3DBFA

Crystal structure of an activated (thr->asp) polo-like kinase 1 (plk1) catalytic domain in complex with compound 562
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
287
structure length
261
Chain Sequence
b'KEIPDVLVDPRTMKRYMRGRFLGKGGFAKCYEITDMDTKEVFAGKVVPKSMLLKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMRQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIHSFEVDIWSLGCILYTLLVGKPPFETSCLKETYIRIKKNEYSVPRHINPVASALIRRMLHADPTLRPSVAELLTDEFFTSGYAPMRLPTSCLTVPPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polo-like kinase
publication title Design and synthesis of 2-amino-pyrazolopyridines as Polo-like kinase 1 inhibitors.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transferase
total genus 74
structure length 261
sequence length 287
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2008-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dbfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dbfA01
4QP2A 2P2HA 1Q8WA 1OGUA 4R1VA 2J51A 3MB7A 4J1RA 4K6ZA 4ANMA 3UQCA 3LFSA 5HG7A 2O63A 5IQDA 4AE6A 3LFQA 1R78A 3GFWA 4BBFA 3GXLA 1KUTA 4M12A 2GHGA 3COHA 5FQDC 4TW9A 3ZXTA 2HWOA 3PYYA 4JDJA 5TOZA 1JLUE 2BALA 3C0IA 3F7WA 3OW3A 1Y8GA 4QTCA 1ZXEA 3KF4A 3QTRA 4XG7A 3ULIA 2QOQA 1OKYA 3EYHA 4QP7A 3KXZA 4X2KA 3S95A 3MTLA 5CAVA 2BHHA 4J52A 5E7RA 3KB7A 3NNUA 4XYFA 4ZLZA 2J0KA 2BFXA 3KA0A 5CNNA 1MRVA 3FXWA 4XV1A 3FY2A 3E8CA 5M4UA 4ERWA 4IZAA 3WF5A 3S00A 4YZ9A 5AA8A 4PMTA 5JEBA 4BCNA 5JGBA 3DQWA 2BFYA 2EXMA 4CTCA 1HOWA 4GJ2A 3BBWA 3BHYA 2BZKB 3VBVA 4DEDA 3LMHA 3UQGA 5DT0A 1OKVA 3PDTA 4C4IA 4O96A 3DTCA 1JKSA 2A2AA 3ET7A 4FV9A 4KIKA 4WBOA 3OHTA 2IPXA 5CI7A 1M14A 2EUFB 3D7TB 3NYOA 2VWBA 2FSMX 3VJOA 3PA5A 3ZC5A 3NWWA 2F7EE 4AW5A 4GIHA 4RIXB 3MVLA 4GSBA 5IEYA 4DLIA 1ZYSA 2PUNA 4V04A 4QRCA 5AV0A 4BICA 2P55A 3AGLA 5CVHA 4B6LA 2RGPA 3ORPA 2UW7A 3OOMA 3UPZA 2UW4A 1YDSE 1VYWA 1TQMA 4IX4A 1U54A 1JKKA 2VTPA 4E7WA 3QRUA 5K4JA 2DWBA 2XA4A 4GT3A 4MD9E 2UW3A 2PVLA 3DFCB 3I5NA 3NS9A 1H0WA 1DM2A 4L01A 3OBJA 4ZTLA 1FVVA 1H0VA 2Y0AA 3G90X 4FKJA 5D9HA 4L3PA 3I79A 4KWPA 3W2SA 3NAYA 4A9TA 3QL8A 4FSNA 3E62A 3QYWA 4GU6A 4L44A 3DCVA 4GMYA 4BDDA 4F9WA 4FEQA 3UVQA 4D2PA 3U6IA 3FI3A 3DKFA 2RL5A 5H8GA 4QMZA 4C4EA 3AC2A 3UOLA 3H0ZA 1K2PA 3GB2A 3LPBA 4CFXA 5CAQA 3PVWA 1ZZLA 1IA9A 1CKPA 1VYZA 2ZM3A 5K3YA 3U51A 4FKTA 3Q9ZA 2W5HA 3L1SA 4I6HA 4KIQA 2ERZE 2W9FB 2XJ2A 2BDFA 3C4CA 3R8UA 5IA2A 1KWPA 1GIHA 4PX6A 4F1TA 3MGYA 3IOKA 2WIPA 3VUMA 3G2FA 1H01A 4EH6A 3GU5A 2YM3A 2BROA 3GVUA 4RJ8A 3R9NA 5M55A 3ZC6A 4OT5A 4ALWA 4F6SA 3QQUA 3WOWA 2PVKA 5T68A 3REPA 1YHVA 4UEUA 3QLGA 5CU3A 3WF8A 1OB3A 2EU9A 3C13A 5FDPA 3R83A 3E8DA 3D0EA 4FTAA 3F9NA 2XUUA 4IXPA 1QPDA 2J5EA 4NIFA 3D4QA 1JAMA 2J0MB 4DE4A 5AUYA 5E8TA 4NJ3A 4DHFA 2JEDA 3BWJA 4H3PA 3OW4A 5JH6A 5AP6A 4O83A 1NVRA 1H25A 4JBPA 2NP8A 4XG6A 4OR5A 1PY5A 4O6EA 5D10A 3BLHA 3TN8A 4JBQA 5CU4A 2W9ZB 3V5PA 5CALA 3PPKA 4LOOA 3TDWA 1TVOA 3K5UA 3TWJA 3VUTA 5AUWA 1DI8A 1WBSA 4IM0A 3RAKA 4EUUA 3ANQA 1IA8A 4MAOA 3E88A 4F70A 4O84A 3FYJX 4IC7A 4EZ7A 3ZDUA 2HXQA 1SZMA 3KXGA 4CLJA 1WBTA 4IWDA 4I41A 3DFAA 4IZ5A 4O0RA 3L8SA 3BE9A 4HOKA 3RBWA 3ERKA 1A06A 5KMIA 3R01A 2XS0A 2C0TA 3VHKA 5AV1A 5CSXA 4KBCA 1QL6A 4EJ7A 5IQBA 3V5TA 4Z7HA 2CNVA 4F7NA 3O7LD 2QHMA 4F0FA 3S1HA 3LQ5A 1PMVA 2J50A 5KX8A 2C6OA 3ZU7A 5J7BA 2F2CB 5DNRA 4GH2A 5AIKA 3M2WA 2Y9QA 1PYXA 5E90A 3BQCA 4KBKA 3ZFMA 4FSWA 5CT0A 4EK4A 4XCUA 4RLLA 4HZSA 2YDIA 4ZTRA 4FKUA 5CZHA 3TEIA 5AP5A 3OBGA 3EL8A 3DJ5A 3QRKA 4MNEB 2JBPA 4RFMA 5M06A 4YC6A 5KUPA 3KU2A 4QOXA 2AYPA 3HMMA 1O9UA 4X6QC 5DE2A 4N4SA 4YPSA 3UYTA 5FXQA 3RZFA 4Z16A 4W4WA 1AD5A 3ANRA 3IKAA 3R2BA 4R7IA 2FSLX 3MJ2A 1URWA 3NRMA 4I3ZA 3VO3A 3BYOA 2P2IA 2WEIA 3PZEA 1K9AA 3AT3A 3P86A 4AOIA 4ZIMA 4EOMA 5ANGA 4CVAA 4IADA 4MWHA 2RG5A 5EM7A 5CEPA 3WZDA 2AC5A 2R3OA 3O8PA 1GZOA 4DEEA 1R39A 3E3PA 4Z7GA 3EQFA 4ASXA 2B1PA 3KK9A 4RG0A 2CKOA 4RJ7A 5F20A 3DDPA 3MIAA 4R3RA 4LUEA 4P4CA 4C62A 4ZJJA 1I44A 5EW9A 3FQHA 4PRJA 3WYYA 4AG8A 4CGAA 3AMBA 4GFMA 3CE3A 5FEQA 2UW0A 2ETRA 3PLSA 4Y8DA 1MRUA 4ZY4A 3WE4A 2GNFA 2YCFA 2OSCA 3TZMA 4ASEA 3A7HA 4MBLA 3TV6A 2X39A 4DEHA 4QP4A 2UVYA 4DYMA 4DFBA 4OLIA 4UXQA 4FICA 4CMUA 1WVWA 2XF0A 3KCFA 2VO6A 2W06A 3EB0A 2C3IB 2Y8OA 3EHAA 5EKNA 2F7ZE 3W33A 4EONA 4M0YA 3LW0A 4U40A 3UOKA 4E3CA 3KMUA 5FTGA 3Q9WA 4ANQA 4DGOA 4HPTE 5AFVA 4UMPA 3A8XA 4ZY5A 4ERKA 4L3JA 4E20A 3G6HA 2VNWA 3Q5ZA 4XP3A 2GHMA 1M2QA 2HELA 3BHTA 2OGVA 3LFDA 4U43A 5KBRA 3QTWA 3HKOA 3S0OA 2BHEA 3RVGA 2ERKA 2O3PA 2BRBA 4AZVA 2E9VA 4CKIA 2VX3A 3E8EA 4BTJA 4HCUA 4L8MA 4BCKA 1P2AA 3TNQB 2XEYA 3I1AA 3GCVA 4O86A 3EYGA 3QZFA 5A3XA 3HDNA 1O6YA 3WBLA 3OT8A 1M2PA 2XRUA 3MWUA 2PSQA 5BVKA 3RK5A 3WE8A 4YTFA 1REKA 2JIVA 3QRTA 3PJ1A 4RX8A 2OH0E 2X7FA 3BBTB 5E8XA 5HIBA 5IUIA 5JKGA 3U54A 2OG8A 1R3CA 3KXHA 4RWIA 3H4JA 2HIWA 3DBFA 4TRLA 5CZIA 3ENHA 4RLKA 2VAGA 3OWKA 1PXLA 2ZOQA 4UX9A 3A7IA 3JXWA 3PP0A 4AXAA 4BHNA 2VU3A 5LMKA 4FKSA 3JYAA 3QC9A 2C1AA 1YHSA 4ZSGA 3UJGA 2PHKA 3PSBA 3E7VA 3FXZA 3VS7A 1YXTA 4M8TA 4DEBA 4BCPA 4PUZA 1S9IA 4PL4A 4XBUA 4U5JA 3RWPA 3ATTA 4ZS4A 2J7TA 4BDKA 1OUKA 4G5PA 2UW8A 2XM9A 2OXXA 2BIYA 