1ZAOA

Crystal structure of a.fulgidus rio2 kinase complexed with atp and manganese ions
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
282
structure length
271
Chain Sequence
MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVGHTKVKEFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Autophosphorylation of Archaeoglobus fulgidus Rio2 and crystal structures of its nucleotide-metal ion complexes.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Transferase
molecule keywords Rio2 serine kinase
total genus 93
structure length 271
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zaoA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zaoA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zaoA02
1AQ1A 4RWLA 3FMRA 3VS7A 3SXRA 3O96A 3TI1A 2STTA 5CEOA 2CMWA 3FY0A 3EQDA 1A06A 3V51A 2VO6A 4Y72A 4KA3A 4D2VA 3I5NA 1MGTA 2P5VA 3ORMA 2PVFA 3AT4A 2B1PA 3KF7A 4FIHA 4RS8A 1ZWSA 5CSHA 5CEQA 4Q5HA 1Q8TA 2HQRA 3KVXA 3GQIA 1K7AA 1IAHA 4AA4A 4KBCA 4UV0A 2FSMX 5AX3A 1O9UA 1I44A 2P7CB 5IEXA 5KHXA 4YO6A 2J6MA 4C36A 3K1PA 4U40A 5EDRA 5B2LA 2OZAA 4ZY4A 5HDGA 2O03A 2R64A 2I0YA 4AFEA 2IWIA 1UNLA 3MA6A 2EB3A 4R77A 1HOWA 2C5VA 3GQLA 3QALE 4X2GA 3QWKA 3VS6A 4C34A 2ETRA 4FV7A 1PXJA 1XB4A 3HV4A 4MCVA 1QNTA 2RKHA 5TR6A 3ATTA 5FFZA 4EJOA 4BTMA 1GXQA 2DPUA 2GSFA 1OM1A 3COIA 3UJGA 5CF6A 2OA4A 4G7ZF 4H39A 2RFNA 5KCVA 2W1ZA 3SVVA 2BILB 4DLIA 3BPRA 4XBFA 3VBXA 3LFDA 4ETSA 2NRAC 4FKTA 4RJ8A 3P9CA 3UYSA 5CVRA 1LEBA 3QTWA 3QD0A 2J0JA 3LM5A 4JI9A 4G1WA 2WQNA 3AT3A 4JL9A 5C9CA 1ZARA 2Q83A 4FTIA 4L43A 1KSWA 4XNEA 2GWRA 3WE8A 2QG5A 3G51A 3OW4A 4KB8A 1R00A 5FUTA 1JKSA 2EFQA 2E9OA 5BQ0A 3BLHA 4LFUA 4GFGA 4GSBA 3SHEA 3F8MA 4FEQA 3AXWA 3DK7A 3KXNA 4D5KA 5ANGA 3DCVA 2WTJA 5CAPA 3C18A 5L3GA 4I0TA 4BBFA 4YO4A 4GK4A 2IP2A 4EKKA 3ZC6A 2Y7JA 4O7SA 3LFKA 1TQIA 4EJTA 2XNOA 2O65A 3Q9ZA 1WWXA 3R04A 4HYHA 2XJ0A 5CLSA 2UW5A 4BGQA 3TACA 4O91A 4C0TA 4UX9A 4FV9A 4EL9A 3MVJA 3V01A 4BXUA 2PFBA 3LCDA 1K2PA 3HEGA 5AM7A 5FRIA 5BYLA 2FMYA 5FEDA 4TWCA 4O0TA 5G1XA 4BH9A 2WMAA 2OK1A 4ZLOA 5J6XA 4NFMA 3LMGA 4IADA 2OF4A 4IVBA 3AG9A 1XBAA 4RAZA 3NUAA 1XR1A 1J1BA 3SKCA 2NP8A 4O2PA 4DYMA 4M6XA 4OTHA 3U1DA 3IK3A 2QQ7A 3G9LX 3WF5A 4CTBA 1FNNA 3FZRA 2EFWA 2JZYA 3CJFA 2G01A 2QOQA 4GKHA 3FYJX 3IGGA 2O5KA 2F5EA 2K4JA 2LKPA 2R3IA 5HLHA 5ED4A 4ZZOA 4B4LA 4YJSA 4LG4A 3AMAA 3BQCA 4KT5C 3P7AA 3FWQA 3W2OA 2C0IA 4AWIA 3PXYA 2UW9A 2UXXA 2P4IA 3LFQA 3QAME 5D10A 3NVMB 3I1AA 1PYXA 2QG7A 1BIAA 3J81Z 3ORKA 4A9YA 4EC8A 4LLGF 3QX4A 3FLNC 3R8PA 2C3KA 3R7EA 1UU3A 1LEZA 3W2RA 4G6DA 4TWOA 4QYEA 3NDMA 3D14A 3JSOA 3QF9A 3RCDA 5AR2A 1K78B 3BZ6A 2VOOA 1WBOA 3FMNA 4RB0A 2ZMEB 3ZMDA 2VX3A 5KMKA 3KULA 3Q4ZA 3T8OA 2RFDA 3NW6A 2OI4X 5EYCA 5BUEA 3CJGA 5HESA 1H08A 4S04A 3UC4A 3UZPA 4PPCA 3COKA 1RUOA 2GAUA 4ITJA 5FTQA 1P2AA 4M67A 4BDGA 1ZYCA 5DCFA 3BIZA 2PE1A 2DAOA 3WTUC 4F09A 3KP3A 3COHA 4XLIA 2BRNA 2GHGA 2ONLA 3EFJA 5TOZA 4QYHA 3TL8A 2AXLA 4FVQA 2F4JA 1OIYA 2IZSA 3BV3A 5AFVA 2XK9A 3QQJA 3BJAA 3PVUA 4FV3A 1BMKA 4X3FB 5EKOA 3ZXTA 2H6DA 4AACA 3U87A 3TNQB 2YZLA 3L7WA 4UYAA 4JQFA 3FPQA 4C35A 4A6EA 2A3SA 3UIMA 2BAKA 3ULZA 3BEAA 3TNWA 5H3QA 5JH6A 4FZDB 5BVOA 3WARA 4BCPA 5IA3A 3EZRA 3PLSA 1ZH5A 4E5BA 4XG9A 2M45A 2W84A 3P9JA 3V8LA 4QMSA 1JHHA 3ANQA 4EHVA 3TDVA 2WZJA 3DQWA 3R73A 5ICEA 4X2JA 4FSMA 1IRGA 3QXPA 3QKKA 4FG7A 3FUPA 4TZRA 5KNJA 3NNWA 5IDPA 5KBQA 3MFSA 1YI4A 3ZO4A 1KE6A 2BZJA 2CN8A 1WMKA 4IZ5A 5LGUA 4FA2A 1DP7P 2XGXA 3UC3A 1L3LA 3GEZA 4P5OA 4BDHA 4QO9A 4JR3A 4MEXF 3KRJA 2Q8KA 4RC2A 4LB5A 1MJ9A 3LA7A 3EFWA 4NJ3A 2NRYA 3DA6A 1OKYA 2X4HA 3KMWA 1ZY5A 4IJAA 3RP9A 1X8BA 2DQ7X 1JKTA 4G2FA 3E6DA 3VUGA 1AGWA 4RG0A 1LJ9A 1YS7A 3AD5A 2XUUA 4JDJA 4BTFA 5DPVA 3F6XA 3ULIA 2OIDA 2OBPA 4TN6A 3V5JA 4WXHA 3SG8A 3HIFA 2YITA 3M7GA 4TYIA 1AWCA 2LDUA 1K78A 3KL8A 5HD4A 5DT0A 5CSPA 4OMYA 1YHSA 2XM8A 2V1XA 4QNAA 3JY9A 4C4JA 4O7WA 5BOXA 2CNQA 4I5MA 5DEQA 2PVLA 3ZTXA 4GJ3A 5AV1A 2YWPA 5HIDA 3ZUTA 2PLYA 4WSQA 3BI6A 3CIKA 3TDZC 4TTHB 3A4OX 4EQQA 4IZ7A 3KRLA 1UHMA 3F61A 2ZMDA 2IG7A 4CCUA 4IRIA 4L9VA 3RPUA 2OU2A 2XCKA 5HVKA 4FT8A 5E8YA 1OI9A 2NYXA 3R0AA 2G15A 1PHKA 2ZJ2A 3TWJA 3V8KA 1XH4A 4WA9A 3I79A 4DC2A 3QQFA 3AMBA 5D5UB 4N9IA 2IT0A 5CTPA 2WV0A 3O0GA 4QP4A 2EFNA 4PWNA 3H30A 4MGRA 1DM2A 3VWAA 2DYLA 5LEKA 3D94A 4EORA 2XKPA 4QWQA 2J5OA 5AV2A 2MC3A 1XH9A 2WGJA 1JKLA 2C6OA 4WO5A 3R8VA 5CU2A 5C26A 4O22A 5IT3A 1QPCA 3NYOA 3DPKA 3UQCA 3JVSA 2DW4A 4L5JA 4K9YA 4D2PA 2BDFA 4GT5A 3MVMA 4K2EA 1S9JA 2XIXA 5IDNA 4HV5A 3GU5A 5CNNA 2X0LA 4V05A 5LWMA 5IPJA 3QFVA 3OS3A 2XAJA 4YNEA 3OZ6A 2WQMA 3PXRA 4CFUA 3V7CA 5K0XA 3F7WA 3RI4A 5DCMB 4CFVA 2G2HA 1XQZA 4F6SA 2Z7RA 3R9NA 1P6RA 2QBYA 3VN9A 2PYWA 3Q52A 3GFEA 4O86A 1GHCA 2GQSA 4PQNA 3HTSB 4YTHA 4AVPA 3VBYA 3VS0A 1ZMWA 3S4QA 4ZJJA 1JPAA 4EOKA 4N6ZA 1KOBA 4XRFA 5LOHA 3ZZWA 4FNWA 3V5LA 3IS5A 3LW0A 3T9IA 3BDDA 4FK6A 1ZYDA 4O7YA 2FSLX 1Z7UA 4XG2A 3R6SA 5TO8A 4FODA 4WXDA 4BR3A 3MVHA 2ISYA 1UFMA 4I93A 2XIZA 1M2QA 3M42A 4CFWA 4WBBB 3MBLA 4A4LA 4NTTA 3FMKA 3FMLA 2GDOA 3ORPA 3HYIA 4OBPA 3H3UA 3B2WA 3R7YA 1W98A 3WTVC 2WTWA 2M1BA 2HENA 4C02A 4R5SA 