1ZAOA

Crystal structure of a.fulgidus rio2 kinase complexed with atp and manganese ions
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
282
structure length
271
Chain Sequence
MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVGHTKVKEFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rio2 serine kinase
publication title Autophosphorylation of Archaeoglobus fulgidus Rio2 and crystal structures of its nucleotide-metal ion complexes.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Transferase
total genus 93
structure length 271
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zaoA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zaoA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zaoA02
4WF2A 5IU2A 2W96B 3DQWA 3EFJA 2QKWB 4AUAA 4NM3A 4RQVA 3ANRA 2H09A 5L3DA 3HUGA 2EB3A 4K1BA 5A6NA 3MW1A 2O0UA 3E5UA 5DV5A 3FLQA 4L9IA 4DLIA 4B6LA 5ETIA 5L3CA 4Y73A 4E6QA 3RPQA 1Z5MA 3DJ5A 3SX9A 4IB3A 5KMLA 2ZDUA 1RIOH 3IW4A 2O3PA 2VE9A 4O7SA 2W1CA 1O6LA 4GO1A 3QLFA 4ZJIA 1XR1A 5KMKA 3P7AA 3AQVA 3QGWA 2F2EA 1KQ9A 3CIKA 5IH4A 4TKSA 4KIPA 5ICCA 3DQXA 3UZRA 3QCXA 3BEGA 3H0ZA 3FI2A 5JKGA 2YIQA 4FNZA 3KCKA 4A6DA 4CFWA 2H8HA 3DTWA 2RGVA 2YERA 4MEYF 3L2CA 2W4JA 2F4JA 4D28A 3QZFA 3DBQA 2FBIA 3DJ7A 5LMAA 5T68A 5BMSA 4MF1A 4G7HF 5J79A 1Z6RA 2WMUA 5IA3A 4F65A 2XJ1A 3NW5A 3GI3A 5DT3A 3LMHA 4RX7A 1Z91A 4A0ZA 3O96A 2W5BA 4MBJA 4HVGA 3HAMA 2F5EA 3FZRA 5F20A 5HG8A 4I93A 1J3HA 4P9FA 3JVRA 3PA4A 1F5TA 5AIKA 4DT9A 1H26A 5AV1A 4EBWA 3W8QA 4DCAA 5K4JA 1LQ1A 2HZNA 2OW3A 4Z16A 2PYWA 4DBXA 4XRLA 2UZKA 4GGGA 4HF0A 1APME 4DGMA 3QQUA 4AIJA 2GSFA 3BELA 4FX3A 4QTCA 4C34A 4OAVB 2WMSA 3R9NA 1SVGA 4FTOA 5IZFA 3F2NA 2QD9A 3ZU7A 3TTJA 3GFIA 3NCGA 3WF7A 4IW0A 5BPIA 2BAQA 3P23A 3DKWA 1LEWA 3BQRA 3LXNA 4W9XA 3R63A 3VVHA 4EKLA 3PJ3A 2H6CA 2UZDA 2OJGA 3COHA 1HCLA 1U5TC 3R7EA 3RTRA 3FSFA 4IVDA 5K5QA 4O7ZA 3R7VA 3UC4A 4YBJA 3UQFA 4O0WA 4LLLA 3EQCA 4OTIA 3FF5A 5CNNA 2XGXA 3RAIA 2GNFA 4G2FA 1OBDA 5EEHA 4V05A 4YPSA 4RWKA 2BGCA 2P5LC 4KIGA 3EB0A 2UW6A 4JIKA 3FPQA 5GIOE 3FMDA 3E88A 3T3VA 1SMYF 2X7GA 3KCFA 2JDOA 4B8MA 3UYTA 3BY6A 5HORA 5E7RA 4AWIA 2JC6A 3DKGA 2GNHA 3O3KA 4D0PA 3R9HA 2ZAZA 3KREA 4UWCA 1DM2A 4CZZA 4O2ZA 3HRCA 2XNBA 2BZKB 2PZ5A 4AZSA 4YO6A 3ZXZA 2CCIA 4IFGA 5LMKC 5EM6A 4Z7HA 2BBYA 4FIGA 2QKRA 3OEFX 4H58A 3ORKA 3HTUA 4BVUA 3A8WA 4L9VA 1SD5A 3LJ1A 4JS8A 1PXMA 3TUDA 4QQ5A 2YPRA 3BPVA 4GU9A 1SFUA 4HYIA 1YOLA 3KN6A 4ZY4A 2QOKA 4USFA 3DNEA 3LKMA 1E2XA 5F1ZA 2XA4A 2OH4A 2NAZA 3LWFA 5CALA 5A4CA 2ITQA 3LXKA 4UMPA 4GXOA 3EN4A 2EXMA 2DK8A 3K3IA 3QXPA 5DCMA 3HYIA 3ZO1A 1J5YA 2WQBA 3ELJA 4L3PA 1NHAA 2DAOA 3DJ6A 3MFSA 4KYWA 3MY5A 2BHHA 4O81A 3D0SA 3CKXA 3QD2B 2GXGA 5CU3A 2GS6A 3HP5A 2G1TA 4FT0A 4MQ2A 2JRTA 1JSUA 1MJBA 2ZKZA 5CLPA 3GC9A 4D0WA 4Q9SA 5F1RA 4GT5A 4ACDA 2B54A 4IM2A 4ZS4A 5HX8A 3BP8A 4KN4X 4C62A 2OQGA 3R60A 3AC5A 4K33A 4AGDA 5LHGA 4RGJA 4G6OA 1O3SA 2WMAA 1LDDA 4Y8DA 1MUOA 3ZN1A 3FZ1A 5TO8A 3Q4ZA 5C4LA 3U54A 3RPRA 4BGGA 5EYKA 3GEQA 1KGSA 3LMGA 5IT9Z 3A7IA 4MH7A 4AIHA 3ZYAA 3MH0A 2VTHA 4ANMA 3F2AA 5HCYA 4LGGA 1IN7A 2ISYA 3SOAA 5BUJA 4WG3A 3J7AO 4XMOA 1XWSA 1IRFA 3EN7A 3IC7A 5JRSA 2KIMA 4JAIA 2A5YB 4ASZA 5FXSA 4GT3A 4CT2A 3I6WA 3TM0A 2BKZA 4EJOA 2PVFA 3FSKA 4FODA 3RKYA 3FHZA 5F95A 4WX9A 4F7SA 2WC2A 4GUBA 4L0YB 1WWXA 3IOPA 1H1WA 4ASDA 4F08A 5GZ9A 2BTRA 4JX3A 3J81Z 2ZV9A 3OS3A 4YC8A 4IHTA 1EH8A 4DF3A 4FV1A 4CTCA 3MIYA 4RZWA 4WBOA 4YLKA 4UALA 5AR8A 1P6RA 3HZTA 4RJ3A 3CC6A 1PMEA 4PDSA 1SYKA 1MZBA 2VU3A 4HX8A 4FX4A 1IXCA 4C61A 2WQNA 3QGYA 4Q48A 1QBJA 2C3JA 2OJ9A 1WSUA 4F7ZA 4W4YA 3PJ8A 3EFWA 2FBKA 4I3ZA 1R23A 5L6OA 2HZTA 2BIYA 1S8NA 2ZV7A 1SD4A 2QVSE 3E8CA 4JDJA 3T8RA 2IG7A 3DXQA 3W32A 1YKRA 3KU2A 4EH7A 4BDAA 3QTWA 4K77A 2HWOA 3NR9A 3COKA 2OFUA 2ZMEB 2NP8A 2KRFA 4CZYB 4X6QC 3AMBA 2QURA 3KP3A 1ZRCA 1XN7A 5LCKA 4LLNA 4L43A 3F5PA 4N4SA 2YAKA 4DTKA 4XBUA 4O6EA 5BQTA 5DDGA 4LMYA 4R79A 5FB2A 3LCDA 4GU6A 1NY3A 3ZP5A 3F5GA 2XIYA 3ENMA 4KRDA 4F9AA 2ZV2A 3NSZA 2JGZA 2VN2A 4X2NA 2OXDA 3NLBA 2JFLA 2A07F 3CJFA 5I9WA 3ALOA 4L0ZB 2H34A 4O91A 4OBOA 3BDDA 2H27A 3QTSA 4ZY5A 4AN9A 4TV7A 4Y72A 4FT8A 1A9UA 5AM6A 1ZGAA 2PULA 4EQMA 4BQAA 4FG9A 4EM0B 3AC2A 1ZLJA 1Q3WA 2J6MA 4YJVA 5AV4A 2COMA 3GO5A 1J0RA 3BQCA 4KA3A 5DA3A 3UPZA 5DRDA 4FTRA 4U7DA 4GKHA 4APPA 4AZEA 3JR1A 1PXPA 1PY5A 1JSTA 2WMXA 4FV0A 3JVSA 4AZWA 4Y95A 3B73A 4IVNA 1OR7A 1B59A 2G2IA 3VHKA 1P2FA 4HLXA 2CLXA 3GNIB 3REPA 4I1ZA 2Z3YA 2EB2A 4B4LA 3O71A 4BTFA 1FP1D 4O38A 2E9VA 2HOEA 2ESMA 4EJTA 5KMOA 4OBPA 2DW4A 4BL1A 4YC6A 6PAXA 2MD5A 3F2RA 5FLFA 2OU2A 4RFMA 2Y48A 2XCKA 3PXKA 3ECHA 4DG2E 1QPMA 4AFEA 1KQ0A 4RZVA 2PHKA 4YC3A 5FP6A 1YDTE 3SG9A 4WRGA 2L02A 5LMKA 5IH6A 2Z02A 5DD4A 1YFHA 3CUQB 3EYGA 3I6UA 1QPDA 4BC6A 3UIUA 3F8FA 3KA0A 2B9FA 4A9RA 5AWMA 4OT6A 4YTIA 1RZ4A 3DY7A 4EC9A 1CDKA 2FA5A 2P6TA 2UZVA 4S32A 1H1PA 5BPYA 4DAWA 2JIVA 4DGGA 4DN5A 4U7ZA 2P55A 3ITZA 3IOKA 3V4GA 4ANOA 2ZXJA 5ACBC 4AVPA 4CHUA 3QCQA 2I6LA 3C50A 2HGCA 2XAHA 3BBWA 3C4ZA 4EK8A 3U6JA 4TNDA 3T5XA 4NZWB 3ZS5A 1RE8A 4EBVA 2IPXA 4P7EA 1Y0UA 3FUPA 2ZV8A 3FQHA 5I3OA 1YW8A 4FHTA 2B0QA 