3DBFA

Crystal structure of an activated (thr->asp) polo-like kinase 1 (plk1) catalytic domain in complex with compound 562
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
287
structure length
261
Chain Sequence
KEIPDVLVDPRTMKRYMRGRFLGKGGFAKCYEITDMDTKEVFAGKVVPKSMLLKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMRQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIHSFEVDIWSLGCILYTLLVGKPPFETSCLKETYIRIKKNEYSVPRHINPVASALIRRMLHADPTLRPSVAELLTDEFFTSGYAPMRLPTSCLTVPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and synthesis of 2-amino-pyrazolopyridines as Polo-like kinase 1 inhibitors.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transferase
molecule keywords Polo-like kinase
total genus 74
structure length 261
sequence length 287
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2008-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dbfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dbfA01
3UOKA 1CTPE 1Q8TA 2E9NA 1MRVA 5J95A 5KMOA 1KOBA 4XG9A 5CTPA 4A4OA 2XNEA 4G2FA 4IAFA 4FNZA 4HNIA 1U54B 3HNGA 5TKDA 3Q2JA 2YISA 2WQOA 4F63A 5AJQA 2HZNA 4FTUA 4IX6A 2X9FA 3E93A 4LOOA 4BWKA 4UWCA 2QO7A 1Y91A 2IG7A 3ZMMA 5CQWA 1Q3DA 5DI1A 5CU6A 3DU8A 1ZZLA 3C4CA 3F9NA 1DS5A 4ZSGA 3R7OA 2CPKE 3TKIA 1ZOEA 3HMIA 5EM6A 3VQHA 3QZFA 4O96A 2W1DA 4AW0A 4B8LA 3BEGA 3TTIA 3QXOA 3MVHA 3P9JA 4G5JA 2R7IA 4WSQA 3RAWA 2GNGA 2HW6A 4Z16A 2C3KA 2X8IA 2ITOA 4BCKA 4M7IA 3TJCA 4F9AA 1NXKA 4G6LA 2QG5A 5IQEA 2ITXA 4ANBA 2VTNA 4E4NA 4WUAA 3DA6A 4L44A 1YQJA 4O0SA 3LFBA 4LM5A 1NA7A 2X4FA 4K6ZA 5AIRA 3BELA 2UW7A 4IANA 5KMKA 2OJJA 3R30A 5GNKA 2WMBA 4WSYA 1BMKA 4NWMA 4TYEA 5IA0A 5A3XA 3O8PA 4U6RA 3UZPA 3ZM9A 2VGPA 3RPSA 3WBLA 3ZFYA 3NSZA 3O23A 3OS3A 2BKKA 1SVHA 3QQHA 3UIXA 1P4FA 3D0EA 4Q5HA 1M7NA 4EOOA 3QUEA 3GC7A 1IAHA 1PKDA 3OBGA 3NIZA 5AV0A 3ZZWA 4F09A 4XOZA 3NCZA 1OZ1A 2ITTA 4HGTA 3QHRA 3SG8A 4EH7A 4Y83A 3TKHA 2UZUE 5J7HA 3R9HA 5J87A 3OT3A 4FSWA 3MS9A 4GFGA 3ZBXA 3EH9A 4D2VA 1OKYA 1H0VA 5BVOA 4GUEA 2UZLA 3AD6A 2GHGA 3Q9YA 1KV2A 4P5QA 1ZARA 2WNTA 4NIFA 4IVCA 5CZHA 3R2BA 2EB3A 2FH9A 3HGKA 3U6JA 5KMJA 4ZY6A 3EOCA 1OL5A 4ZEGA 1YHWA 2I0VA 4YNEA 5F20A 4Q9SA 4HPTE 4BC6A 4O1OA 5CAVA 2XS0A 4BY9E 1LEWA 1YDSE 3U54A 4DC2A 4F6SA 2O3PA 4NCTC 2NRYA 2Y6OA 3FPMA 2QLUA 3POZA 3Q9WA 5ANOA 4ZTRA 4DH7A 3T9TA 3EYGA 4G9RA 2R3FA 4HYHA 2PVHA 3NEWA 1NT2A 1XHAA 5ICPA 3FDNA 2PUNA 2XA4A 4IWDA 3AMBA 2A0CX 3AG9A 1ZYDA 3QRUA 3ZO1A 4F08A 5IU2A 1MRUA 3BWJA 2QOLA 3BLQA 4XG8A 2YLEA 3FKNA 4GV1A 2G01A 4C62A 3F2AA 2YIYA 4WRGA 4FV0A 4DFUA 4FG9A 4TXCA 2WEIA 3NWWA 4C3FA 2R3QA 3SXFA 2CLXA 3N51A 3PIZA 3Q60A 5KZIA 5D12A 4Q9ZA 4WO5A 4DFZE 2RFDA 3PXFA 5A4QA 3ORIA 2CSNA 3SDJA 1PXLA 3OWJA 2DUVA 5FGKA 4GIIA 1ZZ2A 5IDPA 3DFCB 3QRJA 2XMYA 2GTMA 2YJRA 3EL7A 3LCOA 4RJ3A 3I5ZA 3WARA 3UOJA 3PJCA 4O7TA 4HCVA 3H3CA 2BHEA 5J9YA 4OR5A 3N4VA 3PLAE 4IZYA 1R0PA 4ZTSA 4YTIA 3B2WA 4GJ2A 4HCTA 4TWNA 3IS5A 2PMLX 5DHJA 2JFMA 2PZPA 4TYHB 3DK3A 4Y95A 4RJ8A 1LP4A 3EN5A 2WMUA 2Y9QA 1H1PA 3QQUA 3TT0A 4DGLC 3QQJA 4OLIA 4ID7A 4S30A 3WZDA 3OP5A 2XM8A 4ANSA 3PFQA 1Q24A 4MQ2A 2JBPA 3I4BA 4RWIA 3WI6A 5CASA 5KHWA 5HD7A 4FV5A 3RPVA 2WKMA 1YWRA 4QP1A 3WYXA 1M2RA 3B2TA 2OZOA 2JC6A 4X2KA 4X7QA 5J1VA 1ZY4A 3BYOA 4KD1A 5IUIA 1SZMA 4EOJA 4MWHA 5CEMA 2W7XA 1QCFA 3QLGA 5AR5A 4YC3A 2YHVA 1UWJA 3UJGA 2O8YA 3CKWA 4YMJA 5HG5A 3EZRA 3A7FA 3IGOA 4JIKA 3FI3A 2PYWA 3CKXA 3EFJA 1WAKA 3NNUA 3PJ2A 2P4IA 3KKVA 2R3HA 3PZHA 4UBAA 5KBRA 2VO3A 2X2KA 4EQUA 3PG1A 4BCOA 4ZZOA 4O86A 4EJ7A 3UODA 3CP9A 3R8ZA 4DCAA 2YDKA 4FUXA 2BRNA 4PV0A 1JKTA 4EL9A 4I5HA 3HP2A 3F3WA 4IZ5A 4XV2A 2XIRA 3Q4CA 3NW7A 3EN6A 3GXLA 3OMVA 2XCHA 2UW5A 4ITJA 1G3NA 3H4JA 3KRJA 3EQDA 5A6NA 3O51A 3BYVA 1LR4A 5AP1A 2IW9A 5E1EA 1GZKA 3UQCA 3G5DA 3FYJX 3EQHA 4O81A 2HWOA 5GIPE 3WILA 4OTDA 4CTCA 4Z7GA 1MQBA 5CEPA 4DF3A 1NVRA 1RE8A 2CJMA 4HVSA 4YLKA 3BZ3A 3BU6A 5M56A 5CEQA 3F82A 4RVMA 3E7VA 3ZC5A 4UEUA 2R7BA 2H96A 3D15A 3DK7A 3C5UA 3R63A 4XV3A 5DH3A 4FUYA 4ONAA 3DCVA 4GYGA 3IECA 4I5PA 3LMHA 5KMMA 4XG3A 5CEIA 1OKWA 1XH5A 3JUHA 3WIGA 4JX3A 1LEZA 3O2MA 3V51A 3EMGA 3MFSA 5D9HA 3R73A 2R3OA 3CQEA 4I6FA 1H1RA 2OIQA 2O63A 3FHIA 5E8WA 1RQQA 3DJ7A 4AA4A 4E6DA 4BCFA 2WMAA 4YZ9A 2UZBA 2J0LA 1BL7A 5IEXA 3DNEA 3PVWA 4U7ZA 5CS6A 3FSFA 4B0GA 2VTOA 4J96A 2IW6A 2J51A 3ZOSA 4U41A 2PWLA 4GEOA 3GCQA 3SC1A 2CKEA 3ZO2A 4AA0A 5AX3A 3V01A 3BI6A 5EK7A 4FNXA 5TE0A 3D5WA 4L43A 3FZPA 5DN3A 4O0WA 3KMWA 3OEZA 4KNBA 4ACHA 2BILB 4EH3A 5HOAA 3IONA 3KGAA 4AWIA 5KKRC 4ALVA 2QI8A 2PZIA 1KE7A 2ZJWA 4GIHA 2JKOA 3VVHA 4D4RA 3ORNA 2QU6A 3HV6A 3I60A 4DEDA 3CTQA 2FSTX 2F7XE 2JDVA 5A54A 3FLQA 2HY81 1GAGA 3MIYA 5DR9A 4I22A 4BHNA 1FVRA 4I6BA 3UC4A 2OWBA 3PG3A 3A7GA 4XP2A 5EKOA 4ERWA 3HMNA 2UVYA 4BL1A 4BYJA 4QP7A 4NM5A 2YJSA 3PXQA 4HNFA 1WBNA 4KKGA 1ATPE 4NKSA 4AU8A 4OTIA 4OBQA 4DGOA 3EFLA 4JDJA 4JOAA 3ITZA 4L9IA 4AGUA 2OXYA 4I4EA 3SXSA 1AGWA 4E1ZA 1JLUE 4KWPA 4MF0A 5I3OA 3D5UA 2JKQA 4LGHA 4XLIA 3TZ8A 2UZDA 3MVJA 3QZGA 5IQDA 3W1FA 3EN9A 3PLSA 1TQMA 5EDRA 2X2MA 2C5YA 3K5UA 4FV6A 1OITA 4CGAA 3GU7A 5AR2A 5FBOA 5C8MA 3LFFA 4RBLA 2R64A 3G9NA 4FZ7A 3CD8A 3RWQA 4IB3A 1URCA 2A19B 3OXIA 