3DBFA

Crystal structure of an activated (thr->asp) polo-like kinase 1 (plk1) catalytic domain in complex with compound 562
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
287
structure length
261
Chain Sequence
KEIPDVLVDPRTMKRYMRGRFLGKGGFAKCYEITDMDTKEVFAGKVVPKSMLLKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMRQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIHSFEVDIWSLGCILYTLLVGKPPFETSCLKETYIRIKKNEYSVPRHINPVASALIRRMLHADPTLRPSVAELLTDEFFTSGYAPMRLPTSCLTVPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polo-like kinase
publication title Design and synthesis of 2-amino-pyrazolopyridines as Polo-like kinase 1 inhibitors.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transferase
total genus 74
structure length 261
sequence length 287
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2008-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dbfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dbfA01
4FSYA 1JKTA 1U46A 2H9VA 3EKNA 4II5A 2VU3A 4FT9A 4MK0A 5FXQA 2IVVA 4RWKA 3R1SA 4ZZNA 3PY3A 4HYUA 5JEBA 3UZRA 3G9NA 4NH1A 5KHXA 3D15A 1KE9A 4GG5A 3EH9A 4H58A 4BVUA 5M09A 4XG2A 4ERKA 3FL5A 2CKOA 4V01A 4ZIMA 2HENA 3FMJA 4YJOA 5AR5A 3NRMA 4I93A 3FQSA 5M57A 4EH4A 2R7BA 1A48A 4RX5A 4RIXA 5D11A 5A54A 5C4LA 3NVMB 3TNQB 3CXWA 3THBA 3F3UA 3LFEA 1FINA 4XBRA 4QP1A 4KIQA 4USDA 4LMUA 3RALA 4V05A 5AADA 5AUTA 5CEKA 4N57A 4ZJIA 1OUYA 4A4OA 4BHZA 2RFSA 2QCSA 4H1JA 5IUIA 4DAWA 2QC6A 3C4CA 5GNKA 4G1WA 4EK8A 2XEYA 4MXAA 4YMJA 4O82A 4AE9A 3MFTA 3DKCA 4RC4A 5BVKA 4FGBA 4CGAA 1M52A 3QXPA 2VTQA 3GQIA 2OGVA 3F3WA 3FWQA 2QONA 1J91A 2X81A 4EOOA 4G2FA 4FT3A 3GFWA 4IAKA 3A61A 3PIYA 2R3JA 1OPJA 3VRZA 2VUWA 3RAIA 1H08A 3F5PA 4FKRA 4M15A 4HPTE 4H3PA 3W2RA 4QP7A 2Q0BA 3R7OA 2W17A 3E88A 2WMAA 4YP8A 2XF0A 3P0MA 5DN3A 4BWKA 1R78A 4DEBA 3NGAA 3C1XA 4I5CA 3QA0A 3MV5A 4U3YA 2WMRA 2Z7LA 4AN3A 4BCIA 3HYHA 2IPXA 3DFAA 5FBNC 3NW7A 2ZM4A 1ZYDA 3SXRA 2C30A 2A2AA 1W8CA 3OFMA 4BRXA 1VYZA 2NRYA 2JFLA 3KCKA 4X2FA 4AA5A 4ZS4A 2JITA 3V8TA 4EQMA 2UVXA 3DDQA 3PXQA 5D7AA 3UC4A 4X6QC 3V51A 3AMBA 3ZBFA 3MVMA 3GI3A 3KN5A 4QTBA 3C0GA 5CAOA 3R00A 4G6LA 5HU9A 1ZY4A 4FI1A 3D83A 5DWRA 4B6LA 1G8SA 1FOTA 4CG8A 4IZYA 3JVRA 5E8XA 3C4ZA 5FQDC 3ZLSA 4RJ4A 2XYUA 4CXAA 1TQIA 3TDWA 4O21A 1YWNA 5FEEA 3R7YA 5HTBA 1W7HA 2NO3A 3AMAA 3PJ1A 4F63A 3IW8A 4AOJA 3G15A 5LQFA 2J51A 2VTLA 4R8QA 2B0QA 2AUHA 2WZJA 5KHWA 3L8XA 4J52A 4L00A 5CT0A 2PYWA 1H1SA 4FKLA 3ZFMA 2VTNA 5CQUA 4FSZA 5CX9A 5IEXA 4TKSA 3U51A 4W8DA 5ITAA 3R01A 2W1EA 3FY0A 4JS8A 5F4NA 5HEZA 2QO9A 3W18A 3G90X 5E8ZA 4RMZA 1Q41A 5FM2A 5CWZA 2Z8CA 1GNGA 2PZPA 2BHHA 2QODA 2OIBA 3POOA 5H8EA 4ANOA 2IVSA 3TUBA 3DXPA 4MF1A 4TYHB 2J6MA 1OPKA 1OIYA 3Q32A 4U8ZA 2WMTA 3F2AA 2WGJA 4EOJA 3QRJA 3V01A 1JOWB 4BYJA 5AMNA 1JBPE 3G5DA 4ARKA 4IB5A 3FMKA 2ZM1A 4CT1A 4O7VA 3ZM9A 4KWPA 4PNIA 5E1EA 2ONLC 1YOJA 3AD4A 3IK3A 4QMLA 1XBBA 4QQJA 2X4FA 4UXLA 4CLJA 3DAKA 3R8LA 4MX9A 4AE6A 3PXRA 3HDNA 5HQ0A 2C6LA 4E5AX 4ANBA 4A7CA 5CEOA 2YWVA 4RWJA 4EYJA 3U54A 4L46A 1Y6BA 4DCAA 1FMOE 3UNZA 3WE4A 1ATPE 4EHZA 3FKOA 2JEDA 1F3MC 2P2IA 4FC0A 5AIRA 3DTWA 3OCTA 5FLFA 4RJ5A 4ANMA 4ZTHA 4J99A 5AX9A 4KIOA 1URWA 3RGFA 2GPHA 4UWCA 4QMTA 2IZUA 2XBAA 2FGIA 1PXJA 3GCQA 4FTQA 3L9MA 2XKEA 4XBUA 5BMMA 4C4FA 2XKFA 4PUZA 4YGAA 4ASXA 1REJA 5AP1A 2I1MA 3QTUA 2V5QA 1H0VA 2Y6MA 4XP3A 4ITHA 3HKOA 5AR7A 4PQNA 4IANA 3FI3A 4HNFA 5CTPA 4AW2A 1DAYA 4GVJA 3PFQA 5BVEA 4DBNA 3W2SA 4FZ6A 2I40A 3NLBA 2OJIA 2RFEA 3ZZWA 2PVKA 3BEAA 1H8FA 1WBPA 2F7ZE 3VNTA 4QYFA 4Z3VA 3VWAA 4FEWA 2B9HA 3OY3A 1KE5A 2YCSA 3ENMA 4EOMA 2ITQA 1SVEA 3DNEA 3F6XA 3RM7A 2C3LA 5AP6A 2W9FB 5EQPA 4UX9A 2J4ZA 2PTKA 5IDPA 3PDTA 5G6VA 3GC0A 4RVTA 1F5QA 3P08A 4TRLA 4IMYA 5E91A 2BHEA 4C38A 1OIQA 3VAPA 4S34A 4RX9A 4LUDA 5JGBA 1OL6A 3VUHA 1M7NA 4F7SA 2VO0A 3NNXA 3R9DA 3ZUVA 2YLEA 4F4PA 1ZZ2A 4LRMA 5IISA 4KD1A 3KRJA 1NVRA 3MVHA 3A8WA 2FB8A 5IU2A 3MVJA 4ACHA 1V0OA 3G6GA 2XRUA 2PVRA 4YJUA 3H9OA 4G3CA 3NAYA 5AM6A 4CRLA 4EORA 1PRYA 1S9JA 2WQMA 2X9FA 4MWHA 5DT0A 5H8GA 2J0LA 3QL8A 4EEVA 5CXZA 4G17A 3AC2A 4HJOA 5CVHA 4IW0A 4E6DA 4F6WA 5FTGA 2W5BA 3UJGA 2GFSA 2HY81 4JDKA 4BB4A 1ZY5A 3JYAA 3LJ2A 4TYEA 3A2CA 4IX5A 4MYGA 2BZIB 1XH8A 2RG5A 2UZOA 3RK7A 4HCTA 4OGRA 3DLSA 4MXOA 2I0VA 3KA0A 4EK4A 1H01A 4G3DA 3W2OA 3WE8A 3FPQA 3QD4A 3FMHA 4N6ZA 3MH2A 3OHTA 2RL5A 3H0YA 4I41A 3TTJA 4EH5A 3IW4A 5K4JA 1RDQE 4Q9ZA 3FHRA 5ANGA 4GJ3A 4YBJA 3CY3A 3VIDA 4QTAA 3GXLA 4YJPA 3K2LA 3R83A 4IDTA 3TCPA 4W4YA 2G01A 2P55A 5IQCA 4FTCA 1HCLA 4IQ6A 3MJ1A 1OB3A 3K5UA 2QOHA 3FKLA 3WF8A 1YXUA 4LV5A 2G1TA 4EYMA 3ZO3A 4HVSA 2NRUA 4GT3A 5B2LA 4QPSA 5HVKA 2UVYA 3QTWA 3QZGA 4Y85A 4EH2A 3O17A 2J9MA 4FV6A 5IQEA 3D2KA 3QWJA 3DU8A 3R9HA 5HVJA 3JUHA 3C0HA 3CBLA 3A4OX 5DT4A 1VZOA 5L4QA 2Z7QA 4OBPA 4H36A 2BRNA 5CALA 2QO2A 4DC2A 4TNBA 2UZDA 3ZEPA 5M4FA 4EBWA 4WG5A 3R0TA 2X2MA 3P86A 5FXRA 5IQGA 3A99A 3CKWA 1Q61A 3BWJA 4ZTLA 4BCNA 2CKEA 2GTMA 4MCVA 4QMZA 3AD5A 3CTHA 4I24A 4ALWA 3WOWA 3QBNA 2GS7A 4P2KA 1YHWA 4FV2A 3V3VA 2OIDA 4DLJA 2YISA 3HV3A 4Q2AA 4C3PA 3QD0A 4JG7A 1PXMA 4FV9A 4YPSA 4U79A 4AW1A 3LFDA 5EDPA 2XK6A 4X2JA 4CTCA 2YA9A 4PTEA 