4QMPA 4RAZA 1ZOHA 3C18A 1XJDA 5KE0A 5D8KB 5EDRA 1STZA 4C7TA 3O8PA 5T3QA 4QO9A 2K27A 3QQGA 4DFYA 4I5PA 2IA2A 2C5YA 5LVLA 1XDUA 2W84A 4Z3VA 2HZ4A 3FY0A 3REOA 2M5WA 1XH5A 3N51A 1ZG1A 5IQIA 2IZTA 2RL5A 1XGMA 3DZOA 2UW8A 2DWBA 3B2TA 1U2WA 3PPJA 4P90A 3Q04A 5LJJA 2YZAA 3N4MA 5ERIA 1QZYA 4JDHA 4ZIMA 3R30A 3NGAA 4DGNA 3NYVA 4OGRA 3EJ1A 1LB2A 3AC4A 5AAGA 2I0HA 3FZPA 5LVMA 2V62A 4KN7X 4O1OA 3WF9A 1W83A 4IBMA 3FXRA 1BYGA 4BTMA 2QOOA 3KVXA 3O17A 3QFVA 3ZBXA 5JZNA 2DK5A 3TO9A 4EHZA 3OMVA 2ZNZA 2XMYA 5M4CA 3SD0A 4XG3A 4KNBA 1PP7U 3N97A 2C69A 1YLFA 3W8LA 4K6ZA 3TKYA 3FMJA 3TJCA 3PXZA 3MFUA 3LM0A 4OTGA 4X0MA 2R3PA 2XRNA 3MPAA 3JXWA 4I0SA 5JFRA 4QMTA 3SHFA 3MESA 4MVFA 5HO7A 4YJSA 5A9UA 4N70A 4M9XA 2UZBA 3F6VA 3UIMA 3HA8A 5J5TA 1P2AA 4P9UA 3OG7A 4W4VA 5CJ9A 2HQNA 3MH2A 5EDPA 4FYNA 1ND4A 1DDNA 2GA2A 3R9OA 1H1RA 3TZMA 1R1TA 3H92A 3ZMVA 3MPTA 5FTQA 1WCCA 2OBPA 3HV7A 4FICA 3VHEA 4HVSA 1Q3DA 2X6EA 1Q99A 1IZ1A 4EOMA 3G15A 1OYIA 4A7CA 5JSMA 5CX9A 1F1ZA 2XK9A 3QQKA 4IH8A 3P78A 5IEVA 3PPZA 1UNGA 3ERED 4JBPA 3OTVA 4C3RA 1ZLTA 5AIRA 1PKDA 5JGDA 4DGOA 3DBEA 1BI0A 4RC4A 4MXOA 2PVYA 3ENHA 4WNOA 5HS8A 1DUXC 3HNGA 5DCFA 3I58A 2VTOA 4FIJA 2WTWA 4U0WA 1DAYA 2B7AA 2L01A 5CXHA 5AEPA 4AT3A 1RNLA 3I7CA 2HELA 2Z99A 2OJIA 4RFZA 3ID6C 1H08A 3TV7A 4O7WA 2PG4A 1FT9A 4UV0A 1OPCA 2BV6A 3VBTA 2W85A 4CG9A 3KXZA 1J91A 4U0IA 1OKVA 2YFXA 3F22A 4HYEA 2R0UA 4BI1A 4ZSLA 5D5WB 2VWBA 3MV5A 3HEGA 4DH1A 4ZH4F 3FYJX 2VO7A 2Z7LA 3DEUA 3CEKA 4IX5A 3EL8A 3FLNC 3D7TB 5CU2A 5HLHA 2ZOQA 3QTIA 4HCTA 2P5KA 1NXKA 3PJ1A 4RPVA 4ANQA 3R0TA 5K5NA 2EVAA 4PWNA 4L5IA 3F3WA 2HXLA 4EK4A 1OB3A 3IONA 4NL0A 5ANJA 2X9FA 3PVBA 1ZY4A 4S04A 2BKKA 1FGKA 2VD5A 2PMLX 1M2RA 4ZSGA 2OXYA 2C0OA 4YJTA 5FG8A 3GC0A 1Q62A 3OWJA 3LLTA 3B8QA 3FDNA 1BN5A 1O3QA 4RJ8A 2WNTA 1I1GA 3KP2A 2BMCA 3QRJA 1LEAA 1G3TA 4CYIA 3T9IA 2F5FA 4QNYA 2Q8KA 3BE2A 5E17F 4CTBA 5AFVA 5IQCA 3KMMA 4GFOA 4I4EA 4F9YA 3WTWC 2AYPA 3ANQA 3DV3A 2YM4A 1WBNA 2HDCA 4C2WA 5J6XA 4GJ2A 4U9AA 4F6UA 1XH8A 1Z7UA 4AP7A 3R7UA 4ZLOA 4IDVA 3A61A 2QOHA 2F7XE 3VQUA 2W05A 4O7NA 4D1SA 3H3UA 3A2CA 2VTRA 3RTPA 4E5BA 5KBRA 1GZKA 4YIIA 2YIRA 3F8CA 3TO6A 2A3SA 2X1NA 1B9MA 3HX4A 3VULA 5KHWA 4LB6B 2L54A 3CP9A 2ITYA 3R21A 2UZOA 3OD6X 2GQRA 2VWUA 5CF6A 2O8XA 4MX9A 1QGPA 3R9DA 1S6LA 2EWAA 1CKJA 2X0LA 4RIWB 3CGFA 2XHKA 3R8PA 1V1KA 3BU6A 2GFSA 2ACJA 1I1SA 5DMZA 3OXZA 2P4IA 3Q9WA 3LE6A 3VNTA 3RIRA 4F7LA 4QD6A 3RPYA 2D1VA 4I92A 4CD0A 3IECA 1B38A 1BBYA 3G73A 2QO9A 5FD5A 4BCMA 4KIKA 3H9OA 1Q5KA 4ERWA 1SNXA 4BBEA 3FWEA 3VBXA 1YW7A 3UP2A 3TL8A 4FEWA 4QP4A 3ZHPC 3LLAA 4CYDA 5IKWA 4Y13A 4AE6A 3ZRMA 1ODDA 2RFEA 1H4LA 4ZTLA 5A4EA 3IHUA 4ZMEA 3QYZA 4DG0E 1FOTA 5L4QA 2UZLA 3KFWX 2MC3A 5K5OA 2V7OA 3KC3A 5AP0A 2Y6MA 1FBNA 5M55A 2XROA 4G3DA 2X2LA 2GNJA 3GT8A 4OBQA 4ZMFA 2V1XA 2XP2A 1HW5A 4OIRF 2PMOX 2ZMDA 1PJKA 1SD7A 3F6OA 2Y7JA 5IEXA 2OZUA 3UZPA 2VGOA 2PN6A 5AV3A 5HDGA 4FZ7A 4DEHA 4M14A 2OD5A 1IEPA 4QTBA 3E8NA 2X9EA 1EH6A 1KQ8A 3VEPA 3W2RA 1JGSA 1J59A 4P96A 4DNCA 3F23A 4HCUA 4X3FB 3R7OA 4ZZDA 3RINA 3PLSA 4ID7A 4NB5A 2UW7A 5JMSA 5DT4A 2CQKA 4LG4A 1CSNA 2OBJA 3MQ0A 3BPRA 4CMOA 3VW8A 4IVAA 5ILSA 1XH7A 5DHJA 4UYAA 4B9DA 5LQFA 2J50A 3F61A 2IVMA 5J7BA 3WIKA 3G2FA 1V0BA 1ZYCA 4M68A 4IJAA 3DGKA 3TOBA 2ITNA 3FZOA 3E8EA 1Q61A 4XJ0A 4CGZA 2X7OA 2W4OA 5L8KA 4QMNA 5CYVA 1J1CA 2G01A 4AQCA 2QQ9A 1FMOE 4QMMA 5EKOA 1MRUA 1QO0D 4ZTRA 3Q9ZA 2Q0OA 5LVOA 4DE4A 4L44A 3FBVA 3BLHA 3SW7A 1GNGA 3ORNA 4OTHA 2IVUA 4ESFA 4F1TA 1M7QA 3V5LA 4X2KA 4KDPA 4NKSA 4C36A 1FNNA 5FM2A 1TQPA 1V0PA 3PY0A 4IRGA 2A19B 5K4IA 4BBMA 5TT7A 5AONA 4EI4A 3OUNB 2GFCA 2G2HA 2GCDA 3PXRA 3DBCA 3KRRA 4C4EA 1G8AA 2VTQA 4RGUA 3WTUC 2QOCA 3GU4A 2KJCA 2A2AA 5DNRA 4UWYA 1EH7A 1QPEA 1S29A 5CVFA 2K4JA 2BZJA 4H1MA 1VYZA 1AQ1A 1I27A 4TYJA 5L3BA 3I79A 3UTOA 3A7JA 2O03A 3FMNA 4O86A 2C5VA 5IQGA 3MGYA 1UWJA 1SAXA 3QTZA 3BPXA 4AXAA 4DT8A 3RGFA 3LM5A 1MGTA 4RIYB 4FL3A 2QONA 1HSTA 4HA8A 3L9PA 2X0GA 3R7GA 1WI9A 3D2IA 4DITA 2H94A 2OFVA 3Q4CA 3PP1A 4TW9A 2X81A 5CEOA 4EH6A 4TTHB 3S95A 5EFQA 4ACHA 4BH9A 4WWCA 4FK3A 2E1CA 4L9TA 3L9LA 3RJCA 4N57A 3MA6A 1B6CB 4NW6A 4EVIA 4KT5C 2Z7RA 4D9UA 2W5AA 3W33A 4LG0A 5D6EA 3TEIA 4ETSA 4CCUA 4EKKA 1XB4A 3E6CC 5J1WA 3VFZA 4GYGA 2Z2WA 3KRJA 5AM7A 4MTEA 5CI7A 5KO1A 3O8TA 4IDTA 2DT5A 1BUHA 1VYWA 3QRIA 4ESBA 1PUEE 2PVJA 3IDPA 3RCJA 1H0VA 4D2VA 4G9CA 2Y4PA 2CO5A 4FIHA 3PZEA 1LP4A 1BL7A 2PZPA 1GXPA 3H30A 3WF8A 2CW0F 2VWIA 3D94A 2RG5A 1OL1A 2R3KA 3KXHA 2EXCX 4DH8A 4CQGA 1P4FA 5IQDA 3GUBA 4H1JA 5L3EA 1Q8UA 5HNBA 4I0BA 2G9WA 2VBWA 5HQ0A 3KB7A 2W1DA 1UVRA 3QF9A 5K1YA 3MIAA 3P9KA 2PVMA 4JBAA 2GMXA 2F57A 1CTPE 3U51A 4FSRA 2VO6A 2WMWA 4L7FA 1JPAA 1ZG5A 4TL0A 4LD5A 5E1EA 5CSXA 3V04A 2WEVA 5L3FA 4MQ1A 4GFMA 4JDIA 1FMKA 4E4LA 5HLWA 2QQAA 4JIAA 1KYWA 2JITA 4BDBA 4BDKA 3FHRA 4D2TA 1WBPA 2X8IA 4BCHA 3F3UA 5FO5A 5H8GA 4AW1A 4ZY6A 2HENA 3HRFA 4U0VA 4GUEA 3I64A 3Q5IA 5HE3A 3LFBA 2OF4A 3QX4A 1LDKB 3G90X 5JQ8A 4W8DA 1OIYA 3EQHA 5J8CA 4Q5SF 2QG5A 3VOEA 5ACKA 4L3JA 4AACA 2FXAA 2CSNA 2DUVA 2OU7A 3ORMA 4RGXA 5L2WA 3UMWA 4K11A 4FSZA 2W1FA 4OMYA 4QP9A 4UZDA 4R3RA 2WMRA 3IGOA 4KBCA 4BI0A 