3DBFA

Crystal structure of an activated (thr->asp) polo-like kinase 1 (plk1) catalytic domain in complex with compound 562
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
287
structure length
261
Chain Sequence
KEIPDVLVDPRTMKRYMRGRFLGKGGFAKCYEITDMDTKEVFAGKVVPKSMLLKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMRQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIHSFEVDIWSLGCILYTLLVGKPPFETSCLKETYIRIKKNEYSVPRHINPVASALIRRMLHADPTLRPSVAELLTDEFFTSGYAPMRLPTSCLTVPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Polo-like kinase
publication title Design and synthesis of 2-amino-pyrazolopyridines as Polo-like kinase 1 inhibitors.
pubmed doi rcsb
source organism Danio rerio
total genus 74
structure length 261
sequence length 287
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2008-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dbfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dbfA01
3A7FA 2WIHA 1LP4A 5FTOA 3TXOA 1Y8YA 3DGKA 4MXZA 4D28A 1UKIA 3VWAA 3P78A 4D55A 1OGUA 2E9PA 3W2RA 4L7FA 1BLXA 2W5BA 4XG8A 2JAMA 4ZZMA 3UYTA 3FZSA 4BTMA 5CAOA 4YU2A 3ZRLA 5HO6A 4DA5A 4A9YA 4NFMA 5TO8A 5CZHA 3OG7A 3BYOA 4FZFB 4RMZA 3FEGA 4EKKA 3PY0A 2BKZA 2RF9A 4JBPA 3ZLSA 5IPJA 4KA3A 2V7OA 4ZTLA 1OKZA 2PVMA 5FEEA 4E93A 3QRKA 3NNWA 3VRZA 4D2SA 4LG4A 4QMQA 2VWYA 4K18A 3CJGA 3ZXTA 2JC6A 1SYKA 4IIRA 5H3QA 2C6OA 4RWJA 3QQKA 4FEUA 1BI7A 4E8AA 1PW2A 3ENMA 3VS7A 2YHVA 2AC5A 4NT4A 3D5VA 2E9OA 4XYFA 3QWJA 2ZJWA 2OBJA 4IAIA 4APCA 2B54A 4YLLA 3KGAA 5LMKA 1YWRA 5HTCA 5HKMA 2XZSA 4O84A 3LXKA 1PXMA 4FVQA 4EUTA 5KMIA 5CAPA 1PMUA 3REPA 3FZPA 4BCPA 3ZEPA 3EKKA 4XRLA 3BE2A 3HDNA 3KXMA 3L8XA 5EDPA 5GJDA 2ETMA 4L00A 3ODZX 3RM6A 4DGLC 3VULA 4OTQA 2R0IA 2J2IB 4EI4A 1R0EA 3Q9ZA 2W1CA 3LJ2A 4FTOA 5CU6A 1PXIA 4RJ6A 3MIAA 3EQHA 4DTAA 4FVRA 3TNPC 2W5HA 5FXSA 2G15A 2ZV9A 3SW4A 4GJ3A 4DEGA 1GNGA 2W1EA 2YIXA 3FZ1A 3LFBA 1PMEA 3TIYA 1OL6A 3OD6X 3BELA 1BMKA 1Z5MA 2W1DA 3DDQA 4ZTQA 5HNBA 3TV6A 2P2IA 3GCQA 3QD0A 3WF7A 4J8NA 4E6DA 5A14A 2YITA 5CAUA 3DK7A 5FEDA 4O7SA 4GIHA 3H9RA 5EM6A 4M66A 4KNBA 2YCSA 2GQRA 2WD1A 1XH6A 4YO6A 4R5SA 2WTCA 4QO9A 1OECA 4XLIA 1XHAA 5JGAA 4BDBA 3OF0A 4GFGA 2Q0BA 3RP9A 4CMUA 4NTSA 3ZDIA 4D1SA 3KRRA 4PNKA 4IFGA 2P33A 4K11A 3ZSHA 2FSLX 5AP5A 4O7RA 2UW4A 2JLDA 2XKFA 5JSMA 3IECA 1WBSA 4FTKA 2FH9A 3R73A 3DKOA 3LCKA 3PPZA 4M15A 4OUCA 3HL7A 4K33A 3LZBA 4J97A 2BIYA 3AD4A 2VTHA 3KY2A 3PE2A 2V7AA 4A7CA 4L67A 4FKJA 4EBVA 1APME 3TJCA 4NZWB 3SKCA 1H1WA 1U54A 2R3MA 4ZXTA 4UYAA 3R9RA 4MH7A 4BDCA 5JFSA 4FG8A 3A4PA 3IKAA 2V5QA 4L01A 4ANBA 4F0FA 2XNNA 3L9LA 5IUGA 4KRDA 4A07A 4MQ2A 5AA8A 1ND4A 4CFUA 3SDJA 2GNLA 2QOBA 4PDSA 3PWDA 4U80A 5J9YA 5FUTA 3BYMA 4GIIA 4Y85A 5F20A 1H1SA 3QZIA 3UGCA 3DKCA 5M4FA 3NVMB 3COHA 4FT0A 4TNBA 4ZK5A 3FHRA 3COIA 3FLSA 4OW8A 4UWCA 5M56A 3VW8A 5IDNA 4Z9LA 4IVCA 4ZSGA 3RPYA 4ERWA 3KRLA 4ANQA 3VJOA 3VIDA 4E4XA 3ZRMA 5C8KA 3ZOSA 4LOQA 2GS7A 4F65A 5LQFA 5HNIX 4JAIA 1UA2A 2ITQA 4L3PA 5A6OA 4G17A 5KKRB 1OBDA 3QCXA 2BFYA 3I79A 2UVZA 5J7BA 2XKDA 4MVFA 3FV8A 2VTAA 4IDVA 1XR1A 5AR3A 4JG7A 4BZOA 2B9JA 4WBBB 2XK6A 4IAKA 3PWYA 3P1AA 4APPA 4RX8A 3QGYA 5A3XA 3K3JA 4BCGA 2ITZA 3SRVB 3KVXA 2VTPA 1H0VA 3E87A 3WF8A 5I9XA 4RX9A 5AJQA 4QMTA 3S1HA 3P86A 1OPLA 3QUEA 4KWPA 2O0UA 4RIWB 3QWKA 4GJ2A 2YM4A 1XH4A 4QNYA 4EWQA 1DAYA 3FMMA 1K2PA 4YZMA 3GCSA 3NVKI 1UU7A 1XBCA 2EXMA 3ORLA 4IZYA 2RIOA 4J99A 4C2WA 5HU3A 5FBOA 4KSPA 5AV1A 4XP2A 4ALVA 2X1NA 4FT3A 1MRUA 4AXAA 3HZTA 3GT8A 5EYDA 3VUMA 4DEBA 4F7SA 5EQYA 3OEZA 3E64A 3DNDA 1NVSA 4DH1A 4MF0A 5D11A 4MD9E 1XBBA 3IGOA 3PXRA 4ZS4A 3HMNA 2C6TA 5IQCA 4NIFA 5ANJA 4MD7E 1WBVA 3D5XA 5LVOA 3H4JA 4ITHA 4RGJA 3Q6UA 3H10A 2WTVA 4YZDA 3UO4A 2VV9A 4C34A 2IZTA 2C3LA 3VO3A 3CPCA 5M53A 4DGMA 3QD4A 4ZEGA 1PKGA 3IDCA 3QUDA 3UZTA 4LRMA 1V0PA 5E8SA 1U4DA 4GMYA 4E5WA 2HXLA 4BI2A 2WHBA 4KIKA 2WIPA 2E9NA 4M14A 5JRSA 4S31A 4FSWA 1TKIA 2W96B 4BKYA 1R78A 1UWHA 4XMOA 4FV4A 1ZYLA 4YR8A 4G3CA 4EWHA 1L3RE 3BYVA 4CV8A 3MJ1A 2I6LA 3ZONA 3QF9A 4TT7A 4L3JA 4GG7A 3R28A 4C0TA 3B2WA 3ANQA 4NCTA 4FT5A 4PPBA 4ENXA 4U45A 4PP9A 2ITNA 4O0XA 4QPSA 3RM7A 1FVRA 2ITWA 1IASA 4XEYA 2Y4IB 4F6WA 4FEQA 3ZZEA 4O86A 4U0IA 3E8DA 3G5DA 5KCVA 3NW5A 5KE0A 1O6LA 1WBWA 4XG6A 3FKOA 1JNKA 2R3QA 3LQ5A 2HWPA 2W17A 4IH8A 4IW0A 2Y7JA 3QQUA 4JS8A 2OKRA 4U6RA 3W2SA 1GIIA 3NUSA 3KFAA 4U44A 4IADA 3AGLA 3ZYAA 4IC7A 3I6WA 3HUCA 4OT6A 3TZMA 4ZZNA 1XBAA 3DT1A 4CLIA 4F64A 4KIOA 4NL0A 4X2NA 3DCVA 4HCTA 4H39A 2QONA 2WQNA 3SXSA 3VS2A 2R4BA 4CKRA 4BCKA 4MKCA 2JBPA 2VGPA 4NKAA 4BCFA 3POOA 4ASZA 2HYYA 5I9VA 3R63A 2YEXA 2WTJA 3QKKA 4L3LA 5FRIA 1Q8TA 4CZYB 4ORKA 3UNZA 4HVDA 1YWVA 2GS2A 1QCFA 2BTRA 4ZJJA 2XNPA 4EJNA 5AP4A 4HPUE 5AM7A 3C51A 4OBOA 3G9NA 4U8ZA 2VWUA 4FTJA 2PZIA 4DITA 2ETRA 2H96A 4BCHA 5L6PA 1CKIA 1W82A 3FI8A 2PVFA 4XS2A 3P9JA 2JIIA 1WCCA 4OT5A 1RDQE 3NGAA 3R8UA 2SRCA 3C0HA 3AC1A 3QKLA 3WE8A 3MVHA 4DH3A 2CKQA 2ZVAA 5F95A 2W99B 3FMLA 1NVQA 2IVUA 2FSTX 3EZVA 5HGIA 2C6EA 2HCKA 3FL4A 3V8TA 3W2QA 5AADA 1UNHA 4QP6A 5EKOA 4ZTMA 3EL7A 5FXQA 2W4JA 4GKIA 3EQPA 5EDRA 3CEKA 4JX3A 5CNNA 2W0JA 3BLQA 4I23A 2WMUA 3PVWA 4RIXB 1OKWA 2WMAA 