1GOLA 4FV2A 4GU6A 4FTRA 2IPXA 3P78A 5TR6A 1VYWA 2QQ7A 4GRBA 3VJOA 1V0OA 4GVAA 3D7TA 4XG2A 1FINA 2BR1A 2GNJA 2OF2A 2VX1A 5G1XA 3QA0A 3UIUA 4PX6A 3ZEWA 1BI7A 3GQLA 3KMMA 1TVOA 4BCGA 4QNAA 5B2MA 4WG3A 5HLWA 3ODZX 1R1WA 1WZYA 4XRJA 4CFNA 2ZV7A 2FSMX 4F9YA 5M51A 1TQPA 2PY3A 3EB0A 3KY2A 2VTTA 4D4VA 3UVQA 5CXZA 2HCKA 2PVMA 2XKCA 3LLAA 3V5WA 1GZOA 4QYEA 1H1QA 3CLYA 3OEFX 4U40A 5CF8A 4IHPA 3R1QA 5E8UA 4RZVA 2W4JA 2X1NA 4FZDB 4G3CA 5FBNC 2VTQA 3UZRA 3R9NA 2HELA 4NFNA 4UZDA 3AD5A 3ZRLA 4E8AA 5IISA 2OJIA 3FKLA 4HOKA 3BPRA 3EQFA 1REJA 5LJJA 1PXIA 2YFXA 3PPKA 3QYZA 4LV8A 4CVAA 4O7WA 1UNLA 4G17A 3BHYA 4XV9A 3QU0A 3EKNA 4B4LA 4JG6A 5ANIA 2P0CA 4P4CA 4GMYA 4Y8DA 4WA9A 5CNOA 4MXXA 5EDPA 3RK7A 2C5NA 2J5FA 3HA8A 4FYOA 3HVCA 2BRGA 4IZAA 5LVOA 2YIWA 2P33A 4S32A 3A7IA 4ZS4A 2PZ5A 3PTGA 2ZB0A 4FT3A 4G34A 3VS4A 3C4XA 2XJ2A 4IE9A 1ZWSA 4YTCA 3AOXA 4KABA 4D4YA 3QX4A 3WF5A 1JKLA 2ONLA 4IB1A 4LGGA 3L8SA 4O27B 3UMXA 5IZFA 5LCJA 2W99B 4FZAB 1O6KA 5C03A 3RM7A 1KE9A 1Y6BA 1ZYLA 4F1OA 2ONLC 4CFUA 3IOKA 1YXVA 3SKCA 4NTSA 2VV9A 2ZV8A 3TNWA 5I9YA 2B55A 3D4QA 4M3QA 3WF9A 1PW2A 5IPJA 1WBOA 3OXTA 4BGGA 2R3KA 4OT6A 3HX4A 4CG8A 2WMRA 3VBXA 3ZUTA 4FK6A 4QMQA 1YVJA 4FX3A 4IVBA 3UOHA 2B54A 4LUDA 4GG7A 2E2BA 3ORZA 4YJTA 4IWPA 4QYGA 4FIGA 5HO8A 4IH8A 3KREA 5CEKA 4FTLA 2WIPA 4UN0C 2V5QA 2X4ZA 4QO9A 3GQIA 4O7VA 2PTKA 3TJDA 1PKGA 2HYYA 3KEXA 2G9XA 3E8EA 5F95A 5TO8A 3ROYA 1KSWA 3GT8A 3DFAA 4PRJA 4RFMA 1UWHA 3FYKX 1I44A 5A9UA 4R3CA 3CY3A 3DKFA 3K5VA 3CGFA 3HV7A 4MBIA 1QL6A 5EYCA 5J1WA 4DEIA 1WBWA 2UUEA 2UZOA 1IA8A 2OW3A 3IW7A 4L45A 2XP2A 2QO2A 1PXOA 3G6HA 4DBNA 3GC8A 5LXMA 4FVQA 4JBQA 4IFGA 3VUKA 4ANOA 2C0OA 1PMUA 3QALE 3R00A 4BKZA 3F7ZA 2JEDA 1BL6A 2QU5A 4X2FA 3PY3A 3FXXA 3NS9A 4BBEA 5HCXA 2CGXA 4LOPA 2VAGA 3HDMA 3RTPA 4E73A 4EUUA 3RBWA 4EK6A 5IF1A 1PMVA 3EN7A 5AV3A 5HIEA 3DB8A 5AR7A 4W8EA 4BHZA 4Z7HA 1QPCA 3FWQA 1T46A 2VX3A 4O21A 4JBPA 3D94A 1ZOHA 2O64A 4EK3A 1PF8A 3OTUA 4XBRA 2VTJA 1OL6A 1A48A 2C6LA 4DFYA 3PSDA 4RIWA 3HRCA 4M13A 3L1SA 3S00A 1KWPA 4O0VA 1ZYSA 2VU3A 2VUWA 5CU4A 1KE5A 5T68A 2HY0A 3P86A 4H58A 2OU7A 2UW9A 4QMMA 2CNQA 4HVDA 1OPKA 4I23A 3EYHA 4LV5A 3OHTA 4CV8A 4FSUA 4DG3E 3EQRA 5HTBA 4W4VA 4ITIA 1DAWA 3E7OA 3EFKA 2XM9A 4NEUA 2WOUA 3Q5ZA 3AC3A 3VBWA 4YTHA 3BHVA 3GC9A 3G51A 1M14A 2C4GA 3OY1A 2J90A 4OBOA 4OTFA 2R5TA 4BBFA 3RPRA 3LPBA 4BDFA 1GZNA 4USDA 3LOKA 2ZM3A 2ERZE 2QG7A 1W7HA 2GTNA 3JVSA 5DPVA 2B53A 5I9XA 2ERKA 1H28A 3NUPA 2RL5A 3MBLA 1R3CA 3P08A 3QD4A 4C4IA 2XNMA 2IVTA 4K33A 5DEWA 5BVNA 2PZRA 5CSHA 5FLFA 5BUEA 4DH8A 5FTOA 4C59A 3GU8A 1F3MC 1YOLA 4P90A 3UG1A 3JS2A 3MPAA 2QD9A 3F3UA 4XRLA 4ACDA 3V8SA 1OI9A 5JFXA 4D5HA 3Q4UA 2PMNX 3O96A 3FI4A 4E6QA 4CSVA 5A4EA 1JAMA 3PSCA 3ZCLA 4G3FA 3PJ3A 4ZOGA 4AT4A 3LLTA 4BF2A 1WBSA 3T8OA 3QWKA 3HV4A 1PXMA 4JNWA 4D28A 2IZSA 4WHZA 5CENA 2WQNA 5A6OA 2YLFA 3G2FA 1SM2A 4PF4A 4F4PA 4BVUA 5EM8A 2YM4A 4GW8A 3QQKA 5AUXA 3O8TA 4NM7A 4QTBA 1O9UA 2BUJA 3OD6X 4D0WA 4BTJA 5DT4A 5JGDA 2E9UA 4MVFA 4FG8A 4KRDA 4FEXA 4RVTA 4FVPA 2PPQA 5LMAA 5KE0A 3SOAA 4L00A 5GINE 3SV0A 2ZDUA 4KBCA 4EWQA 5KBQA 1DI9A 4PPCA 3A8WA 3DY7A 2G2HA 2YA9A 1E9HA 2YIRA 4FSTA 4CZTA 4M66A 5AEPA 4W4YA 3S4QA 4W8DA 3VBYA 3RK5A 1H08A 4ZSEA 1G8SA 4U5JA 4G3GA 4XNEA 4PDPA 3Q04A 5BUJA 1IG1A 2Q83A 4FTOA 4M0ZA 4QMUA 1FGKA 2JKKA 3H30A 2PMOX 3RAIA 3RNIA 3TZ9A 2HWPA 2QOHA 3SHEA 4H39A 1NVQA 2FVDA 2NP8A 2YIQA 3LZBA 5L2TA 4A7CA 3RHXA 3UYTA 5E8TA 2C68A 4CG9A 3ZC6A 2JLDA 5B2KA 3AT3A 3LFCA 4WNKA 2GCDA 4D2SA 4TT7A 4Q5EA 4ZSLA 3ULZA 4BDCA 4C58A 2B0QA 3KRWA 4CEGA 4OAUC 4OTQA 5HLNA 1P5EA 4EH8A 4IX3A 2C6EA 2DYLA 2WU7A 2XRWA 3DLSA 2GNIA 2W4KA 1IR3A 4X3JA 4IAIA 3W8QA 2IN6A 1SVEA 1IAJA 4EOPA 4IJ9A 5CI7A 3QAME 3LXLA 3VW8A 4JIAA 3NW6A 4MF1A 4XX9A 2WOTA 4DT9A 3UDBA 3ORLA 4UMRA 3BHHA 4LRKA 2R3MA 2YACA 3DJ5A 4J1RA 3MH0A 1H8FA 4RMZA 5AUYA 2OJ9A 3F2RA 3HUCA 2BVAA 1P14A 4FNWA 4WNPA 5K3YA 2Z7LA 5EHLA 3P7AA 5HCYA 4FNYA 4RJ6A 1YWNA 3LE6A 5HBHA 3W2RA 2YCFA 3VIDA 4YZMA 2B9FA 4FG7A 4HZRA 3DOGA 3EHAA 4J98A 4YURA 3NGAA 4OAVB 1GIJA 2H9VA 4KIKA 3OCBA 1U46A 3NRMA 1KE8A 5E8ZA 3Q5IA 3ZDUA 2PULA 3NVKI 1SYKA 2C30A 4MXCA 5IH4A 3AC1A 4QMNA 4BCMA 4AX8A 3R83A 1M2PA 3FQSA 3PVBA 3IKAA 4I6QA 2XK6A 1OIYA 3NUYA 4J7BA 3R9OA 4BN1A 1BI8A 2H8HA 5M4IA 1OPLA 2Y8OA 5DRBA 3SAYA 1ZYJA 5H3QA 5DR6A 4RQVA 5L2QA 2WQEA 2GPHA 4AGWA 3A61A 4ZZMA 3U6HA 2CGUA 5JFSA 2OJFE 4EYMA 4CFFA 3QXPA 5J79A 3FKOA 3NR9A 5J7BA 4JRNA 2ZM4A 2CCIA 4IQ6A 4L3PA 2JD5A 4E4MA 2C1BA 5EW8A 1DI8A 1JKSA 3AD4A 1XBCA 4QMSA 4RWKA 4ZTLA 4FF8A 4QD6A 4D1ZA 4DITA 3E63A 3NUXA 3NYVA 4EOLA 5AA8A 4OTPA 4YPDA 5IA4A 4F6UA 4QTEA 4DE4A 2C0TA 3ANQA 3KN5A 2QLQA 4JDIA 3ZU7A 2CKQA 2ITPA 4GCJA 4DLIA 4BDBA 4DGNA 4BKYA 5C4KA 5AV2A 2QOFA 2W1EA 3A4OX 3TACA 3UNJA 4EOQA 3EIDA 4WUNA 3TZ7A 4JAJA 2WTCA 4X2NA 4WG5A 2VWBA 4C57A 3KFAA 3B8QA 3BYUA 3DTCA 2X0GA 3I0OA 3OG7A 4AW1A 4BWPA 2UZTA 4EHZA 3GEQA 3RALA 4L52A 4ANNA 1FVTA 2Z7SA 3MFTA 3RWPA 2XNNA 3Q52A 4H3PA 3QHWA 2C6KA 2OIBA 4JG8A 4MH7A 4NCTA 5HCZA 5T6KA 1V0PA 5E92A 4ACMA 3HMMA 4AW2A 1XQZA 3QUPA 4EZ5A 5AA9A 4CLIA 5BMMA 2VZ6A 3DBQA 4RWLA 4IAZA 1NW1A 4J8NA 4WD5A 4X3FC 3I1AA 3UO4A 2PUPA 1SMHA 2EU9A 3ACJA 1PXKA 