1XH4A 3S00A 4P4CA 2ZMCA 5LGNA 2FVDA 1T45A 1USTA 3LHJA 4OAUC 3NVKI 5DGZA 3ACJA 4BIEA 5L6WL 3POOA 3EQRA 3TWJA 3VWAA 4Q9ZA 2G7UA 4FE2A 4ENXA 2LSOA 3UQGA 4S2ZA 3AXWA 3LFDA 2YU3A 4HYHA 4O22A 1ZMWA 4OIOF 4GK2A 2RFSA 3S4QA 2R3LA 1KYZA 3T8TA 2IPQX 3ZFMA 3RCDA 4RC2A 2HZIA 2P4WA 4EWQA 3WYYA 4HOKA 3ZRKA 3CD8A 4D4YA 4RWIA 3ATTA 2UXXA 3W2SA 2C68A 2HCKA 1GZOA 4E6DA 1CGPA 3DLSA 5HLGA 4G3FA 2JTVA 2JBPA 3CY2A 2C6KA 1WRJA 2JPBA 5FLXK 2VT3A 2VTJA 2E7XA 1F9NA 5I0BA 4TYHA 3DPKA 3CSVA 4DEEA 3LXLA 2B0LA 1ZYSA 4BCQA 4EK6A 2ZYBA 4NM0A 5JK3A 4JR7A 3LMIA 5EM5A 4TWCA 2JIIA 2W7XA 4I5HA 4FSUA 2C5NA 4B7TA 3T3UA 4BTJA 2IW6A 1XCBA 1BI3A 1S3JA 3G51A 3UOKA 3ZONA 2FYSA 3R2YA 2GAUA 3ZDIA 5CVIA 2QBYB 4M6YA 3E3BX 5F9EA 1AWCA 3DPLC 5E8TA 1G5SA 3F88A 4IVBA 3KP6A 1U5RA 4WT6A 1M17A 1IXRC 2CPKE 3V8LA 3MB6A 1U46A 2WMBA 3F8BA 4QP7A 4L45A 1OIRA 1P4WA 2OZOA 4H3QA 3GCVA 2W1IA 4AAAA 4OIQF 4IXPA 3LCSA 3DKOA 2V1DA 3DOGA 4XOYA 5DRBA 3HVCA 3TUCA 4LK1F 1WBSA 4M74A 4FX0A 4OMZA 2CHLA 2AUHA 4M84A 5JQ5A 3TOAA 2ZM3A 2Q0NA 1HBXG 3KXNA 2VTAA 3QQFA 4FEVA 4L5JA 2A1AB 3ZOSA 1W82A 4EZ7A 5F94A 2NYXA 5LGTA 3KFAA 4LOOA 4EM1A 2SRCA 5HOAA 5E1WA 5M56A 3C4FA 4M3QA 2QLZA 2Z60A 2B4SB 3FLWA 5LVNA 4YPDA 2IW9A 2JDVA 4IZ5A 1A04A 4ONAA 2YM6A 1Q8ZA 5HIDA 2VX3A 3VF8A 2OIDA 1XO2B 1WKMA 4ZXTA 4EMSA 1H1SA 4R5SA 4APCA 2FGIA 3WGGA 4BZNA 5EEGA 4YFNF 3BE9A 5FEQA 3P7BA 1R0PA 1Y6BA 1EH4A 2RVCA 2PUPA 2W1GA 1TW3A 1HW2A 4JR3A 4CFNA 5IQFA 2PUIA 5IA2A 3HRUA 4IAAA 1TW2A 1NT2A 1P4AA 2R3QA 4FTTA 2ZBKA 4NJ3A 1JBPE 4FKVA 4YSJA 1W7PD 3QALE 3PQKA 3F9NA 3LFEA 4TT7A 3V8TA 2JKQA 5ANKA 4BF2A 5CENA 2RFDA 4ENMA 4DFUA 2DU9A 3R6SA 4RIWA 5JGAA 2QU6A 5B2LA 2CFXA 3UYSA 2R2PA 2CJMA 5FM3A 3OUKA 4C4HA 4MNUA 2R4BA 1IF1A 3ZLWA 4PZJA 4J97A 1G3YA 4A2UA 5FBNC 4EQUA 5ICPA 5L8JA 1BI8A 4O6JA 2VZ6A 3V7CA 4C59A 3N4VA 4QPAA 2LGCA 3W1FA 5DEYA 4AA4A 5FDPA 2JAMA 5EM7A 4NCTC 3PIZA 1MDMA 5L2IA 2A6EF 5IISA 5F64A 4CFUA 3SXSA 1W5TA 1OUYA 4MAOA 5CSPA 4PQNA 3IRRA 1W7PB 2BTSA 3PE2A 4YGAA 2IT0A 4XUFA 4BZDA 4TRLA 5E20A 3SV0A 5K3YA 3D2KA 2MH2A 2C3LA 3FQSA 1KE5A 4X2GA 5LMBA 3ZO3A 2ZB0A 4IC8A 4YJRA 3SXFA 5BYZA 5DPVA 1FY7A 3WE3A 3HAVA 4R78A 2E2BA 2WTCA 2BRGA 2QNJA 3A7HA 4DFNA 4I5MA 5LHIA 2XKPA 4IZAA 2L3DA 2J0KA 5I9UA 4G7OF 4DEBA 2B9JA 3NPCA 4AW2A 3QU3A 5DE2A 1D8JA 3QD4A 1YW2A 3D0EA 4HQEA 3VBVA 4IAYA 1LR4A 1ZYDA 2QVOA 2JFMA 5HG9A 4LL5A 3ATSA 3F72A 2OZAB 2B9IA 4F0FA 4FNWA 5LBQA 3BU5A 4PTGA 3CLYA 3RALA 3KZZA 4EJ7A 3CKWA 4CCBA 3AOXA 4IE9A 4W4WA 5AR2A 4ON0A 2F9GA 3JYAA 4PCQA 4D1ZA 4X21A 2BHEA 5CU0A 5HU3A 4FTMA 1MD0A 1JWHA 4RGSA 2R64A 2GNIA 2J90A 5M08A 2UVZA 5DG5A 3ROYA 3DBDA 2P3GX 4JAJA 3C13A 4QMXA 5KCVA 4GIHA 3RMFA 2HWVA 2PZIA 1RUNA 2UW0A 3D15A 5M53A 3K1MA 5HG7A 4LOPA 2QOLA 5ANIA 5AA9A 1FGIA 1M2PA 3EQIA 1U8RA 2PE0A 4FKLA 1FX7A 4GRBA 2W1HA 3QUEA 2JPCA 1XQZA 4YJOA 3KCCA 4F70A 2C0IA 4YJQA 3QC9A 4E1ZA 1MQ4A 3F66A 1K78B 5M06A 1OL5A 4RVLA 3BZ3A 1J9IA 3IWZA 1OM1A 4HLYA 1IUYA 2ZCWA 2X4ZA 1JNKA 3U9GA 2UVYA 2WB8A 4AZVA 5E8IA 2ETHA 4XLIA 2ZDTA 2W9ZB 3PZHA 2R5TA 3IGGA 4A07A 4Q5EA 2AS5F 3OBGA 4HNIA 4RVMA 1ZOGA 4CZTA 4YUQA 4OR5A 4AX8A 4C8BA 3WU0A 4HVDA 4IHSA 5HI2A 5EK7A 4AW5A 3MWUA 5HD4A 5E8WA 4UHTA 3F69A 5CVHA 2KJBA 3LOKA 2GS7A 3BV3A 3CQUA 1HOWA 5BYLA 2JEDA 3FYKX 4I0RA 1CMKE 4U97A 4ZZOA 3NUXA 1XCVA 3OP5A 5LVPA 3R1YA 3EDPA 3LAPA 2CG4A 3DFGA 4KMUX 3LQRA 2GWRA 4NTTA 5KNJA 3PUPA 4HZSA 3LFNA 2VN9A 3FM3A 3AC1A 2DPDA 2M45A 4R77A 2Y0MA 3BWGA 2UUEA 3OWPA 3F8NA 3I59B 4BHZA 1WVXA 4RAYA 1FPUA 4WNPA 1YI3A 4IHPA 2UV2A 3Q96A 4AA0A 2CWEA 3HMIA 3U6IA 4NIFB 4XSZF 1PXOA 1R1WA 5EI6A 4A5MA 5EHOA 4HW7A 3BHUA 3PA5A 4XG6A 2YX4A 3F3VA 4F99A 5L3GA 4ZZLA 5HDKA 3H9FA 3KRLA 2J5PA 3MTFA 5M44A 5DEWA 2PWLA 2YIXA 2CKPA 3RPUA 2HS5A 5GZAA 3K1NA 4RT7A 5TF9A 4FSYA 3ORLA 4NM5A 4K2EA 4J53A 3PXYA 2EV0A 1ON2A 2V5QA 3LJ2A 5JFSA 4NTSA 4W9WA 4LQMA 4F0IA 3AMAA 4WD5A 3DCVA 5HKMA 2ITPA 5DN3A 2WU6A 1AD5A 1JHHA 3NYNA 2DYLA 4CZUA 5AP1A 2XEZA 3NNXA 1TNSA 4S30A 5F6FA 4E6CA 2FF4A 5L3AA 4G9RA 5J7HA 4KRCA 2QODA 4Z9LA 3Q60A 4RLKA 4XG4A 4ALVA 1ZOEA 3Q6UA 5GJDA 2YWVA 4YJNA 3SXYA 1XMAA 1T46A 2R3MA 4BCGA 4FKRA 3DKCA 1XBCA 2YM8A 2B55A 3EFKA 3EKKA 1AGWA 1P92A 4OTPA 1ZYRF 2BROA 3BYVA 5G6VA 1SMHA 4I6BA 2O64A 1IN8A 5CLSA 4FIIA 4XRFA 4LFIA 5JZJA 4FTQA 2FSLX 1ULYA 3PFIA 1IN6A 2HW7A 5HX6A 4Q47A 4PMMA 2Y75A 3CS9A 3HV5A 3A7GA 1XGOA 2EFWA 3QRFF 4I6FA 2PVRA 1H8FA 4QPSA 4NCTA 2EFOA 2XYUA 1WAKA 3SLSA 4BDFA 5AR7A 5M07A 3JSOA 2C5OA 2HY0A 3PXFA 2KIFA 1RQQA 4OIPF 3ODYX 2BCJA 4G34A 3WE4A 3V6SA 1BI2A 3W2QA 2EA2A 2L4MA 3R2BA 4R1VA 3KQ7A 2ADUA 3MDYA 2X6DA 4U0YA 2YJSA 4MF0A 3G9LX 2WTVA 1K7AA 4EH3A 1STCE 4D2RA 3FZSA 1LDJA 2OO8X 2M1BA 2YCQA 3QLGA 3NNUA 1R5GA 4TN6A 5EKNA 2VRXA 3QKLA 3GLXA 4D5HA 2VBYA 4C02A 2K02A 1PDNC 3QC4A 4CLJA 3LA3A 3ZEPA 3VS2A 3HDNA 3HIFA 5LARA 4EOJA 1Y91A 2PMUA 4D2WA 5FEEA 2CN8A 3WF6A 4EK5A 4L7SA 3QQLA 2FUMA 2C1AA 4FEUA 2EB7A 5IDNA 3GC8A 1UFMA 3WTXC 1QPJA 4UBAA 3Q9VA 4V04A 5L6PA 3KULA 3ALNA 4O0UA 3K9TA 3KMUA 4S33A 3ZRLA 3F5XA 3RHXA 4BDJA 3MS9A 3F3ZA 4EOIA 3TN8A 4FTAA 5HZNA 2OKRA 4HGLA 5FFZA 1BX6A 3QQJA 3SGCA 5KMMA 1RDQE 4G8XA 3WI6A 2XK3A 3G6HA 4ANSA 3H3ZA 4AE9A 