4TNBA 3LFFA 5ANDA 4PTEA 1OKRA 3OT8A 2RSVA 5CALA 4D4SA 3ROCA 2CYYA 3F82A 2RN7A 4OTQA 4BCQA 1R7JA 4YC6A 4IF4A 4HPUE 4B0GA 2UV2A 5A14A 4L45A 4M66A 5LMKA 5IH6A 3DKFA 1B38A 2YJSA 2I40A 4HOKA 2Z7SA 1ZOGA 2CW0F 1REJA 4CFMA 2KIFA 3DY7A 2PPQA 2YCQA 4DHFA 3UBDA 4CMUA 1YO5C 3SA0A 1LUFA 2QQ9A 2O0YA 1ZOHA 4CCBA 4WF2A 4E4MA 4Z3VA 4DFLA 4DFNA 1JBPE 4ORKA 2F9GA 2VX0A 2EXEA 3VULA 2BMCA 4FKLA 3MEXA 4CZZA 3VUMA 1G8AA 2W25A 2Z9OA 4L0ZB 3V04A 2BDWA 1LEWA 1OBDA 4BKYA 2J5FA 3ZLWA 2O2UA 1IA9A 4I41A 3MWUA 1RW8A 4G16A 5IMXA 3KN5A 3F8BA 4FKQA 3GUDA 4LLLA 4IB0A 5K5RA 3O51A 4RA4A 5FXQA 5DRBA 4E26A 3O3KA 3A8XA 3V7SA 1OL6A 2IJMA 4LGDA 2I0EA 4TYJA 1LPUA 5DUIA 2PZ5A 4L0YB 5M4UA 2WB8A 4L9TA 3OF0A 1V1KA 4DH1A 4KIKB 3PXKA 1VTNC 2GHLA 1O3TA 4YZMA 2O61A 3GCPA 5IQEA 4BGHA 3O71A 3LMHA 4EOMA 5EDQA 5EM5A 3LAUA 1HW5A 3IC7A 3I5ZA 4IRGA 5CF8A 5JQ8A 4AZFA 2IW5A 5CSVA 3P23A 3H3ZA 2LF7A 3UVRA 4BIDA 5EQEA 2VC0A 4NU1A 3SOAA 1OITA 3G33A 5B2MA 4R8QA 5M08A 4CLIA 1VZOA 1G3SA 2W06A 3ZFXA 3TZ8A 1P2FA 4D5HA 4LK1F 5HNIX 3VS3A 3WU1B 3KFWX 3NUNA 4AG8A 4TT7A 3NQOA 2QU5A 3PLAE 4NTSA 3DZQA 1Q8WA 2J0IA 3LFBA 2Z33A 3HRTA 4FIGA 2VOPA 1QZYA 2JSCA 2VE9A 4MXXA 4RIWA 4ENYA 2Y8OA 4QTCA 3IKTA 4KN7X 5FLXZ 3RPSA 3GCSA 4ZOGA 4DGOA 1QCFA 3D7TB 5I9UA 4EH4A 3R9DA 2R3HA 2XEYA 2RG5A 4D9UA 4D1XA 5C4LA 1V0BA 5M53A 3T3UA 2W1HA 4ESJA 2DWBA 2RIOA 3HAVA 2JKOA 4KICA 2H9VA 3QPTA 2UW8A 3TZ7A 4EYJA 2I6LA 3A7FA 1DI9A 1YW8A 2OAZA 1B1BA 4FOBA 1J7LA 2GNLA 4CFXA 2F2EA 3CTQA 3R7OA 1OPCA 1FWZA 3EOCA 3QRFF 1U5TA 3DF8A 1O3QA 5HTBA 4N6YA 1STZA 5L2QA 4OR5A 2XMYA 4YG2F 3E8NA 3ZOSA 4MXZA 3NRMA 2VBYA 3RGFA 3TZMA 4G94A 2PN6A 1KWPA 4D0XA 1S7OA 2B9FA 4YJPA 1JE8A 4OTGA 4ACGA 5AR4A 3NEWA 3FLYA 4MQ1A 3FKLA 3TJCA 4F7SA 3PY0A 5E8XA 4YIIA 4KIGA 4MNEA 3ZRMA 2JD5A 4XSXF 3F3ZA 4PMTA 5DG5A 3F5PA 5F4NA 4QPMA 4F6WA 5FTOA 4M8TA 4KWPA 4FE2A 2G9WA 3PP1A 1WQ2A 4YJRA 4O96A 4U0VA 4TY1A 3U9CA 4LOPA 3FMJA 2XAFA 4GYGA 5KO1A 4LV5A 4LUDA 3R63A 3DU8A 2R3LA 4FSQA 5BMSA 4ANBA 2HYFA 1IUYA 2YZAA 2CNUA 4OT6A 3RHKA 5ETIA 2KIUA 3DBEA 3MYGA 4E6CA 3HNGA 4CYDA 4U97A 5HE1A 1URCA 1R5HA 4UZHA 2F49A 1W4MA 3GOPA 1OKZA 5FO5A 2ZJWA 2JPBA 5CQWA 4C3RA 4FTOA 3A60A 5KZIA 2R5TA 1Q1HA 4XH6A 4RFZA 3K69A 3A7HA 3LJ2A 2O0UA 4J53A 4RAYA 3HRUA 5FBOA 3CGOA 3BWGA 4U8ZA 4AT5A 2ZM3A 4PZJA 1OL7A 4IB1A 4MEDA 3EETA 2YM7A 1BN5A 1W83A 2VTSA 4QP8A 5F95A 1ZZ2A 4I6BA 4J1RA 3PXQA 1MRVA 2YAKA 2ZM1A 4I6FA 2QD9A 5L2SA 1HW1A 4GU6A 2PMOX 3UG1A 2J50A 5AAEA 2F5FA 5M4FA 4DGLC 4O1OA 1F5QA 5BVWA 4O1PA 4Q5EA 2R3QA 4KIQA 5ILVA 2BAQA 3RJCA 5CU4A 4EOLA 1U5TB 1G3YA 4AN3A 4W9XA 4O3MA 4BCMA 5EI2A 3CY2A 4R1YA 4IANA 3RAKA 5ICCA 4GVJA 1YW7A 1Q8YA 1YG2A 1YIOA 3GFJA 2I0HA 3Q2JA 3ZP5A 3NUUA 1EH8A 2YM8A 3FC1X 4BTJA 5IQIA 1OECA 4Z7GA 3FAAA 1LNWA 4BHBA 1EV7A 3WTZA 4M69A 4Y73A 4EI4A 2C5YA 3VUHA 4I21A 2REIA 5FTGA 3EDPA 2B9JA 2QYOA 4R3CA 5GINE 2G2FA 2D2WA 2A69F 4BCHA 2VAGA 5I9WA 3SAYA 2A19B 2X6DA 3OROA 4XLVA 2DTRA 2Y4PA 3MH1A 3U9GA 3VOEA 4QQTA 3LQRA 4O0VA 4FV1A 4GVAA 4E8AA 2WMSA 2OXXA 3RKWA 3D0EA 5ILSA 3RYPA 4DEIA 5KMIA 2ZV8A 3ZBFA 1KE9A 4EC9A 4W8EA 2FA5A 2EK5A 1X3UA 4MD9E 4C2WA 2K4BA 4QT1A 5DT4A 3W6KB 4IB5A 3SXFA 3REOA 4QYGA 3LKMA 5E90A 1T0FA 1G3TA 5F1ZA 3R8MA 4HLXA 4HQEA 2R7BA 4JAIA 2HAKA 4O6LA 4CD0A 3MH2A 4BDDA 5LHHA 4FKPA 4D2RA 3BHYA 3FI3A 1PYEA 3R2BA 2A68F 4IHSA 3ORZA 3BHUA 3KXXA 2OXYA 4BDFA 5H8BA 2PU8A 5AONA 4CEGA 1BI1A 5FD6A 3E8EA 4JJRA 4W4XA 4N0BA 1FC3A 2XAHA 3NAXA 4L00A 3R7IA 2OW3A 4A0ZA 3HMIA 1W7PD 2OO8X 4L46A 1P4AA 1S9IA 4BCIA 1Q8UA 2OLCA 4UWBA 4CV8A 2HGCA 3ZM9A 3TCPA 3WZJA 3ZLYA 4U0WA 3BGZA 3C1DA 3DFGA 3WBLA 3IWZA 1VEBA 4HLYA 5J95A 3MJ2A 4MXYA 5AP5A 2EWAA 5HDKA 4OOIA 1PF8A 3PZHA 1XKKA 2W4JA 2CGVA 4MF1A 3SFZA 3ZMMA 1CF7A 4BI1A 4IM3A 5BYYA 4AGCA 2NO3A 2QOFA 3QWJA 5D9HA 3MJ1A 2JIVA 4EM2A 5DR6A 1VJYA 3C3WA 5AR5A 1UU9A 3WF6A 4I98B 5CSXA 4PL4A 3BWFA 3OXZA 4CG9A 3V8TA 1R1VA 1H07A 3DP7A 1TVOA 4BYYA 4A7CA 4OIOF 4UV9A 4BDBA 3KXGA 2H6CA 3DAJA 3L9NA 4R3RA 3I5UA 5FDPA 3FL4A 2ESMA 4I4EA 4HA8A 5HI2A 2OZUA 2Y75A 4DITA 3H0YA 3NGAA 2C4GA 4C4IA 4MH7A 5GHVA 1OZ1A 2IW9A 3LA3A 4EUTA 4QYYA 5IUGA 3GT8A 4JX7A 3LAPA 1L8TA 3MPAA 4BTKA 3AD6A 5KMMA 3CR0A 3I64A 4FT5A 4R3PA 2VX1A 4CLJA 3PXZA 5BPDA 1FGIA 4P7EA 2ITVA 2XKFA 3OHTA 2PY3A 3W10A 4NT4A 4FUYA 4I20A 2YAAA 2BBYA 2WMVA 2GIVA 2WQOA 1NXKA 3QL8A 4ZK5A 4WCGA 4JBVA 2YEXA 2XB7A 4X6QC 1JSUA 3KRRA 4XBRA 3V3VA 5A4LA 5AWMA 4KMFA 4F0IA 3OBGA 4FTAA 4I23A 4ASEA 3T0YA 4JAJA 4IAAA 2MD5A 5EEGA 4YJQA 3BJOA 5C03A 3W55A 1BI8A 3CQUA 2UW0A 1ZYRF 3CLYA 2GQGA 2W17A 1SD4A 4YFKF 2VU3A 3JSPA 3UQFA 4X6RA 4D55A 2W1EA 4QMNA 1RI7A 3F2RA 2Y4IB 1KV1A 4B99A 3BZ3A 3LXKA 3Q60A 5DE2A 5IQBA 1YWNA 2YJRA 4AXAA 4P9FA 1U54B 3J80Z 4DCAA 3JVRA 3ORXA 4HVHA 3K0LA 4K11A 4M13A 4EZ7A 4LFIA 1G6NA 4DN5A 1R23A 3FQEA 5BVDA 1ZMUA 1KU3A 4OTPA 1TKIA 1HKTA 4E4NA 3KREA 1B39A 3QZIA 4MBLA 4KN4X 2VV9A 3VS1A 5LARA 1CKPA 4BHPA 3ZS5A 4Y8DA 3DXPA 1URWA 2FEZA 5HO8A 5BUJA 5JZNA 2LGCA 4HF0A 4R7IA 3ZFMA 3S2WA 1AD5A 4DBXA 1H0WA 3NR9A 5T6KA 4RVKA 3V4GA 5JSMA 2PZPA 3K1NA 1J75A 4GUBA 5KZ0A 1Y6AA 4CYJA 4EQMA 2E1NA 3PJ1A 3UNZA 2RV8A 3BCEA 5GIPE 3MY0A 2Q0NA 4ZIMA 4QP1A 5CX9A 4EH7A 