1JWHA 5KZIA 4J7BA 5B2KA 4FKRA 4C58A 4B8MA 3O96A 2HW6A 2UVXA 4ACDA 1G5SA 5I3OA 5KKRC 2PWLA 2W05A 3MH3A 3W55A 4JXFA 1OIUA 1IR3A 3V5WA 3NIZA 4D2TA 1FVTA 2R3RA 5TR6A 2PY3A 3ZM9A 3EL8A 5J1WA 5IMXA 4YBJA 1IAJA 4L52A 3CC6A 5AP0A 4ID7A 4M84A 4NU1A 5D12A 3MH0A 3BGQA 4YJOA 4Z3VA 3MVLA 4ANSA 4UX9A 3L9NA 3DXQA 3ELJA 2BZIB 4B4LA 2WKMA 4BI1A 2OFVA 3CCNA 1E9HA 4RC4A 5ETIA 3AQVA 3DQXA 3R8VA 4C37A 3KXNA 4J52A 1M7QA 4XP3A 5L2IA 3MS9A 3D7TA 5KBQA 4RVLA 3GU5A 2YERA 1KWPA 4KUJA 2GNIA 5HVYA 2WMQA 4FTNA 4CFWA 4O0YA 3L8VA 4M0ZA 4D4YA 2PMOX 3RAWA 1UNGA 3WZUA 5CEOA 4XUFA 3UQGA 4UMUA 1NW1A 3TUDA 3SW7A 5GINE 3A2CA 3Q52A 1E1VA 3O7LD 1Q8ZA 1ZMVA 3MSSA 3OCBA 5IH4A 2F7ZE 3VS4A 2CJMA 3KL8A 2XK9A 2O65A 3MWUA 3NUPA 2VX1A 4G3DA 4D58A 1TVOA 4RVTA 4UB7A 3DXNA 1R0PA 3QFVA 3UMWA 5IQHA 2BRBA 5K5XA 4I94A 1XH9A 4MBLA 2WOUA 4R1VA 5LMAA 3W33A 4DGOA 4ZMFA 4PPCA 1J3HA 3NS9A 2R3JA 2XRUA 2WOTA 4E6CA 1UNLA 3MA3A 3LFEA 2OJJA 3MYGA 4WG5A 3TL8A 3U54A 2ZOQA 4WUNA 2G2FA 1JSVA 2XS0A 3Q9YA 3RKBA 2BRMA 4A9UA 4EH2A 3C4CA 3OUKA 5HD7A 1IEPA 3TZ8A 2X7FA 1G3NA 4ZOGA 5EOLA 3QL8A 1OL2A 4PTCA 5HX8A 3KVWA 4ASDA 1WVXA 4FF8A 4BCIA 1AD5A 5CEPA 2P55A 5M09A 3QTUA 3BU5A 4QOXA 2XF0A 3ZDUA 2OZOA 3RWPA 3C4ZA 3ROYA 2YDIA 4YLJA 4CLJA 5I4NA 2YJRA 3DK3A 4EZ5A 3M11A 5CEMA 2PVKA 2X2LA 5DEWA 4BKJA 3A4OX 2ZB0A 5KMLA 3KREA 2IVVA 4LOPA 3BV3A 2JKQA 4FL3A 5AM6A 4YTIA 5IG1A 5IUHA 4GFOA 3IW7A 3OHTA 5HBHA 5HG8A 4JBQA 4XCUA 2JKOA 2JGZA 1W8CA 3FLQA 4LRKA 5E4HA 4R78A 4E4MA 4CMOA 5HLWA 4CNHA 3WZJA 4HVHA 3WZEA 3OEFX 1AGWA 2BALA 4NFNA 3SVVA 4DN5A 4FVPA 4ZSJA 2C5XA 4JIAA 5HNGA 4PMPA 3GEQA 3WARA 2YIQA 1ZY4A 2LGCA 2HELA 4YSMA 2V22A 3ZC5A 4C8BA 3WF9A 3F61A 4UZHA 1H07A 3U4UA 4XG2A 4U81A 4BZDA 3U4WA 1A48A 3MY5A 4YNEA 2XNGA 3VBWA 3ZTXA 3VBVA 4AOIA 2XYUA 3AC3A 1W98A 4ZLZA 3O8TA 3WF5A 4C4FA 4J71A 1WBOA 1KOBA 1M2RA 3F5UA 3PXFA 4I1ZA 4LYNA 4MAOA 2UZOA 3VBYA 3IONA 5IF1A 5HE1A 1NY3A 2FUMA 2XYNA 3KEXA 4FKSA 5CT7A 2YACA 3ULZA 2PVYA 1YDTE 2VNWA 2WELA 1QPJA 1ZY5A 3FMNA 3VJNA 3TG1A 5AEPA 4UWBA 2CHLA 4DH8A 5IU2A 3NCZA 3NUAA 3ZO3A 4DGGA 4EONA 4D5HA 5HIEA 5IDPA 4LV8A 1JBPE 2X8EA 3FC2A 3AXWA 4UXQA 5DLSA 4F0IA 5JFWA 1BL7A 4D5KA 3A7JA 3GQIA 4F1MA 2QOKA 5LWNA 1P5EA 4F09A 2GS6A 3AGMA 4IDTA 4LL5A 3FWQA 3LW0A 4OTPA 4BHZA 3HLLA 1CKJA 4QPMA 3BHHA 4EOOA 4U5JA 3A61A 3NYXA 3QZFA 3ZFYA 3E62A 5E8XA 3R21A 3PIYA 1IAHA 2HZNA 2XIRA 1B6CB 1PY5A 3OT8A 2J5EA 4F1OA 1ZZ2A 5E92A 2QOFA 5GIOE 1K9AA 4WG3A 3V5QA 5CALA 2NRYA 4FV0A 1H25A 2XH5A 4OBPA 4MWHA 4M7IA 3ZO1A 2X2KA 3FLZA 2Z02A 2Z7LA 4RVKA 2Q83A 2BILB 3E3BX 4CTCA 4EHVA 3FBVA 3ZO2A 1H4LA 4AN9A 2O8YA 3CD8A 4USDA 3II5A 5DGZA 2A2AA 3DTWA 2XJ1A 3C5IA 4FNXA 1OUYA 4MBIA 4WNMA 5A46A 5J87A 4BDJA 4IWOA 4W4YA 3U9CA 4U3YA 5A54A 4MYGA 4IFCA 4X3JA 4DG0E 4TXCA 4ALUA 2VUWA 3QXPA 4YJVA 5EG3A 3EQFA 2EB2A 2ERKA 4FTQA 3LLAA 1REJA 4C57A 1XWSA 2BKKA 4DE4A 2OLCA 1LEZA 1J1CA 3UBDA 5AX9A 4AZVA 2FSOX 2CNQA 2W9FB 4TTHB 4GFMA 4YC8A 5CEIA 1QMZA 4G3GA 2J0MB 4ITIA 4U3ZA 4XG9A 3Q04A 5EI8A 2UW8A 1U5RA 2UZVA 5J1VA 3JS2A 4RJ4A 3HMIA 3ORNA 4NM7A 5J5SA 4BVUA 4JI9A 4RJ5A 3RWQA 4IEBA 4NW6A 2GQGA 4USFA 1ZAOA 3KN5A 2VAGA 3QLFA 3MFRA 4FNZA 3LCTA 3GOKA 3UO6A 5CI7A 4XLVA 4WT6A 3C4WA 1IA9A 4O2ZA 5IEYA 4LMNA 2XBAA 4RFZA 4RG0A 4BCOA 3VW6A 4M13A 5DN3A 4OTFA 3WZDA 1TQPA 4G34A 1BUHA 3W1FA 3ZSIA 5CANA 3ALOA 4FZAB 2ZMDA 5A4QA 2W06A 5K4JA 4YBKA 5ACBC 3MFSA 2YM3A 2B9HA 2RFDA 4RA5A 5AR2A 1PYXA 5HQ0A 4IM3A 4KAOA 4GSBA 4MQ1A 2HZ4A 3PJ2A 4YJRA 3FYJX 3GU6A 2IW9A 3DB6A 4IWQA 2QKWB 3SA0A 4O6LA 4IJ9A 3EQGA 3CPBA 1XH8A 2IVTA 2XA4A 3NYVA 2FO0A 3O2MA 3ORZA 4FG7A 3TN8A 3FY0A 5KNJA 3OCTA 4CFXA 3TWJA 2J5FA 2E9VA 5M44A 3U6HA 5AV2A 4BWXA 3MVJA 1U54B 2B4SB 2UZDA 3DFCB 3TT0A 5AUVA 4RC2A 3TDVA 1F0QA 1URWA 2BVAA 1PF8A 4FKVA 5AIRA 2Y9QA 1V0OA 3QRJA 4NTTA 5A4EA 3ORXA 3JY9A 3MPMA 4DFXE 4QTAA 4F08A 3RK5A 2OIBA 3PA4A 2RGPA 2XIKA 3Q4UA 2QO2A 4PY1A 5DRBA 4RVMA 3HAMA 2J7TA 2X7OA 4O38A 3SOCA 1JVPP 3DJ5A 3EN9A 1ZARA 5EW9A 5AV3A 3L9PA 2C5NA 3GC9A 4MF1A 3Q4CA 3ZCLA 4EJ7A 4IM0A 5LVMA 4JDKA 2A19B 4FIFA 4CT1A 4OTGA 4E1ZA 2YIYA 1H28A 3EYGA 1PJKA 2C6LA 4RJ8A 2WU7A 2KTYA 5AP7A 3EFLA 5IA5A 3PTGA 5DT0A 4NH1A 3Q2JA 2PVJA 4WSYA 5ANEA 5GNKA 2C5OA 2WPAA 3TEIA 1MQBA 1A9UA 3R00A 2WMVA 2W1HA 3F3TA 4HCVA 4B7TA 3R83A 1WBTA 2UZUE 2YDKA 3HMMA 3IOKA 4WOVA 3PVUA 3F2RA 3SQQA 4BIEA 2ZM3A 3CGFA 2IZRA 4QMNA 3R7EA 3R8ZA 1G8AA 2EVAA 3D2KA 3UVQA 4G3FA 3A7GA 4BZNA 5L8LA 2XBJA 3D94A 3IOPA 3W2OA 3SXFA 4P7EA 4FL2A 3PY1A 2UW3A 4FEXA 5GZ9A 3VUGA 4Y83A 4N4SA 4QPAA 4IJPA 4W9XA 3TKIA 3BEAA 4NKSA 3T9TA 4H36A 4QP1A 5LMBA 2QLQA 2QOHA 3CBLA 4X6RA 4NM3A 5IUIA 1ZRZA 4O7NA 5DYJA 2VN9A 1KE6A 2EWAA 3FAAA 4IWPA 1PMNA 1R3CA 1LEWA 5LMKC 3QLGA 1WVYA 5CS6A 4KSQA 3ZRKA 4BCNA 2PU8A 2HIWA 4IE9A 3R2BA 4I6FA 3MB7A 3PVBA 4EEVA 4EK3A 4NIFB 2C30A 3D9VA 2V62A 4ACGA 2Z7RA 3ZZWA 4AZFA 3ROCA 2PMNX 1FVVA 3G2FA 3JVSA 4IVAA 4YJQA 1H27A 5CU3A 2WMWA 3HMPA 1VYZA 3MDYA 3IW8A 5BVOA 5C26A 5HBJA 2XRWA 1ZMWA 4FICA 4AGCA 5KUPA 3U6JA 3VBTA 5J7HA 2YM6A 4KIKB 5A4LA 3N9XA 2GPHA 3UOHA 5CVGA 4EOMA 1VR2A 1JLUE 4FIEA 3DQWA 2J50A 3TZ9A 3JYAA 3T9IA 4O7ZA 3BWJA 3F5XA 2PZYA 3QQJA 4ZS0A 5AUYA 1T45A 1Y91A 3NNUA 2YISA 3ZSGA 5L8JA 