4F0FA

Crystal structure of the roco4 kinase domain bound to appcp from d. discoideum
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
276
structure length
276
Chain Sequence
RLPTLADNEIEYEKQIGKGGFGLVHKGRLVKDKSVVAIKSLILGDSEGETEMIEKFQEFQREVFIMSNLNHPNIVKLYGLMHNPPRMVMEFVPCGDLYHRLLDKAHPIKWSVKLRLMLDIALGIEYMQNQNPPIVHRDLRSPNIFLQSLDENAPVCAKVADFGLSQQSVHSVSGLLGNFQWMAPETIGAEEESYTEKADTYSFAMILYTILTGEGPFDEYSYGKIKFINMIREEGLRPTIPEDCPPRLRNVIELCWSGDPKKRPHFSYIVKELSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Roco kinase structures give insights into the mechanism of Parkinson disease-related leucine-rich-repeat kinase 2 mutations.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase, signaling protein
molecule keywords Serine/threonine-protein kinase roco4
total genus 80
structure length 276
sequence length 276
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4f0fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4f0fA01
1YW2A 2QI8A 3HKOA 4LGDA 1DM2A 3LXPA 3EKNA 4ACCA 1GIHA 2QLUA 5CLPA 5IH6A 2NRUA 2VUWA 4Z7GA 3WBLA 3V6RA 4S33A 1Q8TA 2O5KA 3DBQA 2WMTA 3NW7A 2YM5A 4JQEA 4MF0A 4OTDA 5ANDA 2B55A 2EB3A 2R7IA 2W1DA 3MTLA 3PIYA 4JI9A 4LMUA 5A6OA 3UMWA 1OBDA 4TPTA 3C0HA 3FKOA 4IX6A 4MQ1A 3DAKA 3UPZA 4PL3A 3HV3A 2QC6A 3GQLA 5T68A 3UQCA 2QOHA 4ERWA 3IGOA 2WU7A 3RM6A 2H34A 3D14A 5AA8A 4O83A 4CGAA 4DTBA 3PRIA 2QG5A 3P7CA 4EL9A 3MPTA 3BGPA 3PVGA 4D5KA 3TUBA 2X39A 1OI9A 4XLVA 2OIBA 4TW9A 4LYNA 1OKYA 1FGIA 4XRJA 3FLZA 5HG5A 5IQIA 2C6MA 3QZFA 3DU8A 4FR4A 2A1AB 1OZ1A 4KIKB 4BRXA 3POOA 2CGUA 3NLBA 2HIWA 2CJMA 5BVKA 2JKQA 4RJ7A 3DK7A 1DAWA 5IA5A 5AP2A 1AQ1A 3R28A 5JMSA 3UNZA 2RKUA 1WFCA 4CZTA 3QBNA 5EOBA 4Q5HA 2OF4A 4YZDA 4QMMA 3DLSA 4JQ7A 3QAME 3DNEA 3TACA 4LUDA 4A9YA 3C51A 4BCFA 3AG9A 4EK5A 4EOOA 5K0XA 3RKBA 3TV6A 3V51A 3E88A 4CD0A 3LHJA 3R01A 4FIIA 4CFWA 2IZUA 1UKHA 3O96A 5BUIA 5CU0A 4EJ7A 4CZYB 3G2FA 2BTSA 1SNXA 3BGQA 5L2TA 3DA6A 3WF6A 1O6LA 3V5WA 3FSFA 3R9RA 3R9OA 2WQOA 5JK3A 2I0VA 4RJ8A 2OJ9A 3OROA 3CLYA 2AC5A 2ITZA 3FMLA 2FGIA 1XWSA 2ZV8A 3PXFA 4R6VA 3BYSA 2J0LA 3DY7A 2YIYA 4AUAA 4YBKA 3U55A 4AU8A 2BDFA 4G3GA 4FC0A 4UMUA 5J5SA 3WE4A 4BI2A 3C5IA 4L3LA 4C7TA 5D7AA 2HZ0A 2VWZA 3QQKA 3AT2A 1JSVA 2HZNA 3T9IA 3Q2JA 4N57A 3DKCA 4ALWA 5C9CA 3AT3A 4BDAA 5HLWA 4EJNA 2PL0A 3Q04A 3ORPA 3EN6A 5J7BA 3U9NA 1MQ4A 5KNJA 5FQDC 1Y57A 5T3QA 2HENA 5CU2A 3SHEA 3P08A 5JQ5A 4X3FC 2FA2A 4YNOA 3F2AA 4QQCA 2F9GA 3PUPA 1VYZA 2JLDA 4FSUA 4PPCA 5IISA 1FOTA 2OO8X 2UVXA 2W1ZA 2ITWA 3NW6A 3OP5A 2VWUA 3OTVA 4BFMA 3R02A 4RX5A 4GKHA 3E8NA 3IPHA 4WG4A 4XOZA 4AW0A 4BCHA 3FMKA 5J9LA 2XB7A 4QQTA 5D7VA 4JRNA 4BDEA 2CN5A 4FOBA 4XX9A 2C3LA 4RX8A 3VJNA 4QPMA 4PDYA 2B7AA 4HYIA 1U54A 4RC2A 3UDBA 4I0RA 4APPA 1K2PA 2JDTA 3LQ5A 5KMNA 3GCQA 2VO6A 5DE2A 3BYVA 3CGFA 3BKBA 4YJRA 3ZCLA 2QNJA 4C4IA 4KRDA 1ZY5A 2XZSA 4O7YA 3FLWA 4P90A 4FIJA 1TQPA 4K9YA 5I3OA 1Y6AA 2VV9A 2QLQA 2UZVA 1KUTA 3DNDA 3D5XA 2VTRA 3KCKA 4AT4A 4F7SA 3W2RA 4ZSAA 1UVRA 2WTDA 3TZMA 5M4FA 3IG7A 4LV8A 2VTQA 3TJCA 3WZUA 2W5BA 4C37A 4EK4A 2OK1A 3RK9A 2C47A 4NW6A 3ZMMA 5M4CA 4GVAA 2PZYA 4AFEA 5ETCA 4ZK5A 1XH4A 3DBFA 4U6RA 2G1TA 3QX4A 3RJCA 2XF0A 3BQRA 3V5PA 3WZDA 4EBWA 5EQPA 2C1AA 2ITTA 1S9IA 4FSNA 5FTGA 5GJGA 1M17A 5FEEA 2C6OA 4TT7A 3QKKA 4FL3A 5H9BA 5LVLA 3RK7A 4PMTA 2YJSA 4FKTA 3MN3A 3GI3A 4IEBA 2BKKA 3VQHA 3FC1X 3EN5A 4NCTA 4V01A 4X2JA 2OICA 3GC8A 3QUDA 5I9UA 2R3IA 5M08A 3A62A 2CNUA 1KE9A 3ZUUA 1NA7A 4JBPA 3HMNA 4LMNA 3UMXA 2YISA 5C03A 3ZSIA 4BY9E 3ZH8A 2YM8A 3I6WA 3HMPA 3QXOA 5DPVA 2PE0A 3FMMA 5J1VA 3LQ3A 2OF2A 3AGMA 4IC7A 5HCXA 2WU6A 4MD7E 3QRJA 3U9CA 1FVTA 1BL6A 4DBNA 3UC4A 2OZAB 2XNPA 3BU6A 3MH1A 5T6KA 3UVQA 4XV3A 1NT2A 2XA4A 3QRTA 4F6WA 1P14A 2X81A 3FLNC 4WSYA 4G3CA 4O2PA 3S1HA 4FTJA 5F95A 1Y6BA 4O7TA 3B8RA 4FTRA 1UU3A 2H6DA 3KN5A 5EH0A 3LKMA 3MIYA 1K3AA 2R3HA 2XNEA 3PY1A 2E9NA 4M8TA 4J8NA 3FZTA 3OUNB 3TV7A 4CRSA 4O0VA 5KMJA 2JDOA 3R7EA 5FUTA 4D2PA 1R0PA 4QMOA 4TYHB 4LM5A 3BWJA 2CCIA 1XKKA 3RAHA 4CV8A 5IUGA 1KOBA 4DBXA 3MWUA 5FXRA 1ATPE 4NM5A 4QYGA 4FMQA 1WBOA 2QQ7A 3MIAA 4E7WA 5CXZA 5C4KA 1XBBA 2J4ZA 3E3PA 3QRIA 3FI2A 4NSTA 4BCNA 4EONA 2YABA 4FEXA 3UO4A 3LXLA 4B99A 1APME 1L3RE 4FV0A 4NJDA 4RA4A 5HVJA 3Q60A 1YXTA 2IVVA 3VF8A 4GL9A 4BYIA 5CEIA 4FIEA 3BLQA 4Y5QA 4BZNA 5I5ZA 2C0IA 3W32A 4WRGA 4XV2A 2CGWA 1PYEA 2BDJA 3O51A 5E7RA 3SA0A 2C69A 3ERKA 3RK5A 5L8JA 1YRPA 3W1FA 4EQUA 1F3MC 3VW8A 4AW5A 4DITA 1ZRZA 4AXAA 2Z7RA 5DFPA 3ZLXA 2WMAA 3UGCA 4ZZNA 4BKZA 4LG4A 3K5UA 3NUXA 4FV6A 4D5HA 2R3KA 1H07A 5AUVA 2UZDA 1YOLA 3K54A 4P5QA 3TCPA 5JFSA 5LWNA 4CCBA 1EH4A 3B8QA 3EFWA 4E6DA 1PXLA 3FQEA 5FTQA 1KSWA 4QTCA 3R1QA 5AUYA 3RI1A 2X2MA 4EK6A 4USDA 5JH6A 3D2IA 4LL0A 5AMNA 2C6TA 3PYYA 4C36A 5J1WA 2ZM4A 3UZTA 3CTHA 3U6HA 3KCFA 4F6SA 3ATSA 4I21A 3QWJA 5FRIA 5A54A 4QTBA 4RRVA 5HHWA 1ZYDA 2BIYA 2CGVA 5LVMA 5DEYA 2VWYA 3ZONA 3NUYA 4C59A 2PULA 3IECA 4J7BA 5H8GA 3PP1A 4QP6A 5EYMA 4K77A 3RPOA 4I23A 3F5GA 3JY0A 3OT8A 1J1BA 2UZBA 3E3BX 5EM5A 3S0OA 4IZ7A 3PA5A 3L9LA 2C5YA 4HCVA 4I41A 5H8EA 4MBLA 5BQ0A 3ATTA 2YM3A 1BI8A 5IPJA 4DA5A 3SG8A 4CXAA 4C34A 1IA8A 4OBQA 5EHYA 3BEGA 3MB7A 4C2WA 2HK5A 4BCMA 4YZBA 