2WU6A 3VUTA 4D2TA 1P4OA 5JRQA 2ITXA 4RZVA 4IVAA 2IW8A 4HW7A 4CQGA 3EL7A 3QZHA 1PXNA 3OUKA 4HYSA 4FOBA 3OWJA 5AV2A 3B2TA 4BKYA 2F7XE 3ZS5A 2OIQA 2F9GA 4UALA 4EQUA 2OKRA 4FKUA 2VTTA 3D7TA 1OL7A 3ZDUA 2R3NA 3PP1A 3GU8A 4NU1A 2ZMDA 1XWSA 3DNDA 2C3JA 1UNHA 2QOKA 1Q8ZA 3KXNA 3LCOA 4GIHA 4KRCA 5HG5A 4DTBA 4JOAA 4R7HA 4JVGA 3V5QA 2PE0A 3EQCA 3KVWA 3OCBA 4JQEA 3GEQA 4W4WA 3SXFA 4BI2A 3U6HA 3OG7A 3QTRA 3DBEA 5E8WA 4PPCA 4E6QA 4ZOGA 5AUWA 4GT5A 2W9ZB 3SDJA 4FODA 2QD9A 2ITPA 2WMUA 2VTPA 3GFEA 4FNZA 4DFYA 3BX5A 3PA3A 4HCUA 2EXCX 4D55A 3QD2B 5GIPE 3EN4A 2PVNA 4XS2A 4UYAA 3ANQA 3RPSA 3L1SA 2LAVA 4JAJA 1U54B 3E92A 3QQJA 1OKYA 4RWLA 3F2NA 5KKRC 4W9WA 1JAMA 2WXVA 3CGFA 3QCYA 5C9CA 4FTJA 2YJRA 4BN1A 3BKBA 2X8EA 4BTFA 4QMXA 4FZAB 4NKAA 3IW7A 3DKOA 4BDEA 1IG1A 2CNQA 4FOCA 3MESA 4C4GA 2O2UA 3DAEA 1I44A 3QUDA 5FG8A 4DFLA 3Q04A 2R3GA 3BGPA 3HUBA 4FYOA 2HXQA 4DBXA 2EU9A 4K9YA 1SNXA 3HMIA 5ANJA 3CSVA 4RLLA 4F99A 2WB8A 3A7IA 3PJ3A 3KL8A 1P14A 4BDDA 4FNXA 4BDIA 4BIDA 3SKCA 4JR3A 3HA8A 4A07A 5A6NA 1YI6A 3TNHA 5CZHA 3Q96A 4BWXA 2WIHA 3R7EA 1Q3DA 3H10A 5AIKA 3BU3A 4ZSEA 4KBAA 2FSMX 1ZXEA 3IW6A 3WYXA 3MB7A 2JFMA 4L8MA 2X6EA 2R9SA 3MH3A 4RG0A 4ZTNA 5EW3A 4RVMA 5TOZA 2EXEA 2J90A 3FYKX 3H9RA 2JIIA 4QT1A 4AZEA 3LW0A 4L68A 4L3LA 4PPAA 2ZV9A 1R39A 4ZEGA 5M4IA 3UPZA 1QPCA 5J79A 4EH9A 1TVOA 4IACA 2UZEA 2FH9A 2YAAA 3G9LX 3F82A 4FSNA 4QP9A 5F94A 3U6JA 3Q3BA 5LMKA 4G6OA 3PVUA 5CASA 4EZ7A 4ZP5A 2J0JA 1XR1A 2W0JA 3VS2A 4DGMA 2WMWA 1B6CB 4G31A 4IM0A 4JRNA 3VS6A 4X21A 4GCJA 4X2GA 5T68A 2QR8A 4NTSA 2WNTA 1Y8YA 2YDJA 4D2VA 4O7ZA 5DHJA 4AGCA 3QF9A 4FV3A 5EM8A 2Z02A 5TO8A 1Q97A 3OVVA 3RK5A 1ZOGA 2QLUA 5FP5A 3L8SA 3QQFA 2YACA 4I6FA 2P0CA 1YXSA 4NIFB 4LL5A 2QU5A 1XJDA 1YHSA 2I0YA 4Y95A 2BUJA 4FICA 4CNHA 3QQKA 4U44A 3VRYA 3A4PA 3SXSA 2HCKA 3KMMA 5BVDA 1OZ1A 3PLAE 4YNEA 2G15A 3OOMA 4QQCA 2NNWB 4U7ZA 3SA0A 4O6EA 4IWDA 4XV9A 2CGUA 5IA1A 5I0BA 1P2AA 5HG8A 3NVKI 2OFUA 4BL1A 4DH1A 2J5EA 2PZIA 2JGZA 3NUSA 4MD9E 4WG4A 1M2RA 3UPXA 3KF4A 4P90A 1OECA 2ETKA 2CPKE 3ENHA 3OC1A 5HE3A 4D1ZA 3AC5A 2ZM3A 4EH6A 2OWBA 4G3EA 3QTXA 2BRMA 3FV8A 3LQ8A 3KU2A 1PW2A 2BALA 1QPJA 4RT7A 2F49A 2RGPA 3G2FA 4FL2A 3TEIA 5M4CA 2GNFA 4DN5A 2BIYA 4YZCA 5BPYA 4YZDA 5JFSA 2VNWA 3R6XA 2PPQA 4FGRA 4ZTQA 4BBEA 3I81A 4WSQA 2JBPA 4NFNA 5L8KA 4G6NA 2XNOA 1Q24A 4PMTA 4DEAA 1OL2A 1W84A 4DFZE 4HGTA 4RJ8A 1PHKA 3V5JA 3AXWA 2PVFA 3BGZA 4M69B 4UWBA 4X3FB 4BDHA 4FSRA 4YLLA 3WIGA 2OLCA 4JLCA 3R30A 4EK5A 1MQ4A 3EHAA 5H8BA 4I22A 2AYPA 3CQUA 5FTQA 5H3QA 5AV3A 1YWRA 1ZAOA 3DBQA 3VULA 2P3GX 3QRTA 4CG9A 3Q2MA 2HWPA 3KULB 3PVGA 4ANQA 5JH6A 3OW4A 2E9OA 2IN6A 2OZAB 4O81A 4WT6A 3DK3A 2IW6A 3U6IA 2XVDA 1OL1A 3ZC6A 4BTMA 2V7AA 2YDKA 4GW8A 5EM7A 3VBXA 1H07A 4CKJA 2WTKC 4KBKA 4BFMA 1BUHA 1NVQA 4GSBA 4O91A 4UY9A 1OMWA 4RZWA 4APCA 5L6WL 3DJ6A 1BX6A 3MPTA 3EFKA 5CU4A 3HAVA 4ASDA 4PY1A 3MW1A 4FV0A 2BTRA 5ANIA 1IEPA 4D2RA 4XNEA 1CTPE 4KSQA 4CZTA 3NR9A 2ETRA 4H3QA 3VJNA 3ZZEA 1MQBA 5K0XA 1ZARA 4BTJA 5HTCA 4YC3A 4IC8A 2WIPA 4FKOA 4XOYA 4U40A 3GP0A 3TIYA 4OR5A 5I9VA 3KREA 2XIZA 1GAGA 4FKGA 4YJNA 5C27A 4I5MA 3OXTA 3QCQA 2GNHA 3O7LD 3CJGA 3BZ3A 3WF7A 1NW1A 2Q83A 5BVWA 4QNYA 3M2WA 5BVFA 4PP7A 2JKMA 4O1OA 4F0IA 4B8LA 3TV4A 2O3PA 2BZHB 2V22A 5AP4A 5EHLA 3TV6A 5IA2A 1BI8A 5F1ZA 4EOPA 5CI6A 2PULA 5FUTA 3BCEA 1OKWA 1NVSA 4FIIA 3CQEA 3ZUTA 4RRVA 2GHMA 2IVUA 1CDKA 1GY3A 4KBCA 5E90A 4UV0A 4IAIA 1U54A 4L9IA 2C5YA 3NUYA 2ZDUA 4IJ9A 3SQQA 4QRCA 1PMEA 4MXZA 4XV1A 4E4LA 4E4XA 4NWMA 2GHLA 2VAGA 4KSPA 5HHWA 5JSMA 2VGOA 2J5FA 3QRUA 3FXZA 3GCVA 3WZEA 4DG2E 4IVCA 3S4QA 2FSTX 3LHJA 1ZLTA 2HOGA 4J71A 5K0KA 1PMUA 5IF1A 3I6UA 2QO7A 3LXNA 4LI5A 4ZMFA 5ACKA 4LOPA 1ND4A 2C6KA 5DG5A 2VTIA 2XK4A 2HW7A 4PV0A 4O0YA 1GIJA 5BUIA 3BHVA 3FZRA 2IW9A 3TNWA 4BCMA 3SW4A 4D28A 1M7QA 4S32A 4PDPA 3UNJA 3ELJA 4I5PA 4PWNA 5HNIX 2CNUA 4BY9E 3AC8A 3HA6A 5E8VA 4LQMA 5JZJA 3ACJA 3LCDA 3ORPA 2CGXA 2PE2A 4O0TA 2RIOA 5CNNA 3NIZA 1QPDA 4O7RA 3SW7A 3EYHA 1XHAA 4QTDA 2OXXA 2BDFA 4RFYA 4U42A 4F7JA 3BBTB 4CCUA 5DE2A 3JY9A 4AA0A 3GCUA 3HLLA 3W55A 4JDIA 4YJRA 3OOGA 4BCQA 3CPCA 5HLWA 4K2RA 4J8MA 4BIBA 4AFJA 2UUEA 4R5SA 1E1XA 4KIPA 4CMUA 4OAUC 3KQ7A 5CS6A 4G9RA 2GFCA 2V7OA 4TWCA 5M56A 4FV7A 3UZTA 4ZTRA 4U80A 2I6LA 2XKDA 5B2MA 4G5PA 1T45A 2HZNA 2I0EA 2R3LA 5JKGA 3R02A 2RFNA 2ZJWA 2PL0A 5DEYA 5F20A 4AOTA 4D1SA 4FEVA 4NW6A 4DT8A 4IJPA 3FXWA 3ZC5A 3KMWA 5CU6A 5I3RA 4HGSA 2OXYA 4ZSGA 4EOLA 5L6OA 1H25A 4O7YA 2UW7A 4NFMA 1ZMWA 1UA2A 2ESMA 2XNEA 4EL9A 3PG3A 2WO6A 4NIFA 3IECA 1WBSA 4I1ZA 2EVAA 3K3IA 4CFVA 4CVAA 3S3IA 3GC9A 4ZY4A 5LVPA 4YNOA 4C02A 1H4LA 4QMPA 3VF8A 4UZDA 3R9NA 5DPVA 3M1SA 3OT3A 3QC9A 5L8LA 4F1MA 3OWKA 4IB3A 4DF3A 4GK3A 4FV8A 3UYTA 4BBFA 2BAJA 5M07A 5IQDA 1ZOEA 2W4KA 2WTVA 5FGKA 2CCHA 4FT0A 4FV5A 1PMVA 3CP9A 3FAAA 4YC8A 4O7TA 2QHMA 2WKMA 5EFQA 3HP5A 3E64A 3MIAA 3HUCA 3PZEA 3D5VA 3Q9WA 4QTEA 2UW0A 1JVPP 4JBVA 4AN2A 1AD5A 2WOUA 4I0SA 4XEYA 1BKXA 4F6UA 2YERA 5IH5A 4XV3A 3QALE 3WF6A 4K0YA 4PL5A 3BYUA 2C6EA 4O0SA 1FMKA 4C4JA 5EDRA 1TQPA 3MH0A 3SAYA 5B2KA 5GJGA 2GTNA 4BCGA 2JAVA 3PIZA 5L2IA 4TWOA 4RC3A 3EZRA 5IMXA 4LL0A 2C6MA 3KXHA 4HCVA 1JQHA 5EYCA 4CZUA 4AZTA 