1M7QA

Crystal structure of p38 map kinase in complex with a dihydroquinazolinone inhibitor
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
348
structure length
348
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Design and synthesis of potent, orally bioavailable dihydroquinazolinone inhibitors of p38 MAP kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 348
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2002-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1m7qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1m7qA01
4E93A 2DYLA 3IONA 3F7WA 2C5OA 1QCFA 3DTWA 3QD0A 3KL8A 3DAEA 4TYIA 5CX9A 4AT4A 4C3FA 3RK9A 2UW9A 2FSLX 2JAVA 4BB4A 3D5WA 3LFSA 5AAGA 5JGAA 3OCGA 4TWPA 2BRNA 3ZO4A 3I0OA 2G2IA 5I0BA 1NW1A 4DEDA 4NUSA 2IZRA 4D1SA 3QFVA 3QKMA 4HVSA 4C4EA 4Q9ZA 4C3PA 2FO0A 5I9XA 4W9WA 5DH3A 5JZNA 3UOHA 2ONLA 5HX8A 4IW0A 1OBGA 2Y8OA 1FBNA 5GINE 3C4FA 2WTKB 4I6FA 4B4LA 2ITZA 1UU7A 3A7JA 4PPBA 2WMTA 4MWHA 3R22A 3PG1A 4EOIA 2A27A 1YHWA 3DJ7A 3GI3A 4C02A 2BFXA 1GZOA 4ZAUA 2WTWA 2OH0E 3FQSA 3Q32A 2W1CA 4MXOA 3AC3A 4L53A 4NW6A 4X0MA 3EN4A 1ZARA 5CWZA 3R7VA 1KWPA 4FGBA 3DKOA 4M15A 3V5JA 2P33A 5HIBA 4AG8A 5HG5A 3ATSA 3EWHA 3OP5A 3HKOA 4N6ZA 4TYHB 3DBDA 3FMKA 4EC9A 3HNGA 4C4GA 3UYTA 2WOUA 3ORPA 2WIHA 1B38A 3P4KA 5J9YA 4FTCA 4GCJA 5L8JA 4Q5HA 4H36A 3MPAA 4E6QA 1OIUA 2O5KA 3P79A 3QYZA 5CSWA 2IG7A 1GIJA 3FHIA 4L9IA 1M52A 3V3VA 3WYYA 2GHGA 5IQFA 3EN5A 3FY0A 3G9NA 2BHEA 2OSCA 4YLJA 1ZYLA 5HESA 3F3VA 5A4LA 4G17A 1Q62A 1I44A 1STCE 4PPAA 3JY0A 5KMOA 3RAHA 5K5NA 3O23A 3SAYA 3OBGA 4EQUA 3MVMA 2WMAA 3Q4UA 4Q2AA 4UB7A 5AM7A 3Q60A 4QMOA 4DFZE 5FM3A 2X2MA 4R3CA 4O7LA 2BZJA 2YM3A 3QQUA 3DLSA 3QL8A 3IW4A 2IVUA 4NTSA 3CXWA 4W9XA 4O21A 1H1SA 3WZKA 5FXSA 2ITTA 4KKEA 3Q4TA 3PE2A 2AC5A 2XRWA 4YHJA 5DR2A 3IOPA 4FV9A 2VU3A 4AA5A 4ZSEA 4RC4A 4KBKA 2YWVA 3OTUA 2A19B 4KBCA 3P7CA 3RPVA 4DFYA 3KREA 3PRIA 2R3OA 4G3GA 4O6LA 3NNWA 2CNUA 3NMUF 1PKGA 5KE0A 4N6YA 4BWXA 2V5QA 4Z55A 1YW2A 3QZFA 4UWCA 4F99A 1Q8TA 3LIJA 3KA0A 4AA4A 4Z7GA 2XBAA 4QMVA 3WF6A 3EN9A 3IK3A 3UJGA 2WMQA 3R2BA 5DRBA 4YBJA 3UBDA 5KMLA 4C36A 1SVHA 3DBFA 2QOIA 3MGYA 4TZRA 2UV2A 3Q5ZA 3LCDA 3GFEA 3LOKA 3A7FA 2HIWA 3LMGA 4CZUA 4FSTA 5A4CA 3E5AA 5HE3A 4AQCA 1IA8A 4BVUA 4QYGA 3F2RA 4LFIA 4O0TA 3TI1A 4IVDA 4JDHA 3AD5A 4QMZA 5DVRA 4EKKA 1Z5MA 4F70A 3V5QA 3OW3A 5KHWA 4R1YA 5E8SA 5L2IA 3EL7A 5IUHA 4NWMA 5ANEA 5M51A 2W1EA 3O7LB 4Y73A 2W0JA 2WMUA 5AUZA 2QOHA 4G9RA 3V6RA 4S33A 4FKWA 4GU9A 4L3JA 4Y5QA 5HEZA 3C5UA 4D2WA 4FKLA 3P08A 3AGLA 1YI4A 4QP6A 4OGRA 4ZY6A 1XH9A 3OF0A 4UBAA 2IW9A 4LV8A 3JVSA 4WSYA 5DFPA 1QL6A 3C4EA 3R8LA 3R00A 4MK0A 3AT2A 1M2PA 3SOAA 5C01A 4O84A 2I0HA 3UC3A 5JQ5A 3E88A 4MX9A 5AX9A 3ZS5A 3ZRLA 2IZSA 3HECA 3KXHA 4NFMA 4HPUE 4V0GB 2YDIA 3WZDA 3LLTA 4J1RA 4C4FA 3NUAA 4AU8A 4I93A 3UZRA 3TIZA 5FTGA 5CAPA 4WO5A 4WIHA 1LPUA 2CPKE 1GY3A 3TCPA 1Z57A 3TL8A 5IISA 3AC5A 5J87A 4UN0C 4O0UA 2WXVA 1B39A 5DEWA 4EC8A 5IG1A 3FMDA 3OWPA 4EK8A 3HRBA 3NYNA 3UYSA 3RZBA 2O0UA 4BDCA 3R1NA 4BIDA 2IZTA 3O17A 2ACXA 2HCKA 4OBPA 5C4LA 4ERKA 1YHVA 4JQ7A 4EUUA 5TO8A 3P23A 1Q41A 4IX3A 2CHLA 2HENA 2VTLA 3LXNA 3ZSGA 3TNHA 5K9IA 2R0UA 2RKUA 1KE9A 2HAKA 3MTFA 4L7FA 4M66A 4EONA 4CYJA 2QKRA 2Y4IC 2VWWA 2V62A 4YBKA 5B0XA 3TZ9A 5TKDA 2IW8A 2C5YA 3EFJA 2JLDA 3A61A 4IVAA 4YJRA 3ZO3A 4AAAA 2WFYA 4MBLA 3GP0A 5D11A 3PLSA 2QU5A 4YC3A 1NT2A 4O0WA 3VUTA 4UMTA 4HYHA 3BGPA 4MD7E 1KE5A 3TNWA 4U7ZA 3L9MA 3K3JA 4NKSA 5CTPA 3WF9A 4FL2A 5GJFA 3LJ1A 4D2TA 4A07A 4PMPA 4USFA 5HX6A 4AX8A 5ICPA 2QVSE 5B2MA 3QKLA 3BYOA 4ID7A 3R9NA 1XHAA 3MA3A 2YN8A 1JNKA 5HCZA 4YMJA 4QRCA 4DEAA 5CI6A 1OMWA 2X7OA 3ZOSA 4BICA 2ZJWA 4EORA 4RJ7A 3ZRKA 4XV9A 4E5WA 4ANQA 3U87A 1GZKA 4FTQA 4B7TA 4M0YA 1KSWA 2RL5A 2C6TA 3EKNA 1BUHA 2FSOX 4X3JA 4DAWA 1YQJA 2E9OA 2UZTA 3H3CA 4FOBA 5EI2A 4L3PA 1MQ4A 4BDEA 4HNFA 4JBOA 3EQHA 5EKOA 4JQ8A 3E8NA 2BR1A 2WQEA 3D7TA 3FV8A 4PY1A 3QC4A 3R63A 3DTCA 1YVJA 4XS2A 5BVKA 3S95A 3VC4A 4FZDB 4B8MA 2FUMA 4NT4A 3MV5A 4UYNA 2HW6A 2XEZA 4X6QC 4C8BA 1IG1A 4E8AA 1XO2B 4JR3A 2B52A 3A62A 4HVGA 1IEPA 4J97A 5L6WL 1F5QA 4LYNA 5A4QA 3BRBA 3VBXA 3DLZA 5HGIA 5EKNA 5AR8A 3LFNA 3TUDA 2PUIA 2OW3A 4QT1A 5D10A 5ANKA 3DT1A 3HMOA 3N9XA 2VWXA 4LV5A 5L6PA 3PIXA 4IZ7A 4F9YA 4R78A 2HZ4A 4K77A 2R7BA 2WTDA 4O38A 4ZK5A 5EQEA 3NWWA 4TYGA 3BWJA 1ATPE 5DOSA 4F65A 4K6ZA 5M4IA 4HVIA 4M12A 1UWJA 1TQPA 2F49A 4AN2A 3MW1A 2NP8A 1XH4A 3DBCA 2CKOA 2FYSA 2JFMA 3AC2A 3L8SA 4KABA 2WNTA 4YR8A 5FBOA 2IJMA 2PZIA 5IQBA 1U54A 5F1ZA 4BDKA 2Z60A 3SVVA 5FM2A 3I60A 2XIYA 2W7XA 3W8LA 4G3FA 4NJDA 3TKHA 4CZYB 3WZUA 4PDOA 3OXIA 1H28A 1YDTE 5HNGA 4BZOA 2R4BA 5BVEA 3G15A 3VHEA 3F6XA 3MBLA 5CZIA 3MVLA 1M2QA 5EM7A 4PMSA 5AEPA 2VO3A 4TXCA 1KE8A 4U3ZA 2RG5A 3Q6WA 5CSHA 3LFCA 4W4WA 4C35A 2Q83A 2WD1A 4OTGA 3QRKA 3H10A 3UNKA 3UG2A 3HVCA 4JIKA 3GC7A 4XRLA 5BUIA 3DBEA 4YSJA 5KKRB 1PY5A 5EG3A 2X8IA 2XK9A 3SGCA 4XBUA 4MF0A 1JKSA 3KEXA 2WHBA 4L42A 4YHTA 2I0EA 4KRCA 5IA5A 4RBLA 4Y72A 2NPQA 2O65A 4V04A 1S9JA 2WKMA 2WMXA 3DPKA 4D55A 4YTFA 3U51A 3SW7A 3D15A 3PSBA 3HA8A 4U43A 4D9TA 4M8TA 2B9HA 4RVLA 