2OXYA 4AAAA 4B6LA 2YFXA 3PFQA 4YC6A 5CEKA 2UW9A 1W0XC 3R9NA 2UZNA 3MFUA 3R8PA 4BDKA 4CXAA 3H3CA 3I6UA 4FZDB 4JLCA 4XOZA 3RINA 4WA9A 2XCHA 4ALWA 3O0GA 4DG3E 4RWIA 4C3FA 3OY1A 1B38A 3F88A 3FLNC 2UW6A 1UU8A 4HGEA 4FBXA 1O6KA 2VTQA 2ETKA 1YI6A 4FR4A 4HGLA 5E8YA 1CSNA 4G9RA 5CEQA 2VTLA 3UTOA 3ODYX 4K0YA 4AW2A 4AU8A 2F7XE 3BE9A 2X8DA 3HYHA 3ZHPC 1SNXA 3PRIA 2YDJA 5I9WA 3HRBA 1OIYA 4R6VA 2PTKA 4YMJA 1UV5A 4YTCA 2ACXA 3KULB 3PXKA 3BRBA 2IWIA 5I5ZA 2PZPA 1OKVA 3CKWA 1GIJA 3OFMA 2WMTA 2NP8A 4O0WA 4S34A 3WYYA 3QX2A 5FDXA 4UMRA 5HVKA 3O8UA 4OLIA 2FYSA 4QT1A 2W1IA 3LXLA 4HVSA 5DVRA 2QR7A 1QL6A 2UW7A 3FMHA 4MXYA 5AUXA 1WVWA 2UZWE 5C4LA 4N57A 1Y8GA 2R3PA 1ZLTA 3LCSA 5HE0A 4G2FA 4U42A 3HP2A 4MWIA 3WZKA 4EH9A 3QC9A 2BAKA 2BRGA 2JIVA 4EHZA 3KB7A 3Q60A 3VS5A 4ZY5A 4I4FA 2Z2WA 5E8VA 5EQEA 4F9BA 4G5PA 3KRWA 4GYIA 4CMTA 2X0GA 2WMBA 4F7LA 4O83A 3POZA 3ZM4A 4DF3A 3RTPA 3R22A 5AP3A 2VTRA 4TWOA 1Y6BA 5JZNA 3MN3A 3VN9A 3RVGA 2H6DA 4C61A 4QQTA 1YDSE 3ET7A 1MP8A 5CF4A 5M4CA 4FK6A 2ITUA 3UG2A 3VS0A 1YOMA 4Y8DA 4II5A 3NUNA 3GC7A 3CQUA 3QQLA 3BPRA 4KKHA 5KBRA 5LOHA 3N51A 4BDIA 2PUUA 3PIXA 3EN6A 3I0QA 1QPEA 2O63A 3OXIA 3LCDA 1HCLA 3QKMA 5EW8A 3ULIA 2PUNA 1YXUA 3GCUA 4C36A 2YJSA 4PDYA 2X81A 1SNUA 3RHKA 3HKOA 4BDAA 3LPBA 3F69A 3KRXA 4QMUA 3VUTA 3DDPA 5D9HA 1O6YA 2BRNA 3O7LB 3LFDA 4S2ZA 1MRYA 5DT4A 5L2QA 2CMWA 4GG5A 2CNUA 3MPAA 2XCKA 3BHUA 5TE0A 5C1QB 4YZBA 1Q3DA 4EK5A 3VBXA 3D7TB 5K5NA 3DXPA 2XIYA 4BDDA 5HG5A 4CRSA 4I0TA 1Y6AA 5CQWA 2BHEA 2PULA 3U8WA 4XG3A 3NMUF 4YZNA 2OF2A 1VJYA 4UY9A 4Z16A 2ZV7A 3R7YA 2H34A 5IEVA 2YA9A 1M52A 2WZJA 3UZPA 4X3FA 4GT5A 4P4CA 3HA8A 1XKKA 3UODA 1KE5A 1TQIA 4QNAA 5DRDA 2RFNA 4EHEA 5FXRA 1BYGA 4CYJA 3R0TA 1J91A 1JSTA 3I0OA 2QOQA 4O0SA 4OTHA 4Y46A 2GNHA 4UV0A 4FSRA 2CGWA 3JY0A 4EK8A 4Y95A 3BWFA 2VO0A 2C6IA 5JGBA 5HESA 3DKFA 3R1NA 1OMWA 3FPMA 4YPDA 2PVHA 4CFNA 4CYIA 5BX0A 3QU0A 4G16A 5BVDA 4YUQA 3L1SA 4M3QA 3V6RA 4CFMA 3C5UA 1YRPA 3PSDA 4USEA 3BYUA 4FOBA 3NEWA 3FXWA 5AWMA 2XB7A 3FE3A 4IHPA 3QC4A 3PJCA 4NCTC 3DZQA 4IXPA 4A06A 4WG4A 5DHJA 4AZEA 3K54A 5HD4A 5CI6A 4EH3A 3CTHA 3PA3A 1J1BA 1PHKA 3RAIA 3UIUA 3LQ3A 3V6SA 4K77A 3ATSA 2CN5A 2P3GX 3Q9WA 5E90A 1KUTA 4DFBA 2UVYA 5E8WA 2BAJA 2GU8A 4YC3A 5E91A 5EM7A 2X39A 3VUKA 4ACHA 5C27A 3F66A 4DBXA 1P4OA 4KB8A 5HCYA 3ZLXA 1OITA 3WF6A 5CNOA 3OXZA 4PMSA 2VTOA 2RG5A 4EQMA 4I6HA 2XKEA 5DPVA 4BICA 4Y72A 4I21A 3V8SA 1W84A 2X8IA 3EFJA 1IA8A 2QOIA 1FGKA 4HJOA 4YPSA 4CG9A 3DJ7A 3HV3A 4IWDA 3OTUA 3RAHA 3LXPA 1QPCA 3DU8A 4L7SA 4RFYA 4C4HA 5L2WA 3LAUA 4O1OA 4FT9A 2OH0E 4PUZA 4E26A 4ZSLA 5H8GA 3EQDA 3FI2A 4RX7A 5HZNA 3BU3A 5I0BA 1JSUA 3K5VA 4F0GA 2RFSA 3KXGA 2ZV8A 3S3IA 3FZOA 3ZLWA 3MV5A 2ZAZA 4M69A 5JKGA 1ZYCA 3IDPA 4ZLYA 2BZJA 1OVEA 1VZOA 3M1SA 4D0XA 3CTQA 3ORTA 1NVRA 3BLRA 4F99A 1H0WA 2PPQA 3MY0A 3UP2A 3IW6A 4U7ZA 5DI1A 4PDOA 2A4LA 3Q32A 5D1JA 2IJMA 3PJ8A 3KULA 3LLTA 3HA6A 2ITOA 1GIHA 3KU2A 1WMKA 4D9UA 5K4IA 3O50A 3ZUTA 4NSTA 4CEGA 3SAYA 4JQ7A 4RPVA 3UPZA 2QC6A 3LMHA 5BNJA 3PE1A 5JEBA 3B8RA 2KULA 4A9TA 3QZGA 2JKKA 1F3MC 4TYHB 4JRNA 1ZYSA 4G6LA 2X7GA 3U87A 4FV9A 2I40A 3NLBA 3PLSA 5BPYA 3LFCA 5A4TA 3E63A 4BGQA 4BR3A 4XV9A 5ANOA 4IVBA 2QG7A 3BKBA 3NUXA 2EU9A 3DAEA 5AP2A 3LQ8A 5FP5A 4BBEA 1A06A 5BVNA 4FIGA 3KMUA 4BL1A 4EOIA 3SOAA 2Z60A 3NUUA 4MXAA 1YHVA 3A7IA 4TWNA 2VO7A 3NCGA 5FDPA 2PUPA 4DT8A 3LHJA 4EKLA 4XV1A 3L8SA 4QQ5A 1YXSA 1H08A 3QXOA 2GNGA 1ZOHA 2J6MA 4F9YA 2EXCX 1K3AA 4NEUA 4Z55A 3N4UA 4DCAA 2ERZE 5CENA 2WB8A 3E8EA 4P2KA 4HCUA 4C3RA 4C33A 3TDWA 2BIKB 3VUDA 1UU9A 5BUEA 3PSCA 4AFJA 3DS6A 4OGRA 4FTLA 4KIPA 4HYUA 5HU9A 4OTWA 3N4VA 4H58A 3OW4A 2WU6A 2BRHA 4XRJA 4GL9A 3VF9A 1OB3A 2OO8X 2PMIA 5TOZA 2HK5A 2QD9A 4JDJA 5HCZA 2W7XA 2QU6A 2ONLA 3MFTA 5T6KA 1W83A 3HP5A 3QYZA 5J5TA 3R7OA 4QMWA 2Y6OA 3T3VA 3UIBA 1VEBA 3VQHA 4E4NA 3EHAA 2Z8CA 4MCVA 1E1XA 3R7IA 3GFWA 3A60A 2IZSA 3G0EA 3G33A 3QCSA 1PXPA 3G6GA 5DFPA 1Z57A 3G90X 4IAAA 1UKHA 3LM5A 4FIHA 4Y73A 3LKMA 1M17A 4CCBA 4RX5A 2BR1A 2GTNA 4FV1A 1ERKA 3ZLYA 2A27A 5DG5A 3S2PA 2GHMA 2IW8A 4EYJA 4W8EA 1SMHA 4I92A 2OICA 3V3VA 4FMQA 3NAYA 2B55A 4GT4A 4JNWA 3FI3A 4GU9A 5T3QA 2P0CA 1CDKA 4QYHA 3ORMA 3IPHA 4FX3A 4ACCA 4K1BA 3EFWA 4C4GA 4L68A 3R7GA 5DIAA 4F70A 2C4GA 4XV3A 4FGRA 5KMKA 1CKPA 1WAKA 4MXCA 3GVUA 4EH4A 4ZSAA 2QG5A 5B2LA 4O91A 4I5HA 3RCJA 5T68A 3UC4A 4NW5A 3P7BA 4QMZA 4LV5A 5BVFA 5CASA 2OZAB 3FYKX 5CF5A 4QMOA 1OL7A 5B0XA 2Q0NA 2LAVA 4EOSA 4P5QA 3GC8A 2F2CB 4G6NA 4DFLA 2VD5A 5IA4A 4RIYA 2R3KA 2F2UA 5M55A 4AE9A 4CRLA 3P4KA 5B7VA 2JFLA 3UMXA 2C3KA 4FZ6A 3A8XA 4EOLA 3U55A 2VGOA 4E4LA 1MQ4A 3S00A 2HZIA 3E5AA 5L6OA 2BFXA 4LQMA 4IQ6A 2IW6A 3R30A 5CVFA 2CN8A 3DOGA 4PQNA 2Z7QA 5DNRA 5CU0A 1BKXA 3UOJA 1M2PA 3VS3A 3OXTA 3Q3BA 2B1PA 3KKVA 3WIGA 2Y4IC 3KCKA 3BCEA 2A1AB 5AUWA 1H00A 5CSHA 3E8NA 4LMUA 3W18A 3D14A 3ATTA 4DFUA 4PRJA 2J0LA 3TIZA 1Q5KA 4LUEA 3OWLA 3R9HA 4L44A 3D0EA 3EQRA 2J90A 2CCHA 4QMXA 2R2PA 1JKKA 3S4QA 2GNFA 4ZTRA 4ONAA 3QGWA 5FTQA 4DLIA 3MTFA 3FZRA 4IZAA 3VHKA 1PYEA 1OL5A 2DUVA 3PJ1A 4EH6A 3AMBA 5BVKA 5KMOA 3P23A 5IQGA 1JAMA 2CLQA 2PHKA 4GU6A 4H3BA 1Z9XA 4I22A 4IB5A 3RJCA 5AR5A 3I5ZA 4O6EA 5FGKA 3MBLA 5CF6A 3LFSA 