3BE2A 2RFNA 3Q9ZA 5ETAA 3D9VA 3DJ6A 4LYNA 4XLVA 5CU3A 4RIXB 2OH0E 5HNIX 4EUTA 5HZNA 3MH3A 4FT7A 3W2PA 4EZ3A 4LRMA 3VS5A 4JS8A 5EH0A 5FQDC 2C69A 3FY0A 4IM2A 4U80A 4W9XA 2BRBA 4DHFA 3UIMA 4DINA 5CALA 5IA2A 4MXAA 4PY1A 1RW8A 3MJ2A 3C0IA 1OBDA 3PXRA 3UG2A 4PDSA 3I5NA 4NM0A 4BBMA 5FEEA 4YJVA 3CTHA 4QP9A 4C4HA 2FSOX 4EHVA 5I4NA 5HG8A 4M69B 4OTRA 4TPTA 4CFMA 5DE2A 4FSNA 1PYEA 3DZOA 4I4FA 4YSMA 4C3PA 2DWBA 4MWIA 2QCSA 3TXOA 4CNHA 5IA3A 5HEZA 4Q2AA 2C6MA 3AXWA 3OWLA 5LCKA 4PL5A 3TM0A 5BVDA 1OL2A 2O2UA 3AC5A 4RJ4A 2YWPA 5BMSA 2ETRA 5M4UA 4I94A 3U4UA 4IDVA 3UO6A 2OFUA 4RGJA 3U51A 4D55A 3OTVA 3QRKA 3Q53A 4P5ZA 4U97A 3CBLA 3T3UA 2ETKA 1FQ1B 4YPSA 5HQ0A 3ZYAA 1Z5MA 1YI6A 2XK8A 2OICA 3BCEA 3H9OA 4JR7A 2A2AA 3TG1A 2YN8A 4ACCA 4CFWA 2V55A 5EI6A 5FM3A 4U81A 4DFNA 4F0GA 4AE6A 5IMXA 5ETCA 4KA3A 4MD8E 4AOIA 2VTPA 3M11A 4G3DA 2CKOA 2RSVA 3LMIA 2C6TA 5EM5A 1L3RE 4Y72A 1UU3A 3NMUF 5ANDA 4BDHA 2J50A 2Q0BA 2YZAA 2XYUA 1JNKA 3SLSA 2I0HA 5AM7A 2W4OA 3S95A 2A27A 2E9VA 5EW3A 1W0XC 5M07A 1ZMWA 3DKGA 2F7EE 1ERKA 4O22A 4QMOA 3ZRKA 4KIOA 2EWAA 3PA4A 4DBXA 3TCPA 5G6VA 3ROCA 4II5A 1ZLTA 4RIOA 3ERKA 3ZFXA 4FR4A 5E7RA 3S3IA 4JQ8A 4DCEA 5IG1A 3GB2A 1CKJA 1B38A 4UY9A 3VS0A 4C02A 3FE3A 3QD3A 4R77A 3TUDA 4ASXA 3MI9A 2QOIA 3KXHA 3VC4A 4BGHA 4U0IA 2IZTA 1XH4A 2O5KA 4MTAA 3RP9A 3A60A 5FM2A 3QTQA 1Y8YA 4QPSA 4F1TA 2ITYA 4K2RA 3RAHA 4ZLYA 4QP2A 4TYJA 3EN4A 1J1CA 4MAOA 1CKPA 4R6VA 2NNWB 4DTKA 2ITNA 2BDWA 3LFQA 3DTWA 3PVGA 2J7TA 2CLQA 3PWDA 4YC6A 4JBVA 2QOQA 4PMSA 3ELJA 1XJDA 2RFSA 2B52A 3HMOA 4BZNA 4YO4A 4ZTQA 3OUKA 3BX5A 5C8KA 5CEOA 4JX7A 3L9MA 4MX9A 4QMLA 4HYSA 2CN8A 3G90X 4RA4A 2O0UA 2J5EA 2QURA 2WEVA 3KCKA 4FIEA 4BI1A 2OSCA 2J0IA 3FLZA 4IB5A 4CKJA 4FV9A 4NSTA 4QMXA 4GU9A 3ZSGA 5L2IA 4X6RA 1J7LA 4MHAA 5EYMA 4TL0A 4PP9A 4OTHA 5CY3A 4FT0A 4HZSA 2QKWB 3TUBA 3BRBA 4AA5A 4K18A 5EYKA 5HE0A 1V0BA 3PA5A 3LW0A 4O83A 4YJSA 4ZMEA 5M08A 4YZCA 2PK9A 5B2LA 4JI9A 1XH9A 3FZTA 3QC9A 4O0UA 2HXQA 4TY1A 4JQ7A 3Q6UA 3TZMA 3UNKA 2BZKB 5HE3A 4C4FA 1Q8YA 3QCQA 3FLYA 3HLLA 4D4SA 5HNBA 4HVGA 5CT7A 3FHRA 4N0SA 2OO8X 2XIKA 2PVLA 3LQ5A 4XJ0A 4YNOA 2X7FA 3VHKA 3ZLYA 5L8LA 4HJOA 2RF9A 2VNYA 3QQLA 2YM7A 2PSQA 3SRVA 2XZSA 4FKGA 4E4LA 4JXFA 3ORXA 4CTBA 3VN9A 4ENYA 4FKTA 4FSQA 4YZBA 4C2WA 4I92A 4BGQA 3RKBA 4PNKA 5KMLA 3N4UA 4RX7A 1PRYA 1Z9XA 3QZHA 2WO6A 4XUFA 2FA2A 3CQWA 3A2CA 3BYMA 4R5YA 4ZK5A 4BDEA 4BFMA 5AADA 3FLNC 3OUNB 2I40A 4QT1A 4WNOA 4HGLA 4GSBA 1O6YA 2GHLA 2BHHA 4FTNA 1H01A 1REKA 1BYGA 4EORA 3DQWA 4FSMA 1UA2A 4QP6A 3ZZEA 2YIXA 2WHBA 4IMYA 3TNIA 4Y73A 5AR4A 3IG7A 4GUBA 4YU2A 5CAPA 4RWJA 2GQSA 4F7NA 3WYYA 4DG0E 3QBNA 3G0FA 3PUPA 2UZNA 5E91A 4E7WA 3DAKA 3LMGA 3JR1A 3A4PA 4F6WA 2W06A 3NUNA 3VBQA 3QKLA 4C8BA 4EBVA 4H36A 4C33A 4DFBA 3QTXA 2B7AA 4O0YA 3ZO3A 3R21A 5AAEA 4C35A 4I0TA 5E8VA 1ZXEA 4IJPA 4O7ZA 4RVLA 2PVNA 4H1MA 3E8DA 4KB8A 5FWKK 5K5XA 1YKRA 4S33A 3UTOA 2G1TA 2JFLA 3PY0A 4FOBA 3ZUUA 5HVKA 5GZ9A 3H0ZA 4ZP5A 3UVPA 3NIEA 5E4HA 5JT2A 4X2JA 2OXXA 3GU6A 4EK4A 2VO0A 3G33A 5AP7A 5EQPA 4L46A 4A9SA 5CWZA 2XVDA 3ZS5A 3JY9A 1H1WA 3F69A 5IDNA 1PHKA 4FTMA 3PE2A 2OLCA 3MH2A 4Y5QA 5FXQA 3CCNA 3FMJA 1YRPA 4DN5A 3SW4A 5DGZA 2OBJA 2Z7RA 3II5A 4AP7A 4EKLA 4LRJA 3TI1A 4CQEA 3P7BA 2XK9A 2WGJA 4UZHA 4WG4A 1PXJA 3M2WA 1T45A 3UPZA 4A9UA 4QP8A 1FPUA 4GVJA 4DTBA 5M53A 1QPDA 3BU3A 5DOSA 3UIBA 1W98A 4GFOA 1MP8A 2XK3A 5AR8A 3GBZA 5FDXA 4IIRA 3KXMA 3KXXA 2UW8A 4TKSA 4ASZA 4IAYA 4I5MA 5AUTA 3WF7A 4EOIA 1QMZA 4M97A 4RX9A 4BICA 5HBJA 4JLCA 4BIEA 4ZY5A 3QRTA 3TEIA 2RKUA 4C34A 3MW1A 2JBOA 3ACKA 3P23A 5EI2A 4PWNA 2YM3A 3F5UA 4ARKA 5M06A 3C9WA 4DGGA 1F0QA 3OVVA 2BROA 4F64A 3PY1A 2ZOQA 3ZLXA 3H0YA 2FYSA 5D7AA 4W4WA 2V22A 2XK7A 4IC7A 5JKGA 3NLBA 4BWXA 1Q5KA 4FKPA 3TWJA 4NT4A 4MKCA 2ETMA 2W1CA 5HIBA 4ZLZA 4FTTA 4Y5HA 2FSLX 3MSSA 4F1MA 4MXOA 2R3LA 3FL4A 4ZTNA 3UP2A 4FZ6A 4A07A 2J0KA 3FSKA 3VBVA 1GIHA 4U43A 2P2IA 3C51A 1K3AA 2IZUA 3C4WA 4NZWB 4ACGA 3O17A 3R71A 4M8TA 5CF5A 5M4FA 2QO9A 4G31A 3HKOA 5BVFA 3GCUA 4R8QA 4GT5A 4PDYA 1S9IA 4FKSA 2DS1A 4G3EA 2PUIA 5HNGA 1UU9A 2BIKB 3OCGA 4FICA 4NYEA 4ASEA 1H25A 1QPJA 4J53A 2ZDTA 4RIWB 5EOLA 3U9NA 3DB6A 3GCVA 3KL8A 1R78A 5JGAA 5IQAA 1VZOA 4IC8A 3VWAA 5M57A 3HUBA 5AM6A 3E5AA 3OCSA 3REPA 4L42A 3DDPA 5BUIA 2VX0A 3DK6A 4BDGA 3GCPA 3FAAA 2WTKB 3QKMA 4FIHA 4NJDA 2HK5A 4ZSAA 4EH6A 5CVGA 1Q4LA 3NDMA 3CTJA 4V0GB 4EQMA 3EL8A 3PPZA 4NW6A 4M12A 3VO3A 2YWVA 3NW5A 4D2WA 2Z2WA 2IVVA 4F7JA 4FVRA 3AGMA 1OPJA 4PTGA 4DA5A 3AT4A 2IVSA 2QNJA 3MIAA 4FBXA 4FTAA 3VAPA 3WE8A 2XIZA 4O6LA 2OFVA 2VO7A 1UKHA 3G0EA 3KULA 5M4CA 3OROA 4QOXA 5K9IA 3EKKA 5HO6A 4K0YA 3V5TA 3W2QA 4M0YA 5DFPA 4C3RA 4EHGA 5CANA 3HRBA 3QTZA 3FJQE 3M1SA 3ZONA 3NYNA 3D7ZA 3L8PA 2HOGA 2X9EA 3SOCA 3FMLA 4FT5A 3MB6A 3QQFA 1Q97A 4ZSJA 1F5QA 1A06A 2I0YA 2REIA 3EWHA 4FL1A 4O91A 3IW6A 3ZM4A 4FKVA 2JDTA 2PL0A 2QOBA 3TV6A 3FMNA 4DEEA 1P2AA 3C5IA 2YCSA 5JGBA 3KXGA 2JDRA 4MYGA 3UMWA 2J0MB 2W1ZA 3BQRA 4K9YA 5E8YA 3G15A 1Y8GA 4USFA 4U3YA 1U5QA 3PJ8A 3P5KA 4FV4A 2BKZA 2Y0AA 3TIZA 4O82A 3IDPA 1OIUA 2UVZA 2V62A 3OBJA 5HU9A 2IZRA 4ERKA 3R1YA 5BQ0A 4HW7A 5FRIA 1YI4A 2UZWE 4U79A 4YGAA 5E8SA 3V8TA 3UYSA 3C0GA 3HDNA 