5DEQA 2IG7A 5EM8A 4AZEA 4ZSGA 4FSNA 3ZCLA 3ZH8A 3N4TA 2GIVA 1YWNA 4QQ5A 3ZU7A 3GCVA 4C2WA 1MQBA 3P7NA 3C1DA 3OBGA 1HCKA 2ITXA 2FEZA 4H1MA 3SG8A 2VE9A 3PFQA 2H27A 5GIPE 3HRCA 4A4XA 2A0CX 5ETAA 4O7LA 4FYNA 1YOMA 5HE1A 2ITWA 3R9OA 4EI4A 4GEOA 2W0JA 5JSMA 3S2WA 4GMYA 4EOQA 4CT2A 4RAZA 2XUUA 2RIOA 4IWPA 4QP1A 4ZLOA 5M07A 3ZLSA 4S04A 2VTTA 4YURA 3ZO4A 3GW2A 4DNCA 4L68A 5EFQA 2FE3A 3MEXA 3AD5A 2XVCA 4EJWA 4N4SA 3SX9A 2ZM4A 2O6GE 2K02A 3GGFA 4HQEA 3OROA 1QBJA 3DB8A 1WRJA 3WILA 3DBCA 1KE6A 1GIHA 2YLEA 2C5OA 2W5HA 5LHIA 3BZ3A 2DK8A 3PY3A 2A3SA 2X81A 4L44A 3N4VA 2PLYA 2DQRA 2W05A 2XIKA 3UVRA 1R0EA 5A6NA 4B7TA 4X6RA 4ZJVA 2PZPA 3QZHA 5AEPA 3PJ1A 3E5UA 3BCEA 4ZH4F 1S8NA 1VEBA 4AS0A 4LRJA 1DI9A 3DK7A 1PKGA 3TI1A 4OAUC 2ZMEB 5HD4A 3BPVA 2UZTA 4FT5A 3R0JA 2V79A 4RJ6A 1ZGJA 3W16A 3V5JA 5DGZA 5L3AA 4I6QA 1YW8A 4WUNA 4RB1A 5J8CA 3F8BA 4P2KA 3QWJA 1G3SA 5A3XA 3PXRA 1E9HA 5GJDA 4ANBA 4IMYA 4IX5A 3FBVA 2XKEA 3TTIA 5ANEA 1KOAA 3VS7A 5CU0A 3O8UA 4DINA 5E8SA 4M6XA 4FTNA 2E7WA 5AP5A 4R7HA 1H1QA 2Z99A 5BYLA 3JUHA 4OINF 3I0OA 4FSYA 4P5QA 2G9WA 2X4HA 1LQ1A 2GNIA 1OYWA 1YXUA 3PXFA 1B4AA 3HECA 4NH1A 3QC4A 1XN7A 2R7BA 5DT3A 3KLNA 1T46A 5EKOA 3ZFXA 5IG1A 5HBJA 5CEKA 3GQLA 3OT8A 5AMNA 4IAFA 4NYEA 3O17A 3H0YA 3QQFA 3CD3A 1JHFA 1VYZA 5A14A 5LGTA 4XRJA 5K3YA 1U5QA 4I22A 4EONA 1UHMA 4FTJA 4BCPA 2OFVA 3DFCB 1HQCA 4ENXA 4FVPA 1O6YA 4G3DA 4YJRA 5HG9A 2DS1A 2A68F 3RTRA 5CU3A 3IG7A 4TYJA 2AXLA 4OTPA 2OU2A 3OWPA 4X2NA 3GP0A 2WQNA 4CMUA 4S34A 1KV2A 4DTKA 2KJCA 4C59A 4QNYA 5GJFA 4IM2A 2BZIB 5TJJA 4I09A 4ZTHA 3OXZA 4IH8A 5HVYA 4L7SA 4HF1A 3COKA 5AP3A 3OCGA 1F0QA 1OYIA 4QTDA 4U0VA 4CV8A 4HLYA 3PXQA 3EZRA 4YP8A 4M69B 4AFJA 2DI3A 3LCTA 2Q0BA 3BDDA 2W1EA 3A7IA 4X7QA 3ZFMA 4XP3A 4C62A 1JOWB 4IB1A 2YPRA 3Q3BA 4O1PA 1BI1A 2GSFA 3BWFA 2KULA 2OBJA 3NUAA 3GFEA 1KE7A 1ZLKA 3VB2A 3ECOA 2XUBA 5K5QA 1USTA 4EHEA 3F3WA 2JC6A 1ZLJA 2VTQA 3I0TA 2P2IA 4BDDA 3ZLYA 1B9NA 1PW2A 3NLBA 1PUEE 1ZG5A 2F57A 2UVZA 2ZMEA 2J0IA 1CMKE 3R0AA 1PMUA 3CD8A 5DWRA 4QD6A 3WTTC 3TO7A 2FSLX 3CUQC 4IXAA 3DV8A 2JFMA 2WU7A 3FJQE 1UHWA 2WTEA 5EH0A 3NCGA 1EH7A 4CD0A 1YO5C 3E8EA 4LB6B 4LFIA 1B1BA 1R7JA 4YNEA 2BRGA 1YVJA 4OAVB 2YX7A 3GC0A 3HNGA 4V0GA 4XS2A 3ROYA 4TT7A 2UW5A 5CALA 4CGAA 4MEXF 3TCPA 2WXVA 1YWVA 4DFUA 5AR5A 3B2WA 3EYYA 1NA7A 1R1TA 4DH1A 4AD9A 3J81Z 2R3SA 4EJOA 2EB3A 4APCA 4U88A 2IVMA 2X6DA 4I21A 3TDWA 2YISA 4CVAA 4ZZDA 3BJOA 2ESMA 5IQAA 4BN1A 3OP5A 1I6XA 3HSEA 5JFXA 3V51A 4V01A 1CSNA 1UKIA 2OZ6A 4JR3A 1QZZA 3CIKA 1FMKA 1U3EM 3HUCA 1XH4A 1BLXA 1H1PA 4U40A 4XLVA 1FT9A 2PWLA 2DUVA 3A62A 4NJDA 2JPBA 2V5QA 1NW1A 3PSBA 3W1FA 3E7VA 3UQGA 4AUAA 1ZRCA 5CNNA 2WD1A 3I54A 2YCRA 4QMMA 2A1AB 3KVWA 4LMUA 2A69F 2ETKA 2QM3A 4D2RA 4G2FA 3QCQA 1P5EA 2XIYA 3BI6A 4A9SA 5DT4A 5TR6A 2ZXJA 4RFZA 2ITOA 2WTVA 4KB8A 3LXLA 1LEWA 2P8TA 4L9JA 1OKWA 1PRYA 2F2UA 2WU6A 4LGWA 3GU8A 2ETMA 4F6SA 3W2CA 1WQ2A 2WIHA 3WIGA 2M8EA 2IW5A 4GIIA 3DFAA 1Y8GA 4BWPA 5K5XA 3BZ6A 1H08A 5GINE 3CO6C 5HICA 2EB7A 2VX0A 4O38A 3A99A 5FD6A 4M69A 3OVVA 3K1MA 4X3FC 1ZLTA 3KXHA 2VWUA 3DOGA 