4MWHA 1STCE 3MDYA 5JRSA 4L3LA 4AOTA 1PDNC 1GOLA 2R3PA 5IQAA 4FSWA 1UVRA 1RE8A 2YCFA 4II5A 2PVMA 5CZIA 3KLOA 4FKUA 2HWVA 3I7BA 2MH9A 3DK3A 2WIPA 3ZLSA 2JDVA 4IZAA 2YN8A 1ZOEA 2W9FB 2YERA 3HRSA 2BZIB 4L3JA 4FTNA 3E64A 4EONA 4M9SA 1XWSA 4XEYA 4FSTA 1S6LA 2WELA 4BB4A 1T38A 3M2WA 2DS1A 4AAAA 5L8LA 2X39A 2XNBA 2LF8A 4FIIA 3CJNA 3DKCA 3JAMK 4HOBA 4JBQA 3F6VA 4KSQA 3TKHA 1XSDA 4BKZA 1MUOA 2BRMA 4AZVA 3CSVA 4FNZA 4ANOA 3MTLA 3VQUA 4PP7A 2PVKA 2ELHA 3BYVA 3F2AA 4ZZDA 3DKWA 3M9AA 4FUXA 3GLXA 3LFNA 1FINA 4LI5A 2YM3A 2YM6A 2XK6A 3MSSA 4JDHA 3TNPC 5DCMA 3OCBA 5HU9A 2VO7A 2ZV7A 4YJVA 4A9RA 2HFHA 4GT4A 3FZSA 4FKRA 4RJ5A 2W9ZB 4AFJA 2A61A 4WOVA 4YTFA 1FYLA 1GIJA 1YDTE 4O7ZA 3D5VA 2X6EA 2QUFA 3UO4A 3TUDA 3NEUA 4XRJA 3B2TA 3QTIA 5IH5A 1T46A 4ALUA 5AM6A 1W5SA 2C6DA 5M55A 3A62A 1FMKA 3DZOA 4QMPA 1I6XA 5DOSA 2Z2WA 3QRJA 3QKLA 1FP2A 5EOLA 3H10A 3PPJA 3RPOA 3NIEA 4QP6A 3H3CA 2QURA 4FV8A 4GGGA 4EOJA 4WKQA 4L52A 5I9YA 2V9VA 3Q5FA 3ORNA 3VS2A 2XM9A 5HGIA 4AA0A 3RIRA 3BGQA 2R2PA 2PE2A 4NQWA 4Q48A 4ZY5A 1ZG5A 3OMVA 3TKYA 4U7ZA 4D4RA 4KINA 3HA8A 5JT2A 5DLSA 4BL1A 4FTRA 3VC4A 1OMIA 5DEYA 4YPDA 4U7BA 4HZFA 5CLPA 2WTVA 3MB6A 2HXQA 3FMEA 4KUMA 4EM0B 1OYWA 2IJLA 3BU6A 3FX3A 3P79A 4E1ZA 1XBCA 5EM8A 4A9UA 3ML6A 3M1SA 4GFOA 1RNLA 2WEVA 4DTBA 3LZBA 4RGJA 4F70A 4S2ZA 3N97A 1FSEA 2ZDUA 1PXLA 5J7HA 1HBXG 3I0QA 4OINF 3IW8A 4R7BA 4QP3A 1YQJA 4LMNA 3DLZA 5CVIA 3NNVA 3TOBA 2GS6A 4HGEA 4O81A 1U8RA 1RDQE 3JXWA 4WK8F 5BPIA 2NNNA 4PTGA 3CEKA 3FI4A 3PJ8A 3K3JA 5BUIA 4UUVA 4M15A 4AW0A 3AMYA 5E8IA 2DQRA 4ZZLA 3FY2A 3JTHA 4RLLA 3JS2A 3I58A 3S00A 3R60A 3HGKA 2WTKC 5F1RA 5C01A 3PVWA 4R1VA 4XOZA 4B6LA 3I0TA 4JBAA 1Q8ZA 4ZAUA 2IPQX 4PNIA 5DYJA 3E62A 1KYZA 2L02A 5HO7A 4BZNA 4LK0F 4FSNA 4BVUA 4QMTA 1IN7A 2VRXA 4I2OA 4XBUA 4GXOA 5E1WA 3JY0A 2ACJA 3KZZA 1HCLA 2X2MA 4NCTA 4GCVA 3RHXA 4DGNA 1MQ4A 2P6TA 3WGIA 1CSNA 4Z9LA 5M4IA 4O0SA 2JIIA 2O64A 2O63A 5KUPA 3CTAA 2EV0A 3TDWA 3OEFX 5AP4A 2C3LA 4JS8A 4DFXE 1W8CA 5L8JA 2CGUA 3NWWA 3K5VA 1KE7A 4KBKA 2PQ8A 2M30A 2Z3YA 3HSFA 3CLOA 5IQDA 2O8XA 1ZY4A 3CQEA 2F7EE 3LCSA 2GNHA 4DH8A 1GNGA 1IR3A 5E8UA 4ZTRA 1YXUA 4QMMA 2CSOA 4HX4A 3IDCA 2DQLA 3ELJA 2CKEA 2BUJA 2WO6A 3F3XA 1U3EM 4ZTSA 1UWJA 4MNUA 1FZPB 2Y0AA 3EKKA 4A12A 1ZN2A 2Z5UA 2L4MA 1ATPE 3QC9A 2VWIA 4UMTA 5BVKA 2EB2A 4O7TA 4JQ7A 3GBZA 4HGTA 2IVMA 4GG5A 5ERIA 3F23A 4I09A 5E8GA 2C6EA 4EHZA 1G3WA 4MQ2A 4ZLYA 5EYDA 3R02A 5JGAA 5IA0A 3BY6A 2GTNA 4G6LA 1U6GA 3H0ZA 2ZMEA 4E73A 5CENA 2VGPA 3F8NA 2FBHA 4IWOA 2B53A 3QU6A 4JIAA 4WUAA 2IA2A 4U44A 2XEZA 1PUEE 5DR9A 1J91A 2ETMA 3D15A 1Q97A 4LV8A 3CY3A 3IDPA 4RIYA 2XK7A 3L1SA 5AR3A 5BMMA 4X3FC 4LL5A 4QTDA 4M7IA 1JKKA 4YUQA 1SAXA 5FLXK 1ZREA 4FSUA 1F3MC 3HV5A 5EDPA 4DLJA 3QA8A 4XMOA 3EYYA 4GL9A 4FKGA 3QQLA 5HOAA 4MBJA 5EG3A 2KULA 4OGRA 4C3FA 2QNJA 3DK6A 4OTIA 3W2PA 4YSMA 2HOGA 4LRJA 1WI9A 3NVKI 2IZTA 4O83A 3O50A 2ZFWA 4Y46A 2FUMA 3V7RA 3LM0A 3HYHA 3SQQA 3ZN0A 5HVYA 3WTTC 4EJNA 4E5AX 2COMA 3C9WA 1HW2A 1CMKE 3BQRA 5CEPA 3QRIA 4IE9A 3H9OA 4YTCA 2UVZA 5CVGA 3IPHA 3QRUA 4KFCA 1FSHA 1PRYA 2E2BA 4OTWA 4N4SA 4JBPA 3GB2A 4QQJA 2OG8A 1LB2A 3DKGA 3C51A 4DEBA 3WF9A 3EN9A 3IOKA 5KKRC 3GI3A 3TDUC 5HD7A 1OR7A 4GU9A 2WPAA 4P55A 1D5VA 3LVPA 3CDHA 3F6OA 2ERKA 1WBWA 2P4WA 5J7BA 4XLNF 3U2RA 2W24A 4I24A 3TV7A 2G1TA 4ENNA 1IEPA 3PSBA 4C4EA 2UWMA 1V0OA 1ZRDA 2UUEA 4Q9SA 2D1HA 1NA7A 5GJDA 2J4ZA 1FPUA 2HZTA 3FF5A 3RWPA 2ZBKA 4ACCA 3F66A 2WMWA 3Q04A 4O7VA 1GZ8A 4G5PA 1FOKA 4GRBA 3FMDA 2YM4A 2W5AA 4L3PA 4AX8A 2NAZA 5IA5A 4H3PA 2H27A 3C13A 2PUIA 1LDJA 4YLLA 4XJ0A 1BI2A 2BIYA 3DT1A 5HU3A 4XP0A 5DNRA 3O7LD 4IBMA 5FP6A 1UCRA 1SMHA 2K02A 5F64A 3K3IA 4FKOA 1Q24A 3BKBA 2CDZA 3ROYA 4ZYGA 3WOWA 2UVYA 3DJ5A 4BIEA 1XGSA 5EHYA 3FLWA 3HUBA 3BYMA 4QP2A 3OFMA 2PHKA 4KS8A 3HMPA 2W4KA 2B54A 5BPYA 4MKCA 5I3OA 4Y13A 2PUNA 4NIFA 1ZXEA 4EK8A 2W1FA 2P5KA 4FI1A 4AT3A 4L7SA 3LWFA 3LE6A 4HW0A 3IDBA 4GT3A 3FWEA 5LHGA 2ITNA 4APCA 2GNFA 2C6IA 5ACBC 1GY3A 3LFCA 3GZ6A 5CYVA 3RINA 5AP0A 2QZ8A 3F3TA 4CDGA 2VTAA 4CYIA 5DH3A 2QLQA 4JXFA 5IQFA 1DPRA 1OMWA 3LQ3A 1USSA 4BHCA 2RGPA 4CRLA 3MGYA 1ZLKA 4LMYA 3F9NA 2VT3A 3CKXA 5ANIA 4WNPA 5A4CA 3C5IA 4A07A 5ANKA 4M73A 2FE3A 3D5LA 2VO3A 2H34A 3LSTA 1A48A 1H28A 1ODDA 2YPRA 1XDUA 4OIRF 3OEZA 2WD1A 1W7HA 2W5BA 3DLSA 4X2FA 2L4AA 2VTRA 3W8LA 4FGBA 3R7GA 4HVIA 3UOLA 4G9CA 5AUTA 3OWKA 2YR2A 5EH0A 4TYHA 5T3QA 2IVVA 3R4KA 4PRJA 3QU0A 2B9HA 1M52A 3IKVA 2X81A 2HOEA 4IRHA 4V01A 2EXMA 4ZY6A 2JAVA 2EVAA 4RJ6A 3QAHA 4ZSJA 1Y8YA 2PVHA 4FKSA 1KQ8A 2YHVA 3PIZA 2PE0A 3POOA 4A2UA 5GJGA 3DPLC 3PXFA 4OAVB 1FOTA 2UZNA 5E91A 1S3JA 3U8WA 4RGXA 3DNDA 1FVVA 5H6RA 1BM9A 3PY1A 3MVLA 3NSZA 3AT2A 2HIWA 2VTTA 5DBXA 3LCTA 3I59B 4ITHA 2A4LA 3QTUA 5L3FA 3BJ6A 2G7HA 3O7LB 3EYIA 1H9GA 4B8XA 1GXPA 4TKSA 3NCZA 3KEXA 3PA5A 2IA1A 3OBJA 4UXNA 4R8HA 2ZYBA 3DV3A 4PY1A 3QPHA 3WE3A 4FYOA 3EFKA 3DTCA 2XK8A 5L3DA 4C57A 1XO2B 1KU7A 2DUVA 3TOAA 2R4BA 5TE0A 3DTWA 1TNTA 1J2XA 4QMQA 4ZEGA 3MFUA 4U7DA 4RJ4A 2R3FA 3QTXA 4QMVA 1APME 3CS9A 4CKRA 2B9IA 3Q9VA 2B55A 4BHNA 3R7VA 4DT9A 1MZBA 4BCNA 3LLAA 5AAGA 2BEOA 3Q9YA 1SZMA 5HE2A 2YIQA 3U6IA 4EH9A 1F1ZA 