4EK3A 3AT2A 4FSUA 2DWBA 4M69A 2OZOA 4X3FA 5EM6A 4XG8A 3DJ5A 1GOLA 3KKVA 4EQCA 4G16A 2PE1A 3FBVA 4F64A 4QMQA 3R9RA 2YCQA 5HIBA 5AA9A 4NM0A 2WTDA 3F7ZA 4Y83A 2XM9A 4O1PA 5J8IA 3KULA 2GU8A 2Z2WA 5A4CA 3RAKA 1M14A 3P4KA 2VD5A 5DT3A 2OZAA 5HBJA 2ZB0A 3RPOA 5HESA 2OICA 2BAKA 3U87A 3ORTA 4IVDA 4ASZA 4E6AA 5LVMA 3A8XA 3ZLXA 3KN6A 2OJJA 3GCPA 4A06A 4FVRA 2CLQA 2XK3A 4LFIA 2ACXA 4D5KA 3LM5A 5EDQA 4MXCA 1LR4A 4HYHA 4O6LA 4QMUA 5E8SA 2ERKA 3OEFX 5HKMA 3RNYA 5BMSA 1G5SA 5JMSA 4ASEA 4GKIA 4CFFA 3EQDA 3K3JA 4L6QA 3QX2A 3ATTA 4XYFA 2NPQA 3TT0A 3KRXA 4RSSA 3HRCA 3BYSA 3LMHA 1PXIA 3FPMA 4BCHA 4NM5A 5FM3A 5FP6A 2C0OA 5HLPA 3MPMA 3VHEA 1Y57A 4GUEA 5KCVA 1M2QA 1XO2B 2X0GA 4GRBA 4NZWB 2FYSA 3NEWA 4OTIA 3D7TB 3IO7A 4YTFA 3MN3A 4L52A 1FBNA 3R2BA 3W10A 4TTHB 4JIKA 4XH6A 1K3AA 4DGGA 3TM0A 5GIOE 2QU6A 5FTOA 4C2WA 4I92A 2XNGA 2Y0AA 4YLJA 3ZOSA 4I3ZA 3ERKA 2C5XA 2IZRA 2PY3A 5IUGA 3OUNB 5AAEA 3R8MA 4FG9A 4AZSA 4ITJA 4PTCA 2XNMA 4MBIA 3ZRKA 3LQ5A 4QMMA 1REKA 1X8BA 4IAYA 3ZO2A 5IDNA 2OH4A 3HV5A 3QQGA 4ERWA 4O27B 4PF4A 4BDKA 2W4JA 3MIYA 3DFCB 4DGOA 1CKIA 4E1ZA 3H4JA 4LM5A 4P4CA 4FIFA 4I6HA 3VF9A 5HO7A 1IRKA 2JKOA 2VWYA 4MBJA 2VWZA 2WOTA 4YJQA 2HZ0A 3FQHA 3DZQA 1W0XC 3C5UA 4ZSJA 3L8PA 3PXYA 5HO6A 3KF7A 3O8TA 4AFEA 3E7OA 3QHWA 5AR8A 4CCBA 4F9YA 4TYIA 3LFFA 1FVTA 1UKIA 3RNIA 2G2HA 3KK9A 4BDCA 4IAZA 1ERKA 4D2WA 3DJ7A 1SVHA 2GS2A 3PPZA 2QOCA 2R64A 1J1BA 2OF2A 3AG9A 1K9AA 2EWAA 3Q60A 5AEPA 5AP5A 5D12A 4DEIA 4RGJA 4J7BA 3IS5A 4BDBA 4C4EA 3ZLWA 2VWBA 4FZDB 4L42A 2B55A 3CR0A 2VX1A 3L8VA 1PKDA 3L9LA 5AR4A 4O2PA 4PPBA 3DXNA 4XRLA 3HNGA 5EQYA 4K1BA 2WTCA 4K6ZA 3KXMA 3S95A 5CF4A 1GJOA 5KO1A 3QZIA 1J7IA 1FVVA 2R3KA 2WEIA 3BQCA 5A14A 5HZNA 4O7WA 2QOIA 5K4IA 4FIHA 4QYEA 5DNRA 3HDMA 3C0IA 4RPVA 2YLFA 1Q5KA 5AP2A 3GGFA 4EZ3A 2Q0NA 3A7JA 4YJSA 3ZRMA 4CMTA 3N4VA 3ZUUA 2RSVA 4DH5A 3VQUA 2JDTA 4BIEA 4PDOA 4LUEA 5D41A 3BV3A 5CF8A 1E1VA 1G3NA 1H1QA 3Q5IA 4FTMA 3F2RA 4IM2A 4MAOA 2R3QA 3EJ1A 3F5UA 5DBXA 5CEMA 3F7WA 2UV2A 2W7XA 5A4EA 5I9YA 5A46A 2X2LA 2Z60A 4M66A 3DPKA 2JKQA 3O23A 4NJ3A 3TNPC 5M51A 3EN6A 5LVOA 3R7IA 1QMZA 3EN5A 3KVXA 4ZAUA 2YZAA 5ETIA 4BCPA 3D5XA 1ZYCA 3AQVA 4PX6A 3TXOA 3F61A 2RFDA 3GU7A 1KE7A 3PG1A 1WBNA 4GYGA 4MF0A 4U6RA 3T3VA 3FLSA 4C58A 1QCFA 3DS6A 5HBHA 3UIBA 1LEWA 5IPJA 1JSUA 3QCXA 2C6IA 5FEDA 5FD2A 5HI2A 1OITA 1XQZA 4QTCA 3U4WA 2A19B 3CD3A 5HIEA 3UVQA 2BILB 2XBJA 5M08A 2P2HA 2B9JA 3LFNA 3VN9A 4PRJA 3RKBA 4FKQA 3TN8A 4CYIA 2CDZA 2YABA 5JQ8A 2X1NA 4APPA 3FE3A 3TUDA 5JFVA 4C7TA 4OTFA 3OTVA 4GH2A 4QMOA 3FI4A 5M55A 4YHTA 3ZU7A 5HD4A 4L45A 4LMNA 5CSPA 3KFAA 3ORKA 4OTPA 1GZNA 3ZO4A 4C36A 4IB1A 3PXZA 3R1YA 5KKRB 1CKJA 2OH0E 4J98A 3ZHPC 2VV9A 2HELA 3R1QA 1Q8WA 4CRSA 2IVTA 3NYNA 2BTSA 4GFGA 4BC6A 2HIWA 2IWIA 4JNWA 4TXCA 4YTCA 4AAAA 5JQ5A 3G0FA 5GINE 4A9SA 4DA5A 3LXLA 3WF5A 4Z7HA 4PDYA 4IFCA 5CSWA 4FTOA 2X2KA 3MPAA 3PWDA 5CAVA 3ZSHA 3W2CA 4DCEA 3VUKA 4AF3A 4CFNA 3LKMA 4XP2A 5IQHA 4BR3A 2ZV2A 2W1GA 1XH9A 2GNGA 2YFXA 2G2IA 1IASA 4YBKA 3UIMA 3V5LA 3C7QA 3MBLA 4W4XA 2R3FA 4GG7A 3ZXTA 5KBRA 5HOAA 3GT8A 4E93A 5ETCA 2VWXA 1JPAA 4M14A 2C47A 5IA5A 1U5QA 4IFGA 4M0ZA 4FIJA 4AQCA 1E9HA 3KXZA 1PMNA 2WEVA 3R9OA 2A4LA 5K9IA 1CM8A 4EOIA 5IQBA 3OF0A 1YXTA 3M42A 5D7VA 5IUHA 2BPMA 4KNBA 3Q9XA 4O2ZA 3S1HA 5J9ZA 3NUXA 3OY1A 4GYIA 1CKPA 1QL6A 2V62A 5M06A 4WNKA 3CLYA 2BRGA 3BI6A 4M3QA 2C1BA 4RX8A 4E26A 5CF6A 4ZS0A 2ZAZA 2CSNA 4JXFA 4O38A 3PSDA 4YZMA 2VTOA 4I94A 5CXHA 5J1VA 1UNLA 3VQHA 3CKXA 3LFSA 1JKSA 3VO3A 3TDVA 5EI2A 3MY0A 4MBLA 5KE0A 4WO5A 3POZA 5GHVA 4MVFA 4PTGA 3W1FA 1OI9A 2R4BA 1MRVA 2HW6A 2R0UA 4J97A 5CZIA 1U4DA 2YM3A 3OT8A 2E9NA 2PVMA 5L2WA 3TTIA 4B4LA 1VJYA 4F65A 4BZOA 3FQEA 2VWUA 3UOKA 5HG7A 5EYDA 4I0RA 3VS1A 4IC7A 4LG4A 3UGCA 5AAGA 5DLSA 4QP8A 4ZTMA 2VTRA 4ACMA 1T46A 4M12A 3WZJA 2E9UA 3CTQA 3BIZA 3IKAA 2J2IB 4FKSA 2QKRA 5ACBC 3O51A 3LLAA 5A3XA 4FVQA 2F4JA 4L3JA 3PE2A 3MA6A 2JDVA 3QLFA 1NA7A 4HVGA 4TL0A 5JGDA 4U9AA 4BTKA 5J5TA 1NY3A 2JIVA 3QCSA 3SG9A 2W05A 3NNUA 3TNIA 5IKWA 3BHYA 4I23A 4DYMA 2YZLA 3JR1A 3WIKA 4LOOA 5KMKA 5AJQA 4AN9A 3C4XA 3FI8A 4X6RA 4Y8DA 1WVXA 1J3HA 3GQLA 2J0MB 2H96A 2W1DA 4GUBA 4MH7A 3GU6A 4GL9A 4BKZA 3Q2JA 3FMDA 4FF8A 5EYKA 1H26A 4CD0A 4AX8A 4U43A 4FBXA 3IGOA 3EFLA 4WBOA 3BELA 3UQGA 2WQEA 2BDJA 5BVNA 2VX3A 3COHA 2Y4IB 4N0SA 3H0ZA 1JWHA 4AOIA 4EHVA 4PMPA 5AAFA 3CGOA 4IWQA 1PJKA 1SM2A 4NTTA 5H9BA 3UIUA 1WVWA 5KMMA 4V04A 2GQRA 3CQWA 3T3UA 3VHKA 3Q6UA 1GZ8A 1KSWA 4NW5A 3V5PA 3DOGA 3E63A 4FSQA 2X7GA 2YJSA 2ZDTA 3KRWA 4QMWA 2UW4A 2UW5A 4L3PA 3F69A 4N6YA 1R0EA 3L9PA 4FIGA 1YOLA 4JT3A 4RX7A 4FMQA 1TQMA 4EH3A 2XKCA 2GNLA 4S30A 4L67A 1I09A 3FLWA 4C62A 2ZV8A 1UV5A 5DR9A 3N9XA 3LOKA 3D4QA 4F9CA 1OBDA 2PSQA 5KMLA 3IDBA 5CENA 3MS9A 4AT3A 3EWHA 4JBQA 3DBFA 1YKRA 2O64A 3ZRLA 1YDSE 2G9XA 4C8BA 1IR3A 5AA8A 3UG1A 3RK9A 5CSXA 3EFWA 3O8UA 2O8YA 4OTHA 5M44A 3PPJA 3MYGA 3Q4CA 2G2FA 3B2WA 4C59A 3BWFA 4XLVA 2PUUA 3LCKA 2YEXA 4JBOA 5HE0A 4W4VA 3DA6A 5F95A 3VW6A 4DG0E 1JLUE 2FVDA 4TY1A 5H2UA 4L7FA 3TIZA 4CKRA 4TWNA 1B39A 2OW3A 2ERZE 2XRWA 3WBLA 2C3KA 4U81A 3DZOA 4KAOA 4YZNA 3P7CA 3ROCA 3V6SA 4DGLC 4ORKA 4ZJJA 2P4IA 4DEGA 1Z57A 4FV4A 3AGMA 