2GHLA 4OTPA 5E8ZA 1BKXA 4C2WA 5FBNC 4E6CA 4G9CA 4FZ6A 3EFWA 1W0XC 5IH6A 4E8AA 5D1JA 3EN7A 3FZ1A 4YJVA 4BL1A 3FXXA 3O50A 5TR6A 2X8EA 4WG5A 3ZSGA 4JI9A 5HBJA 3ETAA 4AA0A 4EQCA 5AUTA 3JUHA 1H28A 1UU7A 4C57A 3DT1A 3PY3A 5AA9A 4IX3A 1FGKA 3C0HA 4NEUA 4EOIA 2WO6A 3R8PA 3C5IA 3BU3A 5DEWA 3CJFA 5EKOA 5AADA 4IAZA 4LG4A 4MQ2A 4OBQA 1YXSA 2J6MA 2PZRA 2QOCA 1J91A 4ENYA 2C5XA 5GZ8A 3THBA 2IJMA 1SVHA 3WIGA 3ID6C 4GUEA 4XLVA 1L8TA 4NW5A 3D5UA 2O64A 4QQCA 4EI4A 4GJ3A 4MQ1A 5BVFA 4C59A 5K9IA 4CCBA 3VN9A 2XVDA 1ZZ2A 1O6LA 3DKCA 4GKIA 3VS2A 3ORLA 3F6XA 4O7WA 3ZEPA 2WMBA 3NUAA 3SRVA 2WIHA 3ENMA 4Q5HA 4CFUA 2B9JA 4DFLA 5K5XA 5IA0A 2W4OA 4JG8A 3TACA 3FMMA 3A4PA 3IW4A 4GEOA 4DGLC 2OW3A 1H4LA 4MCVA 2R3MA 4XEYA 4FT9A 5J8IA 4G6NA 4ZTMA 2VWXA 1FQ1B 4FV7A 1WZYA 1LEWA 1Q62A 4RVMA 4DTKA 1M52A 2ITPA 3ALNA 5CSWA 4MXXA 3QKLA 4XNEA 1Q8UA 3CBLA 1BYGA 4LMNA 4M69B 4RJ5A 3NZ0A 5A6NA 3TT0A 5ICPA 3NUPA 1H8FA 4QPAA 4CV8A 2FGIA 4FSRA 3QWKA 3U6HA 5DA3A 3WF7A 4BBEA 4EC8A 1K3AA 3W16A 4RA4A 2WGJA 4ZAUA 4A4LA 4BYJA 4GW8A 3UOJA 5LVMA 4CFFA 1ND4A 4U81A 4KIPA 4B8MA 2PZPA 4EKKA 2XK6A 4IM2A 1ZYJA 5ANOA 4FMQA 1Y8YA 4NZWB 1ZOGA 1UWHA 4UZHA 4F9YA 4QP1A 3NUYA 4JJRA 5AUUA 2IZUA 4X7QA 4FX3A 3NLBA 3Q4UA 3QZGA 4RIYA 2PULA 4O7RA 1KOBA 2XJ1A 4X6RA 3B8QA 5C8KA 2HYYA 4A06A 3A62A 4FK6A 5CWZA 4FTTA 1Q41A 3BHVA 4FTLA 3MVMA 3BV3A 3F66A 4WNOA 1YXVA 3P4KA 4IX5A 4C33A 5KMKA 4JS8A 4U3ZA 1E9HA 5C27A 4FG7A 4XBRA 2P3GX 3HDMA 2XZSA 3LFFA 3DS6A 4FKOA 4RSSA 1X8BA 5AX3A 3AMAA 5HLWA 3CY3A 4BDCA 4NW6A 3Q9YA 5E1EA 4X21A 3NAXA 2ITNA 5D11A 4G1WA 3OXZA 4HNIA 4E73A 2FO0A 2ZV9A 4JG7A 3LKMA 1YI4A 1V1KA 4DCAA 3KXNA 2SRCA 3QD2B 3AD5A 5HICA 4R78A 3CD8A 1M2RA 3OVVA 4YJRA 4AFEA 2XBJA 5CYIA 1PF8A 3UNJA 4BCGA 4R7BA 5C26A 1V0OA 2BKZA 3COIA 3SW4A 1ZYDA 1KV2A 4XG4A 3CS9A 4GVAA 5GINE 4D2RA 5DLSA 4U6RA 3ZXZA 3IW6A 2XB7A 5KKRB 3MDYA 1FMOE 3DQXA 3NIEA 5HO8A 4PF4A 3WZKA 1V0PA 2W4JA 4FTKA 1SNUA 5HG9A 1QMZA 3SW7A 2R3KA 2X7GA 2XP2A 3HYHA 4NKSA 3MESA 2C6EA 3GI3A 3QZHA 5LVLA 4E4LA 3NPCA 3QU0A 4G3FA 4KKGA 1OKZA 2OI4X 4UWCA 5HVKA 5L2IA 1W8CA 1XH4A 5L2WA 2PZIA 1HCLA 3FV8A 2J5FA 2OZAB 3SX9A 4P90A 2RSVA 4DT8A 3QQGA 3OCSA 4II5A 5E91A 3UGCA 3QKKA 1JNKA 5DI1A 5CEKA 4D4RA 1UV5A 5I3RA 4BDGA 2ITUA 4MXOA 4F0GA 5C03A 1H08A 4ENXA 2PVFA 4F6UA 1NVQA 4DFXE 5IA4A 5DRDA 4BIBA 2ITWA 4GIIA 4IJ9A 4XV3A 4IE9A 4U41A 3WARA 4LOPA 4NYEA 3F3TA 4G2FA 4F1MA 4HW7A 2P33A 4FKGA 3LJ2A 3MJ1A 5C01A 3I6WA 2VWZA 4HPUE 2WQBA 3SOAA 2WNTA 4L7FA 4OT6A 3VUDA 4ZSAA 2XCHA 3KULA 5CNOA 5K5NA 3AG9A 3RWQA 2XYNA 1J3HA 1H07A 2CCIA 2HWPA 2W0JA 5DPVA 4W4VA 5AMNA 3DXPA 3EMGA 1UA2A 3WZEA 4BCMA 2C30A 1UWJA 4FVQA 4G34A 2B9FA 5AV3A 4CEGA 4D28A 5IUHA 5F1ZA 5HIDA 5IISA 3R00A 4M0ZA 5ANIA 4FUXA 2PMLX 4D4YA 1ZY4A 3HMOA 2NRUA 5LMAA 3UMWA 5CF4A 2UZLA 4RX9A 4BBMA 4O38A 1IRKA 4R3PA 4XX9A 3F5XA 4XG2A 4U42A 5AP1A 5EQPA 2OJGA 2VTNA 3A99A 2LGCA 3E92A 4RC4A 5HNGA 3EN4A 5DIAA 5B2LA 3R7EA 2R5TA 4E4MA 1J1CA 1YDTE 1PXIA 5AR7A 4NFNA 3S2PA 4GRBA 2C5YA 4XG8A 4R1YA 2YIRA 4GUBA 3D83A 4C0TA 2UZOA 5DG5A 2YM5A 3TL8A 4LM5A 2YDKA 4CFNA 3AQVA 1IASA 2I0VA 4AAAA 2GTMA 3EQIA 4ITIA 3UDBA 4X3FB 2OF2A 4CV9A 3BI6A 2QKWB 3FDNA 5HI2A 3SXFA 1YDRE 5BQ0A 2OF4A 2R7IA 4F09A 3DJ7A 1YWNA 5CSVA 4L53A 4AUAA 2QI8A 3GGFA 3IGOA 4BCHA 4DCEA 1IAJA 4C3PA 3KY2A 5AUXA 3UG2A 3PJCA 4BHZA 2W1ZA 5CSHA 4UWYA 4BYIA 3OWPA 4EKLA 2WQOA 1OL2A 3CTHA 3FPQA 5LVPA 1RE8A 4KB8A 2Z7SA 3KREA 3GFEA 4N6YA 4AW0A 2GU8A 2WQEA 2G2HA 3ACKA 4O0YA 1Z9XA 2CSNA 2OBJA 3ZZEA 5J1VA 2EXEA 1YVJA 3OOGA 5EYKA 3T3UA 4RA5A 3ZZWA 1IR3A 3EJ1A 4JIAA 2G2FA 4S33A 1DI9A 4XUFA 3NMUF 3OC1A 1RJBA 4Y95A 2OFUA 3UMXA 3VBXA 3BX5A 3FY0A 3ROCA 4FV6A 4USFA 2F57A 3P79A 1ZMVA 5JZNA 4IVDA 4N6ZA 3QYZA 3OROA 4FTJA 4ZJIA 4AA5A 4V0GB 5JGDA 1FVRA 4QMVA 1Q4LA 3NUXA 5M09A 3PVBA 5DVRA 3C4WA 3PJ8A 2WQNA 4I5MA 3D7TA 4K11A 1F3MC 4PTGA 2WMAA 4C38A 3R8VA 1H24A 2OXYA 3KN5A 1ZLTA 4YHTA 5JFXA 2X8DA 4R8QA 1APME 3O7LB 3A61A 5HE2A 4DBNA 5J7HA 1Q3DA 3FLNC 2QOIA 3JPVA 4E26A 4DT9A 2A0CX 5L6OA 2BDJA 3BEGA 1OL6A 3H10A 2R3GA 4OBOA 4LV5A 1SNXA 2F2UA 2PE2A 2Z7QA 3OXIA 3CP9A 5M4FA 4Y72A 3OY1A 4IWPA 2GPHA 4QPMA 4CZUA 4UMUA 3OCBA 3ZM9A 3B2WA 4OTGA 2ITVA 4R77A 4FA2A 5LARA 3V6RA 3WF6A 1OITA 3BPRA 4M84A 3CEKA 4QO9A 4UWBA 4A4XA 2ITXA 3ORTA 4L52A 4MNFA 5A54A 2RFNA 3C7QA 4AT3A 3Q96A 1FGIA 1VEBA 3C1XA 3DLSA 3P1AA 2F4JA 3JS2A 3VNTA 5HD4A 2GQSA 3VQHA 2ZAZA 4OTWA 4QMPA 3NIZA 2J90A 2ETMA 3SV0A 3IW8A 1J7IA 5L3AA 3OWJA 2PE0A 3VRYA 2YZAA 1AQ1A 2GNGA 2PY3A 1CKIA 2F49A 4FGBA 4TYIA 2JC6A 2ZM1A 4EHEA 2YACA 2PVRA 1BMKA 1B6CB 4YJUA 3ZSHA 2JFLA 4O6LA 3RPOA 3AOXA 2UZUE 3E8NA 4D0XA 5LCJA 1PXKA 4GS6A 5HX6A 5D41A 5B0XA 3V3VA 3F2RA 2QC6A 5GJGA 1MQBA 1IG1A 4FV5A 1GY3A 5IKWA 3FMNA 3QFVA 3UIUA 3FMEA 3TKHA 4ZTHA 5E8WA 4DINA 4BCOA 4L46A 2YERA 3NNWA 3QKMA 4GK4A 4L3LA 3GQLA 3MPAA 2G9XA 4S31A 3S4QA 4TWNA 4IB0A 2Y6MA 2PE1A 4JAJA 5ANKA 4IBMA 4TT7A 3FLQA 3FZPA 4MH7A 4ACMA 4UN0C 5BVNA 5IMXA 5J9LA 3P5KA 3ZCLA 2XCKA 2C4GA 1OPJA 2C5NA 4BCIA 4BKZA 2B53A 3MY1A 3CJGA 5DRBA 5FTQA 3RHXA 2FB8A 3D5WA 3W2PA 3FLZA 3F61A 3PXZA 5KO1A 4BDJA 3UC3A 3VC4A 3HAMA 4K2RA 5FP6A 3GCQA 2B9HA 2GTNA 2R3PA 2WELA 3HVCA 4MKCA 3MYGA 5A4QA 4C34A 