1GJOA 4G9CA 5H8BA 5HBEA 4AZTA 4BB4A 3C1XA 4FGBA 3B8RA 4GL9A 4L01A 1R0EA 5C9CA 3R9DA 3RI1A 4DEHA 5KKRB 2F57A 4O84A 2BIYA 2R3JA 3CXWA 4FMQA 4Z55A 4FOCA 4FTIA 2QR8A 5IQCA 5DWRA 4RC2A 4MXYA 1WBTA 3GVUA 4FKLA 3VQUA 5IQHA 3GNIB 4H3BA 5CF4A 3DXQA 1Q8WA 2Y6MA 4U45A 4A4XA 2HZ0A 2R3PA 3PZEA 4QMTA 5BPYA 3O50A 3VRYA 4FZFB 4OTWA 3D2IA 4RLLA 2W9ZB 4TTHB 4I6HA 5HIDA 4DH1A 4ENXA 4KS8A 4BCJA 3LKMA 4CKRA 4WNMA 5CSWA 1WBPA 2GNLA 4FK3A 4YHJA 4YP8A 2OF4A 2XF0A 5LMBA 3KN6A 4LL0A 3SGCA 4BDJA 1PMEA 4X21A 2W5BA 4OBPA 1FMOE 3VRZA 5HI2A 2G2FA 4M84A 3ZDIA 2GS2A 3DKCA 4BTKA 3I0QA 3MN3A 2I7QA 4NUSA 1W84A 4ZIMA 3DT1A 5JZNA 2W1FA 1S9JA 4EHEA 2CNUA 3AMAA 4IM0A 4XV1A 5DNRA 2GHMA 5A4CA 1OVEA 2BRHA 3CSVA 1WFCA 2QOCA 3NAYA 4L67A 2FUMA 4LL5A 3LFEA 4EQCA 3EZVA 1Q8UA 3R02A 5BVWA 2Z60A 3FZRA 3W2OA 4QRCA 4D0XA 3KF4A 5T3QA 3ZO4A 5GIOE 3BWFA 4EH5A 1ZY5A 5JH6A 3E64A 5DYJA 4K1BA 3NZ0A 5ANEA 4P2KA 5F4NA 1YHSA 3UVRA 4IFCA 4J99A 5K4IA 2W1GA 3FXZA 1JQHA 4N6YA 1YDTE 3F5GA 5D11A 2JAMA 5EQYA 1FGIA 5IMEA 3VW6A 4EH4A 4RFZA 4IAAA 5LMKC 4LMUA 4YJPA 3AMYA 3TTJA 4JDHA 4EWHA 3P7CA 5AAFA 3R7IA 5HU3A 5M44A 3OWKA 4BCIA 2JIVA 3GFWA 1E1XA 3EJ1A 4UB7A 3GOKA 2CDZA 4QPAA 4RRVA 5CNNA 2B9IA 4JVGA 4MCVA 4GJ3A 3QCYA 3L9LA 5ANJA 4PNIA 1OIRA 4L6QA 3RAKA 3RMFA 3KXZA 4FKOA 3LM5A 2KULA 3W18A 5CF6A 1P4OA 3O7LD 4WBBB 1CKIA 4F7LA 4I0RA 5L2WA 4K8AA 2WXVA 4AXAA 2XUUA 4CCUA 5K4JA 3U55A 3FMDA 3HA6A 5BYYA 2GS6A 4QMPA 3BBTB 4D2TA 4M68A 3JY0A 3AT2A 2C6IA 3F2NA 3VUGA 3O7LB 5F1ZA 3A99A 4O38A 5IEVA 2F4JA 5ETFA 3HECA 4F0FA 5HESA 3RZBA 4I3ZA 4NTTA 5HE2A 5KO1A 2PHKA 5DT0A 2YEXA 1RDQE 2W5AA 2WIHA 5FEQA 3KC3A 4GYIA 2X39A 3P0MA 2QODA 1BKXA 3Q96A 2BAJA 5GJFA 5D1JA 4IDTA 2VTIA 3MYGA 3OOMA 5KX8A 1UNGA 4HCUA 3RPYA 3UE4A 5ANKA 1PJKA 4BIBA 1SVGA 4EEVA 3DKOA 2XIYA 2O65A 4FV1A 5EYDA 4D2PA 5IA1A 1OECA 1EH4A 2V0DA 4GS6A 2ITUA 3RK9A 3SX9A 3DZQA 3LVPA 1YDRE 4DLJA 3E62A 2JITA 3E88A 5LQFA 2GSFA 2X2LA 2ZMCA 2A4LA 3CEKA 3V6SA 3CPBA 3ATTA 3D14A 3FQHA 4D9UA 3KVWA 4KIKB 1H4LA 4FC0A 5CQUA 4F9WA 5AAGA 5M55A 5ITAA 3MGYA 4X6QC 4E6CA 5I3RA 1J7IA 3DAEA 4RIYA 4BYIA 4MD7E 4YR8A 4QMZA 1H1SA 2NPQA 4FSZA 4RIXA 3PWYA 2ITVA 5L6WL 3NVMB 2AC3A 4KIPA 4ALWA 4E93A 4UWBA 1H26A 3IQ7A 3VUIA 3I7CA 1OKVA 5ACBC 4L7FA 3TNPC 3BEAA 4V0GA 5H2UA 3A62A 2C6DA 3NNVA 4AS0A 1TQIA 3MPMA 4BRXA 2BZJA 3MFRA 4JQEA 2LAVA 4D1XA 3DV3A 4Z9LA 3C0HA 3PP1A 4AT5A 4H1JA 3KVXA 2OZAB 2VWXA 4NW5A 2GS7A 2ITWA 2Q0NA 3LQ8A 3R0TA 4MNFA 5JQ8A 2IWIA 3U8WA 1Q41A 5CLPA 5IQGA 4UXQA 4MQ1A 4ALUA 2OH4A 3KK8A 3FZ1A 4G6NA 3QYWA 1V1KA 2VWYA 5LVMA 4IX5A 4W9WA 2OXDA 2WELA 3IGGA 3OY3A 2GFSA 3KRLA 4QQ5A 5JK3A 1CM8A 4FSRA 2X8EA 5EG3A 5A14A 3NUSA 1U59A 5L2SA 1X8BA 2BALA 2ZMDA 3MVLA 3FMKA 3HMPA 5DMZA 4GG5A 4QQTA 3LXNA 4XEYA 5CAUA 3S0OA 2XRUA 4L68A 1VYZA 4NFMA 4EI4A 3U87A 1M7QA 2ZYBA 3F5PA 4X3FA 2I6LA 3VHEA 2JKMA 4TRLA 3ZSIA 2X6EA 5CU2A 1Q3WA 3R04A 4ANLA 3A7JA 5I5ZA 2F9GA 2HZIA 4OGRA 4MBLA 5AX9A 4A9YA 2WTVA 4C4EA 5DG5A 3HZTA 4W4XA 5F9EA 4ZMFA 3IW8A 5AP4A 1WMKA 5AP0A 2CHLA 1CSNA 3UQGA 3VF8A 4QP4A 2WMWA 3ORPA 4EKKA 4EOKA 4RLKA 3ZLWA 3CQUA 3MJ1A 3MDYA 2F7ZE 3TN8A 4DGMA 2FO0A 3COKA 5EOBA 2UW4A 2PE2A 5EW9A 4R3PA 5D10A 4ZTHA 2XBAA 1XKKA 5LOHA 4F99A 1YOJA 3QX2A 5EDQA 2XJ1A 3RJCA 3Q6WA 1MRYA 5L8KA 3NPCA 4IWQA 2WMQA 4B7TA 4B9DA 4HYUA 4QPMA 1SNXA 4O2PA 3TIYA 4QP3A 3W33A 3EQBA 4EH9A 2YZLA 4WKQA 1UKIA 5FXSA 4GT4A 3V3VA 4FKRA 2ZV9A 4PMPA 4IWOA 4KBKA 5K5NA 5GZ8A 1JSUA 1RJBA 1PXPA 2IO6A 5HHWA 2R3RA 5LVPA 5H9BA 2F2CB 4D5KA 5HGIA 4DYMA 2WU6A 1LUFA 3OW4A 5AV4A 1KOAA 2VTMA 3R9RA 4FV3A 2BFYA 4UMQA 5IKWA 3F61A 1XH6A 2EVAA 3GU5A 4EK5A 5HVJA 3PDTA 4F7SA 3Q2MA 3MH1A 4KAOA 4AACA 3FEGA 1O6LA 1KV1A 5KCVA 4XP3A 3OCTA 3L8VA 1IRKA 4ZS0A 2QR7A 2I0EA 2Z7QA 3WF8A 3S2PA 2GNHA 1YI3A 3OOGA 3IW5A 1J91A 3CY2A 3JPVA 5AUZA 3T3VA 3A7HA 4FV8A 3QGYA 3O71A 2H34A 3FXWA 3K3IA 4JRVA 1HOWA 4R7IA 2BDJA 4G6OA 3DLZA 3I7BA 5E90A 3ZH8A 4CMUA 4C37A 4FTKA 3PA3A 2AUHA 3HV3A 4QTCA 4L8MA 2NRUA 2EB2A 2OKRA 4FEVA 3ETAA 5EM7A 2RGPA 2VTAA 4HGSA 5H8GA 4BDIA 4RQKA 2JGZA 3DBEA 4DG2E 4O7RA 4ZJJA 4U8ZA 4O0RA 4JDKA 5M09A 2PVRA 4UMPA 2H6DA 2XYNA 4XOYA 4MNEB 3DXPA 1K2PA 2ZAZA 1VJYA 2IJMA 1CDKA 4E20A 3OXZA 4Y46A 4OTGA 1FOTA 2XJ0A 3UPXA 3TDWA 1UVRA 3QQGA 3QL8A 5H8EA 2BDFA 3KXNA 2W96B 3PXYA 4TNDA 5IH6A 5E1SA 5JQ5A 3E8NA 4RC3A 2XEYA 3ZLSA 4E5AX 3W2SA 4KSPA 4U44A 5IEYA 4UWYA 3F3ZA 3SXRA 3D5XA 5CSVA 5FDPA 3ZRMA 1ZOGA 3K3JA 5TOZA 1SNUA 4JBOA 3JYAA 3QGWA 4IAKA 3VS7A 3LJ1A 2J4ZA 4R1VA 3ENMA 1R39A 3FUPA 2I1MA 3Q9XA 2WTKC 3W10A 4LI5A 3W2CA 3ORTA 4EYJA 2YAAA 5D41A 2R3GA 2PE1A 3IDCA 2CKPA 2PMIA 5HG7A 5EHYA 5C26A 2JAVA 4XH6A 4Y85A 3UNZA 5CT0A 1B39A 3C7QA 5DBXA 3F3VA 3R28A 3IDBA 4FEQA 3VS2A 4DEBA 5JN2A 1YWVA 3MWUA 3VUMA 3Q32A 3RNYA 3LCTA 3I81A 2GDOA 2SRCA 3ZFMA 5HD4A 3DBDA 4AW5A 2Y4IB 4U42A 5LVLA 4HYIA 4RFYA 5CU0A 5CSPA 3R7YA 1KUTA 3HAMA 2R3IA 2WMSA 3IOPA 2PVJA 2VGOA 4FV7A 4H3QA 1JSVA 4YBKA 5CZIA 2C3JA 2VTLA 4GK4A 4WRSA 1YXTA 3PP0A 5AUUA 3PXKA 3R6XA 3R7GA 3LIJA 4QNYA 3UZTA 4YLJA 3KCFA 1J1BA 4TZRA 3NUUA 5DT3A 2UZVA 5LARA 4CRLA 5HTCA 1IA9A 4OW8A 3V5LA 5JSMA 5CSXA 2LGCA 4IX4A 3R7UA 2XKFA 4R1YA 4FYNA 4NIFB 1KE6A 2V7AA 2YDJA 3D83A 4NJ3A 4BKJA 4EZ7A 