3ZEWA 4O0RA 4BDCA 4JQ8A 5E17F 2C30A 3EN6A 1QL6A 1ZYJA 3LQ5A 1SD6A 4I0AA 2YDJA 4BYJA 3TO6A 1KQ0A 3ETAA 3GUBA 2JT1A 1H1PA 2P33A 4FOCA 2ITUA 4QTBA 5HHWA 2KJCA 5DHJA 4RGRA 4C8BA 4I5HA 3MS9A 1SVGA 1FY7A 4KIKA 2XIKA 4PCQA 5JRQA 4EH3A 4OBOA 5DA3A 3PRIA 4L44A 4KSPA 3SW4A 2HKOA 4FV6A 2HTSA 3QKMA 3HTUA 5HS8A 4UXQA 4FSZA 4YHFA 4DFBA 1MJBA 3FM5A 4EK4A 3IG7A 5I5ZA 4NYEA 3RPVA 2F5CA 1D8KA 4GW8A 5JHUA 5L4QA 3DJ6A 1B6CB 2YLEA 3PE2A 1ERKA 3RTRA 5EM7A 4MQVA 2FF4A 1H01A 2WFYA 4JNWA 3Q9XA 4CKIA 4DF3A 5CEIA 3F21A 4EGZA 4YC8A 3QQHA 5CY3A 3HP5A 4NEUA 2J7TA 3I59A 3VW6A 3IW5A 3H4JA 4UWYA 4A4XA 5D5WB 2LSOA 2VODA 4AIKA 1OPJA 3ERED 4JBOA 3RK7A 3MH0A 4EMSA 3EHAA 2OIQA 4FIFA 3C50A 4WD5A 1GZKA 4F0GA 1W0XC 5HICA 2PG4A 4HW7A 4IDTA 4F7NA 3WTYC 4KKGA 3N4UA 3KA0A 3R00A 3GW2A 4OU0A 3PTGA 4DFUA 3CGFA 5CT0A 2QLUA 3FV8A 1YOMA 2UZVA 5HVQC 4O6EA 3ANRA 3TIYA 2X0GA 3O8TA 3DBDA 3W2SA 3G9NA 3FXUA 3MESA 2XIRA 3FYKX 3IO7A 2YX7A 5EM6A 3ZM4A 2XKOA 4K0YA 4E4XA 4NM3A 2QLZA 3AC2A 5BVNA 2CG4A 3MA3A 4XV2A 1LVAA 5TJJA 5AA8A 3QD3A 5JKGA 3B73A 5IISA 4GG7A 5A3XA 4C59A 4ZS4A 4EH8A 4J96A 3Q9WA 2W85A 1U46A 2IRFG 4BDEA 3VHEA 3R1YA 2RF9A 5FWKK 4M72A 1SNXA 1H24A 5FD2A 5E8WA 2X7OA 1TNSA 4GJ2A 4FG8A 4IJ9A 4QOXA 4F6UA 4IZYA 4HCTA 4QQCA 4X0MA 5FLFA 3R6XA 2Q0OA 2QOLA 1NW1A 4FBXA 3ID6C 4GK2A 2QR8A 3Q2MA 2X7FA 4CSVA 3OCTA 5LCJA 3SG9A 5ANOA 2Z60A 3AAFA 2XAGA 1WCCA 3ECHA 1EH6A 4R5YA 5AP7A 2CKPA 2XYNA 1R39A 5L3AA 3R0JA 1OL1A 1QPEA 4BBEA 4FZ6A 5L3CA 2W96B 2XNPA 2J9MA 2O3PA 4HYUA 1T98A 4MEYF 2ZV2A 4RB1A 2PVRA 1RQQA 2KTYA 4HDVA 3B8QA 5DI1A 1ZYSA 5ETCA 1JVPP 4KRDA 3I6UA 4BQAA 5HLWA 4G5JA 2K27A 1G8SA 4E6AA 3N4TA 3GNIB 2QOCA 4FTUA 2C69A 5FFXA 3A4PA 2JFMA 5D4RA 2F7ZE 5BX0A 5J9LA 3VIDA 4K2RA 1T6SA 4B8LA 3R28A 4FX3A 4FYNA 2VZ6A 3GC7A 4DAWA 2QHMA 5E8SA 2VN9A 2HEOA 3AD4A 3FZOA 1IXCA 3QBNA 3GYHX 2YISA 4YZDA 1ZRFA 4S34A 3G6HA 2YLFA 2FSOX 3D7TA 3SDJA 4M84A 1YWRA 4KIBA 3LFEA 2VO0A 3J7AO 3SW7A 5LEJA 4K77A 3HMMA 3I60A 4EK3A 1J5YA 3NUPA 3J81K 3KVWA 5JGBA 5FBNC 1OUKA 3FKNA 4M68A 4W8DA 1R1WA 3PPKA 1ZGJA 2ADUA 4FVPA 3ZC5A 2HK5A 1EH7A 3PG1A 4PPAA 3KK8A 1UU7A 4BAYA 4ZZMA 2W5HA 3IWFA 5JI6A 3QOPA 3HV6A 4PDYA 3G73A 3RZFA 5DD4A 2PUPA 4HZSA 5CEKA 3G3ZA 1L3RE 5IKWA 4WXCA 1R0PA 4RIOA 1SNUA 2J0MB 1PKDA 3TG1A 3BYSA 4PMSA 2V7AA 4N9HA 3TTIA 4D9TA 3R71A 5EW3A 4AW1A 4USDA 2C6TA 4HNFA 4YIFA 2PEXA 5EFQA 5AADA 1Z6RA 1FQ1B 4RC3A 3GC9A 5ICGA 2YIYA 2YX4A 2PMIA 4DFZE 2W1DA 2R3SA 4I6QA 4I7HA 2ZNZA 1REPC 4U88A 2MLGA 3KULB 2QR7A 3PY3A 1F5TA 5IEYA 2OJIA 4MHGA 2UZKA 4IWPA 4Z16A 3MFTA 1KE8A 5FXRA 5LVNA 3VUIA 5D7VA 4F64A 3V6SA 4XHKB 4I1ZA 5K0KA 3EQRA 4R6VA 1U5TC 5ICPA 4OUCA 5C27A 5EQPA 5M51A 3GO5A 4YJOA 3UTOA 5AUUA 3R21A 4O0YA 3P7BA 4WHZA 3RCJA 1UNHA 3JPVA 2WC2A 5LVPA 4M9ZA 5J79A 4ESFA 3MFKA 4EBVA 2F2CB 3QTSA 4HZRA 4E7WA 1XJDA 4FL1A 4ANMA 3U6HA 4L42A 3UE4A 3FE3A 3PRFA 4BDIA 4DH3A 2NS0A 5DV5A 4H3BA 1V4RA 1YDRE 4J95A 4LJZF 1UKIA 2BAJA 5FDXA 2V55A 2QO7A 3UDBA 2F5DA 1MRUA 2OJGA 4GV1A 2PVNA 1G3NA 3VF9A 5CYIA 4CHUA 2H6BA 1WBVA 3MZHA 4ZYEA 4M12A 4TYHB 4QRCA 5IUHA 3UMXA 3GF2A 5HX6A 1OL5A 4NW6A 4MD7E 4BGGA 4IC7A 2WQEA 2AS5F 3ZMVA 4F7LA 3TZ9A 4YBKA 4BZDA 3VF8A 4BBMA 4C61A 5LMBA 4NIFB 1XH6A 1JOWB 3BHVA 4J97A 4FT3A 4G7OF 3KP6A 1CKIA 3HV7A 2C6YA 4JK1X 3A7JA 3C4EA 3CP9A 4AQCA 4LOQA 4PDOA 1QPMA 3EZVA 4QP7A 4DNCA 3QD4A 2XYUA 3O2MA 4FV5A 4LGGA 2PI0A 3D4QA 2NNWB 2Z99A 1ZYLA 4BWKA 4XG4A 4WSYA 5AIKA 5BS6A 3VUDA 1JLUE 2QOKA 1YOJA 1YW9A 3ORIA 4C58A 2FNAA 1PXNA 2R3GA 4D2TA 5JMSA 3UODA 1B6AA 4GEOA 4H3QA 4XV9A 5AEPA 2WMUA 3UP7A 3ROUA 5LVLA 4U0YA 4DEDA 4JRNA 4P5QA 1H00A 3I7CA 1HKSA 2YCRA 2BRBA 5KK1A 5EYMA 4TWNA 2GXGA 4LG0A 3KRWA 3A7GA 3LXLA 1H0MA 3QC4A 5FGKA 5CAOA 3ORLA 5E20A 3ABTA 2QCSA 4YTIA 1TTYA 1WBTA 3EB0A 4YR8A 4S31A 4NW5A 3R8UA 4W4VA 4S33A 4DCEA 1XMKA 1YKRA 2VE8A 5AA9A 4FZ7A 1O3RA 4OIPF 5IA2A 3WGHA 1CKJA 3ZU7A 1YVJA 4Z7HA 3OWJA 5IUIA 3PPZA 3V5PA 3ZRLA 1ZRZA 5HIEA 2IZRA 3RJPA 1SFXA 4JQEA 4ZSAA 5A46A 2QWWA 4U43A 2ETHA 5M57A 1J3HA 3EQFA 2XNNA 2JC6A 3IW4A 4L5IA 3UQGA 2C5NA 2XHKA 5CWZA 2ERZE 2W05A 3TUCA 5HOOA 4EGYA 3BYUA 1M7NA 5HLGA 4UNOA 2ZDTA 1JQHA 4X2KA 3NX8A 3KP4A 3T1BA 4UWCA 2VBZA 3VUTA 2CN5A 3HDMA 1T39A 1O6KA 3QUDA 4LQMA 1FLIA 4L9NA 3NNXA 1YI6A 3I6WA 4QTEA 5CU6A 4UMQA 3HKOA 5LMKC 2CWEA 4UV8A 3TUBA 2PZRA 3ZQ7A 5A2QZ 1BI0A 3F8CA 2GFSA 3OP5A 2C1AA 2IA0A 2W4OA 1DAYA 1PY5A 3FDNA 4LOOA 1R5GA 5J9YA 2GU8A 3BHTA 1DPUA 4KUJA 4ZYHA 4Y95A 4P4CA 3QHRA 2KIMA 3Q96A 4RBLA 4ASZA 3BBTB 3E7OA 4TRLA 1HXDA 4BRXA 4O0UA 3KB7A 3V6RA 2A5YB 4XV3A 3SV0A 2VTMA 1YFHA 2R3KA 3QHWA 4NSTA 4O38A 3CCNA 4IAFA 4ZZNA 5L6PA 4MVFA 1QPJA 4L9JA 3UIXA 5JN2A 5IT9K 2H09A 5H8GA 4JT3A 2BZHB 3FXQA 4AZTA 5KBRA 4AZEA 5CNOA 3QQKA 1KA8A 1GZNA 3KRXA 3NUYA 3GFMA 3LMIA 4O84A 3MTFA 1H27A 1F9NA 2C5OA 3DJ7A 4A9SA 1I1GA 3ZBXA 3U9NA 2WMXA 2R0IA 3D9VA 2QC6A 1XMAA 3RNIA 4GO1A 3DGKA 3UIUA 1OIQA 2DT5A 1WBPA 1BC8C 2JPCA 5BVFA 4NM0A 4RVMA 3W6JB 4KKHA 1AOYA 3EQGA 4UALA 5TRDA 2WTCA 4IAYA 5A4TA 4P5ZA 4OLIA 2BVAA 2HYYA 4B09A 5CAVA 4A9TA 2R3JA 2OGVA 2HY81 2YDKA 4RWIA 3UNJA 3VBVA 5IA4A 5L8KA 2ZO4A 4FIEA 2QU6A 3C1XA 5AIQA 5LGTA 2Z7QA 3F88A 4RZWA 3RMFA 2XZSA 