2F2CB 2A27A 3BE2A 2GNJA 1MUOA 5DYJA 4NYEA 3HRBA 2XIXA 1S9IA 3QZFA 1SYKA 2YIQA 4RIWB 2WTIA 3MA3A 3SGCA 5EI8A 4Q5HA 5CVFA 5A9UA 3LM0A 2PMIA 4FSWA 4D4YA 3CEKA 3RP9A 3UQCA 4B7TA 3UODA 4N70A 3AOXA 3B8RA 3QYWA 2A1AB 3A7GA 4RIYB 5TKDA 1YVJA 3PY1A 4TYJA 4BF2A 3ZDIA 3SVVA 2OJGA 4UMQA 5BUEA 2C4GA 2XJ0A 4L53A 4ZY6A 3KK8A 3BV2A 3P23A 5HX6A 4EUTA 4CKIA 1YOMA 5HVYA 5CAUA 1OKZA 2JC6A 2YIXA 2UW9A 5CYIA 5J7BA 3Q4TA 2W1ZA 4JIAA 5KMIA 4AZFA 5LWMA 4H3BA 1OM1A 2V0DA 4DG3E 4R1YA 3TZ7A 3M11A 4IVBA 3BGQA 4ZK5A 2W96B 3PWYA 3DCVA 3QTSA 4RFMA 5DR6A 4MNEA 3UE4A 1YI3A 1BMKA 2C5NA 5ICPA 3D94A 5EOLA 4HVDA 4B9DA 1VR2A 5T6KA 3GC8A 4IX6A 3UO5A 5BVOA 4HVHA 2JDSA 5LVLA 5CU3A 2PUIA 5C8NA 3ZMMA 2WTWA 2OO8X 4IHPA 4X7QA 3V04A 4JX7A 4H05A 2UW8A 4F1OA 3CC6A 3PE1A 4WBBB 1AQ1A 3HV7A 4JDHA 3CD8A 3GU5A 3QX4A 4JBPA 4LGHA 4WUAA 1IAHA 3A7HA 5J9YA 3SRVB 5DGZA 5AUZA 4ONAA 2C69A 4OTQA 4EKLA 4FUXA 3UNKA 2BDWA 5EYMA 3ATSA 1KE6A 3LJ0A 3QUEA 2R0IA 3AGLA 3VJOA 2BIKB 4CFXA 4GFOA 4JDJA 5LMBA 4UB7A 3PPKA 4CQEA 4USFA 5EK7A 2VWIA 4TN6A 3BU5A 5IQFA 4KKGA 2W5HA 3I4BA 5LOHA 3Q4ZA 4K18A 1YQJA 3CIKA 4BDFA 2X6DA 3U9CA 5AFVA 5FWKK 5HLNA 3FUPA 3LIJA 1BL6A 1K2PA 4ZJVA 4DFUA 3O2MA 3ZBXA 4WA9A 4WUNA 1WAKA 3NX8A 2OSCA 3UDBA 4DINA 2XK7A 3FL4A 4E6CA 3AT4A 4E8AA 2GQGA 3VVHA 3OMVA 4MEDA 2HY0A 3DDPA 4K11A 3LFBA 3RHXA 4Q9SA 2C6DA 4BBMA 4KIKB 4F0FA 1U59A 3R71A 5HBEA 3RJCA 3WF9A 2VGPA 4FA2A 2CLXA 3QLGA 4AT4A 4C3RA 1W98A 4FK6A 5HO8A 4YURA 3E3PA 2JDOA 4YTHA 1ZMUA 4LV8A 3ZCLA 4D4RA 3R2YA 3VBQA 3MJ2A 3E8EA 4HYIA 5A4QA 1ZOHA 4IADA 4RBLA 4XV2A 3RWPA 1WCCA 4FV1A 4EUUA 2J0IA 3NSZA 2WMBA 3P1AA 3EIDA 3SV0A 4JAIA 1OPLA 2LGCA 2W1HA 1O6LA 3VS7A 4NKSA 4ZXTA 4NCTC 5GZ8A 3OEZA 5G1XA 5EHYA 4NUSA 2VO3A 2XYNA 3OBGA 4YU2A 4LOQA 1YI4A 2QNJA 3U4UA 3G0EA 3UBDA 1VYWA 2UZNA 3D9VA 1GZOA 3HP2A 3FMMA 3LVPA 3QRKA 2WAJA 3F88A 3W8QA 1OKVA 4Z7GA 2PWLA 2PMOX 4UBAA 4QMNA 5LXMA 3GOKA 3MDYA 3MVLA 3P5KA 4TT7A 4EJNA 3QQUA 3EB0A 4U5JA 2QURA 3NUAA 5D1JA 5JRSA 3BYVA 4K8AA 3QKKA 3U55A 4QYYA 4HZRA 5I9UA 3WYYA 4ANNA 5F9EA 4FTRA 4G3GA 3COMA 3IQ7A 4YSJA 1XH6A 2VO6A 4GEOA 4F08A 4QMVA 2V55A 2RF9A 2VWVA 3FSFA 4FSMA 4QYHA 3I0QA 4X2KA 3ZSGA 3KB7A 2B54A 3GB2A 5IEYA 4AWIA 2OK1A 4WD5A 4CMOA 4UMRA 1KOBA 5EOBA 2WQBA 2YDIA 3FDNA 4NK9A 3NMUF 3C13A 3UTOA 5K3YA 4IEBA 3V5WA 3ZFXA 2YITA 3E8DA 3R7UA 3AMYA 2X7FA 4FKTA 3PA4A 2FSLX 4D0XA 4YC6A 3PP0A 3I5ZA 2ZVAA 4FL1A 2RG6A 4FKPA 4M84A 3T9TA 2QLQA 5HU3A 4PMMA 4OBQA 3DXQA 5KMNA 4OT5A 4D1XA 2YM7A 4C33A 4EC8A 2E9VA 3TV7A 1HOWA 5JT2A 2GHGA 4FTIA 4E7WA 4AG8A 1ZYJA 3IGGA 4YHJA 2BCJA 4F70A 2BFXA 3TZ8A 2X9EA 5GZAA 2QOFA 1H0WA 5ANDA 2CNVA 2BROA 4R7IA 4D9UA 2EUFB 3GCSA 3RAWA 3OS3A 4NJDA 4IE9A 4O0RA 4FR4A 3ZFYA 4B0GA 2YWPA 2ITWA 3TL8A 2C6TA 3FC2A 2UZLA 3UMWA 3LFAA 4OW8A 4WOVA 3VC4A 4DEHA 2BRHA 5AP7A 4A4LA 2A0CX 5E4HA 4DTAA 2JD5A 3KMUA 4AU8A 1XKKA 4RIWA 4FX3A 4I0TA 5LWNA 4BHNA 3F5GA 3NCGA 2O63A 3UZPA 1PY5A 4OAVB 4CSVA 2J0KA 2XUUA 4GU9A 4PP9A 3VS4A 4AT5A 3JPVA 5CLPA 2PK9A 3KXXA 2XMYA 3VBTA 1R1WA 2PVYA 3F3TA 3G33A 1BLXA 4X3JA 5L2QA 4YTIA 2BZJA 4RIYA 3MFUA 4F7NA 1KOAA 3DTCA 4G9CA 2R3PA 3QGWA 2H6DA 4FNYA 4BCOA 2ITUA 2VTHA 4A9UA 4WHZA 2XCHA 3PXKA 3NIEA 3C4EA 3DQXA 4PNKA 5EKNA 3H9FA 4E73A 3ZXZA 1UNGA 2QOOA 4DFBA 1FVRA 3RZBA 2I0HA 3DKFA 5C26A 4WIHA 3ZSIA 2KULA 3COIA 4D9TA 4IAFA 5AV0A 5DIAA 1Q62A 3HEGA 4XOZA 2XCKA 3RM6A 3FHIA 2BR1A 4MD7E 1DM2A 2C5OA 3D0EA 3JVSA 4MNFA 3VBYA 4DEEA 2QVSE 5C8MA 2PMNX 4XJ0A 3KCFA 3CE3A 1OL5A 2X39A 4FT7A 5AWMA 3RINA 3W2QA 3C4FA 4E5BA 5BQ0A 4FEUA 3CCNA 4FTUA 3PIXA 2XEZA 4FKIA 4RVLA 4RWIA 5D10A 3HAMA 3TI1A 5C03A 3K5VA 4AUAA 2C3IB 3R7GA 3IDPA 4HGEA 4MQ2A 4CEGA 1O6YA 2Y6OA 3UOJA 4MTAA 3S0OA 3LQ3A 1RQQA 5AR3A 2ITVA 4J96A 5AUXA 3HMMA 4E20A 4EWQA 2WU7A 1V0PA 3SRVA 3U9NA 3D2IA 5AX3A 3UMXA 2PZ5A 1YDRE 3LE6A 3P79A 4GK4A 4QP3A 3R28A 3RMFA 3KGAA 1M2PA 5CF5A 1WBVA 2F7EE 2B52A 4QYGA 3BHTA 2PHKA 5IA3A 1JSTA 5LVNA 3QFVA 1GIIA 4H39A 3BPRA 4R7BA 2WTJA 4IX3A 3QTIA 1WBOA 5I9ZA 4O0VA 3PVWA 4LRKA 4EI4A 4I20A 4ZMEA 1IA8A 2GMXA 2HZ4A 4O7SA 3SG8A 3FSKA 4S2ZA 5CAPA 2GS6A 4FEXA 4H1MA 3OZ6A 4PMSA 5AV1A 4FTAA 5HGIA 3VBVA 2I7QA 1LPUA 4KIKA 3DLZA 2P33A 4JI9A 5HG9A 4A9RA 3KRLA 2W99B 5K5NA 3MI9A 5K5XA 3D5WA 3QU0A 3I7BA 2ZV7A 4AXAA 1YWVA 3LAUA 3C4WA 4E5WA 4QD6A 4V0GA 3ORZA 4WNPA 5FBOA 3TJDA 4IZ5A 3RAHA 3VUIA 2GCDA 1YXXA 1RJBA 2EB2A 3D7ZA 3FMNA 3FZSA 1UU8A 2VTAA 3AC1A 3ET7A 3EL8A 3UIXA 4YZ9A 4IX4A 1PF8A 2ITZA 5DVRA 4FTKA 5JFXA 5HE2A 2BVAA 5IQIA 4J53A 3UYSA 2PZRA 4KRDA 3KC3A 3O7LB 2ZMCA 4R3PA 2GDOA 4L7SA 4C0TA 3NW5A 2YIYA 4GK2A 4OBOA 3A7FA 4FG7A 4GMYA 2W1IA 1L3RE 2R2PA 2W06A 4UZHA 4ZLYA 5LCJA 2EXMA 3JY0A 3DAJA 3LMIA 3IPHA 2WELA 5CSHA 3UG2A 1PYEA 1WZYA 3R1NA 4QPAA 3NUNA 2Y8OA 3FMEA 1SVGA 1R0PA 4PDSA 3TACA 3LPBA 5EI6A 3F9NA 5CI7A 1ZRZA 3EQPA 3LJ1A 3O71A 1A06A 4JRVA 3SOCA 3V5TA 2R3MA 3DB8A 4AACA 2XK8A 3ORIA 3MFRA 3QXOA 3R73A 4C4IA 1JSVA 2XNPA 4XG7A 1H1PA 3FKNA 2CGWA 3PTGA 3ANRA 4FEQA 4KKHA 4Y72A 4F9AA 4JG6A 3LMGA 5J7HA 3U8WA 5IQAA 1FPUA 4XX9A 3BLHA 3K54A 4RVKA 3TG1A 3UQFA 3GOPA 4GS6A 3EQRA 4QNAA 4LGDA 4S31A 5KX8A 4D5HA 4XG9A 2WMVA 5AUVA 3F3VA 3N4UA 4I4FA 1UWJA 4P7EA 2CJMA 3HVCA 3FI2A 4R3CA 3UOLA 