1LR4A 5A3XA 1J1CA 4HVDA 4YJNA 3QTSA 1UVRA 2YERA 2XEYA 5ANJA 2PZPA 4U79A 1YOJA 4I23A 2XK6A 1GJOA 5IQHA 4RG0A 3AD4A 3Q52A 2ZOQA 3NPCA 4GW8A 1W7HA 5ANDA 2F2CB 3OY3A 3DK3A 4FTMA 1H8FA 3A4OX 3KU2A 4JDKA 3ULIA 4AZVA 3HV5A 4DFXE 1ZYCA 3IW6A 4FNYA 3ODYX 1QPEA 5AP5A 4BI2A 5E4HA 1UWHA 4F7JA 4M3QA 5ACBC 4AXAA 5EK7A 2XNEA 3QBNA 2GDOA 5LVLA 2W1GA 2YFXA 2R3MA 5HNBA 1RDQE 3RWQA 4F6SA 2R3GA 3CS9A 2ZV9A 4OR5A 2PZYA 1AQ1A 3KN6A 2A0CX 4GFGA 5BVFA 2BRBA 4HPTE 2XNPA 2PU8A 1K9AA 3NS9A 4QYYA 2PYWA 1YRPA 3ZUUA 4QMXA 1QMZA 1JSTA 3C9WA 4L43A 4CKIA 3AOXA 3DQXA 2ITYA 2ETMA 1MQBA 2CMWA 3SKCA 4RFMA 4WT6A 4D2SA 3ITZA 1UKHA 3PY3A 2BZIB 2VGOA 2W1IA 4EHVA 4ZLOA 4O7WA 1TQMA 3VWAA 1KUTA 4PTGA 4IAIA 5GZAA 1WBSA 2OJFE 2Z7QA 5E8ZA 3QQHA 2QNJA 5E8VA 4EWHA 5IQAA 5LMKA 4KKGA 4J96A 1UNHA 2XKDA 1XBBA 3AQVA 4CFVA 3K3IA 2WEVA 1OUKA 3AMBA 4UXQA 4D4SA 4YU2A 1GIIA 5M56A 4LM5A 4TKSA 3F3WA 2YIXA 3CBLA 4UZDA 1NY3A 3FMEA 3QALE 3TWJA 2G01A 4BTFA 4MBIA 1LEWA 2VTNA 4DC2A 1WBVA 3DKCA 3EYHA 3ODZX 4G3EA 4LOQA 4P5QA 2YAKA 4XEYA 4EBWA 4CCBA 4FNXA 3U4UA 1XWSA 1XH7A 2ONLC 3OWKA 4O1PA 2YACA 4DFNA 4D1XA 4DFBA 3BQCA 2XH5A 3PJ8A 3UPXA 4CZTA 5B7VA 1KOBA 1GZ8A 1OPJA 3DKFA 3II5A 4X3FB 4DG0E 1L8TA 2W96B 3EJ1A 4L67A 1MRYA 3EH9A 3SOCA 3FZPA 4ZJIA 3R01A 3RGFA 2XCKA 3R9OA 3VS5A 4LG4A 2NRUA 5C27A 4X2JA 2XK8A 4RQKA 3PDTA 3OOGA 1JKTA 4CVAA 3OZ6A 5IA4A 4BY9E 4JNWA 3FXWA 3OMVA 2J0KA 4O0XA 4YTHA 2HYYA 3PRFA 4FSNA 2GPHA 4ZTMA 4YNOA 3NW6A 3E92A 2PVRA 3MY1A 4RJ4A 1ZZ2A 2W05A 4O82A 3DXNA 4I0RA 3ULZA 4FV3A 5C03A 4IFGA 4W8DA 4F1TA 4BDAA 2C0TA 2ZAZA 4G16A 3VUIA 2YDKA 4Y8DA 3U9CA 4BTKA 2XRUA 3K54A 1OZ1A 3HUBA 5DR9A 5EW9A 5IQDA 3FUPA 3FE3A 3R8MA 4DEBA 2Q0NA 5D7AA 3QLFA 3MB7A 4ZEGA 5TOZA 4O91A 3NGAA 3OFMA 4NFNA 4XLVA 5KCVA 4F7NA 4I4EA 4RJ3A 4A4OA 2C1BA 2O64A 4QMMA 3LCKA 1A9UA 2PMOX 1ZY4A 3E7VA 5L2QA 1SZMA 2OFVA 4I4FA 5CF6A 2WTKC 4C38A 4JRNA 4X3FA 3PPZA 3QRJA 2J5EA 2X6DA 3BHYA 5JFWA 3U6HA 4KBAA 2CKQA 3R7EA 4CGAA 4I6HA 5M06A 5H9BA 2A4LA 3C13A 3CSVA 4BYIA 3NVKI 2X0GA 3RMFA 1H0WA 1XH5A 4KRDA 1P4FA 4WOVA 1Q4LA 4CEGA 4A7CA 2QO2A 3WIGA 3V01A 3NX8A 5H3QA 3GCUA 3K2LA 4DINA 4BTJA 3EB0A 1Q99A 1V0PA 2V55A 3FHRA 4FZFB 3ORIA 4LGGA 4GU6A 4IACA 1T45A 1JSVA 5D12A 4ARKA 4AW2A 2VWVA 2W99B 5AUWA 3PVWA 1XJDA 5AR4A 3TDVA 2IN6A 4QMSA 5FGKA 3PXFA 3SA0A 4X2GA 1QPCA 4AOIA 5C26A 2QHMA 1BI7A 4IAAA 4XV2A 1DI8A 1BL7A 4D1ZA 1XH8A 4NCTA 3ZO1A 3KULB 2CGXA 2ITVA 3R6XA 2VO6A 3BE9A 2XP2A 4D4VA 5E1EA 1V0BA 3C5IA 4DITA 1R1WA 3CTJA 3H9FA 4LRJA 1FMKA 4EK3A 4J8NA 4JIAA 3I7BA 1H1QA 2OF4A 4IJ9A 4X7QA 4L46A 1OPKA 5HNIX 4YLKA 3DB6A 5HG8A 3KVWA 4M69B 3U9NA 3ZLWA 4FKVA 5AIRA 1Q8UA 1BLXA 3HV6A 5CEKA 5KMMA 2PZRA 1ZOGA 1WBWA 4IHPA 4GKHA 3BYVA 3H9RA 3HA6A 4AW1A 3PPJA 4TN6A 4GUEA 4Q5EA 3G6HA 3QQKA 3R30A 4XV3A 2VNWA 2BRGA 2UZDA 4R7HA 4DTKA 2GU8A 3COIA 3V6SA 4TW9A 2QODA 2VRXA 4ZY5A 1OKZA 4FSMA 2XK7A 3NYVA 1RJBA 5J9ZA 4CFUA 2GTNA 1U5QA 4LGDA 4KD1A 4MTAA 3LCTA 1YKRA 5AMNA 4EJNA 2OLCA 4KB8A 2J7TA 2CCIA 3DFCB 3MTLA 3RPOA 4O2ZA 4QP4A 5M4UA 3GOKA 5AWMA 1YXSA 4DGMA 1H1PA 2WGJA 1APME 3UIMA 4PTCA 1Z9XA 1ZOHA 1Y6BA 5A4TA 4F0IA 3L1SA 3KULA 4NW5A 1IA9A 3EYGA 2CGVA 2QO7A 4RX8A 2JDOA 2XM9A 2BKKA 3KRLA 2R0IA 4I0TA 5JRQA 4M84A 3LFAA 4U44A 4XG2A 3C1XA 2WQOA 4QP9A 4HGLA 1ZOEA 2P2IA 4FKGA 5AR7A 3KKVA 3KRWA 2R3LA 5HVJA 4HOKA 3QUPA 4DLJA 4L6QA 4QP7A 3G51A 4TYJA 3CE3A 4CG8A 3I79A 4QOXA 3FLZA 3UNZA 3WZJA 2X6EA 2PVYA 2R3HA 2ZYBA 2VTAA 3RCDA 4N0SA 3WF7A 1Q3WA 4FOCA 1JLUE 3PTGA 4RIYB 3SXSA 3ROYA 4CG9A 5AUUA 3KN5A 5GZ9A 3UMWA 4JL9A 4DGGA 1WVWA 3MWUA 1ZRZA 2J50A 5DT0A 3FLYA 3OUKA 4WUAA 3FZTA 1H01A 3L9NA 4DFLA 2GS6A 2BZKB 1R0EA 3BBTB 3SXFA 3WE4A 4ANSA 1GOLA 2GMXA 3LJ0A 4FF8A 2HWOA 3A2CA 1ERKA 3JUHA 4XG9A 4HJOA 3SG9A 3MA6A 3UZTA 1BX6A 3P7AA 1F3MC 2YM7A 3MVJA 3LM0A 5C8MA 4AS0A 4BBMA 5DR6A 1AD5A 3E8EA 3PY1A 1JWHA 3PIYA 4AW5A 4BCMA 4P2KA 1Y57A 5LJJA 3V5PA 2OJJA 3E62A 4FV5A 1YI3A 3VN9A 4FX3A 1VYWA 2WTCA 4RWLA 3SRVB 3PUPA 2BTSA 3GC0A 2YZLA 3Q4CA 4L7SA 5HBEA 3ZZWA 3S2PA 3CD8A 3GNIB 3OOMA 3PA3A 5FQDC 5L8KA 2XMYA 3OBJA 3NUUA 1U46A 4DYMA 5B2KA 1MUOA 4KS7A 4HZRA 3D2KA 3QQJA 3QC9A 1YWNA 4W4XA 3I81A 2JGZA 3LXPA 4IAZA 4G9CA 3OWLA 3W2RA 2ETRA 3UG1A 3VO3A 2VN9A 2XJ0A 4FYNA 4TY1A 5IDPA 5EYCA 3RAIA 4QP1A 4QTAA 3W2PA 3QRTA 3P86A 4FEVA 4QTBA 5CASA 4UMUA 3G33A 4FMQA 4QTEA 3AC8A 1SVGA 2GS7A 4GIIA 5HCXA 5BYZA 2X4ZA 4RIYA 3PXKA 4A4LA 3PXYA 4JBQA 3UIXA 2XK4A 4CRSA 4YZMA 5FD2A 3TZ7A 3UZPA 3MSSA 1J7LA 5DBXA 1P14A 4NEUA 3ZM9A 5EI6A 4EOQA 3OXZA 5FDXA 2RIOA 4HGTA 1KOAA 2C6MA 5JGDA 2BTRA 2H96A 4PDPA 3W2CA 5CAUA 2PVJA 3FI4A 3LCOA 4I24A 4TTHB 1R3CA 3A7IA 3ZLYA 3ZSIA 1PXKA 4BZNA 4AGWA 5JT2A 4IX4A 5H8EA 4YPSA 2W1FA 4LOOA 3QA8A 2QI8A 3SRVA 2F57A 4BCGA 2QOKA 2VUWA 3HGKA 4DG2E 3S4QA 4YUQA 1XH6A 3VBTA 4CCUA 4EI4A 1J91A 1JVPP 4YPDA 1YXTA 4JBPA 3R83A 3W2SA 5IDNA 4O7VA 4FBXA 2J9MA 5LVNA 3PFQA 1H07A 4FV8A 2GQSA 4V01A 4ZP5A 4I20A 1UNGA 4EH9A 2EB2A 4ENYA 1PJKA 5F20A 3KK8A 2UZWE 3VUGA 2JIVA 2VAGA 1OL2A 4AT3A 3IS5A 3VNTA 5JFXA 4ZMEA 3PP0A 3PZHA 1PXPA 5CU2A 3HX4A 5KZIA 3AD6A 4GK4A 4EOMA 5BQ0A 2XA4A 3SHEA 2YLFA 2Z02A 3TJCA 4FUYA 4CQGA 3QWKA 1W0XC 