3OCTA 2ITTA 4GKIA 5H3QA 4FSNA 5TJJA 2KTYA 2P5VA 1T6SA 2OH0E 1GVJA 4FVPA 3BLQA 4WNMA 4YNEA 3GU6A 5CASA 2WO6A 3TJDA 3VUIA 1A06A 4E20A 2GNGA 1BI1A 5G1XA 2O3FA 1FQ1B 2BFYA 5M51A 4IACA 3G33A 4WG5A 2NNNA 1IW7F 3ZFYA 4LMNA 3K2LA 2ETKA 4CGAA 1VZOA 4RBLA 5IUIA 1MJ9A 2PEXA 4N9HA 4E6AA 5KKRC 4MD7E 3ZTXA 1XMKA 3RKBA 4KIQA 4LV8A 2UZUE 2V22A 2R3GA 3LIJA 4AGUA 4BRXA 1ZH5A 4FTKA 3GF2A 4XBRA 2LAVA 4H36A 3UNJA 3GVAA 3QRKA 5I9XA 4E7WA 4I22A 2XV4S 5HCXA 5HNIX 5JR3A 2WOTA 3F82A 4GS6A 4O7LA 2QENA 1Z9XA 4L9JA 3V8JA 1ON1A 3QPHA 2YCSA 3JS2A 4MWIA 5CAQA 1AOYA 5HLNA 1YVJA 2XAQA 4FT5A 3I54A 3R1NA 3SQQA 5HS7A 4K18A 2QI8A 4AGWA 3POZA 4WIHA 1Q24A 2J0JA 1PF8A 3KE2A 1H27A 3SDJA 5I9VA 4ZLZA 4J7BA 3UOLA 5J87A 2PSQA 4LK0F 4KD1A 2OSCA 1WBOA 2NRUA 2C3KA 3TGNA 3FHIA 3TKUA 1Q8TA 2PZYA 4ALWA 3W2CA 3JAMK 1R7JA 4L68A 3Q2MA 4L01A 3PIYA 5CZIA 5I4NA 5BMMA 4J8NA 4HF2A 4D55A 4NJDA 2PVHA 2HIWA 5FLXZ 4IX3A 2QCSA 2XK7A 5CEPA 3H0YA 2QHMA 5EQYA 1HQCA 4UVBA 4FZ6A 3H10A 2Z5UA 1FP2A 3I71A 3TQNA 3C4CA 4U43A 2RSVA 4E73A 4CO8A 3H9RA 3SZPA 3TKIA 3I5ZA 4CFXA 3RPOA 4GCVA 5M4IA 4GK4A 3VF9A 3GB2A 4BCFA 5IUGA 5ILVA 3MCZA 5CQUA 3NDMA 3FAAA 4KKGA 1Y8YA 5K0XA 4KICA 2UZNA 4C3PA 3MB7A 4TWNA 3C7QA 3ZCLA 5KVRA 2L4AA 1Y57A 3KF7A 5HO8A 4JJRA 3NUNA 3UZTA 5ICFA 1WVYA 5ITAA 4V0GB 1HW1A 4QPMA 4FYOA 5H8BA 1OECA 3PSDA 4WA9A 3CQEA 5A6OA 3U4WA 4M71A 4YU2A 3Q32A 2G2FA 5EYCA 2YABA 2EFNA 3VJOA 3VRZA 2BUJA 1DAWA 3VIDA 5IPJA 4G1WA 5IQBA 3R9RA 5EW3A 4PL3A 1FINA 3HUBA 3RYPA 4JQ7A 4PL4A 3LPBA 5C26A 3R71A 3QUDA 3R83A 3ZZWA 4LMUA 4D1XA 5DH3A 1URCA 2K86A 3A60A 4XP3A 4LGHA 4WO5A 3VS6A 1KU7A 4QYYA 4R8HA 3PYYA 4I41A 4XP2A 3JY9A 4XEYA 4HQMA 3SRVB 3W6KB 3QOPA 4F09A 4NQWA 4IEBA 3THBA 3P79A 1O3RA 4HF1A 4G3GA 3V8WA 3OFMA 2R7IA 3ZO2A 5I9ZA 1JSVA 4LUDA 3FXZA 3OCSA 4FL1A 4O83A 2XVCA 3GBZA 5GZ8A 3GFLA 2PMHA 1Q8YA 5DIAA 2WTJA 3DAKA 3VS1A 5KX8A 5E92A 1X3UA 4W8EA 2BALA 4IRHA 3ZQ7A 4FIFA 2AXLA 5L2SA 5CEIA 2VBZA 4CV8A 3PVGA 2EV5A 5FDXA 4FZFB 2WTEA 4ASNA 2EU9A 4BDIA 3GOKA 1YHVA 3VRYA 3P9JA 2WTKB 2XAGA 2C6YA 4D2PA 4Y5QA 4F6WA 3MH3A 4U81A 2ACXA 3MVHA 3Q53A 4I01A 1JVPP 3K5VA 1FZPB 4CSVA 2OJJA 3KEXA 1OL6A 4DFLA 5BVOA 2RV8A 4RRVA 5HTBA 2G9XA 1OIUA 2FE3A 2HY81 4F9CA 3GU7A 3UNKA 3GENA 4BZOA 3COAC 3JPVA 1OL2A 4RJ7A 4D58A 1SVHA 2E9NA 4AS0A 3ROUA 4JT3A 4FKWA 3C5IA 3R00A 4ZYDA 4G3CA 4PPAA 3OY1A 2QR7A 1ZMUA 3MEXA 4YTCA 4BCKA 3PLAE 2CMWA 3C1DA 2R3RA 4FUXA 5FP5A 3BHYA 3GXLA 4C0TA 2G7HA 1GHCA 4WOVA 2YITA 4RVTA 2PVKA 3UG1A 5AP5A 2OZ6A 3J80K 5H6QA 3ORPA 3RK7A 3TZ7A 1CF7A 3QP5A 5D8LB 4YZDA 2PPQA 2YDIA 2HW6A 4CKJA 4MTDA 1W8CA 2RKHA 1NVQA 1F5QA 4U8ZA 4D4VA 3QPTA 4ENYA 4AG8A 4FTJA 3U1DA 5JEBA 5K5XA 2XKCA 3KETA 3C51A 5EW8A 3TNIA 2XBAA 2IW8A 5CF8A 3P9IA 5AUXA 2J7TA 4CRSA 1U54A 1YQJA 3ZLXA 3UQCA 2R7FA 3HP2A 4I0TA 4HYUA 1NVRA 5EG3A 5BUIA 4A9YA 5IDPA 3ORIA 1TQIA 4BWKA 5E8UA 4AFJA 4FTNA 3LJ0A 1U6GA 3HRSA 5E9EA 2J4ZA 2GQGA 2P2IA 4MCVA 2I0EA 4RA4A 4PPBA 4DBNA 3V8KA 3LQ8A 4EK3A 1P5EA 2GNLA 5FRIA 1OPKA 2B53A 2Y4IB 4OTWA 4QQCA 3GFEA 2C0TA 2WMTA 4RB1A 3BGPA 4IAFA 4NSTA 4WKQA 2BRBA 2P0CA 3UDBA 4CLIA 3LCOA 3E6DA 3WG9A 3COMA 3AD4A 3C4XA 4HJOA 1PXLA 4JRNA 2XZSA 1IR3A 3Q4UA 5H6RA 3K5UA 4L6QA 5AP7A 2D2WA 4BCNA 2IVVA 1JKTA 1H24A 3P7NA 2WOUA 1DI8A 1ZG3A 1CKPA 2KIUA 1IG1A 1R0EA 5LEKA 5D7AA 2PK9A 3PSBA 4UVAA 1B6AA 5EOLA 3GYHX 1TKIA 3FL5A 1XBBA 4OTQA 3UGCA 3CLOA 1PYEA 1YG2A 1KE8A 3BWJA 1J7IA 4U3ZA 3V3VA 2FNPA 3ULQB 4FBXA 4KMFA 4JG6A 4EC8A 3CPCA 3FM5A 4YJPA 5A46A 4XOZA 4ZJVA 4LB5A 1TTYA 2AC5A 4ZS0A 1QZZA 3QU0A 5ILUA 3DU8A 5IT3A 3I5NA 2GQSA 4PGGA 3MH1A 1IN5A 2X4HA 5JFWA 4HAMA 3TNWA 2WXVA 3K0LA 4PX6A 4DGLC 3RM7A 2OLCA 1F4KA 5FXQA 1KU3A 4A9SA 4E4XA 2PVNA 2J51A 3Q5ZA 4U45A 1H9TA 2PZRA 4CRLA 3D83A 2ZVAA 2NNYA 3QA0A 3V5JA 4A9TA 2M8EA 4R1YA 1ZYLA 4PP9A 2ZJ2A 5A4TA 4I6HA 5EM8A 5HBHA 3BJOA 1DP7P 3P9CA 5BVFA 3F21A 2VO3A 2PMNX 1L3RE 2JDTA 5DCMB 1OGUA 4WK8F 5CSHA 5HHWA 4DA5A 4CQEA 4I7HA 3EN9A 5CXZA 1PXJA 4FV7A 2YHVA 3TDVA 2Y8OA 4GJ3A 2MH9A 4U79A 2VUWA 1WQ2A 3NEUA 4TYEA 4BKZA 1MKMA 4ITIA 4RX5A 2MA3A 3TV4A 3OVVA 2VONA 2ITUA 3KK8A 3EQPA 3FXQA 2XKEA 1XSDA 3KVWA 2HEOA 4RWJA 3RP9A 4CKRA 4GL9A 3VUGA 1OKWA 1YOMA 4MKCA 5ANDA 3VBQA 4YTFA 1YOJA 2FMYA 5BQ0A 4M66A 2PUUA 3GFMA 5D9HA 5DR6A 5J8IA 3D5LA 3LW0A 3Q3BA 3HV4A 4BDHA 3QWJA 4IVCA 1JKLA 3V5TA 5KBQA 3HGKA 4JX7A 3MFRA 5AR4A 4HZRA 4G17A 3T8OA 2HWPA 5EOBA 4CT1A 4DFZE 1E9HA 1T38A 3HMPA 4D5KA 4ANBA 4PDYA 3VUTA 3I7BA 3FWQA 1TLHB 3T9TA 2H9VA 1WBTA 2F49A 2WTIA 2K7LA 2XIKA 4MD9E 3DF8A 1HKSA 1ZWSA 4GEOA 3ML6A 1H07A 3RPVA 3NIEA 1JLUE 4X2JA 4TWPA 2EFQA 3A99A 3OV8A 4B8XA 3ZH8A 1R1VA 4KNYA 2QM3A 1L3LA 3FI8A 3HTSB 3IO7A 1YHWA 1JOWB 2XRWA 2CNQA 1OMIA 2Z8CA 3VS3A 3QX2A 3T0YA 2C6TA 4P55A 3HRBA 3CR0A 4AGCA 3V01A 4FT7A 5AP6A 4DH3A 3RAWA 4BDGA 4IAZA 5BUEA 2ISZA 4C4JA 1XH9A 3I4BA 3AGLA 1RW8A 1Z57A 2WIHA 3NW7A 3QA8A 5CVVA 3L8XA 4U41A 5LRSA 4ZK5A 1ZRFA 4IADA 4HGEA 4EL9A 4IIRA 4QP2A 2FMLA 4BR3A 4TZRA 1BL6A 4PTEA 5GNKA 3LCTA 3PY1A 1I09A 3SOCA 4U6RA 1P4XA 5LCJA 5JI6A 2QLQA 3E3PA 4N6ZA 3UPXA 4AOTA 3ET7A 2HTSA 3F3XA 5D5VB 2X2KA 4YIFA 1JAMA 1ZGJA 3O7LD 4CG8A 5AR5A 3KK9A 3MJ1A 4M6XA 4E4NA 3OW4A 4XV1A 