2XBJA 3LM0A 3F2AA 4FK3A 3OFMA 3DJ7A 2BKKA 5GZ9A 3R28A 3HHHA 2EJRA 4FTKA 2YZAA 2XVDA 2UVXA 3FWEA 2QR7A 2BHEA 5IQCA 2TDXA 4FL3A 3VRYA 3P7CA 4PL5A 3MTLA 2XNPA 1U5TC 4O6JA 2J2IB 3OD6X 4E4LA 3D9VA 4ANMA 3C7JA 4UVCA 3Q9XA 2EFNA 4L3LA 2L54A 3DBQA 1XHAA 4IWOA 1YQAA 3ZUTA 2A2AA 5FRIA 4TWPA 2OBPA 5CVIA 3VBQA 4JRNA 4MK0A 2ZFWA 3POZA 4Q4ZF 5CANA 3PVWA 3HRSA 2H8HA 4AZSA 5E7RA 2IVSA 4KKGA 3GCSA 3NYVA 3OY1A 4LM5A 5M4IA 4FIEA 1LB2A 3IW6A 3JPVA 4ZY5A 3RTPA 5E8UA 5JHUA 2A5YB 5FD2A 3SDJA 2JEDA 5E90A 3PRFA 4I94A 1J1CA 3QXOA 2XS0A 3KZZA 1B39A 3AC5A 3PRIA 3VIDA 4ZY6A 2DPUA 3KMUA 2BR1A 2V22A 4D4YA 5C4KA 5EYMA 3TDZC 2FBKA 2G01A 2YA9A 4CG8A 3A61A 2RDPA 4ZLYA 3FWQA 2P7CB 4MBLA 4HDUA 3D2IA 3Q32A 3D83A 5LVPA 3DA6A 3PE1A 4RIYB 2E9NA 2QOLA 4GUEA 4PMMA 1UU9A 3NMUF 2HW7A 4WBBB 3LFNA 3QA8A 4O0YA 4I24A 2KJBA 3WE8A 2OD5A 1OL1A 3T8TA 3TO9A 3DS6A 3CUQB 3N97A 4BTKA 1BI3A 4BYYA 1NT2A 4K8AA 4OLIA 4BDGA 4M14A 1KYWA 3S1HA 3AD4A 1BI7A 2HZTA 4EYMA 4PUZA 3PLSA 4P4CA 2BDFA 3PYYA 3NS9A 4WRSA 4FOBA 4PTEA 4MTAA 3IRQA 2OZUA 4MTDA 1JHHA 4QMYA 3KFWX 4KNYA 4FKUA 3J80K 4H05A 4IJ9A 4AW5A 4TW9A 1OECA 5BYZA 5JQ8A 4E4MA 3LE6A 4ZS4A 1LP4A 2C0OA 4ACHA 3FXZA 4HW0A 3WTYC 5J8IA 2OJFE 4G6QA 5F1RA 2CPKE 4IFCA 3RPUA 4JDHA 2XJ0A 3I71A 4JBAA 4JBVA 3E5AA 3ATSA 3H4JA 1BC7C 3U4UA 5IEVA 2NO3A 1RE8A 5DDGA 4IZ5A 3FQSA 4RX8A 3KEQA 4IAKA 2PVYA 5AUZA 3KREA 5FG8A 3LXKA 3CDHA 2ITQA 3WTSC 2ITPA 4U43A 4JR7A 1W7HA 2CG4A 4FV8A 3GF2A 2Y0MA 1Y91A 2W1HA 3Q5IA 1FSEA 1WCCA 4A4OA 4CTCA 3ZOSA 3FLNC 3FPMA 3JY9A 5B0XA 3L8PA 3DDPA 4KN7X 2BMCA 4RJ8A 2YM8A 5EW8A 2WTJA 4USDA 4X3FB 5CI6A 4KINA 3GOKA 3MFTA 5H6QA 2R7FA 4D2PA 3S2PA 2ZB1A 1OR7A 1WBTA 1XBCA 2XNNA 3IS5A 4XLIA 2ZBKA 5EQEA 3FF5A 3OCBA 4O21A 2PFBA 3BU3A 3RCDA 3ZSIA 4CFVA 3PA5A 1U5TB 3O3KA 5CAVA 1XH8A 3V6RA 3ERED 5DH3A 5L3BA 4FTTA 2A27A 2XKPA 4RIYA 4HOKA 2OJJA 4PNIA 2BUJA 2V55A 5E8TA 5ICGA 4BIDA 3SFZA 2B53A 3S4QA 4GU9A 5CY3A 4Z9LA 5D12A 3TO6A 3W8LA 2BFYA 4MX9A 4DBNA 1QCFA 4OIOF 4RC4A 3CUQA 4FT9A 3MAJA 3R8ZA 3MA3A 5LMKC 4F7LA 4AA4A 5CEQA 3TXOA 3VBYA 2P2HA 3TKYA 5C8NA 2C6DA 4I7HA 4UMTA 1J1BA 3I60A 4L0ZB 3VNTA 5ANDA 3R7OA 2R3KA 3Q9ZA 3CUOA 5JRSA 3QPTA 4KA4A 4UUVA 2B9FA 5M4CA 4FGBA 4EK4A 3GQIA 2DPDA 4L01A 3ZQ7A 5AIPA 4FEUA 1W4MA 3RGFA 4EM1A 3NVKI 4RC2A 4MWIA 5J1VA 1JQHA 1TTYA 4R5YA 4OTDA 4DQ2A 4RGRA 1XSVA 4L3JA 5HO6A 3MZYA 3NNUA 5AP7A 3ALOA 3M11A 3H3ZA 2AC3A 4BCHA 4XHKB 5L3GA 1YW9A 3AD6A 5IQDA 4R1HA 5KMIA 3TZMA 5FP5A 3R9RA 5HO7A 4O96A 4E70A 3B02A 4A5MA 2ZVAA 4BIEA 4UXNA 1B59A 4EOSA 5AWMA 2O3FA 3QZIA 3JW4A 3MPTA 3FMRA 5AJQA 2COMA 1G5SA 5AONA 1Q8UA 2MH9A 3FLQA 1TKIA 4L0YB 2OFUA 1BMKA 4I6HA 3PZHA 3ORLA 5I9YA 4HX4A 4F9BA 1KE5A 4IB0A 3NW5A 4AT4A 1W83A 5HVQC 5H20A 2CWEA 4LJZF 4J8MA 4MEYF 3CTQA 1XCVA 4E5BA 4LRKA 1MJAA 4RIOA 4X2FA 5IQIA 3V4GA 4ACDA 4HW7A 1O7FA 4X3FA 4WHZA 5I9ZA 3QTSA 1L8TA 5JFRA 3ZSHA 4E6AA 3EMGA 3UZRA 2RG6A 2RVCA 4WXCA 3QTIA 3NWWA 3BLRA 5C01A 5LMAA 3UP7A 4E20A 4QYYA 1LUFA 3V5TA 1U5RA 1U5TA 1SFEA 3D5LA 4I0SA 3AT4A 4U7BA 3L7WA 2YHVA 3WBLA 3DZOA 4OTQA 3HV7A 3ZP5A 4BDJA 5M57A 4HCUA 