4MQ1A 2PMNX 3QD3A 4MXCA 4UEUA 3BQRA 4QD6A 4IJPA 4FEUA 4WRGA 2X81A 4E4XA 3TUCA 4FL3A 3CGFA 2WELA 1KV1A 3ATTA 3K5VA 2BRHA 3L8VA 3FZ1A 4CD0A 4D9UA 4ITHA 4D5HA 5I4NA 4C34A 2WQMA 5IF1A 1ND4A 3G2FA 5HI2A 4DE4A 3OROA 4AZWA 2OI4X 4MF1A 4QMUA 3R2YA 2EVAA 2PUNA 4ZLZA 4E6DA 3W55A 2XK3A 2VTIA 5D1JA 4TYHA 4OT5A 4APPA 5AV4A 1LUFA 4IC8A 4JQEA 1O6KA 4FKUA 4XJ0A 3VF8A 4DFUA 3Q6UA 1WBNA 5FEEA 3DZOA 4BL1A 4KWPA 5HIEA 3MJ1A 4MD8E 2B0QA 1WCCA 1WVXA 4ACHA 3VBYA 4J98A 4G1WA 3EKKA 3ELJA 1O9UA 5M4FA 2EWAA 5CXZA 4FE2A 4RVKA 3TNQB 1GNGA 2OZOA 2XM8A 2XVDA 3HMMA 3M42A 3Q3BA 4DTBA 3DGKA 5AR5A 3AT3A 5JGBA 5KX8A 3VIDA 5A14A 5CANA 3THBA 4EQMA 3PPKA 5KKRC 2W5AA 4I22A 3UVQA 2RF9A 3BELA 5IUIA 2GFCA 2OIBA 2IZUA 2UZBA 3RAWA 2KTYA 3LFDA 4S32A 4YZ9A 5KZ0A 4ITIA 3IG7A 2RFDA 3CJGA 3OXTA 4LRKA 1O6LA 2GNHA 4YHFA 3QTXA 3VRYA 4CSVA 1Q3DA 3PSCA 4MNFA 4MH7A 2HZNA 1HCKA 2GCDA 4WBOA 4AGUA 5M44A 3NUXA 4EOLA 5BVNA 2UZEA 1FVRA 4UWYA 4YZNA 2JKOA 4L01A 4FICA 5LMKC 2W06A 3UTOA 4TNBA 2A1AB 3NAYA 5CVGA 2J51A 4RIWB 5J9LA 3F5PA 1M2RA 2JAMA 2WMSA 4P7EA 1GAGA 3FYJX 3PJ1A 1OL6A 4QYHA 2QHNA 5T68A 2Q0BA 3HMIA 4R5SA 3ZFYA 2RG6A 2H6DA 3MFSA 3QTIA 5JN2A 2B55A 3UO4A 3FZRA 3OCTA 4UYAA 4AGDA 4EOSA 4BN1A 5C9CA 1IASA 2ZDUA 4GT4A 3EQGA 5AUTA 3S00A 4RLLA 2UUEA 4I5MA 4FVQA 4WG3A 1CSNA 4C0TA 4M97A 4IWDA 4G5PA 2B54A 5HBHA 4CKRA 2QQ7A 3NCGA 4MQ2A 1PKDA 4L45A 3BX5A 5HO6A 4IX5A 2REIA 2W5BA 3C50A 3C0IA 4PX6A 3ACJA 5T6KA 2OFUA 4LQMA 4CKJA 4G3CA 2EXMA 1CTPE 3AGMA 3R1YA 1MRUA 4AFEA 1SMHA 4PWNA 4DH3A 4FVRA 4O96A 3PXQA 4LGHA 5K3YA 3RJCA 5BX0A 4EOOA 5GJDA 4FIJA 4FV4A 5HZNA 3A7GA 3KXNA 3TV7A 3FZOA 4IDTA 3F7ZA 4OTDA 5TE0A 3COMA 4BDBA 4O7ZA 5CT0A 2C3KA 3KRJA 3MI9A 2YJSA 1WBTA 4IB5A 1OIRA 1UV5A 4IVCA 3MESA 3PVBA 4FIFA 3ORMA 3JY9A 1CDKA 3F3ZA 4BCJA 4F7SA 3AC1A 5I9ZA 2X1NA 5H8GA 4AZSA 3IDPA 1LP4A 3CCNA 3DS6A 4MAOA 4QMLA 4U80A 5EOLA 1JAMA 4ZSLA 4QTCA 5BUJA 5IUGA 3DBQA 4RIWA 4P5ZA 4O0VA 4V0GA 1IRKA 4JR7A 1RW8A 4I6BA 3NCZA 1H4LA 3AT4A 4KUJA 4A9YA 3R7IA 4P4CA 4KS8A 2PWLA 4RLKA 2PVLA 3V5LA 2Z7LA 5HKMA 3E7OA 4FTKA 4YGAA 1WVYA 3EFKA 1PXLA 3Q9WA 2P2HA 1H08A 4X3FC 3EQFA 2Y7JA 5HU3A 4UV0A 4FIIA 2G1TA 4EOJA 3KC3A 5KMIA 4ZTSA 5EOBA 4EOKA 3LQ5A 3L9PA 2C0IA 2J0LA 3GCVA 2J5FA 4IM3A 4LRMA 3GU4A 3UGCA 1SYKA 3BEAA 3OEFX 4H3BA 5H8BA 2R3KA 4YC8A 5CI7A 4ZTLA 5CU6A 3E3PA 5M55A 3NR9A 5HO7A 5IQCA 2VX3A 5CF4A 3GGFA 2GFSA 5HQ0A 4QNYA 2NNWB 4FKPA 1MRVA 3QUEA 4NIFB 4RWJA 5LCKA 2NO3A 5AA9A 2R3NA 4Z9LA 3UO5A 5LARA 4O83A 4EL9A 3R7YA 3BYMA 4J71A 2PUPA 2ZMCA 2J90A 3BGZA 3GOPA 4J52A 2B4SB 1P4OA 4C58A 1BL6A 1PF8A 4JVGA 3RBWA 2JBOA 3NZ0A 4OTWA 5IA0A 4FUXA 2YCQA 4MXYA 4BIBA 5EDRA 3I5NA 2Z2WA 3RTPA 2DQ7X 4NCTC 2RFEA 3V51A 3JS2A 3BU3A 3ORNA 5B2LA 3LFQA 4HYSA 5KHXA 4ALUA 4YTIA 5I9WA 4JLCA 4YJOA 4BHZA 4PV0A 2PVFA 5I3OA 1KV2A 2UW5A 3QXPA 3BHTA 3UNJA 4DGNA 3QTUA 5BPYA 3QCSA 3BU5A 4GS6A 4BCPA 5E8TA 3KCKA 1PYEA 4XP3A 3ZTXA 3AXWA 5DE2A 4R3PA 4S31A 3ZUTA 1V0OA 3H4JA 4BDFA 2VV9A 3EFWA 3IOKA 1U4DA 4KAOA 1CMKE 1K2PA 2G15A 3RHXA 2X2KA 4I3ZA 5HLNA 4GFOA 5GIPE 3KMWA 2UZUE 3OS3A 4FYOA 4C4JA 4FIHA 2AYPA 2BPMA 1OI9A 4GG5A 4ZSJA 4NIFA 4FODA 3F5XA 3N4UA 1OL5A 4Y46A 4BDJA 2FGIA 3GU6A 1REKA 2F4JA 3MFTA 4RZVA 1IR3A 2WMWA 4YNEA 3RI1A 4AP7A 4AZFA 3VW8A 3FZSA 5JEBA 3VS1A 3TKUA 1E1VA 3FXXA 3LHJA 3PG3A 4IB3A 3TACA 4BDDA 4FZ7A 4JBVA 4QTDA 3NSZA 2QG5A 4HYIA 4R7IA 5DG5A 5FBNC 5HTIA 3ZZEA 4WUNA 4EHZA 2BDWA 4L44A 4UMQA 4DBXA 5CAOA 2QU6A 2OXDA 3IGGA 5LCJA 5M09A 4F09A 3E3BX 5CU4A 3UE4A 4WRSA 4MD9E 4FTOA 4H1MA 3NUPA 5AADA 4YSMA 3Q9ZA 4C37A 3QD4A 3UIBA 4F6WA 5LVMA 3EQRA 2X7FA 5L2SA 3KQ7A 3O2MA 4M13A 2GQGA 4USDA 4E20A 4CMUA 3ENHA 5FEDA 1M14A 3KF4A 3KF7A 5BUEA 4M14A 3FXZA 2Y4PA 4FSUA 4IQ6A 2X8DA 3F5GA 3QX4A 3GB2A 3IW8A 4MVFA 4U6RA 4C59A 2WTIA 3FI8A 3QKKA 4S2ZA 3DU8A 3NUSA 3ZHPC 4GIHA 2BAJA 3E8CA 4AE9A 4ANLA 3Q2JA 5HIDA 3P7BA 2R3PA 4EK4A 4QNAA 4D2VA 3FLNC 5BVWA 4YJUA 3MJ2A 2JKKA 2UZNA 4U5JA 2DS1A 5EM8A 2GNGA 2I6LA 2PMIA 2R3IA 5L3AA 5M4CA 2PL0A 3EL8A 2CCHA 3R7OA 4QQ5A 3M1SA 2XNBA 3GVUA 5DHJA 2BIYA 3T3VA 5HE2A 5K0XA 3O8TA 3HRFA 4RSSA 2SRCA 5J95A 2OJ9A 3R1QA 1WBPA 4JDIA 4U9AA 3TNPC 4E7WA 2RFSA 5I9YA 1H1RA 4BI1A 3UDBA 3CKXA 4XX9A 4QQTA 1A06A 4I1ZA 2G2HA 3WILA 4CLJA 5HLWA 4DBNA 1RQQA 1PMVA 2R9SA 3E93A 4QPSA 3G6GA 5HORA 3F5UA 3ALNA 3ETAA 3FMHA 4IFCA 3FYKX 3NYOA 3QD2B 4QMYA 3ZLSA 3KXZA 4QYFA 3FBVA 5EDQA 4M67A 2IW6A 3U8WA 3DZQA 3MFRA 2UW8A 3MPMA 2C6IA 2J6MA 4E6AA 4CFFA 2OGVA 4FK6A 2YCFA 2XJ2A 3CTHA 3NNVA 4WG5A 5AIKA 2X2LA 2XKCA 5E92A 5J5TA 5JMSA 4DA5A 3DFAA 4IXPA 5ACKA 3RPYA 3IGOA 3ZXTA 3BV2A 1OKWA 5AV2A 2QG7A 3DXPA 1GZNA 4FSWA 4GSBA 4DN5A 4I41A 1WBOA 2ZB0A 2IWIA 2ZM3A 4JT3A 4U0IA 1T46A 5E8XA 4ZIMA 5LVPA 4AOJA 1ZAOA 3KFAA 4FV1A 3Q9YA 4BDIA 3REPA 4F6UA 5IEVA 1NXKA 2VWBA 2OBJA 3VAPA 3F66A 3IQ7A 3CLYA 5CSPA 2GS2A 3EQPA 4JG8A 4UX9A 2W5HA 4JJRA 5AP0A 5FP5A 4NYEA 4PDYA 2PUUA 3LFEA 2HXLA 2B53A 4JAJA 4TWCA 2UW0A 2Y9QA 4W4VA 4XRJA 3QZHA 4RPVA 3FL5A 4E6CA 5LQFA 1KE6A 2YLEA 4BCHA 1URWA 5DIAA 3VHKA 2XYUA 2ZV8A 4KIKB 4QPMA 4CFMA 3R9HA 3IO7A 2ZV7A 2V22A 2J4ZA 3G0EA 3COHA 3NRMA 3WYXA 4TNDA 2XBJA 5JFSA 2X4FA 3HP2A 2YIWA 