2VX0A 4RZVA 4YZCA 3D83A 3VQUA 3BQCA 1DI8A 4ZP5A 5HOAA 4BGHA 1OPJA 3GXLA 3VRYA 4FODA 1L8TA 4FV8A 4JX7A 2VWZA 5HTBA 5FLFA 1GZ8A 5J9LA 3GGFA 3P7CA 4M12A 3RNYA 1B39A 3P5KA 3MH1A 3Q2MA 4AGWA 2BDJA 4IZ7A 5ETFA 5BMMA 2FSMX 3HV4A 3EN5A 4O82A 2FVDA 4N0SA 4MHAA 3ZBFA 4NJDA 4FL1A 2ZDTA 4UMTA 4C2VA 3VAPA 4TL0A 4D1ZA 2BAQA 2ITVA 3G9LX 2H8HA 4Z7HA 1YI4A 3PYYA 4FSZA 2HW7A 5AR8A 4HYSA 2AYPA 3EZRA 2C69A 3EWHA 3KQ7A 3TNIA 3ZH8A 4BWPA 5DWRA 3G15A 4L8MA 2BCJA 5HX6A 3QD3A 3UIXA 3HRFA 4TYHA 4X0MA 1Q99A 3WIKA 4W4VA 1YHWA 5H8EA 3O23A 2R3OA 1Q3WA 3R02A 2X9EA 2HENA 1BX6A 2VWIA 3FSKA 4N70A 5AV0A 5HLPA 3V5PA 5M4UA 5FG8A 5A6NA 3AT2A 3UNJA 3DK6A 4AW1A 3GC0A 4FKOA 3E93A 4N6YA 3RBWA 1KOAA 3SD0A 3W32A 1STCE 4IX3A 4PTEA 2CSNA 4AX8A 4EQCA 3TNHA 4ZAUA 4GW8A 4ZZOA 4JOAA 2JKMA 2UV2A 4AA4A 3L8PA 2QI8A 4X21A 4BGGA 3JVRA 3MY1A 4E6AA 4IC8A 3AMAA 5FWKK 5IQFA 3RALA 3PXYA 3ZXZA 3FMKA 1OIQA 1ZWSA 2BUJA 3MIYA 4FKGA 1DI9A 4ITJA 4OTRA 5AMNA 4L9IA 3AC8A 1KSWA 3F3ZA 3F2NA 1W7HA 1U5QA 3KC3A 3HECA 3TNWA 4DEDA 4NYEA 2GSFA 1WBNA 3QUPA 3QRIA 2CPKE 3EOCA 5JFVA 5JMSA 3TZ7A 4UN0C 1YDRE 3AT3A 5IQIA 3TM0A 3F3VA 2XNMA 3NSZA 4TYJA 4K2RA 4B9DA 3QYWA 2R3HA 2B53A 5D41A 3GU4A 4AZWA 5A4CA 4JG8A 4AA5A 3UYSA 5EM8A 3R8LA 4KS7A 1PKDA 3TTJA 1VYWA 3AC4A 3OROA 4H1JA 2OJIA 4JQ8A 4QQJA 1XQZA 3NYNA 1ZYDA 5J79A 4EUUA 3IDBA 3A99A 5K0KA 3P0MA 5EQPA 3DKGA 3BHTA 4X2KA 4GK4A 3KMMA 3DAKA 3RAKA 4U43A 2C0IA 2IZUA 5AUTA 3NR9A 4J98A 1JOWB 4WRGA 3N4TA 1FMKA 3QTIA 2VTTA 3NWWA 4JL9A 5M57A 4FTTA 4CKJA 3OUNB 2OWBA 2C5YA 3AG9A 3EJ1A 3HUBA 4DFYA 4DAWA 2J9MA 3DBFA 2BZKB 3HDMA 3HNGA 2HY81 4GRBA 4V0GA 5GZAA 3UG1A 2WMXA 4DFNA 1KE7A 4R3RA 3SV0A 1FPUA 4Y5HA 5F4NA 5CX9A 2OZAA 3A62A 3CTJA 4FNWA 3ENHA 3CSVA 4F63A 5AAGA 2OF4A 1P2AA 1S9JA 4MNEA 1EH4A 5EHYA 3LMIA 2XEZA 3ZBXA 4KRCA 4IACA 2QHNA 2YIWA 2VWXA 2CGXA 2JBOA 2PZRA 5HICA 4DHFA 2A0CX 5FTGA 4WIHA 1M7NA 4O0UA 3NW7A 3C7QA 4AWIA 2OU7A 4HW7A 3DLSA 3KK9A 4ZJVA 3PY3A 2XUUA 4IB0A 4JR7A 3KMWA 3EQBA 4M97A 4UMQA 3TV7A 3FHIA 4I24A 3V5LA 4CZTA 3U6IA 2HAKA 4O22A 4PL5A 5DR6A 2FA2A 5L2SA 4WBOA 4RZWA 2XM9A 2W4KA 4U79A 5EYKA 2GCDA 1GJOA 2PUIA 1H24A 2Y4PA 3HV6A 4C35A 5AAEA 4RQVA 3TV4A 2CKOA 3SXRA 3S95A 3D2IA 5I3RA 4MXOA 1J7IA 5TF9A 2RFEA 2VNYA 1WBPA 3OBJA 4AQCA 3ZC6A 3C4EA 4FKQA 4I5MA 1XO2B 2XIZA 4GVAA 4QYEA 5CTPA 3PJ3A 3F5GA 3DA6A 4O1PA 4E5BA 4FYOA 5HE2A 4JVGA 4RLLA 5BYZA 5HG7A 2P4IA 3H9FA 5EM5A 4CQEA 3CY2A 3RMFA 4BFMA 1YXTA 4J95A 3VUHA 1GY3A 3UPXA 3EIDA 2YABA 4WRSA 5CLPA 3RNIA 4CZUA 1X8BA 1SVGA 3LOKA 2V55A 3C0GA 4X3FB 4JJRA 4TPTA 3FPQA 3ETAA 5GZ8A 4RT7A 5HTIA 1YQJA 2GTMA 3R71A 2C68A 3RGFA 4ENYA 3E3PA 4HVIA 4FKTA 4KBKA 5DH3A 3L9MA 3TJDA 4TNDA 5BVEA 2YLFA 2VWBA 3P79A 3LXNA 5BYLA 2XJ2A 4HZRA 2AUHA 5CYIA 3ALNA 4JQEA 5LCJA 3PPJA 3K3IA 4FTIA 3WYXA 4BF2A 2X9FA 5J8IA 2I0VA 3C0IA 4FSUA 2QVSE 4CG8A 3R8MA 1OL1A 4O7WA 4DT9A 5AIKA 1FOTA 1NXKA 1PRYA 4CTBA 4YZ9A 5HIBA 2F4JA 4OBQA 3T8OA 2F49A 2F7EE 4RLKA 4V04A 5IH6A 3OOGA 3E92A 3LM0A 3SC1A 2B9IA 2QOOA 3CR0A 3NRMA 3RI1A 4ANOA 2HOGA 5CAQA 1SZMA 2WGJA 3LFAA 1KE9A 4WUAA 4PMTA 5AP1A 2XNEA 4BTJA 4F1TA 5M08A 4AG8A 4RC3A 2ITTA 2VO3A 3BV2A 4NUSA 3VS6A 1Q24A 4EC8A 1DAWA 3KXXA 4FV3A 4QTDA 4RJ7A 3LFQA 2WFYA 4O2PA 3OW3A 4FE2A 4XHKB 1PXOA 4G31A 4FUXA 5FBNC 3SGCA 2XP2A 4FKUA 2VRXA 4L42A 3FL5A 5AR4A 4AT4A 5BUIA 2YM8A 4WHZA 5KO1A 2XK3A 2QLUA 3H0ZA 4HGSA 5LCKA 4BDEA 5JT2A 3UO5A 2XKCA 4ANMA 4IANA 4EC9A 3PDTA 4L6QA 4I4EA 4E5AX 2HZ0A 4X2GA 1H01A 4BI0A 4E73A 3K5UA 4FSMA 1REKA 4R77A 4XG7A 5CZIA 3RPSA 1Y57A 1WZYA 3MPTA 3T3UA 3KF7A 3BHYA 3W2CA 4FTRA 4IB1A 2WQEA 4EK6A 3TUBA 4PMMA 3Q96A 1Q41A 2XMYA 4TZRA 3B8QA 1FINA 3W16A 4FKWA 3GBZA 4L43A 3MESA 1OM1A 3TTIA 4QD6A 3TUCA 4M69B 4AGUA 4FGBA 3GB2A 2X6EA 2ZV2A 3Q9XA 2VX3A 4FNYA 3PZEA 5BQ0A 3GQLA 3P08A 2OIQA 4IB3A 3NNVA 2VTMA 4D2PA 3UQFA 1J7LA 4G9CA 2UUEA 4D0WA 3LE6A 5LVPA 1OBGA 5D10A 5HEZA 3HX4A 4UALA 5HO7A 1ZMUA 4XJ0A 3QHRA 4HNFA 4ZJIA 2QR8A 3Q5ZA 2OXDA 3OMVA 4FI1A 2ITPA 4KINA 2DQ7X 2WQMA 4R7IA 4EH7A 2CKEA 3RCDA 2O64A 1YVJA 4F9AA 4UMPA 3C4XA 4FK3A 1P14A 3DBDA 3F9NA 1OUKA 2XM8A 4L45A 2JD5A 3R01A 4K9YA 4O21A 4F9CA 1UU3A 2PE0A 4BB4A 3EKNA 4MBJA 4QP4A 4FA2A 3Q4ZA 4DG2E 4PV0A 4X2FA 3BI6A 3EN7A 4LL0A 2CCIA 2XJ0A 3FLWA 4QP2A 5IA2A 2GNJA 4DH5A 2GFSA 4LI5A 4HYIA 4QMMA 4DTBA 2C6DA 3V5TA 4DH7A 2F57A 2J0IA 4QMLA 1ATPE 2YWVA 2QO7A 4N6ZA 4X2JA 1PMVA 3OWJA 5GJGA 4Q9SA 4WSQA 5HE3A 1R1WA 3D5WA 1NA7A 2BTSA 2HXQA 2OIDA 4V01A 5KZ0A 5JH6A 4DFZE 3ZFXA 3PRFA 4ERKA 3RPRA 2R3GA 2R7BA 3LCOA 4K6ZA 2QNJA 4G6OA 3NAXA 4FYNA 5EYCA 2V0DA 3CQEA 4MXXA 5CQUA 4W4XA 5CXHA 3KK8A 3SX9A 4D4RA 2YAAA 4HOKA 2VZ6A 4GK3A 5I9ZA 4Q5EA 3MJ2A 2VTIA 4AE6A 1DM2A 4M0YA 4HNIA 5IH5A 3AD5A 3FKLA 5CWZA 5JZJA 2J4ZA 3R2YA 3QAME 4X7QA 4YJNA 5HCXA 4A4XA 4FOCA 3QTWA 5CSWA 4X3FC 5EYMA 4GUBA 2GHLA 3FQHA 4AN3A 1H8FA 1YXXA 2OJGA 4M8TA 4FSYA 4JBOA 4CKIA 4XP0A 4DEEA 1JPAA 4P90A 4EHGA 2C0TA 5KHXA 2NNWB 4A9SA 1ZZLA 4I0SA 3PVGA 5EK7A 4CCUA 3EB0A 3IS5A 4BIDA 4MD8E 3ZS5A 2QQ7A 2YM7A 3G51A 3KCFA 4JDIA 4QMVA 3AD6A 4XG4A 4D2WA 4WD5A 4BBMA 3V5JA 2PMLX 1V1KA 1GAGA 4GYGA 1I09A 4WNPA 4KD1A 3KXZA 4DYMA 3FC1X 1ZOEA 3PG3A 2W1GA 5JQ5A 1NT2A 4TKSA 2J0KA 3AT4A 5HHWA 