1M7QA

Crystal structure of p38 map kinase in complex with a dihydroquinazolinone inhibitor
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
348
structure length
348
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Design and synthesis of potent, orally bioavailable dihydroquinazolinone inhibitors of p38 MAP kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 107
structure length 348
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2002-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1m7qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1m7qA01
2H6DA 3R9RA 3NDMA 3TEIA 1YXXA 2CDZA 2R0IA 3AGLA 4EZ7A 4GFMA 3R9DA 3CD3A 3T8OA 3GU8A 4BDIA 2XJ2A 1FQ1B 1H1WA 1OL2A 3D0EA 5LMKC 2BHHA 4AW2A 2IW6A 5LWMA 5KZIA 2BZKB 2WQNA 4K2RA 2WTKC 4A07A 4ZMEA 5AMNA 3C4CA 4M84A 5CANA 3A4PA 4ZSGA 3MI9A 2YIWA 4L52A 2RL5A 4O7VA 4ENYA 4OTRA 1HCKA 3TV6A 3C51A 4C37A 4IM0A 4D2PA 3TKHA 2CN5A 3PIZA 3OT3A 4FTMA 1ZYCA 3RHKA 3KCFA 3BQCA 2X4FA 5B7VA 4BDAA 3RGFA 2C6TA 4UBAA 5C8MA 4BI2A 1ZXEA 2HCKA 3ULIA 2QCSA 4YZDA 2QNJA 3OBGA 4YSJA 3ENMA 3SGCA 1YOMA 3QZFA 4WUAA 3DTCA 4X3FC 3T9IA 1HCLA 3KMWA 3NNXA 3PVGA 5AFVA 1OVEA 5C4LA 5FBOA 2HXQA 3NYOA 3MFSA 2VZ6A 3PTGA 4KKEA 4LV5A 3NNUA 3ROYA 3CPBA 2P55A 4E6DA 4ACMA 4DYMA 3S2PA 4WA9A 1WVXA 3QCSA 2BAQA 4O0YA 3U87A 4H1MA 4FUYA 4U5JA 4WG3A 5KMNA 3BYSA 4J8MA 1UU9A 3LM5A 3UVPA 1Q99A 2OZAB 4R77A 2QOFA 4RX9A 4FSYA 3BHUA 5CLPA 3BHHA 3DZOA 2VGOA 2VU3A 4UEUA 3P08A 5AEPA 3NUUA 4D5HA 5JEBA 1Q8ZA 3AC5A 2BRBA 3JY9A 3K2LA 5HO7A 4IAZA 4H05A 4ANLA 5CF6A 4FVQA 3RKBA 4HGEA 4X3JA 5FXQA 4E4XA 1TQMA 1PKDA 1Q3WA 1LEWA 2XNEA 1UNLA 5HG8A 3PLSA 4FNXA 5DT3A 3LVPA 2AC3A 2J0IA 5CU2A 2WU7A 4D58A 4FKTA 4MXYA 4BYJA 3AT3A 2UZNA 4D1ZA 3JY0A 3LJ1A 5J1WA 4XMOA 3AC8A 2HELA 3OC1A 3OY1A 4L46A 3PY1A 3GB2A 3UOKA 3OMVA 3GVUA 2YJSA 4P90A 5AAEA 3V01A 3FBVA 4RJ3A 2OBJA 5FTGA 5L8LA 4TWNA 2JC6A 4FT7A 4PUZA 1V0OA 3B8RA 3HLLA 2WMAA 3VBTA 4DEHA 2UW8A 3H9FA 4F1TA 2KTYA 3Q6WA 5AV2A 3NAXA 4BTMA 4FK6A 3SXSA 5J79A 3LZBA 4QQCA 3VS7A 4EH9A 2BKKA 3KMUA 5AV3A 3P4KA 5FP6A 2CKEA 4BWKA 4K77A 1K2PA 5AIKA 3SAYA 2JDSA 1ZMVA 5JH6A 3VJNA 3NX8A 4AQCA 4DCAA 2C6EA 3EQRA 2R3HA 1CDKA 3PXYA 3ZOSA 5E1SA 1KE7A 1WBPA 4Z7HA 1IAHA 5BYLA 1Y8YA 4I21A 3ZO3A 2GNFA 1UU3A 4MEDA 3ZSGA 4D2SA 4EH8A 2C5YA 5HBHA 5HD7A 3OUNB 4OTWA 3EQCA 1ZRZA 2UVYA 4ZK5A 3QALE 3D5WA 5DE2A 3V8TA 4LM5A 1VEBA 4AW0A 3FYJX 5H9BA 2XRWA 3G0FA 3IW5A 4ID7A 5DLSA 4FUXA 2C3IB 3P23A 5FEDA 2GNIA 4CFXA 1Y57A 2RKUA 5IF1A 1SVHA 2QLQA 5DEWA 2B7AA 5IUGA 4YBKA 5FD2A 2QI8A 3FDNA 2BRGA 1DAYA 4JBPA 4PL4A 4D2RA 3CQUA 3TTIA 4DBNA 4O7TA 2H8HA 1BYGA 3PFQA 4FZ6A 4BI1A 4XP0A 5EOBA 4B0GA 3FLSA 2B9HA 4BCMA 4DCEA 3A7FA 3RCDA 4BY9E 4IC8A 1UWHA 3OW3A 2QU6A 3EHAA 4H3QA 4X2KA 4RWJA 5BVEA 2O65A 3QZGA 4L53A 1W7HA 3NUNA 4JR3A 4WG5A 4EOSA 4BRXA 1OGUA 4FTTA 4WO5A 2VAGA 1UNHA 4FKRA 5FG8A 2O63A 4X0MA 2IG7A 5HO8A 2QHNA 4W8EA 1OZ1A 4YC6A 2CSNA 3ERKA 3FL4A 2XNPA 1H26A 4A4XA 3C50A 4A9TA 2PY3A 5CF5A 4LRJA 2YN8A 4U44A 2CNQA 2ZOQA 2WMBA 4LRKA 3SXRA 4FKUA 2YFXA 3HYHA 3P7AA 3ENHA 4D0WA 2JDOA 3Q6UA 5FQDC 1VYZA 2WZJA 4O7SA 3G0EA 4ZOGA 3TNPC 1SVEA 5HVJA 2XMYA 5HIDA 4JT3A 1CKPA 1H1SA 4HYSA 3MIYA 4G9CA 1W83A 4FR4A 5IDNA 3L8PA 3UODA 3IDPA 5EYCA 2YIYA 2ETMA 4KRCA 4ONAA 2JAVA 5CQUA 3IQ7A 3NR9A 4XRJA 3QRUA 1ZY5A 2YCFA 2G1TA 5ETCA 3KXMA 3FMMA 2XK3A 3LFEA 3DGKA 2QO7A 4M7IA 3R7EA 3NGAA 4LL0A 4XYFA 4IWDA 4KKHA 4UB7A 4W8DA 3VBYA 4XNEA 5J9LA 1M2RA 4LGDA 3I7CA 4FSMA 3ET7A 4LOQA 4GVJA 3QQGA 3UIMA 1YRPA 4GS6A 3D2KA 4GIHA 5EW9A 5AM6A 2ETKA 4NIFB 4BZDA 2JKMA 3F5XA 2JKQA 4U3YA 5FGKA 2OJGA 2ITYA 5AP3A 3PE2A 4IJPA 3TUDA 1PXMA 3GCSA 4V04A 3QLFA 4WSYA 2HIWA 3NW7A 2HZ4A 3PYYA 4OTFA 1J7LA 2OLCA 4H58A 3H30A 4JLCA 1JSTA 4O91A 2YA9A 4V0GB 3AG9A 4F6WA 2OZAA 3FI3A 1VYWA 5EQYA 5HLNA 3SHEA 3ZONA 3GXLA 3U4UA 1SM2A 2R9SA 4IX3A 3AD4A 5K3YA 5HICA 4EI4A 3ZUUA 1A9UA 3FC1X 4LUEA 5ITAA 3H4JA 3C5IA 2EWAA 3PA4A 1KE9A 4CD0A 5T6KA 3CJGA 2P3GX 3P9JA 1WBWA 3OUKA 4JIAA 4FSRA 4WT6A 2BALA 4DE4A 3UOLA 2J7TA 4NSTA 4C34A 4ENXA 5BVKA 2CNVA 3F2RA 3SG8A 2Y4IB 2PVMA 4U7ZA 4ZTQA 4N4SA 2LGCA 3BHVA 4PTGA 5DEYA 4BCQA 3UZTA 4KABA 1CSNA 3VNTA 4BGQA 2PVYA 5C8NA 2R3OA 3RK7A 3OZ6A 2EXCX 4FVRA 3G9LX 3QU0A 3LPBA 4AGWA 2QD9A 4D2WA 5M4IA 2R64A 2XCKA 2FA2A 4APCA 2PUPA 4I6FA 4NKAA 3G15A 4GK3A 3KEXA 4E5BA 5F9EA 4BCFA 5EOLA 4QO9A 3MDYA 3CEKA 4Z55A 3GC7A 2R3MA 4DBXA 4LFIA 2YABA 5TT7A 3R1YA 5DWRA 3R22A 1XQZA 4YJSA 4DFBA 3L8XA 5D11A 4O0VA 3PIXA 4YSMA 2YEXA 2FSLX 3MJ2A 5EM5A 5HNBA 2I0YA 4DGMA 5CEKA 5JRQA 4O0TA 5HORA 2FSOX 5DPVA 4WRGA 5M51A 4ARKA 5C1QB 3Q04A 5ANIA 4L7FA 3PJ2A 4CQEA 2X7GA 2JDVA 4GG5A 4FIHA 2GQSA 1J1BA 1OIUA 2XNBA 4YU2A 5KMLA 3RM6A 3FI8A 2W1EA 4L01A 5HG7A 2ITWA 4XV9A 4QP9A 4FKLA 4FTQA 3SOCA 3V5LA 3EZVA 4K6ZA 1H07A 1PY5A 2GNLA 3COMA 3PP0A 3JUHA 4YJOA 1H1RA 4BGGA 5ANJA 3VRZA 2VWXA 1H1QA 4MNEB 3TTJA 1REKA 4O6LA 3BBWA 4CTCA 4DEIA 4FYOA 2WQBA 4F9WA 5LJJA 4CV8A 4G1WA 2PUUA 5AUYA 2QURA 4TL0A 2BPMA 3HAMA 2ZVAA 4QD6A 2NRYA 2XF0A 5CSWA 3OY3A 1WVWA 3CTJA 3ZUTA 2V62A 4XBRA 3HGKA 2EB2A 4QP7A 2ACXA 2JEDA 3D14A 4YHJA 3V6SA 1UWJA 4G31A 4L3JA 