4AOTA 1OUYA 3E87A 5C01A 3MPTA 3OT8A 4FTJA 3E92A 2EXEA 4U9AA 3H9FA 4YJUA 4RIYB 2BRMA 3VNTA 4BIDA 4HVHA 5I9UA 2GNFA 2W05A 2WMXA 3GCSA 3EQGA 2BAQA 2CGWA 2VTRA 3K54A 4AZEA 3NYOA 4G5PA 1AQ1A 4DH5A 3KB7A 4JJRA 3PVUA 4FIJA 3BHUA 2BAKA 4AFEA 4D1SA 3W16A 5BVEA 3GI3A 3LQ3A 4O7NA 5HE1A 4S31A 3DBCA 3QD2B 4EOSA 1GIIA 4FKUA 2C3LA 4ZY4A 4IW0A 3E8CA 4YBJA 5HO7A 4NK9A 3LJ2A 2ESMA 2OIDA 3KQ7A 5AP2A 4O7SA 2UW0A 1URWA 3RZFA 4H05A 2OZAA 4C2VA 4PMTA 4RJ7A 1UNHA 3GOPA 3MVMA 2GQGA 4AN9A 5C1QB 2J9MA 3S1HA 3AGLA 3PIXA 2W9FB 4XHKB 3HP5A 1WBVA 2QC6A 3WE4A 3QF9A 1Q61A 4PUZA 3QFVA 4G1WA 3VJNA 5GHVA 2WMTA 2QOOA 5CVFA 3D5VA 4AZWA 4YC8A 4LQMA 4F9BA 4ZZNA 3L9NA 2JIUA 3RVGA 4FIFA 4CT1A 1VEBA 5DLSA 4J95A 3A8XA 4UMTA 2VWZA 4IXPA 3FLSA 3GU4A 4DTAA 1W82A 4JL9A 4PDOA 3EQCA 5CAQA 1ZMUA 4QQCA 4IVDA 5KZ0A 2PZYA 3V8WA 3WZEA 4CMOA 4KINA 2W0JA 5BX0A 4K11A 4X3FB 3VS6A 2GFCA 5L3AA 4D58A 3SVVA 1W8CA 3AC8A 4RT7A 4KIQA 4LMNA 2KTYA 3DGKA 3BKBA 1FVVA 2BZHB 2QHMA 2R9SA 2VN9A 2YCRA 3QRIA 4MD9E 4APPA 4KKHA 3G6GA 4PP7A 3TKUA 2CCHA 2IW8A 2RFEA 2VO6A 4R3RA 1ZRZA 5A4TA 3UOLA 1STCE 4FEWA 2QOKA 4PMMA 3VUHA 5EQEA 2HIWA 5AUVA 1GZ8A 1HCKA 4APCA 4BZDA 4YSJA 1APME 3LJ0A 3SQQA 5KNJA 4O6EA 2BZIB 3CC6A 4QYHA 2VWWA 2GQRA 4F70A 3D2KA 5FG8A 2XKDA 3R8PA 1H07A 3LCKA 4AAAA 5HX8A 2J0JA 3HRFA 3PE1A 4YZDA 4GK2A 3EFWA 3P1AA 4FA2A 2XKEA 4C4JA 3QTUA 1JVPP 4KSQA 4FODA 3QTSA 4RC4A 3O0GA 4Z3VA 5IUGA 5HTIA 4MNEA 3R8LA 5FXRA 3BLHA 2QONA 3UQFA 4EBWA 2OGVA 2W17A 3VS3A 4EJNA 3ZXTA 5AWMA 4ORKA 5IA5A 2XNOA 4AZFA 3V04A 5DEYA 2QKRA 4IVAA 4RG0A 1ZAOA 2XNBA 3ATSA 3M42A 3AC2A 2P2HA 3QKKA 4ZXTA 2FB8A 3KULB 4CZYB 4AGCA 4BI2A 4NM3A 3R1SA 1G8AA 4CFVA 3COIA 1Q99A 1OGUA 4YTFA 3SW7A 3P4KA 2B1PA 4E26A 2RG5A 4UX9A 4C36A 3OC1A 4BTMA 4E4XA 5FUTA 4QQJA 4J71A 2BCJA 3MESA 1PY5A 4I1ZA 4FKWA 5EHOA 5FP5A 4I5CA 3KK9A 4YZNA 4A06A 4EC9A 2YERA 4I24A 4OT5A 4LFIA 2EXMA 3CGOA 3R8MA 4FKQA 4QYYA 3NNXA 4HGEA 3WZJA 1OUKA 4IBMA 4C4GA 2VWUA 3HAVA 5BVKA 1NVSA 4PPAA 3MY1A 1CMKE 1JWHA 1Q62A 4TN6A 4X0MA 2UV2A 3DPKA 3BGQA 4JAIA 3EQIA 2WTJA 1M2QA 4V05A 5E8XA 4AT3A 4ZJVA 4ANMA 3V5QA 3SA0A 2EXCX 3BIZA 4R5SA 3L9PA 1B6CB 3W32A 4KS7A 1K9AA 1PMNA 4QTAA 2ZB1A 1H27A 4CFXA 2WQBA 4E6AA 3N9XA 3UBDA 2BPMA 3QTRA 2FGIA 3W8LA 5AIKA 5I9WA 4UYAA 4C61A 3NYXA 3ZBFA 4BCNA 4CYJA 2OK1A 3THBA 4KBAA 3LFSA 3C50A 4GT3A 4XG6A 3ORKA 4AZSA 4CXAA 3ULIA 2XNGA 2C5VA 4B6LA 2QHNA 4NL0A 1LPUA 2W1IA 4C38A 2B9HA 2B9JA 4MK0A 3D7TB 3R1NA 1OB3A 2YABA 4FIIA 3MA3A 3RM6A 4R7BA 2W5HA 3H9RA 4N4SA 3QCSA 1FMKA 3CS9A 3V5PA 3F7WA 5CYIA 3R2YA 5DRDA 4DFLA 2BMCA 2YCQA 4TYIA 4RJ5A 1WVYA 5K0KA 5LVNA 2JDOA 4NKAA 5CX9A 5GZAA 4R78A 2X8DA 3PXZA 4LGDA 2OJGA 5BYZA 4IEBA 4KUJA 4FL3A 1GNGA 3Q4ZA 4FT9A 4I41A 3VUDA 3FLWA 3LXKA 4TWPA 2RG6A 3HL7A 5E9EA 2W1HA 2WTDA 4FSYA 4J52A 1MUOA 2WFYA 5EI8A 4UALA 3BU5A 2XNPA 5KHXA 5JRSA 1Q8ZA 4XP0A 3AC4A 4QMVA 3FZOA 5DIAA 5FTQA 3FL5A 1YOMA 2R2PA 3DDQA 2UW6A 3QUDA 5FP6A 4U3ZA 4E5BA 1J7UA 2E9PA 3FQEA 4GKIA 2G15A 3LCSA 3RCJA 3TNHA 2YM5A 5BYLA 4IADA 3WZUA 2C5OA 4B99A 4CCBA 3QA8A 3IO7A 4AE9A 2XB7A 4XCUA 1GY3A 1Y6AA 3TV4A 2X6DA 4O7YA 3MV5A 3UP7A 3COMA 3RCDA 4L3LA 4C0TA 3FC1X 4V01A 4XG7A 4F0IA 2DQ7X 4AG8A 3QWJA 2XIXA 4BI0A 3JXWA 2UZEA 5JMSA 4RVKA 3F5XA 5JFWA 5F94A 4BDDA 4IM3A 2R3NA 2YDIA 5J9LA 3O8UA 2WTIA 2ZVAA 3KRXA 5KMIA 3L8XA 3MTFA 3K2LA 4AQCA 5IH5A 3BGPA 3WIKA 3DQXA 3BV3A 4R7HA 5ANGA 2PE0A 1UV5A 3DS6A 3QC4A 4UV0A 3QCXA 1UU7A 3BV2A 2F2UA 2XEZA 4DAWA 1XO2B 5J9ZA 3WF6A 2VTHA 4M69A 4N70A 4IZ7A 3W55A 1FBNA 3QLFA 5HLPA 1TKIA 3PSBA 3TNQB 5B7VA 3C4FA 4UXLA 4YJOA 4J8MA 4AOJA 5FTGA 5DA3A 4XMOA 4XG4A 3HYHA 3FI8A 4CT2A 3I6UA 3LAUA 3BYSA 3CJGA 4YJNA 3KF7A 4BCQA 3IK3A 2Z8CA 4KRCA 4EK8A 2AYPA 2JDSA 3RGFA 3LFAA 2RIOA 3FI2A 3R22A 3VUTA 3F3TA 4ASDA 3BE9A 3BGZA 3BQCA 4X2GA 3Q4TA 4MXZA 4BDAA 3H10A 3G9LX 2R4BA 2HZ4A 2JIIA 3NAXA 3TDVA 3E3BX 1ND4A 3RHKA 4F9CA 3DAJA 4IB0A 3R7EA 3C4EA 3OF0A 3RINA 4CD0A 3T9IA 1XH7A 3ALOA 2PVYA 1VR2A 2VD5A 4A9RA 3CPCA 4XS2A 5DR2A 3FMEA 4DEGA 1ZYCA 4O2ZA 3LFNA 2C0IA 3OFMA 3CD3A 4O0XA 2WAJA 3BHTA 4M15A 1OBGA 5AP6A 1JSTA 4TWOA 2PVKA 4BCPA 1XWSA 3N4TA 3ZTXA 2E9OA 3GC0A 3OWPA 3MB7A 4QMYA 2C47A 4CMTA 4FKJA 2PU8A 2VWVA 3PRIA 2YM8A 5AV1A 5CVHA 1XR1A 1JOWB 3PPJA 4QYFA 2WMVA 4RX8A 4CQGA 4MBJA 3LXPA 3R8UA 5I9VA 3RPOA 4JR3A 4AF3A 3ID6C 5I9ZA 4F65A 1I09A 2A1AB 1OMWA 3C13A 4PPBA 3SG9A 4WIHA 4CRSA 4LOQA 3GFEA 4QMWA 4EH2A 5LMKA 5ETIA 1E1VA 4PTCA 5JFVA 1YHVA 1BLXA 3ENHA 3KA0A 2WTWA 3CJFA 3KRRA 4HPUE 4TYGA 1OKZA 5HX6A 5IQBA 4C7TA 1WVXA 2GMXA 5ACKA 4BCHA 4I93A 1OL1A 3AQVA 2NO3A 1Y57A 2PVFA 3V6RA 3DBFA 4I20A 3IW4A 1OL7A 2YITA 1BUHA 3ODYX 4FKIA 4DT8A 2CMWA 1DAYA 4NH1A 4TW9A 3CIKA 5GJDA 5IQFA 5B0XA 2HXLA 3I79A 3U6IA 1YXXA 1M52A 4D2RA 2P55A 5JEBA 4K77A 1W83A 5I0BA 3UC3A 5AMNA 5C4LA 2XK4A 3HV5A 3COHA 3U4WA 1U5RA 3ZEPA 1H24A 5LWNA 5BNJA 5FEDA 4TYHA 2X7OA 5J5SA 3CE3A 3UO5A 3R01A 5EFQA 3FY2A 1U54A 3SD0A 3HEGA 4BDKA 5IUHA 3FPQA 4EONA 3MFUA 2Z02A 4AZVA 4S2ZA 4AN2A 1AD5A 4KKEA 3SRVB 2C1AA 2WD1A 2Y4IC 3FV8A 3ORMA 3LCDA 5EKNA 4PL4A 3QD0A 5CI6A 4A4LA 5A4LA 4FTQA 3LM0A 3NNWA 3LFDA 4PL3A 5KUPA 2XCKA 5K0XA 1J3HA 4QTDA 1NY3A 4BR3A 3VULA 2VTSA 4GK3A 5TF9A 3IPHA 4ANQA 