5H2UA 4U5JA 3W2OA 4LM5A 4H3PA 5CVRA 2Q0BA 4KIFA 3NVMB 1YWVA 2VV9A 4ZTMA 3FI3A 5AJQA 4XV3A 4UV8A 3NYOA 2PE1A 2C5XA 2XIRA 5IUHA 4MNEB 1PXKA 4BKJA 3WILA 2F5DA 3VBYA 4IXAA 3M2WA 3PG1A 2ZM4A 3Q4TA 2A61A 5IQHA 3EQGA 1XHAA 3ZPLA 3B8RA 3WOWA 3E92A 1B39A 4EWHA 2C6IA 1U5TB 4CMTA 4FNYA 3F6XA 3W10A 1FC3A 3TZ9A 3BYSA 3O7LB 5AUYA 2FB8A 1R5HA 3PIXA 3LQQA 3QTRA 4NU1A 2RG6A 2VODA 3R28A 1SNUA 2VGPA 2V7AA 4XNEA 2W17A 3WZKA 5B7VA 3K2ZA 5KZIA 3C4WA 1IN4A 3E97A 3BWFA 3BZ6A 3I53A 4FV6A 3EZRA 3CJNA 3HDMA 1FSHA 2G15A 3EWHA 1YS7A 3SA0A 1FBSA 3MYGA 3EQDA 4R5YA 4Z2YA 3WTZA 3GP0A 3MZYA 3ERKA 4QMOA 3EQBA 2VWYA 2VTTA 3BX5A 4JG7A 4DTAA 1YXVA 2VTMA 3MA3A 3NRMA 4DC2A 3PWDA 2XK4A 4FKGA 4UB7A 1NA7A 4DLJA 4KINA 4QT1A 3QXOA 4G6DA 5E8ZA 2EWNA 4HX7A 4CEGA 2QR8A 2EXEA 3DDPA 2CSOA 4ZYEA 4ZSAA 4FV4A 4C35A 3ABTA 2Z7SA 4JVGA 2CGUA 2V79A 5B2KA 1PMNA 2EUFB 4RSSA 3EQLF 5D6FA 2UW3A 4YJUA 3MFTA 1IAHA 2GIVA 3SQNA 4L46A 2YIWA 4I2OA 4ZSJA 1Z1DA 3HMOA 4PNKA 4KABA 3GC7A 4EM2A 5LWMA 2JBOA 3QZIA 4PMTA 3IW6A 3OHTA 4R3CA 4ZP5A 1LJ9A 5HTIA 2X2MA 3JAMZ 4F6SA 2XS0A 2GA1A 3CUQC 1KE6A 3ORXA 4FC0A 4DQ2A 1FBQA 3K54A 3BV2A 3WTTC 1Q8WA 1RUOA 2EK5A 4O0YA 5EDQA 1OITA 2WIPA 3BGQA 4WXDA 3TDWA 2QU5A 1S9IA 3UE4A 3U6HA 3OCGA 3UOHA 5CU6A 3WZEA 4EH4A 4NW5A 2HTJA 4N0BA 5BVKA 2J9MA 4A12A 3SC1A 5CVGA 3CCNA 4JQ8A 3TI1A 2C6DA 3FMSA 4EOQA 5CVUA 1IASA 4HYSA 4IF4A 1REPC 2HK5A 3C0HA 4L42A 4HV6A 2VX0A 4MK0A 5BPDA 1DS5A 3WGIA 3LQ5A 3TNHA 1YWRA 4ZAUA 3VUMA 4YBKA 3OZ6A 4KIBA 5HLIA 3C7JA 2XK8A 2FU4A 3CGOA 4M97A 2WMQA 2PQ8A 1G3WA 4RLLA 3K3JA 4E70A 2OWBA 4ITHA 5GINE 3LFCA 3GUDA 5I3RA 4M7IA 4QMQA 3I0QA 4DH5A 5AP4A 3FZVA 3FEGA 4E5WA 4RX8A 3FC2A 4BNCA 5CF4A 4XG9A 4FT9A 3PJ2A 2X8DA 3DLZA 3EN6A 1OUKA 5L2QA 3C3WA 3UIXA 3ZN0A 3M1SA 5FEDA 3VUKA 4FSMA 2HR3A 1GOLA 5A4LA 3HKOA 3QBNA 2X8EA 5AX3A 3PVWA 2E9PA 3TNPC 3IRQA 3IQ7A 4G7ZF 4HV5A 5CYIA 2XIGA 3VO3A 4FOCA 3ULIA 2C30A 4GVAA 2QQ7A 3AG9A 4JQEA 1Q41A 2CGWA 4PNIA 3L9FA 3HLLA 1ZMVA 2WMVA 4RG0A 5CNOA 2Y6OA 5IA1A 2VT2A 3TACA 2F2CB 2RC4A 1C0WA 3DTCA 3ACKA 4CXAA 3UO6A 2R3JA 5TKDA 1E1VA 3ORZA 4F4PA 3RZBA 4HNFA 2JIUA 2QG7A 3E6BA 3G0FA 3RDIA 3KP5A 2O8YA 3FLZA 4G3EA 1WMKA 1ZAOA 2W5HA 2ITZA 3ETAA 3KP4A 4FIEA 1BLXA 3M8EA 4EUUA 3ZMSA 3HMNA 3U2RA 1LEZA 4ZJJA 4UZHA 4X3JA 5DOSA 3DAJA 2IRFG 3RNYA 3CO6C 3BEAA 3O50A 3BHHA 3KXMA 3NUUA 4ZTSA 1H28A 4MBIA 5C03A 1XSVA 3QRUA 3NNVA 5D1JA 3BU3A 5D7VA 2FBHA 3OXTA 4PDPA 3L09A 2ZMEA 4ORKA 1MRVA 3BHVA 5DD8A 5AP2A 5DWRA 3MWMA 4HW0A 1UKHA 4O0RA 4MXCA 4BCOA 4EJWA 4FVQA 4C37A 4O0XA 2DO7A 4K0YA 4AZTA 3GCQA 3V51A 3WU1B 4QMSA 4FUYA 4LRMA 4EYJA 4UUVA 4I6QA 4EHEA 4GV1A 3EMGA 2A0CX 1D8KA 1OVEA 5BOXA 5CAUA 3Q52A 3GQIA 2J0IA 3RI1A 4HX4A 1PXIA 4ZTNA 3CQWA 4Q4ZF 3IK3A 1I6XA 3GZ5A 2W9FB 4XRJA 4UNOA 3PG3A 5D4RA 3RI4A 5DVRA 4UMUA 2WQOA 3RZFA 5D12A 5C8KA 3J80Z 2OA4A 1VR2A 2IP2A 4X6RA 2JKKA 2XYNA 2GHGA 3L1SA 4FF8A 1UU9A 3NCZA 2CCHA 4FL2A 3R61A 4EJNA 4AF3A 5IQAA 4O27B 3TUBA 5HDNA 2EFPA 2EV6A 2WELA 5T6KA 2YM5A 3D5WA 2O0YA 4LYNA 4PV0A 5GJGA 5B0XA 4KAOA 2YCFA 3KN5A 4U3YA 3UNZA 2W57A 3HHGA 4F63A 5CEMA 2YZLA 2EJRA 2HOGA 4M67A 4DCEA 3ORTA 1UU8A 5CZHA 3ZC5A 4FV2A 4DHFA 4TPTA 3V5QA 4RJ5A 1M7NA 2VC0A 4O21A 2XF0A 4LJZF 3V5WA 3RKXA 4O7VA 3ABUA 5CAVA 3D5XA 5ETCA 5AA8A 2R9SA 5LOHA 4RGRA 1DPUA 4QYFA 3QKKA 1O3TA 4BGHA 2XKFA 3KP7A 3R02A 1H1QA 3LCKA 4D4RA 2XJ2A 5ANGA 5KMJA 3CTQA 4AU8A 4DEIA 2GHLA 3E93A 3VS4A 3FV8A 1L8TA 2YR2A 5DEQA 3RPSA 4WXHA 4AWXB 2RIOA 3WARA 3DT1A 3M11A 3R7IA 5J9LA 5HIEA 2QQBA 2PY3A 1YXTA 3SG8A 3TT0A 3CUQA 2CGXA 2PMIA 3QU6A 1YI4A 4WBBB 4J8MA 4PL5A 3D4QA 3KRWA 3BHTA 1K79A 1QPCA 1K2PA 2AC3A 3P1AA 3MVMA 4FKPA 5JVTA 4HGTA 3IL2A 2FEZA 1USSA 5HICA 3PWYA 3UMXA 4O7TA 3VS5A 3WGHA 4TYIA 4PDKA 2WGJA 5BS6A 4PUZA 4L52A 3JW4A 4O2PA 1SVEA 4FZAB 2R3SA 2QOBA 4LUEA 3QRTA 3LSTA 4GCJA 4EH8A 4O0SA 4QQTA 3DP7A 2STWA 4C33A 2BRNA 4G6QA 2VE8A 2XIZA 4B0GA 1SFXA 4O84A 4U7BA 4KIKB 4M8TA 1PXNA 1OZ1A 4NWMA 1U4DA 4F1OA 2OJFE 4EQQA 4Y17A 2WPAA 5AV0A 2WKMA 4X2FA 2HXQA 3HV6A 4DFBA 3Q9XA 2IO6A 4I09A 4J95A 3I0TA 4FEXA 3M42A 3WE8A 4ZEGA 1GIHA 3GCSA 3Q5FA 5D41A 4ANLA 3WYXA 2CKQA 5HS9A 4YFXF 1ZARA 3PSCA 2DFIA 4HPUE 2P7VB 3NW6A 2NO3A 3HOTA 3UVQA 5A54A 1KUTA 4XLVA 4U42A 2YJRA 3ZMUA 4GSBA 5C4KA 1R22A 1X8BA 3WE2A 1XD7A 4FV8A 4IX4A 1PYXA 2F5CA 2FH9A 5HO6A 2UZWE 4ZTHA 3P0MA 3R01A 3HSRA 4E93A 4BHCA 2X4FA 3AT2A 3OOPA 2CKEA 2FSOX 3UBDA 4ARKA 3LFAA 3M8FA 4BY9E 4BFMA 2W0JA 5AUWA 2I1MA 2VXZA 5FFXA 4BWPA 4A6EA 3CTJA 2JKMA 1FLIA 5CTPA 2IN6A 4E5AX 2KULA 2IW5A 3A4OX 2BFXA 3KZYA 5BVWA 1Z05A 1PKGA 3OW3A 4MNEA 2Q83A 1U5QA 4PRJA 3RK5A 4X3FC 2QYOA 3ECOA 1SM2A 3AC8A 2PVLA 5E1ZB 3A8XA 3KL8A 5EQEA 4NHJA 3PP0A 1ERKA 1U5TA 1B9NA 2BAJA 4M12A 4XG2A 3PXQA 3S3IA 2P6SA 1R00A 2XCHA 2PFBA 4UWBA 4N9IA 2CNVA 3EYIA 2J2IB 3LQ3A 3MI9A 3FY2A 3C0IA 3HYHA 5KHXA 4HGSA 2BPMA 3TIZA 5CF5A 3KKVA 2MLKA 1ZN2A 1GIIA 2H6DA 3NUPA 2ZM1A 4RQKA 5IA0A 3NMUF 4LGWA 3BJAA 1G4DA 1NVSA 3D9VA 4BCPA 1GAGA 4LRKA 3R0AA 1HSJA 3FKNA 2HKXA 5JFXA 4DEDA 4KA4A 5BVDA 2R7DA 4F7NA 3UIBA 1YXUA 4JOAA 4YO4A 1YI6A 2C3IB 2BDJA 3NEWA 2WAJA 1KE7A 5HE1A 4DEGA 1ONVA 4AN2A 1SD6A 2RF9A 4I24A 1IRKA 3P08A 3R8ZA 4QLCU 