4F70A 3HZTA 3IK3A 3PSBA 4MQ2A 2XB7A 2BZIB 5IA0A 3QTSA 5H3QA 4BI0A 3UIBA 2W1CA 2R3PA 3ZDUA 2OXXA 3LAUA 1Y8GA 2FVDA 3R7YA 3U54A 3FKNA 4OAVB 5HLPA 4F9YA 3EQHA 3ZRMA 5A14A 1KE6A 4Y5QA 3RVGA 3I5ZA 5K5XA 4RVTA 3BLRA 3OFMA 4UX9A 5HE2A 4MF1A 1RW8A 3KN5A 5JFSA 2VO0A 2NRUA 3NCGA 3TACA 2J9MA 3A61A 4HYIA 4NZWB 4RBLA 3LQ8A 1OIYA 4A4OA 3KK9A 5LVMA 3OXZA 3VAPA 1NT2A 4QMYA 3ZRKA 2VO3A 3QAME 5D9HA 4FVPA 4OR5A 3ZZWA 4CMOA 1PXKA 4O2PA 4EBVA 2KULA 3HKOA 3HRCA 3BEGA 3VS1A 2UW4A 3WF9A 1XO2B 4ACDA 4E4NA 2OXDA 2BVAA 4X6QC 5DR6A 3JS2A 3ZXZA 2PVKA 3V5TA 5BVFA 4M0ZA 5HU3A 2OJFE 5LWNA 4I4EA 4IB0A 3FLWA 2W1FA 5ETFA 1NA7A 4OGRA 4RIOA 4ZY5A 2OSCA 2F9GA 2W1ZA 4F64A 3GU7A 5B2MA 2BILB 3H3CA 5A4QA 2CNUA 3GCUA 2YJRA 4O0WA 4ZY4A 4PMMA 2W1DA 3A99A 4M67A 1V1KA 4M66A 4QP8A 1UKIA 2O0UA 4ZSLA 4FTKA 4C4IA 4E3CA 4IW0A 3OXTA 4JAIA 2OFVA 2JKOA 2P2IA 4AG8A 3EKKA 4GJ3A 2VWWA 1JKKA 2UZWE 3L9MA 4PL5A 4EKLA 4UYNA 1PMUA 3LFQA 4ZTNA 1WBVA 3OTUA 3LJ2A 3UG1A 2X6DA 3OP5A 4D9UA 1KSWA 2VTIA 4BHNA 4AZSA 4DITA 3OHTA 5M53A 4AT5A 3DB6A 1SVGA 4YTHA 4ITIA 3WZDA 2ZV2A 4FSNA 5EK7A 4L45A 4FV5A 5BVDA 5JT2A 3FLZA 5LXMA 3S0OA 5CY3A 2HW6A 1XBCA 2X8EA 4GUBA 4Y46A 4TXCA 4ERWA 4ZLYA 4NIFA 3P1AA 3DNDA 3QZIA 3V5WA 3FLQA 4K9YA 3UJGA 2FSTX 4QTCA 4ZSJA 4DF3A 3OEZA 4AA0A 5JMSA 3I4BA 4I6QA 2V55A 2C0IA 3UGCA 4XHKB 3UQFA 4L43A 4KIOA 3FJQE 4BDBA 4AFEA 4DHFA 4EQUA 4DT8A 4WHZA 5M08A 1GZOA 3QUDA 4F1OA 4GCJA 1LR4A 5JQ5A 5M57A 3RINA 3VUIA 2PUNA 2XKCA 1ZOGA 4JBVA 2YM7A 5AAFA 4F1MA 4UWBA 2QOKA 5EQPA 2X0GA 1Q8WA 2IJMA 1OITA 2CKQA 4O2ZA 2GHMA 2X4ZA 4JX7A 3DV3A 3GI3A 4MK0A 5EI6A 1KV2A 2VX3A 4FV8A 3F69A 2DWBA 4AE6A 4BB4A 2WQOA 2X81A 1W82A 2R3GA 2SRCA 2IZRA 4NL0A 3PA3A 4HGSA 3CY2A 4IAAA 5HCXA 2V0DA 2QOBA 4RC3A 4XLVA 3ORZA 3GCPA 4QYEA 2CGWA 1Y6AA 2JLDA 2QU5A 2ZV7A 4FNWA 3GP0A 4IB5A 2PHKA 4Y72A 4EH5A 2R3FA 3KRWA 3SDJA 3OOGA 4X6RA 4G6OA 3A8WA 2YZLA 5HEZA 1UU8A 4XEYA 2B4SB 1O6KA 3CGFA 3HV4A 5C01A 4B8LA 3ALOA 4ZLZA 1GIJA 4AW1A 2QKWB 2J50A 1AD5A 3C4EA 1Q61A 2F7XE 3IG7A 1R0PA 4IAYA 2XNMA 3U55A 3JYAA 4YP8A 4QPAA 4XV3A 1HOWA 4UY9A 1YOLA 2BFXA 2PL0A 3CC6A 4HCUA 3ZLWA 5CEPA 3CD8A 4O1OA 5HU9A 2NPQA 4O22A 5K4JA 2R3NA 1YDTE 5L2QA 5HBEA 3AC3A 4UMUA 1WBOA 5AR3A 2V5QA 2BRNA 2ZB0A 4AT3A 4EOQA 4NM3A 2CLXA 4NU1A 3BI6A 4RA4A 2ITNA 2XJ1A 4OBQA 5AP0A 3P7CA 4Q5HA 4FTCA 4IAIA 2PVHA 5HCZA 1DI9A 4F4PA 4A9SA 1ND4A 3EN5A 4LL5A 2VX1A 4XOYA 1URWA 4ZIMA 5TR6A 4BN1A 2XK6A 5HG5A 5KNJA 1ZYLA 1W0XC 3DPKA 4IVBA 1XBAA 3P79A 4MNEA 4DN5A 2BR1A 2X2LA 4BZNA 1UKHA 2C3KA 1KUTA 4Q9ZA 4RT7A 1CM8A 3E64A 3BZ3A 3QGYA 4NWMA 4O7LA 4IM2A 1Q8UA 2QONA 4GSBA 4DT9A 2Q83A 2GS2A 2IPXA 1YHSA 3VIDA 3V8WA 4PMTA 3Q4CA 1ZOEA 4IZ7A 3QCYA 4U45A 2R3KA 4FNYA 3V04A 2BKZA 3C0IA 2GNGA 3HP5A 5IQAA 5CSVA 3K3IA 3WIGA 3KULB 5GNKA 5A6NA 5HBJA 2VTLA 3KK8A 2UZEA 3W16A 1MRYA 4GH2A 4K8AA 3NWWA 5C9CA 1DS5A 2W0JA 3RCJA 3UNZA 3CLYA 3R1QA 3TNQB 3AXWA 3UYTA 3UG2A 4AA4A 2CGUA 4X7QA 4WKQA 4GFGA 3U6IA 3FUPA 4AN2A 4OT5A 4FC0A 4AX8A 3I79A 5LOHA 1VZOA 3N51A 5DA3A 4PP7A 4F0FA 2YM5A 4N6YA 3TZ9A 3JVSA 3Q52A 3PVBA 4O0XA 2ERZE 4NCTA 3OF0A 2WMRA 4QMWA 4RJ4A 5C03A 3KFAA 4M13A 2XA4A 3O7LD 4C4FA 2H34A 4ANMA 4EOLA 3QFVA 3QKLA 4NJ3A 3TJCA 5K9IA 5A9UA 4AN3A 2B9FA 5DVRA 1QMZA 3P7BA 4BIBA 5J9YA 2BUJA 4DTKA 3D7ZA 4K11A 5AP4A 4RJ7A 1IASA 3LFDA 2XIKA 4RQKA 3CCNA 4HCVA 5I4NA 4G34A 5LCJA 2PUIA 5ACBC 1J91A 3W2QA 2E9PA 2BAJA 2XUUA 2ZMDA 4UALA 5DRDA 2YWVA 4L3PA 4R8QA 5CU3A 5LARA 3CKWA 4XBUA 4YZBA 4NT4A 4IWOA 1YI4A 2ONLA 4A7CA 4FKWA 2F49A 5HG9A 1R78A 4QTAA 2ZV9A 1IAJA 2YCRA 5IQIA 4S2ZA 4BWPA 1WBNA 4BDKA 3HX4A 4U0IA 5AUWA 3DT1A 5AM7A 1YWNA 3QZHA 2OH0E 4FZFB 1OUYA 2OWBA 1FPUA 2YM3A 3EFKA 4FGBA 2O8YA 4K33A 2JFMA 4CFFA 2JITA 2YDJA 3CQEA 4J98A 1OPKA 4DEDA 4U81A 5M4CA 4BDJA 2UZDA 4F7JA 4U43A 3WZEA 2OG8A 3KRXA 3MB6A 4P4CA 2YISA 3VF9A 2W7XA 4DC2A 3I5NA 2NO3A 4FMQA 4EH4A 3C4ZA 1QPEA 2PE2A 3OT8A 3DOGA 3ZO1A 2A1AB 4CMUA 1UU7A 2GNHA 3FMJA 1BL7A 5AV4A 4TNBA 4E5WA 3WYYA 5BVNA 5ANGA 1UA2A 4MBLA 3R28A 4R3RA 4YJNA 1QPJA 5T68A 4MBJA 4D5KA 3K54A 4FG7A 4BCGA 4FTJA 5BNJA 3M2WA 3MGYA 4FV7A 3D94A 3VS0A 5C27A 1JSVA 2BAKA 3R8PA 4WSQA 4CYIA 3OCSA 3EN7A 2B9JA 4FZAB 2OK1A 4KKGA 3CGOA 4L3LA 4LV8A 3O8PA 5GJDA 3W18A 3UOJA 3IGOA 3ZYAA 2X7OA 3TUBA 4ZSEA 4GU6A 2AC5A 2YIXA 2HY0A 3IONA 3OD6X 4C3RA 4EOMA 2ZB1A 4YJPA 4Z16A 4XUFA 3NIZA 4L7SA 5ANEA 5CZIA 3O8TA 2EXEA 3IW6A 3ZS5A 5GINE 3TCPA 5DBXA 1YQJA 3ZEWA 4I5MA 3JR1A 3UMXA 4FEXA 2IVTA 4FIGA 3UYSA 3F5GA 3QYZA 1GY3A 2C5VA 2OIQA 3D9VA 5HO6A 1PMNA 2GDOA 1YVJA 4QMOA 4QYFA 1GZKA 1YXVA 5HNIX 2Y8OA 2FGIA 3MWUA 5CEIA 1KOAA 4FTLA 4BTFA 3A2CA 3FMHA 4IFCA 2RFSA 4UZHA 3TZ7A 4ZAUA 3HMPA 4BIDA 3GENA 1JAMA 3V3VA 2C5OA 1OB3A 3B8QA 4FZDB 1KE8A 2J0MB 4DLJA 4IAFA 2G15A 3HMMA 3ATTA 4FKPA 3FKOA 4WNKA 2ESMA 4MTAA 4NM7A 2W1HA 4AOJA 2ITVA 1OIQA 3P86A 4PPCA 5HIBA 5A4EA 4O27B 4KWPA 2YM6A 3UO6A 2Z7LA 4FG9A 4I3ZA 4TYEA 3RHXA 3CJFA 5CAOA 1T46A 4EONA 4I1ZA 2JKKA 4BCOA 2C6MA 4GT4A 3OVVA 1ZZLA 3NNWA 5CX9A 4RLLA 5EYKA 4CKJA 3A7GA 2DYLA 4XH6A 4CGAA 3OOMA 5DGZA 2VTRA 4I5PA 1WBSA 4IM3A 3NUYA 4EWQA 4IDTA 3LOKA 4D1SA 3QYWA 2YCSA 4M14A 4ANSA 2UZOA 3F2NA 4O6EA 