5BUJA 2PYWA 5IQBA 2OG8A 5K0XA 2VWWA 3BLHA 4ARKA 4YHFA 5E8UA 5AFVA 4AT3A 3AOXA 4QYGA 4JBVA 3UQCA 4HVGA 4CT2A 1LPUA 5JRQA 5IQDA 2JDOA 2W1ZA 4R7HA 5DR9A 4AUAA 2X4ZA 3QX4A 4F7JA 4ZMEA 3QQHA 4AW0A 3R6XA 3MW1A 4S32A 3MTLA 4TY1A 5DT3A 2NRUA 2G2IA 4H05A 4R8QA 4RIOA 3DTCA 1RE8A 4I5CA 4G3EA 2IN6A 1ZYJA 3E88A 4CD0A 3Q6WA 3QZHA 4FSTA 4YO4A 3GI3A 4QP3A 4RIYB 5LVLA 4PTGA 3QTQA 2YZLA 5F9EA 2W1FA 3QQGA 2R5TA 3RPVA 4I41A 2DWBA 4IM2A 3RK7A 4BDFA 3GUBA 3P7AA 2FGIA 4QMYA 5E8TA 4M67A 3BHVA 4AW5A 5M06A 3CKXA 4IX5A 2JAVA 5EW3A 5GJFA 3VNTA 3NYOA 2Y6MA 3RPOA 4ZIMA 4WKQA 1PXNA 2C3IB 2JDRA 1PXKA 4Z7GA 4XH6A 3HEGA 4F4PA 3NNXA 5JQ8A 2DYLA 3OCGA 5C01A 4E3CA 3H0YA 4B99A 1UVRA 3CJFA 3PA5A 3QD2B 3H9OA 3F6XA 5EHOA 4O7LA 2E2BA 3I81A 3VC4A 3ZU7A 1Q4LA 4FV6A 3ACJA 4W4WA 5F1ZA 4O7VA 5HI2A 4LOOA 3PSBA 3Q5IA 5DBXA 4OTIA 3GOPA 2RSVA 5HO8A 1Q8YA 1KV1A 2XK8A 1XH7A 2PL0A 3IGGA 4D1XA 4YHTA 4ANNA 5J95A 2J51A 5FQDC 2PVNA 3FJQE 4GH2A 4FEWA 4C3PA 2JITA 1OPKA 3R9OA 3PLAE 2AC3A 3QHWA 5L2TA 3IG7A 3EH9A 4WNOA 2BROA 5L6WL 5C8MA 4O96A 3TACA 3FMEA 4DTKA 4BCMA 4EK4A 2R3IA 3FXXA 5FD2A 5LVNA 4FT7A 5ETAA 4IVDA 2B9FA 2W5AA 3F7WA 3UVRA 3EQCA 3KF4A 4RRVA 4X6QC 4PL3A 4L53A 1XJDA 2EXEA 2JDSA 4CVAA 3DFAA 3BBTB 3BBWA 5BMSA 3QBNA 4B8LA 4DEHA 2C1BA 3NX8A 5AUZA 5H9BA 2GFCA 5CXZA 2ZDUA 2RG6A 5I9UA 3WE4A 3V04A 5I9YA 4R3PA 3ZUVA 4P5ZA 5GHVA 3DNEA 3ACKA 3JPVA 5ANGA 4JG6A 4TW9A 1GZNA 3DBCA 5ETCA 2REIA 3PXZA 1FGIA 3HGKA 3ITZA 4L46A 3G0FA 3KA0A 4QP8A 3U51A 3CGOA 5AR7A 4QTEA 5IA1A 3OCSA 4DEIA 4KS8A 4QYFA 2BDWA 3COKA 2BPMA 2R3NA 3JUHA 3BQRA 4BTFA 3HAVA 5IQAA 4FZ7A 5E7RA 4BHNA 2WEVA 3BYSA 4O7TA 4S33A 3F2AA 2ONLC 4MNFA 1TQMA 5H8BA 4BDGA 2O2UA 3LIJA 3EMGA 1YI3A 3IK3A 4FSQA 4MK0A 1HOWA 3ZUUA 4LUDA 5EDQA 4RJ3A 2WEIA 1KE8A 3AC5A 3I4BA 4H3QA 3C4FA 4I6BA 4CFVA 5EHLA 4CV9A 1UWJA 4PL4A 5JGDA 1Q61A 3FDNA 2G01A 3R9DA 3WI6A 5M51A 4OAVB 3PUPA 4KKGA 2VO6A 4I3ZA 1OI9A 4AOJA 2QO9A 2WNTA 5CT0A 4J8MA 1V0BA 2YCQA 2YAKA 3C9WA 3OOMA 2FB8A 3I7BA 2PE1A 2YCFA 3M2WA 3NUYA 4IAFA 5C8NA 3UE4A 4UXLA 4KBAA 4NK9A 4D9TA 4ZSEA 3CIKA 2XEYA 3UOKA 3ANRA 2I1MA 2YZAA 5EI2A 4EORA 4AGDA 2UZEA 3DLZA 3GNIB 3KXHA 5FM2A 3QTRA 1U59A 1MRVA 5L4QA 4A4OA 4TWCA 4OAUC 2WQBA 2ZYBA 3BGPA 4FTCA 3AMYA 3AC2A 5E1SA 1BI8A 5KMNA 5KMJA 2RL5A 2NO3A 3FY2A 2QCSA 2B52A 4MEDA 4PX6A 5BVWA 5HBEA 3UVPA 3V8WA 3QTXA 5AUUA 1YOLA 4J96A 2EUFB 4MX9A 3PG1A 5D7AA 4C59A 4O0RA 4HZSA 4TWPA 4QQCA 4UEUA 3TI1A 2PK9A 5KMMA 3DPKA 4GKHA 5IMEA 1Q8WA 1R39A 3DZOA 4JIKA 4ZTHA 1MUOA 5E9EA 3GU8A 3OWPA 4NM5A 4RFMA 4U9AA 4I5PA 5C03A 2GMXA 2PVLA 3QRTA 4EBWA 4FKPA 1T46A 4Q2AA 5HVJA 3SLSA 5DA3A 3LVPA 3VF8A 4GUEA 5M4IA 3SG8A 3U9NA 4AZSA 5EI6A 3CXWA 4YTHA 1Q62A 3VBQA 4BTKA 4W8DA 5A9UA 4TN6A 3LMGA 4QTCA 4LFIA 2YWPA 4V0GB 4F9WA 4AFEA 4DGNA 3FUPA 4KIQA 5KHWA 2WAJA 2Z7SA 4M68A 4R3CA 4YJPA 5H2UA 1M2QA 3PXQA 3OY3A 2QODA 5ANIA 4LGGA 4MNEB 4C4JA 2PVRA 2G2HA 4IX6A 4YLKA 2PZ5A 3W8QA 1SVEA 3MGYA 5JFXA 2G1TA 4JAJA 4K8AA 3F5PA 4O0TA 5FP6A 3MA6A 4S30A 4DCEA 5IA3A 5LJJA 3DV3A 5CU2A 2X6DA 3RZBA 3LJ0A 4YTFA 4XBUA 2QURA 2JEDA 2B7AA 2C6MA 3HMOA 4A9RA 5CF8A 3SRVA 2QKRA 1DS5A 2I0EA 5AP6A 2JDVA 4V05A 5JK3A 4YJUA 2O3PA 5DMZA 3I60A 4IBMA 4RSSA 3G6HA 4U97A 4E7WA 3QTZA 5GIPE 4RIWA 3OC1A 2C47A 4RA4A 3W8LA 4UWYA 4W9WA 1LR4A 3R04A 4U41A 3JR1A 3F3WA 2BZHB 5CSPA 4EOKA 2XNBA 4D4SA 1WFCA 3LFFA 5M07A 1IG1A 3DY7A 4CQGA 3BZ3A 4YURA 2ZB1A 4H3PA 2C6KA 3I1AA 3HVCA 4QP9A 2WO6A 4FV5A 2HWOA 3WBLA 1G8SA 1F5QA 2UZLA 3HV7A 4TRLA 4TYIA 4DEAA 1GZOA 2OW3A 1LUFA 3FLYA 4Q5HA 1SVHA 1U46A 1CMKE 5CSXA 5FEQA 1H1RA 4LRJA 2C3JA 3BX5A 4XX9A 4CSVA 2B0QA 2R3LA 3GFEA 5ACKA 5B2MA 2CGUA 3O71A 2UW0A 4IAYA 4C02A 3DBEA 3NZ0A 4QYYA 4IAZA 5AAFA 1HCKA 4GVJA 1QPDA 3JXWA 3DBQA 2G9XA 3UJGA 2OK1A 3FMDA 3BEGA 3DB8A 3TCPA 4EH8A 5BYYA 5EKNA 4RWLA 4F6UA 5LARA 2C0OA 5EH0A 3GCPA 2XK7A 4GEOA 5L3AA 3SG9A 2WXVA 5CAVA 1CM8A 4AOTA 5HIDA 5ITAA 3PIZA 2QOLA 3PPKA 2Y0AA 2I0YA 3D15A 3MI9A 2ZM1A 3MH2A 4YHJA 4XOYA 2IPXA 3QCQA 1I44A 5AA9A 3ORPA 4RBLA 1OKYA 4D2VA 2XIXA 2W4OA 3NPCA 1RW8A 4XNEA 3CP9A 1S9IA 3FQEA 4YGAA 3B2TA 3R1YA 4C7TA 4DC2A 3TKUA 4JDHA 2IVSA 5G1XA 3F7ZA 2VTJA 3IW5A 4YNOA 5LWMA 3RZFA 4OTDA 3QQFA 4D2RA 5ANDA 3MB6A 3K2LA 3OTVA 4JRVA 5D7VA 4UBAA 4GT3A 4R7BA 3PP1A 2WTKB 4QP7A 3LJ1A 5DOSA 1OIRA 3R1SA 3UDBA 3PZHA 4E6QA 2HY0A 4O27B 2WTDA 5CY3A 3TKHA 2X2MA 1J7UA 1FMOE 2QHMA 4YSJA 4FTMA 4QTBA 4PF4A 3LFNA 4NWMA 2GDOA 2Y8OA 3CD3A 3O51A 3ZMMA 5CVHA 4I0RA 2BDFA 4NM0A 4HPTE 4UYNA 3RHXA 3GENA 3HRCA 3C50A 3GCVA 1RQQA 3QA8A 5E8ZA 1URCA 3W10A 4AACA 4WNKA 5HLNA 4QMPA 5KX8A 2OH4A 3I5NA 4BY9E 5ANKA 4GS6A 3VS1A 3E8CA 5HORA 5IKWA 2CGVA 3OZ6A 2GHGA 4BBFA 5LXMA 4J53A 4PPAA 5CU4A 3FXZA 3F82A 2F9GA 3C1XA 3IO7A 4ZTSA 4BYJA 3ID6C 3D5UA 2OI4X 4O81A 1SM2A 2WTWA 2YM5A 4OR5A 3TNQB 3VVHA 2R7IA 2CNVA 1JQHA 2UZTA 4D4VA 2CDZA 2E9UA 2P2HA 3D7ZA 4BRXA 4EZ3A 4FV2A 4ZY4A 4BKZA 5TT7A 2RKUA 3ORIA 5C9CA 4E20A 3THBA 2I0HA 2C1AA 4ASXA 3OS3A 4YJTA 3COMA 3RK9A 2OJ9A 4XBRA 2CKPA 3O8PA 4FG9A 5DR2A 4PDPA 5IZFA 4AA0A 4LGDA 5AX3A 3UP7A 3A8WA 3KRJA 3ZFMA 2ITYA 2XVDA 4MTAA 3FQSA 4LGHA 3MVMA 4RIXA 5J9ZA 1H1QA 4Y5QA 2OGVA 2XNOA 2YLEA 2PSQA 3H30A 4J1RA 2JIUA 4O7YA 1O9UA 4HYHA 2VTNA 