3N9XA 3W55A 1PJKA 3A8WA 4OTRA 4IAYA 1OUYA 2YITA 2C6KA 2JEDA 1OGUA 4UXQA 3GEQA 5HI2A 2JAMA 1H0WA 2QOQA 4GV1A 4QNYA 3SAYA 3LFDA 2OGVA 3HDMA 3R2YA 4E26A 2PYWA 2XS0A 3HVCA 4TY1A 3KXNA 3NNXA 2FH9A 2RSVA 3IDCA 5EYCA 4XUFA 3POZA 4DFYA 4M0YA 2F7XE 2OJFE 3D7TA 3ZLWA 2W1HA 2VTHA 4WNOA 1ZMUA 3U4WA 5GZ8A 4U42A 3SW4A 3GU8A 4TZRA 4J8MA 1MUOA 1AD5A 3AMBA 3Q9WA 4D9TA 3BBTB 2Y4IC 4CFMA 1ZOGA 1WVXA 4IAAA 5AX9A 3PLAE 1FBNA 3BHUA 2C0TA 3I5NA 2W1FA 3ORKA 4U3ZA 4ID7A 2BRMA 1H27A 3HA8A 4DC2A 3EWHA 3E93A 3FEGA 3CIKA 3P1AA 4V0GA 5E8YA 4NFNA 4IWOA 4G31A 2W17A 3OCTA 4MXAA 4I93A 4XJ0A 5DT3A 4AZSA 1YWRA 2XNBA 3KF7A 3R7GA 3BV3A 4JDKA 1NW1A 4BWXA 2W4KA 1XH8A 3ELJA 3FHRA 4C35A 4YJUA 2KULA 2PE1A 4O7VA 3CD8A 2P2IA 4DGOA 4AOJA 1P2AA 4ZTMA 2EXCX 4G3EA 4GRBA 3R1SA 5BYZA 3UO6A 2XRUA 3UVPA 5IQFA 5E8ZA 2XK6A 4JBOA 4ZJJA 5C27A 5CVGA 4F1TA 4OR5A 2XCHA 3LCTA 5EDRA 1OPLA 2W4JA 3DFCB 5EDQA 2UW5A 4K18A 4FT3A 2Y6MA 4EK3A 3E87A 3FLSA 2J0KA 1YXSA 3LPBA 3V5QA 3LAUA 5KKRB 3QC4A 3GFWA 4A9RA 2XNGA 3L8PA 3AC3A 1BX6A 4UMPA 5HE1A 4RC4A 4UYAA 3UG1A 4FTKA 4MTAA 4FNWA 4C02A 1H28A 4HVSA 2R9SA 3FL5A 4GSBA 1OKZA 4MXYA 3GC7A 4JT3A 1PW2A 2FUMA 1OB3A 2Z7SA 3P7AA 2JFMA 4QP8A 3RM7A 4DCEA 1LEZA 5E1SA 4ZY6A 1OKWA 3RALA 2BMCA 2GNJA 4ASEA 4EOPA 3FXXA 5IQBA 5AUZA 4EOIA 5HU3A 1STCE 5L3AA 3ZBFA 5BUEA 4RWLA 4F1OA 1BI7A 4YTCA 4FYOA 2OLCA 2WB8A 3CPBA 5F20A 4FEUA 1W0XC 2QO9A 2Y9QA 1NVRA 1E9HA 3HECA 1OECA 5CEOA 2R4BA 4FEQA 5HTIA 3REPA 1REKA 5CAQA 3CY3A 1IRKA 1RQQA 2JDSA 3ZOSA 4BGQA 5FD2A 4IAFA 4BCPA 2DS1A 4EQCA 3VBQA 4YU2A 5E8SA 2P33A 4AGDA 5A6NA 4DH1A 2WMVA 3SDJA 5AA9A 3ZRMA 2UW7A 4IMYA 2F2CB 3LCDA 4KBAA 4OTQA 3QTRA 1A9UA 2UZUE 5FBOA 2B9HA 4FTQA 2BVAA 4UMQA 3ZC5A 3ZM4A 1W98A 5BMMA 2I40A 2IN6A 1BYGA 3KRJA 4R3CA 4BBEA 4C2VA 4KD1A 4A7CA 5D11A 4KAOA 3R7YA 3ZUTA 4D55A 1MRUA 2CGXA 4YSJA 1M2PA 3COHA 5M51A 5LXMA 1Q8ZA 3IW8A 4FZDB 2CLQA 3PTGA 2BAJA 4DYMA 3FY0A 3QHRA 3MVHA 2WNTA 4QMPA 4U41A 3NRMA 2ZAZA 1YOMA 4B6LA 2PVJA 5DLSA 4H1MA 3THBA 4FTNA 3DB8A 4GW8A 4EH7A 3CD3A 4X2NA 4ASDA 4NM0A 5EKNA 4D9UA 1KE8A 4BDHA 5EW3A 4WSQA 3VQUA 1Q97A 3NWWA 5I4NA 4FEWA 2WTKB 2VO0A 4DTKA 1GY3A 5AX3A 3QX2A 4FKRA 4MEDA 5FG8A 4UY9A 4EC9A 4GYIA 4IX3A 4OTPA 3PJ3A 1IEPA 3IOPA 4NM3A 4JG8A 2WOTA 3F3TA 3LCSA 4IACA 1RDQE 2RFNA 3H9FA 4JLCA 4YMJA 4YO4A 4EOLA 3FPMA 3GOPA 5I9XA 2UVYA 2WMBA 4I22A 4PRJA 4PNKA 5LMKC 4AE9A 2XKDA 2C5OA 4MBIA 3UOKA 1JKSA 3A60A 2PMOX 4R5SA 4AZFA 4ZSLA 2V55A 2WTJA 4K11A 5DR9A 3VW6A 3CKXA 2ETMA 4HZRA 4KINA 3F2RA 4FGBA 4GG7A 3GCVA 5C01A 3R8UA 3PSDA 3CGOA 5CU4A 4NZWB 2FSTX 5GIPE 2EB2A 3KB7A 2HELA 3MH3A 2F49A 5CY3A 4D58A 3N51A 5CF6A 3ZM9A 1G3NA 2VNYA 3L9NA 4EH5A 4YC8A 4EZ3A 1ND4A 4CNHA 3WIGA 3NDMA 1CTPE 3KXGA 2BRHA 5KHWA 4FBXA 2JBPA 2W1IA 2XEYA 3GOKA 4BCKA 4KUJA 2W1EA 3HGKA 4RMZA 5LOHA 2OW3A 3ZO4A 4IZAA 4L46A 3R9HA 4RFZA 4TYJA 3I81A 3MFSA 4Y46A 4FUXA 2XYUA 5IKWA 4A07A 5IQEA 3DT1A 5E1EA 2GPHA 1YHSA 2A27A 3PWYA 5CXHA 4EHVA 2PUPA 4MF1A 2IZSA 4WG5A 5I9ZA 4O96A 5CANA 3ZRLA 4UMTA 3VUGA 3NUNA 4AP7A 3KQ7A 2B9JA 3G51A 1V0BA 5E91A 4E4MA 3DOGA 5IEVA 1Q24A 2PUNA 2PU8A 4TRLA 4BCGA 5DRDA 4F9CA 4R8QA 2XEZA 3T3VA 5JFVA 4ZAUA 1QL6A 2Z02A 5FM2A 3TWJA 5BMSA 2WHBA 3EMGA 3KXZA 3ZBXA 4PQNA 3QGYA 3OC1A 2E2BA 4FV4A 4ACMA 5AV2A 4C38A 4D4SA 3FE3A 2JGZA 4MCVA 3A8XA 4YHTA 4IWDA 3OY1A 4EH6A 3P23A 4KIQA 3UZRA 5M07A 3F5PA 3ZSGA 5D12A 4O7SA 3VBWA 5AJQA 3GQIA 1LEWA 4FZ6A 5HEZA 4P5ZA 5EM7A 2O2UA 2OI4X 4X0MA 4MD8E 1WVWA 4AQCA 3ZEPA 2Z7QA 4EQMA 2JIVA 4U45A 3CXWA 3W18A 3P5KA 3BE2A 1XH9A 4GKIA 5HG9A 4Q2AA 4MXOA 4XBUA 1Z5MA 3OF0A 4RVKA 4HGLA 3CP9A 5G6VA 2YWVA 3CSVA 3RPSA 3OFMA 4L8MA 2Y4PA 5HOAA 4AWIA 5IQGA 2XK3A 1B38A 4NU1A 5DNRA 2BTRA 1PXNA 1XH7A 2RG6A 2BZJA 2UVZA 3FI4A 3R8PA 3GCSA 1SNUA 5KCVA 3NUSA 4BI1A 3EQHA 4BCIA 5ANOA 3QXPA 4D4YA 4C3RA 3BELA 2I1MA 4C57A 4MYGA 3MFTA 5TKDA 2O64A 4I5HA 3R8VA 1V1KA 1FVVA 2IVSA 3DTCA 3EIDA 2R0IA 4YC3A 4RG0A 2XIZA 3TNWA 4EHGA 4PTGA 5GINE 3V8WA 4ARKA 4CMTA 3RCJA 4ZS4A 1ZYCA 2I0HA 3OEZA 3WYYA 4F0GA 3EOCA 4B7TA 3HV7A 2QG7A 3EZVA 4FVPA 2XIKA 4YGAA 4R1VA 3QRKA 2WIHA 4A4OA 4ALVA 1DI8A 1H1SA 4UN0C 3TNPC 4ENYA 4DINA 5A4CA 2V7AA 1W8CA 2XVDA 2OFUA 2YN8A 3LW0A 3R8MA 2ZMCA 5BVNA 3CQUA 4XNEA 5B7VA 5HVKA 4PTEA 2OH4A 4RZVA 2JBOA 3UNKA 1RW8A 2QKRA 1PXKA 4HGTA 4R78A 3AMYA 3GU7A 4UWBA 3KXMA 2Q0NA 3TNIA 5M4UA 2HOGA 5M09A 5ICPA 4KWPA 4M15A 5K9IA 3OUKA 4YPSA 2X4FA 4CFUA 4YZMA 3GB2A 2OJGA 2VN9A 2ZDUA 1UWJA 4M3QA 5A14A 1ZXEA 4CTCA 4XS2A 1I09A 2YM6A 2Y6OA 1OIRA 3R2BA 1MRVA 2GU8A 3NYNA 2XUUA 2X8EA 3MBLA 3PSBA 2CMWA 3PXRA 3PZEA 2BDWA 4HYUA 4H3BA 4WBOA 1PXOA 2X1NA 3QD4A 3QFVA 4XRLA 5FDXA 3SOAA 5I0BA 2AYPA 3PDTA 5AWMA 1WBTA 4BHNA 4CLJA 4QMYA 2Z2WA 3DJ7A 3I5ZA 2HW6A 4NL0A 4QPAA 3MVJA 4WBBB 5JEBA 2EXEA 3GUBA 1G8SA 3MGYA 3OBGA 5M55A 1M7NA 4C8BA 4CQGA 5AM7A 1FQ1B 5IQHA 4WOVA 3UZPA 2W99B 4D28A 1YOJA 3OMVA 4PWNA 2YDIA 4GIHA 3ETAA 4QP4A 1CKJA 1FINA 4XG2A 4CSVA 2YLEA 5KMIA 1UNLA 2YIXA 4J71A 1IASA 2WEIA 4JR7A 5M53A 3UVRA 5L2SA 3RWPA 3JPVA 3MY1A 4NKAA 5AV3A 3HUCA 1P4FA 5HGIA 4MNFA 4AACA 1QCFA 2QR7A 4HOKA 5HNIX 2OFVA 1KV1A 4A9SA 4DEHA 3L8XA 4HJOA 4ZJVA 3H10A 4N6ZA 2UUEA 4QMWA 3A7FA 5E92A 3WZKA 4BTFA 5L6PA 3SV0A 3IKAA 3OOMA 3P79A 