3MTFA 3GEQA 2B52A 4FIJA 4XG8A 4E73A 2O2UA 4FSZA 3UQCA 3RI1A 2J0JA 3F88A 4ZTLA 3UPXA 5I9WA 5G1XA 4I0RA 2R3LA 1B39A 4JG8A 4ZJVA 1RQQA 3TG1A 3HEGA 5EW3A 3RPYA 3FPQA 1G8AA 1JNKA 3BIZA 2OIDA 2PWLA 3BYOA 2JFLA 3E93A 3RTPA 4FL3A 5HCYA 2Y4PA 4TYHB 2C0TA 4UXLA 5HESA 4G6LA 3LKMA 4EJNA 2XP2A 4HOKA 3PG3A 3PUPA 3QD3A 4X21A 4A4LA 4BKJA 4YURA 3AC4A 2A0CX 4YTCA 2F7EE 5HTCA 5JFXA 5CS6A 3Q5ZA 3SVVA 4YJQA 2OICA 5CVFA 5TE0A 4E20A 2W1GA 3HUCA 3KULA 3EJ1A 4FV6A 2HZIA 4UZDA 2FH9A 3D2IA 4FTUA 2A27A 4HGLA 4RZVA 3SXFA 2UV2A 4YLLA 5BVOA 3E7VA 3GOKA 4PY1A 2BZHB 2XEZA 3Q9XA 5KKRC 4C2VA 3FZOA 1DM2A 3K5UA 4I0TA 2YIRA 4KS8A 1YDRE 5EHYA 3ODZX 3R01A 2C68A 4WBOA 4L00A 4ACGA 2GFSA 4DEEA 4QQTA 5L8KA 2OZOA 3DFAA 4X2FA 2JDRA 4YC8A 5DOSA 5AX3A 4ZS4A 4FOCA 3ZMMA 3VS6A 5FM3A 1M7QA 1FGIA 2C1BA 3BELA 4F9CA 2Y6MA 4PDSA 3VUDA 3EN6A 1TVOA 5IQBA 3BU5A 2WMQA 3FAAA 1ZWSA 5AX9A 4IFGA 1FVTA 2YAAA 1H0WA 1YOJA 3II5A 2X9FA 1SYKA 1STCE 1Q97A 2HAKA 2E9VA 1J3HA 1H25A 2I6LA 4IVCA 2W9FB 4C4HA 1YDSE 5I9UA 2R5TA 2PULA 3AMYA 2EU9A 5DR9A 4D9TA 3MA6A 4MKCA 3CPCA 1PXPA 3B2WA 3LFCA 1MP8A 4FNZA 1BL6A 5IA5A 1L8TA 5AP7A 4OTDA 2WELA 4MWIA 3UVRA 2PTKA 2QOCA 4RLKA 5J5TA 1PW2A 4ERKA 2XBAA 4A06A 1TQIA 1SNUA 2Z60A 3Q96A 4RWKA 4C4JA 4OAUC 3SQQA 2C30A 1JOWB 2WTCA 4EH6A 2XS0A 3GNIB 1WVYA 2E2BA 1K9AA 3SG9A 3GQLA 5M07A 4FIEA 5DR2A 4C33A 5CQWA 3AT2A 2PMIA 3ACKA 5F95A 5CASA 3THBA 3KU2A 3F66A 2QVSE 3MH3A 4AGDA 2OU7A 1DI8A 3VUKA 2Z2WA 3R04A 1YXSA 4GRBA 4MCVA 3ORLA 4R7HA 4QMQA 5L2TA 1W98A 3NVKI 2W99B 3C1XA 4YLKA 2VTMA 5FM2A 3R7VA 4QYHA 2CKPA 3N4VA 2HK5A 3TNIA 2X2MA 5GIPE 1OL7A 3IO7A 4EORA 3DLSA 4JQEA 2G2FA 3V5JA 5FTOA 3FLYA 5DFPA 5FEQA 3R2YA 3PSDA 1M2PA 1Z9XA 4F08A 3QXOA 5E8WA 4C57A 3FMNA 4DEAA 2F2CB 4DFYA 5I3RA 4ZZMA 4BKYA 1PXNA 3KXNA 5AUUA 3KVWA 3FHRA 1LUFA 4C62A 1ERKA 3Q60A 3R9NA 4J99A 4Y5HA 5JGAA 3Q4UA 4FZ7A 3H0YA 3BX5A 4XV2A 5IUIA 1MQ4A 1OM1A 4FV3A 4GYIA 4E6AA 4LUDA 3A7HA 4P7EA 2C6IA 5T3QA 2VTSA 3KCKA 5LVOA 3DBCA 3FL5A 4DLIA 3O96A 4MNFA 5CSXA 5FWKK 4N57A 3WZJA 3TV4A 3WBLA 1YI6A 3ZCLA 3G5DA 2V22A 1YI3A 4RFMA 5E90A 2P0CA 4XX9A 5EYMA 3DA6A 1OKVA 1XH4A 5GJGA 5EG3A 4FE2A 5DNRA 1M7NA 2GS7A 5CU0A 4LMUA 1XH8A 4DGNA 4JXFA 4O82A 5IEYA 1FBNA 2UW7A 3ZO2A 4RG0A 5CZHA 5HE3A 3VBWA 3LQ5A 4QPMA 3S00A 4ASZA 4EQCA 2GCDA 3QCXA 3LCTA 3MJ1A 3FXWA 4QNAA 5DRBA 4NM5A 3NAYA 4QNYA 3AC1A 5A54A 2EUFB 5ANKA 3VRYA 4D28A 1OUKA 4V05A 2YLFA 5E91A 1YHWA 2C4GA 3DNEA 4U97A 4U9AA 4WNOA 5ICPA 4W9XA 4O21A 2IWIA 4G16A 3NW5A 2Q0BA 4BIEA 3OXIA 4FEVA 2CCIA 2ITOA 3U6JA 3KXGA 4F09A 3DY7A 5KHWA 4ZY6A 5A3XA 4KUJA 1E9HA 2A19B 3MS9A 3P5KA 3QQLA 4JL9A 4B7TA 4FOBA 4PP9A 2QOQA 4Y95A 4GL9A 3HRFA 4O1PA 2Z7SA 5ANDA 1ZY4A 3VQHA 4ACHA 4EZ5A 3FI4A 3G90X 3BLQA 4CLJA 3O2MA 4ACCA 1PXLA 4EOOA 1FGKA 4RJ5A 3ZRLA 3NNVA 5GZ9A 2GQRA 3ORKA 2IZSA 1UVRA 4J53A 4PV0A 2ERKA 4RJ6A 4TPTA 3TZ8A 5IQCA 1H01A 2UZTA 3BHYA 1G5SA 1MQBA 1OL5A 4C36A 2G01A 4Y83A 3W8QA 3KGAA 1XR1A 2WIPA 2XIXA 3EN9A 3FXXA 4BICA 4CNHA 2C6KA 4QT1A 4TWPA 4TYHA 4V01A 3U8WA 5K0KA 3DTWA 3LCDA 2OKRA 3KL8A 3EOCA 3MBLA 4CQGA 3COIA 3D4QA 3PY3A 1AGWA 4FV1A 4DH8A 5CF8A 5KMMA 4CMTA 1ZOHA 4AT4A 3R7OA 5F20A 2PMLX 5AP1A 4EUTA 3TWJA 5IA2A 4Q2AA 3DBQA 4OTPA 4FGRA 5CI7A 4RX5A 5IEXA 5D10A 2VTHA 3UVQA 4FSTA 3GUBA 3OS3A 4HPUE 3SRVB 3U9NA 5E9EA 2J6MA 4DG0E 2C3LA 5CAQA 4IXPA 1Y6BA 3EQFA 3PWYA 3BEAA 1U54B 4LYNA 4DTAA 1P4FA 3C7QA 3KN6A 3MA3A 4DFZE 3WIKA 1P2AA 2WO6A 3D15A 2ITZA 5D41A 2W4JA 3KRJA 3MVLA 2I1MA 4EQMA 2WEVA 4FKOA 4GV1A 4A9YA 4EK5A 4HCTA 4XG6A 4YPSA 4OTGA 4JDJA 3AD6A 3EH9A 3IGGA 3UOHA 4C8BA 1K3AA 4UN0C 5IMXA 1CKJA 3DAEA 3FY2A 4GVAA 4D0XA 3GFWA 3POOA 3QQFA 2VUWA 3R0TA 2VTJA 4GG7A 3RAIA 4D55A 1XHAA 4KIQA 1MUOA 4QQ5A 4YZNA 5LVPA 3NVMB 5BUIA 2BDFA 2XK9A 4KAOA 4F7SA 4QTEA 5AR5A 2PVRA 4BDGA 4G5JA 5AR7A 3HV3A 5IQHA 3F3TA 3OTVA 3QHRA 4IAKA 5BUJA 5JQ8A 2BFYA 3PPZA 3D5VA 3LXLA 4FG8A 2ITTA 3PDTA 3HMIA 4EK8A 1NVRA 5B2KA 4APPA 1GJOA 1TKIA 1J7IA 3NYNA 2I0EA 3F3ZA 4UWYA 3W2SA 3C9WA 4MWHA 3VS3A 4U3ZA 2WTWA 4G5PA 3DK6A 5IQGA 5EI2A 1E1VA 1GOLA 2UW3A 3MH2A 3R2BA 4FKJA 4Y8DA 3DAJA 4FIFA 3UNJA 5IEVA 4CFVA 2OIBA 4MD8E 2X2KA 4TWOA 3WOWA 4XJ0A 5CAPA 4D4VA 4G3FA 4JS8A 4DGOA 2WKMA 3UQGA 1W84A 2YACA 5M44A 4FKSA 4J7BA 4CZUA 3O71A 1YWRA 2UW5A 3QD0A 4PDOA 5A4TA 3KF7A 4E4LA 3EL7A 3F3UA 4P5ZA 3C5UA 1H4LA 3VS4A 4BDHA 4BDEA 5HX8A 4O83A 1U59A 5HVYA 5BX0A 4WBBB 2JIIA 2F57A 3BYMA 3ZFYA 3UPZA 1Q3DA 4KBCA 4IB1A 4S30A 5J5SA 3QQUA 4ITJA 5E1EA 3BGZA 5EW8A 4ZEGA 5KO1A 4GMYA 3DK3A 3NSZA 3COKA 3IPHA 3V8SA 3GQIA 4B8MA 2ZMCA 4C4GA 4C38A 2IVSA 1YKRA 4G2FA 4OTHA 2X8IA 5DN3A 1FOTA 2Y6OA 2VTTA 4YZMA 5FLFA 3HP2A 5TOZA 2IZUA 2GSFA 4M15A 4RA5A 5DT0A 4II5A 5JSMA 5CXZA 2IW9A 3K5VA 3ZU7A 1EH4A 1OIRA 3PPJA 3E87A 3PZHA 4BL1A 5IDPA 4CG8A 1RE8A 2CGXA 2QO9A 4BTKA 3EZRA 2GHGA 3P78A 2X1NA 2H9VA 4KB8A 3KY2A 1R3CA 3NUSA 3Q9WA 5A4LA 2UZBA 3M1SA 3RAKA 5IH6A 5JFVA 5AV1A 4QTBA 4BBEA 5LVLA 4U80A 4AP7A 4JRVA 3LMIA 1ZMWA 3AQVA 3EFJA 4RMZA 3UZRA 3ROCA 4FEUA 1FMKA 5E8TA 1BI7A 4DAWA 2R7BA 4BVUA 3MVMA 2IO6A 2B1PA 2Z7QA 5L2WA 2PZIA 1VJYA 2Y4IC 2VTNA 3FPMA 1GIIA 3OEFX 3R8UA 4EK4A 3PXRA 4I4FA 5HTBA 3VS5A 4YO4A 