4FUYA 3D4QA 1Q8UA 2R0UA 1ZXEA 3UNKA 4B0GA 1BL6A 5ICPA 1OZ1A 2XK4A 3S0OA 3HV5A 2CLXA 2X4FA 4O0VA 3WOWA 3NDMA 4FTAA 1ZOGA 4FC0A 1KV2A 3CY3A 4BYIA 3BGZA 4I93A 5C4KA 1GOLA 3R1QA 2YIRA 4YJSA 2O5KA 2ZM4A 5IEXA 3GU7A 4KABA 3FI4A 2R9SA 1YHSA 2GQSA 4QMSA 2QOCA 4R1YA 3R7VA 5G6VA 4F7NA 2OXXA 5IISA 4RQKA 3DJ6A 3M42A 5JN2A 2JFMA 4EOJA 4IX4A 3C13A 3CS9A 1JKTA 4G5JA 4HGTA 4BDHA 5K9IA 2I7QA 2NPQA 3KN6A 2YCRA 2C5VA 4KBCA 5EFQA 2WMRA 3UIMA 3O17A 3UC3A 3NW6A 3OWKA 3SHEA 4FKIA 4AS0A 1JKSA 3OP5A 4C4IA 3W2PA 3UOLA 2ESMA 3OT3A 2ZMCA 4AT5A 4JR3A 1Q97A 4XV2A 4CFFA 4KKEA 4EYMA 3E7OA 4H1MA 1CTPE 4ZTNA 4PP7A 3UZRA 2ITXA 2DS1A 2QU5A 2YN8A 3CE3A 4QRCA 5FM3A 2H9VA 2EB3A 3PP0A 3QTSA 4DINA 3V51A 1IRKA 4RWKA 4C4EA 5IA0A 3EYHA 4GK2A 3Q4TA 4AN2A 3CQWA 3FZTA 5CSVA 5DE2A 5E1EA 4R5YA 5HG9A 2VWVA 3GP0A 1XH5A 4WO5A 4DLJA 4AF3A 3I7CA 5DEYA 3ZEWA 1AQ1A 5AV4A 4G1WA 4I6QA 4IZ5A 2UW5A 5F94A 1YXVA 3OBGA 4TYGA 3OVVA 3EN4A 3ERKA 3IQ7A 4A4LA 2BMCA 4FKLA 4GV1A 3VUIA 4ASEA 2WMSA 5IQEA 4EOQA 4NJ3A 1FQ1B 4FTUA 4AZTA 2IO6A 3A7HA 3NIEA 4ZLOA 3DAJA 3EFKA 1H1PA 2OFUA 2J0JA 3WILA 2WTKC 3IW4A 3QCYA 1H26A 5K3YA 1YWNA 3FMJA 1PXLA 1M14A 3Q53A 2W9ZB 1PXJA 3BU6A 4EL9A 4UZDA 2R64A 4PNIA 4U40A 4I20A 3CLYA 3FKNA 1RJBA 4ZY6A 4C38A 4ACMA 4FIIA 1FBNA 2WQOA 4DBNA 1GZKA 3ORKA 5TKDA 4BC6A 4BN1A 4F6SA 4AP7A 2UZBA 4CGAA 1JKLA 3R7UA 1YOJA 1P4FA 2WTIA 4TYEA 4BIBA 3QRUA 4FSNA 3EQIA 4IMYA 4BCJA 4BCQA 4EQUA 3QALE 4FEVA 2OSCA 3E7VA 4GCJA 2PE2A 4YP8A 3VHEA 3FSFA 1YW2A 2R3FA 3ZO4A 2VU3A 2VTSA 2OJFE 3BIZA 4JT3A 4EOPA 4BWKA 4LM5A 5EOBA 4EH5A 5L8KA 4C62A 1YKRA 4FV7A 4PWNA 4Q9ZA 3QA0A 2JDTA 4ANLA 3F3UA 4EZ7A 3V01A 4FIJA 2BHHA 2IG7A
chains in the Genus database with same CATH superfamily
3A7FA 2WIHA 1LP4A 5FTOA 3TXOA 1Y8YA 3DGKA 4MXZA 4D28A 1UKIA 3VWAA 3P78A 4D55A 1OGUA 2E9PA 3W2RA 4L7FA 1BLXA 2W5BA 4XG8A 2JAMA 4ZZMA 3UYTA 3FZSA 4BTMA 5CAOA 4YU2A 3ZRLA 5HO6A 2A98A 4A9YA 4DA5A 4NFMA 5TO8A 5CZHA 3OG7A 3BYOA 4FZFB 4RMZA 3FEGA 4EKKA 3PY0A 2BKZA 2RF9A 4JBPA 3ZLSA 5IPJA 4KA3A 2V7OA 4ZTLA 1OKZA 2PVMA 5FEEA 4AXFA 4E93A 3QRKA 3NNWA 3VRZA 4D2SA 4LG4A 4QMQA 2VWYA 4K18A 3CJGA 3ZXTA 2JC6A 1SYKA 4IIRA 5H3QA 2C6OA 4RWJA 3QQKA 4FEUA 1BI7A 4E8AA 1PW2A 3ENMA 3VS7A 2YHVA 2AC5A 4NT4A 3D5VA 2E9OA 4XYFA 3QWJA 2ZJWA 2OBJA 4IAIA 4APCA 2B54A 4YLLA 3KGAA 5LMKA 1YWRA 5HTCA 5HKMA 2XZSA 4O84A 3LXKA 1PXMA 4FVQA 4EUTA 5KMIA 5CAPA 1PMUA 3REPA 3FZPA 4BCPA 3ZEPA 3EKKA 4XRLA 3BE2A 3HDNA 3KXMA 3L8XA 5EDPA 5GJDA 2ETMA 4L00A 3ODZX 3RM6A 4DGLC 2NYAA 3VULA 4OTQA 2R0IA 2J2IB 4EI4A 1R0EA 3Q9ZA 2W1CA 3LJ2A 4FTOA 5CU6A 1PXIA 4RJ6A 3MIAA 3EQHA 4DTAA 4FVRA 3TNPC 2W5HA 5FXSA 2G15A 2ZV9A 3SW4A 4GJ3A 4DEGA 1GNGA 2W1EA 2YIXA 3FZ1A 3LFBA 1PMEA 3TIYA 1OL6A 3OD6X 3BELA 1BMKA 1Z5MA 2W1DA 3DDQA 4ZTQA 5HNBA 3TV6A 2P2IA 3GCQA 3QD0A 3WF7A 4J8NA 4E6DA 5A14A 2YITA 5CAUA 3DK7A 5FEDA 4O7SA 4GIHA 3H9RA 5EM6A 4M66A 4KNBA 2YCSA 2GQRA 2WD1A 1XH6A 4YO6A 4R5SA 2WTCA 4QO9A 1OECA 4XLIA 1XHAA 5JGAA 4BDBA 3OF0A 4GFGA 2Q0BA 3RP9A 4CMUA 4NTSA 3ZDIA 4D1SA 3KRRA 4PNKA 4IFGA 2P33A 4K11A 3ZSHA 2FSLX 5AP5A 4O7RA 2UW4A 2JLDA 2XKFA 5JSMA 3IECA 1WBSA 4FTKA 2FH9A 3R73A 3DKOA 3LCKA 3PPZA 4M15A 4OUCA 3HL7A 4K33A 3LZBA 4J97A 2BIYA 3AD4A 2VTHA 3KY2A 3PE2A 2V7AA 4A7CA 4L67A 4FKJA 4EBVA 1APME 3TJCA 4NZWB 3SKCA 1H1WA 1U54A 2R3MA 4ZXTA 4UYAA 3R9RA 4MH7A 4BDCA 5JFSA 4FG8A 3A4PA 3IKAA 2V5QA 4L01A 4ANBA 4F0FA 2XNNA 3L9LA 5IUGA 4KRDA 4A07A 4MQ2A 5AA8A 1ND4A 4CFUA 3SDJA 2GNLA 2QOBA 4PDSA 3PWDA 4U80A 5J9YA 5FUTA 3BYMA 4GIIA 4Y85A 5F20A 1H1SA 3QZIA 3UGCA 3DKCA 5M4FA 3NVMB 3COHA 4FT0A 4TNBA 4ZK5A 3FHRA 3COIA 3FLSA 4OW8A 4UWCA 5M56A 3VW8A 5IDNA 4Z9LA 4IVCA 4ZSGA 3RPYA 4ERWA 3KRLA 4ANQA 3VJOA 3VIDA 4E4XA 3ZRMA 5C8KA 3ZOSA 4LOQA 2GS7A 4F65A 5LQFA 5HNIX 4JAIA 1UA2A 2ITQA 4L3PA 5A6OA 4G17A 5KKRB 1OBDA 3QCXA 2BFYA 3I79A 2UVZA 5J7BA 4O4BB 2XKDA 4MVFA 3FV8A 2VTAA 4IDVA 1XR1A 5AR3A 4JG7A 4BZOA 2B9JA 4WBBB 2XK6A 4IAKA 3PWYA 3P1AA 4APPA 4RX8A 3QGYA 5A3XA 3K3JA 4BCGA 2ITZA 3SRVB 3KVXA 2VTPA 1H0VA 3E87A 3WF8A 5I9XA 4RX9A 5AJQA 4QMTA 3S1HA 3P86A 1OPLA 3QUEA 4KWPA 2O0UA 4RIWB 3QWKA 4GJ2A 2YM4A 1XH4A 4QNYA 4EWQA 1DAYA 3FMMA 1K2PA 4YZMA 3GCSA 3P5JC 3NVKI 1UU7A 1XBCA 2EXMA 3ORLA 4IZYA 2RIOA 4J99A 4C2WA 5HU3A 5FBOA 4KSPA 5AV1A 4XP2A 4ALVA 2X1NA 4FT3A 1MRUA 4AXAA 3HZTA 3GT8A 5EYDA 3VUMA 4DEBA 4F7SA 5EQYA 3OEZA 3E64A 3DNDA 1NVSA 4DH1A 4MF0A 5D11A 4MD9E 1XBBA 3IGOA 3PXRA 4ZS4A 3HMNA 2C6TA 5IQCA 4NIFA 5ANJA 4MD7E 1WBVA 3D5XA 5LVOA 3H4JA 4ITHA 4RGJA 3W0QA 3Q6UA 3H10A 2WTVA 4YZDA 3UO4A 2VV9A 4C34A 2IZTA 2C3LA 3VO3A 3CPCA 5M53A 4DGMA 3QD4A 4ZEGA 1PKGA 3IDCA 3QUDA 3UZTA 4LRMA 1V0PA 5E8SA 1U4DA 4GMYA 4E5WA 2HXLA 4BI2A 2WHBA 4KIKA 2WIPA 2E9NA 4M14A 5JRSA 4S31A 2AQXA 1TKIA 2W96B 4FSWA 1R78A 1UWHA 4XMOA 2X0PA 1ZYLA 4FV4A 4YR8A 4G3CA 4EWHA 1L3RE 3BYVA 4CV8A 3MJ1A 2I6LA 3ZONA 3QF9A 4TT7A 4L3JA 4GG7A 3R28A 4C0TA 3B2WA 3ANQA 4NCTA 4FT5A 4PPBA 4ENXA 4U45A 4PP9A 3W0MA 2ITNA 4O0XA 4QPSA 3RM7A 1FVRA 2ITWA 1IASA 4XEYA 2Y4IB 4F6WA 4FEQA 3ZZEA 4O86A 4U0IA 3E8DA 3G5DA 5KCVA 3NW5A 5KE0A 1O6LA 1WBWA 4XG6A 4DHZA 3FKOA 1JNKA 2R3QA 3LQ5A 2HWPA 2W17A 4IH8A 4IW0A 2Y7JA 3QQUA 4JS8A 2OKRA 4U6RA 3W2SA 1GIIA 