2C0IA 5DGZA 2OIQA 3O51A 2QKRA 4CG8A 2QO9A 4OBPA 4YHJA 3MH3A 3JR1A 3BYSA 3VUGA 2W1GA 4FK3A 2X6DA 3LXKA 3ZO4A 4I6FA 5AAGA 3P08A 3V8TA 5J1WA 2X2KA 3IGGA 4I4FA 1XH5A 4NM7A 4H3BA 1J7LA 1UVRA 5FGKA 4WD5A 3RZBA 3QQHA 4A9UA 2B54A 2I0EA 2QOHA 3ROYA 5IQAA 3V6SA 1WAKA 4H39A 3MSSA 4J98A 5AP2A 4ANNA 1YHWA 4YMJA 2GMXA 2B0QA 3F5GA 3I7CA 5IH5A 5FWKK 2C6IA 3GEQA 3BGZA 3SOCA 1M7NA 4YC8A 5EW3A 2V7AA 3A4OX 3K5VA 4F65A 4BI0A 4AGDA 3PE1A 4L00A 5ANEA 2XK4A 4E1ZA 4QTEA 2YEXA 2VWWA 5BMSA 3NUNA 1GAGA 4TPTA 3MVHA 3UNKA 4AGWA 5HU9A 2OJFE 1TQPA 2Y4IB 1CDKA 4CQEA 3UO5A 3MH2A 4XH6A 4YGAA 5KMMA 2IVTA 3V5JA 2FA2A 4PPAA 3TKIA 4D1XA 2X8IA 1NT2A 3QTZA 4JRNA 4ZSJA 4ARKA 1YXXA 5FM2A 5EW8A 1B39A 3R2YA 3MFSA 4I23A 1IAHA 5AX9A 3NX8A 4NCTA 4C7TA 4I22A 3DZQA 1XBBA 3PIYA 4KKHA 4YNEA 4B0GA 1ZMUA 4JDIA 4YSMA 1RW8A 2IN6A 4OTQA 3BZ3A 2VUWA 2XNGA 2FSOX 4DG3E 5BYYA 3C4FA 5EI8A 4BR3A 3QCXA 4PL5A 2Y4PA 5BUEA 1SVGA 4K18A 4IB3A 2JIIA 2R0IA 3AC5A 4FC0A 4R7HA 2VD5A 5L6WL 3EKKA 4O91A 2WMSA 4NM5A 4BTMA 4K77A 4IACA 4L9IA 4NL0A 2B4SB 1Q8YA 5EYMA 3KRLA 3U9CA 3QA0A 1KV1A 2YCSA 3MBLA 4QP8A 4HGLA 3O96A 5BPYA 5GJDA 3UP2A 2XNNA 2WXVA 4LL5A 3G6GA 3Q52A 2AUHA 4FSQA 5JT2A 3I60A 2JAMA 1UU3A 2PWLA 4XJ0A 3QCQA 4O7YA 3MH1A 3NW7A 3AT2A 3VW6A 3IONA 3F5UA 4FKLA 4HGEA 3R0TA 3SQQA 3PWDA 1CTPE 3Q60A 3QQKA 3W2CA 3VUIA 4QMYA 4XHKB 2B7AA 5EK7A 1NVSA 2W96B 4S2ZA 5EHOA 1Q5KA 3G9NA 4OTIA 4IAYA 1G8SA 2QODA 2GFSA 4EORA 3VJNA 3OEFX 3VS4A 3R30A 3AMYA 4KNBA 4JL9A 5LCKA 4B8LA 5GZAA 3K3IA 4HYHA 3QTXA 5GHVA 3ZH8A 2PVMA 1NXKA 4O21A 4XOZA 4F9AA 3PUPA 4PTCA 2JDSA 4FV3A 2X7OA 2JDVA 4X2JA 3MI9A 2RFDA 3CR0A 4J8NA 4I0RA 4PL3A 4KIKB 3QQLA 4RPVA 3HEGA 5HTBA 4YNOA 4IAIA 1DAWA 2OZOA 3FMLA 2PZ5A 2ZM4A 1WBNA 2FH9A 3KL8A 4J53A 4YJPA 5DHJA 4FEWA 4TY1A 2X2LA 3FEGA 3DXQA 4TWCA 4G6OA 1H1RA 3HP5A 4JDHA 1PMNA 4CFMA 2XKEA 4CLIA 3DGKA 4GKHA 3ORMA 2P4IA 2XIYA 3LQ8A 2C6TA 2Q83A 2XKDA 5DEYA 2W1HA 2HY81 5DOSA 1XHAA 4IVAA 5EM6A 3RPRA 3NW6A 3HMNA 4TL0A 2WB8A 2I7QA 4R5SA 3AD4A 5EH0A 4YZMA 2OK1A 4A7CA 3RAWA 3AC4A 4NJDA 4BDFA 3SC1A 3RTPA 3UIBA 4AS0A 3FZSA 3O2MA 4E5WA 4YO4A 4FL3A 2C6MA 2H34A 4GT5A 4RZWA 4DGNA 4YUQA 3EKNA 4G3DA 1PXPA 4UMTA 4Z3VA 4PMPA 3DB6A 4QYHA 4W4YA 2B52A 3TNHA 5TO8A 4AOJA 4D9TA 4PV0A 4DBXA 5KKRC 1F5QA 2OIDA 4BN1A 3EQCA 5L8KA 3DU8A 3FKNA 4DGMA 4UMRA 3GC7A 4C4JA 4IWOA 4FNWA 2P0CA 3RALA 2YLFA 3DAKA 3MTFA 5DR6A 4C58A 4F9BA 4BY9E 4APCA 3IW5A 3QBNA 4Y73A 4G5JA 2E9OA 2YLEA 4AWIA 3QTSA 4I0SA 3R9DA 3NYXA 2HZIA 4RT7A 4ZTSA 5A14A 3FQEA 1WCCA 4EHVA 4YHFA 3KF7A 4FODA 1JVPP 5AV4A 5JFWA 4M68A 1ZYLA 3HNGA 3TTIA 4X2GA 3FZRA 1JKTA 2WZJA 3HV4A 2X81A 3G0EA 1WVXA 4WNMA 4Q9SA 3TUCA 3I81A 2UZWE 4Y83A 2IW9A 4C35A 1XBAA 1Q97A 4WIHA 1T45A 4BGGA 5JSMA 4NIFB 5IQFA 2CKQA 5DFPA 3FUPA 3GENA 3V5WA 5A9UA 2OIBA 2XYUA 1JWHA 1MP8A 4I5HA 3FPMA 2ZB1A 4WUNA 4EBWA 4RVLA 4XV2A 4YTHA 4M7IA 4J95A 3I0QA 5F94A 4FTNA 3UNZA 4FT7A 5AP3A 4EK5A 2E9NA 3QHWA 4A4OA 1J1BA 5HTIA 3TKUA 2QOKA 3A60A 3M11A 2BDWA 4O0WA 4PWNA 3K54A 2QQ7A 1OL5A 3FMDA 3LXPA 2R2PA 3Q32A 4HVGA 4O7NA 5EG3A 4MHAA 4O0TA 3HMPA 4KSPA 5HO7A 4G6LA 4FTOA 4H36A 1YWVA 2UZTA 3LVPA 4CKRA 2UZBA 3Q3BA 3U8WA 4FEVA 3CPBA 4E4XA 4TXCA 1PW2A 3VF8A 3QTUA 5E4HA 3QXOA 4PMSA 3D94A 2VWUA 3EFLA 2W1DA 2YJSA 3KRRA 3OCTA 4TWPA 3TV7A 2ACXA 5AP7A 4EH7A 1GOLA 3VS3A 5J5TA 4YZNA 3T9IA 4B7TA 3R1NA 4L7SA 4M66A 4CD0A 4FNYA 3C9WA 4PTEA 3E3BX 3FKOA 3G9LX 5LQFA 1REJA 2ITTA 4AOTA 5I0BA 2VX0A 3EOCA 2A4LA 1H26A 5HO6A 3VS1A 1GZ8A 4X3FC 4WRGA 5I5ZA 3BQRA 3FZTA 3N4TA 5HEZA 3N4UA 5HVJA 5HIEA 5H9BA 2RFEA 1Q99A 3ZO2A 4I92A 4ZK5A 4M15A 4CMOA 3IPHA 2ZDUA 3P78A 1ZAOA 4PP9A 2W05A 3MA3A 4DC2A 1STCE 2ZDTA 5AR4A 4BKJA 4FVPA 4LRKA 4AF3A 3LCDA 4WOVA 3BGPA 4FNZA 4F0IA 4MTAA 1DAYA 3FAAA 1OECA 5AP4A 3LLTA 3NNXA 3ORZA 3PWYA 5CEOA 2CKPA 5FLFA 4O82A 4JOAA 3PSCA 2Q0BA 4G17A 2C3LA 4EHGA 3EQHA 3O23A 2EWAA 3GC0A 4R6VA 2HZ0A 2C3KA 4RX7A 2CKEA 2YIQA 5I9YA 5CVFA 5DR9A 2BZHB 4F7JA 4XRLA 2PL0A 4A9YA 4CKJA 1SYKA 4CT2A 5M4CA 5LMBA 2IZTA 3PJ3A 4NKAA 2Z7RA 3I6UA 5HE0A 4KUJA 4DTAA 1E1XA 3HV7A 3QD3A 1FPUA 4D9UA 3HLLA 3SGCA 3HV6A 5TF9A 3T9TA 3HX4A 3KGAA 2HCKA 2NO3A 4KD1A 4DG2E 4KA3A 2CGXA 3UP7A 4G3CA 1YW2A 5B2MA 4A9SA 3F69A 2QO2A 3GUBA 1YOLA 2V5QA 4UV0A 5C1QB 4QYGA 3TUBA 1E1VA 4NK9A 1CKJA 5IQIA 2UZDA 3P7AA 5AUZA 4MEDA 4H1JA 3D9VA 3ZO1A 3NGAA 4IFGA 5CF6A 4DA5A 3ZYAA 3SXSA 1GJOA 1W84A 3GBZA 4ZS0A 5AM7A 3QTIA 4ITHA 2WTCA 2XK3A 3ZUUA 4AZWA 5J9YA 3F5PA 2R3LA 4JIKA 4FOBA 2VO0A 2PMNX 2OWBA 2R0UA 3W8LA 3ZRMA 1OBDA 2XEZA 4DH8A 5HLPA 4YJSA 2VTQA 4UZDA 3R02A 4UALA 3SAYA 3OCGA 2XNEA 4J99A 4D4SA 5BVOA 4E6DA 2OZAA 4FSYA 5BMMA 5JFSA 4U45A 2GCDA 3KXXA 2BAJA 3LFNA 3EQPA 4XV9A 4QQ5A 1PXMA 4J71A 1UNHA 3EIDA 3Q53A 4FTQA 5GZ9A 3R7IA 3LFCA 3RMFA 3V5QA 3COKA 2QLUA 4DITA 3FMKA 4JBVA 4EOPA 5CAUA 1PRYA 4NU1A 1H00A 3BE2A 2G1TA 4TYHB 2BVAA 4EWHA 4BB4A 3E5AA 1WVYA 3OWLA 1RQQA 4IDVA 3C4EA 5HCZA 2V62A 2R3JA 4F99A 3HV3A 2VWVA 4OAUC 4ANOA 2GNLA 1PHKA 3BKBA 4UY9A 2PMIA 3NCZA 3LJ0A 4FZDB 4O1PA 5EQEA 4RVTA 2YAKA 4ZTQA 3TTJA 5KNJA 3KRWA 2YZLA 4CG9A 5CX9A 3NNVA 4CYIA 2J9MA 3UYSA 5DBXA 4O7ZA 4O81A 3QA8A 3TIZA 2WTIA 3CIKA 3C5UA 4KRCA 5B2KA 4B4LA 3SKCA 3L9LA 2O65A 5M44A 5KBQA 