5G6VA 3FXZA 4EJ7A 1BIBA 2V6CA 5TT7A 5D5XB 2IPXA 1KGSA 3E3PA 2CO5A 4RT7A 5DMZA 3HOTA 4MD8E 4EOOA 1DI8A 2E7WA 4RQVA 4EWQA 4GCJA 5GJFA 4IAZA 1O7LA 1MRYA 2F57A 2WMTA 1PMEA 3P78A 5D8KB 4CQEA 3KP5A 4PMMA 4QMUA 1IRKA 3KC3A 4ASNA 4HJOA 1YOLA 1CGPA 3TM0A 4XS2A 3P86A 1RJBA 2UZBA 2GQQA 2JKMA 4L6QA 4FVRA 1VYZA 3RBWA 4Q47A 4YLJA 3LFSA 4BNCA 3S0OA 2FXAA 3RPYA 4H58A 3KQ7A 2KKOA 1PMUA 5LBQA 1WKMA 4ITIA 5CU0A 4TNDA 4ZP5A 2QVOA 2HKXA 3A8WA 4KDPA 4FZAB 3BE9A 1OB3A 4HX7A 4Z2YA 2OSCA 5CF5A 3MB7A 5JFXA 3FI8A 3F5XA 4ON0A 3DBQA 3SRVA 3MFRA 3Q9SA 2XAQA 4PL3A 1M7QA 4I6HA 4U80A 5D41A 4M6YA 4CT1A 5EQYA 4MTEA 5F6FA 1FBNA 4ASDA 1ZG1A 2K7LA 3GC0A 3J80K 4V04A 4G31A 5E9EA 4UHTA 3IRQA 4IHTA 3WZKA 1M17A 3ZO3A 3ZDUA 2V7OA 5HCXA 5AP1A 4ALWA 3NYVA 1SFEA 3L9FA 3P7CA 2HZ4A 3ZONA 2RNJA 4IXAA 2BGCA 3LXNA 4PX6A 4TXCA 3DKOA 1L0OC 4ZMEA 3FJQE 5CASA 5KX8A 4RB3C 1W82A 1I1SA 3LJ0A 4NFNA 1ZRCA 4XSZF 3GENA 2CGPA 1YQAA 3MCZA 4MNEB 4LYNA 2XNMA 1O57A 2ITQA 4AOJA 3EN7A 3II5A 3QQGA 4ERKA 4OTFA 2XKCA 1LR4A 4G9YA 2EWNA 3D83A 3RPQA 5ILUA 3GX4X 2Y9QA 5DYMA 3NS9A 1FGKA 4M9XA 2VWBA 5BVEA 2BHEA 3CD3A 2VWWA 4ANNA 3G15A 5JVTA 4WWCA 3I0OA 3F3WA 5D1JA 3R01A 2W7XA 2R3RA 5HIBA 5E1EA 5CXZA 4FTKA 3WGGA 5HX8A 5J87A 3R9RA 5BNJA 1WSUA 1FBUA 5TKDA 5J5TA 5B2KA 3ZSHA 1ZLTA 5KE0A 3QTQA 2QOBA 3PZEA 1Q62A 5LRRA 4FZFB 2EJRA 2DFIA 4LMUA 4RIXB 4ACMA 3BOQA 4WBOA 3QXOA 4E6QA 1OVEA 3E6CC 2VWYA 4C62A 3NCGA 3WIGA 2F2UA 3E3BX 1OPKA 5HG9A 4EHEA 3EWHA 2WU7A 1Y57A 2YABA 2D1VA 4QPAA 3R2YA 4ANQA 4B9DA 4LGHA 3E5XA 2P2HA 4U79A 4BN1A 3EKNA 2UZTA 4MTAA 2ZNYA 4Y83A 4EM1A 5LJJA 2CNVA 4IJPA 2F7XE 1YWVA 5HDNA 3RKXA 5LGNA 2JIUA 4FSRA 3VJOA 3R22A 4V0GA 4AZSA 3UIBA 3OTUA 4U0IA 3ZMUA 4XUFA 2C0OA 4UVBA 4M3QA 5JQ5A 2HDCA 3L8SA 2YWVA 3M8EA 4DEEA 4L7FA 4DG3E 3ABUA 3P7NA 3OXIA 2DPDA 1EH4A 4ANLA 3RALA 4BICA 4G8XA 2FH9A 5FGMA 4J71A 4IWQA 1U5QA 3N51A 4A0XA 1Q3DA 1W84A 1PXOA 4OT5A 4EKLA 4D0WA 1OPLA 2CKQA 2L54A 1FVRA 2CGWA 4IFCA 1Z1DA 4TYGA 4FKIA 2R3OA 4JDKA 3WYXA 3CPBA 3QCQA 2ZMCA 2BYVE 3KMMA 3U51A 4IX3A 5HE3A 5DWRA 3CO7C 1BI3A 2PVYA 2QI8A 3EN4A 4CGZA 2WOUA 4XYFA 3SXYA 5BYZA 2V1DA 1LDDA 4ENMA 4AD9A 3RNYA 5JZJA 1S29A 3LQ8A 2NNYA 1GIIA 2CPKE 5EW9A 2EUFB 3HX4A 5D6FA 4M0ZA 3D5UA 4WG5A 4N57A 3U6JA 1BI7A 2ZAZA 3DNEA 4HVGA 4K33A 4KD1A 4UY9A 2O8YA 3RK9A 5IG1A 5HG8A 4IAIA 3V8JA 4F9YA 2V0DA 5ITAA 3OOMA 3QGYA 3JYAA 4IXPA 4C2VA 1I09A 2J0LA 1QQIA 4UVAA 4UN0C 2NRUA 4EJVA 1XGMA 2EA4A 3MIYA 1WAKA 4HVDA 4YBJA 4G6NA 5A6NA 5D7AA 4KRCA 3VW8A 3HMOA 3C4FA 4L68A 3KEOA 2X1NA 3F5UA 3SZTA 3TXOA 1YXSA 1KOAA 3T9TA 1R78A 4EOIA 5M07A 5AR8A 1H1SA 2M5WA 3SHFA 3H92A 3GVAA 5DIAA 1MQBA 3LCKA 3FZ1A 2XROA 3ZUVA 1B9MA 3R61A 3T8RA 4RX8A 2JKQA 3CO6C 2HTJA 5LMAA 3GU8A 4ACHA 1KU9A 4E6DA 4C4HA 1O7FA 4FGRA 4G9RA 4FT9A 1BUHA 4IVCA 2PSQA 2XF0A 4FTCA 4NJDA 3ODYX 1Z91A 4RGSA 1C0WA 3PG3A 5LLQA 4BFMA 4FNYA 5LXMA 2YSRA 2FBKA 2JRTA 5KHWA 5A2QK 1XH8A 1OBGA 1YHWA 4NM5A 5F9EA 2OFVA 2HS5A 2J51A 4QMXA 2XJ2A 4BF2A 3HRBA 3VNTA 5J1WA 4GS6A 1IN4A 4AF3A 5J5SA 3FZTA 3RPRA 1WZYA 1SVEA 2UZOA 2OJ9A 1LQ1A 3NAYA 3MW1A 3HMNA 3D7ZA 5HLNA 5E1XA 5E8TA 5EHLA 4KAOA 1P4WA 4O5VA 4IPAA 4MQ9F 3OW3A 3NLBA 2XRWA 4FHTA 3VS4A 4J7BA 4AA5A 4U9AA 4WUNA 2AUHA 3G5DA 3VRYA 5FM3A 5HQ0A 4ZTLA 3KY2A 5JEBA 4RJ7A 1NHAA 1XH7A 4YZ9A 5HBHA 4BZOA 3EL7A 3UPZA 3EFLA 3HLLA 1H0VA 4HF1A 3E93A 4KS7A 2CJMA 4ZH4F 4ENJA 5FP5A 4DEAA 4R79A 5CVFA 2XCHA 3IECA 4G3FA 3HRMA 4BY9E 2IVUA 4IWDA 2ITWA 2XKDA 1GAGA 1ZMVA 3H9FA 3IONA 3DV8A 3GVUA 4YJUA 4Y85A 4ZSEA 4O27B 3VFZA 2A2AA 4I22A 2STWA 3K54A 3COAC 5CVUA 2VTPA 3CBLA 4R7HA 3BPXA 1T45A 4CZYB 3RKBA 1QPDA 4DINA 3WODF 5ETAA 4JDIA 1USTA 3DB8A 4WG4A 1U2WA 2A1AB 4MF0A 1UWHA 2PZIA 3OVVA 3TV4A 3VS5A 3ERKA 2EB7A 1PMNA 1M14A 1FPQA 4Q4ZF 3WG9A 4OAUC 2OJJA 4G3GA 4F65A 4BDKA 5M56A 1QZZA 3V5QA 1W7PA 3O6BB 4EJWA 4NK9A 3CUQA 3ZMTA 3P9KA 3W2QA 2Z7LA 4QMOA 4DTKA 3FPMA 2PK9A 1MDMB 2FNPA 3SC1A 5K3YA 2FRHA 3FSFA 3I4BA 4ENXA 3W8QA 4FX0A 3QP5A 4IB3A 1IAWA 2VONA 2ESNA 4J99A 2FB8A 4O2ZA 4MNFA 4F1TA 1R36A 1XCVA 5D11A 3BHHA 2R7IA 2MBFA 3O17A 2GZWA 3PDTA 2UW6A 4G3CA 2ONLC 3NYXA 5ETFA 5D12A 5CANA 1B9NA 3ELKA 3QTRA 3KCFA 5AUZA 3GEQA 4I4FA 2WMRA 4JIKA 3BBWA 4G3DA 4XOYA 3PSDA 2B7AA 4TW9A 3RWQA 3F7ZA 3QRKA 1HQCA 2H8HA 3DXNA 3E5AA 3L00A 3BLQA 3AGLA 3OG7A 2UVXA 2UZUE 3IW7A 2V79A 5FEQA 4G7HF 4ZLZA 5HNGA 1P5EA 3S3IA 4J8MA 2FA2A 2BTSA 5HCZA 5HS7A 2QKWB 4DBNA 2E7XA 4U3ZA 4ERWA 3EQIA 2J5PA 3ORTA 3E87A 2ISZA 5C8KA 3E92A 4NKSA 3PIXA 3ISPA 3WU0A 1OIRA 2J2IB 2M8EA 4CG8A 5FEEA 1V0PA 4TWPA 2X4FA 3HP2A 3O23A 3HUCA 2GNIA 1TW3A 2W1GA 4UXLA 3SZPA 3P9IA 3RK5A 3FMHA 3WTWC 4EYMA 1Z57A 4IM0A 5J8FA 4U5JA 4GK3A 1Q99A 3LOKA 4DGMA 1IN6A 4Y5QA 1K79A 1Y8GA 4AU8A 4FC0A 4CZTA 2GA1A 4APPA 2MA3A 5I9ZA 4UB7A 1GJOA 4ALVA 4HYSA 3N4MA 4HDUA 4G17A 3E63A 4O0WA 2WQBA 1LP4A 4XLPF 1H4LA 5EYKA 3MQ0A 1YXTA 3CXWA 4A06A 1U59A 4AZWA 5D8LB 3OC1A 3BPVA 5ANJA 3VUKA 2W57A 1J59A 3OXTA 1FVTA 3R0TA 1HKQA 4WNKA 2W1CA 2OZAB 3W32A 1CTPE 2RGVA 2PULA 3NW5A 4E5WA 2ZCWA 4LB6B 4F4PA 4EZ5A 2OH4A 1PXMA 5HE0A 1DS5A 3QA0A 5T68A 4FKJA 3IRRA 5EKNA 2QM3A 3ENMA 5EI6A 2UZDA 3C7QA 3N9XA 4X3JA 5LVOA 5HEZA 3DOGA 1XGOA 