2E9PA 4IDVA 2ITYA 4DLIA 3DV3A 2XNBA 3GNIB 3QKMA 4OLIA 4UMPA 5J5SA 5EH0A 4BZDA 5E8UA 4AZVA 3BYMA 4GFMA 5E92A 3OD6X 4RQVA 2CKPA 2BKKA 1OVEA 5IEVA 2QG5A 4FYNA 4XG3A 3VS3A 1FGIA 3BLRA 2QOQA 4FG8A 5DRDA 3ZYAA 4E3CA 5AR2A 1XH5A 2XIRA 2EB3A 3W32A 2CCIA 2CHLA 3Q5ZA 4OTWA 1VEBA 3JXWA 4I6BA 3IG7A 5CAQA 3DT1A 3RHKA 1NT2A 4N4SA 2VX0A 3BBWA 4YPDA 2VO7A 5EW9A 5BYLA 4QQTA 5GZ9A 1Z9XA 2W5AA 3LZBA 5E8YA 4C34A 4S33A 3PRFA 4WSYA 5I4NA 2XIYA 4GVAA 5GJFA 3IONA 3CS9A 3BE9A 4K77A 5ANEA 2C0TA 2IO6A 2YIRA 3VS5A 3A62A 1DI8A 4C2VA 2XA4A 4R77A 3T8OA 4TZRA 3OXIA 1OBGA 4F7LA 1XH4A 2VRXA 4AS0A 3C9WA 3GVUA 4YUQA 2Y4PA 4FL3A 3V8SA 2XJ1A 5BYYA 3AC4A 4EHGA 3N51A 5FRIA 4BCFA 5CNOA 3ZO1A 3IW5A 5HCXA 4XRJA 5CY3A 4FK3A 2R3OA 3ZEWA 4DGNA 4C4HA 3Q9YA 5M4UA 4DEDA 4D4SA 1UWHA 1WVYA 2HZIA 2XP2A 3EMGA 4DH8A 3UO6A 3HL7A 4PL4A 3RTPA 4D58A 3FLYA 2Z7SA 4D0WA 2QR7A 1UU3A 2B9IA 2JBOA 4YJTA 5DA3A 3PY0A 4O96A 3V8WA 5A6OA 3IOKA 3E8NA 3BHUA 3E93A 2ONLA 1ZWSA 2WQNA 5AP3A 3QWKA 3OTUA 1UU9A 3FZ1A 2BRBA 5CQWA 5EG3A 3EKKA 4UXQA 5I5ZA 4IWOA 2JAMA 3CTJA 3MFSA 4FZFB 3V6RA 3R04A 1XBAA 1PXLA 1UU7A 3E8CA 3QUPA 4CFWA 2VZ6A 1H27A 4LYNA 2UVZA 4CTBA 2BMCA 4XHKB 4C35A 2OG8A 5AUUA 2FA2A 2X7OA 3E5AA 4QMSA 5T3QA 3P9JA 1YXVA 3MTFA 5AUYA 1MP8A 1KV2A 4RJ3A 3AC3A 3T9IA 2DUVA 4GIIA 5CEIA 2B9FA 3MY5A 1GIHA 2WHBA 3EN7A 4WG3A 3NYVA 3ZLYA 1V0BA 3KXGA 3R8ZA 1IA9A 4Y46A 2VTSA 3SOAA 1Q99A 4CV8A 3PA5A 3WZKA 1PXOA 1W82A 3PJCA 2REIA 3DGKA 5E7RA 3EOCA 4FUYA 1EH4A 5IMEA 3COKA 3DBDA 3GC7A 3ZONA 4FT5A 4D2PA 3O8PA 4WRGA 4AP7A 3NAXA 1PXPA 4MNEB 5KBQA 3HRFA 4U97A 5CU2A 2PUNA 1Q8UA 4IBMA 4CYJA 3VUGA 1KWPA 2C6OA 3IDCA 3E3BX 4FVPA 4NM7A 4J8NA 5ANKA 4ZSLA 4F6SA 3C50A 5AV4A 4MWIA 3KRRA 1H24A 5C4KA 4XLIA 1JNKA 3QQHA 2RKUA 2AC3A 3HGKA 5JGAA 4KS7A 4DE4A 2VTMA 1CSNA 2OJ9A 2PVLA 5E8TA 1YHVA 3F3ZA 4ITIA 4TWPA 3OROA 3B8QA 4I5HA 4MHAA 3R8VA 4ACGA 3PYYA 4AW0A 4DHFA 2WPAA 3Q6WA 1RE8A 5ANOA 3H3CA 3HECA 5GJDA 4Z9LA 3FLZA 4C37A 4I4EA 3R22A 2OXDA 3DB6A 1ZZLA 2FUMA 3DY7A 3Q52A 4UWYA 2WMQA 2X8DA 4ALVA 3NW6A 5A4TA 4O83A 3REPA 4WNMA 3BRBA 2QHNA 4DT9A 3ITZA 5CSVA 3QHRA 4OT6A 4OTDA 3VUDA 4HPUE 4PL3A 3DBCA 4IIRA 4R1VA 3UOHA 1MRUA 4QP6A 4F9BA 3Q9ZA 3ODYX 4FNWA 4BI0A 4USEA 4FE2A 3HX4A 1IAJA 2JKKA 4M68A 2BZKB 3PRIA 1F0QA 4JX3A 4HGLA 4EH8A 4IAAA 5CANA 1CMKE 2QOBA 4ENYA 3OW3A 3QAME 3RZFA 5ETFA 2IG7A 2CN8A 3FLQA 2KTYA 3OWPA 3ZTXA 3QRIA 4D4VA 4BWPA 3OP5A 1H00A 4MD8E 2HWOA 3FC1X 2C5VA 3GBZA 3R21A 4XCUA 4MQ1A 3R7VA 4YSMA 1J7LA 3LXPA 3TZMA 5EQEA 2E2BA 5B7VA 1O6KA 2QOLA 3DK7A 4JL9A 4QQ5A 5IZFA 1KUTA 3BQRA 2ZB1A 1OIUA 3BHHA 3FZOA 2XM8A 1PXKA 4KINA 4YJVA 2JLDA 3RI1A 5LMKC 5FEQA 5JN2A 4U0IA 3MB6A 2DYLA 1TKIA 5EW8A 4CZYB 2J7TA 4TNDA 2R3RA 4TYHA 5L2SA 4QMYA 1RW8A 5HCZA 3GU4A 1QPEA 2W4OA 2CMWA 3FJQE 2YAKA 3I0OA 1DAWA 3EN9A 2X4ZA 4FTNA 3BLQA 3PSBA 2ZOQA 3TZ9A 4TPTA 2B7AA 4M8TA 4R6VA 1W83A 2UZWE 4BDJA 5BNJA 4YZBA 2B4SB 3E62A 3H30A 3HMPA 5I9XA 1PYXA 5L3AA 5J1WA 2O5KA 1SNUA 4EBVA 3OCGA 2OF4A 3ORXA 3SHEA 3N4TA 3R63A 2UZUE 3EQGA 2YN8A 4G3FA 3P7AA 4J95A 3R8PA 5HNGA 4ANLA 4HVIA 3EQFA 5DOSA 4NM3A 4FKJA 5I3OA 5TE0A 3NWWA 1YDTE 4QPMA 1URCA 1BL7A 3EQIA 1P5EA 3ZM4A 1LP4A 1JKKA 4FTLA 4L01A 5AP0A 5J9LA 1Y8GA 5DR2A 2H8HA 1FGKA 3HMNA 4ID7A 2IZTA 3D5UA 5DFPA 4DH3A 1Y91A 2OI4X 3ORMA 5D9HA 1L8TA 2CKQA 4RIOA 2PUPA 3GENA 3QTZA 5I9WA 1DI9A 3NS9A 4RLKA 1NXKA 2PVHA 3I7CA 5IH4A 2WTKB 4R5YA 1XBCA 2YM5A 4O0UA 3SC1A 3FYJX 4XP0A 3MTLA 4DH7A 3AD6A 3IOPA 2XB7A 4K33A 5L2TA 2C1AA 2ZYBA 3OBJA 3KEXA 5LARA 1SZMA 4G34A 2WMSA 3TKIA 1YRPA 1UVRA 3QQLA 2YHVA 3CPBA 5BYZA 3A60A 3FZTA 4GV1A 5KMJA 3UVPA 3SX9A 4FIEA 2YM6A 3FZPA 4OTRA 5B0XA 3I60A 2HYYA 3HMOA 4UMTA 3QD3A 1WMKA 4XG6A 4NL0A 4RQKA 5L8JA 4L44A 4UMUA 4EZ5A 2IZSA 4M67A 3ORNA 3LLTA 3NUPA 3ULZA 4BGGA 4C3FA 4JG8A 5CT7A 2Z7RA 4OTGA 1KE8A 5LMAA 5DEWA 4KABA 4DFNA 5JFWA 2H34A 4BCKA 3G6HA 3RCJA 3EYGA 4BGHA 4DTKA 3ROYA 3UVRA 4M13A 4W9XA 4B8MA 3QA8A 5C1QB 2F2UA 5IA0A 1BI7A 1H1RA 2Y9QA 3NYOA 4EKKA 3EQHA 3RPRA 2UW3A 3EFJA 4BCJA 3FXXA 3Q53A 3QTQA 3O96A 5CVGA 4KB8A 1Q8YA 3P78A 3NPCA 1Q8TA 3O0GA 4HZSA 4NSTA 5DRBA 5HNBA 3FMLA 5EKOA 1PKGA 1Q3WA 2Y7JA 3BEGA 3QGYA 4GT4A 3Q4UA 3JS2A 5KMOA 2BFYA 2XK9A 4R78A 2JDRA 2WFYA 5KNJA 4BDGA 1OUKA 1WBTA 3R8UA 3UO4A 4M0YA 3MWUA 4B99A 1H28A 3AT3A 3O50A 4MXYA 4WNOA 3SD0A 4RIXB 4P5QA 4ACCA 3C5IA 3KY2A 3ODZX 4JQ7A 4GKHA 2GNIA 4U41A 2OFVA 5IG1A 3NZ0A 4FKVA 4JR7A 4BKJA 2UW6A 5J95A 1U5RA 4GU6A 4RC2A 4L43A 4IZ7A 2YM8A 3VW8A 3EZVA 4EOQA 4DITA 4MXXA 4O22A 2R7IA 3D14A 4OUCA 2PU8A 4QP2A 2C0IA 3LCTA 3MSSA 2PZYA 4UYNA 4A4XA 4E4NA 4ENXA 5FXSA 2PMLX 4TW9A 3NDMA 2ITNA 4E4MA 2DS1A 2J50A 2Y4IC 3HV4A 4NEUA 4O86A 3FY2A 3VBWA 3ULIA 4O84A 3E7VA 4IB0A 4I6QA 3RWQA 5TT7A 1R3CA 2B53A 4CFMA 2QQ7A 4YHFA 5JZNA 1A9UA 3W2PA 3PLSA 4O0WA 4CV9A 2VWWA 3II5A 4JJRA 2R3IA 3PUPA 4G5JA 4BI1A 1WBWA 3I1AA 2XS0A 3PVBA 2QG7A 3PXFA 5EM5A 3W8LA 4Z55A 2XZSA 4IXPA 5HX8A 4U45A 3DQWA 1DS5A 3HV6A 2OJFE 1WFCA 4EONA 4F1TA 2YCRA 4BYIA 2ITOA 1Q4LA 3I5NA 1G8AA 2ETMA 2QI8A 5KZIA 1Z5MA 4X2NA 4TYGA 4EOKA 3DKGA 5CEPA 3GUBA 2W1FA 4I21A 1APME 4Y73A 4IM3A 5J87A 3LFCA 3QYZA 3NNWA 4IZAA 4J1RA 4V0GB 3SLSA 1XH7A 5A4LA 2NP8A 1O9UA 4UEUA 4ZLZA 2PVJA 