2FBIA 2VC1A 4DFXE 3ISPA 5DIAA 3BPRA 2BHHA 3SXRA 2Y9QA 1IN5A 3G3ZA 4WD5A 4KRDA 3E3BX 3CO7C 4BFMA 2C5NA 3WGGA 1P4FA 4FV3A 2A4LA 2QNJA 5C4LA 2H96A 3L09A 4BY9E 3KA0A 2OAZA 4O7ZA 4FKIA 3R8LA 1U54B 5BVDA 3I4BA 5GHVA 3I6UA 1H25A 4O7VA 5K5OA 4I98B 1WSUA 4MEDA 3RVGA 3ACJA 3L1SA 4NTTA 3MWMA 4UXQA 4H58A 4L8MA 2DW4A 4HVDA 2GA1A 1H00A 1XH9A 4RFMA 3CY2A 3L9LA 2GHGA 3WF5A 4USEA 3RJPA 3QQHA 3U2RA 5FTOA 3GU7A 2ITZA 4J52A 3DNEA 4U42A 3UOHA 3GWZA 2F5FA 3EFWA 2L02A 3ZMUA 5CEPA 4FZDB 5DUKA 4AW0A 5LVMA 3SVVA 4FNYA 4RQKA 2Y75A 4MQVA 4F9YA 4FKGA 3PP1A 4RFYA 3ZXTA 1O9UA 1KU9A 4EH7A 4BCJA 4EBVA 3EQHA 3HZTA 2EFOA 2ITYA 2R0UA 4R7IA 4Z7GA 5L2QA 5C8KA 2OH4A 2VONA 2GQRA 2UZNA 4DGMA 3WTZA 4KD1A 2VV9A 3F2NA 3KK8A 4DFZE 3SXFA 5A4LA 3BE2A 1Q41A 3RI1A 1PP8F 4O82A 3FC2A 1FC3A 4M3QA 3R7VA 3CPBA 4CKRA 3ENHA 3WZDA 3MWUA 2ONLA 3HX4A 5FWKK 5DD8A 2FSWA 5AIKA 1RDQE 2ZJ2A 4JL9A 4GFMA 3RKYA 1Y6AA 4O7RA 3BLQA 5AIRA 4HGEA 4LV5A 2X1NA 4QYEA 3UC3A 4W4VA 2ZDUA 4HYUA 3OG7A 3K2ZA 2Z9OA 3QD2B 4GO1A 4U97A 2EA4A 4R8HA 4GV1A 3C0HA 3QWKA 3QXPA 4D58A 4LOOA 3BYVA 2J0LA 4BZDA 4PMTA 4IAIA 1F1ZA 4Q5SF 1RW8A 5AUYA 2BGCA 5KK1A 3OTVA 3TZ7A 2YN8A 2QU6A 2PMUA 3DLSA 1FP1D 3RWQA 1ZY4A 5M4FA 4OT6A 1OMIA 3P5KA 2PSQA 5AR8A 1U54A 4FKRA 4WCGA 3QTXA 4QT1A 4BDBA 2ZM3A 3LQRA 2X2KA 4J53A 2QQAA 4XRLA 3KN5A 3DLZA 4N6ZA 1NY3A 5H8BA 2FMLA 4R7BA 3KY2A 4AE9A 5LRSA 4XX9A 2IZUA 2IN6A 1ZH5A 4XYFA 2EFWA 3TUBA 2YM3A 2VRXA 4FT7A 2VNWA 3FX3A 3E97A 2PMOX 2X2MA 3DKFA 3VODA 3ORKA 1K79A 3TIZA 4CYDA 4NZWB 2O64A 4JDJA 4O0XA 4N9IA 4JX3A 4EH5A 3Q5FA 2UVYA 4WWCA 4F7NA 3E5XA 2EVAA 1QL6A 5FTQA 3LQ3A 4J98A 3A4OX 2VWXA 3MS9A 5LMKA 2O03A 2HZ0A 5B7VA 5LHGA 3SKCA 4WSYA 1PDNC 5JZNA 2XMYA 4BDKA 2IVTA 1BOAA 4AGCA 3TOAA 4F09A 3UVPA 3CSVA 4OMYA 5T6KA 1H26A 2GTNA 4IF4A 3KULB 5C27A 4FG8A 3FMKA 4AQCA 1CKIA 3LW0A 3UIXA 2PVNA 2STWA 4I41A 3NYXA 2UW6A 4RSSA 5L6OA 4MBIA 2FYSA 5CVRA 4JI9A 5T3QA 4FG7A 3DBDA 3BBTB 3GU4A 3BU6A 5FXQA 4IZAA 4X6QC 2HY81 1XGMA 1PXJA 2VO6A 2ESHA 5CVUA 3ITZA 1YI4A 3R21A 3RDIA 1BL6A 3KCKA 2JRTA 1O3SA 1VYWA 5DCFA 1YTYA 2NYXA 4ASXA 3OW4A 1F4KA 2UZOA 2FH9A 2P6SA 3ROUA 3HSFA 2GAUA 1FGIA 3LCOA 4TYIA 5J1WA 3EN4A 3PDTA 4DCEA 4UWYA 4NFNA 4J1RA 3HMIA 4KS8A 2GPHA 3ZHPC 3CGOA 4C7TA 4A9UA 2BVAA 4HCVA 1TNTA 2BROA 4GFGA 2GNJA 2JDSA 4ZY4A 4YPDA 5HLIA 3N51A 4NWMA 3VWAA 5CZIA 2FA5A 4ASDA 4MXOA 3LMIA 2EWAA 4I92A 3KVXA 3BHVA 1Z5MA 3TNWA 1FX7A 5CVFA 4NKSA 3GU5A 5F95A 5IA2A 3R8PA 3KKVA 2YDIA 3AOXA 1ZOEA 2CFXA 3FL4A 3ZS5A 3RM7A 5AV2A 4AGUA 4CKIA 3O2MA 4RB0A 1BUHA 4ZSJA 5CT7A 1H0VA 5DFPA 4OIRF 3CTHA 4XOYA 5HS7A 2PK9A 1QGPA 3ZPLA 3I7CA 3RAWA 1Z6RA 4ESJA 3BYUA 4O6LA 4RVMA 5LGNA 3FXRA 1XMKA 3MJ2A 3QC9A 3TNIA 5IQGA 3DTCA 2ZNZA 2YU3A 1HKSA 5BUIA 2XZSA 3WYYA 4UMRA 4JRVA 2Y6MA 3JSOA 3HDNA 2KRFA 2O65A 1IN4A 2J50A 3TDVA 4DHFA 2OJIA 4L53A 2WEIA 2VWYA 2IPQX 2DU9A 5HZNA 2ERZE 4EWHA 4EV0A 1MGTA 1URWA 5ANOA 1LJ9A 4BGQA 4A6DA 3QLGA 4KIGA 2VWIA 5DPVA 1XWSA 5EDPA 4NUSA 4FK6A 3KULA 4E6CA 3KP2A 5IQEA 3R6XA 5EM5A 4DE4A 4V04A 4FL1A 1TQIA 3RPVA 3MIAA 1R58A 2EUFB 5KCVA 4EOOA 3OY3A 4AZFA 4ALUA 