4XBUA 2CNVA 5HORA 2HAKA 2CN5A 3FC2A 3QZIA 4GFMA 4L7SA 5L6PA 5C8NA 1JKKA 4YHTA 3DXNA 3NX8A 4FL2A 1OM1A 1PXNA 2YM6A 2GU8A 5J5TA 3EQPA 2B4SB 1M17A 2HW7A 2Y4PA 2WPAA 4HVIA 4O0TA 4RSSA 2VNWA 5HVYA 4O7LA 2WZJA 3NUAA 3P79A 5A46A 2IVUA 2WB8A 1HCLA 4FGRA 1PYXA 4DH3A 2OG8A 4NU1A 1IASA 3KMUA 4EOMA 4RPVA 4EC8A 1XBBA 2UVXA 5FD2A 4YJRA 3BLRA 4B8MA 1JBPE 4S34A 4WBOA 1ZMVA 3NCGA 1UU8A 1QPEA 4IACA 2ITZA 5AUWA 4N57A 3PYYA 5DVRA 4A9TA 3ZXZA 2C3IB 3ET7A 4G16A 4RX5A 2X81A 5J8IA 3R8VA 3PRFA 4AGDA 5LWMA 3TUCA 2ZV2A 3GENA 4YO6A 1WVWA 4E3CA 1YXSA 3KU2A 4YUQA 3F88A 3MY5A 4DFXE 3ANRA 2C6OA 1H0WA 4FTCA 4TWCA 4ITHA 4ZTMA 4I21A 2WQMA 2XH5A 2Y7JA 1BX6A 3FBVA 4CV9A 4N6ZA 5HKMA 4DEAA 2QVSE 4D9TA 1JPAA 2CGVA 2P3GX 3DNDA 4J97A 1A9UA 4FI1A 5L4QA 2BTRA 5AR3A 4PQNA 2J2IB 3QTWA 1WCCA 4WOVA 3F66A 5IQIA 3F6XA 3R7VA 4BTFA 3TL8A 4WT6A 4M14A 4GH2A 4AUAA 5C27A 1XH8A 4I0SA 2XBJA 4O1PA 5AP3A 3ZSHA 4USEA 3FZSA 3OZ6A 4UYNA 4YLLA 2J6MA 3C4ZA 2C5XA 4TNBA 3Q3BA 4E5WA 5KMNA 1Z57A 3I6WA 4RZWA 3MTLA 4RA5A 3ZHPC 4CZUA 3ALNA 4YHFA 3VF9A 4CKIA 4LG4A 1IEPA 3U9CA 3WOWA 2OI4X 1YXUA 3CR0A 3LHJA 4ZAUA 5L8JA 4AN3A 3V5JA 3FMMA 3VS1A 4JT3A 5CXHA 4ZJIA 1OIQA 4P7EA 5GJGA 3GGFA 3GUBA 5HG9A 2V7OA 2BFXA 3OW3A 1MQ4A 4PTEA 4CLJA 1H00A 4FEUA 3JVRA 1U4DA 3ZUVA 5AFVA 1DM2A 3PIYA 1G5SA 4MEDA 3TV7A 5CAOA 2G2IA 3PJ1A 4JG7A 4L53A 5AP5A 4CYIA 4XYFA 2EUFB 3MY0A 5D7VA 2BTSA 5HICA 2YAKA 4LUEA 5JRQA 2UW3A 2ZM1A 3WZKA 1XBAA 2ACXA 3E3PA 3UGCA 4BZOA 2PUUA 2F49A 2X7GA 1YW2A 2HENA 3VBTA 4V04A 2R0UA 4L3JA 4OUCA 3POOA 5L6OA 5TT7A 2ITQA 4UMUA 2AC5A 4M67A 2R0IA 5JZJA 4FE2A 3MA6A 3FMHA 3BBWA 4ZLOA 3GP0A 4AFJA 3QTIA 1L8TA 4GKHA 4YJQA 2VWIA 2VRXA
chains in the Genus database with same CATH superfamily
3UOKA 1CTPE 1Q8TA 2E9NA 1MRVA 5J95A 5KMOA 1KOBA 4XG9A 5CTPA 4A4OA 2XNEA 4G2FA 4IAFA 4FNZA 4HNIA 1U54B 3HNGA 5TKDA 3Q2JA 2YISA 2WQOA 4F63A 5AJQA 2HZNA 4FTUA 4IX6A 2X9FA 3E93A 4LOOA 3NFGB 3NFFB 4BWKA 4UWCA 2QO7A 1Y91A 2IG7A 3ZMMA 5CQWA 1Q3DA 5DI1A 5CU6A 3DU8A 1ZZLA 3C4CA 3F9NA 1DS5A 4ZSGA 3R7OA 2CPKE 3TKIA 1ZOEA 3HMIA 5EM6A 3VQHA 3QZFA 4O96A 2W1DA 4AW0A 1XMLA 4B8LA 3BEGA 3TTIA 3QXOA 3MVHA 3P9JA 4G5JA 2R7IA 4WSQA 3RAWA 2GNGA 2HW6A 4Z16A 2C3KA 2X8IA 2ITOA 4BCKA 4M7IA 3TJCA 4F9AA 1NXKA 4G6LA 2QG5A 5IQEA 2ITXA 4ANBA 2VTNA 4E4NA 4WUAA 3DA6A 4L44A 1YQJA 4O0SA 3LFBA 4LM5A 4DHZA 1NA7A 2X4FA 4K6ZA 5AIRA 3BELA 2UW7A 4IANA 5KMKA 2OJJA 3R30A 5GNKA 2WMBA 4WSYA 1BMKA 4NWMA 4TYEA 5IA0A 5A3XA 3O8PA 4U6RA 3UZPA 3ZM9A 2VGPA 3RPSA 3WBLA 3ZFYA 3NSZA 3O23A 4AAYA 3OS3A 2BKKA 1SVHA 3QQHA 3UIXA 1P4FA 3D0EA 4Q5HA 1M7NA 4EOOA 3QUEA 3GC7A 1IAHA 1PKDA 3OBGA 3NIZA 5AV0A 3ZZWA 4F09A 4XOZA 3NCZA 1OZ1A 2ITTA 4HGTA 3QHRA 3SG8A 4EH7A 4Y83A 3TKHA 2UZUE 5J7HA 3R9HA 5J87A 3OT3A 4FSWA 3MS9A 4GFGA 3ZBXA 3EH9A 4D2VA 1OKYA 1H0VA 5BVOA 4GUEA 2UZLA 3AD6A 2GHGA 3Q9YA 1KV2A 4P5QA 1ZARA 2WNTA 4NIFA 4IVCA 5CZHA 3R2BA 2EB3A 2FH9A 3HGKA 3U6JA 5KMJA 4ZY6A 3EOCA 1OL5A 4ZEGA 1YHWA 2I0VA 4YNEA 5F20A 4Q9SA 4HPTE 4BC6A 4O1OA 5CAVA 2XS0A 4BY9E 1LEWA 1YDSE 3U54A 4DC2A 4F6SA 2O3PA 4NCTC 2NRYA 2Y6OA 3FPMA 2QLUA 3POZA 3Q9WA 5ANOA 4ZTRA 4DH7A 3T9TA 3EYGA 4G9RA 2R3FA 4HYHA 2PVHA 3NEWA 1NT2A 1XHAA 5ICPA 3FDNA 2PUNA 2XA4A 4IWDA 3AMBA 2A0CX 3AG9A 1ZYDA 3QRUA 3ZO1A 4F08A 5IU2A 1MRUA 3BWJA 2QOLA 3BLQA 4XG8A 2YLEA 3FKNA 4GV1A 2G01A 4C62A 3F2AA 2YIYA 4WRGA 4FV0A 4DFUA 4FG9A 4TXCA 2WEIA 3NWWA 4C3FA 2R3QA 3SXFA 2CLXA 3N51A 3PIZA 3Q60A 5KZIA 5D12A 4Q9ZA 4WO5A 4DFZE 2RFDA 3PXFA 5A4QA 3ORIA 2CSNA 3SDJA 1PXLA 3OWJA 2DUVA 5FGKA 4GIIA 1ZZ2A 5IDPA 3DFCB 3QRJA 2XMYA 2GTMA 2YJRA 3EL7A 3LCOA 4RJ3A 3I5ZA 3WARA 3UOJA 3PJCA 4O7TA 4HCVA 3H3CA 2BHEA 5J9YA 4OR5A 3N4VA 3PLAE 4IZYA 1R0PA 4ZTSA 4YTIA 3B2WA 4GJ2A 4HCTA 4TWNA 3IS5A 2PMLX 5DHJA 2JFMA 2PZPA 4TYHB 3DK3A 4Y95A 4RJ8A 1LP4A 3EN5A 2WMUA 2Y9QA 1H1PA 3QQUA 3TT0A 4DGLC 3QQJA 4OLIA 4ID7A 4S30A 3WZDA 3OP5A 2XM8A 4ANSA 3PFQA 1Q24A 4MQ2A 2JBPA 3I4BA 4RWIA 3WI6A 5CASA 5KHWA 5HD7A 4FV5A 3RPVA 2WKMA 1YWRA 4QP1A 3WYXA 1M2RA 3B2TA 2OZOA 2JC6A 4X2KA 4X7QA 5J1VA 1ZY4A 3BYOA 4KD1A 5IUIA 3UDTA 1SZMA 4EOJA 4MWHA 5CEMA 2W7XA 1QCFA 3QLGA 5AR5A 4YC3A 2YHVA 1UWJA 3UJGA 2O8YA 3CKWA 4YMJA 5HG5A 3EZRA 3A7FA 3IGOA 4JIKA 3FI3A 2PYWA 3CKXA 3EFJA 1WAKA 3NNUA 3PJ2A 2P4IA 3KKVA 2R3HA 3PZHA 4UBAA 5KBRA 2VO3A 2X2KA 4EQUA 3PG1A 4BCOA 4ZZOA 4O86A 4EJ7A 3UODA 3CP9A 3R8ZA 4DCAA 2YDKA 4FUXA 2BRNA 4PV0A 1JKTA 4EL9A 4I5HA 3HP2A 3F3WA 4IZ5A 4XV2A 2XIRA 3Q4CA 3NW7A 3EN6A 3GXLA 3OMVA 2XCHA 2UW5A 4ITJA 1G3NA 3H4JA 3KRJA 3EQDA 5A6NA 3O51A 2XANA 3BYVA 1LR4A 5AP1A 2IW9A 5E1EA 1GZKA 3UQCA 3G5DA 3FYJX 3EQHA 4O81A 2HWOA 5GIPE 3WILA 4OTDA 4CTCA 4Z7GA 1MQBA 5CEPA 4DF3A 1NVRA 1RE8A 2CJMA 4HVSA 4YLKA 3BZ3A 3BU6A 5M56A 5CEQA 3F82A 4RVMA 3E7VA 3ZC5A 4UEUA 2R7BA 2H96A 3D15A 3DK7A 3C5UA 3R63A 4XV3A 5DH3A 4FJVA 4FUYA 4ONAA 3DCVA 4GYGA 3IECA 4I5PA 3LMHA 5KMMA 4XG3A 5CEIA 1OKWA 1XH5A 3JUHA 3WIGA 4JX3A 1LEZA 3O2MA 3V51A 3EMGA 3MFSA 5D9HA 3R73A 2R3OA 3CQEA 4I6FA 1H1RA 2OIQA 2O63A 3FHIA 5E8WA 1RQQA 3DJ7A 4AA4A 4E6DA 4BCFA 2WMAA 4YZ9A 2UZBA 2J0LA 1BL7A 5IEXA 3DNEA 3PVWA 4U7ZA 5CS6A 3FSFA 4B0GA 2VTOA 4J96A 2IW6A 2J51A 3ZOSA 4U41A 2PWLA 4GEOA 3GCQA 3SC1A 2CKEA 3ZO2A 