3LW0A 5KBRA 3QQFA 2ITPA 3Q4ZA 4L52A 5DI1A 5HTBA 3OTVA 1F0QA 2XIZA 4FZAB 5DRDA 1JSUA 4D0WA 3NW5A 2JKQA 3MS9A 3KGAA 4LOPA 4WHZA 4XHKB 3QU0A 4F9AA 3OUNB 5C4KA 4GYIA 2QOQA 3MH1A 2CNQA 4I94A 1IAHA 4FKIA 4FNWA 4KSQA 4OUCA 3OD6X 3MDYA 1H27A 3R9RA 4DEGA 4NL0A 3PA4A 2E9PA 4O0YA 5HE0A 2C6EA 3KMMA 5CLPA 3TTJA 3KMUA 5IEYA 5CEPA 3W1FA 2HY0A 1ZMVA 2XJ1A 3MPTA 2Y6OA 4HZSA 4A9UA 4XH6A 5IQEA 5CSVA 2W4JA 3BGQA 3FMMA 3BZ3A 4GVJA 3KRXA 4MHAA 2UW3A 5GNKA 4ZLYA 4FT9A 4TL0A 4OTRA 2I1MA 4P90A 4HCUA 4I92A 5IA3A 1YDRE 5FWKK 3A4PA 4ASDA 5IEXA 3R21A 4GG7A 4ASXA 3TG1A 4ALWA 3IW7A 4G2FA 4BFMA 2PTKA 1OL7A 4RX9A 3UP7A 1JOWB 3MB6A 4W8EA 2BMCA 4MBJA 3D5UA 3B2WA 4FTRA 4JG7A 3TEIA 3UQGA 3ZXZA 3LKMA 2JDRA 3I4BA 3POOA 5D9HA 1ZZLA 4IM2A 3PJ3A 5AUXA 3FDNA 3JPVA 1YI6A 4OTQA 4ERWA 3K5UA 4MNEB 5J5SA 2XB7A 3P78A 4DEEA 5KMKA 3TTIA 4RJ8A 4K8AA 3RK7A 4PL5A 2C6DA 5L4QA 4G5JA 5GHVA 3OCBA 3DK6A 3FKLA 4BGQA 4D5KA 3UODA 2W17A 4K33A 3D0EA 3EQBA 3U55A 4YJPA 3UPZA 4ACMA 3CIKA 2GHLA 1WZYA 2PE2A 3CGOA 4AACA 3W2OA 4BYJA 4EUTA 3R1SA 2I7QA 5L8LA 3R02A 2C30A 4C62A 1JKKA 1Q97A 2OO8X 2BCJA 4JS8A 4YJQA 3LVPA 3QTZA 3VS3A 5AFVA 1OIYA 4OTIA 3O50A 2BIKB 1B6CB 3LXKA 2OJIA 2OH4A 4AF3A 3ZU7A 4DGLC 3E8DA 5J1WA 3GXLA 3FMJA 3V5WA 2UW7A 3TNIA 2V0DA 3FJQE 1HOWA 2W1DA 1PMEA 1NVRA 3GU8A 4EWQA 3QAME 4RQVA 1M17A 1V1KA 3OEZA 1EH4A 4AE6A 4R77A 3FC2A 3COKA 5FTQA 5CZHA 4EH5A 5LMAA 3B8QA 3F2AA 3QX2A 5HG7A 5DNRA 4U45A 2CSNA 4H1JA 5A6OA 3W16A 2R7IA 1W8CA 3ZYAA 4FEWA 2AUHA 2X9FA 2XIXA 1OB3A 3OCSA 3ZDIA 2IVSA 2C68A 3BCEA 5ETCA 2E9NA 4H39A 4I0SA 3DV3A 3ALOA 2G9XA 2LAVA 3TZMA 4E1ZA 5A6NA 1ZWSA 3LMHA 1O6YA 3DK7A 5CENA 2YHVA 4ZOGA 4MNEA 5E8YA 5AP4A 5HG9A 2C0OA 3GCPA 4FKJA 5AR2A 4Y5HA 3GCQA 4DH8A 4GT5A 3T9TA 3QHWA 2UW6A 4M69A 1H1WA 3C4ZA 4O2PA 3W10A 4C3RA 2XIKA 3F3UA 2PVMA 2X8EA 4BWPA 4QMWA 3L8PA 5KNJA 4D4RA 5FEQA 2BDFA 5AV1A 5L2WA 2UZOA 3CKWA 4Y83A 3FY2A 3GQIA 2ITUA 3G0FA 5HD4A 4O0SA 4FEXA 3DNDA 3RWPA 3PLAE 3MN3A 2XNGA 2XZSA 5C8NA 3BU6A 3FAAA 4ITJA 4KIQA 5CSXA 5CXHA 4GUBA 2XNNA 3BYUA 2VTMA 3N4VA 3DOGA 3W8QA 3ZUVA 4J99A 2QLUA 3FWQA 5K5XA 4FT0A 5CALA 2ITOA 3RM6A 2R2PA 2UZVA 3RHKA 4Z3VA 2WAJA 2VO0A 4TPTA 5IKWA 3NYXA 5AP1A 4NZWB 2QOBA 3DKGA 3A7HA 3MY0A 2JFLA 3C0HA 2FVDA 2OIQA 4HGSA 4DEIA 3NIEA 4KIOA 4PF4A 1QPDA 4A06A 3EZRA 1FVTA 3PXRA 5AR3A 3NNXA 2CGUA 1MP8A 4JX3A 4FTNA 2OIDA 3EFLA 1CKPA 1PXJA 4PP7A 3TIYA 2GSFA 2Y0AA 4LUEA 4RMZA 4FV6A 5BVOA 2HOGA 1TVOA 4FL1A 3BKBA 4KINA 4O7SA 3KK9A 2CKEA 1Q5KA 2C3JA 3KVXA 4IBMA 5CEOA 5K4JA 5ETIA 1UU9A 4PL4A 3RPSA 5M07A 2PSQA 5E8WA 2CNVA 3ZBXA 1NVSA 2CJMA 3R28A 2J2IB 3Q9XA 5HICA 3HDNA 2R3FA 4ZS0A 4K11A 1LEZA 3EHAA 4IWOA 4K1BA 3O0GA 3HRCA 4IB0A 3RVGA 4IADA 1ZYJA 4JG6A 2YISA 4NTTA 3D2IA 3RM7A 2IPXA 3GQLA 5IH4A 4R5YA 4FNZA 4O1OA 3V5TA 2HXQA 3OT8A 1G8SA 4LMNA 2RGPA 1XQZA 4OLIA 1E9HA 5LXMA 5CEMA 5CAVA 4BGGA 3P5KA 3ZO2A 3FLWA 3R7UA 3S0OA 3HP5A 3C4XA 3V8SA 4TWOA 4K9YA 5AP7A 3DNEA 5EM6A 1BKXA 4ZTHA 3V8TA 5JK3A 2PE1A 1K3AA 3F88A 3Q5IA 3QYWA 5E91A 4GH2A 1VYZA 2VX0A 5EM5A 3T9IA 5HOAA 2OU7A 4B9DA 4FEQA 4ASEA 4FC0A 4AZTA 2W1HA 2QLQA 2QOFA 2C6OA 4I5CA 3CQUA 3VBQA 4BTMA 3BHHA 2W9ZB 2YA9A 3R0TA 3DA6A 4R3RA 4YTCA 1DAWA 3HDMA 2VTQA 4IZAA 5HD7A 2ERKA 3SV0A 3TJDA 5EYKA 4ASZA 1PXOA 5TT7A 1R0PA 5E8UA 2WMBA 3HUCA 3D83A 4FTUA 2PK9A 4NM7A 3ZONA 3H0ZA 4PNKA 5A4EA 4U42A 4XUFA 4UWBA 4EH8A 3ZC6A 2R3RA 3KCFA 4RRVA 4G34A 4A9SA 3P1AA 3Q2MA 2FSMX 4JOAA 2WTVA 3F69A 4CTBA 4XYFA 4XLIA 4Q9SA 3QF9A 1OUYA 1DS5A 3GCSA 2R3JA 3H30A 4E73A 3QUDA 5EYDA 4AUAA 4B0GA 4BKYA 2OJGA 4CMTA 5JH6A 2O8YA 5M57A 2QO9A 5J7BA 4BKJA 5JZJA 4G31A 4CQEA 2B9JA 4XCUA 2P3GX 4FIGA 3A60A 1KE7A 2B7AA 2ZM1A 3WARA 1UKIA 3VJOA 3FI2A 3R8UA 4MXAA 3WZEA 3UVRA 3ZBFA 3I6UA 2XF0A 5CQUA 5HE1A 5DT4A 4R7BA 3FQHA 3ORZA 1I09A 2PZ5A 2BAQA 3HEGA 4WBBB 3F82A 4U41A 1AGWA 3ZSHA 4BC6A 4CXAA 2YM8A 4BWKA 4F4PA 4F7LA 5EDPA 3E64A 3DQWA 4R8QA 1J3HA 1XBAA 4L00A 4IMYA 5LWMA 3ZMMA 2PULA 4QO9A 1U5RA 4YO4A 5G6VA 4OBOA 2ITQA 4ACGA 4O6EA 1OIQA 1W98A 3BI6A 4FTJA 4HNIA 4CV9A 5JKGA 3BPRA 1IAJA 2BFYA 2C69A 5AUYA 3CY2A 2YJRA 2QOOA 3EOCA 3B2TA 3QCQA 4G3DA 4IANA 3EMGA 3R71A 4RIOA 4RGJA 4YZCA 4O7TA 4BI0A 3V8WA 3HMNA 1SNUA 4FTAA 4PMMA 3FSFA 5H2UA 4IAFA 3U6IA 1YXXA 2RSVA 3PY0A 3MYGA 4WD5A 4Z16A 1ZMUA 3BLHA 2DUVA 2YIQA 4HCTA 1CKIA 4RA5A 4BF2A 4OW8A 2VWIA 5A46A 2CN8A 3TUBA 5D41A 3W18A 4E5BA 5EHLA 1PXMA 4RJ5A 3C4CA 4TYEA 4FGRA 2Y6MA 4JRVA 4LMUA 1DAYA 4E4NA 4D2PA 2C6KA 1URCA 2YCRA 1UA2A 2WMVA 2Z8CA 3QQGA 4QP3A 3RPRA 2PVNA 3R7GA 4IEBA 4FSYA 4D0XA 5M53A 4WNPA 2F7ZE 3ZRMA 5CNOA 5AAEA 4OT6A 2QOCA 3LLAA 2BHHA 4AN3A 4F1OA 4DH7A 5DWRA 3LFBA 5DA3A 2WMRA 4RJ6A 4ACCA 2BILB 2VZ6A 3VS2A 1GIHA 1VR2A 2VO7A 3F9NA 2YM6A 3D5XA 5IA1A 4UZHA 1YXVA 3LQ3A 1Q8ZA 2WQNA 2P4IA 4FT5A 4U40A 3CPBA 4DT9A 4CRLA 3P0MA 4O86A 3O8PA 1YDSE 3D14A 1JBPE 3D4QA 4GEOA 5L2TA 4MWIA 3DB8A 4A4XA 3WF8A 4I5PA 4ZS4A 4QYEA 3D7ZA 2UW4A 4EZ5A 5BNJA 5KMNA 2CKPA 5AM6A 5DYJA 3PIZA 5AAFA 5JSMA 4DH1A 2DWBA 3QTWA 2W1ZA 5HHWA 4AWIA 3LPBA 2LGCA 2X9EA 4F1MA 3VVHA 5IPJA 4XBRA 4EH2A 3SX9A 4AOTA 1WFCA 5KBQA 2C5VA 3O51A 3OY1A 3KRRA 3UQCA 1H00A 2VTOA 3UQFA 4JX7A 