4FYNA 4F63A 3S3IA 4AACA 5H2UA 2CLQA 2DS1A 4P5ZA 2NNWB 2ITOA 4D2WA 1S9JA 4E4NA 5LJJA 2HW7A 4Q2AA 2QO7A 1G3NA 3R7OA 2HW6A 4EC9A 5ANJA 4YZDA 4LFIA 4O0XA 4QP9A 3COMA 1JBPE 3PA4A 4FTRA 4YPDA 5CEIA 4GVJA 2CHLA 4AGUA 3NDMA 1ZWSA 4ZLOA 3RNYA 5CT7A 5E8UA 3W10A 4FL1A 2I0YA 3NCGA 4EH9A 2HOGA 5CENA 1A9UA 4KABA 4KSQA 4RFYA 3ZBFA 2E9UA 3VF9A 4HVHA 3E64A 1B38A 2LAVA 4Y46A 4X3FA 2UZVA 5ITAA 3FBVA 5CXHA 3DLZA 1FINA 2JDRA 3GC9A 4JX7A 2Y7JA 5EDPA 3R9HA 3TNPC 2YCQA 3VQUA 3KK8A 3ZOSA 2BZJA 2PK9A 2CGVA 3A8WA 5A4LA 3EN5A 4MYGA 4ACGA 3KRJA 5HESA 2G01A 5HVYA 2W1CA 4E93A 4IC8A 2DQ7X 3M42A 3I5ZA 5EOLA 4AT4A 3ZEWA 2BTSA 3DDQA 4O0VA 2OO8X 3LM0A 4JDKA 5ACBC 3CTJA 3H9FA 4C4FA 1JSTA 1YOMA 3MW1A 1LP4A 3DY7A 3DB8A 1BL6A 4RIOA 4PP7A 4FT3A 3RINA 5I9XA 3ZFXA 3SRVB 4YZCA 3ZUVA 3BCEA 3W18A 3MY5A 2VTHA 5K0KA 3NR9A 4IANA 4Y5QA 5A4EA 5AR5A 5ANDA 3LMIA 3FSFA 3ZS5A 2WMTA 5HTCA 2C47A 3NW5A 4Z55A 2X9EA 3R63A 2CN5A 4CNHA 2XIRA 3JVRA 4QYFA 4O7LA 2R3FA 2Y4IC 4BFMA 1KSWA 5CQUA 3VBTA 4IAFA 3F7ZA 3MFTA 4CT1A 5JQ5A 1WMKA 3DK3A 4F6WA 5M57A 3DPKA 2VN9A 3CQWA 2C6KA 2H8HA 2YWPA 3QUPA 4MK0A 4UYAA 3VUKA 1ZMWA 4ITJA 5L8JA 3CD3A 5J95A 4BWKA 2XK8A 1U5QA 4FIEA 5EHLA 2V0DA 5KCVA 4NTTA 2Z8CA 4K0YA 2HXLA 4ID7A 2ZV2A 2V22A 1U59A 1OL1A 3U87A 4L43A 5AV2A 1XWSA 3TI1A 5CXZA 4AW1A 1ERKA 3PJ2A 2QR7A 3PY0A 4IB5A 3II5A 2R64A 2X4FA 4JR3A 2JKOA 1XH8A 4BIDA 1Q8TA 4F7SA 3C4ZA 5BVWA 4RIYB 4E6QA 4USEA 1JSVA 4FI1A 5HBEA 4QQTA 3IK3A 3RGFA 3N4VA 3VVHA 2PUIA 3LLAA 2YJRA 4YJTA 3GU6A 3RAHA 5KMLA 3DXNA 1XH9A 3DA6A 4AW2A 4X2NA 4FKIA 4LRMA 2YITA 4PDOA 4RMZA 1UU9A 2OJ9A 4HYUA 3DKGA 3EN6A 2HZ4A 5HX8A 4HGTA 3W8QA 3ZMMA 3Q4CA 2OH4A 3HRBA 4ACHA 3TJDA 2XIKA 4BCQA 4I94A 3UQFA 5DN3A 2WU7A 3LXNA 5CS6A 3R1QA 2IW6A 4O22A 2OJIA 1W98A 2NPQA 3EZRA 2PVJA 4O1OA 4F4PA 3RCDA 2J4ZA 1GZKA 3UZPA 1R0EA 1Y6AA 1OUYA 3BGQA 3NEWA 4FEUA 4OUCA 4EOLA 4RQVA 3MH0A 5IQCA 4KRDA 4CFVA 2UUEA 3Q6WA 4O0SA 3KMMA 4DG0E 2YN8A 3ORNA 4GV1A 4DF3A 1UKIA 3LHJA 2ZMDA 3MS9A 4EH5A 5D7VA 3Q2MA 4QTDA 3HA6A 5DT4A 4EBVA 2QVSE 1NA7A 3FWQA 3K2LA 4XOYA 5FXSA 2BKKA 3OFMA 4JLCA 5KMJA 5LVOA 3R1YA 3QUEA 3HUBA 3EFJA 2VTMA 4FV0A 5DWRA 4ZXTA 2FYSA 4FZ7A 2BRMA 5BUJA 4K8AA 5F9EA 3QCYA 3ZLYA 5HHWA 1YWRA 5CASA 3ZLWA 2X2MA 3AGMA 3RPYA 4AA4A 4AZTA 3O8UA 3EQGA 2GS2A 2XK7A 4USDA 2I0HA 3LZBA 5TT7A 2ZV8A 4BI1A 2IWIA 2J0LA 3HA8A 4FT0A 4S30A 3H9RA 4I0TA 4L6QA 4BF2A 4EZ5A 5IQEA 2BRGA 3L9MA 4ZEGA 3U4UA 4MVFA 4ACDA 2QURA 5JMSA 5BYZA 4RJ6A 5LOHA 4FTUA 3H30A 4L67A 3ORKA 2JDTA 2BAKA 5IA3A 2FUMA 5D7AA 4FUYA 1W7HA 4C4HA 4FSTA 1OL7A 2WTJA 2WTKB 1Q8ZA 3DBQA 3DBCA 1R0PA 3JY9A 3PTGA 4BZNA 1W83A 4RIXA 4YSJA 4G3GA 3DAEA 5F4NA 4E5BA 4EUTA 5AM6A 5DR2A 5IDPA 1Q24A 5HNBA 4APPA 5L2SA 3MA6A 3ITZA 4EOQA 2AC3A 5FUTA 4WG3A 3BHUA 3G15A 5IMEA 4QNYA 3BYUA 4JG6A 4NFMA 3UODA 5HORA 5M07A 2Z7LA 2QR8A 4EH8A 5C8MA 3LFAA 3PLAE 1PKDA 3C0GA 4ZZMA 5LWMA 3FLSA 1IEPA 2PUUA 3Q5IA 2VRXA 4HYSA 4CCUA 4B99A 4FIHA 3BU6A 4C37A 4UB7A 4EQUA 2CNUA 5FG8A 3ZM4A 5J9ZA 2XIZA 3FJQE 3KULB 3CC6A 3QX2A 4QMTA 3GU8A 3DK7A 3R7UA 3BWFA 3BELA 2PVYA 3CGFA 1RDQE 2WTVA 4AQCA 2QOFA 3PXFA 4C2VA 3W2RA 3CTQA 3NSZA 1OIRA 3LAUA 5JRQA 1ZOHA 2VTRA 4ANBA 3MFUA 5A4CA 3TZ8A 1KE9A 4AT5A 3V8WA 3PVGA 1TQIA 4XG9A 2W17A 3E7OA 4IZYA 3NYVA 3F3ZA 2VNYA 2R3HA 2R3RA 4A9RA 3JVSA 1U4DA 4Y5HA 3IECA 5EOBA 3UC4A 4W4XA 4IHPA 4JQ7A 4IWQA 2C6LA 1BX6A 1BI8A 4FIIA 4OTHA 2XK9A 3W2OA 4BGQA 4W9WA 3HMIA 1LEZA 4IVCA 4GCJA 4IJPA 5CLPA 2QU6A 3OUKA 5ETAA 2YABA 5FDXA 3ZBXA 5AR2A 4HVSA 5JGAA 4RVKA 2ZV7A 5KHXA 3DNDA 2IVSA 3T3VA 4CTBA 2OXDA 4KS8A 2JKKA 3E87A 4JVGA 2GNJA 2QG5A 2REIA 2XNOA 3Q04A 2B9IA 4ZOGA 5GNKA 3RK9A 3WILA 4U7ZA 3FL4A 3QTQA 2EB3A 2BR1A 4FKQA 3AXWA 4I4EA 2IW8A 1WBVA 4FG8A 5HCYA 5KZIA 3LFEA 3OUNB 1P4FA 5EI2A 4IFCA 3B8RA 3TXOA 5AAEA 3NUSA 3MIYA 4JR7A 3EFKA 4YBKA 4TNBA 3ALOA 3KMWA 2Z02A 3LJ1A 4FIGA 3P7BA 4AE9A 5A46A 4EJNA 4NM0A 3UBDA 3KVXA 2PMOX 4BRXA 3D2IA 4GU9A 3UTOA 2BZIB 5IU2A 2YWVA 3H3CA 4FV4A 4IX6A 1EH4A 2O2UA 4C8BA 3QD4A 4LL0A 2XNMA 4FKWA 2ZB0A 2IVUA 3DZOA 3CQEA 3L8VA 4MWIA 4BDAA 3PG1A 5JN2A 3CSVA 4I5CA 2QLQA 4WNPA 2YM8A 4O0UA 2XNPA 4WKQA 4ZZOA 3F88A 2CJMA 3EQBA 4TYGA 3PRFA 4NM3A 1BUHA 4RJ3A 4DH7A 1R1WA 4HNFA 4IM3A 3N9XA 5IZFA 3LIJA 2BCJA 2CPKE 2GNIA 3I7BA 3RAIA 5FXRA 2QG7A 3FI8A 2FSTX 3W32A 3ZRLA 4DH3A 2PZYA 2G2IA 2QD9A 1ATPE 3BLQA 3G5DA 3ODZX 2YIYA 4Y85A 2BMCA 5FBOA 3SXRA 4EOKA 4N57A 2WTDA 1BI7A 5TKDA 4ANSA 2OJJA 3NYNA 3FSKA 4RFZA 1PXJA 4MNEA 2F7XE 4FV1A 5IEXA 2VO3A 3IS5A 3MB6A 3DAJA 1Q3WA 4PDSA 3BYVA 3A7FA 2EB2A 3BYMA 4J8MA 4HCVA 4DEGA 4W9XA 1MRYA 1JPAA 2DYLA 4RIWB 5BNJA 2H6DA 3CKXA 5AR8A 3O0GA 3RHKA 2O0UA 4D2TA 1ZY5A 1QPCA 3E63A 3FE3A 3VUHA 5E92A 2YCRA 3ZDIA 1JQHA 3PXYA 4N0SA 4QYEA 5DMZA 3QWJA 4WRSA 4OTRA 5IQHA 5BVEA 3RPVA 4EWQA 5CAPA 4IQ6A 3FKLA 4YU2A 3TUDA 3W2QA 4HZRA 4F9CA 3UZRA 3VRZA 4M3QA 4EEVA 4EH2A 4EH4A 3MFRA 4IZ7A 1PMEA 5CTPA 2R3IA 2OFVA 4AN2A 5J5SA 3ZFYA 2QCSA 1AGWA 3OD6X 4UBAA 2HAKA 2JLDA 3KFAA 3CY2A 4U0IA 4ASZA 3TZ9A 4H58A 4BDEA 2H96A 1Z5MA 2X1NA 2O5KA 2R9SA 4L68A 1OI9A 2HENA 2PYWA 4JAIA 4JBOA 4MF1A 5HD7A 4LMUA 5FEEA 4W8EA 4ALUA 3TG1A 1XR1A 1VJYA 2VTLA 3MY0A 3HAVA 5CU0A 2Q0NA 2GNHA 2C6DA 4LUDA 1KOAA 3K3JA 