3V3VA 2QU5A 3KF4A 1KE5A 1NY3A 2ZV7A 3R71A 3V5LA 3SG9A 4J95A 2JIUA 3R7OA 4FYNA 2PVFA 2BRBA 3SX9A 2YIRA 2UV2A 3KXHA 4C62A 4BGGA 4AOIA 1LR4A 1IG1A 3QTSA 4JG6A 3CQWA 4UX9A 2CHLA 5ITAA 4MWHA 2VO3A 2VWIA 1U4DA 2XBAA 4NT4A 4G5JA 4JS8A 4XLIA 3TKIA 3EH9A 3GT8A 1L8TA 3PXKA 3OEFX 3L1SA 1JKLA 2ZB0A 3A2CA 3A7HA 4YJSA 4DFNA 3L8VA 3NAXA 2OKRA 4QT1A 3WF8A 2XKCA 3EFLA 4U43A 5IQDA 2J5EA 3Q96A 4U40A 3DS6A 4ZSEA 1HOWA 4FKPA 3PVWA 4MH7A 5CX9A 4YTHA 2W7XA 1TKIA 4YO6A 2J9MA 2JFLA 5CZHA 1F5QA 3RTPA 4ZTRA 3H3CA 1T46A 3U8WA 3OWLA 3FHIA 3TUCA 3F69A 3ZZEA 3DBCA 3FV8A 3A7IA 1JOWB 2JD5A 2ZOQA 4FSMA 4I3ZA 2PVYA 4IANA 3DKFA 2PY3A 1J91A 4DFLA 5CEKA 1J7LA 2CPKE 3IDBA 3VUMA 3LFAA 4GIIA 4HW7A 3G15A 2X8IA 3AC1A 5E8XA 4ZEGA 4ITIA 3G33A 2X2LA 4L43A 4E4NA 2XBJA 3AC8A 1RJBA 5FXSA 4FZAB 5CTPA 4CFXA 4EEVA 4CYIA 4EOKA 5A4QA 5AIRA 1YI3A 2PE2A 5CF5A 3QTWA 3ZC6A 3E7OA 3OBJA 4RVLA 4FK3A 3G90X 2BAKA 5CVHA 4ZTLA 5L2WA 1SVGA 3OS3A 3PE1A 1G8AA 4JAIA 4AT5A 4H3QA 4M69A 4BHZA 3CCNA 3S95A 1OL2A 3EHAA 4YJQA 4BKYA 3EQIA 1KWPA 5A4LA 3TZ7A 4BCQA 5FBNC 2SRCA 4KKGA 3NCGA 4I92A 1YHWA 2C4GA 5HKMA 3OCSA 4BCJA 2VTJA 3O71A 2JKKA 4GK2A 4KIKA 4FE2A 2YZAA 5DG5A 3BHTA 3ORMA 4CVAA 3QQFA 3B2TA 4FT7A 4HYHA 2XIRA 3TDVA 3RNIA 4M0ZA 5DR2A 5AR4A 5AR3A 4EC8A 1Y8YA 3U87A 4FTIA 2JC6A 5IA1A 2OZOA 2R3GA 5AR5A 4F1MA 1JAMA 4Y72A 5D10A 4F7JA 4I24A 5TF9A 5HORA 4TWPA 5LMAA 3E5AA 4O82A 2G2HA 3QZIA 4O0XA 3UYTA 5EDPA 2XK7A 3FXWA 4YJVA 4YJTA 5IEXA 2WTKC 4GT5A 5KUPA 2ACXA 4RFMA 1H01A 4QD6A 3MW1A 3Q4CA 2F7ZE 3SD0A 3VUTA 5BX0A 4IBMA 3NYXA 3FQSA 5ACBC 2GCDA 3QCYA 5TE0A 3I0QA 1PXPA 3NZ0A 2H96A 4OW8A 3R30A 4G3DA 3EJ1A 1BL7A 4FKGA 4L68A 2UZWE 2QOIA 5EYDA 2H9VA 2W96B 4WD5A 4C0TA 5C1QB 3LMIA 1ZYSA 4HVIA 2AUHA 2P55A 5E8UA 2I6LA 5TOZA 4L3PA 3SRVA 4ZP5A 4NIFA 3EYGA 4FV1A 1Q8YA 4WUAA 4X6RA 1BMKA 3DB6A 3Q5ZA 4G9RA 4ZY4A 4FTOA 4L42A 4FTMA 3QF9A 1Q4LA 1Q8UA 2PWLA 4M14A 4MXXA 2CLXA 4V05A 5D9HA 4ZLOA 2ITPA 2QOFA 5BVFA 4GCJA 2VTMA 2ZVAA 4E4LA 5EI2A 2VGPA 4AF3A 2JKMA 3ZFXA 5HD7A 2IZRA 1GIJA 4DN5A 4OTFA 1Q41A 3QHWA 3G9NA 4H1JA 4JBVA 4Y8DA 3WZJA 2ESMA 2QHNA 5HESA 3G6HA 4WG3A 5FM3A 2PVMA 3OXZA 2VTNA 4B8LA 4UMRA 3DCVA 3ZYAA 2O0UA 3HV6A 5HTCA 4FSWA 4BBFA 3RAKA 5I9WA 1PMEA 3ORZA 2G2FA 3I6UA 4X3FB 5HBHA 5AAFA 3JXWA 4FKLA 5TT7A 3BBWA 4D0XA 4E5BA 1REJA 4IZ5A 5FWKK 4AW1A 4EOJA 4FF8A 3NNWA 4UV0A 5K5XA 1ZYLA 1X8BA 4FV8A 3QD0A 4L00A 4ZY5A 3DDQA 4GJ3A 3RPVA 4K1BA 5M57A 2ZB1A 3LM0A 4G1WA 2WAJA 3BWFA 4AZVA 3FLYA 4PY1A 2A19B 4U79A 2GTNA 4CEGA 3HRBA 2CNQA 2BZIB 4MQ2A 1FMKA 2WFYA 3A99A 2R3OA 3RCDA 5IQCA 1UU7A 3NPCA 2GMXA 2PVNA 4TYIA 2W9ZB 2XM8A 5DI1A 3E92A 1JSTA 4RQVA 4TTHB 4TYEA 4QMNA 5J8IA 1JKTA 2QOOA 3I1AA 3KL8A 5M44A 1XH6A 4QTEA 4OBPA 4ANLA 4TL0A 3MY0A 3C4EA 3Q4TA 3FC2A 4JNWA 1Y8GA 4M67A 5A3XA 4FX3A 3TI1A 3C9WA 4DEGA 3VNTA 3P9JA 5CSWA 3PLSA 3FY2A 3DLZA 2B4SB 1JLUE 4BWPA 3EQBA 1XJDA 4FKOA 2E9VA 2CNVA 3K5VA 1V0OA 3TN8A 4AZWA 2WELA 2IWIA 4FV7A 5KMLA 4F09A 2QR8A 2V22A 5GJDA 4ACHA 1XH5A 3FYKX 5EHLA 3E8CA 2CCHA 5BYLA 5FP6A 4NIFB 1ERKA 2JAVA 4NTTA 3K3IA 4NCTC 4Y85A 1BUHA 4OAVB 4K2RA 1BLXA 2JITA 4FI1A 5JT2A 4YC6A 4DG2E 4GU9A 3BYUA 3P78A 2VWXA 4M69B 5ANKA 4EKKA 4EZ7A 4QRCA 5GHVA 2KTYA 3TIZA 4AW2A 4F4PA 4BYJA 3ACKA 5CEQA 5H2UA 4EWQA 3NUUA 3KXXA 5JGBA 4DFBA 3TL8A 4F63A 2VTPA 2NRYA 2EVAA 5BYYA 1XO2B 3H0ZA 5DT4A 3HMOA 4FNXA 5M06A 5IUIA 4C58A 5EQYA 2IVUA 3DBEA 4RJ5A 3OOGA 2C30A 2QONA 2X6EA 3Q32A 4NEUA 3AD4A 3KN6A 4RGJA 4W4WA 3FI8A 2C0OA 4AZEA 4L7SA 2O3PA 3LOKA 4KB8A 4LRJA 4QQJA 4DT8A 1QPJA 1I44A 5JSMA 1ZMVA 4BWKA 3WYXA 5KMOA 2ETKA 3IO7A 3H30A 4FTLA 2XIXA 2GNIA 3H0YA 2BZHB 4X7QA 2VTOA 4L44A 4BIEA 4W4XA 1OITA 2X4ZA 3PVUA 4XBRA 3E62A 1ZY4A 4QYEA 4Q9ZA 3PJCA 5ETIA 3F66A 4MNEB 4TWCA 5LMKA 4AN9A 3AC5A 5IA2A 3RWQA 3DXPA 4H58A 1FGKA 2HCKA 3VHEA 5H3QA 2P3GX 3LFCA 3RNYA 3ZDIA 3QKLA 4XYFA 5AAEA 2G2IA 3MJ2A 4PDPA 2VTTA 3LFBA 4G5PA 2NP8A 3U6JA 3F88A 4IDVA 3NCZA 2LAVA 5IEYA 4IJPA 3LM5A 2J6MA 3GU6A 3ORXA 3BPRA 4DGLC 3EQGA 4IVAA 1GOLA 3WZEA 1XBCA 3PG3A 5HBJA 3ODYX 4NK9A 2BALA 3QL8A 4EI4A 4E6QA 4EOQA 4YTIA 1M14A 1GIIA 5AR2A 4QMTA 1JVPP 2WTIA 4IADA 5CZIA 4F65A 5IDPA 3CS9A 2R64A 4Y5HA 3ZU7A 4V04A 5LQFA 2VX0A 5AP0A 2RF9A 3ZTXA 3ORNA 4DH3A 3W2OA 4FTCA 5HNGA 3R73A 3TUDA 4WUNA 5HZNA 2J2IB 4ITJA 2E9PA 4S30A 1KE6A 4K0YA 4C3FA 4RIXA 4UBAA 2QD9A 2DYLA 5DOSA 3MH2A 4YJNA 2YWPA 4XP2A 2BAQA 2Z60A 5IG1A 1PYXA 4MHAA 4UB7A 2F2UA 2VAGA 5ANIA 4Z3VA 3QTUA 3BV2A 5LARA 3F3VA 4EUTA 3MH0A 3ZFMA 3D0EA 4DT9A 2EUFB 4FSYA 4XOYA 2PTKA 4DEBA 5HX6A 4EZ5A 2IW8A 4IXPA 4C4GA 1XR1A 3NIZA 2OSCA 4H3PA 4XP3A 3W16A 2WXVA 2X9EA 5DEWA 3OY3A 4CQEA 2OJJA 4CKRA 3I7BA 4GUEA 5AUTA 4NFMA 4RWJA 1OL7A 3ALOA 4GK4A 3V04A 2BRGA 2ETRA 1WMKA 4JVGA 5AP7A 4JDIA 4EH4A 5JFXA 1IAHA 3E8EA 3Q9ZA 5F9EA 1PF8A 4G6OA 4P2KA 5J5TA 3VVHA 2PZIA 4PV0A 3OWKA 4FKVA 4RLKA 1YXUA 2O65A 4RIXB 4S31A 3UOJA 3EN9A 3PA4A 3GBZA 2R3RA 3DTWA 3QD3A 2XRWA 4DG3E 2F7EE 3UTOA 1TVOA 2QHMA 4BIBA 4IM3A 2FSLX 3BU5A 3C0GA 2GNGA 3HZTA 5K3YA 3KRLA 3FMEA 1UU9A 3WF5A 4EH2A 3QRUA 2BR1A 4PP9A 4A9TA 1JWHA 2HW7A 4KABA 5ETAA 3IONA 4FT9A 3DJ6A 4RX7A 5EW9A 3NVMB 1F0QA 1P5EA 2WZJA 3DKGA 4NWMA 3TTIA 4L9IA 5DYJA 2WMWA 4C61A 3KU2A 2GQRA 2OZAA 