4NYEA 3OROA 4O7RA 3E8NA 2QOHA 2HXLA 3PPKA 4RZWA 2QR7A 3QTRA 2C69A 4TRLA 4KIPA 3E7OA 4JX3A 5HQ0A 4EUUA 4AU8A 2J4ZA 1YW2A 4LOPA 1PXOA 3VWAA 3GU5A 4I24A 5AA9A 4PMPA 3A7JA 5HGIA 5CEQA 4YTIA 2F2UA 4MQ1A 4C35A 1Q24A 3DDPA 2PVJA 2HOGA 3UZPA 1OECA 3BU6A 3KRRA 3FHIA 3QA0A 3M42A 4U41A 1BUHA 2VTPA 1QPCA 2BDWA 3PY0A 4DH3A 3EL8A 2QR8A 3TN8A 1G8SA 3TT0A 3GOPA 4YC3A 4HYHA 3Q5IA 2E9UA 3N9XA 4HYUA 4K0YA 4KRDA 5CSPA 4FEWA 2EXMA 3KRLA 3TI1A 2WMTA 1BKXA 2R7IA 4O0UA 3FI2A 4F99A 4F9AA 2QO2A 3HNGA 3NPCA 3GC9A 3QTZA 2O3PA 3CQWA 1WMKA 3EYGA 1Z57A 4Q5EA 4WD5A 2PZYA 2VNYA 4NJDA 1OL1A 3RJCA 3VQUA 5CT0A 5TF9A 3CSVA 4HNIA 3PJCA 4H3PA 5BYYA 5JN2A 2WMSA 3HMNA 5B0XA 4DEGA 3SRVA 3HDNA 4CG9A 3DKFA 3C4FA 3HDMA 5HE0A 2YITA 3PE1A 4O7WA 4IX4A 2WTKB 5I3OA 3W10A 4RVLA 2YIQA 3FQHA 1U54A 3L9NA 4D2VA 4W9WA 3QWJA 5KX8A 5EKNA 5D12A 3ZTXA 1URCA 3MW1A 4RX7A 4MHAA 3EMGA 2W1IA 4CRLA 4KS7A 3AOXA 5M55A 2IVUA 3QRKA 3MTLA 4FT0A 2J2IB 4YBJA 3TNWA 4ZZOA 2XIRA 3FC2A 3KREA 1KWPA 4GEOA 5BMSA 5HTIA 3KKVA 2JDTA 4O7ZA 4H3BA 4OUCA 3EFLA 4IVAA 4NEUA 4D1XA 4EZ3A 5C4KA 3KC3A 4RC4A 4IWPA 4CEGA 3QQKA 4WNPA 3PZEA 5HLWA 4K18A 5EDPA 4BGHA 3DU8A 2J51A 5KUPA 5JRSA 4DG2E 3VHEA 4X3FB 3BV2A 3TNHA 4JI9A 1QL6A 4G3EA 3O0GA 2YDIA 4AZEA 4IX5A 2ZM3A 3IDBA 5CNOA 4QPSA 3NUAA 3D5UA 4AS0A 5EYDA 4F6UA 4CV9A 4ZZNA 4ALVA 3VHKA 4YR8A 2C5NA 4USDA 3R7IA 4ZTMA 2R3QA 2HENA 4YNEA 4AACA 5BYZA 3SD0A 3DBEA 2BROA 5CAVA 3ZO4A 1JQHA 3OCTA 5C8KA 4C4EA 3PA5A 1ZYSA 1Q8YA 3AT4A 3BE2A 3QX4A 1JKSA 1DAWA 4RWLA 5FP5A 3EQIA 4ASDA 4CFNA 5IKWA 4FYNA 2LAVA 2YERA 1H00A 5IPJA 1ZZ2A 4MAOA 3PJ8A 3R21A 2HWOA 4NKSA 3QKMA 3RK9A 4PNKA 4QP4A 1YXTA 2ONLC 3RNYA 3FZ1A 4A9UA 3L8SA 3ETAA 4GT5A 2I7QA 3N4TA 3WILA 3FE3A 5BQ0A 2P2HA 5JGDA 3LFBA 3QXPA 4HJOA 3KXZA 5E8ZA 3CXWA 4DGLC 3RWQA 5E4HA 2IZTA 5HX6A 3ZC5A 2OO8X 2DUVA 3D5XA 3GU6A 3LMGA 2XKEA 2FSMX 3LXNA 4ITHA 5LCKA 3VF8A 2JD5A 3PVWA 3RPSA 4AF3A 4AGUA 5AAGA 3EFWA 5GIOE 2QLUA 5CYIA 2EB3A 1KV1A 4O7NA 3PXQA 2VWBA 5H2UA 3HA8A 4M8TA 4JAJA 2XNGA 2BTSA 3ORPA 3R83A 1A06A 1RJBA 4R3CA 4TYGA 3QL8A 4KINA 1L3RE 3OWJA 2C6LA 1BX6A 3LCSA 4JRNA 4D2TA 4XP3A 3JXWA 3M11A 4OBPA 4XG7A 3S4QA 2ZYBA 1FVVA 3V5QA 2GU8A 5C26A 4LMNA 1KE5A 3D83A 3Q4ZA 4XV1A 4ZTHA 4EH2A 2Y0AA 1U4DA 3DJ5A 4EHZA 2B9IA 2B54A 3NS9A 5CSHA 4I94A 5DYJA 5CVGA 2XYNA 2E9NA 1F5QA 3F5UA 4I0SA 3TKIA 4F7LA 5FRIA 4UWCA 2BCJA 1SMHA 2YDKA 3LXKA 4GIIA 3AMAA 2OF2A 3QWKA 4ZJJA 3BGPA 4EBWA 1PMVA 3BWFA 4YTFA 3VO3A 2H96A 5L6PA 3QLGA 2W05A 5I9XA 3DAKA 3DBDA 3QUEA 3WI6A 2PMOX 2PZ5A 3EN4A 3QTXA 4YJTA 5DT4A 2WGJA 4AZFA 1E1XA 4NK9A 5AV0A 2I0HA 5EI8A 2B0QA 1YXUA 4BCIA 5F94A 5E8UA 4OT6A 5L6OA 2F7ZE 2VWUA 3A62A 3LFNA 3TDWA 3FZRA 1Y91A 3CE3A 4QMTA 3REPA 2YZAA 4AE9A 1IG1A 4CKRA 2ITXA 3R73A 3HAVA 2ZV8A 3C0HA 4XP2A 5I5ZA 1XBBA 4YHFA 3W2PA 1BLXA 3R00A 1YHVA 2FYSA 1I09A 2RSVA 4IEBA 4CLIA 3QTWA 4NW6A 3BPRA 1BI8A 4RSSA 1GZ8A 2VWYA 5AP6A 4I6HA 3FZSA 3SLSA 3OW4A 2HZNA 2PE0A 1OBGA 3MYGA 5EHOA 2WMUA 1A48A 4BR3A 3BYUA 3QCQA 3QQJA 4EYJA 4ZS0A 3V5PA 3WYXA 2Y9QA 3QC4A 2XEYA 4IBMA 3F6XA 3LQ3A 4M69A 3FLNC 1VR2A 2DS1A 4YJRA 5E7RA 4EOPA 4XS2A 4XOZA 2JGZA 1JLUE 5I0BA 4MBIA 5K0XA 4S32A 4PDYA 2A4LA 3S1HA 1GNGA 5AUVA 3QA8A 2WHBA 3FZTA 4BWXA 3E63A 4FTNA 3SV0A 2OJJA 1WBTA 3LHJA 4LGGA 5A6OA 3VUTA 5GHVA 4J1RA 2YAKA 1GAGA 5E8YA 5EM7A 3R6XA 2I0VA 5FXRA 1WAKA 4QP1A 5FDPA 3IOKA 3RAWA 4H36A 3MFUA 1H8FA 2UVXA 3E3BX 3ELJA 1JBPE 3CKXA 4FI1A 4DTBA 5CAUA 5JGBA 1MRVA 3LCOA 4MF0A 1OL6A 2UZUE 5JKGA 4AWIA 4F0IA 5DH3A 4AN9A 4CFWA 3R1SA 3WARA 5M4FA 4EC8A 2A2AA 2GNJA 1TQPA 3DKGA 3ZSIA 4DINA 3LJ0A 5LMKA 3DKCA 3QGWA 4F9BA 2ITPA 3BQRA 4NH1A 3PIYA 2ETRA 3W2RA 4EC9A 3E8DA 2C6DA 4RJ8A 3C4WA 4DG3E 1M2QA 1IR3A 3CBLA 4I41A 5I9YA 1JKTA 3BCEA 4IVDA 4FKVA 4QP3A 3NZ0A 1ZMUA 3BYVA 3RWPA 3W2CA 1PRYA 4J71A 2JAMA 4HZSA 5AWMA 1NXKA 3VN9A 1BMKA 5BVWA 4IMYA 5IQFA 4JDKA 2RIOA 3FMEA 4MX9A 3PJ1A 3MESA 3VJOA 3MFTA 1JVPP 1R0EA 2YM4A 3F2AA 3O7LB 3PXFA 4U40A 4LRMA 1PYEA 4CZTA 2WB8A 3DKOA 5H8EA 3RPRA 4BBMA 1XH9A 3S3IA 2R4BA 4L44A 3NEWA 2QG7A 2VX0A 4GJ2A 2UUEA 3DXPA 1PXJA 4X3FA 4WRSA 5J87A 5EQEA 1GIHA 3UIXA 4AW5A 4JBQA 2OH4A 2JBOA 3BU3A 3CTHA 4IDVA 4PL3A 4WUNA 3MV5A 4XCUA 3TJDA 4EKKA 4HVHA 4N6ZA 1B38A 2CLQA 4MD9E 3TUCA 3DCVA 2UZLA 3ZFMA 3RK5A 4FSWA 5J95A 1XJDA 4YLJA 3V51A 5EH0A 4E93A 3FV8A 5CWZA 1W8CA 4J52A 3KA0A 4NFMA 4NM0A 5D1JA 3VUHA 4AGCA 3I0OA 4O38A 4QRCA 4HZRA 4R78A 4BDDA 4MXCA 2C0OA 4ASEA 4I93A 4P5QA 4QMUA 4E5AX 4O96A 4XRLA 2J0KA 5E8SA 1NVQA 4JDIA 2BIKB 1O9UA 2RGPA 4R1VA 5AIRA 5IQDA 1J7UA 4GK4A 3ZUVA 3E92A 3PRFA 3RM7A 4KSPA 2BTRA 2XZSA 3ORXA 5IA1A 4XLIA 5KHXA 1OKYA 3CTQA 5DIAA 1F3MC 4XG2A 1H1PA 4QTDA 4TKSA 4WG4A 3C13A 2NP8A 3GFEA 5AR4A 5AR2A 4PWNA 4HVIA 2OI4X 3DS6A 4S31A 5CTPA 5IMEA 4RIXA 4FIIA 3R8MA 4Y73A 3DFCB 4QYYA 4FSQA 4CTBA 4DA5A 5I9ZA 3QTUA 2UW6A 3W1FA 3ORTA 4L6QA 2XK7A 3HV6A 3EQPA 4QP2A 3L8VA 3QRTA 5KMJA 3BKBA 3NRMA 2QC6A 2ZM1A 4N0SA 5IU2A 3F3VA 4TW9A 2ZAZA 3UDBA 5KE0A 3RMFA 1PHKA 2BMCA 2X39A 5ANOA 3U4WA 4HVGA 3PG1A 3QBNA 4DH5A 3QRIA 5AUTA 2WTVA 4ZJIA 2O5KA 2BDJA 4BHZA 3G2FA 1LEZA 3FKLA 3RZFA 3F7WA 2RFDA 4QMPA 3W2OA 4YMJA 2YLEA 1X8BA 2XVDA 