5FM2A 4O21A 3F3UA 4PP9A 4HV6A 2UZLA 2R0UA 3A99A 3NW7A 4HPTE 4C4GA 3UNKA 2XVCA 5HZNA 2XJ1A 3GOKA 5H2UA 2ITTA 4K1BA 3DXJF 3LIJA 2HCKA 4FT7A 4H05A 2HY0A 2FU4A 1M2RA 3IQ7A 5DEWA 2YM5A 4PV0A 3Q53A 2OZ6A 3RDIA 3DBFA 5CVHA 5DN3A 5C4KA 4GKIA 3GP0A 2ZM4A 2ITYA 2G9XA 5AV4A 3MAJA 4P90A 1O6LA 3Q6WA 2FGIA 4R78A 3FEGA 3JTGA 1PXKA 1JXSA 4Y15A 2TDXA 3OOPA 2UZEA 4ZTQA 3BV2A 5JFSA 2KJBA 2HZ0A 4OW8A 4NWMA 1Y91A 3E5UA 4YZNA 3NIZA 2Q2EA 3FQSA 5J1VA 3JUHA 4ZSGA 2FMLA 3KKVA 2XUBA 4EVIA 2OFUA 1U78A 3QYZA 1MKMA 4UMRA 3TGNA 2JGZA 1SD7A 3ZZEA 3EUHA 4ARKA 3ZSGA 3R1QA 3LFAA 2WU6A 2X9FA 3UVPA 2B0QA 2O3FA 2CQKA 4V0GB 3LLTA 3F8FA 2GXBA 2WHBA 5GNKA 5HTCA 3B02A 1B4AA 4RGUA 3C4CA 4WX9A 3CD8A 1R58A 4CNHA 4KMUX 3VEPA 1BLXA 4RZVA 3IOPA 4QQ5A 2OQRA 4IX5A 3MPTA 4CFFA 3OV8A 5CI7A 3C4WA 2VTQA 5IA1A 2MH2A 1CM8A 5AP6A 3EQCA 2EU9A 4FEUA 1BKXA 3AC3A 5I0BA 3UOJA 2WWYA 3OWPA 4JRVA 1SM2A 2BROA 2QKRA 5HORA 2B0LA 5L2TA 1P14A 3MN3A 1I5ZA 4PTCA 5TF9A 2VD5A 2PMLX 2PTKA 2VTIA 2G7UA 4RVTA 3BRBA 1BC7C 5LCKA 4RPVA 4C3PA 4N70A 1ZAOA 4QMWA 3NUSA 3GU4A 2HWPA 2VTOA 5B0XA 4F99A 3Q4CA 5DRDA 3QZGA 4MHAA 3UP2A 4FL3A 3KK9A 2AC3A 4PDSA 2ZKZA 3PE1A 5C8MA 3OWLA 2GMXA 2FSTX 3DBCA 2Z8CA 4HBLA 4ESBA 4BHZA 3QQUA 2VWVA 3U4UA 3GXLA 3EQHA 3CTJA 3TO7A 3ENHA 3WE4A 1UHWA 4KYWA 1J0RA 4W9WA 4XRLA 4D0PA 2XBJA 4FMQA 2BKZA 3HVCA 1TW2A 5HG7A 4I92A 4IVDA 4U41A 3OUNB 3KU2A 5FB2A 2PJPA 4LRMA 3KFAA 3L9PA 5K4JA 2FOKA 4X21A 3HUGA 1E1VA 2ETKA 3LA2A 3L9MA 4KIPA 1WFCA 3COMA 3LPBA 2KRFA 4LGWA 2DBBA 3K2LA 3D2IA 1D3YA 5KMOA 2XVDA 4EOQA 4YMJA 5L2IA 3F2NA 4UMPA 4TL0A 3LXPA 4LD5A 1REKA 3UYTA 2IN6A 5K4IA 4FT0A 2BDJA 4ZJIA 3SRVB 4RFYA 3IL2A 2HR3A 2PWLA 2RFEA 3BU3A 3KEQA 3REPA 4LRKA 4CO8A 2YACA 2J0KA 2XRNA 3K9TA 4U3YA 3EMGA 5LWNA 3RAWA 4CQGA 1YDSE 4E20A 2I0VA 5KMJA 3IKAA 3FXWA 3V8WA 2P0CA 2CLQA 2R7DA 4YP8A 3QLGA 2R7FA 3S2PA 4QPSA 2VGOA 3T5XA 3FI2A 1Z5MA 3QCXA 4RVLA 2OICA 5L6OA 3RVGA 5IU2A 4F9CA 2VWXA 3DAKA 3QD2B 2PBIA 2VN2A 4L8MA 4O6JA 2OJFE 4JG7A 2MLKA 4FNXA 4D4YA 3GCUA 4YGAA 4CMOA 3PA3A 1R1TA 2EFOA 2JDOA 4FF8A 3P0MA 2X4ZA 3KMUA 4Q2AA 4RIYB 2AYPA 3BGPA 3BWJA 4FTJA 2OIBA 5E7RA 3OCGA 3EJ1A 4FEXA 4FKWA 2V1UA 3AQVA 4BIBA 3W18A 1KE5A 4MXOA 4I0SA 1VR2A 3KE2A 2HXLA 1FBQA 1JAMA 4CT2A 3L8PA 2FSWA 3HRFA 3TKUA 3PVGA 1KYWA 4MWIA 4NH1A 3OCSA 1Q4LA 2IVTA 3HAMA 1WVWA 4HNIA 4G3EA 2IW6A 2P3GX 1UA2A 1SVHA 4M69B 2Z02A 3GU6A 3QGWA 5AP3A 5I9VA 3RAHA 1V3FA 3WF7A 3UOHA 2PMUA 3F22A 3C0GA 4LM5A 1OKVA 3WZDA 2WAJA 4E93A 3DXQA 3MI9A 2FQ3A 2JEDA 2GTMA 2HWOA 3VBQA 3VHKA 4RIXA 3PWDA 5AUYA 5FG8A 4X2NA 4GIHA 4W4WA 3D5XA 4ONAA 3CUQB 2XK3A 4WT6A 3O2PE 3UPXA 2RDPA 5K5OA 3BE2A 2X8EA 2VTNA 3FMQA 4BCGA 4CXFA 4O7NA 5KMNA 2A6EF 3EQPA 4D4VA 4CICA 3G0FA 3CUQC 5M44A 2QOOA 3TNHA 5H6QA 2HQNA 4P9UA 4K18A 5KMLA 3MY5A 4TV7A 4XG8A 3SQNA 3RKYA 2DI3A 1ZG3A 2VTHA 4H36A 2CFXA 2AC5A 4PPBA 2WTEA 1RZ4A 4AS0A 3HL7A 3LQQA 4NB5A 4EZ3A 3Q32A 2CHLA 2RG6A 4PNKA 3FLZA 4NL0A 3IW6A 1IF1A 3U54A 1IASA 2QBYB 4OTRA 3Q5IA 4AIJA 4DEHA 3AC4A 4S05A 2DU9A 1S7AA 3WIKA 2V62A 3HSRA 1SYKA 1IW7F 4QMYA 4PGGA 2RVCA 4RFMA 3SX9A 3WZUA 1BJAA 4C38A 1ZZLA 2GS2A 5L6WL 2XASA 1PMVA 3CKWA 3E88A 4YPSA 1H1WA 1Z9XA 2GNJA 4DTAA 1IG1A 5IH4A 2A07F 2W1IA 1FMOE 2C0TA 2H94A 3FZVA 2RKUA 4EH5A 1FBSA 4RWJA 1QBJA 4C4FA 4CRSA 4LLNA 3E6BA 1CF7B 2GPHA 4P2KA 4I0BA 2JBOA 2DLLA 3BX5A 2IO6A 1YXVA 1RIOH 3TO9A 3NMUF 2JBPA 5AAFA 4UBAA 3CE3A 2VNWA 1YTYA 3L2CA 2VC1A 1MDMA 4IM2A 3S1HA 1JHFA 1KUTA 3GCQA 3B8RA 3K1MA 4L53A 3BLRA 3HHHA 3HHGA 5LRSA 3FHRA 4D28A 1HCKA 4MXCA 3LHJA 4M71A 2XRUA 3R1NA 1H1QA 1KU2A 4ZTNA 3GFIA 2W99B 3MZYA 3ZO2A 3DB6A 4FTQA 3FM3A 3F5GA 2P8TA 4GFMA 3TV6A 5FD5A 3SXSA 4P96A 3OTVA 1ON1A 3OT3A 2V5QA 4RQKA 4BKJA 3I81A 5CXHA 3PFQA 1IN5A 1ULYA 5ICFA 5DGZA 1KQ9A 1NT2A 3ACKA 1QO0D 4MBIA 1ZHFA 1LDKB 4AIHA 4DT8A 1NVQA 3VRZA 3M1EA 2IVSA 1OKWA 2CKOA 5AIPA 5J8IA 4YHTA 2XIGA 4HQMA 5EI8A 1Z05A 3MH3A 2IW8A 2A6HF 1P4OA 3KP2A 2XV4S 1XSVA 3HECA 2WKMA 3PYYA 2JTVA 5LQFA 4XP3A 4AP7A 5CVJA 5LHIA 5L3BA 4TPTA 2DO7A 2CCHA 1U54A 5EK7A 5CZHA 4YZBA 1UV5A 3IGOA 3KETA 2RFSA 5HS9A 3F69A 3HRCA 3PJ3A 3PQJA 1IA8A 1XSXA 3EYGA 3W1FA 1TBXA 3AC8A 4M14A 4IQ6A 3QLFA 3PA4A 3TIZA 1H26A 4FEWA 3DFCB 1KV2A 5GZ8A 4WRSA 2BCJA 2GNGA 3QX2A 3WTXC 3W2CA 3C7JA 1MJAA 1YW2A 2VWZA 2YIRA 2FYSA 3THBA 1TLHB 3KXZA 2BFXA 1FX7A 2A27A 1QGPA 1TQPA 3VODA 2X2LA 2ZV9A 3ALNA 3P08A 3VBTA 4IFGA 4JR7A 1OYYA 3MIAA 1J9IA 5DT3A 4J52A 4CKJA 2UW7A 1IXRC 2C6KA 3LJ1A 2GFCA 2Y48A 4A5MA 3V5WA 1OIUA 4YSJA 3JW4A 2QHNA 3QZHA 1K9AA 3FL5A 5CJ9A 2YFXA 5E4HA 4I02A 4QLCU 5HTIA 1DAWA 5HO6A 1XDSA 5HKMA 1S8NA 4AUAA 5IMEA 3D5WA 1XCBA 4KIFA 1GZOA 4QTAA 4U42A 4H0EA 3TNIA 2C3IB 5ACKA 2UW3A 5FXSA 1H8FA 3F72A 2R3NA 4GYIA 4RMZA 4AN2A 2WMBA 3QYWA 4BCKA 3TQNA 1R22A 1PXIA 5A4QA 3GFWA 4Y5HA 1I27A 4G6OA 3WYYA 5CSWA 1ZLJA 1G5SA 4FKVA 3QRTA 3VO3A 4I5PA 3K2ZA 3EIDA 2ITOA 3G6GA 5J9ZA 2QQBA 2BIKB 3LCOA 3E3VA 5LVMA 4J8NA 3S95A 4B8MA 1Q41A 3ZCLA 2P7VB 1T2KA 4IX6A 3ZMZA 1YYVA 1BBYA 1UNGA 3AC1A 3ZLXA 2XS0A 4NZWB 4YFXF 4U6RA 4YLKA 3E8CA 3EQLF 5H20A 4AGUA 2HZNA 4L18B 4USEA 1NVRA 4FV4A 4F9WA 3ZRKA 4UVCA 2GCDA 1BL7A 1ND4A 5EHOA 4PGHA 4JOAA 4IVNA 4IC8A 4EJUA 