3OTVA 5HBHA 1PMUA 4QMUA 4MD7E 4OGRA 2PPQA 3VWAA 4EL9A 3PE2A 3R1SA 3D5VA 4JQ8A 2WPAA 4LOQA 3Q9XA 4CMTA 2VV9A 1H1SA 3F3UA 4C36A 4IVBA 3D7ZA 3U6JA 4E5AX 2YM4A 2WMVA 5CQWA 3R8MA 2CDZA 4JX3A 2R3QA 5G6VA 4FV8A 3F82A 5I9WA 3IDCA 3CCNA 4IH8A 4J96A 1V0BA 3R6XA 2WEVA 3OXTA 2WMQA 2VTOA 3MN3A 3R04A 5HQ0A 3AD6A 1L3RE 3ZLSA 3CQUA 4BTKA 1WBPA 5I4NA 1Y57A 1U46A 2UZNA 1FBNA 1UNLA 3AC8A 5FEDA 3LOKA 4GK3A 5CAOA 2BTRA 4W8DA 1OBGA 5HE1A 3GU7A 5LMKC 3QALE 2IZSA 3QQFA 4MX9A 4ASDA 3IG7A 2DUVA 4B9DA 4G3EA 1TKIA 4GFGA 2A19B 3H9OA 3KC3A 3FMHA 4DFYA 3C4XA 5G1XA 2CLXA 3OS3A 3O71A 2VO7A 4RWKA 3SLSA 3E93A 1OIUA 3RK7A 2C5OA 1Q61A 2XBAA 4U97A 4QNAA 5AIRA 2CN8A 2C1BA 1U54B 5EI6A 3R8LA 3PFQA 3LCOA 5BVDA 1BL7A 2GS6A 1DS5A 1QCFA 3BLRA 3LMGA 1XJDA 5C8NA 4BZOA 4YLLA 3F3WA 1I09A 4FT5A 4U79A 2I6LA 3GCSA 2BPMA 4BCJA 3A7GA 3VBYA 4EYMA 2ZVAA 3CGOA 4FZFB 1WFCA 1VR2A 2CMWA 3DBEA 2GFCA 3FMJA 4DN5A 4YLKA 4RBLA 3TNWA 4O2ZA 2IG7A 2NRYA 3HZTA 2C5VA 3QRJA 5LVNA 2YISA 4UMQA 4FF8A 3BHHA 3RI1A 2JFMA 2QNJA 2WU6A 4AZEA 1NW1A 3SG8A 4ZJVA 5DH3A 1GZNA 2XIXA 3R71A 1YRPA 4U9AA 4WT6A 4F64A 4RGJA 3POZA 3IO7A 5JQ8A 5FM3A 5E9EA 3TV4A 3DOGA 3R21A 1SM2A 3DNEA 4I24A 3PXQA 4LGGA 5H8EA 4O27B 3WZUA 5IPJA 4GK2A 1XH7A 4J7BA 3KRXA 5L2QA 3UO4A 3O17A 4U8ZA 5ETFA 4D0WA 4YLJA 1H1PA 2VGOA 2JKMA 3SG9A 4U3YA 5IUGA 3ZTXA 4YJOA 5M08A 1WBOA 2HZNA 4PDPA 4PQNA 3ZHPC 4NH1A 4S32A 4XMOA 3LXLA 3CPCA 1H1QA 3B2TA 4RX5A 3NUUA 5T3QA 2X0GA 4BDHA 4LYNA 5ETCA 3EH9A 5IA5A 4QMOA 4H05A 3A7JA 4DFNA 1CM8A 4ZTNA 4D5HA 3BEAA 2XRWA 4Z9LA 1OIQA 1XH6A 5JK3A 3AC1A 1URCA 2ITQA 2ZJWA 4K1BA 3MV5A 3R9OA 5L2TA 2JD5A 5E1SA 3QAME 4JQEA 2KTYA 5A4TA 5IA1A 3EWHA 3KN6A 3HUCA 4YJNA 4L42A 3EN9A 1UU8A 2UVZA 3HRFA 3PXRA 3R7GA 4IDTA 5GJFA 4BVUA 5E8SA 4M69A 3SDJA 2QOBA 1P5EA 1OZ1A 2WMXA 3DKOA 4LGHA 4JT3A 4ZY6A 4D2VA 2BILB 4FKPA 4X3JA 4I21A 2YAAA 3C50A 4PPBA 4D1SA 1XKKA 3R8ZA 2JIUA 5L6PA 2VTJA 1OIYA 3RP9A 4HVIA 4ALVA 4TYHA 3PZHA 4YBJA 4DH5A 3ORXA 2JDOA 3P7CA 1SVEA 2H9VA 3GCUA 4KKEA 1JOWB 3PPZA 4HVDA 2G15A 4I6QA 3D5XA 3FC1X 4QTAA 2WD1A 4WO5A 5I9UA 5M51A 5EYCA 2C68A 1ZRZA 2OKRA 3D15A 2X6EA 3RPSA 5JRSA 1MUOA 4EZ3A 3L9PA 5H3QA 2W5AA 3HP2A 3GP0A 4BDBA 4FIJA 2EXCX 2QONA 2UV2A 4IB1A 4DFUA 3F2AA 3U4WA 5L4QA 1LPUA 5HG8A 3QHRA 3V01A 4TYEA 4Q9ZA 2GS7A 5JFVA 4O7VA 2RF9A 4CZYB 4FYOA 3ZO3A 5H8BA 5EM5A 1JSUA 4I20A 4V01A 5HZNA 3OTUA 3TNIA 5C4LA 4P2KA 2J0JA 2QOOA 1H1WA 3R7YA 5K4IA 2PVNA 3IW7A 4OAVB 3TIYA 2ZMCA 2B55A 2JITA 3LCKA 3N51A 4LV8A 2XMYA 4U44A 4FR4A 4IMYA 2UW9A 3BRBA 5HE3A 1OPKA 3HV5A 2VTTA 4DFZE 4P7EA 3OF0A 4M67A 4MXAA 2QHNA 2W1EA 4NWMA 4ZP5A 5KHWA 2C3JA 3W55A 2JAVA 1GNGA 3FQSA 5EHYA 2VWIA 4NTSA 4TNDA 4QQJA 2XH5A 3EZVA 3GOPA 2IZRA 3PVUA 3ZUTA 1YI3A 2W5BA 3GNIB 4HJOA 4D5KA 4EK8A 5IF1A 5ACKA 3WIKA 2VGPA 2X9FA 3P0MA 4R5YA 5IH4A 3PXKA 3ZRKA 1GIIA 1PYEA 2ESMA 4D58A 1UKHA 3PSDA 3P23A 5EYDA 3VULA 2WTKC 5B7VA 1OVEA 3JY0A 4PMMA 4WG4A 5HOAA 2V55A 3FLWA 5C4KA 1CMKE 3LFBA 3ACJA 1W82A 5HGIA 2WAJA 3VS0A 4YURA 2EVAA 4FSUA 1VZOA 2RFSA 4DTBA 2HK5A 2UZEA 4PDYA 5EQYA 5FTOA 3NVMB 4QPSA 4EQMA 5AEPA 2E9PA 3V5LA 3UO6A 1M17A 5A6OA 1KE6A 2WMRA 2YIXA 3KCKA 5C9CA 3AT4A 5CY3A 4D55A 2QOLA 3Q4TA 4OTFA 2J0IA 3Q4ZA 3V51A 4BC6A 4CFWA 5FP5A 3FL5A 4RWLA 1H27A 2CGUA 1KE8A 4S34A 1ZYCA 2WMWA 4YP8A 4ACCA 4F1OA 2JBOA 3BU5A 4RC3A 5FRIA 4DAWA 2O8YA 4ORKA 2WTWA 1HCKA 3PY1A 5KZ0A 5BUIA 4I1ZA 3DJ6A 4EOOA 4FBXA 5IQGA 4G31A 3HECA 2YA9A 4QYYA 4RJ4A 2C69A 4FGRA 4KINA 4WUAA 4X0MA 4BI2A 4DEAA 4LI5A 1U5RA 3KKVA 4XLIA 4PNKA 4DH1A 3TJCA 2ONLC 4ZSEA 1YI6A 3CKWA 4FV2A 5J87A 5LWNA 1FOTA 5M4IA 4YTIA 2CNQA 4EHZA 5CF5A 2E2BA 1FMKA 4FZAB 3TDVA 1XBCA 2VX1A 5HLNA 5AJQA 4ZMFA 3LE6A 3Q6UA 4QMSA 2IO6A 3DK6A 2W7XA 3FZOA 4GFOA 2PUPA 4KIOA 3GCPA 3OY3A 2UW6A 2XNBA 3QC4A 5M53A 2GQGA 4I6BA 3W1FA 2ZYBA 2XJ0A 4LQMA 4XRJA 5EFQA 4JXFA 3RJCA 3VHEA 4AGCA 4FVRA 4FE2A 1Z57A 3IDPA 4YJQA 1OKWA 4RRVA 3VS5A 4FKRA 3SHEA 3BIZA 4QMQA 3DV3A 3KEXA 4ZMEA 3UVRA 3PG3A 4EOJA 1LR4A 4UYNA 3HGKA 5IEVA 2A27A 4HGSA 4I5PA 3UE4A 4FKVA 4L45A 4HCTA 1Y6BA 3TM0A 1P14A 4QT1A 4RWJA 4TWOA 4XS2A 1PJKA 1XO2B 4QMXA 2YFXA 4GYGA 4AP7A 4FTMA 4M14A 2R7BA 2F9GA 2YIWA 4C02A 4UXLA 5AWMA 5GIOE 3V8SA 4ZLYA 4TZRA 1G5SA 3NVKI 3HL7A 4I93A 4V05A 4MXCA 5DYJA 3R9RA 4ANLA 3WZJA 4MXYA 2UW5A 3UIXA 1WBWA 3R7VA 4ZSLA 3PPJA 3KVWA 2VTSA 5CU6A 1FVTA 4M97A 3RKBA 4C4GA 4E6AA 3RNIA 3DTWA 3U9NA 5E8YA 2BRHA 4J97A 3QGYA 3FYKX 4NSTA 3VS6A 2GQRA 4C3RA 3UVPA 3ZSIA 1PXOA 2C0OA 2R3NA 4K9YA 5CI6A 3Q2JA 3OP5A 4KS7A 3PP1A 4TN6A 4CYJA 4FNXA 4YR8A 3OMVA 3D14A 3GU4A 4GL9A 2HY0A 3LM5A 4QTBA 4CZTA 4V0GA 2VZ6A 4D1ZA 2QU5A 1T46A 5HCXA 2PTKA 3OT3A 4CXAA 2J2IB 4FL2A 1CSNA 3RM6A 3VW8A 4K33A 2JKQA 3RM7A 2V7OA 4CRSA 5CF8A 2JGZA 3ODYX 3FHIA 3ZLXA 3H0YA 4WSYA 3QD0A 4MD8E 5GIPE 4EYJA 5JZJA 4O7SA 4DEIA 1XQZA 4WHZA 2CCHA 4FSZA 5IG1A 4N70A 4BWXA 3UG1A 1G8AA 3MPTA 3AC3A 4QMNA 4WNKA 2Z60A 3QRIA 3F3VA 4TYJA 5FD2A 2OU7A 4BCFA 3FLYA 2W1FA 1NY3A 1MQ4A 4AU8A 4MBJA 3MPMA 5BX0A 4PPCA 4P5QA 5I9ZA 3FC2A 2YM7A 1YQJA 5KMNA 3O8TA 4QP3A 3R73A 4CSVA 3F2NA 3POOA 4WA9A 2XM8A 1YOJA 4TKSA 3P9JA 5CVGA 3UOHA 4NT4A 1OM1A 3PA3A 4GG7A 2ITZA 4OW8A 4EK6A 4BGHA 2WOUA 5KE0A 2XKCA 3LCTA 2BAQA 3QX4A 