2OICA 5CEQA 3PXZA 3UO6A 3VS4A 4RVMA 3NUYA 1TQIA 5FXRA 2BRMA 2E2BA 3ZEWA 2FA2A 3FLSA 2R3QA 4W4YA 3VQUA 3O71A 3HV4A 4XG7A 2YITA 2IVTA 4IDVA 1UU8A 1G3NA 2GNLA 3CTQA 4RFYA 5CU0A 3E87A 1E1XA 1XKKA 3AMYA 1Q8YA 1W82A 5E7RA 2ERZE 5DN3A 2EXEA 4EZ7A 4OAVB 4F0GA 2P0CA 2HZ0A 3D7TB 4EQCA 4E3CA 4RC3A 3RK5A 3G9LX 4CFWA 1G5SA 4PPCA 3HAVA 2QCSA 1R78A 1FGKA 3MFUA 5BYLA 4PRJA 3VBVA 1SVEA 3ORXA 1WAKA 4G6LA 2VWZA 4EOPA 4B6LA 4QP8A 3RCJA 4FK3A 4ZSAA 3FEGA 3M2WA 4USEA 4IC7A 5ANIA 5IU2A 3TXOA 2W4OA 3CEKA 3NVMB 2BALA 4U8ZA 4FKRA 2GNIA 3WI6A 3GC9A 3PA5A 4RVTA 4FSQA 5EQYA 2VTHA 4QQJA 3RKBA 4DH5A 3ZEPA 4LI5A 1OKVA 3D5VA 1XR1A 4MEDA 4NU1A 3EQCA 4UALA 3VUHA 4ANBA 3DDQA 1HCLA 4U97A 2OXYA 3LMIA 4CLIA 4EKLA 3MH2A 3QWJA 5EHOA 1BI8A 3MH0A 1W83A 1OKYA 3PVUA 4II5A 4ZJJA 2C5XA 4M0ZA 3RNIA 4OTPA 5EQPA 1A48A 3WBLA 3C7QA 4WNKA 1U54B 4YC6A 3ZH8A 4NH1A 5LWNA 2BZHB 4H05A 4BRXA 1Q24A 3JYAA 3I0QA 2XKEA 2CDZA 4BCNA 5M08A 1PMNA 2JKMA 4XNEA 2YZAA 3CQWA 4FI1A 4EH3A 3FI3A 5BMMA 4C61A 4EH4A 3DAJA 2FSTX 5E9EA 4NM3A 3POZA 4GRBA 4K0YA 3PP1A 2QD9A 3EN7A 4C57A 5CT7A 3PWDA 1BMKA 3R04A 4S34A 4EHEA 5I3RA 5AV0A 2GTMA 2JD5A 2XKFA 4NM5A 4C4IA 1SM2A 4GVAA 2ITNA 3PE1A 3QHRA 4FSZA 4I5HA 3ZDUA 4XMOA 5HBJA 3TV4A 4EH6A 3E63A 3V04A 5HVKA 1OITA 4NJ3A 4Z7HA 1H26A 3OWJA 3BLQA 2JBPA 3C4WA 2VX1A 4YP8A 3IW5A 4YZDA 2C47A 3IDCA 4UXLA 3NIZA 3CP9A 4FG8A 1QPJA 4FSRA 4BCOA 3ZFXA 4RFZA 4ZMFA 4BGHA 3FMNA 3PJCA 4FT7A 5ETFA 2GNJA 3HZTA 4FTTA 5C8KA 4JAIA 2RFNA 4EEVA 4EH7A 2C4GA 3H0YA 1P2AA 1X8BA 2QC6A 4BBEA 4DT8A 4ZZOA 4GMYA 3KXMA 3FC1X 1OBDA 3ENMA 3FLQA 4M68A 2CN5A 4LUDA 3VBWA 2ZMDA 5G1XA 4LL5A 3TM0A 2ETKA 4EBVA 4IZ5A 5JQ8A 2I0VA 5LMBA 2EXCX 3SC1A 2PMLX 4XG3A 2JEDA 4M7IA 3ZCLA 1RE8A 1Y8GA 3PWYA 4ZZMA 1P5EA 2GNFA 4X2NA 5J1VA 2F7EE 4S30A 3UOKA 2I40A 5AUVA 1SNXA 4IWQA 4D58A 3VJNA 3P9JA 2W9FB 3NW7A 1H24A 2VTPA 2KULA 3GEQA 3DDPA 3Q96A 3QCYA 3BHUA 4D4YA 4Y95A 1TKIA 4J53A 4GV1A 2YABA 4EHGA 4DTAA 3LAUA 3RP9A 4ANMA 2BDJA 3LCSA 4WKQA 3MVHA 3R8VA 3BE2A 4O27B 3VULA 4DCEA 4DG3E 1REJA 4O7YA 2J0MB 3MIYA 3QCXA 4PUZA 3R73A 3O8UA 5AX3A 4HCVA 3RAKA 4EK5A 5HTCA 2PHKA 4XOZA 4NK9A 4FIEA 4IAKA 1CKJA 4FT3A 4FKQA 3RNYA 4BIEA 2H34A 4E4LA 5FTOA 4F9BA 3FKOA 3QXOA 2WU6A 5KMJA 1PRYA 4FV0A 3U4WA 4I6QA 2VTSA 3ZFMA 5DMZA 3OVVA 4F9CA 4ORKA 4R1VA 3VF9A 5TF9A 2G2FA 4AZEA 4OBQA 4CMOA 2PPQA 4EZ3A 1DM2A 2BAKA 3EZVA 3KB7A 4FR4A 4XP2A 5CVFA 5HVYA 5I9UA 3UP2A 3AMAA 5BMSA 3DAKA 4FKSA 4B99A 4E26A 3GUBA 3JR1A 2QOLA 4C2WA 2A2AA 4ALVA 3QGYA 4OTHA 4TT7A 3T8OA 2YDJA 4RX5A 1J7IA 1FOTA 3SG8A 5TR6A 3NUNA 4RIXB 4AFJA 5DPVA 1OL1A 4DCAA 3UOJA 2V7AA 3LFFA 4PNIA 4C4HA 4X2FA 2H9VA 3PVGA 4ZJVA 4PQNA 3F3TA 2WPAA 3ZM4A 4O0RA 1ZLTA 2F2UA 5K4IA 2GQRA 4CTCA 3CPCA 5D7VA 4KNBA 5A9UA 3U54A 3BWFA 2YCSA 4MXZA 5AP2A 5F9EA 5FDPA 4FKOA 2E9VA 3PSDA 4HGEA 5EW8A 3F61A 1XBCA 3HL7A 4RT7A 5CVHA 2C5NA 3C0GA 3IKAA 4U81A 3SQQA 2C3LA 4QMTA 4BR3A 4DLIA 4QMNA 4DF3A 3UC4A 3BV3A 4BCKA 2P55A 3ANQA 3ORKA 3C51A 5JFVA 4IB1A 4UMPA 3RINA 2BVAA 5BVDA 5ITAA 2Y4IB 1FQ1B 5IQGA 2VTTA 4JXFA 4N4SA 4GT3A 4EYJA 3CR0A 3D94A 4IH8A 4MXXA 1YWVA 1H0VA 4E5AX 2HW7A 2UVYA 3VW6A 3LJ2A 4RWIA 1J7UA 2BKZA 1DI9A 2EB3A 3LQ8A 4NM0A 4XV1A 3SLSA 4F64A 3DJ5A 5GIOE 3QZIA 4QPAA 2F7XE 3I6WA 5FRIA 4DEHA 4N70A 1Q8WA 2VWYA 4HYUA 3O7LD 2PVHA 1OGUA 2WB8A 3BLRA 4XG6A 5FXQA 3LE6A 4LL0A 3WF5A 1J1BA 2QR7A 3HV3A 4YO6A 3SDJA 3ORLA 3T3UA 3Q04A 3TZ8A 5ANGA 1JKLA 5BYYA 3VQHA 3O96A 4XG8A 5J79A 2OXXA 3IDBA 5KO1A 3ID6C 3LZBA 2XYNA 4RIXA 2I0YA 1R39A 4TRLA 5CAQA 4XP0A 4BBFA 2QONA 3EIDA 2JIUA 3GU5A 4YJTA 3I5ZA 5EI8A 1YWRA 2WZJA 4R6VA 4O22A 3ACKA 5F4NA 2PY3A 4FTLA 2VTRA 3BIZA 3WOWA 3VUMA 2PE0A 3SXRA 3PYYA 5KUPA 3D9VA 2XUUA 4IE9A 2UZLA 4PMTA 4XOYA 4C2VA 4F0FA 1YOLA 2PVKA 2YWPA 4ZSGA 3KXXA 2NRYA 2O3PA 4J8MA 2JDTA 3GC8A 2BUJA 3PZEA 2VD5A 4FV2A 5EH0A 3NLBA 1FGIA 3AC4A 1VJYA 3HYHA 4PP9A 4BDGA 5CF5A 2VNYA 3ORTA 4AW0A 2VWUA 2ZM4A 3ANRA 3L8XA 4EJ7A 2BROA 1BYGA 3PJ2A 1PXIA 4UMRA 2H8HA 1ZY5A 2B9FA 3GT8A 2UVXA 4L8MA 3UOLA 5L6OA 1OECA 4RA4A 1FVVA 5EHYA 3VRZA 4BHNA 1ZYSA 4YZBA 2HWPA 2ZB1A 2EU9A 2ITWA 2JITA 2WOTA 3F2NA 3MY5A 4KSPA 1JPAA 3DXQA 3M11A 3FSKA 3EQIA 3UMXA 3QLGA 5HLPA 2WEIA 3I7CA 4V05A 4CT2A 1JQHA 3GBZA 3N4TA 4FKTA 3BBWA 3G5DA 3B8RA 3CJFA 5CS6A 2ZV2A 1PMUA 5LOHA 3QTQA 1Y6AA 3FKNA 3N51A 5ETAA 4CFXA 1YXUA 1ZXEA 5IZFA 3WIKA 1W84A 5F95A 3ZLXA 2IVVA 3R9DA 2AC3A 4ZTRA 1WMKA 1OVEA 1UNLA 3S3IA 3AG9A 2W4KA 4QP2A 4O7RA 4GL9A 3SD0A 3W2QA 1ZMWA 3HAMA 3R8ZA 2JDVA 4K18A 2IO6A 2ITXA 4L3LA 5GJGA 1ZYDA 3NDMA 4UY9A 2CLXA 1PXNA 3ZC5A 1UU3A 4BCQA 1Y8YA 3Q53A 5HO8A 3HV7A 5CEIA 4F63A 3QTRA 4YURA 4ZTQA 2OZAB 4KIKA 3FPMA 3QRIA 3G90X 4GYGA 3A99A 4CNHA 4KKHA 4A9RA 2JDSA 3KY2A 3I1AA 1PW2A 3FPQA 4IVBA 4PTEA 4OTFA 4XG4A 5EFQA 3S1HA 3DCVA 2GHMA 5DLSA 4IX6A 3QA0A 4JI9A 4FG9A 1OPLA 5CF8A 2XNOA 4WA9A 4ZTNA 3W33A 1NA7A 4PDSA 3TV6A 5IH6A 2O63A 4RX7A 2CGWA 4D28A 5FUTA 4O81A 3CC6A 4HW7A 3UVPA 3DY7A 3TT0A 4OAUC 4N57A 4KA3A 2OF2A 5I9VA 4I21A 5CQWA 4WSQA 4IIRA 4X6RA 3VS0A 1M7QA 5I5ZA 2OK1A 2VGPA 3HMPA 2QKWB 4DHFA 3ET7A 4FZ6A 3JXWA 2R64A 4B8LA 1NVQA 3JVRA 3RZFA 2EUFB 1FINA 4E4MA 5IH5A 1OM1A 4BZDA 