4KABA 2R9SA 3ZPLA 5CVVA 5DFPA 4AE9A 5IQGA 3GZ5A 2P55A 2FVDA 5CEMA 3NRVA 2ZB1A 4GMYA 5AV0A 3FC2A 3QCYA 3U4WA 3F3VA 4S32A 3OUKA 3E8DA 4ZXTA 1R0EA 2QOHA 3WE2A 4LL0A 4ZTMA 1YS6A 5IEVA 2YU3A 4YJTA 2WTKB 2X2KA 3C4XA 3OOGA 5HBJA 1K6OA 1B59A 3NUXA 3H9RA 4AGWA 3C0IA 3R9OA 2NPQA 2QO9A 3QU3A 3DDQA 4AWXB 2HW7A 3HDNA 3GXOA 2RL5A 1D8JA 4JLCA 4YC3A 1FP1D 2HYGD 4QMLA 2I1MA 4RC4A 3TN8A 3ZUUA 5JGDA 3G0EA 3E6MA 2YIXA 2YCSA 3KN6A 2VXZA 4FG9A 5CAQA 5D4SA 3CC6A 4KIOA 4HAMA 3KXHA 5DD8A 4K6ZA 3GC8A 3E5QA 5KKRB 4LUEA 4FSYA 4DG2E 4CTCA 1ON2A 2QODA 3W16A 4ZSLA 3V5TA 5I3RA 4G34A 4KNBA 4BDJA 3QP6A 2EFPA 4AW2A 3TT0A 4KBAA 3L8VA 1P4FA 3ZH8A 1PKGA 3OY3A 1IAJA 4ZTHA 3DEUA 2J90A 5GIOE 5JFVA 3AC5A 4I94A 4HYEA 3AOXA 2OKRA 4Z55A 4CFNA 4BWXA 2O6GE 5AIRA 2H96A 3O8UA 4XX9A 2C1BA 4IVAA 2VBXA 3P5KA 3I71A 5HLIA 3ZO1A 3BEGA 4O82A 3LAJA 2LAVA 2OQGA 2QO2A 2WTIA 1H9TA 3I4PA 5K5NA 4YNOA 5EEHA 5K9IA 1U5RA 5A4EA 5DUKA 3Q6UA 3WZEA 2FO0A 3UMWA 3KZYA 4DFYA 2VT2A 2EXCX 3HSEA 3BU5A 4FTLA 5HVJA 4D58A 4UYNA 2BFYA 1XHAA 3ZYAA 4DA5A 4IEBA 4HGLA 1PW2A 5CAUA 5HG5A 5K1YA 1XGNA 3FXXA 2QQAA 4XV1A 1HSTA 2JDTA 2Y6OA 2JDSA 3MY1A 4IIRA 2DK8A 2DK5A 4PDKA 4CGAA 3UO6A 1VYWA 4YJNA 5HCYA 4AE6A 4CXAA 1XD7A 3G2FA 2RC4A 2WOTA 3D2KA 2IZUA 3K5UA 1SMYF 4MTDA 3MV5A 5HLPA 2WIHA 4GH2A 2Y0MA 1XBBA 1WRJA 4UMUA 1TQMA 4AOIA 1J1CA 2XIYA 4UEUA 1JSVA 4X7QA 1UB9A 5E1ZB 2ACXA 3FBVA 3C0HA 4C7TA 1DUXC 4A5NA 1M2PA 3ZMSA 3KCCA 1OL2A 4L9IA 4IW0A 4E70A 2PZYA 3TTJA 2JITA 3RYRA 1BX6A 3VQHA 5AUVA 2X7GA 4WRGA 5K5QA 4RRVA 3HA6A 3FZPA 5F20A 3RM7A 2QONA 2XBAA 3VVHA 5JFRA 4EEVA 3PFIA 1NVSA 2HELA 4UZDA 4N0SA 4FTTA 1CDKA 1SMTA 4IDVA 4DEGA 3CPCA 2E1CA 1YI3A 3HOSA 1H25A 2L01A 5AR7A 4EH2A 3SGCA 3POZA 3U55A 3D0SA 2BE5F 3GCVA 3PJ2A 2VTJA 2ITPA 3GGFA 4K8AA 3Q5ZA 4IX4A 3ZSIA 1MD0A 2X8IA 1E2XA 3UG2A 2XH5A 4AT4A 2PVJA 4O7RA 1O6YA 2GS7A 2OBJA 3QCSA 3ULQB 1OUYA 2XA4A 3L9LA 3UZTA 4HCVA 1SD5A 3L09A 3BYOA 1Y0UA 1GIHA 5CU3A 2OWBA 1PP7U 4PF4A 3RZBA 3ET7A 5D5VB 5B7VA 4A0YA 2ITXA 3ODZX 3UGCA 2I7QA 3WF8A 4M74A 2CLXA 2P5LC 4HF2A 2Y4IC 4E3CA 3PIYA 4XG3A 4FV0A 3ZXZA 1NY3A 1Z9CA 1LEAA 2V22A 5AUWA 2VWUA 3NNUA 5HBEA 4HX8A 2FBIA 3SLSA 4G6QA 3NZ0A 2JLDA 5I9XA 3CQWA 2OZOA 5I4NA 4W4YA 4C37A 4KKEA 2R3MA 4MYGA 3DDPA 4RJ3A 5AP2A 3VB2A 3DQXA 4ENKA 3ITZA 4D1SA 4GUEA 4YFNF 4YHJA 1JGSA 3BP8A 1YLFA 4ZYDA 2WEIA 4DQ2A 1BYGA 4BYIA 3FHIA 4IAKA 2ZB0A 3EN5A 1G4DA 3MPMA 3QTZA 1IXSB 4I0RA 4C33A 3R1SA 5AX9A 3KCKA 5KVRA 1OYIA 2BHHA 3FLQA 4RX7A 4Q9ZA 5IQCA 2WNTA 2EV6A 4PMPA 4WIHA 5C1QB 2OF2A 3TEIA 5BQTA 5A9UA 3DFAA 3UO5A 3T8TA 4D2WA 3UOKA 4YU2A 5IZFA 3G90X 2UW4A 5AMNA 4AN9A 4ANSA 2QENA 3BROA 4PL5A 5M4CA 3R7UA 5DR2A 3KF4A 3E97A 3AGMA 3ATSA 3R8LA 1WBSA 2WTDA 4IMYA 2E9NA 2XKEA 1GVJA 2C3JA 5DVRA 1P92A 3E7VA 3FLSA 2OD5A 2EA2A 2X8DA 2BPMA 2UZWE 2ESHA 4IH8A 3FSKA 3P1AA 2RQPA 4OBQA 1F0QA 5JFWA 2WXVA 1W5TA 2OXDA 4EQUA 4L01A 4WNMA 4CV9A 4RWKA 4ZMFA 3FMMA 3ZHPC 2JDRA 5M09A 4EHGA 4RX9A 1XH5A 5CT7A 1YHVA 2ZOQA 3PWYA 2BR1A 4OMZA 4E4LA 5L3EA 2M87A 2C47A 2GHMA 1J7IA 4CZUA 5GZAA 2SRCA 2L3DA 2BRHA 3NYNA 3QUEA 3ECOA 3TKIA 4ID7A 4L67A 5E92A 2J5EA 5EOBA 2C5XA 4M0YA 1ONVA 4WNOA 4HCUA 4RA5A 2VTLA 2B52A 1A04A 4QP9A 3OY1A 3C5UA 2UXNA 4EK6A 3VAPA 1K3AA 2BRGA 4LG0B 4FX4A 3ZEPA 3R9HA 2B4SB 3ZN1A 4FIJA 3A7IA 3A2CA 4EWHA 3FQHA 3DAEA 4CMTA 2K86A 4NM7A 2E9PA 4QYFA 4MXAA 2A0CX 1PXPA 4DG0E 3IHUA 4F08A 4HVSA 4M97A 3RI1A 4F7ZA 4MAOA 1R3CA 4X3FA 4D2SA 4ACDA 2YA9A 4HGSA 5E8ZA 1E9HA 5FQDC 4DH5A 1A9UA 1QMZA 1JSTA 4QNYA 2HW6A 3Q3BA 3ALOA 3A61A 4A6DA 2W0JA 4JG8A 3CUOA 1J7KA 3MWMA 4FICA 1FT9A 1FYMA 2BKKA 4B7TA 3VJNA 4TYEA 2GQRA 2G2IA 3PVBA 3P4KA 4F63A 1OGUA 2XK4A 2E9UA 4DH7A 2CGXA 1RUNA 4QMZA 1MP8A 1UU8A 2P2IA 3PQKA 4NCTC 2QVSE 5JK3A 2XNGA 2Y6MA 5D6EA 4BI0A 4BC6A 4JX3A 5E18F 4I01A 4BCJA 5H8EA 4FV2A 5CS6A 3DQVC 3GFLA 5F94A 4RLKA 4MX9A 4JVGA 4EOSA 1JNKA 4EH6A 1E17A 3PP0A 4JG6A 1PP8F 4RSSA 4AW5A 3DPTA 5CF4A 4MK0A 4ZS0A 2YIWA 3KXMA 6PAXA 3KGAA 4F1OA 4XG7A 3Q4UA 4FK3A 3FKOA 4IHPA 3V8SA 2ZVAA 5L2WA 3L8XA 5CQUA 3R83A 4F9BA 1Q5KA 3EH9A 5K5XA 4CVAA 1YRPA 1U4DA 2ZXJA 2OH0E 4AGDA 3EL8A 3ZDIA 3EQBA 2PMHA 4KA4A 3WTSC 4O0XA 2EV5A 3SOCA 5AJQA 4BCOA 4GIIA 5AV3A 4NHJA 2C68A 3RM6A 1SFUA 3R30A 3M8FA 4RIWB 3N4VA 3FHZA 5JR3A 3PSCA 4EUUA 1BOAA 3W33A 4QD6A 4F7JA 3GWZA 2BALA 1E1XA 4ZJVA 4F1MA 3T3VA 4S30A 1H1RA 4DE4A 3Q4TA 5A54A 5IT9Z 4FEVA 4R1HA 4A4OA 5CI6A 1HSJA 2GA2A 1IRFA 4EOPA 1F4KA 4NKAA 3EYHA 4XG6A 3C4ZA 3FMSA 2Q0BA 4OIQF 3R8ZA 4BDAA 4OTDA 5AUXA 5DDGA 1XN7A 2PMNX 1R1UA 3KLNA 3UZRA 2ITZA 2LNBA 3WILA 1W7PB 3WI6A 4USFA 2HZIA 4BCFA 4EV0A 2C6LA 1WBNA 4H1MA 2PL0A 4BI2A 1BL6A 3JAMZ 5IQHA 4F9AA 1Y6BA 5C8NA 2D45A 4FTMA 4I3ZA 4D1ZA 1WVYA 5GZ9A 4XCUA 2OU7A 4Q5SF 2QOIA 3I54A 5H9BA 4I5CA 3ZFYA 1DDNA 2JFLA 2XP2A 2JKKA 4YZCA 3PUPA 1JWHA 4U45A 2BTRA 3GU7A 3VBWA 3NPCA 4KNYA 3BELA 1IN8A 3PJCA 2CSNA 4XP2A 1PJKA 4ASXA 3CTHA 1P4XA 4BWPA 2WMQA 5IF1A 4RX5A 4Y17A 4PUZA 4DGGA 3HV3A 5E1SA 3O8PA 3UVQA 5A6OA 3QZFA 3RAIA 3FXRA 1UKHA 3SD0A 4O7LA 2VBWA 1O3SA 3DS6A 2BV6A 5J8CA 2C6MA 4HYIA 1IZ1A 3ACJA 3TJDA 3I53A 1Z6TA 4F0FA 1FYKA 3HZTA 4YURA 4H1JA 1Q3WA 5BMZA 3OD6X 4FR4A 4NUSA 4U81A 2P6SA 2JAMA 4RB2C 3JR1A 1Q61A 1YXXA 5ANEA 4EBWA 2XNEA 4IACA 3RTPA 4WG3A 5E8VA 5M06A 2YDIA 2VUWA 1ZGAA 4PDPA 3KP7A 5EW8A 5HNBA 1J7UA 4EK5A 3M11A 4EQCA 2CCIA 2PUUA 3QUPA 2BZKB 4J98A 1WVXA 4FL2A 2E9VA 2X9EA 2VNYA