3HUBA 4IQ6A 3RVGA 4NUSA 2R3PA 2ZM3A 4OGRA 2YAAA 3ANQA 5CU3A 5E8WA 4EHZA 2B54A 3NYVA 3F3ZA 4O91A 3SW7A 4PF4A 2CKPA 5DT0A 4EUUA 3VS6A 4FA2A 5CF4A 3LJ1A 3MI9A 5CENA 1XHAA 4KS8A 4WIHA 2PMNX 3FWQA 4NTSA 4M84A 3I4BA 2Y4IB 1M52A 4UZHA 3PSCA 2JDRA 4RLLA 5HCYA 5AV4A 5AR8A 3R21A 2FSMX 5DWRA 4YUQA 3M11A 2Z7LA 3D4QA 3IS5A 3ITZA 3NSZA 4I4EA 2B9IA 2Y8OA 4M13A 5CQUA 4BBMA 4FOCA 1WBNA 1U54B 5EM8A 4H39A 4LRKA 4XV9A 5CSHA 2LGCA 3PXQA 4ACGA 4CT2A 3ORIA 5AAGA 4L52A 4PL4A 4IB5A 1BKXA 3DXNA 3LMGA 4UYNA 2B9FA 4AE6A 4DF3A 4OAUC 3WF9A 4IB0A 4LOOA 2GS6A 1H08A 4XG6A 5KE0A 3JY9A 3VS7A 3IW5A 4R7BA 4RJ6A 4Y73A 4YJOA 4X2GA 3BHHA 5EFQA 3ZEWA 3RZFA 2J7TA 3C4XA 5L6OA 2WOUA 1ZZ2A 3PPJA 2CN8A 2I0YA 3D2KA 3PWDA 4A4LA 4H05A 4RIOA 3R1NA 1LP4A 2OJIA 3GP0A 4U0IA 3FPQA 4PUZA 5G1XA 4E3CA 5KKRC 5CAUA 5HLNA 2QU6A 4Q5EA 1DAYA 2C6LA 2QURA 3AOXA 5FLFA 5HU9A 2XP2A 1PHKA 2YAKA 3ZO1A 1A48A 1IR3A 3JVSA 4OUCA 4ANNA 5TO8A 1MRYA 3F5XA 2IZTA 4CG9A 1U46A 3D83A 5HNBA 4FIGA 5BVWA 3ZO3A 3HYHA 3W2QA 2J51A 3DK3A 3QCSA 4QP2A 4O6EA 3EQDA 3EYHA 4XG3A 3LZBA 4X3FA 4ZTQA 4USFA 2PUIA 4CT1A 4A9UA 4FZFB 4C3PA 3HX4A 5GIOE 3PXZA 4DFZE 3QKMA 4GJ2A 4IH8A 4NM7A 4YZCA 1R78A 3COIA 3VIDA 3H9OA 2A4LA 4G9CA 2R3MA 3EQRA 2JDVA 3KA0A 4FODA 4QYYA 3BHYA 2CDZA 4CLIA 2ZM1A 3W2SA 3TJDA 1GAGA 4I6QA 5IMXA 2IG7A 3VC4A 5GZAA 2ITYA 4ALUA 3UODA 5CU6A 2WQMA 4ASZA 4GVJA 5LVNA 3OD6X 1QPEA 4L01A 3OW4A 3UG2A 4FEVA 4S34A 5LMBA 2YCSA 4F70A 3R83A 4M12A 5J87A 4FT5A 3OZ6A 3FYJX 4ZSGA 3AD6A 5CYIA 4FTTA 2HZIA 4RPVA 5FXQA 4S32A 3SQQA 3RGFA 3E7VA 4JAJA 4WT6A 3WOWA 2A0CX 3R04A 3GENA 5AP5A 2X2KA 4LL5A 4C33A 2JKOA 3VS4A 3OTUA 4H36A 3O17A 5HO8A 4R7IA 3LVPA 5IH5A 4DGNA 4AZTA 2EWAA 1QPCA 2CKEA 4LI5A 5DRBA 2FSOX 2ITXA 3QQGA 3L9MA 3DV3A 4HNFA 3ZRKA 5EW8A 1GZOA 4QP9A 4FNZA 1PKGA 1SVHA 3TZ8A 4HVGA 3E64A 5JKGA 5A4EA 4FKQA 4BDCA 3QLFA 4FSRA 1E1VA 4YLLA 2J90A 4FL1A 4MAOA 1CKPA 3LLAA 3AMAA 3W8LA 1UNHA 2Z8CA 3QTZA 4E6CA 2UZLA 4FSQA 4IVBA 3ET7A 4Q9SA 4BVUA 3U4UA 2C5NA 4FUYA 4I5MA 3TEIA 4ORKA 5I3RA 3CY2A 4O0SA 2YCQA 2YERA 3HAMA 2WIPA 5EI8A 3D9VA 4PP7A 3ORTA 5KO1A 4BKJA 3PPKA 4G16A 5CAPA 3R6XA 3JUHA 4RIWB 3HMMA 5I9VA 4DTAA 2VX3A 4EOSA 4EOMA 2OWBA 2UW6A 3P86A 4BB4A 4EH3A 5FGKA 4HZSA 1Y91A 1O9UA 4CYJA 1W7HA 2RIOA 2C3JA 3HEGA 4R1YA 4U7ZA 5HLPA 4O1OA 5KHXA 5HG7A 3HLLA 3UP2A 1PKDA 4FNYA 4UEUA 3O7LD 4CFNA 3H4JA 4DEAA 4X3JA 3DFAA 1E1XA 4E1ZA 3ORLA 3ZUVA 3DXQA 4ZLZA 1CSNA 5JQ8A 2XJ1A 3LE6A 4TWNA 4X2FA 3G9LX 4TNBA 4CKJA 4AGUA 3KVXA 3Q3BA 4QPSA 4RBLA 5GJFA 3VRYA 4F99A 2C6DA 2JIIA 1R1WA 3G0EA 2W1CA 3K2LA 3MB6A 4P4CA 3S4QA 4ZS0A 4BDDA 1G5SA 2QODA 3JVRA 3MPAA 2GS7A 4G2FA 4IVDA 5AP4A 2C1BA 1QPDA 4FG7A 4M68A 4RWIA 5KZIA 3DBDA 3R9DA 1H26A 4BDFA 5B2LA 5CSPA 3KKVA 4FICA 4WNPA 4E73A 3EB0A 4IDTA 2BPMA 3BLHA 3F82A 1YDTE 4IJ9A 5CAOA 3NVKI 3FZ1A 4CMOA 4QP7A 5DR6A 2VWVA 5E90A 2WQEA 2HAKA 3COKA 3R7VA 3P0MA 5K4IA 3QC9A 2C6IA 3Q52A 2UW4A 4KIOA 4X2KA 4JJRA 4YNEA 3KK9A 4MNEA 4AA4A 2OXDA 3L9PA 3TV4A 4WHZA 4QTAA 1WBPA 4EWHA 4E8AA 3F61A 4D2VA 4NW5A 4YHFA 2YJRA 3NNVA 5L2QA 2WTWA 4EHEA 4U97A 5K0KA 1CKIA 2C3KA 4GFMA 4EYJA 4WNKA 3QALE 1W84A 4TN6A 1YVJA 1M7QA 2X0GA 3EQPA 1J1CA 3VS1A 3R7IA 2YLFA 3CKWA 4IX4A 4I5PA 1XBAA 4RC3A 4O7ZA 2PVRA 4QMXA 5F94A 5JRSA 3VUHA 3DAEA 3GC9A 5HCZA 5LJJA 2WTCA 1H1RA 4RVTA 1Q61A 1Q99A 4YSMA 1GZNA 3BIZA 3QTIA 3TKUA 1ZYJA 2QOKA 5KMKA 2HXLA 1OL6A 4NH1A 4ZIMA 3S3IA 4IM0A 4OTIA 4F9YA 4N70A 5LCKA 2CKQA 1Q3WA 4FKSA 4K6ZA 1Q8WA 3FMHA 3O8UA 2ONLC 3G6GA 3AD5A 2HXQA 4MXZA 3SXRA 5DMZA 3PY0A 3V5TA 5LVOA 2DUVA 5J95A 3DPKA 2YHVA 4AN2A 2GNLA 3ANRA 5HIBA 2BHEA 1JPAA 3TDWA 3AXWA 4PPBA 4BTKA 1AGWA 3FL4A 4IB1A 4DH5A 2IJMA 4OTGA 4ZTSA 5HQ0A 3WF7A 5A46A 3N4UA 2J0IA 2R3JA 3FXZA 2ZYBA 3I79A 2PUUA 3MV5A 4OTWA 3CBLA 5JRQA 3LCKA 4O21A 1YHVA 5KMMA 3MDYA 1Q3DA 3Q5IA 4JDHA 3R1YA 4O6LA 2YZLA 2R3NA 4W9WA 4BCOA 5BVDA 2FYSA 3RP9A 2X6DA 3NW5A 5IUHA 2YDKA 4L3JA 2UZTA 5DBXA 3KK8A 3MA3A 3QQJA 3R9NA 4ANQA 4O7WA 4DLIA 3ALNA 4QQ5A 3MESA 3D7ZA 2YIQA 3KVWA 2G01A 3C1XA 5CAVA 3EN7A 3LCOA 1B6CB 1GNGA 4I20A 3FBVA 4YBJA 5AUUA 1XQZA 2W0JA 2OXXA 3PXYA 1OM1A 2ITOA 3E63A 4UALA 3U51A 3ID6C 3I60A 4JOAA 1KV2A 3O2MA 2VX1A 3MYGA 1DI9A 3FZRA 1QMZA 4DEDA 4F08A 4YJPA 2G15A 3CC6A 3Q9XA 4G3FA 2VNWA 4IWPA 4V0GB 4M66A 4F7NA 1ZOHA 5DGZA 4Z7HA 2AC3A 4KBCA 4OTHA 2OXYA 3LFSA 4X6QC 3RPYA 1HCKA 4GS6A 4PPAA 4GEOA 2HY81 4JX3A 4LGHA 4W8DA 3BGZA 2WMUA 3PIZA 1JSUA 4HCUA 4ACDA 5CNNA 2O63A 5DHJA 2ZDTA 1O6KA 3RZBA 4HVDA 1OIQA 4DFXE 1ZZLA 3IDPA 2ITNA 4O7LA 2VZ6A 4ASXA 3GNIB 3KMWA 4C4HA 3F9NA 3Q2MA 4IIRA 4O1PA 3R0TA 4U8ZA 3VUIA 4Z9LA 1ZLTA 4DG0E 3WE8A 2YM4A 1M2RA 3OT3A 4IFCA 4XCUA 4I0SA 3NAYA 4LQMA 4YLKA 3PFQA 3COMA 1JNKA 3CQEA 3QLGA 3SC1A 1H0VA 3R00A 2VGOA 1OIYA 2WQBA 4EYMA 3C4ZA 3C50A 4II5A 4EK8A 3HAVA 4O0RA 4JIKA 4D1SA 3FMDA 5HG8A 5DVRA 4F9BA 4K33A 2NO3A 1U5QA 3R8LA 5ANGA 1OVEA 3KEXA 4RIYB 3O7LB 5JGDA 4ONAA 4ANOA 4KNBA 1UU8A 5BVOA 4LOQA 4LRMA 1PXJA 1LUFA 3PG1A 4AOTA 5EOLA 4B8MA 3VS3A 2QCSA 4R3PA 2XKFA 3CE3A 5L6WL 4C4JA 4QP1A 4XMOA 2HWPA 4UZDA 1S9JA 5AFVA 3ZSHA 4W8EA 3KRXA 2R7BA 2HWOA 3W33A 2BUJA 3RBWA 3UOLA 4JRVA 3UNJA 3QU0A 4YR8A 4QMUA 3E8DA 3VULA 3A4OX 4D1XA 3KREA 3IW6A 3F3UA 2IVTA 4GUBA 