2FSOX 3G51A 2F57A 4M7IA 4Y5HA 4F09A 1P4FA 4KUJA 2XIKA 3P7BA 4GJ2A 2R5TA 3WILA 2UZTA 5C01A 2W1CA 3ID6C 3ALNA 3PSCA 5LJJA 1ZMVA 4WKQA 4FSTA 2YM4A 5C8KA 4A9YA 4U3ZA 3I6WA 3W16A 1B38A 4LRJA 4RA5A 5E1SA 5TR6A 4ZSAA 2CN5A 3LXKA 4O0XA 5DMZA 4C61A 4DFXE 2HXLA 3ACKA 3S2PA 5ETAA 4O7NA 5CU0A 2WQOA 4AGUA 4Y5QA 4CT2A 3CY2A 4X0MA 3TKUA 3QKLA 4IWPA 5LCKA 4QO9A 3NCZA 3F66A 4HOKA 1J7UA 2OBJA 4LGGA 5TF9A 4AA4A 4BICA 3LCSA 1M17A 3HZTA 3WI6A 2YIWA 3WZUA 3WZDA 3MGYA 3S00A 3TUCA 1LEZA 4C57A 2GSFA 1STCE 4BDAA 2GQSA 3DK6A 4QP4A 4JQ8A 4M97A 1V1KA 1ZYLA 2R3HA 4QOXA 4RA4A 2B1PA 2XJ2A 3NNVA 4ZLOA 3ALOA 4ACDA 5BX0A 4EH7A 4RJ6A 4ZZOA 3WARA 3ZH8A 1SMHA 2HK5A 2SRCA 2UZBA 3BU6A 4CLIA 5HTIA 5E9EA 4XUFA 4EOSA 3NYXA 3ORLA 4BZNA 4EC9A 1H1WA 2HAKA 3I79A 4ANSA 5IH6A 4EK6A 3PJ2A 3UC3A 4BGQA 3RPYA 5HORA 4YO4A 2BKZA 3TKHA 4AGWA 2UZVA 2VTJA 1BYGA 5CEQA 3QC4A 5L6PA 2XH5A 3TJCA 1MRYA 2CGVA 4FTTA 4YR8A 4O7LA 4AW5A 5HCYA 1Y6AA 4F9WA 2XNNA 2FO0A 2DQ7X 5EHOA 4XG4A 1UKHA 2BAQA 3EQBA 1JKLA 2X8IA 5HD7A 3MY1A 4A9TA 4ZZMA 4AZWA 4ZTSA 5KUPA 3TWJA 4ZY5A 1AGWA 4RFZA 3OCSA 4EWHA 2O0UA 4Q5EA 5JK3A 4KS8A 3UP7A 4YLKA 3W33A 5HE1A 4NT4A 4X3FC 1J1CA 3PZHA 4YO6A 2VN9A 4D2SA 3CJFA 4Z16A 1HCKA 4W8EA 3UP2A 3RBWA 4FKWA 4KA3A 5HICA 4EHEA 5DI1A 2OU7A 4EJ7A 1KV1A 4RJ7A 3BYOA 3PJ8A 2VNYA 3VUMA 4UN0C 2IJMA 5FDPA 3LFQA 2WMXA 5AM7A 3FEGA 3E87A 3FLNC 4KKEA 4CFUA 5M53A 2AC5A 1OGUA 3F5XA 4R3RA 5FDXA 4F0GA 3MH1A 4NCTA 1LUFA 2ITTA 4IH8A 3RCDA 3VS0A 2C68A 4AGDA 2WD1A 3OWLA 1ZYSA 1FQ1B 5BUJA 1YW2A 3NUUA 5HIDA 1OIRA 3ETAA 5DH3A 3OXZA 4XMOA 4ALUA 1GZKA 5KZ0A 4HNIA 2QKWB 2YCFA 4MKCA 2O65A 4WRSA 3RPVA 5IA4A 2JIUA 3L9NA 3RVGA 4P5ZA 3C51A 4FZ7A
chains in the Genus database with same CATH superfamily
4FSYA 1JKTA 1U46A 2H9VA 3EKNA 4II5A 2VU3A 4FT9A 4MK0A 5FXQA 2IVVA 4RWKA 3R1SA 4ZZNA 3PY3A 4HYUA 5JEBA 3TYKA 3UZRA 3G9NA 4NH1A 5KHXA 3D15A 1KE9A 4GG5A 3EH9A 4H58A 4BVUA 5M09A 4XG2A 4ERKA 3FL5A 2CKOA 4V01A 4ZIMA 2HENA 3FMJA 4YJOA 5AR5A 3NRMA 4I93A 3FQSA 5M57A 4EH4A 2R7BA 1A48A 4RX5A 4RIXA 5D11A 5A54A 5C4LA 3NVMB 3TNQB 3CXWA 3THBA 3F3UA 3LFEA 1FINA 4XBRA 4QP1A 4KIQA 4USDA 4LMUA 3RALA 4V05A 5AADA 5AUTA 5CEKA 4N57A 4ZJIA 1OUYA 4A4OA 4BHZA 2RFSA 2QCSA 4H1JA 5IUIA 4DAWA 2QC6A 3C4CA 5GNKA 4G1WA 4EK8A 2XEYA 4MXAA 4YMJA 4O82A 4AE9A 3MFTA 3DKCA 4RC4A 5BVKA 4FGBA 4CGAA 1M52A 3QXPA 2VTQA 3GQIA 2OGVA 3F3WA 3FWQA 2QONA 1J91A 2X81A 4EOOA 4G2FA 4FT3A 3GFWA 4IAKA 3A61A 3PIYA 2R3JA 1OPJA 3VRZA 1XMLA 2VUWA 3RAIA 1H08A 3F5PA 4FKRA 4M15A 4HPTE 4H3PA 3W2RA 4QP7A 2Q0BA 3R7OA 2W17A 3E88A 2WMAA 4YP8A 2XF0A 3P0MA 5DN3A 4BWKA 1R78A 4DEBA 3NGAA 3C1XA 4I5CA 3QA0A 3MV5A 4U3YA 2WMRA 2Z7LA 4AN3A 4BCIA 3HYHA 2IPXA 3DFAA 5FBNC 3NW7A 2ZM4A 1ZYDA 3SXRA 2C30A 2A2AA 1W8CA 3OFMA 4BRXA 1VYZA 2NRYA 2JFLA 3KCKA 4X2FA 4AA5A 4ZS4A 2JITA 3V8TA 4EQMA 2UVXA 3DDQA 3PXQA 5D7AA 3UC4A 4X6QC 3V51A 3AMBA 3ZBFA 3MVMA 3GI3A 3KN5A 4QTBA 3C0GA 5CAOA 3R00A 4G6LA 5HU9A 1ZY4A 4FI1A 3D83A 5DWRA 4B6LA 1G8SA 1FOTA 4CG8A 4IZYA 3JVRA 5E8XA 3C4ZA 5FQDC 3ZLSA 4RJ4A 2XYUA 4CXAA 1TQIA 3TDWA 4O21A 1YWNA 5FEEA 3R7YA 5HTBA 1W7HA 2NO3A 3AMAA 3PJ1A 4F63A 3IW8A 4AOJA 3G15A 5LQFA 2J51A 2VTLA 4R8QA 2B0QA 2AUHA 2WZJA 5KHWA 3L8XA 4J52A 4L00A 5CT0A 2PYWA 1H1SA 4FKLA 3ZFMA 2VTNA 5CQUA 4FSZA 5CX9A 5IEXA 4TKSA 3U51A 4W8DA 5ITAA 3R01A 2W1EA 3FY0A 4JS8A 5F4NA 5HEZA 2QO9A 3W18A 3G90X 5E8ZA 4RMZA 1Q41A 5FM2A 5CWZA 2Z8CA 1GNGA 2PZPA 2BHHA 2QODA 2OIBA 3POOA 5H8EA 4ANOA 2IVSA 3TUBA 3DXPA 4MF1A 4TYHB 2J6MA 1OPKA 1OIYA 3Q32A 4U8ZA 2WMTA 3F2AA 2WGJA 4EOJA 3QRJA 3V01A 1JOWB 4BYJA 5AMNA 1JBPE 2XALA 3G5DA 4ARKA 4IB5A 3FMKA 2ZM1A 4CT1A 4O7VA 3ZM9A 4KWPA 4PNIA 5E1EA 2ONLC 1YOJA 3AD4A 3IK3A 4QMLA 1XBBA 4QQJA 2X4FA 4UXLA 4CLJA 3DAKA 3R8LA 4MX9A 4AE6A 3PXRA 3HDNA 5HQ0A 3O5AA 2C6LA 4E5AX 4ANBA 4A7CA 5CEOA 2YWVA 4RWJA 4EYJA 3U54A 4L46A 1Y6BA 4DCAA 1FMOE 3UNZA 3WE4A 1ATPE 4EHZA 3FKOA 2JEDA 1F3MC 2P2IA 4FC0A 5AIRA 3DTWA 3OCTA 5FLFA 4RJ5A 4ANMA 4ZTHA 4J99A 5AX9A 4KIOA 1URWA 3RGFA 2GPHA 4UWCA 4QMTA 2IZUA 2XBAA 2FGIA 1PXJA 3GCQA 4FTQA 3L9MA 2XKEA 4XBUA 5BMMA 4C4FA 2XKFA 4PUZA 4YGAA 4ASXA 1REJA 5AP1A 2I1MA 3QTUA 2V5QA 1H0VA 2Y6MA 4XP3A 4ITHA 3HKOA 5AR7A 4PQNA 4IANA 3FI3A 4HNFA 5CTPA 4AW2A 1DAYA 4GVJA 3PFQA 5BVEA 4DBNA 3W2SA 4FZ6A 2I40A 3NLBA 2OJIA 2RFEA 3ZZWA 3W0SA 2PVKA 3BEAA 1H8FA 1WBPA 2F7ZE 3VNTA 4QYFA 4Z3VA 3VWAA 4FEWA 2B9HA 3OY3A 1KE5A 2YCSA 3ENMA 4EOMA 2ITQA 1ST4A 1SVEA 3DNEA 3F6XA 3RM7A 2C3LA 5AP6A 2W9FB 5EQPA 4UX9A 2J4ZA 2PTKA 5IDPA 3PDTA 5G6VA 3GC0A 4RVTA 1F5QA 3P08A 4TRLA 4IMYA 5E91A 2BHEA 4C38A 1OIQA 3VAPA 4S34A 4RX9A 4LUDA 5JGBA 1OL6A 3VUHA 1M7NA 4F7SA 2VO0A 3NNXA 3R9DA 3ZUVA 2ZFYA 2YLEA 4F4PA 1ZZ2A 4LRMA 5IISA 4KD1A 3KRJA 1NVRA 3MVHA 3A8WA 2FB8A 5IU2A 3MVJA 4ACHA 1V0OA 3G6GA 2XRUA 2PVRA 4YJUA 3H9OA 4G3CA 3NAYA 5AM6A 4CRLA 4EORA 1PRYA 1S9JA 2WQMA 2X9FA 4MWHA 5DT0A 5H8GA 2J0LA 3QL8A 4EEVA 5CXZA 4G17A 3AC2A 4HJOA 5CVHA 4IW0A 4E6DA 4F6WA 5FTGA 2W5BA 3UJGA 2GFSA 2HY81 4JDKA 4BB4A 1ZY5A 3JYAA 3LJ2A 4TYEA 3A2CA 4IX5A 4MYGA 2BZIB 1XH8A 2RG5A 2UZOA 3RK7A 4HCTA 4OGRA 3DLSA 3PUFC 3UDZA 4MXOA 2I0VA 3KA0A 4EK4A 1H01A 4G3DA 3W2OA 3WE8A 3FPQA 3QD4A 3FMHA 4N6ZA 3MH2A 3OHTA 2RL5A 