3ODYX 4I20A 3NMUF 4FL2A 3UTOA 3T3UA 2HZ0A 4E6CA 4EH7A 4F7NA 3ATSA 3FMKA 4FX3A 2VV9A 5AP2A 3I6WA 1U46A 4TTHB 4QOXA 3ZDIA 4U6RA 2F4JA 5ETIA 1Q4LA 4FKQA 5JK3A 3FYKX 5AP5A 1O6LA 1U5QA 4L68A 4R7BA 3DK7A 4MXZA 3TIZA 4LOOA 4PX6A 1H27A 1B6CB 3BBTB 4BYIA 4IJ9A 1WZYA 4AZVA 5A4CA 5DI1A 3DQXA 5E8XA 5ACKA 4LG4A 4AFJA 2W5HA 4ZP5A 3E8EA 3ZH8A 3C0GA 4GU9A 3MPTA 4YNOA 3Q9ZA 4B9DA 3UBDA 3UC3A 3VUGA 4E8AA 3CIKA 3GCQA 2HWPA 3ID6C 3NLBA 2HY81 4W4VA 2GTNA 3I60A 1APME 1OKZA 4R7IA 4QMMA 2FUMA 4G17A 5EM6A 4RX8A 3R9OA 3RAHA 2UW0A 3JVRA 4FT3A 3R63A 2PSQA 2QQ7A 5FXSA 4BC6A 4F0GA 3GCVA 3QHWA 2FB8A 4QMXA 3ZEPA 4ANQA 4KSQA 2WIHA 2IN6A 3EB0A 3NW6A 5IH4A 4KIKB 3R71A 3I0QA 3RNIA 2C47A 5JZNA 3LMHA 2XYUA 3R8LA 3ZBXA 4RGJA 3KB7A 3HMOA 2PYWA 2WQEA 4KBAA 3OWPA 3HV5A 3G6GA 1JKLA 4FTOA 5HOAA 4TYJA 2RG6A 1JPAA 1M17A 2V7AA 4C61A 4BCNA 4CCUA 5F4NA 3WF6A 3ZXTA 4EK3A 2HW7A 3LE6A 2XNOA 3R8VA 5GZAA 2W9ZB 2JIVA 4PNIA 3QX2A 3RZBA 3TXOA 4O81A 3PXKA 4FT5A 1AQ1A 4FTAA 3Q32A 4IANA 4GKHA 3QD2B 4PDPA 5CALA 4W4XA 4Y85A 5FBNC 3T9TA 3ZLSA 1M52A 3EYHA 4UXQA 3DZQA 5AUXA 4CSVA 3K3JA 4DH7A 3HA6A 2XH5A 2BRMA 4JQ7A 5FEEA 3QRJA 3TM0A 4FK3A 3DDQA 1OI9A 5IA4A 2QOIA 4AXAA 3H0ZA 3FWQA 5IISA 4C58A 2Z8CA 1I44A 3F3WA 4YPDA 4AA5A 2WNTA 4JJRA 4O0RA 3IECA 2X7FA 4DGGA 4RPVA 5FTQA 2I40A 1OBDA 1ATPE 1ZYJA 4ZLOA 1LP4A 3F9NA 2RFEA 5KCVA 3G51A 4IB3A 4P2KA 5J1VA 3VBQA 4MVFA 5CT7A 3D7TB 4PTCA 2OFUA 3VW8A 4J95A 2P4IA 2VWVA 1PMEA 4FEQA 2XK4A 2GPHA 5CU6A 1UNGA 4C0TA 3FMLA 3KMMA 4O0SA 5AR8A 5AUZA 3ITZA 4K1BA 4J8NA 5GJFA 5M09A 3HVCA 4BTJA 3VW6A 1H08A 2BIYA 4OBOA 2W5BA 4KBKA 5HNGA 5KBQA 5ETAA 2ITQA 4J96A 2YHVA 2OJIA 2VGPA 3OWKA 4Z3VA 3PJ3A 4WIHA 5J8IA 2B53A 3C4XA 5A46A 4I5HA 2UW9A 3ZM4A 2ZDUA 2XNNA 4PPAA 3BLHA 4DH1A 1NVSA 2IVVA 4E26A 2C1AA 3ZLXA 4GT3A 2BHEA 3WF8A 4I5CA 4XG4A 4IACA 5K4IA 5J7HA 4I92A 4LQMA 1P4OA 2WMWA 1IA9A 4CRSA 4D4SA 1KOBA 3B2TA 2AUHA 3KXXA 4HVDA 5LMBA 2WTJA 3AMBA 2CMWA 4M12A 3BV3A 5TO8A 4IC7A 4J97A 4QQJA 3OCBA 2R2PA 1ZAOA 3MIAA 2R3JA 4S33A 3RP9A 3W8LA 3GT8A 4OW8A 2XKDA 4EEVA 4D4RA 4G6NA 1XH5A 4CYJA 4RC2A 2Z02A 2YM8A 5EFQA 3S95A 4FBXA 4G3GA 3GGFA 3I7BA 3GBZA 4GYGA 2BRHA 1U5RA 4LGHA 3LLTA 3COHA 4IZAA 4TWCA 1ZARA 2WMXA 3FSKA 3QD4A 2CPKE 5M56A 4HNFA 3IOPA 4MYGA 4EH3A 3PWDA 4GFOA 3IW4A 4S34A 2AYPA 4FKIA 3UE4A 3W32A 4B99A 1CKIA 1FMOE 1R1WA 2GHLA 4FT9A 4FF8A 4L42A 3OBJA 4R1YA 4FV2A 4NTSA 1OPLA 3MN3A 3G6HA 3PVUA 3PRIA 1Q41A 3NUXA 4X2NA 3UMWA 4RIYB 5F1ZA 2RFNA 3NIEA 1WCCA 2GS6A 3UNKA 3U6HA 3DLZA 4JR7A 4ANOA 2GQGA 4BCJA 3WZUA 4E7WA 4FV4A 3MSSA 3I81A 1P14A 1XH6A 3NYXA 5CI6A 5CVHA 1CMKE 1PF8A 3MPMA 4HW7A 1S9IA 5H8BA 2YCQA 4FICA 4D4YA 4U42A 2FO0A 5L6WL 4GKIA 3BRBA 3GC0A 4QMNA 2J90A 3R8ZA 2VWZA 4C3PA 3DXQA 4O84A 4AOTA 3POZA 2VTOA 1JWHA 3H9OA 3MH1A 4M68A 3H9RA 4NW5A 5L8JA 3KVXA 4WOVA 3ALNA 4EHVA 3BWJA 2VTQA 5JFWA 1REJA 4FTIA 2UVZA 4F6SA 4CCBA 4RVKA 4JQ8A 3F61A 3QKKA 4ZSAA 3CP9A 4PQNA 2ITUA 3QF9A 2NNWB 4AZWA 3ANRA 4I23A 4AOIA 1Q62A 2WQMA 4BF2A 2B55A 3L1SA 1JSUA 3MVJA 4W4YA 3A7IA 3IKAA 4GK2A 4NUSA 5EDRA 4IADA 2J5EA 2JIUA 4KNBA 4R5YA 5E8VA 4BDFA 2PU8A 5L2SA 3EQGA 4IH8A 3O23A 3ACJA 4H1JA 2WOUA 4TYIA 3Q3BA 1GZNA 3T3VA 1OKWA 2WOTA 2WTIA 4R6VA 4C02A 5HHWA 4KIKA 2G9XA 2V7OA 4BKZA 2REIA 4O7YA 3R7GA 5HZNA 3ZFXA 2YWPA 4EYMA 3L9PA 5FUTA 3ORNA 2OGVA 1NW1A 4ZTSA 4U79A 1Q5KA 4U8ZA 4ZXTA 4ANBA 3RALA 4FSUA 3QUPA 5TKDA 3P0MA 5EKOA 3U51A 2PE1A 3EQDA 3LFAA 3AGMA 1FINA 5J7BA 2XIZA 4E1ZA 3MY1A 4FODA 4QP6A 1SNXA 4EJ7A 3HECA 2WU6A 3VUMA 5B2LA 3E3PA 5LVNA 4USEA 5D7AA 3DJ7A 3VBXA 1NY3A 1H0VA 2R3RA 1G3NA 4QMSA 5IZFA 2O64A 4X2JA 2GMXA 3SA0A 3MY0A 1FVRA 2XM8A 2CN8A 2GFCA 3MPAA 4YJUA 2RF9A 1Q8TA 3GC8A 3FQSA 3L9LA 3NUPA 2WAJA 4RIWB 4ASXA 4BFMA 3TZMA 3E5AA 4FV0A 2QKRA 2WXVA 3HRBA 4EOKA 4JDHA 5EM8A 3V6RA 4R3PA 3D7TA 3CY3A 3U9CA 4YHTA 5L2IA 1QCFA 1YWVA 2ZJWA 2VTAA 4JNWA 1CTPE 3QC9A 3N4UA 3UP7A 4MXXA 2XK8A 1M14A 1IEPA 2J0LA 5KBRA 1ZLTA 3FY0A 4M69B 4N70A 3SX9A 3VC4A 5EHLA 3ZM9A 4JG7A 2X6EA 4JOAA 4V0GA 4YGAA 3FXZA 4C7TA 4OTIA 1O6YA 2GTMA 5IQEA 3RBWA 2PPQA 4EHEA 3ZBFA 2OW3A 2QHMA 5G6VA 4JBOA 5E92A 4JVGA 3ANQA 3FSFA 3Q2MA 2C6OA 5JZJA 3FZPA 3E88A 3IDCA 2W4KA 3BGQA 3CR0A 4PRJA 2VWIA 3BHTA 5IH5A 3SKCA 5CEMA 3R7UA 3E8CA 3IS5A 4FA2A 4PF4A 4RQVA 1T45A 3Q2JA 4L8MA 4ORKA 3ZC6A 3E62A 4YZ9A 2DQ7X 1XWSA 2VD5A 4RVMA 4NFNA 2Q0NA 3WF7A 2W5AA 4OTQA 2CJMA 3A8XA 2UZVA 4PPBA 2C5XA 3AC2A 4I6BA 3ZSHA 3MFRA 4JG6A 4Z7GA 3G9NA 1PXIA 4UMRA 2IW8A 4F63A 3H10A 2PVFA 3MVHA 3O17A 4E6QA 2QOLA 2X9EA 4CZYB 1R39A 1F0QA 4FTRA 4F65A 3QTQA 3WE8A 4C59A 3MY5A 4WNMA 4GUEA 5CF4A 4CFUA 2PZPA 4DFLA 4OLIA 4YO6A 3SW4A 5L4QA 2XIYA 5HI2A 1RDQE 4MXOA 3G33A 4TN6A 4CVAA 2Z7RA 3F5PA 4RWIA 4YZCA 2Y7JA 3TKUA 2QODA 3VS2A 3KQ7A 1Z5MA 4IIRA 3ULZA 1PYXA 4UYAA 3UO4A 4ZMFA 3O51A 2ZDTA 3LFSA 5HD4A 1QPDA 5M4UA 2OJ9A 3EQBA 5DG5A 5KZ0A 4I22A 2WEIA 3Q9YA 3R1NA 2ZM4A 4L9IA 5BUEA 5IA3A 3WZKA 1IA8A 2W96B 3DQWA 2PK9A 3FQEA 4UV0A 5HE1A 5LMAA 3VVHA 4EK6A 4BCHA 1WFCA 4O86A 3O8UA 2BZJA 3EIDA 3TIYA 4DFNA 4YUQA 4Q9SA 4IQ6A 4QMLA 5KMKA 4C3FA 1PKGA 4QYGA 4IWQA 2WFYA 2JBPA 3OWLA 4H39A 2OF4A 2XKFA 3A4OX 3KXHA 4G3CA 3I1AA 4IZ5A 