chains in the Genus database with same CATH superfamily
1AQ1A 4RWLA 3FMRA 2L2OA 5KHDA 1ZR4A 3VS7A 3SXRA 3O96A 3TI1A 2STTA 5CEOA 3OYKA 2CMWA 3FY0A 3EQDA 4A93J 1A06A 3G71I 3V51A 2VO6A 4Y72A 4KA3A 4D2VA 5J1YA 3I5NA 1MGTA 4A3JJ 2P5VA 3ORMA 2PVFA 3AT4A 2B1PA 3KF7A 4FIHA 4RS8A 1ZWSA 5CSHA 5CEQA 4Q5HA 5J1UA 1Q8TA 3QPSA 2HQRA 3KVXA 3GQIA 1K7AA 1IAHA 4E7HA 3LMMA 4AA4A 3ZQGA 1IO2A 4KBCA 4DZPA 4UV0A 2FSMX 5AX3A 1O9UA 1I44A 2P7CB 5IEXA 5KHXA 4YO6A 2LVSA 2J6MA 4C36A 3K1PA 4U40A 5EDRA 5C3EJ 5B2LA 2OZAA 4ZY4A 5HDGA 2O03A 2R64A 3BG9A 2I0YA 4AFEA 2IWIA 1UNLA 3MA6A 2EB3A 4R77A 2R7UA 1HOWA 2C5VA 3GQLA 3QALE 4X2GA 3QWKA 3VS6A 1TWFJ 4C34A 2ETRA 4FV7A 1PXJA 1XB4A 3OYGA 1Z0XA 3HV4A 4MCVA 1QNTA 1U8BA 4B48A 2RKHA 2W4SA 5TR6A 3ATTA 5FFZA 1VNDA 4EJOA 4BTMA 1GXQA 2CH0A 1VQ7I 2DPUA 2GSFA 1OM1A 3COIA 3UJGA 5CF6A 2OA4A 4G7ZF 4H39A 2RFNA 5KCVA 2W1ZA 3SVVA 2BILB 4DLIA 3BPRA 4XBFA 3VBXA 3LFDA 4ETSA 2NRAC 4FKTA 1ZK8A 4RJ8A 3P9CA 3UYSA 5CVRA 1LEBA 3QTWA 3QD0A 2J0JA 3LM5A 4JI9A 4G1WA 2WQNA 3AT3A 4JL9A 5C9CA 1ZARA 2Q83A 4FTIA 4L43A 3M4OJ 1KSWA 4XNEA 2GWRA 3WE8A 2QG5A 3G51A 3OW4A 4KB8A 1R00A 5FUTA 1JKSA 2EFQA 2F48A 2E9OA 3OYMA 1UAAA 5BQ0A 3BLHA 4LFUA 4GFGA 4GSBA 3SHEA 3Q0UA 3F8MA 4FEQA 3AXWA 3DK7A 3KXNA 4D5KA 5ANGA 3DCVA 1VQKI 2WTJA 5CAPA 2OPTA 3C18A 5L3GA 4I0TA 4BBFA 4YO4A 4GK4A 2ZJPF 2IP2A 4EKKA 3ZC6A 1T95A 2Y7JA 4O7SA 3LFKA 1TQIA 2E1MC 4EJTA 2XNOA 2O65A 3Q9ZA 1WWXA 3R04A 4HYHA 2XJ0A 5CLSA 2UW5A 3UR3C 4BGQA 3TACA 4O91A 4C0TA 4UX9A 4FV9A 3KX2A 4EL9A 3MVJA 3V01A 4BXUA 2HOSA 2PFBA 3LCDA 2K9NA 2WAEA 2Y69H 1K2PA 3HEGA 5AM7A 5FRIA 3NWSA 5BYLA 2FMYA 5FEDA 4TWCA 2EH3A 4O0TA 5G1XA 5M5YJ 4BH9A 2WMAA 2OK1A 4ZLOA 5J6XA 4NFMA 3LMGA 4IADA 2OF4A 4IVBA 3AG9A 1XBAA 4RAZA 3NUAA 1XR1A 1J1BA 3SKCA 2NP8A 3CZ6A 2A98A 4O2PA 4DYMA 4M6XA 4OTHA 1QVTA 3U1DA 3IK3A 2QQ7A 3G9LX 3WF5A 4CTBA 1FNNA 3FZRA 2X6WA 2EFWA 2JZYA 3CJFA 2ZSHB 2G01A 2QOQA 4GKHA 3FYJX 3IGGA 2O5KA 2F5EA 2FD5A 1KONA 2K4JA 2LKPA 3GLLA 2R3IA 3FDYA 5HLHA 5ED4A 4ZZOA 4B4LA 4YJSA 4O4EA 4LG4A 3AMAA 3BQCA 4KT5C 3P7AA 4ZDPA 3FWQA 3W2OA 2C0IA 4AWIA 3PXYA 2UW9A 2UXXA 2P4IA 3LFQA 3QAME 5D10A 3NVMB 3I1AA 1PYXA 2QG7A 5B1BH 1BIAA 3J81Z 3ORKA 4A9YA 4EC8A 4BE0A 4LLGF 3QX4A 3FLNC 3R8PA 2C3KA 3R7EA 4IOCF 1UU3A 1LEZA 3W2RA 4G6DA 4TWOA 3ZQHA 4QYEA 3NDMA 3D14A 3JSOA 3QF9A 3RCDA 5AR2A 3NAUA 1K78B 3BZ6A 2VOOA 3W0PA 5M5XJ 1WBOA 3FMNA 4RB0A 2ZMEB 4HSRA 3ZMDA 2VX3A 5KMKA 3KULA 3Q4ZA 3T8OA 2RFDA 2RQQA 3NW6A 2OI4X 5EYCA 5BUEA 3CJGA 5HESA 1H08A 4S04A 3UC4A 3UZPA 4PPCA 3COKA 2MG4A 3LNQA 4AC0A 1RUOA 2GAUA 3JRDA 3CCRI 4ITJA 5FTQA 1P2AA 4M67A 4BDGA 1TZLA 1ZYCA 5EYRA 5DCFA 3BIZA 2PE1A 3O8GA 1X1AA 2DAOA 3WTUC 4F09A 3KP3A 3COHA 4XLIA 2BRNA 2GHGA 2ONLA 3ABKH 1S72I 3EFJA 5TOZA 4QYHA 1RPWA 3J7YJ 3TL8A 2AXLA 4FVQA 5IYBJ 1OIYA 2F4JA 2IZSA 3BV3A 5AFVA 2XK9A 3QQJA 3BJAA 3PVUA 4FV3A 1BMKA 4X3FB 5EKOA 3ZXTA 2H6DA 4AACA 3U87A 1B72A 3TNQB 1MNEA 2YZLA 3L7WA 2IGKA 4UYAA 4JQFA 3FPQA 1OGYA 2IGMA 3IP4B 2L9SA 1HDPA 4C35A 4A6EA 2A3SA 3UIMA 2BAKA 2M7AA 3ULZA 3BEAA 3TNWA 5H3QA 2F4OB 5JH6A 4FZDB 5BVOA 3WARA 3A01B 4JX6A 4BCPA 2W48A 5IA3A 3EZRA 3PLSA 1ZH5A 2ECCA 4E5BA 3QYEA 4XG9A 2M45A 1XMLA 3K70C 2W84A 3P9JA 3V8LA 4QMSA 1JHHA 3ANQA 4EHVA 3TDVA 2WZJA 3DQWA 3R73A 5ICEA 4X2JA 1WGXA 3SJMA 2K9MA 3FXJA 4FSMA 1IRGA 3QXPA 3QKKA 4FG7A 3FUPA 4TZRA 5KNJA 2AHQA 3NNWA 5IDPA 3U21A 5KBQA 3MFSA 1YI4A 3ZO4A 1KE6A 2BZJA 2CN8A 1WMKA 4IZ5A 5LGUA 4XLHA 4FA2A 3ZRGA 1DP7P 2XGXA 3UC3A 1L3LA 3GEZA 4P5OA 4BDHA 4QO9A 1FOXA 4MEXF 4JR3A 4D5FA 2Q8KA 3KRJA 4RC2A 1Z77A 4LB5A 1MJ9A 3LA7A 3EFWA 4NJ3A 3FXKA 2NRYA 3DA6A 1OKYA 1N77A 2X4HA 3KMWA 1ZY5A 4IJAA 3RP9A 1X8BA 4E6KG 2X85A 2DQ7X 1JKTA 4G2FA 3E6DA 3VUGA 1AGWA 1BR4A 4RG0A 1LJ9A 4KITB 1YS7A 4IHYA 3AD5A 2XUUA 3IAS2 4JDJA 2HXOA 4BTFA 5DPVA 2HNHA 3F6XA 3ULIA 2OIDA 2OBPA 4TN6A 3V5JA 4WXHA 3SG8A 1QZEA 3HIFA 2YITA 3M7GA 4TYIA 1AWCA 2LDUA 2LK2A 1K78A 3KL8A 1MIJA 3L2QA 5HD4A 5DT0A 5CSPA 4OMYA 1YHSA 2XM8A 2V1XA 4QNAA 3JY9A 4C4JA 3P5JA 4O7WA 5BOXA 2CNQA 4I5MA 5DEQA 2PVLA 3ZTXA 5FKKA 4GJ3A 5AV1A 2YWPA 2HVRA 5HIDA 3ZUTA 2CW7A 2PLYA 1W5CC 4WSQA 3BI6A 3CIKA 3TDZC 4TTHB 3A4OX 4EQQA 4IZ7A 3KRLA 1UHMA 3F61A 2ZMDA 2IG7A 3K4BA 3OL3A 4L9VA 4IRIA 4CCUA 3RPUA 2OU2A 2XCKA 5HVKA 4FT8A 5E8YA 2K9LA 3H35A 1OI9A 2NYXA 3R0AA 4BJTA 2G15A 1PHKA 2ZJ2A 3TWJA 3V8KA 1XH4A 4WA9A 2MFZA 3I79A 4DC2A 3QQFA 3AMBA 5D5UB 4N9IA 2IT0A 5CTPA 2WV0A 3O0GA 2MABA 1K61A 4QP4A 2EFNA 4PWNA 4HNTA 3H30A 4MGRA 1DM2A 3VWAA 2DYLA 5K7FA 3C2GA 5LEKA 3IAM2 3D94A 4EORA 2XKPA 4QWQA 2J5OA 5AV2A 2MC3A 1XH9A 2WGJA 1JKLA 2C6OA 4WO5A 3R8VA 3CC7I 5CU2A 2VPLA 2DMQA 5C26A 4O22A 2R92J 1F43A 5IT3A 1QPCA 2K9QA 4BE2A 3NYOA 3ZQQA 3DPKA 3UQCA 3JVSA 2DW4A 4L5JA 4K9YA 4D2PA 5F04A 2BDFA 4GT5A 3MVMA 4K2EA 1B8IA 1LVKA 1S9JA 2XIXA 5E3OA 4HV5A 1JTYA 5IDNA 3GU5A 5CNNA 2X0LA 4HRIA 4V05A 5LWMA 5IPJA 3QFVA 2X6OA 3OS3A 2XAJA 4YNEA 3OZ6A 2WQMA 3PXRA 4CFUA 3V7CA 5K0XA