3OF0A 3WF5A 3WZJA 3QD3A 4AW0A 3MTLA 4HDVA 4FG7A 4QQJA 5FQDC 3ZFXA 3W16A 4XX9A 1REKA 4M13A 3DXJF 4S05A 4K8AA 4F7JA 4NKAA 1WBVA 4LG0B 5ICEA 4A5NA 3UVPA 4I02A 4QP8A 4WHZA 3M7GA 3HV3A 2DI3A 2VWXA 3PTGA 3L9MA 4G6LA 2ELHA 3MSSA 5EYDA 2OI4X 3D7TA 4YMJA 2ESNA 5J5SA 3OTUA 1LUFA 3KF4A 4AT4A 3AT3A 3QAME 1YXXA 1O6KA 4QMWA 3Q6WA 3B2WA 1MP8A 3F7WA 2P2HA 4GH2A 4LL0A 3GXOA 5DI1A 3R8UA 1A48A 1TQMA 3CDHA 3AT4A 4IMYA 3SW4A 1UKIA 3IPHA 2UW9A 4RA5A 2JT1A 4GK3A 3I81A 3MVLA 3BYUA 4XLPF 2OG8A 1F0QA 5TR6A 1W5SA 1D5VA 3LFSA 3DXPA 1K6OA 3FXWA 2QWWA 4YHTA 1S7AA 4I98B 2VWZA 3SVVA 4RS8A 5E18F 5DFPA 1XH6A 1IRGA 1H0MA 3FL4A 1H00A 3OC1A 4KFCA 4Y5HA 5E8XA 1GXQA 5TE0A 3LXPA 3BIZA 2HYGD 5C01A 1FVRA 5HG5A 1XGSA 2YA9A 4M0ZA 4Y15A 5HE2A 2J0MB 5HVYA 1XKKA 3ZMTA 5HU9A 3Q9YA 2YWPA 4L8MA 5D4SA 3VS0A 2P8TA 3MJ2A 4EHVA 5ETFA 3EH9A 2HZ0A 2IZUA 1UU3A 2C6LA 2NNWB 2CYYA 4P2KA 4EONA 4OTDA 5AMNA 3I4PA 3KRXA 5DYJA 4CFVA 5H20A 2YSRA 4LOQA 3ELKA 3HOSA 3Q9SA 4H05A 2WZJA 4TY1A 1JHFA 4Y46A 4FKUA 3RAKA 3FKOA 1R58A 5C8MA 4IB0A 3R1SA 1YW9A 4DYMA 4IFCA 4KKHA 3VS7A 2W1ZA 4BCIA 1OYYA 4KB8A 3VB2A 4QNAA 3E87A 3WTSC 4ZZNA 2V9VA 5HNGA 4F9WA 2VBXA 4JK1X 4R6VA 2A68F 5JN2A 4ACCA 4FKTA 5IG1A 4Z7GA 4E3CA 4ZZMA 4BKYA 1FVVA 4FV5A 4O6LA 3M9AA 5M4FA 3R8MA 5CT0A 1Q4LA 3ZMMA 3E6MA 2OICA 4JBVA 4USEA 3HRMA 4BXUA 4GW8A 4FG8A 5LWNA 2MBFA 4EQCA 4BHBA 1KU2A 2XASA 5L8LA 3SAYA 5H8EA 2GHMA 3GCPA 4KBKA 1V4RA 3G3ZA 3HSEA 3R22A 4MXYA 2ONLC 3SZTA 3UO5A 3CO7C 3OEZA 2Z7QA 5EHLA 3AMYA 3MY1A 5DLSA 3V8SA 1XGNA 2O6GE 2XM8A 2XNMA 1OKRA 4MQVA 1QL6A 5DYMA 4H39A 4CV9A 3EYHA 1SMTA 2KKOA 5DUKA 4FGBA 3CTAA 2YAAA 5BYYA 4FTLA 2K4BA 1BIAA 4TYHB 3QHWA 5J9ZA 3FQEA 5I5ZA 1ZZ2A 3ISPA 2WQEA 1FOKA 4X3FA 4QMUA 4JRVA 2ITXA 3KLOA 5CSWA 3C4EA 3W18A 3FXUA 1MRYA 4OUCA 3OT3A 3QD0A 5AX9A 3WZDA 1MQBA 4G31A 1ZYJA 3MVJA 3F3TA 3R0JA 3SHEA 4BAYA 1G3SA 4EHGA 2VTIA 3PRIA 2BAKA 4BIDA 2FNAA 2C6EA 1ZRZA 4D2SA 4M15A 5ICGA 3C0GA 3GX4X 1ATPE 2MLGA 2GTMA 1M2QA 3UG2A 4EOKA 3AGMA 3RWPA 2GPHA 4UMRA 4RB0A 2GTNA 3V6RA 1T2KA 4ESJA 4O7RA 3E63A 5LLQA 3K1PA 4BHNA 5EQPA 2D45A 5CVJA 1WZYA 2JD5A 1G8SA 1B1BA 4C4GA 2WHBA 2ETMA 4A9UA 4PY1A 4R1HA 4M72A 4CMUA 5A4QA 4BWXA 3MBLA 1O7FA 4FKSA 3HHHA 3TCPA 3BGZA 4W4XA 3FI4A 4EYMA 4F9BA 4RB2C 3VW6A 3AAFA 3L8SA 5JH6A 2VAGA 2R3OA 4UXQA 1YRPA 1UNLA 3FX3A 4EV0A 4RIYA 4YHJA 1T0FA 2YDJA 3PA3A 3DK7A 3E62A 3LZBA 2V6CA 4FKIA 3QTXA 2OXXA 5J1VA 3FXXA 3Q2JA 4ENKA 5CI6A 5CAOA 2W99B 3BKBA 3HA6A 1JQHA 4J52A 3S2WA 4BCJA 5CEKA 1E1XA 4MTAA 2H6BA 4EGZA 2Z9OA 4YLLA 1Z6TA 4UN0C 1REJA 4XSXF 1DPRA 4UXLA 1J7UA 2XVDA 4QP1A 5AV2A 3JSPA 4XYFA 1YTYA 1OIQA 2W1EA 3R6XA 2RGPA 1FPQA 5D11A 3UODA 3CUOA 4EH9A 1MDMB 3FMHA 5CS6A 2Y0AA 5EYMA 4BTKA 4M9ZA 3D7ZA 1TBXA 3CY3A 1J7LA 1QMZA 3ZXTA 2WWYA 1HKTA 4TYGA 2HYYA 4TWOA 2WQMA 2BDFA 4G5PA 2JAVA 1S7OA 2BRMA 4NFNA 5KUPA 3W2PA 1ZRDA 5DT0A 3RM6A 4UMTA 2DTRA 2JZYA 1VJYA 1JKKA 4XG8A 2A27A 2VOPA 4MQ9F 3SFZA 2UXNA 3RNIA 4QMVA 2R3IA 4FKQA 1PHKA 5E90A 4NH1A 1QNTA 2HYFA 2OIQA 4FNXA 4M0YA 4ASXA 2BZIB 4RB3C 3ZUUA 3KMWA 2V0DA 1OMWA 4OINF 4C4FA 1YIOA 5C27A 3DB6A 5AUZA 4RFYA 3U87A 1H9GA 2A69F 3ZSHA 1BIBA 1ZY5A 1KOAA 4KUMA 3DS6A 4JQFA 2C6MA 3HSFA 5JFVA 2F7EE 2D1HA 4QWQA 3EKNA 4JBOA 4WUNA 2CKOA 4PMPA 1Y8GA 4XV2A 3JY0A 1WVWA 4AA5A 4OW8A 4NYEA 5JT2A 3NAYA 4AD9A 3MY0A 2BEOA 3II5A 2VOOA 2X7FA 5IH5A 4BHPA 2O61A 4PP7A 3QCYA 1YDSE 3ZMDA 4DH7A 5ED4A 3FE3A 1XBAA 1JXSA 4BDEA 1MJAA 4YZNA 3G9NA 2I7QA 3JTGA 5KMNA 2FSTX 3BCEA 5AAFA 4M73A 4EOLA 3W55A 2BDWA 3S2PA 5J95A 4FGRA 2WD1A 3MFKA 3MZHA 4O7YA 4XBFA 1IA8A 4QOXA 3S1HA 2BRHA 1OI9A 2YN8A 3LFQA 2IWIA 5A2QK 1OYWA 4HVIA 1U3EM 5LRRA 4NK9A 1YYVA 3EETA 3DK3A 4HPTE 4U88A 4EORA 3QZGA 2C6OA 3WTVC 3FMQA 2ONLA 1GJOA 5CWZA 3EZVA 3NNWA 3ZZEA 4ENNA 5BX0A 4Q2AA 4Y85A 4AOJA 3N4UA 4FSTA 4ZYHA 4RIXB 4QYHA 3ZM4A 4Z55A 4MHGA 2ERKA 3I60A 1BC7C 2FOKA 2ERZE 1U59A 3VJNA 4WSYA 3R73A 4MXAA 5C8NA 4WXCA 4GYIA 4UVCA 5IMXA 4EOPA 3EL7A 3FKLA 3IDBA 3LA2A 2J5OA 4F0GA 1VEBA 2O5KA 4UMQA 1W98A 4D4SA 3HRTA 3U9CA 3GQLA 3PRFA 3ZEWA 4J1RA 4C4IA 2BVAA 4NUSA 4TNBA 1LPUA 2B9HA 1UCRA 3WBLA 4JG8A 2PE2A 4GVJA 4A06A 1RI7A 4E26A 2R3NA 2VTSA 4MEDA 1V3FA 3QHRA 4FZDB 5HBJA 2QBYA 1OL7A 3VBWA 4EJVA 3DFCB 4M69B 1YS6A 5LEJA 4CXFA 4IWOA 3V7SA 3V5PA 1ZREA 3G0EA 2P7CB 3ZUVA 3EUHA 2O63A 3NX8A 4CFMA 1UWHA 2IZRA 5K5RA 4CICA 3F7ZA 4YZ9A 3DBFA 3R04A 4L3LA 1BI7A 5AIQA 3VUDA 4YHFA 4RVKA 5FGMA 3FMEA 1R78A 4IWDA 3OBJA 4U40A 3CJGA 4FV3A 4MXXA 4R7IA 4QTDA 5J9YA 1RJBA 4I20A 5ANOA 5AIPA 3E7VA 1O7LA 2DS1A 3U4UA 3DB8A 2XIXA 3S0OA 3GFJA 1O9UA 4B99A 4FV9A 2V55A 4XG7A 5JRQA 2C1BA 2VO0A 3BRBA 1Q97A 3TNQB 5IF1A 2A6HF 3I5UA 2O2UA 4II5A 2GDOA 2W24A 4GT4A 1R1UA 4EUTA 2HFHA 4GIIA 2FO0A 4RMZA 4EH2A 2YLEA 4FTCA 1URWA 1GZNA 3TO7A 4OTRA 4U80A 4M9SA 4YTHA 5GHVA 3QZHA 3COIA 4WUAA 2YEXA 4BBFA 4O82A 3TKHA 3LFFA 4FA2A 4P5OA 2XNPA 3PDTA 1ZLKA 4R7HA 4BDCA 1FYMA 3OXIA 2I0VA 2YX7A 3NUAA 5FD2A 5D10A 3CE3A 4JLCA 4TXCA 4QYEA 3HMMA 2ZJWA 2HAKA 4IWQA 4FTUA 1UB9A 4JBQA 4BB4A 4BYIA 1Z9CA 2XBJA 2JDSA 4JNWA 2BZHB 1G3NA 4Q5HA 3RKWA 2A4LA 4RIOA 3L8VA 3PVUA 2YM3A 2XRUA 4NM7A 3M1EA 5HOOA 3JUHA 5AADA 3DQVC 4NEUA 1ZZLA 1IAJA 