4CFNA 4F08A 1M7NA 5AV3A 3GENA 3NAXA 4CV8A 4BDHA 2Z7RA 4X2KA 3H9OA 1VZOA 4MKCA 4Y85A 5HCYA 3R8PA 4QMQA 1G8AA 4GK2A 2HZIA 3A8WA 4U3YA 5ANOA 5CNNA 3TN8A 4JDJA 4O7NA 3ROCA 5FG8A 3A8XA 1S9IA 2YEXA 2FB8A 2XS0A 4H3PA 3UIUA 5IA2A 5IMEA 4CYIA 5E1SA 1FPUA 2V7OA 2JC6A 2YIRA 4FG7A 5K0KA 5AJQA 2J0JA 2OZAA 2WO6A 3CY3A 3WE8A 4ACDA 4AGCA 4QMPA 3U6JA 5IMXA 3TDWA 4D2RA 2HELA 1VEBA 4ANNA 2F9GA 1YHSA 1FMOE 2XCHA 3OT3A 4IWPA 5J7HA 5LVOA 3CQEA 4H58A 4FVPA 4AT5A 5DT3A 2J0IA 2QR8A 5FLFA 3MIAA 5AP3A 2C3IB 3QQLA 5C1QB 4X21A 2WTJA 2WU7A 2YM5A 2JIIA 5JRSA 3BEGA 3QRUA 5F94A 4ANOA 4APCA 5HU9A 2R5TA 3L9LA 4G6OA 1CM8A 4NKAA 2E9UA 5CYIA 4EYMA 4GJ3A 4RZWA 3EN6A 3OC1A 2UVZA 2B1PA 1H25A 4WNMA 3VS6A 4IZYA 4AA0A 1U59A 3IPHA 4BCIA 2XNMA 5DEYA 2B9IA 1PYXA 5FP6A 4AN9A 4C7TA 4GK3A 2X39A 2WQBA 4RWKA 4H3QA 4J95A 4YJSA 5E90A 3OG7A 3GFWA 4RC2A 2QURA 5EW3A 5AA8A 2OWBA 1L3RE 4YJVA 4IAYA 3VS7A 2OG8A 2HK5A 4K2RA 4C33A 4WNOA 4EK6A 2C1AA 3NEWA 4F9WA 4L68A 2XIRA 4YLLA 3FMLA 3TKIA 2WIPA 3DJ6A 4FTIA 4BCFA 1Q61A 4ONAA 3QGWA 4A9TA 4NSTA 2CLQA 1YOMA 3BYSA 4WG4A 4GFMA 4GJ2A 2X7GA 3LXLA 4MCVA 3BHVA 4TWNA 5J8IA 3OHTA 4ZY4A 4QQCA 5EYMA 5A54A 3VUKA 4GKIA 3CD3A 5DGZA 3NNUA 4G6NA 3W32A 2HY81 2FH9A 2ZDTA 4PL3A 3ERKA 4ZZNA 3RALA 2YAAA 4MYGA 3SW4A 2YM4A 3EQDA 5CU3A 4ZXTA 2YIYA 3FQEA 1PHKA 1Y91A 4IM0A 2VTJA 4ENXA 3KXGA 3OW4A 4FA2A 3IECA 4HVHA 4CT1A 3FL4A 3LM5A 5CY3A 2O2UA 2OKRA 3VUDA 4DGOA 3HLLA 5IQIA 5AP6A 2C6LA 3MH3A 3QZGA 2ZVAA 2Z7SA 4J7BA 5GZ8A 3GU7A 4KIPA 4BKZA 5T3QA 4FV7A 2ESMA
chains in the Genus database with same CATH superfamily
4E93A 2DYLA 3IONA 3F7WA 2C5OA 1QCFA 3DTWA 3QD0A 3KL8A 3DAEA 4TYIA 5CX9A 4AT4A 4C3FA 3RK9A 2UW9A 2FSLX 2JAVA 4BB4A 3D5WA 3LFSA 5AAGA 5JGAA 3OCGA 4TWPA 2BRNA 3ZO4A 3I0OA 2G2IA 5I0BA 1NW1A 4DEDA 4NUSA 2IZRA 4D1SA 3QFVA 3QKMA 4HVSA 4C4EA 4Q9ZA 4C3PA 2FO0A 5I9XA 4W9WA 5DH3A 5JZNA 3UOHA 2ONLA 5HX8A 4IW0A 1OBGA 2Y8OA 1FBNA 5GINE 3C4FA 2WTKB 4I6FA 4B4LA 2ITZA 1UU7A 3A7JA 4PPBA 2WMTA 4MWHA 3R22A 3PG1A 4EOIA 2A27A 1YHWA 3DJ7A 3GI3A 4C02A 2BFXA 1GZOA 4ZAUA 2WTWA 2OH0E 3FQSA 3Q32A 2W1CA 4MXOA 3AC3A 4L53A 4NW6A 4X0MA 3EN4A 1ZARA 5CWZA 3R7VA 1KWPA 4FGBA 3DKOA 4M15A 3V5JA 2P33A 5HIBA 4AG8A 5HG5A 3ATSA 3EWHA 3OP5A 3HKOA 4N6ZA 4TYHB 3DBDA 3FMKA 4EC9A 3HNGA 4C4GA 3UYTA 2WOUA 3ORPA 2WIHA 1B38A 3P4KA 5J9YA 4FTCA 4GCJA 5L8JA 4Q5HA 4H36A 3MPAA 4E6QA 1OIUA 2O5KA 3P79A 3QYZA 5CSWA 2IG7A 1GIJA 3FHIA 4L9IA 1M52A 3V3VA 3WYYA 2GHGA 5IQFA 3EN5A 3FY0A 3G9NA 2BHEA 2OSCA 4YLJA 1ZYLA 5HESA 3F3VA 5A4LA 4G17A 1Q62A 1I44A 1STCE 4PPAA 3JY0A 5KMOA 3RAHA 5K5NA 3O23A 3SAYA 3OBGA 4EQUA 3MVMA 2WMAA 3Q4UA 4Q2AA 4UB7A 5AM7A 3Q60A 4QMOA 4DFZE 5FM3A 2X2MA 4R3CA 4O7LA 2BZJA 2YM3A 3QQUA 3DLSA 3QL8A 3IW4A 2IVUA 4NTSA 3CXWA 4W9XA 4O21A 1H1SA 3WZKA 5FXSA 2ITTA 4KKEA 3Q4TA 3PE2A 2AC5A 2XRWA 4YHJA 5DR2A 3IOPA 4FV9A 2VU3A 4AA5A 4ZSEA 4RC4A 4KBKA 2YWVA 3OTUA 2A19B 4KBCA 3P7CA 3RPVA 4DFYA 3KREA 3PRIA 2R3OA 4G3GA 4O6LA 3NNWA 2CNUA 3NMUF 1PKGA 5KE0A 4N6YA 4BWXA 2V5QA 4Z55A 1YW2A 3QZFA 4UWCA 4F99A 1Q8TA 3LIJA 3KA0A 4AA4A 4Z7GA 2XBAA 4QMVA 3WF6A 3EN9A 3IK3A 3UJGA 3VONA 2WMQA 3R2BA 5DRBA 4YBJA 3UBDA 5KMLA 4C36A 1SVHA 3DBFA 2QOIA 3MGYA 4TZRA 2UV2A 3Q5ZA 3LCDA 3GFEA 3LOKA 3A7FA 2HIWA 3LMGA 4CZUA 4FSTA 5A4CA 3E5AA 5HE3A 4AQCA 1IA8A 4BVUA 4QYGA 3F2RA 4LFIA 4O0TA 3TI1A 4IVDA 4JDHA 3AD5A 4QMZA 5DVRA 4EKKA 1Z5MA 4F70A 3V5QA 3OW3A 5KHWA 4R1YA 5E8SA 5L2IA 3EL7A 5IUHA 4NWMA 5ANEA 5M51A 2W1EA 3O7LB 4Y73A 2W0JA 2WMUA 2AEGA 5AUZA 2QOHA 4G9RA 3V6RA 4S33A 4FKWA 4GU9A 4L3JA 4Y5QA 5HEZA 3C5UA 4D2WA 4FKLA 3P08A 3AGLA 1YI4A 4QP6A 4OGRA 4ZY6A 1XH9A 3OF0A 4UBAA 2IW9A 4LV8A 4QDEA 3JVSA 4WSYA 5DFPA 1QL6A 3C4EA 3R8LA 3R00A 4MK0A 3AT2A 1M2PA 3SOAA 5C01A 4O84A 2I0HA 3UC3A 5JQ5A 3E88A 4MX9A 5AX9A 3ZS5A 3ZRLA 2IZSA 3HECA 3KXHA 4NFMA 4HPUE 4V0GB 2YDIA 3WZDA 3LLTA 4J1RA 4C4FA 3NUAA 4AU8A 4I93A 3UZRA 3TIZA 5FTGA 5CAPA 4WO5A 4WIHA 1LPUA 2CPKE 1GY3A 3TCPA 1Z57A 3TL8A 5IISA 3AC5A 5J87A 4UN0C 4O0UA 2WXVA 1B39A 5DEWA 4EC8A 5IG1A 3FMDA 3OWPA 4EK8A 3HRBA 3NYNA 3UYSA 3RZBA 2O0UA 4BDCA 3R1NA 4BIDA 2IZTA 3O17A 4AXEA 2ACXA 2HCKA 4OBPA 5C4LA 4ERKA 1YHVA 4JQ7A 4EUUA 5TO8A 3P23A 1Q41A 4IX3A 2CHLA 2HENA 2VTLA 3LXNA 3ZSGA 3TNHA 5K9IA 2R0UA 2RKUA 1KE9A 2HAKA 3MTFA 4L7FA 4M66A 4EONA 3AKLA 4CYJA 2QKRA 2Y4IC 2VWWA 2V62A 4YBKA 5B0XA 3TZ9A 5TKDA 2IW8A 2C5YA 3EFJA 2JLDA 3A61A 4IVAA 4YJRA 3ZO3A 4AAAA 2WFYA 4MBLA 3GP0A 5D11A 3PLSA 2QU5A 4YC3A 1NT2A 4O0WA 3VUTA 4UMTA 4HYHA 3BGPA 4MD7E 1KE5A 3TNWA 4U7ZA 3L9MA 3K3JA 4NKSA 5CTPA 3WF9A 4FL2A 5GJFA 3LJ1A 4D2TA 4A07A 4PMPA 4USFA 5HX6A 4AX8A 5ICPA 2QVSE 5B2MA 3QKLA 3BYOA 4ID7A 3R9NA 1XHAA 3MA3A 2YN8A 1JNKA 5HCZA 3UDSA 4YMJA 4F78A 4QRCA 4DEAA 5CI6A 1OMWA 2X7OA 3ZOSA 4BICA 2ZJWA 4EORA 4RJ7A 3ZRKA 4XV9A 4E5WA 4ANQA 3U87A 4AAYA 1GZKA 4FTQA 4B7TA 4M0YA 1KSWA 2RL5A 2C6TA 3EKNA 1BUHA 2FSOX 4X3JA 4DAWA 1YQJA 2E9OA 2UZTA 3H3CA 4FOBA 5EI2A 4L3PA 1MQ4A 4BDEA 4HNFA 4JBOA 3EQHA 5EKOA 4JQ8A 3E8NA 2BR1A 2WQEA 3D7TA 3FV8A 4PY1A 3QC4A 3R63A 3DTCA 1YVJA 4XS2A 5BVKA 3S95A 3VC4A 4FZDB 4B8MA 2FUMA 4NT4A 3MV5A 4UYNA 3PUFC 2HW6A 2XEZA 4X6QC 4C8BA 1IG1A 