4AFJA 4JNWA 4RC2A 2PU8A 2VTIA 4GT4A 4NUSA 4IEBA 4CQGA 2I40A 4CRLA 3KXMA 2WKMA 3A2CA 5TE0A 5I9VA 4PY1A 2Y6OA 2ITYA 4EH3A 2ONLA 3DBDA 4QMLA 3UIMA 4ZZNA 2OLCA 3IQ7A 5HNIX 1J7UA 2CGWA 3VBQA 4H3QA 2VTAA 4BDIA 4FG9A 4RZVA 1QPJA 2YM6A 3IOPA 4XG3A 4EK3A 4IAAA 4FEXA 4YTCA 4YO6A 3I4BA 2XKFA 1OPLA 1Y91A 3MVJA 5K0XA 4YZBA 3L8PA 4O2PA 3VBWA 2FVDA 2R4BA 1YXUA 2YHVA 3PRIA 4BZDA 2WOTA 1O6KA 5D12A 1QPEA 4DGGA 3WI6A 3G33A 3WF9A 3PIZA 5HG5A 3TCPA 3VAPA 3FI4A 4M13A 4A07A 4LRJA 4BIEA 2BRNA 3ATSA 1JKLA 3EQRA 4QP6A 3WYXA 3LQ3A 2RG6A 3ORIA 2BUJA 2YDJA 3OZ6A 4D2SA 3IDBA 2GDOA 2W1IA 2X4ZA 5CU2A 3CXWA 3M1SA 4KBAA 4AN3A 2WMUA 4O7TA 2WQMA 3EQDA 1M7QA 3L8XA 4YC3A 3GT8A 1ZARA 3ZONA 1PXNA 2W99B 4PNIA 3TZ7A 2RIOA 5EM8A 1SMHA 3QGWA 3R22A 5HU3A 2W4KA 3ULZA 3FHRA 3VIDA 5E8VA 4HYIA 4F08A 5M56A 5HKMA 1UNGA 3QLFA 3GOKA 1PKGA 4BKYA 5L8LA 4QD6A 5LXMA 4FSMA 2OICA 4WBBB 5F95A 3T8OA 3U55A 3G0FA 4FTIA 3QZIA 4LGDA 4FTCA 4FOCA 4XP0A 3GC8A 4IIRA 4G16A 4DLJA 3R28A 5J79A 5I3OA 5CANA 3LCSA 4OTDA 4RQKA 3C51A 1A48A 5AR3A 2WHBA 3UPXA 2WFYA 3I0OA 3QCSA 3CLYA 4WSQA 3UZTA 5EDQA 3BV2A 3QQJA 4BWPA 1ZOEA 3GQIA 4QMMA 4X2FA 1P4OA 3L9NA 5EDRA 3SA0A 4XP2A 4G9RA 5AAFA 3RCJA 4QMWA 1YKRA 2RKUA 4H1MA 4KAOA 4AZSA 3QUDA 1BLXA 1KE7A 4GYIA 5AP0A 4Q5EA 4JRVA 3KQ7A 2VWYA 4NCTC 4BTFA 5KMOA 4D4VA 5ETIA 2BIKB 1GIJA 1LUFA 4FIFA 4IAKA 5DT3A 3SD0A 5CSPA 3QXPA 3G51A 1KE5A 2UVXA 4MXZA 4AX8A 4C3FA 4ONAA 2GSFA 5T6KA 5IDNA 3QF9A 3SVVA 4GG5A 3OEZA 4MBIA 2A1AB 3PIXA 2PVHA 4RIWA 3FI2A 5AUVA 3EL7A 1F0QA 2IVVA 3OG7A 2I1MA 4TTHB 2Z2WA 5CEQA 3ELJA 4U80A 1OMWA 2KULA 4MF0A 4AN9A 5CEMA 4R3CA 3V04A 2ETKA 4IW0A 4C61A 5BYLA 4EOSA 3D2KA 4F7LA 4AZFA 3HRCA
chains in the Genus database with same CATH superfamily
4QP2A 2P2HA 1Q8WA 3BL7A 1OGUA 4R1VA 2J51A 3MB7A 4J1RA 4K6ZA 4ANMA 3UQCA 3LFSA 5HG7A 2O63A 5IQDA 4AE6A 3LFQA 1R78A 3GFWA 4BBFA 3GXLA 1KUTA 4M12A 2GHGA 3COHA 5FQDC 4TW9A 3ZXTA 2HWOA 3PYYA 4JDJA 5TOZA 1JLUE 2BALA 3C0IA 3F7WA 3OW3A 1Y8GA 4QTCA 1ZXEA 3KF4A 3QTRA 4XG7A 3ULIA 2QOQA 1OKYA 3EYHA 4QP7A 3KXZA 4X2KA 3S95A 3MTLA 5CAVA 2BHHA 4J52A 5E7RA 3KB7A 3NNUA 4XYFA 4ZLZA 2J0KA 2BFXA 3KA0A 5CNNA 1MRVA 3FXWA 4XV1A 3FY2A 3E8CA 5M4UA 4ERWA 4IZAA 3WF5A 3S00A 4YZ9A 5AA8A 4PMTA 5JEBA 4BCNA 5JGBA 3DQWA 2BFYA 2EXMA 4CTCA 1HOWA 4GJ2A 3BBWA 3BHYA 2BZKB 3VBVA 2A98A 4DEDA 3LMHA 3UQGA 5DT0A 1OKVA 3PDTA 4C4IA 4O96A 3DTCA 1JKSA 2A2AA 3ET7A 4FV9A 4KIKA 4WBOA 3KIOC 3OHTA 2IPXA 5CI7A 1M14A 2EUFB 3D7TB 4I6LA 3NYOA 2VWBA 2FSMX 3VJOA 3PA5A 3ZC5A 3NWWA 2F7EE 4AW5A 4GIHA 4RIXB 3MVLA 4GSBA 5IEYA 4DLIA 1ZYSA 2PUNA 4V04A 4QRCA 5AV0A 4BICA 2P55A 3AGLA 5CVHA 4B6LA 2RGPA 3ORPA 2UW7A 3OOMA 3UPZA 2UW4A 1YDSE 1VYWA 1TQMA 4IX4A 1U54A 1JKKA 2VTPA 4E7WA 3QRUA 5K4JA 2DWBA 2XA4A 4GT3A 4MD9E 2UW3A 2PVLA 3DFCB 3I5NA 3NS9A 1H0WA 1DM2A 4L01A 3OBJA 4ZTLA 1FVVA 1H0VA 2Y0AA 3G90X 4FKJA 5D9HA 4L3PA 3I79A 4KWPA 3W2SA 3NAYA 4A9TA 3QL8A 4FSNA 3E62A 3QYWA 4GU6A 4L44A 3DCVA 4GMYA 4BDDA 4F9WA 4FEQA 3UVQA 4D2PA 3U6IA 3FI3A 3DKFA 2RL5A 5H8GA 4QMZA 4C4EA 3AC2A 3UOLA 3H0ZA 1K2PA 3GB2A 3LPBA 4CFXA 5CAQA 3PVWA 1ZZLA 1IA9A 1CKPA 1VYZA 2ZM3A 5K3YA 3U51A 4FKTA 3Q9ZA 2W5HA 3L1SA 4I6HA 4KIQA 2ERZE 2W9FB 2XJ2A 2BDFA 3C4CA 3R8UA 5IA2A 1KWPA 1GIHA 4PX6A 4F1TA 3MGYA 3IOKA 2WIPA 3VUMA 3G2FA 1H01A 4EH6A 3GU5A 2YM3A 2BROA 3GVUA 4RJ8A 3R9NA 5M55A 3ZC6A 4OT5A 4ALWA 2IF8A 3QQUA 3WOWA 4F6SA 2PVKA 5T68A 3REPA 1YHVA 4JMQA 4UEUA 3QLGA 5CU3A 3WF8A 1OB3A 2EU9A 3C13A 5FDPA 3R83A 3E8DA 3D0EA 4FTAA 3F9NA 2XUUA 4IXPA 1QPDA 2J5EA 4NIFA 3D4QA 1JAMA 2J0MB 4DE4A 5AUYA 5E8TA 4NJ3A 4DHFA 2JEDA 3BWJA 4H3PA 3OW4A 5JH6A 5AP6A 4O83A 1NVRA 1H25A 4JBPA 2NP8A 4XG6A 4OR5A 1PY5A 4O6EA 5D10A 3BLHA 3TN8A 4JBQA 5CU4A 2W9ZB 3V5PA 5CALA 3PPKA 4LOOA 3TDWA 1TVOA 3K5UA 3TWJA 3VUTA 5AUWA 1DI8A 1WBSA 4IM0A 3RAKA 4EUUA 3ANQA 1IA8A 4MAOA 3E88A 4F70A 4O84A 3FYJX 4IC7A 4EZ7A 3ZDUA 2HXQA 1SZMA 3KXGA 4CLJA 1WBTA 4IWDA 4I41A 3DFAA 4IZ5A 4O0RA 3L8SA 3BE9A 4HOKA 3RBWA 3ERKA 1A06A 5KMIA 3R01A 2XS0A 2C0TA 3VHKA 5AV1A 5CSXA 4KBCA 1QL6A 4EJ7A 5IQBA 3V5TA 4Z7HA 2CNVA 4F7NA 3O7LD 2QHMA 4F0FA 3S1HA 3LQ5A 1PMVA 2J50A 5KX8A 2C6OA 3ZU7A 5J7BA 2F2CB 5DNRA 4GH2A 5AIKA 3M2WA 2Y9QA 1PYXA 5E90A 3BQCA 4KBKA 3ZFMA 4FSWA 5CT0A 4EK4A 4XCUA 4RLLA 4HZSA 2YDIA 4ZTRA 4FKUA 5CZHA 3TEIA 5AP5A 3OBGA 3EL8A 3DJ5A 3QRKA 4MNEB 2JBPA 4RFMA 5M06A 4YC6A 5KUPA 3NFGB 3KU2A 4QOXA 2AYPA 3HMMA 1O9UA 4X6QC 5DE2A 4N4SA 4YPSA 3UYTA 5FXQA 3RZFA 4Z16A 4W4WA 1AD5A 3ANRA 3IKAA 3R2BA 4R7IA 2FSLX 3MJ2A 1URWA 3NRMA 4I3ZA 3VO3A 3BYOA 2P2IA 2WEIA 3PZEA 1K9AA 3AT3A 3P86A 4AOIA 4ZIMA 4EOMA 5ANGA 1W2CA 4CVAA 4IADA 4MWHA 2RG5A 5EM7A 5CEPA 3WZDA 2AC5A 2R3OA 3O8PA 1GZOA 4DEEA 1R39A 3E3PA 4Z7GA 3EQFA 4ASXA 2B1PA 3KK9A 4RG0A 2CKOA 4RJ7A 5F20A 3DDPA 3MIAA 4R3RA 4LUEA 4P4CA 4C62A 4ZJJA 1I44A 5EW9A 3FQHA 4PRJA 3WYYA 4AG8A 4CGAA 3AMBA 4GFMA 3CE3A 5FEQA 2UW0A 2ETRA 3PLSA 4Y8DA 2XARA 1MRUA 4ZY4A 3WE4A 2GNFA 2YCFA 2OSCA 3TZMA 4ASEA 3A7HA 4MBLA 3TV6A 2X39A 4DEHA 4QP4A 2UVYA 4DYMA 4DFBA 4OLIA 4UXQA 4FICA 4CMUA 1WVWA 2XF0A 3KCFA 2VO6A 2W06A 3EB0A 2C3IB 2Y8OA 3EHAA 5EKNA 2F7ZE 3W33A 4EONA 4M0YA 3LW0A 4U40A 3UOKA 4E3CA 3KMUA 5FTGA 3Q9WA 4ANQA 4DGOA 4HPTE 5AFVA 