4J99A 3T9TA 4YTFA 2BFXA 3KRRA 1KOAA 3QCQA 5HBEA 4BGHA 5HE3A 3DJ5A 5CASA 4AG8A 4R77A 4N6YA 5L4QA 2GDOA 4QMSA 5J79A 3MVLA 2PVHA 2BFYA 4O27B 1TQIA 3HNGA 4DEEA 3H9RA 5J9YA 4RX9A 3QUEA 4W9XA 4C4EA 5DH3A 4OT5A 3FJQE 3GU4A 3M2WA 3VRZA 3TIYA 3G5DA 2REIA 4D2WA 1H1PA 4USEA 3ROCA 5IH4A 4MKCA 4GH2A 2WTVA 3CEKA 3CJGA 2PHKA 2X7OA 2V7OA 2BKZA 2R3LA 2VU3A 1YXXA 3BYOA 2QO2A 4I6FA 2FO0A 3S2PA 4IAZA 4OBOA 2WPAA 1JQHA 5J9ZA 5ANJA 2YACA 4HPUE 1YI4A 4JIAA 1GZ8A 2RG5A 3DKOA 4LGGA 1GJOA 3TT0A 5EK7A 1JBPE 4JX7A 4AA0A 1YDRE 5AP3A 4KSPA 1A06A 3RPRA 4DCAA 3FKLA 3W2CA 2GNHA 3KMMA 4RQKA 3Q4UA 4FV5A 3O23A 3GVUA 3QUPA 4B9DA 4CFVA 4PMPA 4FIFA 4BI0A 3OXTA 2DQ7X 2XNNA 3NR9A 4E93A 2QOLA 3F7ZA 3NGAA 2ZMDA 3JYAA 4G17A 1CDKA 4U81A 4ANBA 1U5RA 2PZ5A 4FTUA 2W06A 5IA4A 4KIPA 3IQ7A 4N0SA 1KE7A 3WIKA 1OPKA 3BU3A 1OL5A 2ZJWA 4FSZA 3JR1A 3UIXA 3UQFA 4WRSA 3BYMA 1ZMWA 3P7BA 2UW8A 4BZDA 4Z16A 5K4JA 3IW4A 1R0EA 3QWKA 1W83A 1H24A 5HO7A 2GHGA 2ZV9A 3D7TB 4RWKA 3ZXTA 4GFGA 1VJYA 5JFWA 4I4FA 3SVVA 4RT7A 4OT6A 2VTAA 1VR2A 2ITVA 3GU5A 5E9EA 2I0EA 3IK3A 1NVSA 4PDOA 3SKCA 4BICA 3D5WA 4HCTA 4KSQA 3UIMA 3ZFYA 4FSTA 2IW6A 1ZOEA 3MFRA 5CEMA 2QVSE 4G6NA 4O86A 1W82A 4WA9A 5HICA 1ZARA 2RGPA 4F6UA 3HL7A 4PL5A 3VO3A 3KULB 4N4SA 5HE0A 4W4VA 3CTJA 3FZPA 3F7WA 3CJFA 3HP2A 5FDPA 5E8VA 5H8BA 2VO7A 5EYKA 3CTQA 4AT3A 1TQMA 5FTOA 5IF1A 4RIYA 4ENXA 1RE8A 2GQSA 2BHHA 3N4VA 3LXKA 2P4IA 1SM2A 2B1PA 2GNFA 2HY0A 4M7IA 2EU9A 3TZ9A 3O50A 2YIWA 4FV3A 3UOHA 2XKEA 3EQCA 4FIHA 4GK3A 4I6BA 4J96A 1YXVA 1OIUA 2X7GA 4JG7A 3QYWA 3BZ3A 3K3JA 2B0QA 2XK8A 5A9UA 2J50A 3T3UA 5AP6A 3AQVA 4EORA 3A4PA 4HYSA 3MJ1A 5KX8A 5I9YA 1SZMA 3II5A 5KZ0A 3BQCA 3PVBA 4RFYA 5C8KA 3C4FA 2VD5A 2WMQA 2Y0AA 2X7FA 4O81A 5IQAA 3UE4A 4BTJA 3A7JA 5CVFA 5AUXA 3VN9A 1UNGA 1LPUA 1R3CA 4KBKA 3VS5A 2VRXA 4FT0A 1OUKA 2HYYA 3ZZWA 3HRCA 5GZ9A 5KBQA 4O84A 4JBQA 2OBJA 3R7UA 4J98A 3O0GA 1P4OA 3FMNA 4DGGA 1UKIA 3CPCA 4ZTNA 1PY5A 3PZHA 4KA3A 3TKHA 3V8SA 3FSKA 2GFSA 3FDNA 3QA8A 5A4TA 5IDNA 5M56A 3DZOA 3BE9A 3KC3A 2XNMA 4BL1A 2Y7JA 1K9AA 2V5QA 3S00A 4FVRA 4GT3A 4HGSA 4TWOA 1IA9A 3LIJA 3B2WA 4QNAA 3RHKA 3R22A 4IZYA 3F2NA 3IW7A 3N4TA 4BDGA 3GCUA 1VZOA 3OG7A 4WNMA 3NUAA 5AP1A 4W4YA 4ZOGA 3MSSA 2IO6A 5C26A 4ZLYA 4GFOA 2UW0A 4AA5A 4Z55A 4J97A 3OVVA 3C0IA 3FQHA 3DZQA 4IE9A 4LUEA 4ANMA 4F0FA 2UZNA 1OBGA 3EN4A 3QYZA 2J0JA 5B0XA 3EL7A 5AV1A 5BPYA 3NIEA 4I0TA 5IA0A 3ODZX 2P2HA 4FTAA 4FK6A 3C4WA 4AN3A 3ZLYA 3SOCA 4AGWA 2P0CA 2OIQA 3AGLA 4QMLA 4IWQA 4BDJA 4O7RA 4IAIA 4QO9A 4IM2A 4S2ZA 3QA0A 1B39A 1CM8A 3IGGA 4NKSA 5CI6A 5HE2A 2OU7A 3EQFA 2GTMA 2E9OA 1CMKE 2H8HA 3OXIA 5CS6A 4ZXTA 1FMOE 3HRFA 4F0IA 3LFFA 3MTFA 4M97A 2J5FA 4RZWA 4FZ7A 4JQ8A 4J53A 2PVKA 1YDSE 4O0WA 4ZTHA 3UPXA 4QP3A 5CI7A 3UYSA 1UA2A 4PMSA 3NNUA 4DH8A 5CWZA 2A2AA 3IOKA 3BRBA 4HNIA 4AX8A 3ZDUA 2WMSA 4BZOA 3SRVB 3VHKA 3A61A 2QOCA 2RFSA 4FKIA 4MD9E 2O8YA 3WI6A 2EXMA 5K5NA 4FL2A 4RJ3A 3BHVA 4APCA 3DK6A 4U9AA 2XM9A 3GFEA 3HP5A 4GU6A 4EH8A 2WO6A 4FV9A 3QGWA 4R3RA 4E5WA 3ZS5A 3VBXA 4RSSA 4BTMA 5C8NA 1H25A 3ENMA 4FG9A 3VF9A 5KBRA 3PP0A 4CG8A 4XP0A 2PMLX 2PK9A 1J7UA 3TG1A 1Z9XA 4XEYA 3NEWA 1R39A 3U6IA 2E9UA 4CMUA 5HTBA 4QYFA 5LCJA 5D1JA 3FMJA 3D5UA 1PMNA 4MBJA 1U59A 5AUWA 4DGMA 3LQ8A 4F7LA 4IX5A 2XIYA 4E5AX 2ERZE 3P4KA 4JR3A 3DQWA 3PRFA 1WZYA 3OWPA 1J7IA 3PJ2A 1PMVA 1YWVA 3LJ2A 3VS2A 3O8TA 2IW9A 3NUPA 2ZV2A 3G0FA 4O0UA 5EHOA 3DQXA 4GMYA 5AM6A 4L67A 2GS2A 5FEDA 2BILB 1H1QA 1H1WA 4LOPA 1H4LA 2R2PA 3EL8A 3SLSA 3EFKA 3Q4ZA 3GCPA 3ULIA 5HD4A 5E8TA 2ERKA 4X21A 2PVLA 4GT4A 5GNKA 4ANSA 5IZFA 3MPMA 4D4RA 2XJ0A 2G9XA 2UZEA 5L8KA 2C5VA 1GZKA 1Q62A 2BIKB 3C4CA 2C6EA 5CNOA 2YA9A 3KFAA 3HV5A 3PY3A 4Y95A 3ROYA 4RA5A 4D4VA 3CR0A 1Z57A 5DN3A 2V62A 3M42A 3SGCA 3F6XA 4BDKA 3MA6A 5L2IA 3F3WA 3WILA 5BNJA 2W05A 2W1GA 1URCA 4O0YA 4ZMEA 4G34A 1OKVA 4L53A 4R5YA 4U44A 2ITUA 3VJOA 2YDJA 2W5HA 2CSNA 3QQUA 5TR6A 3PJ1A 3FZSA 3BI6A 4JDJA 4YPDA 5B2MA 2ITQA 3NYOA 3W10A 5BVEA 1OL1A 4XG8A 3BX5A 2FVDA 3F5UA 5DA3A 4O0TA 4JL9A 4E20A 4FV2A 5BUJA 2WMRA 2PSQA 4WKQA 3U54A 4BF2A 2WKMA 4BDIA 3D94A 4ZJIA 3O8PA 4JXFA 5AEPA 4EKLA 3TM0A 5CQWA 3VS0A 4YLJA 3UQGA 2Q83A 4DLJA 4A4XA 2ONLA 3T8OA 2QKWB 2C68A 5EQEA 1Q5KA 3HA6A 3V01A 1WCCA 4PTCA 3AT4A 3JS2A 3Q6WA 5HO6A 3W8QA 3R63A 1WAKA 4AGCA 4D1ZA 3ZO2A 2B53A 2VWWA 3V5JA 4ZMFA 4PDSA 3GXLA 3LXNA 1FVRA 4TXCA 3GC0A 1MP8A 4AFJA 2WD1A 2XCKA 4EBVA 4E6AA 3I0OA 3PIXA 3MVMA 2R3FA 1PMUA 3UIBA 4ZZOA 3UC3A 2BROA 1YWNA 4XG9A 3TNHA 3HV4A 3RAWA 5IMEA 4IVCA 4PMMA 4QMVA 2PZPA 3DGKA 4TKSA 3A7GA 2YCRA 3PA3A 4BN1A 2WQNA 5D41A 4DAWA 4U3YA 3ENHA 3VBYA 1H00A 2XK9A 3Q6UA 4FVQA 2VTLA 4QMZA 4FKJA 4QTDA 2OIDA 2FB8A 4HPTE 5HIEA 4ZZMA 3V6SA 3QQHA 3VUKA 3PE2A 4C4FA 4NJ3A 5F4NA 4MXCA 4RJ4A 4XG4A 5C8MA 5HVYA 4DEIA 2HZ4A 2DWBA 3QZGA 4BIDA 4WO5A 4CFFA 5HX8A 2W9FB 4XH6A 2B52A 3C5UA 1O6YA 2XJ2A 4FGRA 5M4IA 3SXSA 4DE4A 3MY5A 3AC4A 4YHJA 3KRWA 3SXFA 1NVQA 1YI6A 3EZRA 3VAPA 2PZRA 4I5CA 3D5VA 4K8AA 4UWCA 2V0DA 5AV0A 3LFEA 2I7QA 3L8SA 4O7NA 2BRNA 3DAJA 4RIWA 3FZOA 3VBTA 1WVYA 1FPUA 2QO7A 2XH5A 1IAJA 3GGFA 5FP5A 3OCBA 1WBVA 3VBVA 4J1RA 1SMHA 1SVEA 4MK0A 2R0UA 4QMQA 3LMHA 4KS7A 1NXKA 4D2RA 4F64A 2OH0E 2GQGA 5EG3A 2PPQA 4B4LA 