3H0YA 4LV7A 4I41A 3TTJA 4EH5A 3IW4A 5K4JA 1RDQE 4Q9ZA 3FHRA 5ANGA 4GJ3A 4YBJA 3CY3A 3VIDA 4QTAA 3GXLA 4YJPA 3K2LA 3R83A 4IDTA 3TCPA 4W4YA 2G01A 2P55A 5IQCA 4FTCA 1HCLA 4IQ6A 3MJ1A 1OB3A 3K5UA 2QOHA 2NYAA 3FKLA 2X0PA 3WF8A 1YXUA 4LV5A 2G1TA 4EYMA 3ZO3A 4HVSA 2NRUA 4GT3A 5B2LA 4QPSA 5HVKA 2UVYA 3QTWA 3QZGA 4Y85A 4EH2A 3O17A 2J9MA 4FV6A 5IQEA 3D2KA 3QWJA 3DU8A 3R9HA 5HVJA 3JUHA 3C0HA 3CBLA 3A4OX 5DT4A 1VZOA 5L4QA 2Z7QA 4OBPA 4H36A 2BRNA 5CALA 2QO2A 4DC2A 4TNBA 2UZDA 3ZEPA 5M4FA 4EBWA 4WG5A 3R0TA 2X2MA 3P86A 5FXRA 5IQGA 3A99A 3CKWA 1Q61A 3BWJA 4ZTLA 4BCNA 2CKEA 2GTMA 4MCVA 4QMZA 3AD5A 3CTHA 4I24A 4ALWA 3WOWA 3QBNA 2GS7A 4P2KA 1YHWA 4FV2A 3V3VA 2OIDA 4DLJA 2YISA 3HV3A 4Q2AA 4C3PA 3QD0A 4JG7A 1PXMA 4FV9A 4YPSA 4U79A 4AW1A 3LFDA 5EDPA 2XK6A 4X2JA 4CTCA 2YA9A 4PTEA 2WU6A 3VUTA 4D2TA 1P4OA 5JRQA 2ITXA 4RZVA 4IVAA 2IW8A 4HW7A 4CQGA 3EL7A 3QZHA 4DDGA 1PXNA 3OUKA 4HYSA 4FOBA 3OWJA 5AV2A 3B2TA 4BKYA 2F7XE 3ZS5A 2OIQA 2F9GA 4UALA 4EQUA 2OKRA 4FKUA 2VTTA 3D7TA 1OL7A 3ZDUA 2R3NA 3PP1A 3GU8A 4NU1A 2ZMDA 1XWSA 3DNDA 2C3JA 1UNHA 2QOKA 1Q8ZA 3KXNA 3LCOA 4GIHA 4KRCA 5HG5A 4DTBA 4JOAA 4R7HA 4JVGA 3V5QA 2PE0A 3EQCA 3KVWA 3OCBA 4JQEA 3GEQA 4W4WA 3SXFA 4BI2A 3U6HA 3OG7A 3QTRA 3DBEA 5E8WA 4PPCA 4E6QA 4ZOGA 5AUWA 4GT5A 2W9ZB 3SDJA 4FODA 2QD9A 2ITPA 2WMUA 2VTPA 3GFEA 4FNZA 4DFYA 3BX5A 3PA3A 4HCUA 2EXCX 4D55A 3QD2B 5GIPE 3EN4A 2PVNA 4XS2A 4UYAA 3ANQA 3RPSA 3L1SA 2LAVA 4JAJA 1U54B 3E92A 3QQJA 1OKYA 4RWLA 3F2NA 5KKRC 4W9WA 1JAMA 2WXVA 3CGFA 3QCYA 5C9CA 4FTJA 2YJRA 4BN1A 3BKBA 2X8EA 4BTFA 4QMXA 4FZAB 4NKAA 3IW7A 3DKOA 4BDEA 1IG1A 2CNQA 4FOCA 3MESA 4C4GA 2O2UA 3DAEA 1I44A 3QUDA 5FG8A 4DFLA 3Q04A 2R3GA 3BGPA 3HUBA 4FYOA 2HXQA 4DBXA 2EU9A 4K9YA 1SNXA 3HMIA 5ANJA 3CSVA 4RLLA 4F99A 2WB8A 3A7IA 3PJ3A 3KL8A 1P14A 4BDDA 4FNXA 4BDIA 4BIDA 3SKCA 4JR3A 3HA8A 4A07A 5A6NA 1YI6A 3TNHA 5CZHA 3Q96A 4BWXA 4FRFA 2WIHA 3R7EA 1Q3DA 3H10A 5AIKA 3BU3A 4ZSEA 4KBAA 2FSMX 1ZXEA 3IW6A 3WYXA 3MB7A 2JFMA 4L8MA 2X6EA 2R9SA 3MH3A 4RG0A 4ZTNA 5EW3A 4RVMA 5TOZA 2EXEA 2J90A 3FYKX 3H9RA 2JIIA 4QT1A 4AZEA 3LW0A 4L68A 4L3LA 4PPAA 2ZV9A 1R39A 4ZEGA 5M4IA 3UPZA 1QPCA 5J79A 4EH9A 1TVOA 4IACA 2UZEA 2FH9A 2YAAA 3G9LX 3F82A 4FSNA 4QP9A 5F94A 3U6JA 3Q3BA 5LMKA 4G6OA 3PVUA 5CASA 4EZ7A 4ZP5A 2J0JA 1XR1A 2W0JA 3VS2A 4DGMA 2WMWA 1B6CB 4G31A 4IM0A 4JRNA 3VS6A 4X21A 4GCJA 4X2GA 5T68A 2QR8A 4NTSA 2WNTA 1Y8YA 2YDJA 4D2VA 4O7ZA 5DHJA 4AGCA 3QF9A 4FV3A 5EM8A 2Z02A 5TO8A 1Q97A 3OVVA 3RK5A 1ZOGA 2QLUA 5FP5A 3L8SA 3QQFA 2YACA 4I6FA 2P0CA 1YXSA 4NIFB 4LL5A 2QU5A 1XJDA 1YHSA 2I0YA 4Y95A 2BUJA 4FICA 4CNHA 2XARA 3QQKA 4U44A 3VRYA 3A4PA 3SXSA 2HCKA 3KMMA 5BVDA 1OZ1A 3PLAE 4YNEA 2G15A 3OOMA 4QQCA 2NNWB 4U7ZA 3SA0A 4O6EA 3AKKA 4IWDA 4XV9A 2CGUA 5IA1A 5I0BA 1P2AA 5HG8A 3NVKI 2OFUA 4BL1A 4DH1A 2J5EA 2PZIA 2JGZA 3NUSA 4MD9E 4WG4A 1M2RA 3UPXA 3KF4A 4P90A 1OECA 2ETKA 2CPKE 3ENHA 3OC1A 5HE3A 4D1ZA 3AC5A 2ZM3A 4EH6A 2OWBA 4G3EA 3QTXA 2BRMA 3FV8A 3LQ8A 3KU2A 1PW2A 2BALA 1QPJA 4RT7A 2F49A 2RGPA 3G2FA 4FL2A 3TEIA 5M4CA 2GNFA 4DN5A 2BIYA 4YZCA 5BPYA 4YZDA 5JFSA 2VNWA 3R6XA 2PPQA 4FGRA 4ZTQA 4BBEA 3I81A 4WSQA 2JBPA 4NFNA 5L8KA 4G6NA 2XNOA 1Q24A 4PMTA 4DEAA 1OL2A 1W84A 4DFZE 4HGTA 4RJ8A 1PHKA 3V5JA 3AXWA 2PVFA 3BGZA 4M69B 4UWBA 4X3FB 4BDHA 4FSRA 4YLLA 3WIGA 2OLCA 4JLCA 3R30A 4EK5A 1MQ4A 3EHAA 5H8BA 4I22A 2AYPA 3CQUA 5FTQA 5H3QA 5AV3A 1YWRA 1ZAOA 3DBQA 3VULA 2P3GX 3QRTA 4CG9A 3Q2MA 2HWPA 3KULB 3PVGA 4ANQA 5JH6A 3OW4A 2E9OA 2IN6A 2OZAB 4O81A 4WT6A 3DK3A 2IW6A 3U6IA 4DHIB 2XVDA 1OL1A 3ZC6A 4BTMA 2V7AA 2YDKA 4GW8A 5EM7A 3VBXA 1H07A 4CKJA 2WTKC 4KBKA 4BFMA 1BUHA 1NVQA 4GSBA 4O91A 4UY9A 1OMWA 4RZWA 4APCA 5L6WL 3DJ6A 1BX6A 3MPTA 3EFKA 5CU4A 3HAVA 4ASDA 4PY1A 3MW1A 4FV0A 2BTRA 5ANIA 1IEPA 4D2RA 4XNEA 1CTPE 4KSQA 4CZTA 3NR9A 2ETRA 4H3QA 3VJNA 3ZZEA 1MQBA 5K0XA 1ZARA 4BTJA 5HTCA 4YC3A 4IC8A 2WIPA 4FKOA 4XOYA 4U40A 3GP0A 3TIYA 4OR5A 5I9VA 3KREA 2XIZA 1GAGA 4FKGA 4YJNA 5C27A 4I5MA 3OXTA 3QCQA 2GNHA 3O7LD 3CJGA 3BZ3A 3WF7A 1NW1A 2Q83A 5BVWA 4QNYA 3M2WA 5BVFA 4PP7A 2JKMA 2XANA 4O1OA 4F0IA 4B8LA 3TV4A 2O3PA 2BZHB 2V22A 5AP4A 5EHLA 3TV6A 5IA2A 1BI8A 5F1ZA 4EOPA 5CI6A 2PULA 5FUTA 3BCEA 1OKWA 1NVSA 4FIIA 3CQEA 3ZUTA 4RRVA 2GHMA 2IVUA 1CDKA 1GY3A 4KBCA 5E90A 4UV0A 4IAIA 1U54A 4L9IA 2C5YA 3NUYA 2ZDUA 4IJ9A 3SQQA 4QRCA 1PMEA 4MXZA 4XV1A 4E4LA 4E4XA 4NWMA 2GHLA 2VAGA 4KSPA 5HHWA 5JSMA 2VGOA 2J5FA 3QRUA 3FXZA 3GCVA 3WZEA 4DG2E 4IVCA 3S4QA 2FSTX 3LHJA 1ZLTA 2HOGA 4J71A 5K0KA 1PMUA 5IF1A 3I6UA 2QO7A 3LXNA 4LI5A 4ZMFA 5ACKA 4LOPA 1ND4A 2C6KA 5DG5A 2VTIA 2XK4A 2HW7A 4PV0A 4O0YA 1GIJA 5BUIA 3BHVA 3FZRA 2IW9A 3TNWA 4BCMA 3SW4A 4D28A 1M7QA 4S32A 4PDPA 4O4DA 3ELJA 4I5PA 4PWNA 3UNJA 5HNIX 2CNUA 3AC8A 5BV3A 3HA6A 5E8VA 4LQMA 5JZJA 3ACJA 3LCDA 3ORPA 2CGXA 2PE2A 4O0TA 2RIOA 5CNNA 3NIZA 1QPDA 4O7RA 3SW7A 3EYHA 1XHAA 4QTDA 2OXXA 2BDFA 4RFYA 4AXCA 4U42A 4F7JA 3BBTB 1OGYA 4CCUA 5DE2A 3JY9A 4AA0A 3GCUA 3HLLA 3W55A 4JDIA 4YJRA 3OOGA 4BCQA 3CPCA 5HLWA 4K2RA 4J8MA 4BIBA 4AFJA 2UUEA 4R5SA 1E1XA 4KIPA 4CMUA 4OAUC 3KQ7A 5CS6A 4G9RA 2GFCA 2V7OA 4TWCA 5M56A 4FV7A 3UZTA 4ZTRA 4U80A 2I6LA 2XKDA 5B2MA 4G5PA 1T45A 2HZNA 2I0EA 2R3LA 