4UMPA 3A8XA 4ZY5A 4ERKA 4L3JA 4E20A 3G6HA 2VNWA 3Q5ZA 4XP3A 2GHMA 1M2QA 2HELA 3BHTA 2OGVA 3LFDA 4U43A 5KBRA 3QTWA 3HKOA 3S0OA 2BHEA 3RVGA 2ERKA 2O3PA 2BRBA 4AZVA 2E9VA 4CKIA 2VX3A 3E8EA 4BTJA 4HCUA 4L8MA 4BCKA 1P2AA 3TNQB 2XEYA 3I1AA 3GCVA 4O86A 3EYGA 3QZFA 5A3XA 3HDNA 1O6YA 3WBLA 3OT8A 1M2PA 2XRUA 3MWUA 2PSQA 5BVKA 3RK5A 3WE8A 4YTFA 1REKA 2JIVA 3QRTA 3PJ1A 4RX8A 2OH0E 2X7FA 3BBTB 5E8XA 5HIBA 5IUIA 5JKGA 3U54A 2OG8A 1R3CA 3KXHA 4RWIA 3H4JA 2HIWA 3DBFA 4TRLA 5CZIA 3ENHA 4RLKA 2VAGA 3OWKA 1PXLA 2ZOQA 4UX9A 3A7IA 3JXWA 3PP0A 4AXAA 4BHNA 2VU3A 5LMKA 4FKSA 3JYAA 3QC9A 2C1AA 1YHSA 4ZSGA 3UJGA 2PHKA 3PSBA 3E7VA 3FXZA 3VS7A 1YXTA 4M8TA 4DEBA 4BCPA 4PUZA 1S9IA 4PL4A 4XBUA 4U5JA 3RWPA 3ATTA 4ZS4A 2J7TA 4BDKA 1OUKA 4G5PA 2UW8A 2XM9A 2OXXA 2BIYA 2GHLA 4OTPA 5E8ZA 1BKXA 4C2WA 5FBNC 4E6CA 4G9CA 4FZ6A 3EFWA 1W0XC 5IH6A 4E8AA 5D1JA 3EN7A 3FZ1A 4YJVA 4BL1A 3FXXA 3O50A 5TR6A 2X8EA 4WG5A 3ZSGA 4JI9A 5HBJA 3ETAA 4AA0A 4EQCA 5AUTA 3JUHA 1H28A 1UU7A 4C57A 3DT1A 3PY3A 5AA9A 4IX3A 1FGKA 3C0HA 4NEUA 2XANA 4EOIA 2WO6A 3R8PA 3C5IA 3BU3A 5DEWA 3CJFA 5EKOA 5AADA 4IAZA 4LG4A 4MQ2A 4OBQA 1YXSA 2J6MA 2PZRA 2QOCA 1J91A 4ENYA 2C5XA 5GZ8A 3THBA 2IJMA 1SVHA 3WIGA 3ID6C 4GUEA 4XLVA 1L8TA 4NW5A 3D5UA 2O64A 4QQCA 4EI4A 4GJ3A 4MQ1A 5BVFA 4C59A 5K9IA 4CCBA 3VN9A 2XVDA 1ZZ2A 1O6LA 3DKCA 4GKIA 3VS2A 3ORLA 3F6XA 4O7WA 3ZEPA 2WMBA 3NUAA 3SRVA 2WIHA 3ENMA 4Q5HA 4CFUA 2B9JA 4DFLA 5K5XA 5IA0A 2W4OA 4JG8A 3TACA 3FMMA 3A4PA 3IW4A 4GEOA 4DGLC 2OW3A 1H4LA 4MCVA 2R3MA 4XEYA 4FT9A 5J8IA 4G6NA 4ZTMA 2VWXA 1FQ1B 4FV7A 1WZYA 1LEWA 1Q62A 4RVMA 4DTKA 1M52A 2ITPA 3ALNA 5CSWA 4MXXA 3QKLA 4XNEA 1Q8UA 3CBLA 1BYGA 4LMNA 4M69B 4RJ5A 3NZ0A 5A6NA 3TT0A 5ICPA 3NUPA 1H8FA 4QPAA 4CV8A 2FGIA 4FSRA 3QWKA 3U6HA 5DA3A 3WF7A 4BBEA 4O4FA 4EC8A 1K3AA 3W16A 4RA4A 2WGJA 4ZAUA 4A4LA 4BYJA 4GW8A 3UOJA 5LVMA 4CFFA 1ND4A 4U81A 4KIPA 4B8MA 3VONA 2PZPA 4EKKA 2XK6A 4IM2A 1ZYJA 5ANOA 4FMQA 1Y8YA 4NZWB 1ZOGA 1UWHA 4UZHA 4F9YA 4QP1A 3NUYA 4JJRA 5AUUA 2IZUA 4X7QA 4FX3A 3NLBA 3Q4UA 3QZGA 4RIYA 2PULA 4O7RA 1KOBA 2XJ1A 4X6RA 3B8QA 5C8KA 2HYYA 4A06A 3A62A 4FK6A 5CWZA 4FTTA 1Q41A 3BHVA 2AQXA 3MVMA 4FTLA 3BV3A 3F66A 4WNOA 1YXVA 3P4KA 4IX5A 4C33A 5KMKA 4JS8A 4U3ZA 1E9HA 5C27A 4FG7A 4XBRA 2P3GX 3HDMA 2XZSA 3LFFA 3DS6A 4FKOA 4RSSA 1X8BA 5AX3A 3AMAA 5HLWA 3CY3A 4BDCA 4NW6A 3Q9YA 5E1EA 4X21A 3NAXA 2ITNA 5D11A 4G1WA 3OXZA 4HNIA 4E73A 2FO0A 2ZV9A 4JG7A 3LKMA 1YI4A 1V1KA 4DCAA 3KXNA 2SRCA 3QD2B 3AD5A 5HICA 1XMMA 4R78A 3CD8A 4LDTA 1M2RA 3OVVA 4YJRA 4AFEA 2XBJA 5CYIA 1PF8A 3UNJA 4BCGA 4R7BA 5C26A 1V0OA 2BKZA 3COIA 3SW4A 1ZYDA 1KV2A 4XG4A 3CS9A 4GVAA 5GINE 4D2RA 5DLSA 4U6RA 3ZXZA 3IW6A 2XB7A 5KKRB 3MDYA 1FMOE 3DQXA 3NIEA 5HO8A 4PF4A 3WZKA 1V0PA 2W4JA 4FTKA 1SNUA 5HG9A 1QMZA 3SW7A 2R3KA 2X7GA 2XP2A 3HYHA 4NKSA 3MESA 2C6EA 3GI3A 3QZHA 5LVLA 4E4LA 3NPCA 3QU0A 4G3FA 4KKGA 1OKZA 2OI4X 4UWCA 5HVKA 5L2IA 1W8CA 1XH4A 5L2WA 2PZIA 1HCLA 3FV8A 2J5FA 2OZAB 3SX9A 4P90A 2RSVA 4DT8A 3QQGA 3OCSA 4II5A 5E91A 3UGCA 3QKKA 1JNKA 5DI1A 5CEKA 4D4RA 1UV5A 5I3RA 4BDGA 2ITUA 4MXOA 4F0GA 5C03A 1H08A 4ENXA 2PVFA 4F6UA 1NVQA 4DFXE 5IA4A 5DRDA 4BIBA 2ITWA 4GIIA 4IJ9A 4XV3A 4IE9A 4U41A 3WARA 4LOPA 4NYEA 3F3TA 4AQKA 4G2FA 4F1MA 4HW7A 4BJJB 2P33A 4FKGA 1W2FA 3LJ2A 1TZDA 3MJ1A 3I6WA 5C01A 4QEBA 2VWZA 4HPUE 2WQBA 3SOAA 2WNTA 4L7FA 4OT6A 3VUDA 4ZSAA 2XCHA 3KULA 5CNOA 5K5NA 3AG9A 3RWQA 2XYNA 1J3HA 1H07A 2CCIA 2HWPA 2W0JA 5DPVA 4W4VA 5AMNA 3DXPA 3EMGA 1UA2A 3WZEA 4BCMA 2C30A 1UWJA 4FVQA 4G34A 2B9FA 5AV3A 4CEGA 4D28A 5IUHA 5F1ZA 5HIDA 5IISA 3R00A 4M0ZA 5ANIA 4FUXA 2PMLX 4D4YA 1ZY4A 3HMOA 2NRUA 5LMAA 3UMWA 5CF4A 2UZLA 4RX9A 4BBMA 4O38A 1IRKA 4R3PA 4XX9A 3F5XA 4XG2A 4U42A 5AP1A 5EQPA 2OJGA 2VTNA 3A99A 2LGCA 3E92A 4RC4A 5HNGA 3EN4A 5DIAA 5B2LA 3R7EA 2R5TA 4E4MA 1J1CA 1YDTE 1PXIA 5AR7A 4NFNA 3S2PA 4GRBA 2C5YA 4XG8A 4R1YA 2YIRA 4GUBA 3D83A 4C0TA 2UZOA 5DG5A 2YM5A 3TL8A 4LM5A 2YDKA 4CFNA 3AQVA 1IASA 2I0VA 4AAAA 2GTMA 3EQIA 4ITIA 3UDBA 4X3FB 2OF2A 4CV9A 3BI6A 2QKWB 3FDNA 5HI2A 3SXFA 1YDRE 5BQ0A 2OF4A 2R7IA 4F09A 3DJ7A 1YWNA 5CSVA 4L53A 4AUAA 2QI8A 3GGFA 3IGOA 4BCHA 4DCEA 1IAJA 4C3PA 3KY2A 5AUXA 3UG2A 3PJCA 4BHZA 2W1ZA 5CSHA 4UWYA 4BYIA 3OWPA 4EKLA 2WQOA 2NYAA 1OL2A 3CTHA 3FPQA 5LVPA 1RE8A 4KB8A 2Z7SA 3KREA 3GFEA 4N6YA 4AW0A 2GU8A 2WQEA 2G2HA 3ACKA 4O0YA 1Z9XA 2CSNA 2OBJA 3ZZEA 5J1VA 2EXEA 1YVJA 3OOGA 5EYKA 3T3UA 4O4BB 4RA5A 3ZZWA 1IR3A 3EJ1A 4JIAA 2G2FA 4S33A 1DI9A 4XUFA 3NMUF 3OC1A 1RJBA 4Y95A 2OFUA 3UMXA 3VBXA 3BX5A 3FY0A 3ROCA 4FV6A 4USFA 2F57A 3P79A 1ZMVA 5JZNA 4IVDA 4N6ZA 3QYZA 3OROA 4FTJA 4ZJIA 4AA5A 4V0GB 5JGDA 1FVRA 4QMVA 1Q4LA 3NUXA 5M09A 3PVBA 5DVRA 3C4WA 3PJ8A 2WQNA 4I5MA 3D7TA 4K11A 1F3MC 4PTGA 2WMAA 4C38A 3R8VA 1H24A 2OXYA 3KN5A 1ZLTA 4YHTA 5JFXA 2X8DA 4R8QA 1APME 3O7LB 3A61A 5HE2A 4DBNA 5J7HA 1Q3DA 3FLNC 2QOIA 3JPVA 4E26A 4DT9A 2A0CX 5L6OA 2BDJA 3BEGA 1OL6A 3H10A 2R3GA 4OBOA 4LV5A 1SNXA 2F2UA 2PE2A 2Z7QA 3OXIA 3CP9A 5M4FA 4Y72A 3OY1A 4IWPA 2GPHA 4QPMA 4CZUA 4UMUA 3OCBA 3ZM9A 3B2WA 4OTGA 2ITVA 4R77A 4FA2A 5LARA 3V6RA 3WF6A 1OITA 3BPRA 4M84A 3CEKA 4QO9A 4UWBA 4A4XA 2ITXA 3ORTA 4L52A 4MNFA 4DDIA 5A54A 2RFNA 3C7QA 