4A4LA 3A7GA 1R5HA 3ZO1A 2GNLA 4BDEA 5CVVA 3QQKA 2YWPA 4FL2A 5F94A 4TN6A 1WBPA 3BIZA 2QOFA 4GGGA 4HZFA 3RJCA 4A0YA 2C6IA 4IVBA 4A5NA 1W82A 3FAAA 4O7NA 4ENMA 5FFXA 3CLOA 4TKSA 4DGLC 3LAJA 3FMDA 4OIPF 4PDYA 4NL0A 4YC3A 3H9OA 5E1SA 2HELA 3GXOA 3IRRA 1Y0UA 1L3LA 4AE6A 2EXMA 4BCIA 3PIYA 2F7EE 4PDSA 5A2QK 4CLJA 3Q4CA 5KKRC 3F3ZA 2W7XA 4LFUA 5E8GA 3ZEWA 2B0LA 3P0MA 3W2PA 1YIOA 3ELKA 1R1WA 3PPJA 1D8JA 4AG8A 3K3JA 4EH2A 3UP2A 4ESFA 2K7LA 1G3WA 3PIXA 1Z9XA 5FUTA 1HOWA 5KNJA 2JT1A 1SNUA 1MD0A 3CQUA 3K5UA 3UODA 2OIQA 4H1JA 4N0SA 5E8IA 3GUBA 5D41A 3F6VA 5AX3A 2C30A 1EH4A 1W0XC 3SW7A 3HV5A 4LUDA 2WEVA 3HA6A 4BCNA 3KP7A 4FZ6A 3MH3A 3W33A 4G6DA 2W4KA 2XBAA 4RZWA 2M1BA 4YJUA 4W9WA 3QYZA 3KETA 2LAVA 1ODDA 3VVHA 2Y0AA 4KKHA 4IVCA 1G3TA 2C3JA 4UEUA 1SZMA 4GUBA 4Q5HA 3ZN1A 4DG2E 3L9PA 3ZZEA 1R0PA 4OU0A 5HIBA 5M55A 1T6SA 3C4CA 4ENKA 1RUOA 1FVRA 4GFOA 4FI1A 4CYJA 4DH8A 3FZRA 5HU9A 3VQHA 2C69A 3CJNA 5L2TA 3QF9A 3VJNA 3WZKA 4HYSA 2PUPA 1Z7UA 3KGAA 4RGXA 1OI9A 2QG7A 3F61A 3MB7A 4XNEA 2C1AA 4AW2A 2GNGA 1D8KA 3WYXA 3QCYA 1SMTA 4L9IA 5H6RA 4IWQA 3KRRA 3G90X 1S7AA 3NGAA 2BIYA 2A19B 3EQPA 4RGSA 1KE8A 1KQ9A 4K1BA 3R7UA 1Q5KA 2Z8CA 4FSRA 2VT3A 1T45A 5JFSA 1OYYA 4Y46A 4HAMA 4BBMA 3UIBA 2YM4A 4MAOA 4JG6A 2QODA 2AC5A 4FIHA 4TXCA 4UWBA 1P6RA 3NVMB 4FICA 4ZSAA 4A2UA 3HMMA 3V7SA 3TWJA 3NZ0A 2K27A 3HSRA 2X2LA 3LJ0A 4OT5A 4BL1A 4WBOA 1BM9A 2Q0NA 4C4EA 4AX8A 1OBGA 3CP9A 3E7OA 1U2WA 3EQBA 4A9RA 1XMAA 4AU8A 3QALE 2QLZA 3CGFA 4UV9A 2X4FA 3EUHA 2EB2A 4KWPA 2Q83A 1JKSA 5M51A 2YIYA 1EH6A 1H0WA 2XCHA 3R8UA 3MESA 3TTJA 2WMQA 5E17F 4YHJA 1J0RA 3ZTXA 2Q0OA 2A61A 5H3QA 2NNWB 4QP9A 3B8RA 1L0OC 4RPVA 1KQ0A 4WIHA 4IPAA 3COIA 2PQ8A 5I5ZA 3FXQA 4DGGA 3ZDIA 1XGSA 3VC4A 3ZMMA 4IJPA 3FZPA 2WAJA 3PQJA 1OPLA 5CNOA 3PFIA 1ZYSA 1LR4A 2V7OA 4EHGA 4GT5A 2UV2A 3FMLA 1ZXEA 3F5GA 2QUFA 4KIFA 4LB5A 4IHSA 3EFKA 4FBXA 3QTWA 2J6MA 4S33A 3T0YA 4BVUA 3GCQA 4FR4A 4EQQA 5KKRB 3MYGA 2GS2A 3MFUA 1M7NA 4QTCA 1UFMA 5TOZA 3BY6A 4BDAA 3GX4X 4QYGA 1P2FA 2P0CA 2PG4A 4EKLA 3MY5A 4AGDA 4YR8A 2UWMA 4IM0A 3CJFA 4XG8A 4TY1A 5AR7A 4KBKA 4MXCA 3VO3A 5CYIA 2OQRA 3ODYX 2PEXA 1YS6A 3OC1A 4D9TA 3J80Z 4ZOGA 3LJ1A 2RNJA 5I4NA 4YLLA 3RKWA 4FEXA 5IA5A 2Z3YA 1WAKA 4EC9A 4H3PA 1RJBA 5FLXK 2QKRA 3FL5A 4IX4A 3K69A 4BRXA 1YFHA 1ZYRF 2C6LA 2E1CA 3O7LB 3NPCA 2PVLA 5B2LA 4LMNA 5E8WA 1IXCA 5L3EA 5EQPA 2R3NA 4A12A 2JKQA 4K2EA 3RNYA 1X3UA 1CGPA 1XH6A 3JY0A 3AC4A 4I0RA 1B6CB 5AM6A 4FG9A 4IADA 4AP7A 4WSQA 4E1ZA 1QQIA 1VR2A 2XA4A 4ORKA 4YJVA 2D2WA 3VBWA 2XIRA 4DLJA 1JKKA 3R7YA 1FYLA 4AN3A 4WNKA 2H9VA 5EM7A 4I3ZA 3KC3A 2Z7LA 3OMVA 1DPRA 3ODZX 4M71A 3ZEPA 2GWRA 3UNJA 1YKRA 4D2VA 4BDFA 1JKTA 4BR3A 2A6HF 4XBUA 5D10A 3HLLA 1ZARA 4YTFA 1QZYA 3K1PA 3QUDA 5CSWA 3R7GA 3UNZA 3JXWA 3TNPC 5ITAA 3I59B 4S32A 4K6ZA 2NP8A 4CICA 3HA8A 2BAJA 5DD4A 1HSJA 2HTSA 2QHNA 3BEGA 3V8KA 3HGKA 4ZYEA 2V1XA 4XH6A 1KUTA 5A9UA 1FGKA 3KXMA 4GK3A 4WXDA 3QTUA 1DDNA 3FLWA 3E88A 5M09A 4M8TA 3SXSA 4FIFA 3VN9A 3IDBA 3LHJA 2EV0A 4EK5A 5L8KA 2E9VA 1W7PD 4BCFA 2OF4A 3ZMTA 5DT0A 3OWKA 1ZMUA 4YZBA 1J9IA 