4E8AA 1XO2B 4JR3A 2B52A 3A62A 4HVGA 2XAOA 1IEPA 4J97A 5L6WL 1F5QA 4LYNA 5A4QA 3BRBA 3VBXA 3DLZA 5HGIA 5EKNA 5AR8A 3LFNA 3TUDA 2PUIA 2OW3A 4QT1A 5D10A 5ANKA 3DT1A 3HMOA 3N9XA 2VWXA 4LV5A 5L6PA 3PIXA 4IZ7A 4F9YA 4R78A 2HZ4A 4K77A 2R7BA 2WTDA 4O38A 4ZK5A 5EQEA 3NWWA 4TYGA 3BWJA 1ATPE 5DOSA 4F65A 4K6ZA 5M4IA 4HVIA 4M12A 1UWJA 1TQPA 2F49A 4AN2A 3MW1A 2NP8A 1XH4A 3DBCA 2CKOA 2FYSA 2JFMA 3AC2A 3L8SA 4KABA 2WNTA 4YR8A 5FBOA 2IJMA 2PZIA 5IQBA 1U54A 5F1ZA 4BDKA 2Z60A 3SVVA 5FM2A 3I60A 2XIYA 2W7XA 3W8LA 4G3FA 4NJDA 3TKHA 4CZYB 3WZUA 4PDOA 3OXIA 1H28A 1YDTE 5HNGA 4BZOA 2R4BA 5BVEA 3G15A 3VHEA 3F6XA 3MBLA 5CZIA 3MVLA 1M2QA 5EM7A 4PMSA 5AEPA 2VO3A 4TXCA 1KE8A 4U3ZA 2RG5A 3Q6WA 5CSHA 3LFCA 4W4WA 4C35A 2Q83A 2WD1A 4OTGA 3QRKA 3H10A 3UNKA 3UG2A 3HVCA 4JIKA 3GC7A 4XRLA 5BUIA 3DBEA 4YSJA 5KKRB 1PY5A 5EG3A 2X8IA 2XK9A 3SGCA 4XBUA 4MF0A 1JKSA 3KEXA 2WHBA 4L42A 4YHTA 2I0EA 4KRCA 5IA5A 4RBLA 4Y72A 2NPQA 2O65A 4V04A 1S9JA 2WKMA 2WMXA 3DPKA 4D55A 4YTFA 3U51A 3SW7A 3D15A 3PSBA 3HA8A 4U43A 4D9TA 4M8TA 2B9HA 4RVLA 1LR4A 5A3XA 1J1CA 4HVDA 4YJNA 3QTSA 1UVRA 2YERA 2XEYA 5ANJA 2PZPA 4U79A 1YOJA 4I23A 2XK6A 1GJOA 5IQHA 4RG0A 3AD4A 3Q52A 2ZOQA 3NPCA 4GW8A 1W7HA 5ANDA 2F2CB 3OY3A 3DK3A 4FTMA 1H8FA 3A4OX 3KU2A 4JDKA 3ULIA 4AZVA 3HV5A 4DFXE 1ZYCA 3IW6A 4FNYA 3ODYX 1QPEA 5AP5A 4BI2A 5E4HA 1UWHA 4F7JA 4M3QA 5ACBC 4AXAA 5EK7A 3W0RA 2XNEA 3QBNA 2GDOA 5LVLA 2W1GA 2YFXA 2R3MA 5HNBA 1RDQE 3RWQA 4F6SA 2R3GA 3CS9A 2ZV9A 4OR5A 4JMQA 2PZYA 1AQ1A 3KN6A 2A0CX 4GFGA 5BVFA 2BRBA 4HPTE 2XNPA 2PU8A 1K9AA 3NS9A 4QYYA 2PYWA 1YRPA 3ZUUA 4QMXA 1QMZA 1JSTA 3C9WA 4L43A 4CKIA 3AOXA 3DQXA 2ITYA 2ETMA 1MQBA 2CMWA 3SKCA 4RFMA 4WT6A 4D2SA 3ITZA 1UKHA 3PY3A 2BZIB 2VGOA 2W1IA 4EHVA 4ZLOA 4O7WA 1TQMA 3VWAA 1KUTA 4PTGA 4IAIA 5GZAA 1WBSA 2OJFE 2Z7QA 5E8ZA 3QQHA 2QNJA 5E8VA 4EWHA 5IQAA 5LMKA 4KKGA 4J96A 1UNHA 2XKDA 1XBBA 3AQVA 4CFVA 3K3IA 2WEVA 1OUKA 3AMBA 4UXQA 4D4SA 4YU2A 1GIIA 5M56A 4LM5A 4TKSA 3F3WA 2YIXA 3CBLA 4UZDA 1NY3A 3FMEA 3QALE 3TWJA 2G01A 4BTFA 4MBIA 1LEWA 2VTNA 4DC2A 1WBVA 3DKCA 3EYHA 3ODZX 4G3EA 4LOQA 4P5QA 2YAKA 4XEYA 4EBWA 4CCBA 4FNXA 3U4UA 1XWSA 1XH7A 2ONLC 3OWKA 4O1PA 2YACA 4DFNA 4D1XA 4DFBA 3BQCA 2XH5A 3PJ8A 3UPXA 4CZTA 5B7VA 1KOBA 1GZ8A 1OPJA 3DKFA 3II5A 4X3FB 4DG0E 1L8TA 2W96B 3EJ1A 4L67A 1MRYA 3EH9A 3SOCA 3FZPA 4ZJIA 3R01A 3RGFA 2XCKA 3R9OA 3VS5A 4LG4A 2NRUA 5C27A 4X2JA 2XK8A 4RQKA 3PDTA 3OOGA 1JKTA 4CVAA 3OZ6A 5IA4A 4BY9E 4JNWA 3FXWA 3OMVA 2J0KA 4O0XA 4YTHA 2HYYA 3PRFA 4FSNA 2GPHA 4ZTMA 4YNOA 3NW6A 3E92A 2PVRA 3MY1A 4RJ4A 1ZZ2A 2W05A 4O82A 3DXNA 4I0RA 3ULZA 4FV3A 5C03A 4IFGA 4W8DA 4F1TA 4BDAA 2C0TA 2ZAZA 4G16A 3VUIA 2YDKA 4Y8DA 3U9CA 4BTKA 2XRUA 3K54A 1OZ1A 3HUBA 5DR9A 5EW9A 5IQDA 3FUPA 3FE3A 3R8MA 4DEBA 2Q0NA 5D7AA 3QLFA 3MB7A 4ZEGA 5TOZA 4O91A 3NGAA 3OFMA 4NFNA 4XLVA 5KCVA 4F7NA 4I4EA 4RJ3A 4A4OA 2C1BA 2O64A 4QMMA 3LCKA 1A9UA 2PMOX 1ZY4A 3E7VA 5L2QA 1SZMA 2OFVA 4I4FA 5CF6A 2WTKC 4C38A 4JRNA 4X3FA 3PPZA 3QRJA 2J5EA 2X6DA 3BHYA 5JFWA 3U6HA 4KBAA 2CKQA 3R7EA 4CGAA 4I6HA 5M06A 5H9BA 2A4LA 4MUQA 3C13A 3CSVA 4BYIA 3NVKI 2X0GA 3RMFA 1H0WA 1XH5A 4KRDA 1P4FA 4WOVA 1Q4LA 4CEGA 4A7CA 2QO2A 3WIGA 3V01A 3NX8A 5H3QA 3GCUA 3K2LA 4DINA 4BTJA 3EB0A 1Q99A 1V0PA 2V55A 3FHRA 4FZFB 3ORIA 4LGGA 4GU6A 4IACA 1T45A 1JSVA 5D12A 4ARKA 4AW2A 2VWVA 1ST0A 2W99B 5AUWA 3PVWA 1XJDA 5AR4A 3TDVA 2IN6A 4QMSA 5FGKA 3PXFA 3SA0A 4X2GA 1QPCA 4AOIA 5C26A 2QHMA 1BI7A 4IAAA 4XV2A 1DI8A 1BL7A 4D1ZA 1XH8A 4NCTA 3ZO1A 3KULB 2CGXA 2ITVA 3R6XA 4BJJB 2VO6A 3BE9A 2XP2A 4D4VA 5E1EA 1V0BA 3C5IA 4DITA 1R1WA 3CTJA 3H9FA 4LRJA 1FMKA 4EK3A 4J8NA 4JIAA 3I7BA 1H1QA 2OF4A 4IJ9A 4X7QA 4L46A 1OPKA 5HNIX 4YLKA 3DB6A 5HG8A 3KVWA 4M69B 3U9NA 3ZLWA 4FKVA 5AIRA 1Q8UA 1BLXA 3HV6A 5CEKA 5KMMA 2PZRA 1ZOGA 1WBWA 4IHPA 4GKHA 3BYVA 3H9RA 3HA6A 4AW1A 3PPJA 4TN6A 4GUEA 4Q5EA 3G6HA 3QQKA 3R30A 4XV3A 2VNWA 2BRGA 2UZDA 4R7HA 4DTKA 2GU8A 3COIA 3V6SA 4TW9A 2QODA 2VRXA 4ZY5A 1OKZA 4FSMA 2XK7A 3NYVA 1RJBA 5J9ZA 4CFUA 2GTNA 1U5QA 4LGDA 4KD1A 4MTAA 3LCTA 1YKRA 5AMNA 4EJNA 2OLCA 4KB8A 2J7TA 2CCIA 3DFCB 3MTLA 3RPOA 4O2ZA 4QP4A 5M4UA 3GOKA 5AWMA 1YXSA 4DGMA 1H1PA 2WGJA 1APME 3UIMA 4PTCA 1Z9XA 1ZOHA 1Y6BA 5A4TA 4F0IA 3L1SA 3KULA 4NW5A 4BJJA 1IA9A 3EYGA 2CGVA 2QO7A 4RX8A 2JDOA 2XM9A 2BKKA 3KRLA 2R0IA 4I0TA 5JRQA 4M84A 3LFAA 4U44A 4XG2A 3C1XA 2WQOA 4QP9A 4HGLA 1ZOEA 2P2IA 4FKGA 5AR7A 3KKVA 3KRWA 2R3LA 5HVJA 4HOKA 3QUPA 4DLJA 4L6QA 4QP7A 3G51A 4TYJA 3CE3A 4CG8A 3I79A 4QOXA 3FLZA 3UNZA 3WZJA 2X6EA 2PVYA 2R3HA 2ZYBA 2VTAA 3RCDA 4N0SA 3WF7A 1Q3WA 4FOCA 1JLUE 3PTGA 4RIYB 3SXSA 3ROYA 4CG9A 5AUUA 3KN5A 5GZ9A 3UMWA 4JL9A 4DGGA 3P5JC 1WVWA 3MWUA 1ZRZA 2J50A 5DT0A 3FLYA 4DDIA 3OUKA 1G8JA 4WUAA 3FZTA 1H01A 3L9NA 4DFLA 2GS6A 4DHJA 2BZKB 1R0EA 3BBTB 3SXFA 3WE4A 4ANSA 1GOLA 2GMXA 3LJ0A 4FF8A 2HWOA 3A2CA 1ERKA 3JUHA 4XG9A 4HJOA 3SG9A 3MA6A 3UZTA 1BX6A 3P7AA 1F3MC 2YM7A 3MVJA 3LM0A 5C8MA 4AS0A 4BBMA 5DR6A 1AD5A 4O4EA 3E8EA 3PY1A 3AKKA 1JWHA 3PIYA 4AW5A 4BCMA 4P2KA 1Y57A 5LJJA 3V5PA 2OJJA 3E62A 4FV5A 1YI3A 3VN9A 4FX3A 1VYWA 2WTCA 4RWLA 3SRVB 3PUPA 2BTSA 3GC0A 2YZLA 3Q4CA 4L7SA 