3NUSA 3KFAA 4U44A 4IADA 3AGLA 3ZYAA 4IC7A 3I6WA 3HUCA 4OT6A 3TZMA 4ZZNA 1XBAA 3DT1A 4CLIA 4F64A 4KIOA 4NL0A 4AXDA 4X2NA 3DCVA 4HCTA 4H39A 2QONA 2WQNA 3SXSA 3VS2A 2R4BA 4CKRA 4BCKA 4MKCA 2JBPA 2VGPA 4NKAA 4BCFA 3POOA 4ASZA 2HYYA 5I9VA 3R63A 2YEXA 2WTJA 3QKKA 4L3LA 5FRIA 1Q8TA 4CZYB 4ORKA 3UNZA 4HVDA 1YWVA 2GS2A 1QCFA 2BTRA 4ZJJA 2XNPA 4EJNA 5AP4A 4HPUE 5AM7A 4AAYA 3C51A 4OBOA 3G9NA 4U8ZA 2VWUA 4FTJA 2PZIA 4DITA 2ETRA 2H96A 4BCHA 5L6PA 1CKIA 1W82A 3FI8A 2PVFA 4XS2A 3P9JA 2JIIA 1WCCA 4OT5A 1RDQE 3NGAA 3R8UA 2SRCA 3C0HA 3AC1A 3QKLA 3WE8A 3MVHA 4DH3A 2CKQA 2ZVAA 5F95A 2W99B 3FMLA 1ST0A 1NVQA 2IVUA 2FSTX 3EZVA 5HGIA 2C6EA 2HCKA 3FL4A 3V8TA 3W2QA 5AADA 1UNHA 4QP6A 5EKOA 4ZTMA 3EL7A 5FXQA 2W4JA 4GKIA 3EQPA 5EDRA 3CEKA 4JX3A 5CNNA 2W0JA 4LV7A 3BLQA 4I23A 2WMUA 3PVWA 4RIXB 1OKWA 2WMAA 1JWHA 5KZIA 4J7BA 5B2KA 4FKRA 4C58A 4B8MA 3O96A 2HW6A 2UVXA 4ACDA 1G5SA 5I3OA 5KKRC 2PWLA 2W05A 3MH3A 3W55A 4JXFA 1OIUA 1IR3A 3V5WA 3NIZA 4D2TA 1FVTA 2R3RA 5TR6A 2PY3A 3ZM9A 3EL8A 5J1WA 5IMXA 4YBJA 1IAJA 4L52A 3CC6A 5AP0A 4ID7A 4M84A 4NU1A 5D12A 3MH0A 3BGQA 4YJOA 4O4EA 3MVLA 4Z3VA 4ANSA 4UX9A 3L9NA 3DXQA 3ELJA 2BZIB 4B4LA 2WKMA 4BI1A 2OFVA 3CCNA 1E9HA 4RC4A 5ETIA 3AQVA 3DQXA 3R8VA 4C37A 3KXNA 4J52A 1M7QA 4XP3A 5L2IA 3HAMA 3MS9A 3D7TA 5KBQA 4RVLA 3GU5A 2YERA 1KWPA 4KUJA 2GNIA 5HVYA 2WMQA 4FTNA 4CFWA 4O0YA 3L8VA 4M0ZA 4D4YA 2PMOX 3RAWA 1UNGA 3WZUA 5CEOA 4XUFA 3UQGA 4UMUA 1NW1A 3TUDA 3SW7A 3BL9A 3A2CA 5GINE 3Q52A 1E1VA 3O7LD 1Q8ZA 1ZMVA 3MSSA 3OCBA 5IH4A 2F7ZE 3VS4A 2CJMA 3KL8A 2XK9A 2O65A 3MWUA 3NUPA 2VX1A 4G3DA 4D58A 1TVOA 4RVTA 4UB7A 3DXNA 1R0PA 3QFVA 3UMWA 5IQHA 2BRBA 5K5XA 4I94A 1XH9A 4MBLA 2WOUA 4R1VA 5LMAA 3W33A 4DGOA 4ZMFA 4PPCA 1J3HA 3NS9A 2R3JA 2XRUA 2WOTA 3UDZA 4E6CA 1UNLA 3MA3A 3LFEA 2OJJA 3MYGA 4WG5A 3TL8A 3U54A 2ZOQA 4WUNA 2G2FA 1JSVA 2XS0A 3Q9YA 3RKBA 2BRMA 4A9UA 4EH2A 3C4CA 3OUKA 5HD7A 1IEPA 3TZ8A 2X7FA 1G3NA 4ZOGA 5EOLA 3QL8A 1OL2A 4PTCA 5HX8A 3KVWA 3W0RA 4ASDA 1WVXA 4FF8A 4BCIA 1AD5A 5CEPA 2P55A 5M09A 3QTUA 3BU5A 4QOXA 2XF0A 3ZDUA 2OZOA 3RWPA 3C4ZA 3ROYA 4DHJA 2YDIA 4YLJA 4CLJA 5I4NA 2YJRA 3DK3A 4EZ5A 3M11A 5CEMA 2PVKA 2X2LA 5DEWA 4BKJA 3A4OX 2ZB0A 5KMLA 3KREA 2IVVA 4LOPA 3BV3A 2JKQA 4FL3A 5AM6A 4YTIA 5IG1A 5IUHA 4GFOA 3IW7A 3OHTA 5HBHA 5HG8A 4JBQA 4XCUA 2JKOA 2JGZA 1W8CA 3FLQA 4LRKA 5E4HA 4R78A 4E4MA 4CMOA 5HLWA 4CNHA 3WZJA 4HVHA 3WZEA 3OEFX 1AGWA 2BALA 4NFNA 3SVVA 4DN5A 4FVPA 4ZSJA 2C5XA 4JIAA 5HNGA 4PMPA 3GEQA 3WARA 2YIQA 1ZY4A 2LGCA 2HELA 4YSMA 2V22A 3ZC5A 4C8BA 3WF9A 3F61A 4UZHA 1H07A 3U4UA 4XG2A 4U81A 4BZDA 3U4WA 1A48A 3MY5A 4YNEA 2XNGA 3VBWA 3ZTXA 3VBVA 4AOIA 2XYUA 3AC3A 1W98A 4ZLZA 3O8TA 3WF5A 4C4FA 4J71A 1WBOA 1KOBA 1M2RA 3F5UA 3PXFA 4I1ZA 4LYNA 4MAOA 2UZOA 3VBYA 3IONA 5IF1A 3O5AA 5HE1A 3PUFC 1NY3A 2FUMA 2XYNA 3KEXA 4FKSA 5CT7A 2YACA 3ULZA 2PVYA 1YDTE 2VNWA 2WELA 1QPJA 1ZY5A 3FMNA 3VJNA 3TG1A 5AEPA 4UWBA 2CHLA 4DH8A 5IU2A 3NCZA 3NUAA 3ZO3A 4DGGA 4EONA 4D5HA 5HIEA 5IDPA 4LV8A 1JBPE 2X8EA 3FC2A 1G8KA 3AXWA 4UXQA 5DLSA 4F0IA 5JFWA 1BL7A 1VLRA 4D5KA 3A7JA 3GQIA 4F1MA 2QOKA 5LWNA 1P5EA 4F09A 2GS6A 3AGMA 4IDTA 4LL5A 3FWQA 3LW0A 4OTPA 4BHZA 3HLLA 1CKJA 4QPMA 3BHHA 4EOOA 4U5JA 3A61A 3NYXA 3QZFA 3ZFYA 3E62A 5E8XA 3R21A 3PIYA 1IAHA 2HZNA 2XIRA 1B6CB 1PY5A 3OT8A 2J5EA 4F1OA 1ZZ2A 5E92A 2QOFA 5GIOE 1K9AA 4WG3A 3V5QA 5CALA 2NRYA 4FV0A 1H25A 2XH5A 4OBPA 3AKLA 4MWHA 4M7IA 3ZO1A 2X2KA 3FLZA 2Z02A 2Z7LA 4RVKA 2Q83A 2BILB 3E3BX 4CTCA 4EHVA 3VONA 3FBVA 3ZO2A 1H4LA 4AN9A 2O8YA 3CD8A 4USDA 3II5A 5DGZA 2A2AA 3DTWA 2XJ1A 3C5IA 4F78A 4FNXA 1OUYA 4MBIA 4WNMA 5A46A 5J87A 4BDJA 4IWOA 4W4YA 3U9CA 4U3YA 5A54A 4MYGA 4IFCA 4X3JA 4DG0E 4TXCA 4ALUA 2VUWA 3QXPA 4YJVA 5EG3A 3EQFA 2EB2A 2ERKA 4FTQA 3LLAA 1REJA 4C57A 1XWSA 2BKKA 4DE4A 2OLCA 1LEZA 1J1CA 3UBDA 5AX9A 4AZVA 2FSOX 2CNQA 2W9FB 4TTHB 4GFMA 4YC8A 5CEIA 1QMZA 4G3GA 2J0MB 4ITIA 4U3ZA 4XG9A 3Q04A 5EI8A 2UW8A 1U5RA 2UZVA 5J1VA 3JS2A 4RJ4A 3HMIA 3ORNA 4NM7A 5J5SA 4BVUA 4JI9A 4RJ5A 3RWQA 4IEBA 4NW6A 2GQGA 4USFA 1ZAOA 3KN5A 2VAGA 3QLFA 3MFRA 4FNZA 3LCTA 3GOKA 3UO6A 5CI7A 4XLVA 4WT6A 3C4WA 1IA9A 4O2ZA 5IEYA 4LMNA 2XBAA 4RFZA 4RG0A 4BCOA 3VW6A 4M13A 5DN3A 4OTFA 3WZDA 1TQPA 4G34A 1BUHA 3W1FA 3ZSIA 5CANA 3ALOA 4FZAB 2ZMDA 5A4QA 2W06A 5K4JA 4YBKA 5ACBC 3MFSA 2YM3A 2B9HA 2RFDA 4RA5A 5AR2A 1PYXA 5HQ0A 4IM3A 4KAOA 4GSBA 4MQ1A 2HZ4A 3PJ2A 4YJRA 3FYJX 3GU6A 2IW9A 3DB6A 4IWQA 2QKWB 3SA0A 4O6LA 4IJ9A 3EQGA 3CPBA 1XH8A 2IVTA 2XA4A 1TZDA 2FO0A 3NYVA 3O2MA 3ORZA 4FG7A 3FY0A 3TN8A 3OCTA 4CFXA 5KNJA 3TWJA 2J5FA 2E9VA 5M44A 3U6HA 5AV2A 4BWXA 3MVJA 1U54B 2B4SB 2UZDA 3DFCB 3TT0A 5AUVA 4RC2A 2ZFYA 3TDVA 1F0QA 1URWA 2BVAA 1PF8A 4FKVA 5AIRA 2Y9QA 1V0OA 3QRJA 4NTTA 5A4EA 3ORXA 3JY9A 3MPMA 4DFXE 4QTAA 4F08A 3RK5A 2OIBA 3PA4A 2RGPA 2XIKA 3Q4UA 2QO2A 4PY1A 4O4CA 4RVMA 5DRBA 2J7TA 2X7OA 4O38A 3SOCA 1JVPP 3DJ5A 3EN9A 1ZARA 5EW9A 5AV3A 3L9PA 2C5NA 3GC9A 4MF1A 3Q4CA 3ZCLA 4EJ7A 4IM0A 5LVMA 4JDKA 2A19B 4FIFA 4CT1A 4OTGA 4E1ZA 2YIYA 1H28A 3EYGA 1PJKA 2C6LA 4RJ8A 3BLAA 2WU7A 2KTYA 5AP7A 3EFLA 5IA5A 3PTGA 5DT0A 4NH1A 3Q2JA 4LDTA 2PVJA 4WSYA 5ANEA 5GNKA 2C5OA 2WPAA 3TEIA 1MQBA 1A9UA 3R00A 2WMVA 