2VTLA 3RBWA 3VODA 2V1UA 1W0XC 3IW8A 4XLNF 4EGYA 2XB7A 1V0OA 5BNJA 4J71A 2VNWA 3KEQA 3A62A 2GZWA 1J7KA 3R8VA 1W7PA 4QTAA 4EZ5A 1L0OC 4WSQA 1YXSA 4KIOA 4G9YA 2LF7A 4IQ6A 4FVRA 3DK6A 2DQRA 4G94A 4EOOA 4IANA 1J1BA 5IQEA 5H9BA 2X39A 2C4GA 3KULB 2XKOA 5JGBA 4MGRA 3EIDA 2OGVA 4MXZA 3QAHA 3ZDUA 4PTCA 4AIKA 3EHAA 1YDRE 4C38A 4I21A 5I9YA 4UXNA 2F2UA 4YFKF 2VTNA 4AOIA 4FT3A 2PBIA 4FKJA 4I0AA 3VAPA 5JHUA 3BYMA 2OZAA 4NT4A 2QHNA 3VUHA 4R8QA 2STTA 2CGVA 3NS9A 4BGQA 3EQFA 4LRJA 2RN7A 3ZLYA 2VC1A 4DINA 4N6YA 4ACMA 2RFNA 3AD5A 3O6BB 3JTHA 4QMYA 2M87A 3I1AA 4CDGA 2QLUA 4CNHA 3R4KA 1BOAA 4G6NA 1EV7A 4MD8E 1UHMA 1BM9A 3EOCA 1P4OA 3IDCA 3IW7A 4L53A 2NRYA 4S31A 4WNKA 4LI5A 1R39A 1J75A 3NUYA 2R3HA 3E8DA 3GFWA 3OWLA 4YZCA 3NRVA 3I0OA 4GG7A 4B09A 3ZM9A 3RWQA 4JL9A 3QTQA 1JE8A 2IA1A 2NPQA 2FA2A 4J99A 1YO5C 3CBLA 5E8YA 1K78A 4I94A 1SFEA 1OPLA 4ZLYA 4C2VA 4BIBA 1KOBA 3GVUA 2ITOA 4FR4A 1IA9A 3NQOA 3BJ6A 3VC4A 3RJPA 5L2TA 2PI0A 2XNOA 3GZ6A 5HVQC 5HGIA 4DTBA 3FMLA 3RAHA 1IAWA 3UO4A 3IKAA 2R0IA 3LFKA 3DFAA 4YZBA 1H0WA 1DI9A 3TG1A 2BILB 2XH5A 2Y9QA 2R3FA 4PF4A 2BE5F 4IPAA 1GY3A 4L00A 5LHHA 2B1PA 4FKOA 2DBBA 2YDKA 1BC8C 4ZTQA 3QQHA 3NZ0A 2LKPA 2OIBA 1O57A 3ULZA 1FBUA 1S9JA 4DG3E 2PU8A 1K3AA 3ZMZA 3R1QA 3EYYA 2JKOA 2YISA 1KV1A 3QKMA 1HKQA 4IJPA 4MWHA 3E5AA 3DZQA 4BYJA 1OKZA 2YCRA 4BN1A 2Z33A 2LDUA 3ZSGA 5AP3A 5K0KA 2OQRA 4KS8A 5M57A 3KGAA 3FMMA 4XS2A 2YM7A 3OY3A 4A0YA 2VWWA 4YNOA 3ZO4A 4H0EA 3HL7A 5F4NA 1PMUA 2J0LA 3U8WA 2XAFA 2ZFWA 3I59A 3F8MA 3NUSA 1LNWA 1I44A 3GEZA 3CXWA 3AC3A 3GU5A 3ZC6A 3QL8A 1M14A 1T98A 1W84A 4D0XA 4O96A 3E5XA 4PPCA 4CKIA 2ESHA 4LLGF 4FMQA 5TOZA 3DPTA 3IW5A 1H01A 4NIFA 4BI2A 4WRSA 5AAEA 1QQIA 3CPBA 3QTUA 3SXRA 1B4AA 1P14A 3R8LA 1LVAA 4AT5A 1Q1HA 1TVOA 2QO2A 3C1XA 5LGUA 3UVRA 4K9YA 3BBTB 5HESA 5FGKA 2OAZA 4KSPA 5KMIA 5AR3A 3RVGA 4N0SA 3FC1X 3OOMA 3N4TA 2HKOA 3WTYC 3DKFA 5CANA 4QP3A 2XKDA 3KXGA 3RK9A 4B8LA 5E91A 4IM0A 4K2RA 1R3CA 2BR1A 3C9WA 5A14A 2CNUA 4LV5A 4O5VA 1KU9A 3ZUTA 4IAIA 3VN9A 4ENJA 3LAJA 4UYNA 3V7RA 4JI9A 3CTHA 4QRCA 3F5UA 4QTEA 3L9NA 1VTNC 3FMRA 4QP6A 2XK6A 5IT9K 4ALUA 3DAEA 4P5ZA 5HLPA 4IX6A 3GW2A 3P5KA 3ZLSA 4RX9A 3O51A 4L67A 5HTCA 3PPKA 3WIGA 3W6JB 5A3XA 5EW9A 2QOFA 3IS5A 3KEOA 3KY2A 4GG5A 1XSXA 4WCGA 3BLRA 1NW1A 4O1PA 3IKTA 3U9NA 3DDQA 4QMLA 1FSEA 2ZNYA 2F7ZE 4IZ7A 1U78A 5LXMA 4ZYGA 1D3YA 2PJPA 5E1SA 1KV2A 1J2XA 3OROA 2R7BA 3RYRA 1PW2A 4BICA 1CKIA 4F64A 4HBLA 5CQWA 2XNGA 2ZB1A 1ZHFA 3R7YA 3QYWA 5HBEA 3ZBFA 4X7QA 4O3MA 5E4HA 2XJ0A 4XH6A 4BDDA 2DQ7X 4QMZA 3QCSA 2QO7A 3J81K 5CSVA 5J8FA 2GU8A 1O6YA 4R7BA 2P33A 4GMYA 1OBGA 5GIPE 4BYYA 4EZ3A 1PMVA 2QZ8A 3TZ8A 4ERKA 5BVEA 5DR9A 2JDRA 1UHWA 3L7WA 3FMKA 4IB1A 4J96A 5EI8A 3GU8A 3FPMA 4YLJA 2RDPA 4NFMA 5DBXA 4RIXA 5DR2A 5M09A 2O65A 3PFQA 2WEIA 5K9IA 2J5EA 5HEZA 2DLLA 2IVSA 1BJAA 4KWPA 4O0VA 5B2MA 1BMKA 4CYJA 1YQAA 4IAKA 3QWKA 4XP0A 4YG2F 4E4MA 2C47A 5C9CA 1TNTA 4I23A 2WTKC 3FLYA 1E17A 4KBAA 2QOIA 5EHYA 3OCBA 4IC7A 3D5UA 1W4MA 3TXOA 3LA7A 3UOJA 2E9UA 4MNFA 4FTIA 3QUPA 2OF2A 5E8SA 4D9TA 2I0YA 4IZYA 4E8AA 5AUUA 4CFFA 4IM3A 2VX1A 4RJ6A 4YZMA 5IEYA 4PGHA 3IG7A 3UJGA 2W25A 4USDA 5BMZA 2WTDA 2GS2A 1UU7A 2LF8A 4KUJA 5GJFA 3LVPA 2PUNA 5HVJA 2REIA 2E9OA 3H3CA 1HCKA 5EH0A 1BKXA 4DEAA 5FBOA 4L9NA 3E5QA 1ZXEA 2IA0A 5D5XB 5CT7A 1KA8A 5D5UB 4AN3A 3C5UA 4OTFA 1CF7B 5E1XA 4M69A 3CD3A 5KKRB 4C57A 3GGFA 3D5VA 3O0GA 3E3VA 3O23A 4FSWA 2W06A 2IJMA 4HCVA 5HD7A 3PE1A 5AUTA 4DFXE 3DA6A 3BROA 1G6NA 2FSMX 5HVKA 3PQJA 3EFLA 4IB5A 5AUVA 4ZSEA 3VQHA 5DUIA 2YIYA 3FLSA 2RNJA 2RQPA 2IZSA 4IWPA 4YR8A 3O2MA 5CAPA 1R36A 3L8PA 4EJUA 3TTIA 3QP6A 3OT8A 2E1NA 1IXSB 1U54B 1T39A 3WODF 3PJCA 4L18B 4WG4A 5IA5A 1JKSA 4ITJA 2FQ3A 3NAXA 2H96A 2UW5A 1CM8A 3HECA 4HDUA 2W4KA 4FEQA 2GQQA 3D14A 4C58A 3BYOA 3KXXA 4YURA 3P4KA 4FI1A 4F1MA 5KZ0A 4YSMA 4UEUA 5FD6A 4HOBA 1YWNA 3U55A 5A2QZ 3IKVA 4CVAA 1K9AA 1KE9A 4ANNA 1HXDA 3TIYA 1GZ8A 2VNYA 3G6GA 2VTPA 1M52A 3AD6A 2NRAC 2ETRA 1GIJA 4FK6A 5CU4A 2YACA 3BI6A 3GCUA 4P5QA 1WBWA 5CEQA 3O8UA 2PLYA 3E7OA 4H3BA 1H25A 3L00A 4HZFA 3P86A 1I5ZA 3O2PE 1WFCA 2JLDA 1SZMA 2Y4IC 5IMEA 4LGDA 1QCFA 4KSQA 2J5FA 3NIZA 2WFYA 4U44A 1OPJA 4I5CA 1FYKA 2B52A 5KK1A 2GXBA 2PL0A 5C1QB 3TV6A 4J98A 4A4XA 4YP8A 2XNNA 2RKUA 3UP7A 4EOSA 4LFUA 4O0TA 4A4OA 3PY3A 3NWWA 2M30A 3OWKA 4MBLA 2XM9A 2XEYA 1UA2A 2FRHA 1FYLA 4Y83A 3B02A 3BOQA 4RWLA 3UC3A 3WZUA 2CLQA 3GOPA 2Q2EA 2CN5A 2LNBA 4JXFA 5M4UA 1KWPA 1PP8F 3FZTA 5CY3A 3ZSIA 2UZTA 4XV9A 5ETAA 5IA4A 3ODZX 4RJ4A 4IJ9A 1Y6AA 3A4PA 1FWZA 2XNEA 3EN5A 2ZO4A 2CGPA 4S34A 4RC3A 2WV0A 2UW4A 3DV8A 2ITWA 5HCZA 4OU0A 1PRYA 3H4JA 3RHKA 3P7CA 4OLIA 3K69A 1KSWA 4ZOGA 2JSCA 2E7WA 2EA4A 5FTGA 2BYVE 5TRDA 4V0GA 3T1BA 4UV9A 5BVNA 1FVTA 3NYXA 4R3PA 2PTKA 1F3MC 4UX9A 4G16A 3TDZC 5HE0A 3MAJA 2OK1A 2CDZA 1YHSA 5FTOA 2TDXA 4JDKA 5ANEA 2I40A 2XUUA 2QOQA 1W7HA 2NS0A 3FJQE 3LAUA 4GFGA 4PDOA 5FWKK 3DNDA 4FOBA 5HIBA 4A0XA 4UY9A 4PMSA 3N9XA 4G5JA 4C3FA 5EI2A 3TDUC 3ROCA 3A7FA 2XAJA 2ITVA 3SKCA 3GWZA 2UVXA 4EH5A 2IJLA 2YLFA 1XDSA 4I4FA 4EEVA 3SRVA 4FSQA 2DPUA 5E8GA 4KS7A 2VWVA 4KKEA 4V01A 2UWMA 4MEXF 4XHKB 2XUBA 3MPMA 4ACGA 3E64A 5E8VA 4AZFA 4HVHA 4OOIA 2FSWA 3IWFA 3OOGA 4MHAA 2IVTA 4IRIA 1LEBA 2UZEA 4XCUA 3HUCA 1OKYA 1UV5A 3G5DA 2QC6A 2QUFA 2BIKB 5FXRA 1UNHA 5FUTA 2WU7A 3KLNA 4ASEA 2DQLA 3MN3A 2HQRA 4MYGA 4OT5A 4A4LA 4QYGA 3DXNA