5HBEA 3ZZWA 3S2PA 3CD8A 3GNIB 3OOMA 3PA3A 5FQDC 5L8KA 2XMYA 3OBJA 3NUUA 1U46A 4DYMA 5B2KA 1MUOA 3UDZA 4KS7A 4HZRA 3D2KA 3QQJA 3QC9A 1YWNA 4W4XA 3I81A 2JGZA 3LXPA 4IAZA 4G9CA 3OWLA 3W2RA 2ETRA 3UG1A 3VO3A 2VN9A 2XJ0A 4FYNA 4TY1A 5BV3A 5IDPA 5EYCA 3RAIA 4QP1A 4QTAA 3W2PA 3QRTA 3P86A 4FEVA 4QTBA 5CASA 4UMUA 3G33A 4FMQA 4QTEA 3AC8A 1SVGA 2GS7A 4GIIA 5HCXA 5BYZA 2X4ZA 4RIYA 3PXKA 4A4LA 3PXYA 4JBQA 3UIXA 2XK4A 4CRSA 4YZMA 5FD2A 3TZ7A 3UZPA 3MSSA 1J7LA 5DBXA 1P14A 4NEUA 3ZM9A 5EI6A 4EOQA 3OXZA 5FDXA 2RIOA 4HGTA 1KOAA 2C6MA 5JGDA 2BTRA 2H96A 4PDPA 3W2CA 5CAUA 2PVJA 3FI4A 3LCOA 4I24A 4TTHB 1R3CA 2AQXA 3A7IA 3ZLYA 3ZSIA 1PXKA 4BZNA 4AGWA 5JT2A 4IX4A 5H8EA 4YPSA 3KIOC 2W1FA 4LOOA 3QA8A 2QI8A 3SRVA 2F57A 4BCGA 2QOKA 2VUWA 3HGKA 4DG2E 3S4QA 4YUQA 1XH6A 3VBTA 4CCUA 4EI4A 1J91A 1JVPP 4YPDA 1YXTA 4JBPA 3R83A 3W2SA 5IDNA 1VLRA 2XALA 4O7VA 4FBXA 2J9MA 5LVNA 3PFQA 1H07A 4FV8A 2GQSA 4V01A 4ZP5A 4I20A 1UNGA 4EH9A 2EB2A 4ENYA 1PJKA 5F20A 3KK8A 2UZWE 3VUGA 2JIVA 2VAGA 1OL2A 4AT3A 3IS5A 3VNTA 5JFXA 4ZMEA 3PP0A 3PZHA 1PXPA 5CU2A 3HX4A 5KZIA 3AD6A 4GK4A 4EOMA 5BQ0A 2XA4A 3SHEA 2YLFA 2Z02A 3TJCA 4FUYA 4CQGA 3QWKA 1W0XC 4MQ1A 2PMNX 3QD3A 4MXCA 4UEUA 3BQRA 4QD6A 4IJPA 4FEUA 4WRGA 2X81A 4E4XA 3TUCA 4FL3A 4FJVA 3CGFA 2WELA 1KV1A 3ATTA 3K5VA 2BRHA 3L8VA 3FZ1A 4CD0A 4D9UA 4ITHA 4D5HA 5I4NA 4C34A 2WQMA 5IF1A 1ND4A 3G2FA 5HI2A 4DE4A 3OROA 4AZWA 2OI4X 4MF1A 4QMUA 3R2YA 2EVAA 2PUNA 4ZLZA 4E6DA 3W55A 2XK3A 2VTIA 5D1JA 4TYHA 4OT5A 4APPA 5AV4A 1LUFA 4IC8A 4JQEA 1O6KA 4FKUA 4XJ0A 3VF8A 4DFUA 3Q6UA 1WBNA 5FEEA 3DZOA 4BL1A 4KWPA 5HIEA 3MJ1A 4MD8E 2B0QA 1WCCA 1WVXA 4ACHA 3VBYA 4J98A 4G1WA 3EKKA 3ELJA 1O9UA 5M4FA 2EWAA 5CXZA 4FE2A 4RVKA 3TNQB 1GNGA 2OZOA 2XM8A 2XVDA 3HMMA 3M42A 3Q3BA 4DTBA 3DGKA 5AR5A 3AT3A 5JGBA 5KX8A 3VIDA 5A14A 5CANA 3THBA 4EQMA 3PPKA 5KKRC 2W5AA 4I22A 3UVQA 2RF9A 3BELA 5IUIA 2GFCA 2OIBA 2IZUA 2UZBA 3RAWA 2KTYA 3LFDA 4S32A 4YZ9A 5KZ0A 4ITIA 3IG7A 2RFDA 3CJGA 3OXTA 4LRKA 1O6LA 2GNHA 4YHFA 3QTXA 3VRYA 4CSVA 1Q3DA 3PSCA 4MNFA 4MH7A 2HZNA 1HCKA 2GCDA 4WBOA 3PFYA 4AGUA 5M44A 3NUXA 4EOLA 5BVNA 2UZEA 1FVRA 4UWYA 4YZNA 2JKOA 4L01A 4FICA 5LMKC 2W06A 3UTOA 3W0QA 4TNBA 2A1AB 3NAYA 5CVGA 2A98A 2J51A 4RIWB 5J9LA 3F5PA 1M2RA 2JAMA 2WMSA 4P7EA 1GAGA 3FYJX 3PJ1A 1OL6A 4QYHA 2QHNA 3BL9A 5T68A 2Q0BA 3HMIA 4R5SA 3ZFYA 2RG6A 2H6DA 3MFSA 3QTIA 5JN2A 2B55A 3UO4A 3FZRA 3OCTA 4UYAA 4AGDA 4EOSA 4BN1A 5C9CA 1IASA 2ZDUA 4GT4A 3EQGA 5AUTA 3S00A 4RLLA 2UUEA 4I5MA 4FVQA 4WG3A 1CSNA 4C0TA 2XAMA 4M97A 4IWDA 4G5PA 2B54A 5HBHA 4CKRA 2QQ7A 3NCGA 4MQ2A 1PKDA 4L45A 3BX5A 5HO6A 4IX5A 2REIA 2W5BA 3C50A 3C0IA 4PX6A 3ACJA 5T6KA 2OFUA 4LQMA 4CKJA 4G3CA 2EXMA 1CTPE 3AGMA 3R1YA 1MRUA 4AFEA 1SMHA 4PWNA 4DH3A 4FVRA 4O96A 3PXQA 4LGHA 5K3YA 3RJCA 5BX0A 4EOOA 5GJDA 4FIJA 4FV4A 5HZNA 3A7GA 3KXNA 3BL7A 3TV7A 3FZOA 4IDTA 3F7ZA 4OTDA 5TE0A 3COMA 4BDBA 4O7ZA 5CT0A 2C3KA 3KRJA 3MI9A 2YJSA 1WBTA 4IB5A 1OIRA 1UV5A 4IVCA 3MESA 3PVBA 4FIFA 3ORMA 3JY9A 1CDKA 3F3ZA 4BCJA 4F7SA 3AC1A 5I9ZA 2X1NA 5H8GA 4AZSA 3IDPA 1LP4A 3CCNA 3DS6A 4MAOA 4QMLA 4U80A 5EOLA 1JAMA 4ZSLA 4QTCA 5BUJA 5IUGA 3DBQA 4RIWA 4P5ZA 4O0VA 4V0GA 1IRKA 4JR7A 1RW8A 4I6BA 3NCZA 1H4LA 3AT4A 4KUJA 4A9YA 3R7IA 4P4CA 4KS8A 2PWLA 4RLKA 2PVLA 3V5LA 2Z7LA 5HKMA 3E7OA 4FTKA 4YGAA 1WVYA 3EFKA 1PXLA 3Q9WA 2P2HA 1H08A 4X3FC 3EQFA 2Y7JA 5HU3A 4UV0A 4FIIA 2G1TA 4EOJA 3KC3A 1ST4A 5KMIA 4ZTSA 5EOBA 4EOKA 3LQ5A 3L9PA 2C0IA 2J0LA 3GCVA 2J5FA 4IM3A 4LRMA 3GU4A 3UGCA 1SYKA 3BEAA 3OEFX 1G8KA 4H3BA 5H8BA 2R3KA 4YC8A 5CI7A 4ZTLA 5CU6A 3E3PA 5M55A 3NR9A 5HO7A 5IQCA 2VX3A 5CF4A 3GGFA 2GFSA 5HQ0A 4QNYA 2NNWB 4FKPA 1MRVA 3QUEA 4NIFB 4RWJA 5LCKA 2NO3A 5AA9A 2R3NA 4Z9LA 3UO5A 5LARA 4O83A 4EL9A 3R7YA 3BYMA 4J71A 2PUPA 2ZMCA 2J90A 3BGZA 3GOPA 4J52A 2B4SB 1P4OA 4C58A 1BL6A 1PF8A 4JVGA 3RBWA 2JBOA 3NZ0A 4OTWA 5IA0A 4FUXA 2YCQA 4MXYA 4BIBA 5EDRA 3I5NA 2Z2WA 3RTPA 2DQ7X 4NCTC 2RFEA 3V51A 4DHZA 3JS2A 3BU3A 3ORNA 5B2LA 3LFQA 4HYSA 5KHXA 4ALUA 4YTIA 5I9WA 4JLCA 4YJOA 4BHZA 4PV0A 2PVFA 5I3OA 1KV2A 2UW5A 3QXPA 3BHTA 3UNJA 4DGNA 3QTUA 5BPYA 3QCSA 3BU5A 4GS6A 4BCPA 5E8TA 3KCKA 1PYEA 4XP3A 3ZTXA 3AXWA 5DE2A 4R3PA 4S31A 3ZUTA 1V0OA 3H4JA 4BDFA 2VV9A 3EFWA 3IOKA 1U4DA 4KAOA 1CMKE 1K2PA 2G15A 3RHXA 2X2KA 4I3ZA 5HLNA 4GFOA 5GIPE 3KMWA 2UZUE 3OS3A 4FYOA 1TZDA 4C4JA 4FIHA 2AYPA 2BPMA 1OI9A 4GG5A 4ZSJA 4NIFA 4FODA 3F5XA 3N4UA 1OL5A 4Y46A 4BDJA 2FGIA 3GU6A 1REKA 2F4JA 3MFTA 4RZVA 1IR3A 2WMWA 4YNEA 3RI1A 4AP7A 4AZFA 3VW8A 3FZSA 5JEBA 3VS1A 3TKUA 1E1VA 3FXXA 3LHJA 3PG3A 4IB3A 3TACA 1OGYA 4BDDA 4FZ7A 4JBVA 4QTDA 3NSZA 2QG5A 4HYIA 4R7IA 5DG5A 5FBNC 5HTIA 3ZZEA 4WUNA 4EHZA 2BDWA 4L44A 4UMQA 3NFFB 5CAOA 4DBXA 2QU6A 2OXDA 3IGGA 5LCJA 5M09A 4F09A 3E3BX 5CU4A 3UE4A 4WRSA 4MD9E 4FTOA 4H1MA 3NUPA 5AADA 4YSMA 3Q9ZA 4C37A 3QD4A 3UIBA 4F6WA 5LVMA 3EQRA 2X7FA 5L2SA 3KQ7A 3O2MA 4M13A 2GQGA 4USDA 4E20A 4CMUA 3ENHA 5FEDA 1M14A 3KF4A 3KF7A 5BUEA 4M14A 3FXZA 2Y4PA 4FSUA 4IQ6A 2X8DA 3F5GA 3QX4A 3GB2A 3IW8A 4MVFA 4U6RA 4C59A 2WTIA 3FI8A 3QKKA 4S2ZA 3DU8A 3NUSA 3ZHPC 4GIHA 2BAJA 3E8CA 4AE9A 4ANLA 3Q2JA 5HIDA 3P7BA 2R3PA