2W1HA 3F3TA 4HCVA 4B7TA 3R83A 1WBTA 2UZUE 2YDKA 3HMMA 3IOKA 4WOVA 3PVUA 3F2RA 3SQQA 4BIEA 2ZM3A 3CGFA 2IZRA 4QMNA 3R7EA 3R8ZA 1G8AA 2EVAA 3D2KA 3UVQA 4G3FA 3A7GA 4BZNA 5L8LA 2XBJA 3D94A 3IOPA 3W2OA 3SXFA 4P7EA 4FL2A 3PY1A 2UW3A 4FEXA 5GZ9A 3VUGA 4Y83A 4N4SA 4QPAA 4IJPA 4W9XA 3TKIA 3BEAA 4NKSA 3T9TA 4H36A 4QP1A 5LMBA 2QLQA 2QOHA 3CBLA 4X6RA 4NM3A 5IUIA 1ZRZA 4O7NA 5DYJA 2VN9A 1KE6A 2EWAA 3FAAA 4IWPA 1PMNA 1R3CA 1LEWA 5LMKC 3QLGA 1WVYA 5CS6A 4KSQA 3ZRKA 4BCNA 2PU8A 2HIWA 4IE9A 3R2BA 4I6FA 3MB7A 3PVBA 4EEVA 4EK3A 4NIFB 2C30A 3D9VA 2V62A 4ACGA 2Z7RA 3ZZWA 4AZFA 3ROCA 2PMNX 1FVVA 3G2FA 3JVSA 4IVAA 4YJQA 1H27A 5CU3A 4DHIB 2WMWA 3HMPA 1VYZA 1W2DA 3MDYA 3IW8A 5BVOA 5C26A 5HBJA 2XRWA 1ZMWA 4FICA 4AGCA 5KUPA 3U6JA 3VBTA 5J7HA 2YM6A 4KIKB 5A4LA 3N9XA 2GPHA 3UOHA 5CVGA 4EOMA 1VR2A 1JLUE 4FIEA 3DQWA 2J50A 3TZ9A 3JYAA 3T9IA 4O7ZA 3BWJA 3F5XA 2PZYA 3QQJA 4ZS0A 5AUYA 1T45A 1Y91A 3NNUA 2YISA 3ZSGA 5L8JA 2OXYA 4AAAA 4B6LA 2YFXA 2XARA 3PFQA 4YC6A 1W2FA 5CEKA 2UW9A 1W0XC 3R9NA 2UZNA 3MFUA 3R8PA 4BDKA 4CXAA 3H3CA 3I6UA 4FZDB 4JLCA 4XOZA 3RINA 4WA9A 2XCHA 4ALWA 3O0GA 4DG3E 4RWIA 4C3FA 3OY1A 1B38A 3F88A 3FLNC 2UW6A 1UU8A 4HGEA 4FBXA 1O6KA 2VTQA 2ETKA 1YI6A 4FR4A 4HGLA 5E8YA 1CSNA 4G9RA 5CEQA 2VTLA 3UTOA 3ODYX 4K0YA 4AW2A 4AU8A 2F7XE 3BE9A 2X8DA 3HYHA 3ZHPC 1SNXA 3PRIA 2YDJA 5I9WA 3HRBA 1OIYA 4R6VA 2PTKA 4YMJA 1UV5A 4YTCA 2ACXA 3KULB 3PXKA 3BRBA 2IWIA 5I5ZA 2PZPA 1OKVA 3CKWA 1GIJA 3OFMA 2WMTA 2NP8A 4O0WA 4S34A 3WYYA 3QX2A 5FDXA 4UMRA 5HVKA 3O8UA 4OLIA 2FYSA 4QT1A 2W1IA 3LXLA 4HVSA 5DVRA 2QR7A 1QL6A 2UW7A 3FMHA 4MXYA 5AUXA 1WVWA 2UZWE 5C4LA 4N57A 1Y8GA 2R3PA 1ZLTA 3LCSA 5HE0A 4G2FA 4U42A 3HP2A 4MWIA 3WZKA 4EH9A 3QC9A 2BAKA 2BRGA 2JIVA 2X0QA 4EHZA 3KB7A 3Q60A 3VS5A 4ZY5A 4I4FA 2Z2WA 5E8VA 5EQEA 4F9BA 4G5PA 3KRWA 4GYIA 4CMTA 2X0GA 2WMBA 4F7LA 4O83A 3POZA 3ZM4A 4DF3A 3RTPA 3R22A 5AP3A 2VTRA 4TWOA 1Y6BA 5JZNA 3MN3A 3VN9A 3RVGA 2H6DA 4C61A 4QQTA 1YDSE 3ET7A 1MP8A 5CF4A 5M4CA 4FK6A 2ITUA 3UG2A 3VS0A 1YOMA 4Y8DA 4II5A 3NUNA 3GC7A 3CQUA 3QQLA 3BPRA 4KKHA 5KBRA 5LOHA 3N51A 4BDIA 3AKJA 2PUUA 3PIXA 3EN6A 3I0QA 1QPEA 2O63A 3OXIA 3LCDA 1HCLA 3QKMA 5EW8A 3ULIA 2PUNA 1YXUA 3GCUA 4C36A 2YJSA 4PDYA 2X81A 1SNUA 3RHKA 3HKOA 4BDAA 3LPBA 3F69A 3KRXA 4QMUA 3VUTA 3DDPA 5D9HA 4AXEA 1O6YA 2BRNA 3O7LB 3LFDA 4S2ZA 1MRYA 5DT4A 5L2QA 2CMWA 4GG5A 2CNUA 3MPAA 4O4FA 2XCKA 4I6LA 3BHUA 5TE0A 5C1QB 4YZBA 1Q3DA 4EK5A 3VBXA 3D7TB 5K5NA 3DXPA 2XIYA 4BDDA 3KIOC 5HG5A 4CRSA 4I0TA 1Y6AA 5CQWA 2BHEA 2PULA 3U8WA 4XG3A 3NMUF 4YZNA 2OF2A 1VJYA 4UY9A 4Z16A 2ZV7A 3R7YA 2H34A 4QEBA 5IEVA 2YA9A 1M52A 2WZJA 3UZPA 4X3FA 4GT5A 4P4CA 3HA8A 1XKKA 3UODA 1KE5A 1TQIA 4QNAA 5DRDA 2RFNA 4EHEA 5FXRA 1BYGA 4CYJA 3R0TA 1J91A 1JSTA 3I0OA 2QOQA 4O0SA 4OTHA 4Y46A 2GNHA 4UV0A 4FSRA 2CGWA 3JY0A 4EK8A 2X0OA 4Y95A 3BWFA 2VO0A 2C6IA 5JGBA 4DDIA 5HESA 3DKFA 3R1NA 1OMWA 3FPMA 4YPDA 2PVHA 4CFNA 4CYIA 5BX0A 3QU0A 4G16A 5BVDA 4O4DA 4YUQA 3L1SA 4M3QA 3V6RA 4CFMA 3C5UA 1YRPA 3PSDA 4USEA 3BYUA 4FOBA 3NEWA 3FXWA 5AWMA 2XB7A 3FE3A 4IHPA 3QC4A 3PJCA 4NCTC 3DZQA 4IXPA 4A06A 4WG4A 5DHJA 4AZEA 3K54A 5HD4A 5CI6A 4EH3A 3CTHA 3PA3A 1J1BA 1PHKA 3RAIA 3UIUA 3LQ3A 3V6SA 4K77A 3ATSA 2CN5A 2P3GX 3Q9WA 5E90A 1KUTA 4DFBA 2UVYA 5E8WA 2BAJA 2GU8A 4YC3A 5E91A 5EM7A 2X39A 3VUKA 4ACHA 5C27A 3F66A 4DBXA 1P4OA 4KB8A 5HCYA 3ZLXA 1OITA 3WF6A 5CNOA 3OXZA 4PMSA 2VTOA 2RG5A 4EQMA 4I6HA 2XKEA 5DPVA 4BICA 4Y72A 4I21A 3V8SA 1W84A 2X8IA 3EFJA 1IA8A 2QOIA 1FGKA 4HJOA 4YPSA 4CG9A 3DJ7A 3HV3A 4IWDA 3OTUA 3RAHA 3LXPA 1QPCA 3DU8A 4L7SA 4RFYA 4C4HA 5L2WA 3LAUA 4O1OA 4FT9A 2OH0E 4PUZA 4E26A 4ZSLA 5H8GA 3EQDA 3FI2A 4RX7A 5HZNA 3BU3A 5I0BA 1JSUA 3K5VA 4F0GA 2RFSA 3KXGA 2ZV8A 3S3IA 3FZOA 3ZLWA 3MV5A 2ZAZA 4M69A 5JKGA 1ZYCA 3IDPA 4ZLYA 2BZJA 1OVEA 1VZOA 3M1SA 4D0XA 3CTQA 3ORTA 1TFFA 1NVRA 3BLRA 4F99A 1H0WA 2PPQA 3MY0A 3UP2A 3IW6A 4U7ZA 5DI1A 4PDOA 2A4LA 3Q32A 5D1JA 2IJMA 3PJ8A 3KULA 3LLTA 3HA6A 2ITOA 1GIHA 3KU2A 1WMKA 4D9UA 5K4IA 3O50A 3ZUTA 4NSTA 4CEGA 3SAYA 4JQ7A 4RPVA 3UPZA 2QC6A 3LMHA 5BNJA 3PE1A 5JEBA 3B8RA 2KULA 4A9TA 3QZGA 2JKKA 1F3MC 4TYHB 4JRNA 1ZYSA 4G6LA 2X7GA 3U87A 4FV9A 2I40A 3NLBA 3PLSA 5BPYA 3LFCA 5A4TA 3E63A 4BGQA 4BR3A 4XV9A 5ANOA 4IVBA 2QG7A 3BKBA 3NUXA 2EU9A 3DAEA 5AP2A 3LQ8A 5FP5A 4BBEA 1A06A 5BVNA 4FIGA 3KMUA 4BL1A 4EOIA 3SOAA 2Z60A 3NUUA 4MXAA 1YHVA 3A7IA 4TWNA 2VO7A 3NCGA 5FDPA 2PUPA 4AQKA 3LHJA 4EKLA 4DT8A 4XV1A 3L8SA 4QQ5A 1YXSA 1H08A 3QXOA 2GNGA 1ZOHA 2J6MA 4F9YA 2EXCX 1K3AA 4NEUA 4Z55A 3N4UA 4DCAA 2ERZE 5CENA 2WB8A 3E8EA 4P2KA 4HCUA 4C3RA 4C33A 3TDWA 2BIKB 3VUDA 1UU9A 5BUEA 3PSCA 4AFJA 3DS6A 4OGRA 4FTLA 4KIPA 4HYUA 5HU9A 4OTWA 3N4VA 4H58A 3OW4A 2WU6A 2BRHA 4XRJA 4GL9A 3VF9A 1OB3A 2OO8X 2PMIA 5TOZA 2HK5A 2QD9A 4JDJA 5HCZA 2W7XA 2QU6A 2ONLA 3MFTA 5T6KA 1W83A 3HP5A 3QYZA 5J5TA 3R7OA 4QMWA 2Y6OA 3T3VA 3UIBA 1VEBA 3VQHA 4E4NA 3EHAA 2Z8CA 4MCVA 1E1XA 3R7IA 3GFWA 3A60A 2IZSA 3G0EA 3G33A 3UDTA 3QCSA 1PXPA 3G6GA 5DFPA 1Z57A 3G90X 4IAAA 1UKHA 3LM5A 4FIHA 4Y73A 3LKMA 1M17A 4CCBA 4RX5A 2BR1A 2GTNA 4FV1A 1ERKA 3ZLYA 2A27A 5DG5A 3S2PA 2GHMA 2IW8A 4EYJA 4W8EA 1SMHA 4I92A 2OICA 3V3VA 4FMQA 3NAYA 2B55A 4GT4A