5CU4A 4DEBA 5HVKA 4RIYA 4ANNA 3JPVA 1V0PA 3MH0A 4NCTC 2OXYA 4HVSA 3O50A 4IZYA 5EDQA 4FV9A 3RPVA 5CXHA 4KA3A 3LXPA 4EHGA 2WPAA 3R30A 5AADA 4HGTA 4TNDA 2XBJA 2VO6A 3QQHA 1OPJA 4TY1A 3BE9A 2CKOA 3UC4A 5LQFA 4NTTA 3MB7A 5FDXA 1OMWA 4EOJA 2C3JA 3TDVA 4CT1A 5BPYA 2CCHA 4DFUA 3VBVA 4MH7A 4HPTE 1S9JA 3LCKA 5DMZA 4LI5A 2W17A 2WTDA 4Z9LA 1MRUA 5KMOA 3ZLYA 2XM9A 4IHPA 3DXNA 4XG9A 4UMPA 1PJKA 2PVLA 2R0UA 3DBFA 4RIXB 2XRUA 5H8GA 3IW8A 5HIEA 3PXZA 3Q4TA 4FKGA 3DB8A 3F7ZA 4KD1A 4M3QA 2VRXA 5HKMA 5AJQA 3FMDA 2HYYA 5L3AA 4RFZA 2XJ0A 4G3DA 3PSCA 3OG7A 4AZTA 4B4LA 5AA8A 3PLAE 4C2WA 3IW7A 4TT7A 2VNWA 4EOIA 4B6LA 2G2IA 3R02A 1H28A 3DJ6A 4BBFA 3LLAA 2G2HA 3F82A 2QG5A 3SOAA 3LFFA 4GW8A 5CEOA 4M0YA 5CENA 2RG5A 3Q53A 3QTIA 4CXAA 2EVAA 5BMMA 2QOOA 5I9VA 4ALUA 3A60A 3NCZA 3ZZEA 3UP2A 1V0BA 1J1CA 1XKKA 3W33A 4BDCA 4L67A 3FEGA 2CGVA 4ALWA 3SW7A 4CFMA 4QMZA 3LM0A 4XG3A 5KKRB 3ZHPC 2VN9A 2PVNA 3HV7A 3LW0A 4PMSA 4R5SA 4RRVA 4DFXE 4E4MA 2J5FA 3KF4A 3UO5A 5J9ZA 5CNNA 2W06A 4ZTRA 2PZRA 2R3IA 4MXAA 4G9RA 3W55A 4BCKA 4USFA 4PTEA 4EWHA 2X8DA 5GZ8A 5DHJA 4IX6A 3HUBA 1UV5A 4MD7E 5D7VA 3SC1A 5IG1A 4BZOA 3GU4A 3LIJA 3WF5A 1SZMA 5K5NA 5M06A 4YJVA 5KMIA 2E9OA 3TL8A 3OCGA 2XCHA 3UIUA 2PMNX 4X2GA 3EKNA 3EWHA 3VULA 4A9RA 4AUAA 5IUHA 1H24A 2P33A 2VO7A 3HL7A 4IE9A 4RFYA 4CT2A 3ORIA 4RIWA 3CS9A 4JIKA 3R9HA 4UMQA 4BCPA 4AAAA 3WE4A 3RPOA 2CHLA 2W4OA 3TV7A 2WMVA 2WD1A 1XH7A 1ZYDA 4EL9A 1IRKA 4QMVA 4UMTA 3NYVA 4M97A 1P5EA 4FL1A 3ORMA 4W4WA 3I6UA 3PP1A 4CKIA 3AD5A 1LPUA 4TZRA
chains in the Genus database with same CATH superfamily
2H6DA 3R9RA 3NDMA 3TEIA 1YXXA 2CDZA 2R0IA 3AGLA 4EZ7A 4GFMA 4DHIB 3R9DA 3CD3A 3T8OA 3GU8A 4BDIA 2XJ2A 1FQ1B 1H1WA 1OL2A 3D0EA 5LMKC 2BHHA 3W0PA 4AW2A 2IW6A 5LWMA 5KZIA 2BZKB 2WQNA 4K2RA 2WTKC 4A07A 4ZMEA 5AMNA 3C4CA 4M84A 5CANA 3A4PA 4ZSGA 3MI9A 2YIWA 4L52A 2RL5A 2NYAA 4O7VA 4ENYA 4OTRA 1HCKA 3TV6A 3C51A 4C37A 4IM0A 4D2PA 1W2DA 3TKHA 2CN5A 3PIZA 3OT3A 4FTMA 1ZYCA 3RHKA 3KCFA 3BQCA 2X4FA 5B7VA 4BDAA 3RGFA 2C6TA 4UBAA 5C8MA 4BI2A 1ZXEA 2HCKA 3ULIA 2QCSA 4YZDA 2QNJA 3OBGA 4YSJA 3ENMA 3SGCA 1YOMA 3QZFA 4WUAA 3DTCA 4X3FC 3T9IA 1HCLA 3KMWA 3NNXA 3PVGA 5AFVA 1OVEA 5C4LA 5FBOA 2HXQA 3NYOA 3MFSA 2VZ6A 3PTGA 4KKEA 4LV5A 3NNUA 3ROYA 3CPBA 2P55A 4E6DA 4ACMA 4DYMA 3S2PA 4WA9A 1WVXA 3QCSA 2BAQA 4O0YA 3U87A 4H1MA 4FUYA 4U5JA 4WG3A 5KMNA 3BYSA 4J8MA 1UU9A 3LM5A 3UVPA 1Q99A 2OZAB 4R77A 2QOFA 4RX9A 4FSYA 3BHUA 5CLPA 3BHHA 3DZOA 2VGOA 2VU3A 2XARA 4UEUA 3P08A 5AEPA 3NUUA 4D5HA 5JEBA 1Q8ZA 3AC5A 3PFYA 2BRBA 3JY9A 3K2LA 5HO7A 4IAZA 4H05A 4ANLA 5CF6A 4FVQA 3RKBA 4HGEA 4X3JA 5FXQA 4E4XA 1TQMA 1PKDA 1Q3WA 1LEWA 2XNEA 1UNLA 5HG8A 3PLSA 4FNXA 5DT3A 3LVPA 2AC3A 2J0IA 5CU2A 2WU7A 4D58A 4FKTA 4MXYA 4BYJA 3AT3A 2UZNA 4D1ZA 3JY0A 3LJ1A 5J1WA 4XMOA 3AC8A 2HELA 3OC1A 3OY1A 4L46A 3PY1A 3GB2A 3UOKA 3OMVA 3GVUA 2YJSA 4P90A 5AAEA 3V01A 3FBVA 4RJ3A 2OBJA 4DDGA 5FTGA 5L8LA 4TWNA 2JC6A 4FT7A 4PUZA 1V0OA 3B8RA 3HLLA 2WMAA 3VBTA 4DEHA 2UW8A 3H9FA 4F1TA 2KTYA 3Q6WA 5AV2A 3NAXA 4BTMA 4FK6A 3SXSA 5J79A 3LZBA 4QQCA 3VS7A 4EH9A 2BKKA 3KMUA 5AV3A 3P4KA 5FP6A 2CKEA 4BWKA 3W0NA 4K77A 1K2PA 5AIKA 3SAYA 2JDSA 1ZMVA 5JH6A 3VJNA 3NX8A 4AQCA 4DCAA 2C6EA 3EQRA 2R3HA 1CDKA 3PXYA 3ZOSA 5E1SA 1KE7A 1WBPA 4Z7HA 1IAHA 5BYLA 1Y8YA 4I21A 3ZO3A 1OGYA 2GNFA 1UU3A 4MEDA 4BJJB 3ZSGA 4D2SA 4EH8A 2C5YA 5HBHA 5HD7A 3OUNB 4OTWA 3EQCA 1ZRZA 2UVYA 4ZK5A 3QALE 3D5WA 5DE2A 3V8TA 4LM5A 1VEBA 4AW0A 3FYJX 5H9BA 2XRWA 3G0FA 3IW5A 4ID7A 5DLSA 4FUXA 2C3IB 3P23A 5FEDA 2GNIA 4CFXA 1Y57A 2RKUA 5IF1A 1SVHA 2QLQA 5DEWA 2B7AA 5IUGA 4YBKA 5FD2A 2QI8A 3FDNA 2BRGA 1DAYA 4JBPA 4PL4A 4D2RA 3CQUA 3TTIA 4DBNA 4O7TA 2H8HA 1BYGA 3PFQA 4FZ6A 4BI1A 4XP0A 5EOBA 4B0GA 3FLSA 2B9HA 4BCMA 4DCEA 3A7FA 3RCDA 4BY9E 4IC8A 1UWHA 3OW3A 2QU6A 3EHAA 4H3QA 4X2KA 4RWJA 5BVEA 2O65A 3QZGA 4L53A 1W7HA 3NUNA 4JR3A 4WG5A 4EOSA 4BRXA 1OGUA 4FTTA 4WO5A 2VAGA 1UNHA 4FKRA 5FG8A 2O63A 4X0MA 2IG7A 5HO8A 2QHNA 4W8EA 1OZ1A 4AXEA 4YC6A 2CSNA 3ERKA 3FL4A 2XNPA 1H26A 4A4XA 3C50A 4A9TA 2PY3A 5CF5A 4LRJA 2YN8A 4U44A 2CNQA 2ZOQA 2WMBA 4LRKA 4O4EA 3SXRA 4FKUA 2YFXA 3HYHA 3P7AA 3ENHA 4D0WA 2JDOA 3Q6UA 5FQDC 1VYZA 2WZJA 4O7SA 3G0EA 4ZOGA 3TNPC 1SVEA 5HVJA 2XMYA 5HIDA 4JT3A 1CKPA 1H1SA 4HYSA 3MIYA 4G9CA 1W83A 4FR4A 5IDNA 3L8PA 3UODA 3IDPA 5EYCA 2YIYA 2ETMA 4KRCA 4ONAA 2JAVA 5CQUA 3IQ7A 3NR9A 4XRJA 3QRUA 1ZY5A 2YCFA 2G1TA 5ETCA 3KXMA 3FMMA 2XK3A 3LFEA 3DGKA 2QO7A 4M7IA 3R7EA 3NGAA 4LL0A 4XYFA 4IWDA 4KKHA 4UB7A 4W8DA 3VBYA 4XNEA 5J9LA 1M2RA 4LGDA 3I7CA 4FSMA 3ET7A 4LOQA 4GVJA 3QQGA 3UIMA 1YRPA 4GS6A 3D2KA 4GIHA 5EW9A 5AM6A 2ETKA 4NIFB 4BZDA 2JKMA 3F5XA 2JKQA 4U3YA 5FGKA 2OJGA 2ITYA 4QDEA 5AP3A 3PE2A 4IJPA 3TUDA 1PXMA 3GCSA 4V04A 3QLFA 4WSYA 2HIWA 3NW7A 2HZ4A 3PYYA 4OTFA 1J7LA 2OLCA 4H58A 4DDIA 3H30A 4JLCA 1JSTA 4O91A 2YA9A 4V0GB 3AG9A 4F6WA 2OZAA 3FI3A 1VYWA 5EQYA 5HLNA 3SHEA 3P5JC 3ZONA 3GXLA 3U4UA 1SM2A 2R9SA 4IX3A 3AD4A 5K3YA 5HICA 2AEGA 4EI4A 3ZUUA 1A9UA 3FC1X 4LUEA 5ITAA 3H4JA 3C5IA 2EWAA 3PA4A 1KE9A 4CD0A 5T6KA 3CJGA 2P3GX 3P9JA 1WBWA 3OUKA 4JIAA 4FSRA 4WT6A 2BALA 4DE4A 3UOLA 2J7TA 4NSTA 