5JKGA 3R02A 2RFNA 2ZJWA 2PL0A 5DEYA 5F20A 3NFGB 4AOTA 4D1SA 4FEVA 4NW6A 4DT8A 4IJPA 3FXWA 3ZC5A 3KMWA 5CU6A 5I3RA 4HGSA 2OXYA 4ZSGA 4EOLA 5L6OA 1H25A 4O7YA 2UW7A 4NFMA 1ZMWA 3VONA 1UA2A 2ESMA 2XNEA 4EL9A 3PG3A 2WO6A 4NIFA 3IECA 1WBSA 4I1ZA 2EVAA 3K3IA 4CFVA 4CVAA 3S3IA 3GC9A 4ZY4A 5LVPA 4YNOA 4C02A 1H4LA 4QMPA 3VF8A 4UZDA 3R9NA 5DPVA 3M1SA 3OT3A 3QC9A 5L8LA 4F1MA 3OWKA 4IB3A 4DF3A 4GK3A 4FV8A 3UYTA 4BBFA 2BAJA 5M07A 5IQDA 1ZOEA 2W4KA 2WTVA 5FGKA 2CCHA 4FT0A 4FV5A 1PMVA 3CP9A 3FAAA 4YC8A 4O7TA 2QHMA 4O4EA 2WKMA 5EFQA 3HP5A 3E64A 3MIAA 3HUCA 3PZEA 3D5VA 3Q9WA 4QTEA 2UW0A 1JVPP 4JBVA 4AN2A 1AD5A 2WOUA 4I0SA 4XEYA 1BKXA 4F6UA 2YERA 5IH5A 4XV3A 3QALE 3WF6A 4K0YA 4PL5A 3BYUA 2C6EA 4O0SA 1FMKA 4C4JA 5EDRA 1TQPA 3MH0A 3SAYA 5B2KA 5GJGA 2GTNA 4BCGA 2JAVA 3PIZA 5L2IA 4TWOA 4RC3A 3EZRA 5IMXA 4LL0A 1W2FA 2C6MA 3KXHA 4HCVA 1JQHA 5EYCA 4CZUA 4AZTA 4EK3A 3AT2A 4FSUA 2DWBA 4M69A 2OZOA 4X3FA 5EM6A 4XG8A 3DJ5A 1GOLA 3KKVA 4EQCA 4G16A 2PE1A 3FBVA 4F64A 4QMQA 3R9RA 2YCQA 5HIBA 5AA9A 4NM0A 2WTDA 3F7ZA 4Y83A 2XM9A 4O1PA 5J8IA 3KULA 2GU8A 2Z2WA 5A4CA 3RAKA 1M14A 3W0NA 3P4KA 2VD5A 5DT3A 2OZAA 5HBJA 2ZB0A 3RPOA 5HESA 2OICA 2BAKA 3U87A 3ORTA 4IVDA 4ASZA 4E6AA 5LVMA 3A8XA 3ZLXA 3KN6A 2OJJA 3GCPA 4A06A 4FVRA 2CLQA 2XK3A 4LFIA 2ACXA 4D5KA 3LM5A 5EDQA 4MXCA 1LR4A 4HYHA 4O6LA 4QMUA 5E8SA 2ERKA 3OEFX 5HKMA 3RNYA 5BMSA 1G5SA 5JMSA 4ASEA 4GKIA 4CFFA 3EQDA 3K3JA 4L6QA 3QX2A 3ATTA 4XYFA 2NPQA 3TT0A 3KRXA 4RSSA 3HRCA 3BYSA 3LMHA 1PXIA 3FPMA 4BCHA 4NM5A 5FM3A 5FP6A 2C0OA 5HLPA 3MPMA 3VHEA 1Y57A 4GUEA 5KCVA 1M2QA 1XO2B 2X0GA 4GRBA 4NZWB 2FYSA 3NEWA 4OTIA 3D7TB 3IO7A 4YTFA 3MN3A 4L52A 1FBNA 3R2BA 3W10A 3TMOA 4TTHB 4JIKA 4XH6A 1K3AA 4DGGA 3TM0A 5GIOE 2QU6A 5FTOA 4C2WA 4I92A 2XNGA 2Y0AA 4YLJA 3ZOSA 4I3ZA 3ERKA 2C5XA 2IZRA 2PY3A 5IUGA 3OUNB 5AAEA 3R8MA 4FG9A 4AZSA 4ITJA 4PTCA 2XNMA 4MBIA 3ZRKA 3LQ5A 4QMMA 1REKA 1X8BA 4IAYA 3ZO2A 5IDNA 2OH4A 3HV5A 3QQGA 4ERWA 4O27B 4PF4A 4BDKA 2W4JA 3MIYA 3DFCB 4DGOA 1CKIA 4E1ZA 3H4JA 4LM5A 4P4CA 4FIFA 4I6HA 3VF9A 5HO7A 1IRKA 3W0OA 2JKOA 2VWYA 4MBJA 2VWZA 2WOTA 4YJQA 2HZ0A 3FQHA 3DZQA 1W0XC 3C5UA 4ZSJA 3L8PA 3PXYA 5HO6A 3KF7A 3O8TA 4AFEA 3E7OA 3QHWA 5AR8A 4CCBA 4F9YA 4TYIA 3LFFA 1FVTA 1UKIA 3RNIA 2G2HA 3KK9A 4BDCA 4IAZA 1ERKA 4D2WA 3DJ7A 1SVHA 2GS2A 3PPZA 2QOCA 2R64A 1J1BA 2OF2A 3AG9A 1K9AA 2EWAA 3Q60A 5AEPA 5AP5A 3BLAA 5D12A 4DEIA 4RGJA 4J7BA 3IS5A 4BDBA 4C4EA 3ZLWA 2VWBA 4FZDB 1G8KA 4L42A 2B55A 3CR0A 2VX1A 3L8VA 1PKDA 3L9LA 2IEWA 4O2PA 4PPBA 3DXNA 4XRLA 5AR4A 3HNGA 5EQYA 4K1BA 2WTCA 4K6ZA 3KXMA 3S95A 5CF4A 1GJOA 5KO1A 3QZIA 1J7IA 1FVVA 2R3KA 2WEIA 3BQCA 5A14A 5HZNA 4O7WA 2QOIA 5K4IA 4FIHA 4QYEA 5DNRA 3HDMA 3C0IA 4RPVA 2YLFA 3W0QA 1Q5KA 3W0MA 5AP2A 3GGFA 4EZ3A 2Q0NA 3A7JA 1G8JA 4YJSA 3ZRMA 4CMTA 3N4VA 3ZUUA 2RSVA 4DH5A 3VQUA 2JDTA 2X0QA 4BIEA 4PDOA 4LUEA 5D41A 3BV3A 5CF8A 1E1VA 1G3NA 1H1QA 3Q5IA 4FTMA 3F2RA 4IM2A 4AXDA 4MAOA 4QDEA 2R3QA 3EJ1A 3F5UA 5DBXA 5CEMA 3F7WA 2UV2A 2W7XA 5A4EA 5I9YA 5A46A 2X2LA 2Z60A 4M66A 3DPKA 2JKQA 3O23A 4NJ3A 3TNPC 5M51A 3EN6A 5LVOA 3R7IA 1QMZA 3EN5A 3KVXA 4ZAUA 2YZAA 5ETIA 4BCPA 3D5XA 1ZYCA 3AQVA 4PX6A 3TXOA 3F61A 2RFDA 3GU7A 1KE7A 3PG1A 1WBNA 4GYGA 4MF0A 4U6RA 3T3VA 3FLSA 4C58A 1QCFA 3DS6A 5HBHA 3UIBA 1LEWA 5IPJA 1JSUA 3QCXA 2C6IA 5FEDA 5FD2A 5HI2A 1OITA 1XQZA 4QTCA 3U4WA 2A19B 3CD3A 5HIEA 3UVQA 2BILB 2XBJA 5M08A 2P2HA 2B9JA 3LFNA 3VN9A 4PRJA 3RKBA 4FKQA 3TN8A 4CYIA 2CDZA 2YABA 5JQ8A 2X1NA 4APPA 3FE3A 3TUDA 5JFVA 4C7TA 4OTFA 3OTVA 4GH2A 4QMOA 3FI4A 5M55A 4YHTA 3ZU7A 5HD4A 4L45A 4LMNA 5CSPA 3KFAA 3ORKA 4OTPA 1GZNA 3ZO4A 4C36A 4IB1A 3PXZA 3UDTA 3R1YA 5KKRB 1CKJA 2OH0E 4J98A 4AAYA 3ZHPC 2VV9A 2HELA 3R1QA 1Q8WA 4CRSA 3UDSA 2IVTA 3NYNA 2BTSA 4GFGA 4BC6A 2HIWA 2IWIA 4JNWA 4TXCA 4YTCA 4AAAA 5JQ5A 3G0FA 5GINE 4A9SA 4DA5A 3LXLA 3WF5A 4Z7HA 4PDYA 4IFCA 5CSWA 4FTOA 2X2KA 3MPAA 3PWDA 5CAVA 3ZSHA 3W2CA 4DCEA 3VUKA 4AF3A 4CFNA 3LKMA 4XP2A 5IQHA 4BR3A 2ZV2A 2W1GA 1XH9A 2GNGA 2YFXA 2G2IA 1IASA 4YBKA 3UIMA 3V5LA 3C7QA 3MBLA 4W4XA 2R3FA 4GG7A 3ZXTA 5KBRA 5HOAA 3GT8A 4E93A 5ETCA 2VWXA 1JPAA 4M14A 3P5JC 2C47A 5IA5A 1U5QA 4IFGA 4M0ZA 4FIJA 4AQCA 1E9HA 3KXZA 1PMNA 2WEVA 3R9OA 2A4LA 5K9IA 1CM8A 4EOIA 5IQBA 3OF0A 1YXTA 1TZDA 3M42A 5D7VA 5IUHA 2BPMA 4KNBA 3Q9XA 4O2ZA 3S1HA 5J9ZA 3NUXA 3OY1A 4F78A 4GYIA 1CKPA 1QL6A 2V62A 5M06A 4WNKA 3CLYA 2BRGA 3BI6A 4M3QA 2C1BA 4RX8A 4E26A 5CF6A 4ZS0A 2ZAZA 2CSNA 4JXFA 4O38A 3PSDA 4YZMA 2VTOA 4I94A 5CXHA 5J1VA 1UNLA 3VQHA 3CKXA 3LFSA 1JKSA 3VO3A 3TDVA 5EI2A 3MY0A 4MBLA 5KE0A 4WO5A 3POZA 5GHVA 4MVFA 4PTGA 3W1FA 1OI9A 2R4BA 1MRVA 2HW6A 2R0UA 4J97A 5CZIA 1U4DA 2YM3A 3OT8A 2E9NA 2PVMA 5L2WA 3TTIA 4B4LA 1VJYA 4F65A 4BZOA 3FQEA 2VWUA 3UOKA 5HG7A 5EYDA 4I0RA 3VS1A 4IC7A 4LG4A 3UGCA 5AAGA 5DLSA 4QP8A 4ZTMA 2VTRA 4ACMA 1T46A 4M12A 3WZJA 2E9UA 3CTQA 3BIZA 3IKAA 2J2IB 4FKSA 2QKRA 5ACBC 3O51A 3LLAA 5A3XA 4FVQA 2F4JA 4L3JA 3PE2A 3MA6A 2JDVA 3QLFA 1NA7A 4HVGA 4TL0A 5JGDA 4U9AA 4BTKA 5J5TA 1NY3A 2JIVA 3QCSA 3SG9A 2W05A 3NNUA 3TNIA 5IKWA 3BHYA 4I23A 4DYMA 2YZLA 3JR1A 3WIKA 4LOOA 5KMKA 5AJQA 4AN9A 3C4XA 3FI8A 4X6RA 4Y8DA 1WVXA 1J3HA 3GQLA 2J0MB 2H96A 2W1DA 4GUBA