4RX9A 3TUDA 4G5JA 5FGKA 2NRUA 4KBCA 5DR6A 1TLHB 4ZAUA 4RWJA 1YOLA 3F23A 2XF0A 2CGUA 2YIQA 2AUHA 3FZ1A 2X8DA 2PBIA 1P4XA 5IA4A 3P4KA 2EA2A 3Q6UA 2WQOA 2GHLA 3ET7A 4IC7A 1BKXA 4M72A 2XNOA 3PE2A 6PAXA 1AD5A 3G5DA 4Y17A 3RNIA 4MHGA 2HIWA 4AWIA 3IKTA 1KQ8A 4O0VA 1UNHA 3QU0A 1JE8A 1EV7A 1Z6TA 3VW6A 3HEGA 5HVKA 4R1VA 2VWBA 5CQWA 4BHNA 5HVJA 4FTIA 2IPXA 5LEKA 5M56A 4OBOA 5E4HA 2FRHA 2H6CA 2LF8A 4ARKA 5DR2A 5HD7A 3WF9A 1SYKA 2QCSA 2VAGA 3ZBFA 3ORMA 4HYHA 3V5WA 2OIDA 5CVGA 1QO0D 2CGVA 5K4IA 2C6OA 5K5RA 2C6KA 2JLDA 5EM6A 2VO0A 4Q48A 4WG5A 1SVEA 4R3RA 1YI6A 1M14A 1Q3DA 1F3MC 3EKKA 4MH7A 1YHSA 3SOCA 4EM0B 1SD4A 1J7UA 4RJ3A 5K9IA 5A6OA 5L6PA 3OOGA 5HX8A 3LZBA 2VX3A 2FGIA 4K33A 2W96B 2WQBA 4MXZA 4BTJA 3FQEA 2FMYA 1BI2A 4L9TA 1SVGA 3EQCA 5E9EA 3I59A 1UVRA 1YXTA 3T9TA 2P5KA 4FV0A 3EQLF 4L42A 4RAYA 5DCMB 5AUUA 2F7ZE 3ZRKA 4LI5A 1SFUA 2V7AA 5E1WA 1R1VA 1FY7A 1YWRA 3P1AA 4FKJA 3IW7A 3FMNA 3ZMDA 4RIXB 4YHFA 2WTCA 1SFXA 1V0PA 4AAAA 1R22A 4FSZA 2FB8A 4FT0A 4C4HA 4NK9A 5DRDA 2VODA 4IC8A 1Z57A 2C3KA 4O86A 3IO7A 3NUSA 1BJAA 1MDMB 4D1ZA 2G2HA 4B9DA 4DG0E 2XP2A 3WE4A 3AGMA 2FSTX 5IU2A 4FZFB 2ZO4A 1UA2A 2B4SB 2VO3A 2BYVE 1Q8YA 4KKEA 2OZAB 4JG8A 3DKCA 3I5NA 3C3WA 3QP5A 2PZYA 4FTCA 4FEVA 3HTUA 1U6GA 2P4IA 3VS1A 3COHA 2CLQA 3UBDA 4DGOA 1IN6A 4YSMA 1UWHA 1K6OA 3U9GA 4J99A 5EDRA 4BZNA 5E20A 5CJ9A 1ZOHA 5CS6A 4HZSA 4F0FA 3R2YA 4KAOA 4JJRA 5CAOA 2H6BA 5J7HA 4PCQA 4ID7A 2W1IA 5AP6A 2GFCA 2OXDA 5EK7A 4YZDA 3VEPA 3C18A 3CCNA 2UZDA 4KICA 2UW9A 3VBXA 5F20A 5HLNA 4YFXF 1FBSA 3S0OA 1ZMVA 3BV2A 2QBYB 5GZAA 1IW7F 1Q4LA 3A4PA 2R3FA 4M6YA 1F5TA 4UY9A 4YFKF 2WFYA 5G6VA 3CBLA 3QTQA 5IPJA 2G7UA 4O5VA 5ERIA 1DUXC 3V3VA 2UZBA 4E6QA 1J3HA 1YDTE 3ORXA 1G3YA 4YUQA 2XKFA 4DYMA 2XAQA 4PF4A 3BX5A 1ZHFA 4JAJA 3V04A 3Q96A 4FSQA 1ERKA 1A48A 4ANOA 2OG8A 3LCSA 3QUEA 3WF6A 3FHIA 3QFVA 3LWFA 3ZZWA 5AX9A 4BH9A 2JDOA 4YU2A 3SW4A 1Q99A 5EI2A 4O7SA 1LVAA 4M7IA 1UWJA 4XG2A 5CASA 2WIPA 4BCGA 2G7HA 4YIIA 4ITHA 3RIRA 4BKZA 2UUEA 3AG9A 4K0YA 2CGPA 1TW2A 4UV0A 4IVAA 4XJ0A 5DCMA 4O7TA 4RX5A 4I0BA 4GCJA 3OT3A 1WI9A 4C58A 4D1XA 4ERKA 4P9UA 1OM1A 1V0BA 3Q9SA 4RJ7A 3IC7A 2ZNYA 3TJDA 4ZTNA 5D7VA 2VTNA 2PY3A 2PN6A 4AN9A 5LXMA 3U55A 1NVRA 5IA0A 3DT1A 3AMYA 3IDCA 2LF7A 4L45A 4BF2A 1MDMA 2MH2A 4FGRA 4CFNA 3SG9A 5JR3A 1MJ9A 4FX0A 3EETA 3PIZA 4DT9A 1OKYA 2VOOA 3UO6A 3JAMK 3UIUA 3TNQB 2OZAA 3WTWC 4XP2A 5TT7A 2IZTA 5KX8A 5K5NA 4JBQA 1OUKA 4IANA 2Y8OA 4QPSA 2O61A 4BDHA 4FTAA 2HZIA 4JQEA 3NNWA 1JPAA 1ON1A 4C3PA 1JSUA 1ZOGA 5CZHA 1DAWA 3DB6A 2YX4A 2QOBA 3BWJA 4F0GA 1YI3A 5AR2A 3ZRMA 3MPAA 2QOIA 3ZXZA 2H94A 3GBZA 3ZLXA 3HMNA 1GY3A 4J8NA 4EL9A 5CTPA 3UQCA 4PV0A 2WGJA 4CSVA 3D0SA 3GZ5A 3GB2A 3DKWA 5BS6A 2EFPA 2HEOA 3ZM4A 3VUHA 3QP6A 4EJUA 2QBYA 5HLWA 4FKLA 1OIYA 1BX6A 4MQ9F 5FBOA 4IW0A 1IN7A 5E1ZB 4YJQA 3DXJF 3JYAA 4BTMA 2JSCA 4EK3A 4CCBA 4FV1A 4BIBA 2JD5A 4IVDA 3F8NA 5DHJA 5EEHA 4XOZA 4O2PA 4ZK5A 4LD5A 4HYEA 4BTFA 2XHKA 3EH9A 3F8FA 2J0JA 3NUNA 1PP7U 2WPAA 2C3LA 4YC6A 2FU4A 4IX6A 4L00A 1U4DA 2CGWA 2G2IA 2I40A 4RLLA 3VF9A 4ASEA 5D8KB 2VZ6A 4O7YA 