5LWMA 2R5TA 2NNWB 4DFUA 1WBSA 4ZSJA 2GFCA 2UW3A 4G6LA 4E4XA 5IU2A 1JKKA 4CCUA 3V8TA 4Y83A 2J0MB 2QOBA 3I7CA 3ULZA 4FKUA 4IHPA 5ANEA 3UJGA 2X8DA 4CKIA 5AR7A 4D2TA 2GSFA 4IB3A 4L45A 3QD2B 2YM7A 3Q53A 2YEXA 1YKRA 3KULA 3MS9A 4O2ZA 4P7EA 2WGJA 4U5JA 5CT0A 4HVHA 1J3HA 2VTIA 4BC6A 5CSVA 2WEVA 2UZOA 4BR3A 3HDNA 4AS0A 4NYEA 2X9FA 5J7HA 2XYNA 3KGAA 4DH7A 4OLIA 3MFUA 3UBDA 5CF8A 1UV5A 2NPQA 3TNQB 5AIKA 4GYGA 2OG8A 2C3IB 4A06A 3Q9YA 3WARA 2UW9A 4UWYA 2YFXA 4ERKA 3OCGA 4U80A 5E4HA 3NX8A 3AC2A 3LFNA 4IC8A 3KMUA 4KKHA 1PRYA 3QQLA 2XMYA 5ETFA 4XV1A 3ZHPC 1ZWSA 3RAIA 1OMWA 5JZNA 4AAAA 4YZNA 2VWBA 2XNOA 3LJ0A 3FKNA 2W4OA 3RINA 4BDBA 4J52A 3W2PA 4I1ZA 4YURA 4TNDA 3DDPA 3BCEA 4F9WA 3ZXZA 5JN2A 1WBWA 5EM6A 3VWAA 5EKOA 5C4LA 3OWJA 3FLQA 2WMXA 4I94A 3NS9A 4D0WA 1HCLA 4GG5A 4IFGA 4CRLA 4O22A 2IPXA 5DIAA 5FEQA 4CZUA 1YQJA 4DHFA 4TYHA 3FAAA 4XHKB 1T45A 1ZAOA 3PPZA 4KRCA 2GHLA 3M1SA 4IW0A 5IA3A 2PMIA 1MQBA 4MWIA 2BCJA 1VYWA 2RFEA 2Q0BA 4CTBA 4FKWA 5CSXA 3BEAA 2CKOA 3NMUF 2YCFA 4CV9A 1UWHA 3QTQA 4ITHA 4B0GA 4RVMA 5ACKA 3QTXA 3RHXA 1OPJA 1URWA 1PXIA 3KY2A 4FG8A 4R7HA 3OHTA 2XK4A 3C7QA 2RL5A 5HIDA 5JGAA 3LFQA 5EI6A 3UIUA 4I6HA 3OW3A 4L6QA 1M2QA 1V0PA 2BZKB 2VTSA 4O38A 3VUDA 3D15A 3EKKA 4PX6A 5CEPA 3TXOA 2RFDA 5B2KA 3LLTA 4MVFA 4QOXA 3ACJA 3FI3A 3QCXA 1PXMA 2W5AA 4HGEA 4KKEA 4LV5A 4MX9A 2R3QA 4YP8A 1VEBA 5CT7A 3RMFA 3FUPA 1H8FA 4YZ9A 3EFJA 4UXLA 4D2SA 4PNIA 3C13A 5CALA 4F9AA 3ZLSA 1SYKA 2F57A 3BLRA 3TTJA 4QYHA 1DS5A 2F4JA 3QZHA 2C5XA 3PJ8A 4LFIA 2GHMA 5F1ZA 4XG7A 3UP7A 5AADA 3R8ZA 3UO5A 4EH9A 5JZJA 5L8LA 4L7FA 4IAKA 3HMIA 5LVPA 4TYGA
chains in the Genus database with same CATH superfamily
1YW2A 2QI8A 3HKOA 4LGDA 1DM2A 3LXPA 3EKNA 4ACCA 1GIHA 2QLUA 5CLPA 5IH6A 2NRUA 2VUWA 4Z7GA 3WBLA 3V6RA 4S33A 1Q8TA 2O5KA 3DBQA 2WMTA 3NW7A 2YM5A 4JQEA 4MF0A 4OTDA 5ANDA 2B55A 2EB3A 2R7IA 2W1DA 3MTLA 3PIYA 4JI9A 4LMUA 5A6OA 3UMWA 1OBDA 4TPTA 3C0HA 3FKOA 4IX6A 4MQ1A 3DAKA 3UPZA 4PL3A 3HV3A 2QC6A 3GQLA 5T68A 3UQCA 2QOHA 4ERWA 3IGOA 2WU7A 3RM6A 2H34A 3D14A 5AA8A 4O83A 4CGAA 4DTBA 3PRIA 2QG5A 3P7CA 4EL9A 3MPTA 3BGPA 3PVGA 4D5KA 3TUBA 2X39A 1OI9A 4XLVA 2OIBA 4TW9A 4LYNA 1OKYA 1FGIA 4XRJA 3FLZA 5HG5A 5IQIA 2C6MA 3QZFA 3DU8A 4FR4A 2A1AB 1OZ1A 4KIKB 4BRXA 3POOA 2CGUA 3NLBA 2HIWA 2CJMA 5BVKA 2JKQA 4RJ7A 3DK7A 1DAWA 5IA5A 5AP2A 1AQ1A 3R28A 5JMSA 3UNZA 2RKUA 1WFCA 4CZTA 4AXCA 3QBNA 5EOBA 4Q5HA 2OF4A 4YZDA 4QMMA 3DLSA 4JQ7A 3QAME 3DNEA 3TACA 4LUDA 4A9YA 3C51A 4BCFA 3AG9A 4EK5A 4EOOA 5K0XA 3RKBA 3TV6A 3V51A 3E88A 4CD0A 3LHJA 4DDIA 3R01A 4FIIA 4CFWA 2IZUA 1UKHA 3O96A 5BUIA 5CU0A 4EJ7A 4CZYB 3G2FA 2BTSA 1SNXA 3BGQA 5L2TA 3DA6A 3WF6A 1O6LA 3V5WA 3FSFA 3R9RA 3R9OA 2WQOA 5JK3A 2I0VA 4RJ8A 2OJ9A 3OROA 3CLYA 2AC5A 2ITZA 3FMLA 2FGIA 1XWSA 2ZV8A 3PXFA 4R6VA 3BYSA 2J0LA 3DY7A 2YIYA 4AUAA 4YBKA 3U55A 4AU8A 2BDFA 4G3GA 4FC0A 4UMUA 5J5SA 3WE4A 4BI2A 3C5IA 4L3LA 4C7TA 5D7AA 2HZ0A 2VWZA 3QQKA 2XANA 3AT2A 1JSVA 2HZNA 3T9IA 3Q2JA 4N57A 3DKCA 4ALWA 5C9CA 3AT3A 4BDAA 5HLWA 4EJNA 2PL0A 3Q04A 3ORPA 3EN6A 5J7BA 3U9NA 4O4EA 1MQ4A 5KNJA 5FQDC 1Y57A 5T3QA 2HENA 5CU2A 3SHEA 3P08A 5JQ5A 4X3FC 2FA2A 4YNOA 3F2AA 4QQCA 2F9GA 3PUPA 1VYZA 2JLDA 4FSUA 4PPCA 5IISA 1FOTA 2OO8X 2UVXA 2W1ZA 2ITWA 3NW6A 3OP5A 2VWUA 3OTVA 4BFMA 3R02A 4RX5A 4GKHA 3E8NA 3IPHA 4WG4A 4XOZA 4AW0A 4BCHA 3FMKA 5J9LA 2XB7A 4QQTA 5D7VA 4DHZA 4JRNA 4BDEA 2CN5A 4FOBA 4XX9A 2C3LA 4RX8A 3VJNA 4QPMA 4PDYA 2B7AA 4HYIA 1U54A 4RC2A 3UDBA 4I0RA 4APPA 1K2PA 2JDTA 3LQ5A 5KMNA 3GCQA 2VO6A 5DE2A 3BYVA 3CGFA 3BKBA 4YJRA 3ZCLA 2QNJA 4C4IA 4KRDA 1ZY5A 2XZSA 4O7YA 3FLWA 4P90A 4FIJA 1TQPA 4K9YA 5I3OA 1Y6AA 2VV9A 2QLQA 2UZVA 1KUTA 3DNDA 3D5XA 2VTRA 3KCKA 4AT4A 4F7SA 3W2RA 2XAMA 4ZSAA 1UVRA 2WTDA 3TZMA 5M4FA 3IG7A 4LV8A 2VTQA 3TJCA 3WZUA 2W5BA 4C37A 4EK4A 2OK1A 3RK9A 2C47A 4NW6A 3ZMMA 5M4CA 4GVAA 2PZYA 4AFEA 2X0QA 5ETCA 4ZK5A 1XH4A 3DBFA 4U6RA 2G1TA 3QX4A 3RJCA 2XF0A 3BQRA 3V5PA 3WZDA 4EBWA 5EQPA 2C1AA 2ITTA 1S9IA 4FSNA 5FTGA 5GJGA 1M17A 5FEEA 2C6OA 4TT7A 3QKKA 4FL3A 5H9BA 5LVLA 3RK7A 4PMTA 2YJSA 4FKTA 3MN3A 3GI3A 4IEBA 2BKKA 3VQHA 3FC1X 3EN5A 4NCTA 4V01A 4X2JA 2OICA 3GC8A 3QUDA 5I9UA 2R3IA 5M08A 3A62A 2CNUA 1KE9A 3ZUUA 1NA7A 4JBPA 3HMNA 4LMNA 3UMXA 2YISA 5C03A 3ZSIA 4BY9E 3ZH8A 2YM8A 3I6WA 3HMPA 3QXOA 5DPVA 2PE0A 3FMMA 5J1VA 3LQ3A 2OF2A 3AGMA 1ST4A 4IC7A 5HCXA 2WU6A 4MD7E 3QRJA 3U9CA 1FVTA 1BL6A 4DBNA 3UC4A 2OZAB 2XNPA 3BU6A 3MH1A 5T6KA 3UVQA 4XV3A 1NT2A 2XA4A 3QRTA 4F6WA 1P14A 2X81A 3FLNC 4WSYA 4G3CA 4O2PA 3S1HA 4FTJA 5F95A 1Y6BA 4O7TA 3B8RA 4FTRA 1UU3A 2H6DA 3KN5A 5EH0A 4I6LA 3LKMA 3MIYA 1K3AA 2R3HA 2XNEA 3PY1A 2E9NA 4M8TA 4J8NA 3FZTA 3OUNB 3TV7A 4CRSA 4O0VA 5KMJA 2JDOA 3R7EA 5FUTA 4D2PA 4AXFA 1R0PA 4QMOA 4TYHB 4LM5A 3BWJA 2CCIA 1XKKA 3RAHA 4CV8A 5IUGA 1KOBA 4DBXA 3MWUA 5FXRA 1ATPE 4NM5A 4QYGA 4FMQA 1WBOA 2QQ7A 3MIAA 4E7WA 5CXZA 5C4KA 1XBBA 2J4ZA 3E3PA 3QRIA 3FI2A 4NSTA 4BCNA 4EONA 2YABA 4FEXA 3UO4A 3LXLA 4B99A 1APME 1L3RE 4FV0A 4NJDA 4RA4A 5HVJA 3Q60A 1YXTA 2IVVA 3VF8A 4GL9A 4BYIA 5CEIA 4FIEA 3BLQA 4Y5QA 4BZNA 5I5ZA 2C0IA 3W32A 4WRGA 4XV2A 2CGWA 1PYEA 2BDJA 3O51A 5E7RA 3SA0A 2C69A 3ERKA 3RK5A 5L8JA 1YRPA 3W1FA 4EQUA 1F3MC 