4AT3A 3Q96A 1FGIA 1VEBA 3C1XA 3DLSA 3P1AA 2F4JA 3JS2A 3VNTA 5HD4A 2GQSA 3VQHA 2ZAZA 4OTWA 4QMPA 3NIZA 2J90A 2ETMA 3SV0A 3IW8A 1J7IA 5L3AA 3OWJA 2PE0A 3VRYA 2YZAA 1AQ1A 2GNGA 2PY3A 1CKIA 2F49A 4FGBA 4TYIA 2JC6A 2ZM1A 4EHEA 2YACA 2PVRA 1BMKA 1B6CB 4YJUA 3ZSHA 2JFLA 4O6LA 3RPOA 3AOXA 2UZUE 3E8NA 4D0XA 5LCJA 1PXKA 4GS6A 5HX6A 5D41A 5B0XA 3V3VA 3F2RA 2QC6A 5GJGA 1MQBA 1IG1A 4FV5A 1GY3A 5IKWA 3FMNA 3QFVA 3UIUA 3FMEA 3TKHA 4ZTHA 5E8WA 4DINA 4BCOA 3P5JC 4L46A 2YERA 3NNWA 3QKMA 4GK4A 4L3LA 3GQLA 3MPAA 2G9XA 4S31A 3S4QA 4TWNA 4IB0A 2Y6MA 2PE1A 4JAJA 5ANKA 4IBMA 4TT7A 3FLQA 3FZPA 4MH7A 4ACMA 4UN0C 5BVNA 5IMXA 5J9LA 3P5KA 3ZCLA 2XCKA 2C4GA 1OPJA 3W0QA 2C5NA 4BCIA 4BKZA 2B53A 3MY1A 3CJGA 5DRBA 5FTQA 3RHXA 2FB8A 3D5WA 3W2PA 3FLZA 3F61A 3PXZA 5KO1A 4BDJA 3UC3A 3VC4A 3HAMA 4K2RA 5FP6A 3GCQA 2B9HA 2GTNA 2R3PA 2WELA 3HVCA 4MKCA 3MYGA 5A4QA 4C34A 2C0IA 5DGZA 2OIQA 3O51A 2QKRA 4CG8A 2QO9A 4OBPA 4YHJA 3MH3A 3JR1A 3BYSA 3VUGA 2W1GA 4FK3A 2X6DA 3LXKA 3ZO4A 4I6FA 5AAGA 3P08A 3V8TA 5J1WA 2X2KA 3IGGA 4I4FA 1XH5A 4NM7A 4H3BA 1J7LA 1UVRA 5FGKA 4WD5A 3RZBA 3QQHA 4A9UA 2B54A 2I0EA 2QOHA 3BLAA 3ROYA 5IQAA 3V6SA 1WAKA 4H39A 3MSSA 4J98A 5AP2A 4ANNA 1YHWA 4YMJA 2GMXA 2B0QA 3F5GA 3I7CA 5IH5A 5FWKK 2C6IA 3GEQA 3BGZA 3SOCA 1M7NA 4YC8A 5EW3A 2V7AA 3A4OX 3K5VA 4F65A 4BI0A 4AGDA 3PE1A 4L00A 5ANEA 2XK4A 4E1ZA 4QTEA 2YEXA 2VWWA 5BMSA 3NUNA 1GAGA 4TPTA 3MVHA 3UNKA 4AGWA 5HU9A 2OJFE 1TQPA 2Y4IB 1CDKA 4CQEA 3UO5A 3MH2A 4XH6A 4YGAA 5KMMA 2IVTA 3V5JA 2FA2A 4PPAA 3TKIA 4D1XA 2X8IA 1NT2A 3QTZA 4JRNA 4ZSJA 4ARKA 1YXXA 5FM2A 5EW8A 1B39A 3R2YA 3MFSA 4I23A 1IAHA 5AX9A 3NX8A 4NCTA 4C7TA 4I22A 3DZQA 1XBBA 3PIYA 4KKHA 4YNEA 4B0GA 1ZMUA 4JDIA 4YSMA 1RW8A 2IN6A 4OTQA 3BZ3A 2VUWA 2XNGA 2FSOX 4DG3E 5BYYA 3C4FA 5EI8A 4BR3A 3QCXA 4PL5A 2Y4PA 5BUEA 1SVGA 4K18A 4IB3A 2JIIA 2R0IA 3AC5A 4FC0A 4R7HA 2VD5A 5L6WL 3EKKA 4O91A 2WMSA 4NM5A 4BTMA 4K77A 4IACA 4L9IA 4NL0A 2B4SB 1Q8YA 5EYMA 3KRLA 3U9CA 3QA0A 1KV1A 2YCSA 3MBLA 4QP8A 4HGLA 3O96A 5BPYA 5GJDA 3UP2A 2XNNA 2WXVA 2X0QA 3G6GA 3Q52A 2AUHA 4FSQA 4LL5A 5JT2A 4AAYA 3I60A 2JAMA 1UU3A 3W0SA 2PWLA 4XJ0A 3QCQA 4O4EA 4O7YA 3MH1A 3NW7A 3AT2A 3VW6A 3IONA 3F5UA 4FKLA 4HGEA 3R0TA 3SQQA 3PWDA 1CTPE 3Q60A 3QQKA 3W2CA 3VUIA 4QMYA 4XHKB 2B7AA 5EK7A 1NVSA 2W96B 4S2ZA 5EHOA 1Q5KA 3G9NA 4OTIA 4IAYA 1G8SA 2QODA 2GFSA 4EORA 3VJNA 3OEFX 3VS4A 3R30A 3AMYA 4KNBA 4DDGA 4JL9A 5LCKA 4B8LA 5GZAA 3K3IA 4HYHA 3QTXA 5GHVA 3ZH8A 2PVMA 1NXKA 4O21A 4XOZA 4F9AA 3PUPA 4PTCA 2JDSA 4FV3A 2X7OA 2JDVA 4O4DA 4X2JA 2XALA 3MI9A 2RFDA 3CR0A 4J8NA 4I0RA 4PL3A 4KIKB 3QQLA 4RPVA 3HEGA 5HTBA 4YNOA 4IAIA 1DAWA 2OZOA 3FMLA 2PZ5A 2ZM4A 1WBNA 2FH9A 3KL8A 4J53A 4YJPA 5DHJA 4FEWA 2XAMA 4TY1A 2X2LA 3FEGA 3DXQA 4TWCA 4G6OA 1H1RA 3HP5A 4JDHA 1PMNA 4CFMA 2XKEA 4CLIA 3DGKA 4GKHA 3ORMA 2P4IA 2XIYA 3LQ8A 2C6TA 2Q83A 2XKDA 5DEYA 2W1HA 2HY81 5DOSA 1XHAA 4IVAA 5EM6A 3RPRA 3NW6A 3HMNA 4TL0A 2WB8A 2I7QA 4R5SA 3AD4A 5EH0A 4YZMA 2OK1A 4A7CA 3RAWA 3AC4A 4NJDA 4AXFA 4BDFA 3SC1A 3RTPA 3UIBA 4AS0A 3FZSA 3O2MA 4E5WA 4YO4A 4FL3A 2C6MA 2H34A 4GT5A 4RZWA 4DGNA 4YUQA 3EKNA 4G3DA 1PXPA 4UMTA 4Z3VA 4PMPA 3DB6A 4QYHA 4W4YA 2B52A 3TNHA 5TO8A 4AOJA 4D9TA 4PV0A 4DBXA 5KKRC 1F5QA 2OIDA 4BN1A 3EQCA 5L8KA 3DU8A 3FKNA 4DGMA 4UMRA 3GC7A 4C4JA 4IWOA 4FNWA 2P0CA 3RALA 2YLFA 3DAKA 3MTFA 5DR6A 4C58A 4F9BA 4BY9E 4APCA 3IW5A 3QBNA 4Y73A 4G5JA 2E9OA 2YLEA 4AWIA 3QTSA 4I0SA 3R9DA 1W2DA 3NYXA 2HZIA 4RT7A 4ZTSA 5A14A 3FQEA 1WCCA 4EHVA 4YHFA 3KF7A 4FODA 1JVPP 5AV4A 5JFWA 4M68A 1ZYLA 3HNGA 3TTIA 4X2GA 3FZRA 1JKTA 2WZJA 4AXDA 3HV4A 2X81A 3G0EA 1WVXA 4WNMA 4MUQA 4Q9SA 3TUCA 3I81A 2UZWE 4Y83A 2IW9A 4C35A 1XBAA 1Q97A 4WIHA 1T45A 4BGGA 5JSMA 4NIFB 5IQFA 2CKQA 5DFPA 3FUPA 3GENA 3V5WA 5A9UA 2OIBA 2XYUA 1JWHA 3UDTA 1MP8A 4I5HA 3FPMA 2ZB1A 4WUNA 4EBWA 4RVLA 4XV2A 4YTHA 4M7IA 4J95A 3I0QA 5F94A 4FTNA 3UNZA 4FT7A 5AP3A 4EK5A 2E9NA 3QHWA 4A4OA 4LV7A 1J1BA 5HTIA 3TKUA 4AXEA 2QOKA 3A60A 3M11A 2BDWA 4O0WA 4PWNA 3K54A 2QQ7A 1OL5A 3FMDA 3LXPA 2R2PA 3Q32A 4HVGA 4O7NA 5EG3A 4MHAA 4O0TA 3HMPA 4KSPA 5HO7A 4G6LA 4FTOA 4H36A 1YWVA 2UZTA 3LVPA 4CKRA 2UZBA 3Q3BA 3U8WA 4FEVA 3CPBA 4E4XA 4TXCA 1PW2A 3VF8A 3QTUA 5E4HA 3QXOA 4PMSA 3D94A 2VWUA 3EFLA 2W1DA 2YJSA 3KRRA 3OCTA 4TWPA 3TV7A 2ACXA 5AP7A 4EH7A 1GOLA 3VS3A 5J5TA 4YZNA 3T9IA 4B7TA 3R1NA 4L7SA 4M66A 4CD0A 4FNYA 3C9WA 4PTEA 3E3BX 3FKOA 3G9LX 5LQFA 2ZFYA 1REJA 2ITTA 4AOTA 5I0BA 2VX0A 4DHZA 3EOCA 2A4LA 1H26A 5HO6A 3VS1A 1GZ8A 4X3FC 4WRGA 5I5ZA 3BQRA 3FZTA 3N4TA 5HEZA 3N4UA 5HVJA 5HIEA 5H9BA 2RFEA 1Q99A 3ZO2A 4I92A 4ZK5A 4M15A 4CMOA 3IPHA 2ZDUA 3P78A 1ZAOA 4PP9A 2W05A 3MA3A 4DC2A 1STCE 2ZDTA 5AR4A 4BKJA 4FVPA 4LRKA 4AF3A 3LCDA 4WOVA 3BGPA 4FNZA 4F0IA 4MTAA 1DAYA 3FAAA 1OECA 5AP4A 3LLTA 3NNXA 3ORZA 3PWYA 5CEOA 2CKPA 5FLFA 4O82A 4JOAA 3PSCA 2Q0BA 4G17A 2C3LA 4EHGA 3EQHA 3O23A 2EWAA 3GC0A 4R6VA 2HZ0A 2C3KA 4RX7A 2CKEA 2YIQA 5I9YA 3W0PA 5CVFA 5DR9A 2BZHB 4F7JA 4XRLA 2PL0A 4A9YA 4CKJA 1SYKA 4CT2A 5M4CA 5LMBA 2IZTA 3PJ3A 4NKAA 2Z7RA 3I6UA 5HE0A 4O4CA 4KUJA 4DTAA 1E1XA 3HV7A 3QD3A 1FPUA 4D9UA 3HLLA 3SGCA 3HV6A 5TF9A 3T9TA 3HX4A 3KGAA 2HCKA 2NO3A 4KD1A 4DG2E 4KA3A 2CGXA 3UP7A