2GA2A 1XO2B 2ACXA 2OU7A 3M1EA 5KO1A 3BLHA 5IQBA 2UW4A 3PPZA 4L9NA 3LFSA 3D15A 1P2AA 2ITNA 1HBXG 4FUXA 3J7AO 5EHYA 3PLAE 2ZJWA 3LPBA 4E73A 3AT2A 2Q2EA 2UZUE 4O6EA 4DC2A 4XLPF 3ZUUA 3BU5A 5KMKA 4LLNA 4J71A 2QOCA 3DAJA 5BVFA 5HTBA 3DDQA 4TYEA 3V7RA 1UV5A 2B0QA 4PGHA 4D0WA 4GK2A 1USSA 3QBNA 3S00A 3KB7A 3T5XA 2DWBA 5AV1A 1KWPA 3PXYA 3C51A 1JSTA 5ETCA 2XM8A 4QO9A 3R9HA 4TTHB 4RC3A 3Q60A 3L8VA 4I4EA 5IT3A 4PP9A 3L9MA 3Q9WA 3LSTA 3QOPA 3QUPA 4V0GB 3D94A 4FKOA 2Z60A 4GXOA 4HPUE 4YTIA 3CEKA 3GEQA 4BICA 2QOQA 2YM6A 3DKGA 4D4VA 2PVRA 4ITIA 4IM3A 5F9EA 3CTJA 2WO6A 2WTWA 4GL9A 2XEZA 4NM5A 1KSWA 3IECA 3LFEA 5HG7A 5AR4A 2R3RA 1GIIA 4PX6A 1O57A 3I58A 4G3GA 5TKDA 3IONA 4L46A 5I3RA 4W8DA 4FSUA 4EOKA 3FQHA 2XIZA 4TWNA 4J7BA 4GVJA 5LVNA 2NRAC 2PHKA 3ZFYA 4O91A 2XJ1A 3PUPA 1OKVA 4CZYB 5EQYA 2RSVA 4QP2A 1Z91A 1WMKA 3G6GA 3GXLA 1H28A 3DQWA 2Z02A 4BYJA 3F3TA 3FMMA 2QLUA 4P9FA 3HOSA 2J9MA 2YM5A 2FBHA 4EUTA 3R30A 4QMUA 3RPOA 2C3IB 5HHWA 4HLXA 2UXXA 4N70A 3LJ2A 2W5BA 5DLSA 1UNGA 2K86A 1PYXA 5FXRA 2FQ3A 5HOAA 4TPTA 3KLOA 2XNGA 4ZS0A 3OWLA 3KXZA 2ZCWA 3AMBA 3HYHA 2JDTA 1YXVA 4RRVA 4EH8A 3DF8A 4QQTA 4WNMA 2YFXA 3SHFA 1QNTA 1LNWA 2VN2A 1R3CA 3TKHA 3SXYA 5FM2A 4EOIA 1IAHA 3BJ6A 5KMLA 1VJYA 4BBEA 2JIVA 4PMSA 1R5GA 3SZPA 3E8CA 1HXDA 5KBRA 2WOTA 4BKJA 3LFDA 3ORZA 2G15A 4KA3A 1PY5A 4FKPA 3PVBA 2XJ2A 4MF1A 2OW3A 5KVRA 4MXXA 1Y57A 5JI6A 3LCDA 2HYFA 2W99B 1FYKA 2Z33A 4CGZA 1FOTA 4FVQA 4YZMA 1RQQA 2R64A 2MC3A 2BEOA 4ZIMA 5A2QZ 5LGUA 1Q62A 2J5FA 3R61A 2IA1A 3Q2JA 4PY1A 3R8VA 5BMSA 2OWBA 1F9NA 2B54A 2JKOA 1U8RA 3KP6A 2BDJA 5J6XA 4G5PA 2QQBA 5AP0A 1E2XA 2MD5A 1U46A 4U6RA 1Q24A 3P9KA 3NCZA 5LOHA 4A06A 5BQ0A 4HCTA 3UPZA 2WKMA 4PGGA 4W4XA 3D4QA 2QZ8A 3D7TB 2C1BA 2JIUA 4FV7A 1XR1A 4BKYA 1W5TA 3WE2A 3KRLA 3R1NA 2R2PA 4JK1X 4QMNA 5BMZA 4M13A 3DQXA 1C0WA 3KP5A 2UZEA 3UOKA 1H0MA 3L9FA 2I0VA 4Q9SA 2CSNA 5HDNA 3W6KB 5CU4A 3O8PA 5E8ZA 3NIEA 4ON0A 3W8QA 3Q52A 3IWFA 3KEOA 3D5XA 3D2KA 4L7FA 4PMPA 3V8WA 4NB5A 3CXWA 2I0EA 3P79A 4YMJA 5TRDA 3C4EA 3IKAA 4G9RA 4BHBA 3W55A 2QD9A 1QPDA 4ANSA 1BIAA 5KMNA 3H30A 3ORTA 3VUDA 4ZZMA 5FFZA 3NYNA 1HW1A 2WWYA 3TDUC 2QONA 5HNBA 5LQFA 2JDRA 4I5HA 2W4OA 1FWZA 4KFCA 1QPMA 5EW3A 3MQ0A 4MBJA 3R83A 5E1EA 1UU8A 4HF0A 2C5VA 1KOBA 1YDSE 1PHKA 3FSFA 1T0FA 5I3OA 2W85A 4M15A 3Q9VA 5AV4A 1K3AA 3DK3A 3ZUVA 2E2BA 4MXYA 4KNBA 1J7IA 5EOBA 3TG1A 1JWHA 1K9AA 2CN5A 4DA5A 3I6WA 3E6MA 1STZA 2EXEA 3RCJA 3RPSA 2Y4PA 4MCVA 4ANLA 4JVGA 3GUDA 3OUKA 4E5AX 4MD7E 4DTBA 4QP7A 4RJ5A 5ACKA 3UMXA 4DFNA 1D3YA 4GK4A 5ETFA 4H39A 4AIKA 4JIAA 3U51A 4PDPA 4XG6A 3F9NA 2XIGA 3PWYA 4AN2A 5M4UA 3RALA 3CJGA 3O8TA 4U45A 2OIBA 2VGPA 3VS4A 3KL8A 3QQLA 1OKRA 3MVHA 4ONAA 4YJOA 3LOKA 2XNBA 4XEYA 1PKDA 3MFKA 2FSOX 4ZEGA 2FXAA 3TV7A 3OEZA 3FHZA 1ZYLA 4PNKA 4C34A 4QWQA 4FNWA 1XDUA 1LEZA 3U6IA 3RK7A 3LA7A 3MFSA 4JDIA 3F3VA 4DEEA 3D7TA 2G1TA 1GOLA 3F69A 3PSCA 4ENNA 4U8ZA 4G9YA 1RUNA 5IDPA 3QRUA 4BB4A 1I1SA 4BHPA 4WG3A 3DAKA 4R78A 1OBDA 2IJMA 2OZOA 4A9TA 2XK6A 4GU6A 1MUOA 5EG3A 4FV4A 1GAGA 2DT5A 3VQUA 3E8DA 4F70A 4U81A 3OS3A 4AA0A 