4AA0A 5AX3A 3V01A 3BI6A 5EK7A 4FNXA 5TE0A 3D5WA 4L43A 3FZPA 5DN3A 4O0WA 3KMWA 3OEZA 4KNBA 4ACHA 2BILB 4EH3A 5HOAA 3IONA 3KGAA 4AWIA 5KKRC 4ALVA 2QI8A 2PZIA 1KE7A 2ZJWA 4GIHA 2JKOA 3VVHA 4D4RA 3ORNA 2QU6A 3HV6A 3I60A 4DEDA 3CTQA 2FSTX 2F7XE 2JDVA 5A54A 3FLQA 2HY81 1GAGA 3MIYA 5DR9A 4I22A 4BHNA 1FVRA 4I6BA 3UC4A 2OWBA 3PG3A 3A7GA 4XP2A 5EKOA 4ERWA 3HMNA 2UVYA 4BL1A 4BYJA 4QP7A 4NM5A 2YJSA 3PXQA 4HNFA 1WBNA 4KKGA 1ATPE 4NKSA 4AU8A 4OTIA 4OBQA 4DGOA 3EFLA 4JDJA 4JOAA 3ITZA 4L9IA 4AGUA 2OXYA 4I4EA 3SXSA 1AGWA 4E1ZA 1JLUE 4KWPA 4MF0A 5I3OA 3D5UA 2JKQA 4LGHA 4XLIA 3TZ8A 2UZDA 3MVJA 3QZGA 5IQDA 3W1FA 3EN9A 3PLSA 1TQMA 5EDRA 2X2MA 2C5YA 3K5UA 4FV6A 1OITA 4CGAA 3GU7A 5AR2A 5FBOA 5C8MA 3LFFA 4RBLA 2R64A 3G9NA 4FZ7A 3CD8A 3RWQA 4IB3A 1URCA 2A19B 3OXIA 1GOLA 4FV2A 4GU6A 4FTRA 4LDTA 2IPXA 3P78A 5TR6A 1VYWA 2QQ7A 4GRBA 3VJOA 1V0OA 4GVAA 3D7TA 4XG2A 1FINA 2BR1A 2GNJA 2OF2A 2VX1A 5G1XA 3QA0A 3UIUA 4PX6A 3ZEWA 1BI7A 3GQLA 3KMMA 1TVOA 4BCGA 4QNAA 5B2MA 4WG3A 5HLWA 3ODZX 1R1WA 1WZYA 4XRJA 4CFNA 2ZV7A 2FSMX 4F9YA 5M51A 1TQPA 2PY3A 3EB0A 3KY2A 2VTTA 4D4VA 3UVQA 5CXZA 2HCKA 2PVMA 2XKCA 3LLAA 3V5WA 1GZOA 4QYEA 1H1QA 3CLYA 3OEFX 4U40A 5CF8A 4IHPA 3R1QA 5E8UA 4RZVA 2W4JA 2X1NA 4FZDB 4G3CA 5FBNC 2VTQA 3UZRA 3R9NA 2HELA 4NFNA 4UZDA 3AD5A 3ZRLA 4E8AA 1VLRA 5IISA 2OJIA 3FKLA 4HOKA 3BPRA 3EQFA 1REJA 5LJJA 1PXIA 2YFXA 3PPKA 3QYZA 4LV8A 4CVAA 4O7WA 1UNLA 4G17A 3BHYA 4XV9A 3QU0A 3EKNA 4B4LA 4JG6A 5ANIA 2P0CA 4P4CA 4GMYA 4Y8DA 4WA9A 5CNOA 4MXXA 5EDPA 3RK7A 2C5NA 2J5FA 3HA8A 4FYOA 3HVCA 2BRGA 4IZAA 5LVOA 2YIWA 2P33A 4S32A 3A7IA 4ZS4A 2PZ5A 3PTGA 2ZB0A 4FT3A 4G34A 2AEGA 3VS4A 3C4XA 2XJ2A 4IE9A 1ZWSA 4YTCA 3AOXA 4KABA 4D4YA 3QX4A 3WF5A 1JKLA 2ONLA 4IB1A 4LGGA 3L8SA 4O27B 3UMXA 5IZFA 5LCJA 2W99B 4FZAB 3AKKA 1O6KA 5C03A 3RM7A 1KE9A 1Y6BA 1ZYLA 4F1OA 2ONLC 4CFUA 3IOKA 1YXVA 3BLAA 3SKCA 4NTSA 2VV9A 2ZV8A 3TNWA 5I9YA 2B55A 3D4QA 4M3QA 3WF9A 1PW2A 5IPJA 1WBOA 3OXTA 4BGGA 2R3KA 4OT6A 3HX4A 4CG8A 2WMRA 3VBXA 3ZUTA 4FK6A 4QMQA 1YVJA 4FX3A 1TFFA 4IVBA 3UOHA 2B54A 4LUDA 4GG7A 2E2BA 3ORZA 4YJTA 4IWPA 4QYGA 4FIGA 5HO8A 4IH8A 3KREA 5CEKA 4FTLA 2WIPA 4UN0C 2V5QA 2X4ZA 4QO9A 3GQIA 4O7VA 2PTKA 3TJDA 1PKGA 2HYYA 3KEXA 2G9XA 3E8EA 5F95A 5TO8A 3ROYA 1KSWA 3GT8A 3DFAA 4PRJA 4RFMA 1UWHA 3FYKX 1I44A 5A9UA 4R3CA 3CY3A 3DKFA 3K5VA 3CGFA 3HV7A 4MBIA 1QL6A 5EYCA 5J1WA 4DEIA 1WBWA 2UUEA 2UZOA 1IA8A 2OW3A 3IW7A 4L45A 2XP2A 2QO2A 1PXOA 3G6HA 4DBNA 3GC8A 5LXMA 4FVQA 4JBQA 4IFGA 3VUKA 4ANOA 3VONA 2C0OA 1PMUA 3QALE 3R00A 4BKZA 3F7ZA 2JEDA 1BL6A 2QU5A 4X2FA 3PY3A 3FXXA 3NS9A 4BBEA 5HCXA 2CGXA 4LOPA 2VAGA 3HDMA 3RTPA 4E73A 4EUUA 3RBWA 4EK6A 5IF1A 1PMVA 3EN7A 5AV3A 5HIEA 3DB8A 5AR7A 4W8EA 4BHZA 4Z7HA 1QPCA 3FWQA 1T46A 2VX3A 4O21A 4JBPA 3D94A 1ZOHA 2O64A 4EK3A 1PF8A 3OTUA 4XBRA 2VTJA 1OL6A 1A48A 2C6LA 4DFYA 3PSDA 4RIWA 3HRCA 4M13A 3L1SA 3S00A 1KWPA 4O0VA 1ZYSA 2VU3A 2VUWA 5CU4A 2X0OA 1KE5A 5T68A 2HY0A 3P86A 4H58A 2OU7A 2UW9A 4QMMA 2CNQA 4HVDA 2XARA 1OPKA 4I23A 3EYHA 4LV5A 3OHTA 4CV8A 4FSUA 4DG3E 3EQRA 5HTBA 4QDVA 4W4VA 4ITIA 1DAWA 3E7OA 3EFKA 2XM9A 4NEUA 2WOUA 3Q5ZA 3AC3A 3VBWA 4YTHA 3BHVA 3GC9A 3G51A 1M14A 2C4GA 3OY1A 2J90A 4OBOA 4OTFA 2R5TA 4BBFA 3RPRA 3LPBA 4BDFA 1GZNA 4USDA 3LOKA 2ZM3A 2ERZE 2QG7A 1W7HA 2GTNA 3JVSA 5DPVA 2B53A 5I9XA 2ERKA 1H28A 3NUPA 2RL5A 3MBLA 1R3CA 3P08A 3QD4A 4C4IA 2XNMA 2IVTA 4K33A 5DEWA 5BVNA 2PZRA 5CSHA 5FLFA 5BUEA 4MUQA 4DH8A 5FTOA 4C59A 3GU8A 1F3MC 1YOLA 4P90A 3UG1A 3JS2A 3MPAA 2QD9A 3F3UA 4XRLA 4ACDA 3V8SA 1OI9A 5JFXA 4D5HA 3Q4UA 2PMNX 3O96A 3FI4A 4E6QA 4CSVA 5A4EA 3ML1A 1JAMA 3PSCA 3ZCLA 4G3FA 3PJ3A 4ZOGA 4AT4A 3LLTA 4BF2A 1WBSA 3T8OA 3QWKA 3HV4A 1PXMA 4JNWA 4D28A 2IZSA 4WHZA 5CENA 2WQNA 5A6OA 2YLFA 3G2FA 1SM2A 4PF4A 4F4PA 4BVUA 5EM8A 2YM4A 4GW8A 3QQKA 5AUXA 3O8TA 4NM7A 4QTBA 1O9UA 2BUJA 3OD6X 4D0WA 4BTJA 5DT4A 5JGDA 2E9UA 4MVFA 4FG8A 4KRDA 4FEXA 4RVTA 4FVPA 2PPQA 5LMAA 5KE0A 3SOAA 4L00A 5GINE 3SV0A 2ZDUA 4KBCA 4EWQA 5KBQA 1DI9A 4PPCA 3A8WA 3DY7A 2G2HA 2YA9A 1E9HA 2YIRA 4FSTA 4CZTA 4M66A 5AEPA 4W4YA 3S4QA 4W8DA 3VBYA 3RK5A 1H08A 4ZSEA 1G8SA 4U5JA 4G3GA 4XNEA 4PDPA 3Q04A 5BUJA 1IG1A 2Q83A 4FTOA 4M0ZA 4QMUA 1FGKA 2JKKA 3H30A 2PMOX 3RAIA 3RNIA 3TZ9A 2HWPA 2QOHA 3SHEA 4H39A 1NVQA 2FVDA 2NP8A 2YIQA 3LZBA 5L2TA 4A7CA 3RHXA 3UYTA 5E8TA 2C68A 4CG9A 3ZC6A 2JLDA 5B2KA 3AT3A 3LFCA 4WNKA 2GCDA 4D2SA 4TT7A 4Q5EA 4ZSLA 3ULZA 4BDCA 4C58A 2B0QA 3KRWA 4CEGA 4OAUC 4OTQA 5HLNA 1P5EA 4EH8A 4IX3A 2C6EA 2DYLA 2WU7A 2XRWA 3DLSA 2GNIA 2W4KA 1IR3A 4X3JA 4IAIA 3W8QA 2IN6A 1SVEA 1IAJA 4EOPA 4IJ9A 5CI7A 3QAME 3LXLA 3VW8A 4JIAA 3NW6A 4MF1A 4XX9A 2WOTA 4DT9A 3UDBA 3ORLA 4UMRA 3BHHA 4LRKA 2R3MA 2YACA 3DJ5A 4J1RA 3MH0A 1H8FA 4RMZA 5AUYA 2OJ9A 3F2RA 3HUCA 2BVAA 1P14A 4FNWA 4WNPA 5K3YA 2Z7LA 5EHLA 3P7AA 5HCYA 4FNYA 4RJ6A 1YWNA 3LE6A 5HBHA 3W2RA 2YCFA 3VIDA 4YZMA 2B9FA 4FG7A 4HZRA 3DOGA 3EHAA 4J98A 4YURA 3NGAA 4OAVB 1GIJA 2H9VA 4KIKA 3OCBA 1U46A 3NRMA 1KE8A 5E8ZA 3Q5IA 3ZDUA 2PULA 3NVKI 1SYKA 2C30A 4MXCA 5IH4A 3AC1A 4QMNA 4BCMA 4AX8A 3R83A 1M2PA 1W2DA 3FQSA 3PVBA 3IKAA 4I6QA 2XK6A 1OIYA 3NUYA 4J7BA 3R9OA 4BN1A 1BI8A 2H8HA 5M4IA 1OPLA 2Y8OA 5DRBA 4BJJA 