4C34A 4ENXA 5BVKA 2CNVA 3F2RA 3SG8A 2Y4IB 2PVMA 4U7ZA 4ZTQA 4N4SA 2LGCA 3BHVA 4PTGA 5DEYA 4BCQA 3UZTA 4KABA 1CSNA 3VNTA 4BGQA 2PVYA 5C8NA 2R3OA 3RK7A 3OZ6A 2EXCX 4FVRA 3G9LX 3QU0A 3LPBA 4AGWA 2QD9A 4D2WA 5M4IA 2R64A 2XCKA 2FA2A 4APCA 2PUPA 4I6FA 4NKAA 3G15A 4GK3A 3KEXA 4E5BA 5F9EA 4BCFA 5EOLA 4QO9A 3MDYA 3CEKA 4Z55A 3GC7A 2R3MA 4DBXA 4LFIA 2YABA 5TT7A 3R1YA 5DWRA 3R22A 1XQZA 4YJSA 4DFBA 3L8XA 5D11A 4O0VA 3PIXA 4YSMA 2YEXA 2FSLX 3MJ2A 5EM5A 5HNBA 2I0YA 4DGMA 5CEKA 5JRQA 4O0TA 5HORA 2FSOX 5DPVA 4WRGA 5M51A 4ARKA 5C1QB 3Q04A 5ANIA 4L7FA 3PJ2A 4CQEA 2X7GA 2JDVA 4GG5A 4FIHA 2GQSA 1J1BA 1OIUA 2XNBA 4YU2A 5KMLA 3RM6A 3FI8A 2W1EA 4L01A 5HG7A 2ITWA 4XV9A 4QP9A 4FKLA 4FTQA 3SOCA 3V5LA 3EZVA 4K6ZA 1H07A 1PY5A 2GNLA 3COMA 3PP0A 3JUHA 4YJOA 1H1RA 4BGGA 5ANJA 3VRZA 2VWXA 1H1QA 4MNEB 3TTJA 1REKA 4BJJA 4O6LA 3BBWA 4CTCA 4DEIA 4FYOA 2WQBA 4F9WA 5LJJA 4CV8A 4G1WA 2PUUA 5AUYA 2QURA 4TL0A 2BPMA 3HAMA 2ZVAA 4QD6A 2NRYA 2XF0A 5CSWA 3OY3A 1WVWA 3CTJA 3ZUTA 2V62A 4XBRA 3HGKA 2EB2A 4QP7A 2ACXA 2JEDA 3D14A 4YHJA 3V6SA 1UWJA 4G31A 4L3JA 4F70A 3HZTA 3IK3A 3PSBA 4MQ2A 2XB7A 2BZIB 5IA0A 3QTSA 5H3QA 4BI0A 3UIBA 2W1CA 2R3PA 3ZDUA 2OXXA 3LAUA 1Y8GA 2FVDA 3R7YA 3U54A 3FKNA 4OAVB 5HLPA 4F9YA 3EQHA 3ZRMA 5A14A 1KE6A 4Y5QA 3RVGA 3I5ZA 5K5XA 4RVTA 3BLRA 3OFMA 4UX9A 5HE2A 4MUQA 2IF8A 4MF1A 1RW8A 3KN5A 5JFSA 2VO0A 2NRUA 3NCGA 3TACA 2J9MA 3A61A 4HYIA 4NZWB 4RBLA 3LQ8A 1OIYA 4A4OA 3KK9A 5LVMA 3OXZA 3VAPA 1NT2A 4QMYA 3ZRKA 2VO3A 3QAME 3UDTA 5D9HA 4FVPA 4OR5A 3ZZWA 4CMOA 1PXKA 4O2PA 4EBVA 2KULA 3HKOA 3HRCA 3BEGA 3VS1A 2UW4A 3WF9A 1XO2B 4ACDA 4E4NA 2OXDA 2BVAA 4X6QC 5DR6A 3JS2A 3ZXZA 2PVKA 3V5TA 5BVFA 4M0ZA 5HU3A 2OJFE 5LWNA 4I4EA 4IB0A 3FLWA 2W1FA 5ETFA 1NA7A 4OGRA 4RIOA 4ZY5A 2OSCA 2F9GA 2W1ZA 4F64A 3GU7A 5B2MA 2BILB 3H3CA 5A4QA 2CNUA 3GCUA 2YJRA 4O0WA 4ZY4A 4PMMA 2W1DA 3A99A 4M67A 1V1KA 4M66A 4QP8A 1UKIA 2O0UA 4ZSLA 4FTKA 4C4IA 4E3CA 4IW0A 3OXTA 4JAIA 2OFVA 2JKOA 2P2IA 4AG8A 1W2FA 3EKKA 2VWWA 4GJ3A 1JKKA 2UZWE 3L9MA 4PL5A 4EKLA 4UYNA 1PMUA 3LFQA 4ZTNA 1WBVA 3OTUA 3LJ2A 3UG1A 2X6DA 3OP5A 4D9UA 1KSWA 2VTIA 4BHNA 4AZSA 4DITA 3AKKA 3OHTA 5M53A 4AT5A 3DB6A 1SVGA 4YTHA 4ITIA 3WZDA 2ZV2A 4FSNA 5EK7A 4L45A 4FV5A 5BVDA 5JT2A 3FLZA 5LXMA 3S0OA 5CY3A 2HW6A 1XBCA 2X8EA 4GUBA 4Y46A 4TXCA 4ERWA 4ZLYA 4NIFA 3P1AA 3DNDA 3QZIA 3V5WA 3FLQA 4K9YA 3UJGA 2FSTX 4QTCA 4ZSJA 4DF3A 3OEZA 4AA0A 5JMSA 3I4BA 4I6QA 2V55A 2C0IA 3UGCA 4XHKB 3UQFA 4L43A 4KIOA 3FJQE 4BDBA 4AFEA 4DHFA 4EQUA 4DT8A 4WHZA 5M08A 1GZOA 3QUDA 4F1OA 4GCJA 1LR4A 5JQ5A 5M57A 3RINA 3VUIA 2PUNA 2XKCA 1ZOGA 4JBVA 2YM7A 5AAFA 4F1MA 4UWBA 2QOKA 5EQPA 2X0GA 1Q8WA 2IJMA 1OITA 2CKQA 4O2ZA 2GHMA 2X4ZA 4JX7A 3DV3A 3GI3A 4MK0A 5EI6A 1KV2A 2VX3A 4FV8A 3F69A 2DWBA 4AE6A 4BB4A 2WQOA 2X81A 1W82A 2R3GA 2SRCA 2IZRA 4NL0A 3PA3A 4HGSA 3CY2A 4IAAA 5HCXA 2V0DA 2QOBA 4RC3A 4XLVA 3ORZA 3GCPA 4QYEA 2CGWA 1Y6AA 2JLDA 2QU5A 2ZV7A 4FNWA 3GP0A 4IB5A 2PHKA 4Y72A 4EH5A 2R3FA 3KRWA 3SDJA 3OOGA 4X6RA 4G6OA 3A8WA 2YZLA 5HEZA 1UU8A 4XEYA 2B4SB 1O6KA 3CGFA 3HV4A 5C01A 4B8LA 3ALOA 4ZLZA 1GIJA 3ML1A 4AW1A 2QKWB 2J50A 1AD5A 3C4EA 1Q61A 2F7XE 3IG7A 1R0PA 4IAYA 2XNMA 3U55A 3JYAA 4YP8A 4QPAA 4XV3A 1HOWA 4UY9A 1YOLA 2BFXA 2PL0A 3CC6A 4HCUA 3ZLWA 5CEPA 3CD8A 4O1OA 5HU9A 2NPQA 4O22A 5K4JA 2R3NA 1YDTE 5L2QA 5HBEA 3AC3A 4UMUA 1WBOA 5AR3A 2V5QA 2BRNA 2ZB0A 4AT3A 4EOQA 4NM3A 2CLXA 4NU1A 3BI6A 4RA4A 2ITNA 2XJ1A 4OBQA 5AP0A 3P7CA 4Q5HA 4FTCA 4IAIA 2PVHA 5HCZA 1DI9A 4F4PA 4A9SA 1ND4A 3EN5A 4LL5A 2VX1A 4XOYA 1URWA 4ZIMA 5TR6A 4BN1A 2XK6A 5HG5A 5KNJA 1ZYLA 1W0XC 3DPKA 4IVBA 1XBAA 3P79A 4MNEA 4DN5A 2BR1A 2X2LA 4BZNA 1UKHA 2C3KA 1KUTA 4Q9ZA 4RT7A 1CM8A 4F78A 3E64A 3BZ3A 3QGYA 4NWMA 4O7LA 4IM2A 1Q8UA 2QONA 4GSBA 4DT9A 2Q83A 2GS2A 2IPXA 1YHSA 3VIDA 3V8WA 4PMTA 3Q4CA 1ZOEA 4IZ7A 3QCYA 4U45A 2R3KA 4FNYA 3V04A 2BKZA 3C0IA 2GNGA 3HP5A 5IQAA 5CSVA 3K3IA 3WIGA 3KULB 5GNKA 5A6NA 5HBJA 2VTLA 3KK8A 2UZEA 3W16A 1MRYA 4GH2A 4K8AA 3NWWA 5C9CA 1DS5A 2W0JA 3RCJA 3UNZA 3CLYA 3R1QA 3TNQB 3AXWA 3UYTA 3UG2A 2X0QA 4AA4A 2CGUA 4X7QA 4WKQA 4GFGA 3U6IA 3FUPA 4AN2A 4OT5A 4FC0A 4AX8A 3I79A 5LOHA 1VZOA 3N51A 5DA3A 4PP7A 4F0FA 2YM5A 4N6YA 3TZ9A 3JVSA 3Q52A 3PVBA 4O0XA 2ERZE 4NCTA 3OF0A 2WMRA 4QMWA 4RJ4A 5C03A 3KFAA 4M13A 2XA4A 3O7LD 4C4FA 2H34A 4ANMA 4EOLA 3QFVA 3QKLA 4NJ3A 3TJCA 5K9IA 5A9UA 4AN3A 2B9FA 5DVRA 1QMZA 3P7BA 4BIBA 5J9YA 2BUJA 4DTKA 3D7ZA 4K11A 5AP4A 4RJ7A 1IASA 3LFDA 2XIKA 4RQKA 3CCNA 4HCVA 5I4NA 4G34A 5LCJA 2PUIA 5ACBC 1J91A 3W2QA 2E9PA 2BAJA 2XUUA 2ZMDA 4UALA 5DRDA 2YWVA 4L3PA 4R8QA 5CU3A 5LARA 3CKWA 4XBUA 4YZBA 4NT4A 4IWOA 1YI4A 2ONLA 4A7CA 4FKWA 2F49A 5HG9A 1R78A 4QTAA 2ZV9A 1IAJA 2YCRA 5IQIA 4S2ZA 4BWPA 1WBNA 4BDKA 3HX4A 4U0IA 5AUWA 3DT1A 5AM7A 1YWNA 3QZHA 2OH0E 4FZFB 1OUYA 2OWBA 1FPUA 2YM3A 3EFKA 4FGBA 2O8YA 4K33A 2JFMA 4CFFA 2JITA 2YDJA 3CQEA 4J98A 1OPKA 4DEDA 4U81A 5M4CA 4BDJA 2UZDA 4F7JA 4U43A 3WZEA 2OG8A 3KRXA 3MB6A 4P4CA 2YISA 3VF9A 2W7XA 4DC2A 3I5NA 2NO3A 4FMQA 4EH4A 3C4ZA 1QPEA 2PE2A 3OT8A 3DOGA 3ZO1A 2A1AB 4CMUA 1UU7A 2GNHA 3FMJA 1BL7A 5AV4A 4TNBA 4E5WA 3WYYA 5BVNA 5ANGA 1UA2A 4MBLA 