chains in the Genus database with same CATH superfamily
4WF2A 5IU2A 2W96B 3DQWA 3EFJA 2NVYJ 2QKWB 3L2VA 2XDVA 4AUAA 4A3IJ 2BVMA 4NM3A 2QGUA 4RQVA 3ANRA 2H09A 5L3DA 3HUGA 2EB3A 4K1BA 4XLEA 5A6NA 3MW1A 5J4VA 2O0UA 4XQFA 3E5UA 5DV5A 3FLQA 4L9IA 4DLIA 4B6LA 5ETIA 5L3CA 2LKSA 1AU7A 4Y73A 3AL0B 4E6QA 3RPQA 1Z5MA 3DJ5A 3SX9A 4IB3A 5KMLA 2ZDUA 1RIOH 2LKXA 4J01A 4EEFG 3IW4A 2O3PA 2VE9A 2CW7A 2R7ZJ 4O7SA 2W1CA 1O6LA 4GO1A 2OC6A 3QLFA 4ZJIA 1XR1A 1FJLA 5KMKA 3P7AA 3AQVA 3QGWA 3A0BC 2F2EA 1KQ9A 3CIKA 5IH4A 4TKSA 4A3CJ 1WZ2A 4KIPA 5ICCA 2BY0A 3DQXA 3UZRA 3QCXA 3BEGA 3H0ZA 3FI2A 3HM5A 5JKGA 2YIQA 4FNZA 3KCKA 1WHUA 4A6DA 4CFWA 3GLLA 2H8HA 3DTWA 2RGVA 2YERA 2Y2ZA 4MEYF 3L2CA 2W4JA 2X85A 2F4JA 4D28A 3QZFA 3DBQA 2FBIA 3DJ7A 5LMAA 5T68A 5BMSA 4MF1A 4G7HF 5J79A 3KEYA 1WJFA 1Z6RA 2WMUA 5IA3A 2O5RA 4F65A 2K40A 2XJ1A 3NW5A 3GI3A 5DT3A 3LMHA 4RX7A 1Z91A 4A0ZA 3O96A 2JK3A 2W5BA 4MBJA 4HVGA 5J1UA 3HAMA 2F5EA 3FZRA 5F20A 5HG8A 4I93A 2JUGA 1J3HA 4P9FA 3JVRA 3PA4A 1F5TA 5AIKA 4DT9A 1H26A 5AV1A 4EBWA 3W8QA 4DCAA 5K4JA 1WJ5A 1LQ1A 2HZNA 2XB5A 2DFEA 2OW3A 4Z16A 2PYWA 3BTCA 1OGYA 4DBXA 4XRLA 2UZKA 4IHWA 4GGGA 4HF0A 1APME 4DGMA 2VKEA 3QQUA 4IQ4A 3NARA 4AIJA 1I3AA 2GSFA 3BELA 5KAFC 4FX3A 2E60A 4QTCA 4C34A 4OAVB 2WMSA 3R9NA 1SVGA 4FTOA 5IZFA 3F2NA 2QD9A 3ZU7A 4XNFA 3TTJA 3GFIA 3NCGA 3WF7A 4IW0A 5BPIA 2BAQA 3P23A 3DKWA 1LEWA 3BQRA 3KZIC 3PIOF 3LXNA 4W9XA 3R63A 3VVHA 4EKLA 3PJ3A 2H6CA 2UZDA 2OJGA 2NVTJ 3COHA 1HCLA 1U5TC 3CCSI 3R7EA 3RTRA 3WHBA 3QYBA 3FSFA 4IVDA 2IF8A 5K5QA 4O7ZA 3R7VA 4ZTFA 3UC4A 4YBJA 3UQFA 4O0WA 4LLLA 2LP0A 3K7AJ 3DTKA 3EQCA 4OTIA 3FF5A 1QZEA 1HDPA 5CNNA 2XGXA 3RAIA 1JI8A 2GNFA 4G2FA 1OBDA 5EEHA 4V05A 4YPSA 4RWKA 2BGCA 2P5LC 4KIGA 1X4PA 3EB0A 2UW6A 4JIKA 3FPQA 5GIOE 3FMDA 3E88A 5TISC 5HNHA 3T3VA 1SMYF 2X7GA 1GLNA 3KCFA 2JDOA 4MFDA 4B8MA 3UYTA 3BY6A 5HORA 5B3SH 3NAUA 5E7RA 2JC6A 4AWIA 3DKGA 2GNHA 3O3KA 4D0PA 4A69C 3S14J 1R49A 1FIPA 3R9HA 2ZAZA 3KREA 3MD2A 4UWCA 1DM2A 4CZZA 4O2ZA 3HRCA 2XNBA 2BZKB 2PZ5A 4AZSA 4YO6A 3ZXZA 2LG4A 2CCIA 1VI0A 5F0FA 2BOLA 2A98A 4IFGA 5LMKC 5EM6A 4Z7HA 2BBYA 1DP3A 1FOWA 4FIGA 1Z0XA 2QKRA 3OEFX 2R7RA 4H58A 3ORKA 1YHQI 3HTUA 4BVUA 3A8WA 4B47A 4L9VA 1SD5A 3LJ1A 4JS8A 1PXMA 3TUDA 4QQ5A 2YPRA 3BPVA 4GU9A 3S32A 1SFUA 4HYIA 1YOLA 3KN6A 4ZY4A 2QOKA 4USFA 3DNEA 3LKMA 1E2XA 5F1ZA 4ZJZA 2XA4A 1T08B 2OH4A 3IH3A 2NAZA 3LWFA 5CALA 5A4CA 5LD2C 2ITQA 3LXKA 4UMPA 4GXOA 3EN4A 2E5NA 1APLC 2EXMA 2DK8A 3K3IA 3QXPA 5DCMA 3HYIA 3SDGA 3ZO1A 2O8KA 1J5YA 2WQBA 3ELJA 4L3PA 1NHAA 1RETA 2DAOA 3DJ6A 3MFSA 4KYWA 3MY5A 3HKZN 2BHHA 4O81A 3D0SA 3CKXA 3QD2B 2GXGA 5CU3A 2GS6A 4IHXA 2G1TA 3HP5A 4FT0A 4MQ2A 4YEJA 2JRTA 1JSUA 1MJBA 4M3DA 2ZKZA 2JA6J 1JT0A 3PO2J 5CLPA 3GC9A 4D0WA 4Q9SA 4E7KA 1IUFA 5F1RA 4GT5A 4ACDA 2B54A 4IM2A 2VJ5A 3GTLJ 4ZS4A 2CQ7A 3ZOBA 5HX8A 3BP8A 4KN4X 4C62A 2OQGA 3R60A 3AC5A 4K33A 4AGDA 5LHGA 4RGJA 4G6OA 1O3SA 2WMAA 3CCYA 1LDDA 4Y8DA 1MUOA 2E5ZA 3ZN1A 3FZ1A 4AQKA 5TO8A 1X4OA 3Q4ZA 3DU5A 3U54A 5C4LA 3RPRA 4BGGA 5EYKA 3BR1A 3GEQA 1KGSA 3LMGA 5IT9Z 2F4IA 3A7IA 4MH7A 4HRIA 4AIHA 3ZYAA 3MH0A 2VTHA 4ANMA 3F2AA 5HCYA 4LGGA 1IN7A 2ISYA 3SOAA 5BUJA 3MZ8A 4WG3A 3J7AO 1VFCA 4XMOA 1XWSA 1IRFA 2FX0A 3EN7A 3IC7A 5JRSA 1MBGA 2KIMA 4JAIA 2A5YB 4ASZA 5FXSA 5J1RA 3OYJA 4GT3A 3OYAA 4CT2A 3I6WA 3TM0A 2BKZA 4EJOA 2PVFA 3FSKA 3LSIA 4FODA 3RKYA 3FHZA 5F95A 4WX9A 1OCTC 2RQQA 4F7SA 2WC2A 2E34A 4GUBA 4L0YB 1WWXA 3W2WA 3IOPA 1H1WA 3H9JA 4ASDA 4F08A 2E1MB 2H8RA 5GZ9A 2BTRA 4JX3A 3J81Z 2ZV9A 3OS3A 4YC8A 4IHTA 1EH8A 4DF3A 4FV1A 4CTCA 3MIYA 4RZWA 4WBOA 4YLKA 4UALA 2ZSHB 5AR8A 1P6RA 1ETKA 3HZTA 4RJ3A 2HU9A 3CC6A 4RA2A 1PMEA 4PDSA 1SYKA 3BR3A 4NBQA 1MZBA 2VU3A 4HX8A 4FX4A 1IXCA 4C61A 3OYBA 4CCKA 2EIMH 2WQNA 3QGYA 4Q48A 1QBJA 2C3JA 2OJ9A 1WSUA 4F7ZA 4W4YA 2G0EA 2HOSA 3PJ8A 3EFWA 2FBKA 4I3ZA 4CA0A 1R23A 5L6OA 1X1BA 2HZTA 2BIYA 1S8NA 1TL8A 2ZV7A 1SD4A 2QVSE 3E8CA 4JDJA 3T8RA 2IG7A 3OIOA 3DXQA 3W32A 1D1BA 1YKRA 3KU2A 4EH7A 4A3LJ 4NC6A 4BDAA 3QTWA 4K77A 2HWOA 3NR9A 3COKA 2OFUA 2ZMEB 2NP8A 2KRFA 1LFBA 2Y0SA 4CZYB 4X6QC 3AMBA 3I4NJ 2QURA 3KP3A 1ZRCA 1XN7A 5LCKA 4LLNA 4L43A 3F5PA 4N4SA 2YAKA 4DTKA 4XBUA 4O6EA 4BJ5C 5BQTA 2JSPA 5DDGA 3TP0A 4LMYA 4R79A 3A0HC 5FB2A 3LCDA 4GU6A 1NY3A 3ZP5A 3F5GA 2XIYA 1POGA 1BR4A 3ENMA 2ECCA 4KRDA 4F9AA 2ZV2A 3NSZA 2JGZA 2VN2A 4X2NA 2OXDA 3HGGA 3NLBA 2JFLA 2A07F 3CC7I 3CJFA 5I9WA 3ALOA 4L0ZB 2H34A 4BQNA 4O91A 4OBOA 3BDDA 2H27A 3QTSA 4ZY5A 4AN9A 4TV7A 4Y72A 2B63J 2QSGX 4FT8A 1A9UA 5AM6A 1ZGAA 2PULA 4EQMA 4BQAA 4FG9A 4EM0B 3AC2A 1ZLJA 1Q3WA 2L9NA 2J6MA 4YJVA 5AV4A 2COMA 3GO5A 1J0RA 3BQCA 4KA3A 2V9KA 5DA3A 3UPZA 5DRDA 4FTRA 4U7DA 4GKHA 1E0EA 4APPA 4AZEA 3JR1A 1PXPA 1PY5A 1JSTA 1WPKA 2WMXA 4FV0A 4OAYA 3JVSA 4AZWA 4Y95A 3B73A 4IVNA 5F04A 1OR7A 5GTIC 1B59A 2G2IA 3OYGA 3K4NA 1BR2A 3VHKA 1P2FA 1MSEC 4HLXA 4XKVA 2CLXA 3GNIB 3REPA 4I1ZA 2Z3YA 2EB2A 4B4LA 3O71A 4ZDOA 4BTFA<