3VW8A 4AW5A 4DITA 1ZRZA 4AXAA 2Z7RA 5DFPA 3ZLXA 2WMAA 3UGCA 4ZZNA 4BKZA 4LG4A 3K5UA 3NUXA 4FV6A 4D5HA 2R3KA 1H07A 5AUVA 2UZDA 1YOLA 3K54A 4P5QA 3TCPA 5JFSA 5LWNA 4CCBA 1EH4A 3B8QA 3EFWA 4E6DA 1PXLA 3FQEA 5FTQA 1KSWA 4QTCA 2XALA 3R1QA 5AUYA 3RI1A 2X2MA 4EK6A 4USDA 5JH6A 3D2IA 4LL0A 5AMNA 2C6TA 3PYYA 4C36A 5J1WA 2ZM4A 3UZTA 3CTHA 3U6HA 3KCFA 4F6SA 3ATSA 4I21A 4BJJA 3QWJA 5FRIA 5A54A 4QTBA 4RRVA 5HHWA 1ZYDA 2BIYA 2CGVA 1XMLA 5LVMA 5DEYA 2VWYA 3ZONA 3NUYA 4C59A 2PULA 3IECA 4J7BA 5H8GA 3PP1A 4QP6A 5EYMA 4K77A 3RPOA 4I23A 3F5GA 3JY0A 3OT8A 1J1BA 2UZBA 3E3BX 5EM5A 3S0OA 4IZ7A 3PA5A 3L9LA 2C5YA 4HCVA 4I41A 5H8EA 4MBLA 5BQ0A 3ATTA 2YM3A 1BI8A 5IPJA 4DA5A 3SG8A 4CXAA 4C34A 1IA8A 4OBQA 5EHYA 3BEGA 3MB7A 4C2WA 2HK5A 4BCMA 4YZBA 3N9XA 3W55A 1PJKA 3A8WA 4OTRA 4IAYA 1OUYA 2YITA 2C6KA 2JEDA 1OGUA 4UXQA 3GEQA 5HI2A 2JAMA 1H0WA 2QOQA 4GV1A 4QNYA 3SAYA 3LFDA 2OGVA 3HDMA 3R2YA 4E26A 2PYWA 2XS0A 3HVCA 4TY1A 3KXNA 3NNXA 2FH9A 2RSVA 3IDCA 5EYCA 4XUFA 3POZA 4DFYA 4M0YA 2F7XE 2OJFE 3D7TA 3ZLWA 2W1HA 2VTHA 4WNOA 1ZMUA 3U4WA 5GZ8A 4U42A 3SW4A 3GU8A 4TZRA 4J8MA 1MUOA 1AD5A 3AMBA 3Q9WA 4D9TA 3BBTB 2Y4IC 4CFMA 1ZOGA 1WVXA 4IAAA 5AX9A 3PLAE 1FBNA 3BHUA 2ZFYA 2C0TA 3I5NA 2W1FA 3ORKA 4U3ZA 4ID7A 2BRMA 1H27A 3HA8A 4DC2A 3EWHA 3E93A 3FEGA 3CIKA 3P1AA 4V0GA 5E8YA 4NFNA 4IWOA 4G31A 2W17A 3OCTA 4MXAA 4I93A 4XJ0A 5DT3A 4AZSA 1YWRA 2XNBA 3KF7A 3R7GA 3BV3A 4JDKA 1NW1A 4BWXA 2W4KA 1XH8A 3ELJA 3FHRA 4C35A 4YJUA 2KULA 2PE1A 4O7VA 3CD8A 2P2IA 4DGOA 4AOJA 1P2AA 4ZTMA 2EXCX 4G3EA 4GRBA 3R1SA 5BYZA 3UO6A 2XRUA 3UVPA 5IQFA 5E8ZA 2XK6A 4JBOA 4ZJJA 5C27A 5CVGA 4F1TA 4OR5A 2XCHA 3LCTA 5EDRA 1OPLA 2W4JA 3DFCB 5EDQA 2UW5A 4K18A 4FT3A 2Y6MA 4EK3A 3E87A 3FLSA 2J0KA 1YXSA 3LPBA 3V5QA 3LAUA 5KKRB 3QC4A 3GFWA 4A9RA 2XNGA 3L8PA 3AC3A 1BX6A 4UMPA 5HE1A 4RC4A 4UYAA 3UG1A 4FTKA 4MTAA 4FNWA 4C02A 1H28A 4HVSA 2R9SA 3FL5A 4GSBA 1OKZA 4MXYA 3GC7A 4JT3A 1PW2A 2FUMA 1OB3A 2Z7SA 3P7AA 2JFMA 4QP8A 3RM7A 4DCEA 1LEZA 5E1SA 4ZY6A 1OKWA 3RALA 2BMCA 2GNJA 4ASEA 4EOPA 3FXXA 5IQBA 5AUZA 4EOIA 5HU3A 1STCE 5L3AA 3ZBFA 5BUEA 4RWLA 4F1OA 1BI7A 4YTCA 4FYOA 2OLCA 2WB8A 3CPBA 5F20A 4FEUA 1W0XC 2QO9A 2Y9QA 1NVRA 1E9HA 3HECA 1OECA 3AKJA 5CEOA 2R4BA 4FEQA 5HTIA 3REPA 1REKA 5CAQA 3CY3A 1IRKA 1RQQA 2JDSA 3ZOSA 4BGQA 5FD2A 4IAFA 4BCPA 2DS1A 4EQCA 3VBQA 4YU2A 5E8SA 2P33A 4AGDA 5A6NA 4DH1A 2WMVA 3SDJA 5AA9A 3ZRMA 2UW7A 4IMYA 2F2CB 3LCDA 4KBAA 4OTQA 3QTRA 1A9UA 2UZUE 5FBOA 2B9HA 4FTQA 2BVAA 4UMQA 3ZC5A 3ZM4A 1W98A 5BMMA 2I40A 2IN6A 1BYGA 3KRJA 4R3CA 4BBEA 4C2VA 4KD1A 4A7CA 5D11A 4KAOA 3R7YA 3ZUTA 4D55A 1MRUA 2CGXA 4YSJA 1M2PA 3COHA 5M51A 5LXMA 1Q8ZA 3IW8A 4FZDB 2CLQA 3PTGA 2BAJA 4DYMA 3FY0A 3QHRA 3MVHA 2WNTA 4QMPA 4U41A 3NRMA 2ZAZA 1YOMA 4O4FA 4B6LA 2PVJA 5DLSA 4H1MA 3THBA 4FTNA 3DB8A 4GW8A 4EH7A 3CD3A 4X2NA 4ASDA 4NM0A 5EKNA 4D9UA 1KE8A 4BDHA 3AKLA 5EW3A 4WSQA 3VQUA 1Q97A 3NWWA 5I4NA 4FEWA 2WTKB 2VO0A 4DTKA 1GY3A 5AX3A 3QX2A 4FKRA 4MEDA 5FG8A 4UY9A 4EC9A 4GYIA 4IX3A 4OTPA 3PJ3A 1IEPA 3IOPA 4NM3A 4JG8A 2WOTA 3F3TA 3LCSA 4IACA 1RDQE 2RFNA 4FJVA 3H9FA 4JLCA 4YMJA 4YO4A 4EOLA 3FPMA 3GOPA 5I9XA 2UVYA 2WMBA 4I22A 4PRJA 4PNKA 1W2DA 4AE9A 2XKDA 5LMKC 2C5OA 4MBIA 3UOKA 1JKSA 3A60A 2PMOX 4R5SA 4AZFA 4ZSLA 2V55A 2WTJA 4K11A 5DR9A 3VW6A 3CKXA 2ETMA 4HZRA 4KINA 3F2RA 4FGBA 4GG7A 3GCVA 5C01A 3R8UA 3PSDA 3CGOA 5CU4A 4NZWB 2FSTX 5GIPE 2EB2A 3KB7A 2HELA 3MH3A 2F49A 5CY3A 4D58A 3N51A 5CF6A 3ZM9A 1G3NA 2VNYA 3L9NA 4EH5A 4YC8A 4EZ3A 1ND4A 4CNHA 3WIGA 3NDMA 1CTPE 3KXGA 2BRHA 5KHWA 4FBXA 2JBPA 2W1IA 2XEYA 3GOKA 4BCKA 4KUJA 2W1EA 3HGKA 4RMZA 5LOHA 2OW3A 3ZO4A 4IZAA 4L46A 3R9HA 4RFZA 4TYJA 3I81A 3MFSA 4Y46A 4FUXA 2XYUA 5IKWA 4A07A 5IQEA 3DT1A 5E1EA 2GPHA 1YHSA 2A27A 3PWYA 5CXHA 4EHVA 2PUPA 4MF1A 2IZSA 4WG5A 5I9ZA 4O96A 5CANA 3ZRLA 3UDZA 4UMTA 3VUGA 3NUNA 4AP7A 3KQ7A 2B9JA 3G51A 1V0BA 5E91A 4E4MA 3DOGA 5IEVA 1Q24A 2PUNA 2PU8A 4TRLA 4BCGA 5DRDA 4F9CA 2IF8A 4R8QA 2XEZA 3T3VA 5JFVA 4ZAUA 1QL6A 2Z02A 5FM2A 3TWJA 5BMSA 2WHBA 3EMGA 3KXZA 3ZBXA 4PQNA 3QGYA 3OC1A 2E2BA 4FV4A 4ACMA 5AV2A 4C38A 4D4SA 3FE3A 2JGZA 4MCVA 3A8XA 4YHTA 4IWDA 3OY1A 4EH6A 3P23A 4KIQA 3UZRA 5M07A 3F5PA 3ZSGA 5D12A 4O7SA 3VBWA 5AJQA 3GQIA 1LEWA 4FZ6A 5HEZA 4P5ZA 5EM7A 2O2UA 2OI4X 4X0MA 4MD8E 1WVWA 4AQCA 3ZEPA 2Z7QA 4EQMA 2JIVA 4U45A 3CXWA 3W18A 3P5KA 3BE2A 1XH9A 4GKIA 5HG9A 4Q2AA 4MXOA 4XBUA 1Z5MA 3OF0A 4RVKA 4HGLA 3CP9A 5G6VA 3BL9A 2YWVA 3CSVA 3RPSA 3OFMA 4L8MA 2Y4PA 5HOAA 4AWIA 5IQGA 2XK3A 1B38A 4NU1A 3P5JC 5DNRA 2BTRA 1PXNA 1XH7A 2RG6A 2BZJA 2UVZA 3FI4A 3R8PA 3GCSA 1SNUA 5KCVA 3NUSA 4BI1A 3EQHA 4BCIA 5ANOA 3QXPA 4D4YA 4C3RA 3BELA 2I1MA 4C57A 4MYGA 3MFTA 3ML1A 5TKDA 2O64A 4I5HA 3R8VA 1V1KA 1FVVA 2IVSA 3DTCA 3EIDA 2R0IA 4YC3A 4RG0A 2XIZA 3TNWA 4EHGA 4PTGA 5GINE 3V8WA 4ARKA 4CMTA 3RCJA 4ZS4A 1ZYCA 2I0HA 3OEZA 3WYYA 4F0GA 3EOCA 4B7TA 3HV7A 2QG7A 3EZVA 4FVPA 2XIKA 4YGAA 4R1VA 3QRKA 2WIHA 4A4OA 4ALVA 2AQXA 1DI8A 1H1SA 4UN0C 3TNPC 4ENYA 4DINA 5A4CA 2V7AA 1W8CA 2XVDA 2OFUA 2YN8A 3LW0A 3R8MA 2ZMCA 5BVNA 3CQUA 4XNEA 5B7VA 5HVKA 4PTEA 2OH4A 4RZVA 2JBOA 3UNKA 1RW8A 2QKRA 1PXKA 4HGTA 4R78A 3AMYA 3GU7A 4UWBA 3KXMA 2Q0NA 3TNIA 5M4UA 2HOGA 5M09A 