3R28A 4R3RA 4YJNA 1QPJA 5T68A 4MBJA 4D5KA 3K54A 4FG7A 4BCGA 4FTJA 5BNJA 3M2WA 3MGYA 4FV7A 3D94A 3VS0A 5C27A 1JSVA 2BAKA 3R8PA 4WSQA 4CYIA 3OCSA 3EN7A 2B9JA 4FZAB 2OK1A 4KKGA 3CGOA 4L3LA 4LV8A 3O8PA 5GJDA 3W18A 3UOJA 3IGOA 3ZYAA 2X7OA 3TUBA 4ZSEA 2XAOA 4GU6A 2AC5A 2YIXA 2HY0A 3IONA 3OD6X 4C3RA 4EOMA 2ZB1A 4YJPA 4Z16A 4XUFA 3NIZA 4L7SA 5ANEA 5CZIA 3O8TA 2EXEA 3IW6A 3ZS5A 5GINE 3TCPA 5DBXA 1YQJA 3ZEWA 4I5MA 3JR1A 3UMXA 4FEXA 2IVTA 4FIGA 3UYSA 3F5GA 3QYZA 1GY3A 2C5VA 2OIQA 3D9VA 5HO6A 1PMNA 2GDOA 1YVJA 4QMOA 4QYFA 1GZKA 1YXVA 5HNIX 2Y8OA 2FGIA 3MWUA 5CEIA 1KOAA 4FTLA 4BTFA 3A2CA 3FMHA 4IFCA 2RFSA 4UZHA 3TZ7A 4ZAUA 3HMPA 4BIDA 3GENA 1JAMA 3V3VA 2C5OA 1OB3A 3B8QA 4FZDB 1KE8A 2J0MB 4DLJA 4IAFA 2G15A 3HMMA 3ATTA 4FKPA 4QEBA 3FKOA 4WNKA 2ESMA 4MTAA 4NM7A 2W1HA 4AOJA 2ITVA 1OIQA 3P86A 4PPCA 5HIBA 5A4EA 4O27B 4KWPA 2YM6A 3UO6A 2Z7LA 4FG9A 4I3ZA 4TYEA 3RHXA 3CJFA 5CAOA 1T46A 4EONA 4I1ZA 2JKKA 4BCOA 2C6MA 4GT4A 3OVVA 1ZZLA 3NNWA 5CX9A 4RLLA 5EYKA 4CKJA 3A7GA 2DYLA 4XH6A 4CGAA 3OOMA 5DGZA 2VTRA 4I5PA 1WBSA 4IM3A 3NUYA 4EWQA 4IDTA 3LOKA 4D1SA 3QYWA 3TMOA 2YCSA 4M14A 4ANSA 2UZOA 3F2NA 4O6EA 3MTFA 3GEQA 2B52A 4FIJA 4XG8A 4E73A 2O2UA 4FSZA 3UQCA 3RI1A 2J0JA 3F88A 4ZTLA 3UPXA 5I9WA 5G1XA 4I0RA 2R3LA 1B39A 4JG8A 4ZJVA 1RQQA 3TG1A 3HEGA 5EW3A 3RPYA 3FPQA 1G8AA 1JNKA 3BIZA 2OIDA 2PWLA 3BYOA 2JFLA 3E93A 3RTPA 4FL3A 5HCYA 2Y4PA 4TYHB 2C0TA 4UXLA 5HESA 4G6LA 3LKMA 4EJNA 2XP2A 4HOKA 3PG3A 3PUPA 3QD3A 4X21A 4A4LA 4BKJA 4YURA 3AC4A 2A0CX 4YTCA 2F7EE 5HTCA 5JFXA 5CS6A 3Q5ZA 3SVVA 4YJQA 2OICA 5CVFA 5TE0A 4E20A 2W1GA 3HUCA 3KULA 3EJ1A 4FV6A 2HZIA 4UZDA 2FH9A 3D2IA 3BL9A 4FTUA 2A27A 4HGLA 4RZVA 3SXFA 2UV2A 4YLLA 5BVOA 3E7VA 3GOKA 4PY1A 2BZHB 2XEZA 3Q9XA 5KKRC 4C2VA 3FZOA 1DM2A 3K5UA 4I0TA 2YIRA 4KS8A 1YDRE 5EHYA 3ODZX 3R01A 2C68A 4WBOA 4L00A 4ACGA 2GFSA 4DEEA 4QQTA 5L8KA 2OZOA 3DFAA 4X2FA 2JDRA 1W2CA 4YC8A 5DOSA 5AX3A 4ZS4A 4FOCA 3ZMMA 3VS6A 5FM3A 1M7QA 1FGIA 2C1BA 3BELA 4F9CA 2Y6MA 4PDSA 3VUDA 3EN6A 1TVOA 2IEWA 3BU5A 2WMQA 3FAAA 1ZWSA 5AX9A 4IFGA 1FVTA 5IQBA 2YAAA 1H0WA 1YOJA 3II5A 2X9FA 1SYKA 1STCE 2XALA 1Q97A 2HAKA 2E9VA 4AXDA 1J3HA 1H25A 2I6LA 4IVCA 2W9FB 4C4HA 1YDSE 5I9UA 2R5TA 2PULA 3AMYA 2EU9A 5DR9A 4D9TA 3MA6A 4MKCA 3CPCA 1PXPA 3B2WA 3LFCA 1MP8A 4FNZA 1BL6A 5IA5A 1L8TA 5AP7A 4OTDA 2WELA 4MWIA 3UVRA 2PTKA 2QOCA 4RLKA 5J5TA 1PW2A 4ERKA 2XBAA 4A06A 1TQIA 1SNUA 2Z60A 3Q96A 4RWKA 4C4JA 4OAUC 3SQQA 2C30A 1JOWB 2WTCA 4EH6A 2XS0A 3GNIB 1WVYA 2E2BA 1K9AA 3SG9A 3GQLA 5M07A 4FIEA 5DR2A 4C33A 5CQWA 3BLAA 3AT2A 2PMIA 3ACKA 5BV3A 5F95A 5CASA 3THBA 3KU2A 3F66A 2QVSE 3MH3A 4AGDA 2OU7A 1DI8A 3VUKA 2Z2WA 3R04A 1YXSA 4GRBA 4MCVA 3ORLA 4R7HA 4QMQA 5L2TA 1W98A 3NVKI 2W99B 3C1XA 4YLKA 2VTMA 5FM2A 3R7VA 4QYHA 2CKPA 3N4VA 2HK5A 3TNIA 2X2MA 5GIPE 1OL7A 3IO7A 4EORA 3DLSA 4JQEA 2G2FA 3V5JA 5FTOA 3FLYA 5DFPA 5FEQA 3R2YA 3PSDA 1M2PA 1Z9XA 4F08A 3QXOA 5E8WA 4C57A 3AKJA 3FMNA 4DEAA 2F2CB 4DFYA 5I3RA 4ZZMA 4BKYA 1PXNA 3KXNA 5AUUA 3KVWA 3FHRA 1LUFA 4C62A 1ERKA 3Q60A 3R9NA 4J99A 4Y5HA 5JGAA 3Q4UA 4FZ7A 3H0YA 3BX5A 4XV2A 5IUIA 1MQ4A 1OM1A 4FV3A 4GYIA 4E6AA 4LUDA 3A7HA 4P7EA 2C6IA 5T3QA 2VTSA 3KCKA 5LVOA 3DBCA 3FL5A 4DLIA 3O96A 4MNFA 5CSXA 5FWKK 4N57A 3WZJA 3TV4A 3WBLA 1YI6A 3ZCLA 3UDSA 3G5DA 2V22A 1YI3A 4RFMA 5E90A 2P0CA 4XX9A 5EYMA 3DA6A 1ST4A 1OKVA 1XH4A 5GJGA 5EG3A 4FE2A 5DNRA 4AXCA 1M7NA 2GS7A 5CU0A 4LMUA 1XH8A 3W0SA 4DGNA 4AQKA 4JXFA 4O82A 5IEYA 1FBNA 2UW7A 3ZO2A 4RG0A 5CZHA 3W0QA 5HE3A 3VBWA 3LQ5A 4QPMA 3S00A 4ASZA 4EQCA 2GCDA 3QCXA 3LCTA 3MJ1A 3FXWA 4QNAA 5DRBA 4NM5A 3NAYA 4QNYA 3AC1A 5A54A 2EUFB 5ANKA 3VRYA 4D28A 1OUKA 4V05A 2YLFA 5E91A 1YHWA 2C4GA 3DNEA 4U97A 4U9AA 4WNOA 5ICPA 4W9XA 4O21A 2IWIA 4G16A 3NW5A 2Q0BA 4BIEA 3OXIA 4FEVA 2CCIA 2ITOA 3U6JA 3KXGA 4F09A 3DY7A 5KHWA 4ZY6A 5A3XA 4KUJA 1E9HA 2A19B 3MS9A 3P5KA 3QQLA 4JL9A 4B7TA 4FOBA 4FJVA 4PP9A 3KIOC 2QOQA 4Y95A 4GL9A 3HRFA 4O1PA 2Z7SA 5ANDA 1ZY4A 3VQHA 4ACHA 4EZ5A 1TZDA 3FI4A 3G90X 3BLQA 4CLJA 3O2MA 4ACCA 1PXLA 4EOOA 1FGKA 4RJ5A 3ZRLA 3NNVA 5GZ9A 2GQRA 3ORKA 2IZSA 1UVRA 4J53A 4PV0A 2ERKA 4RJ6A 4TPTA 3TZ8A 5IQCA 1H01A 4JMQA 2UZTA 3BHYA 1G5SA 1MQBA 1OL5A 4C36A 2G01A 4Y83A 3W8QA 3KGAA 1XR1A 2WIPA 2XIXA 3EN9A 3FXXA 4BICA 4CNHA 2C6KA 4QT1A 4TWPA 4TYHA 4V01A 3U8WA 5K0KA 3DTWA 3LCDA 2OKRA 3KL8A 3EOCA 3MBLA 4CQGA 3COIA 3D4QA 3PY3A 1AGWA 4FV1A 4DH8A 5CF8A 5KMMA 4CMTA 1ZOHA 4AT4A 3R7OA 5F20A 2PMLX 5AP1A 4EUTA 3TWJA 5IA2A 4Q2AA 3DBQA 4OTPA 4FGRA 3W0MA 5CI7A 4RX5A 5IEXA 5D10A 2VTHA 3UVQA 4FSTA 3GUBA 3OS3A 4HPUE 3SRVB 3U9NA 5E9EA 2J6MA 4DG0E 2C3LA 2X0PA 5CAQA 4IXPA 1Y6BA 3EQFA 3PWYA 3BEAA 1U54B 4LYNA 4DTAA 1P4FA 3C7QA 3KN6A 3MA3A 4DFZE 3WIKA 1P2AA 2WO6A 3D15A 3TYKA 2ITZA 5D41A 2W4JA 3KRJA 3MVLA 2I1MA 4EQMA 2WEVA 4FKOA 4GV1A 4A9YA 4EK5A 3NFFB 4HCTA 4XG6A 4YPSA 4OTGA 4JDJA 3AD6A 3EH9A 3IGGA 3UOHA 4C8BA 1K3AA 4UN0C 5IMXA 1CKJA 3DAEA 3FY2A 4GVAA 4D0XA 3GFWA 3POOA 3QQFA 2VUWA 3R0TA 2VTJA 4GG7A 3RAIA 4D55A 1XHAA 4KIQA 1MUOA 4QQ5A 4YZNA 5LVPA 3NVMB 5BUIA 4DHJA 2BDFA 2XK9A 4KAOA 4F7SA 4QTEA 5AR5A 2PVRA 4BDGA 4G5JA 5AR7A 3HV3A 5IQHA 3F3TA 3OTVA