3SAYA 1ZYJA 5H3QA 5DR6A 4RQVA 5L2QA 2WQEA 2GPHA 4AGWA 3A61A 4ZZMA 3U6HA 2CGUA 5JFSA 2OJFE 4EYMA 4CFFA 3QXPA 5J79A 3FKOA 3NR9A 5J7BA 4JRNA 2ZM4A 2CCIA 4IQ6A 4L3PA 2JD5A 4E4MA 2C1BA 5EW8A 1DI8A 1JKSA 3AD4A 1XBCA 4QMSA 4RWKA 4ZTLA 4FF8A 4QD6A 4D1ZA 4DITA 3E63A 3NUXA 3NYVA 4EOLA 5AA8A 4OTPA 4YPDA 5IA4A 4F6UA 4QTEA 4DE4A 2C0TA 3ANQA 3KN5A 2QLQA 4JDIA 3ZU7A 2CKQA 2ITPA 4GCJA 4DLIA 4BDBA 4DGNA 4BKYA 5C4KA 5AV2A 2QOFA 2W1EA 3A4OX 3TACA 3UNJA 4EOQA 3EIDA 4WUNA 3TZ7A 4JAJA 2WTCA 4X2NA 4WG5A 2VWBA 4C57A 3KFAA 3B8QA 3BYUA 3DTCA 2X0GA 3I0OA 3OG7A 4AW1A 4BWPA 2UZTA 4EHZA 3GEQA 3RALA 4L52A 4ANNA 1FVTA 2Z7SA 3MFTA 3RWPA 2XNNA 3Q52A 4H3PA 3QHWA 2C6KA 2OIBA 4JG8A 4MH7A 4NCTA 5HCZA 5T6KA 1V0PA 5E92A 4ACMA 3HMMA 4AW2A 1XQZA 3QUPA 4EZ5A 5AA9A 4CLIA 5BMMA 2VZ6A 3DBQA 4RWLA 4IAZA 1NW1A 4J8NA 4WD5A 4X3FC 3I1AA 3UO4A 2PUPA 1SMHA 2EU9A 3ACJA 1PXKA 3BE2A 2RFNA 3Q9ZA 5ETAA 3D9VA 3DJ6A 4LYNA 4XLVA 5CU3A 4RIXB 2OH0E 5HNIX 4EUTA 5HZNA 3MH3A 3KIOC 4FT7A 3W2PA 4EZ3A 4LRMA 3VS5A 4JS8A 3UDSA 5EH0A 5FQDC 2C69A 3FY0A 4IM2A 4U80A 4W9XA 2BRBA 4DHFA 3UIMA 4DINA 5CALA 5IA2A 4MXAA 4PY1A 1RW8A 3MJ2A 3C0IA 1OBDA 3PXRA 3UG2A 4PDSA 3I5NA 4NM0A 4BBMA 5FEEA 4YJVA 3CTHA 4QP9A 4C4HA 2FSOX 4EHVA 5I4NA 5HG8A 4M69B 4OTRA 4TPTA 4CFMA 5DE2A 3BL9A 4FSNA 1PYEA 3DZOA 4I4FA 4YSMA 4C3PA 2DWBA 4MWIA 2QCSA 3TXOA 4CNHA 5IA3A 5HEZA 4Q2AA 2C6MA 3AXWA 3OWLA 5LCKA 4PL5A 3TM0A 5BVDA 1OL2A 2O2UA 3AC5A 4RJ4A 2YWPA 5BMSA 2ETRA 5M4UA 4I94A 3U4UA 4IDVA 3UO6A 2OFUA 4RGJA 3U51A 4D55A 3OTVA 3QRKA 3Q53A 4P5ZA 4U97A 3CBLA 3T3UA 2ETKA 1FQ1B 4YPSA 5HQ0A 3ZYAA 1Z5MA 1YI6A 2XK8A 2OICA 3BCEA 3H9OA 4JR7A 2A2AA 3TG1A 2YN8A 4ACCA 4CFWA 2V55A 5EI6A 5FM3A 4U81A 4DFNA 4F0GA 4AE6A 5IMXA 5ETCA 4KA3A 4MD8E 4AOIA 2VTPA 3M11A 4G3DA 2CKOA 2RSVA 3LMIA 2C6TA 5EM5A 1L3RE 4Y72A 1UU3A 3NMUF 5ANDA 4BDHA 2J50A 2Q0BA 2YZAA 2XYUA 1JNKA 3AKJA 3SLSA 2I0HA 5AM7A 2W4OA 3S95A 2A27A 2E9VA 5EW3A 1W0XC 5M07A 1ZMWA 3DKGA 2F7EE 1ERKA 4O22A 4QMOA 3ZRKA 4KIOA 2EWAA 3PA4A 4DBXA 3TCPA 5G6VA 3ROCA 4II5A 1ZLTA 4RIOA 3ERKA 3ZFXA 4FR4A 5E7RA 3S3IA 4JQ8A 4DCEA 5IG1A 3GB2A 1CKJA 1B38A 4UY9A 3VS0A 4C02A 3W0MA 3FE3A 3QD3A 4R77A 3TUDA 4ASXA 3MI9A 2QOIA 3KXHA 3VC4A 4BGHA 4U0IA 2IZTA 1XH4A 2O5KA 4MTAA 3RP9A 3A60A 5FM2A 3QTQA 1Y8YA 4QPSA 4F1TA 2ITYA 4K2RA 3RAHA 4ZLYA 4QP2A 4TYJA 3EN4A 1J1CA 4MAOA 1CKPA 4R6VA 2NNWB 4DTKA 2ITNA 2BDWA 3LFQA 3DTWA 3PVGA 2J7TA 2CLQA 3PWDA 4YC6A 4JBVA 2QOQA 4PMSA 3ELJA 1XJDA 2RFSA 2B52A 3HMOA 4BZNA 4YO4A 4ZTQA 3OUKA 3BX5A 5C8KA 5CEOA 4JX7A 3L9MA 4MX9A 4QMLA 3PFYA 4HYSA 1OGYA 2CN8A 3G90X 4RA4A 2O0UA 2J5EA 2QURA 2WEVA 3KCKA 4FIEA 4BI1A 2OSCA 2J0IA 3FLZA 4IB5A 4CKJA 4FV9A 4NSTA 4QMXA 4GU9A 3ZSGA 5L2IA 4X6RA 1J7LA 4MHAA 5EYMA 4TL0A 4PP9A 4OTHA 5CY3A 4FT0A 4HZSA 2QKWB 3TUBA 3BRBA 4AA5A 4K18A 5EYKA 5HE0A 1V0BA 3PA5A 3LW0A 4O83A 4YJSA 4ZMEA 5M08A 4YZCA 2PK9A 5B2LA 4JI9A 1XH9A 3FZTA 3QC9A 4O0UA 2HXQA 4TY1A 4JQ7A 3Q6UA 3TZMA 3UNKA 2BZKB 5HE3A 4C4FA 1Q8YA 3QCQA 3FLYA 3HLLA 4D4SA 5HNBA 4HVGA 5CT7A 3FHRA 4N0SA 2OO8X 2XIKA 2PVLA 3LQ5A 4XJ0A 4YNOA 2X7FA 3VHKA 3ZLYA 5L8LA 4HJOA 2RF9A 2VNYA 3QQLA 2YM7A 2PSQA 3SRVA 2XZSA 4FKGA 4E4LA 4JXFA 3ORXA 4CTBA 3VN9A 4ENYA 4FKTA 4FSQA 4YZBA 4C2WA 4I92A 4BGQA 3RKBA 4PNKA 5KMLA 3N4UA 4RX7A 1PRYA 1Z9XA 3QZHA 2WO6A 4XUFA 2FA2A 3CQWA 3A2CA 3BYMA 4R5YA 4ZK5A 4BDEA 4BFMA 5AADA 3FLNC 3OUNB 2I40A 4QT1A 4WNOA 4HGLA 4GSBA 1O6YA 2GHLA 2BHHA 4FTNA 1H01A 1REKA 1BYGA 4EORA 3DQWA 4FSMA 1UA2A 4QP6A 3ZZEA 2YIXA 2WHBA 4IMYA 3TNIA 4Y73A 5AR4A 3IG7A 4GUBA 4YU2A 5CAPA 4RWJA 2GQSA 4F7NA 3WYYA 4DG0E 3QBNA 3G0FA 3PUPA 2UZNA 5E91A 4E7WA 3DAKA 3LMGA 3JR1A 3A4PA 4F6WA 2W06A 3NUNA 3VBQA 3QKLA 4C8BA 4EBVA 4H36A 4C33A 4DFBA 3QTXA 2B7AA 4O0YA 3ZO3A 3R21A 5AAEA 4C35A 4I0TA 5E8VA 1ZXEA 4IJPA 4O7ZA 4RVLA 2PVNA 4H1MA 3E8DA 4KB8A 5FWKK 5K5XA 1YKRA 4S33A 3UTOA 2G1TA 2JFLA 3PY0A 4FOBA 3ZUUA 5HVKA 5GZ9A 3H0ZA 4ZP5A 3UVPA 3NIEA 5E4HA 5JT2A 4X2JA 2OXXA 3GU6A 4EK4A 2VO0A 3G33A 5AP7A 5EQPA 4L46A 4A9SA 5CWZA 2XVDA 3ZS5A 3JY9A 1H1WA 3F69A 5IDNA 1PHKA 4FTMA 3PE2A 2OLCA 3MH2A 4Y5QA 5FXQA 3CCNA 3FMJA 1YRPA 4DN5A 4O4CA 3SW4A 5DGZA 2OBJA 2Z7RA 3II5A 4AP7A 4EKLA 4LRJA 3TI1A 4CQEA 3P7BA 2XK9A 2WGJA 4UZHA 4WG4A 1PXJA 3M2WA 1T45A 3UPZA 4A9UA 4QP8A 1FPUA 4GVJA 4DTBA 5M53A 1QPDA 3BU3A 5DOSA 3UIBA 1W98A 4GFOA 1MP8A 2XK3A 5AR8A 3GBZA 5FDXA 4IIRA 3KXMA 2ZFYA 3KXXA 2UW8A 4O4BB 4TKSA 4ASZA 4IAYA 4I5MA 5AUTA 3WF7A 4EOIA 1QMZA 4M97A 4RX9A 4BICA 5HBJA 4JLCA 4BIEA 4ZY5A 3QRTA 3TEIA 2RKUA 4C34A 3MW1A 2JBOA 3ACKA 3P23A 5EI2A 4PWNA 2YM3A 3F5UA 4ARKA 5M06A 3C9WA 4DGGA 1F0QA 3OVVA 2BROA 4F64A 3PY1A 2ZOQA 3ZLXA 3H0YA 2FYSA 5D7AA 4W4WA 2V22A 2XK7A 4IC7A 5JKGA 3NLBA 4BWXA 1Q5KA 4FKPA 3TWJA 4NT4A 4MKCA 2ETMA 4DDIA 2W1CA 5HIBA 4ZLZA 4FTTA 4Y5HA 2FSLX 3MSSA 4F1MA 4MXOA 2R3LA 3FL4A 4ZTNA 3UP2A 4FZ6A 4A07A 2J0KA 3FSKA 3VBVA 3W0QA 1GIHA 4U43A 2P2IA 3C51A 1K3AA 2IZUA 3C4WA 4NZWB 4ACGA 3O17A 3R71A 4M8TA 5CF5A 5M4FA 2QO9A 4G31A 3HKOA 5BVFA 3GCUA 4R8QA 4GT5A 4PDYA 1S9IA 4FKSA 2DS1A 4G3EA 2PUIA 5HNGA 1UU9A 2BIKB 3OCGA 4FICA 4NYEA 4ASEA 1H25A 1QPJA 4J53A 2ZDTA 4RIWB 5EOLA 3U9NA 2XAOA 3DB6A 3GCVA 3KL8A 1R78A 5JGAA 5IQAA 1VZOA 4IC8A 3VWAA