5ICPA 4KWPA 4M15A 5K9IA 3W0OA 3OUKA 4YPSA 2X4FA 4CFUA 4YZMA 3GB2A 2OJGA 2VN9A 2ZDUA 1UWJA 4M3QA 5A14A 1ZXEA 4CTCA 4XS2A 1I09A 2YM6A 2Y6OA 1OIRA 3R2BA 1MRVA 2GU8A 3NYNA 2XUUA 2X8EA 3MBLA 3PSBA 2CMWA 3PXRA 3PZEA 2BDWA 4HYUA 4H3BA 4WBOA 1PXOA 2X1NA 3QD4A 3QFVA 4XRLA 5FDXA 3SOAA 5I0BA 2AYPA 3PDTA 5AWMA 1WBTA 4BHNA 4CLJA 4QMYA 2Z2WA 3DJ7A 3I5ZA 2HW6A 4NL0A 4QPAA 3MVJA 4WBBB 5JEBA 2EXEA 3GUBA 1G8SA 3MGYA 3OBGA 5M55A 1M7NA 4C8BA 4CQGA 5AM7A 1FQ1B 5IQHA 4WOVA 3UZPA 2W99B 4D28A 1YOJA 3OMVA 4PWNA 2YDIA 4GIHA 3ETAA 4QP4A 1CKJA 1FINA 4XG2A 4CSVA 2YLEA 5KMIA 1UNLA 2YIXA 4J71A 1IASA 2WEIA 4JR7A 5M53A 3UVRA 5L2SA 3RWPA 3JPVA 3MY1A 4NKAA 5AV3A 3HUCA 1P4FA 5HGIA 3W0MA 4MNFA 4AACA 1QCFA 2QR7A 4HOKA 5HNIX 2OFVA 1KV1A 4A9SA 4DEHA 3L8XA 4HJOA 4ZJVA 3H10A 4N6ZA 2UUEA 4QMWA 3A7FA 5E92A 3WZKA 4BTFA 5L6PA 3SV0A 3IKAA 3OOMA 3P79A 3V3VA 2QU5A 3KF4A 1KE5A 1NY3A 2ZV7A 3R71A 3V5LA 3SG9A 4J95A 2JIUA 3R7OA 4FYNA 2PVFA 2BRBA 3SX9A 2YIRA 2UV2A 3KXHA 4C62A 4BGGA 4AOIA 1LR4A 1IG1A 3QTSA 4JG6A 3CQWA 4UX9A 2CHLA 5ITAA 4MWHA 3VONA 2VO3A 2VWIA 1U4DA 2XBAA 4NT4A 4G5JA 4JS8A 4XLIA 3TKIA 3EH9A 3GT8A 1L8TA 3PXKA 3OEFX 3L1SA 1JKLA 2ZB0A 3A2CA 3A7HA 4YJSA 4DFNA 3L8VA 3NAXA 2OKRA 4QT1A 3WF8A 2XKCA 3EFLA 4U43A 5IQDA 2J5EA 3Q96A 4U40A 3DS6A 4ZSEA 1HOWA 4FKPA 3PVWA 3W0RA 4MH7A 5CX9A 4YTHA 2W7XA 1TKIA 4YO6A 2J9MA 2JFLA 4DHJA 5CZHA 1F5QA 3RTPA 1TFFA 4ZTRA 3H3CA 1T46A 3U8WA 3OWLA 3FHIA 3TUCA 3F69A 3ZZEA 3DBCA 3FV8A 3A7IA 1JOWB 2JD5A 2ZOQA 4FSMA 4I3ZA 2PVYA 4IANA 3DKFA 2PY3A 1J91A 4DFLA 5CEKA 1J7LA 2CPKE 3IDBA 3VUMA 3LFAA 4GIIA 4HW7A 3G15A 2X8IA 3AC1A 5E8XA 4ZEGA 4ITIA 3NFFB 3G33A 2X2LA 4L43A 4E4NA 2XBJA 3AC8A 1RJBA 5FXSA 4FZAB 5CTPA 4CFXA 4EEVA 4CYIA 4EOKA 5A4QA 5AIRA 1YI3A 2PE2A 5CF5A 3QTWA 3ZC6A 3E7OA 3OBJA 4RVLA 4FK3A 3G90X 2BAKA 5CVHA 4ZTLA 5L2WA 1SVGA 3OS3A 3PE1A 1G8AA 4JAIA 4AT5A 4H3QA 4M69A 4BHZA 3CCNA 3S95A 1OL2A 3EHAA 4YJQA 4BKYA 3EQIA 1KWPA 5A4LA 3TZ7A 4BCQA 5FBNC 2SRCA 4KKGA 3NCGA 4I92A 1YHWA 2C4GA 5HKMA 3OCSA 4BCJA 2VTJA 3O71A 2JKKA 4GK2A 4KIKA 4FE2A 2YZAA 5DG5A 3BHTA 3ORMA 4CVAA 3QQFA 3B2TA 4FT7A 4HYHA 2XIRA 3TDVA 3RNIA 4M0ZA 5DR2A 5AR4A 5AR3A 4EC8A 1Y8YA 3U87A 4FTIA 2JC6A 5IA1A 2OZOA 2R3GA 5AR5A 4F1MA 1JAMA 4Y72A 5D10A 4F7JA 4I24A 5TF9A 5HORA 4TWPA 5LMAA 3E5AA 4O82A 2G2HA 3QZIA 4O0XA 3UYTA 5EDPA 2XK7A 3FXWA 4YJVA 4YJTA 5IEXA 2WTKC 4GT5A 5KUPA 2ACXA 4RFMA 1H01A 4QD6A 3MW1A 3Q4CA 2F7ZE 3SD0A 3VUTA 5BX0A 4IBMA 3NYXA 3FQSA 5ACBC 2GCDA 3QCYA 5TE0A 3I0QA 1PXPA 3NZ0A 2H96A 4OW8A 3R30A 4G3DA 3EJ1A 1BL7A 4FKGA 4L68A 2UZWE 2QOIA 5EYDA 2H9VA 2W96B 4WD5A 4C0TA 5C1QB 3LMIA 1ZYSA 4HVIA 2AUHA 2P55A 5E8UA 2I6LA 5TOZA 4L3PA 3SRVA 4ZP5A 4QDVA 4NIFA 3EYGA 4FV1A 1Q8YA 4WUAA 4X6RA 1BMKA 3DB6A 3Q5ZA 4G9RA 4ZY4A 4FTOA 4L42A 4FTMA 3QF9A 1Q4LA 1Q8UA 2PWLA 4M14A 4MXXA 2CLXA 4V05A 5D9HA 4ZLOA 3W0NA 2ITPA 2QOFA 5BVFA 4GCJA 2VTMA 2ZVAA 4E4LA 5EI2A 2A98A 2VGPA 4AF3A 2JKMA 3ZFXA 5HD7A 2IZRA 1GIJA 4DN5A 4OTFA 1Q41A 3QHWA 3G9NA 4H1JA 4JBVA 4Y8DA 3WZJA 2ESMA 2QHNA 5HESA 3G6HA 4WG3A 5FM3A 2PVMA 3OXZA 2VTNA 4B8LA 4UMRA 3DCVA 3ZYAA 2O0UA 3HV6A 5HTCA 4FSWA 4BBFA 3RAKA 5I9WA 1PMEA 3ORZA 2G2FA 3I6UA 4X3FB 5HBHA 5AAFA 3JXWA 4FKLA 5TT7A 3BBWA 4D0XA 4E5BA 1REJA 4IZ5A 5FWKK 4AW1A 4EOJA 4FF8A 3NNWA 4UV0A 5K5XA 1ZYLA 1X8BA 4FV8A 3QD0A 4L00A 4ZY5A 3DDQA 4GJ3A 3RPVA 4K1BA 5M57A 2ZB1A 3LM0A 4G1WA 2WAJA 3BWFA 4AZVA 3FLYA 4PY1A 2A19B 4U79A 2GTNA 4CEGA 3HRBA 2CNQA 2BZIB 4MQ2A 1FMKA 2WFYA 3A99A 2R3OA 3RCDA 5IQCA 1UU7A 3NPCA 2GMXA 2PVNA 4TYIA 2W9ZB 2XM8A 5DI1A 3E92A 1JSTA 4RQVA 4TTHB 4TYEA 4QMNA 5J8IA 1JKTA 2QOOA 3I1AA 3KL8A 5M44A 1XH6A 4QTEA 3W0QA 4OBPA 4ANLA 4TL0A 3MY0A 3C4EA 3Q4TA 3FC2A 4JNWA 1Y8GA 4M67A 5A3XA 4FX3A 3TI1A 3C9WA 4DEGA 3VNTA 3P9JA 5CSWA 3PLSA 3FY2A 3DLZA 2B4SB 1JLUE 4BWPA 3EQBA 1XJDA 4FKOA 2E9VA 2CNVA 3K5VA 1V0OA 3TN8A 4AZWA 2WELA 2IWIA 4FV7A 5KMLA 4F09A 2QR8A 2V22A 5GJDA 4ACHA 1XH5A 3FYKX 5EHLA 3E8CA 2CCHA 5BYLA 5FP6A 4NIFB 1ERKA 2JAVA 4NTTA 3K3IA 4NCTC 4Y85A 1BUHA 4OAVB 4K2RA 1BLXA 2JITA 4FI1A 5JT2A 4YC6A 4DG2E 4GU9A 3BYUA 3P78A 2VWXA 4M69B 5ANKA 4EKKA 4EZ7A 4QRCA 5GHVA 2KTYA 3TIZA 4AW2A 4F4PA 4BYJA 3ACKA 5CEQA 5H2UA 4EWQA 3NUUA 3KXXA 5JGBA 4DFBA 3TL8A 4F63A 2VTPA 2NRYA 2EVAA 5BYYA 1XO2B 3H0ZA 5DT4A 3HMOA 4FNXA 5M06A 5IUIA 4C58A 5EQYA 2IVUA 3DBEA 4RJ5A 3OOGA 2C30A 2QONA 2X6EA 3Q32A 4NEUA 3AD4A 3KN6A 4RGJA 4W4WA 3FI8A 2C0OA 4AZEA 4L7SA 2O3PA 3LOKA 4KB8A 4LRJA 4QQJA 4DT8A 1QPJA 1I44A 5JSMA 1ZMVA 4BWKA 3WYXA 5KMOA 2ETKA 3IO7A 3H30A 4FTLA 2XIXA 2GNIA 3H0YA 2BZHB 4X7QA 2VTOA 4AXDA 4L44A 4BIEA 4W4XA 1OITA 2X4ZA 3PVUA 4XBRA 3E62A 1ZY4A 4QYEA 4Q9ZA 3PJCA 5ETIA 3F66A 4MNEB 4TWCA 5LMKA 4AN9A 3AC5A 5IA2A 3RWQA 3DXPA 4H58A 1FGKA 2HCKA 3VHEA 5H3QA 2P3GX 3LFCA 3RNYA 3ZDIA 3QKLA 4XYFA 5AAEA 2G2IA 3MJ2A 4PDPA 2VTTA 3LFBA 4G5PA 2NP8A 3U6JA 3F88A 4IDVA 3NCZA 2LAVA 5IEYA 4IJPA 3LM5A 2J6MA 3GU6A 3ORXA 3BPRA 4DGLC 3EQGA 4IVAA 1GOLA 3WZEA 1XBCA 3PG3A 5HBJA 3ODYX 4NK9A 2BALA 3QL8A 4EI4A 4E6QA 4EOQA 4YTIA 1M14A 1GIIA 5AR2A 4QMTA 1JVPP 2WTIA 4IADA 5CZIA 4F65A 5IDPA 3CS9A 2R64A 4Y5HA 3ZU7A 4V04A 5LQFA 2VX0A 5AP0A 2RF9A 3ZTXA 3ORNA 4DH3A 3W2OA 4FTCA 5HNGA 3R73A 3TUDA 4WUNA 5HZNA 4AQKA