4HNFA 4LLLA 4P96A 3K9TA 2PZRA 2RQPA 3RHKA 5C9CA 1O6LA 4Y5QA 2J7TA 4M0YA 4DN5A 3I0QA 3R00A 2UW7A 2J0MB 1JSVA 4C38A 4D4RA 2GDOA 3ZBXA 4FV6A 1IAJA 5M06A 3TZ9A 2HR3A 3NYOA 4DTAA 2CNUA 2ONLC 4EH4A 4U80A 4C33A 1S6LA 4FVRA 1O3RA 4E3CA 2O0YA 4IX3A 3P9JA 2YCQA 3FC1X 4XV1A 1JKLA 3HVCA 5FLXZ 3O50A 3FEGA 3DV3A 5GNKA 3E64A 4YZCA 4QP3A 5DG5A 2BRBA 3C7QA 4C61A 1YRPA 4M74A 4RA4A 2YITA 4FX4A 1J75A 4AA5A 1ZG3A 4F7JA 4L3PA 1IR3A 5CF6A 4EMSA 5TE0A 3F5UA 1TBXA 2MLGA 2OXXA 1DM2A 3QRKA 2CKQA 4G7HF 2HAKA 3ULQB 2OF2A 5HI2A 1XGNA 2BKZA 4FMQA 4O0RA 3WZEA 2ADUA 2ZOQA 4X2JA 4U0YA 4R8QA 4FF8A 4DFYA 5EI6A 4XV2A 4GYIA 4Y8DA 1S29A 4L9VA 3HUGA 3EOCA 2F5EA 3OEFX 2VBZA 5K4JA 3OZ6A 5FO5A 4HX7A 1R1UA 1BIBA 3ACKA 2VTPA 5JZJA 2E9OA 3B8QA 5JQ5A 3HTSB 1IASA 2WMXA 4DF3A 1FPUA 3GFJA 4LOPA 5LWMA 4BGGA 5HS9A 4YIFA 2O2UA 2IW9A 4TRLA 5HBHA 5IUGA 4I93A 4U79A 1XBBA 3F8MA 5HG5A 3SZTA 4IAYA 5J95A 2CNQA 4F9AA 4L52A 4HX8A 5CF8A 1MRUA 5HCXA 3FI3A 2YAAA 2YIRA 4C3FA 3GOPA 2JBOA 4BCQA 4AIHA 3GFMA 3BYSA 2YLFA 2WTIA 4FIIA 1J59A 4S2ZA 4YBJA 4DEAA 1FVVA 1R78A 4EK6A 4KIBA 4GVAA 3ZN0A 3C4FA 2WQMA 4IBMA 5HE0A 2R3PA 3FM5A 3N4UA 3RKBA 3PQKA 4RMZA 2PTKA 2WNTA 1SD7A 3E92A 3MSSA 4CCUA 2YEXA 4X0MA 4DT8A 4C8BA 1ONVA 1ZRDA 3QQUA
chains in the Genus database with same CATH superfamily
2CW0F 2PE2A 2ZXHA 2JKMA 4AFEA 4XG7A 2V6CA 1S7OA 2X0QA 4LGHA 1MMDA 4OWRB 4PDOA 3LA2A 3RBWA 1M2QA 3I53A 1ST4A 5J5TA 2O3PA 3ERMA 1IXRC 5JHFA 1OMWA 3W2SA 4B09A 2J5PA 4EM2A 4ZZNA 3T9IA 3DTKA 1YX3A 2H6DA 4ZTSA 4HVIA 4IJAA 4YJTA 2JJ7A 1YW7A 3FMQA 2X0PA 3U6HA 3R01A 2B9JA 2VX1A 4X2KA 3M2WA 1O3QA 2F5VA 2O5KA 2W06A 4ZTQA 4ZXTA 3SQNA 4BDCA 4W4WA 2X6WA 3OOPA 4C2VA 3IAM2 4OAZA 2BDWA 3ENMA 4G3FA 1H1SA 4EH9A 3MV5A 2CUZA 4G6NA 3R4KA 1W2DA 3DP7A 1XTAA 4F7ZA 3DBRB 4A07A 3ECHA 4Z16A 3VOEA 1G8AA 1MBFA 2QO7A 4ZDOA 4GKHA 5DEWA 5KAIC 1A9UA 3OW3A 2NVQJ 3TV6A 4HGLA 3B6AA 3M9AA 2PVJA 4O0WA 3CLYA 2WAQN 2BW3A 4ERWA 1LKXA 1S9JA 3BV3A 2NS7A 1PXKA 4AZTA 3RZBA 5HCYA 5E8XA 3V6SA 4MLOA 1JT6A 3H5RA 3EN9A 2HGCA 3EWHA 4EUUA 2L01A 1G4DA 4XOTA 4UWCA 5BVEA 4HQMA 4D5HA 2X6EA 2VTLA 4BHCA 2D1HA 5FROA 3F7WA 3ONQA 4KYWA 1R49A 4A9YA 1GXPA 3QKMA 2X8IA 2CHLA 1FMOE 1JKPC 4XG4A 4QMQA 5JK3A 4WXHA 4FKVA 5M53A 5GJGA 4ZTLA 4E93A 1FYMA 5HDGA 2GXBA 4D1SA 4EH6A 4ZTJA 2ZC2A 1VQ4I 4FKQA 4N9HA 4OW8A 5AFVA 2ZKZA 4BEHA 3EFLA 2BAKA 4I5PA 3GTJJ 4NQWB 4RQVA 3OV8A 2GZWA 3L2RA 4XBRA 2X1DA 3ATTA 2RF9A 4NIFA 3V01A 5GIOE 3FMHA 1JAMA 4FNXA 3GYHX 4FZ7A 1LVKA 1APME 1WI3A 2UUZA 1W98A 2RFEA 3TZ8A 3VYSB 2GNHA 1H8AC 2XK4A 1NVSA 3FLSA 3E3PA 4G12A 4PJ0C 2R4BA 4P5OA 4KRCA 3AT3A 3LIJA 4IRIA 1PVEA 3HMOA 4HVHA 2A6EF 4KUJA 5BX0A 5TO8A 2XIXA 5LWNA 2WMVA 2Z5UA 4QMTA 4KT5C 3NX8A 3H10A 5J1RA 3TIYA 3QOEA 1S72I 3EHAA 4WT6A 4E7SA 5M5YJ 1L3RE 4UYAA 3UMWA 3BG7A 3CCVI 2VO7A 2PMIA 2LKPA 2BTSA 4UZDA 3IW5A 1YRNB 5E8YA 5K0KA 4EGZA 1NTCA 1ULYA 3PY0A 3IPHA 3M8FA 2OUMA 4D4SA 1KONA 3C5UA 4EK8A 2V6EA 2PVFA 1IEPA 4F55A 5HQ0A 4H36A 5EDQA 2X9FA 5M3FJ 4QMPA 4YGAA 4RA5A 3TL4X 1Y8QB 2FF4A 4X2GA 2BY0A 5B2KA 4HGSA 5KNLA 1E3PA 4QNAA 1CF7B 3EFJA 4FEWA 2RFSA 3FXWA 3M1SA 3M8EA 4LMYA 4O0TA 3WI6A 3BR3A 5KBQA 3CR0A 2Y7JA 4FKSA 4RT7A 2FVDA 2HYJA 1LDDA 3TW6A 4G6OA 5L2WA 3QAHA 3OYEA 5CAPA 4UX9A 3TYKA 2MLKA 1X1CA 5AAFA 3LSMA 4WG4A 4RB2C 3BE9A 4U3ZA 1SAUA 4E6DA 2W5AA 3L8SA 4RVKA 1FZPB 5LD2C 4I76A 2LK2A 2WMSA 1OIUA 4AC0A 4LK0F 3DEUA 4YJPA 3CZ6A 4F63A 3UG1A 3BELA 4BNCA 3OYFA 2RC4A 4XSXF 1SM2A 3JSPA 2QKWB 3R1QA 4GG7A 5FGMA 4ZTRA 4I5CA 4TNDA 4N6YA 3ZQGA 5ICPA 2FA2A 3FI4A 5DV5A 2PI0A 5IDNA 3FKJA 1CTPE 3DK6A 2QOOA 2P4WA 4JBPA 4EQUA 5IF1A 3IP4B 4FTMA 4HRIA 5C8MA 2STTA 2W84A 5FD5A 4W9XA 1BYGA 4B8MA 4D9UA 2IWIA 4EZ5A 4E7WA 3SYTA 2NPQA 2F4IA 3MDYA 3DCVA 4Y73A 5HCZA 1B72B 4ZJIA 5AIQA 3NQOA 2W17A 2ELHA 4NQWA 1I5ZA 5E91A 4BI1A 3HAVA 1ZWSA 4M68A 1GZOA 4PTCA 1LEAA 2EZKA 4YFNF 3KRWA 4NW5A 2XKCA 1MMNA 5T68A 3BG3A 4RWKA 4XQFA 4WF2A 3ESWB 5ILUA 3HV4A 3DXNA 2HOGA 1YW2A 2R7VA 3JRCA 3LKMA 4IZ7A 1YJ9I 4OBQA 4DFLA 2WTKC 4A7CA 4OTHA 4XUFA 4FEQA 3JAMZ 2CGXA 3QU3A 2E19A 2C6EA 3KXXA 3ORIA 4O1OA 2R3HA 1NHAA 2PMZN 3RYRA 3WE3A 2ZM1A 4XBFA 1YQJA 2Z7RA 3R73A 4KIKB 1LDJA 4A3GJ 3EKNA 3NRVA 2OCEA 3FDYA 2HXQA 1ZREA 4GDFA 3HUBA 5KHXA 2KIMA 3WZUA 5FB2A 3GO5A 4KSPA 4FSMA 4TL0A 4ETSA 1YRNA 1KU3A 3M7GA 1G8SA 3HG9A 4Z6YA 3UZPA 2GTMA 4PDKA 2NOJB 3QKLA 1VQMI 5BUJA 5A4EA 2KIQA 3IV5A 4JBOA 1X8BA 2GS6A 4B3XA 4IXPA 1RI7A 2AXTC 3RPUD 4ZTMA 2QVSE 1Y8YA 3UG2A 2RGVA 2LDUA 5B2MA 3SDGA 2CMPA 2DCEA 4XP0A 4EKKA 2H1LA 1J5YA 3G1OA 3MCZA 1QPEA 2B52A 3POOA 1FPQA 1HSTA 2FSMX 2CSOA 4MVFA 3QPHA 3LM5A 1CF7A 4JP0A 4F7SA 2JA7J 4NSTA 4CG9A 4G31A 4BI0A 3V5QA 4UVAA 3KZYA 4C0TA 4AOIA 1E1XA 4B8LA 5AR3A 4FX3A 3C50A 2DFHA 3A7FA 1XC5A 1Y0NA 4IHTA 1VNDA 4XKVA 2QYOA 5CQUA 2MABA 3HPHA 4RGJA 4UUSB 5IMEA 3ZRLA 2W1FA 2PYWA 1M52A 3ANQA 5IEYA 1B6AA 4YG2F 3K2AA 1W5CC 3Q6WA 2OGVA 3AG3H 4LOQA 3KE2A 3KRXA 4D28A 4AVZA 4GJ2A 4CZUA 4CSWA 4YBKA 4DEDA 2PUNA 3S3IA 3VS5A 4EZ3A 4I20A 4F99A 4EQMA 3HMPA 4C36A 5GPAA 4EVIA 3W2WA 4KABA 4FSWA 4CTBA 3IAS2 3OTUA 5ANJA 2OCCH 3LFFA 5ICEA 1IF1A 3GU6A 4GIHA 1FIPA 4QYFA 3F66A 3Q4TA 4R6VA 5C1QB 3R7EA 3G33A 4AXEA 3C4WA 4U41A 5JGDA 1TWCJ 1B9MA 2VWZA 3L9NA 2XEYA 3ZDUA 3C2HA 3HRMA 2HYYA 2Y48A 2VASA 1IRKA 2IW8A 4PPBA 1B72A 1QPJA 3L2CA 4O22A 1ZG1A 1Q61A 5KAFC 4AOTA 3REOA 2ISZA 2KTYA 3OXTA 1JBPE 2HXLA 5D5VB 3GT8A 4QMXA 4BDYA 5C03A 4B1RA 4XN3A 2QURA 3JVSA 4JOAA 1FNNA 1FP2A 4BC6A 3J7AY 4ACMA 3O8GA 3FYJX 4QMWA 3ALNA 4PL3A 3UOLA 5AV3A 3IK3A 3A7HA 2EXCX 2YCFA 3RK5A 3UIMA 3ID6C 4ASZA 2AEGA 4LIUA 5IP9J 3EYGA 1SMYF 5LEJA 3NUPA 2K9MA 1ZYCA 5HEZA 4UYNA 2OI4X 4CMTA 3WTVC 4HF2A 5L4QA 3VJOA 2QI8A 4A0ZA 4XLNF 2COBA 5FM3A 1ZZLA 4IVNA 3SRVB 3R1YA 4KIKA 1GUUA 1YHWA 2HS5A 3VUTA 5TF9A 3MPMA 2NOGA 1SD6A 2DQ7X 3Q9YA 2LBFB 3KQ7A 1YG2A 2XAJA 2WC2A 4LRMA 3TNHA 3KRJA 1Y39A 1PXNA 1OL2A 2QKMB 1HKQA 4NM3A 3SC1A 4G1WA 2QVOA 1UHSA 5ICFA 2W25A 4GSBA 3SD0A 4ZMFA 2IVVA 3QAME 5CWZA 4ZZLA 4AIJA 4BCKA 4A3BJ 2WAFA 4DEHA 3LFKA 2W7NA 3MN3A 3TEIA 2RL5A 1H01A 4NU1A 2Y4IC 2CJMA 3HAMA 3PJCA 2XYUA 5ILSA 4BI2A 1ZMWA 5CSXA 4JX7A 2FNPA 3ZQHA 5DMZA 5IISA 3LFUA 3PNTA 3NAUA 3MVLA 2ETRA 2X1EA 2WTKB 1LPUA 2LY9A 4XNFA 3LOC