4F0FA

Crystal structure of the roco4 kinase domain bound to appcp from d. discoideum
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
276
structure length
276
Chain Sequence
RLPTLADNEIEYEKQIGKGGFGLVHKGRLVKDKSVVAIKSLILGDSEGETEMIEKFQEFQREVFIMSNLNHPNIVKLYGLMHNPPRMVMEFVPCGDLYHRLLDKAHPIKWSVKLRLMLDIALGIEYMQNQNPPIVHRDLRSPNIFLQSLDENAPVCAKVADFGLSQQSVHSVSGLLGNFQWMAPETIGAEEESYTEKADTYSFAMILYTILTGEGPFDEYSYGKIKFINMIREEGLRPTIPEDCPPRLRNVIELCWSGDPKKRPHFSYIVKELSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase roco4
publication title Roco kinase structures give insights into the mechanism of Parkinson disease-related leucine-rich-repeat kinase 2 mutations.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase, signaling protein
total genus 80
structure length 276
sequence length 276
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4f0fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4f0fA01
3ZFYA 5C4KA 1H25A 3COKA 4BHNA 3UNZA 3KGAA 4QMXA 4F08A 3FLYA 2C5YA 3AC1A 3SQQA 5GZAA 1GZNA 2W5AA 3UIXA 3NPCA 2F4JA 1JKTA 4NT4A 3KXGA 2VWBA 5C8MA 3QZHA 2WEIA 4QP8A 2OGVA 4FV9A 4KIQA 2V0DA 4RFYA 4IVDA 3SV0A 3PVBA 5HTIA 2IW6A 3UIMA 4EL9A 3TCPA 2BKKA 3V5WA 4YJVA 3CJFA 1PKDA 3NW7A 3CY3A 3R1NA 2GNGA 2UZTA 3W2RA 3N4TA 3ZDUA 4YTFA 4RJ7A 2CKOA 5IQCA 4J7BA 4L43A 2R3OA 2YWPA 4R7IA 5IU2A 4FKLA 1J7UA 3BE2A 1M2PA 4R8QA 4MQ2A 2VTSA 5CT7A 1ATPE 1F3MC 3JVSA 4HW7A 4TYJA 4IB0A 2ZM3A 2W96B 2WOTA 4J98A 4X2NA 1YRPA 3M2WA 4YJOA 3DXPA 5CLPA 2BFYA 3QTXA 3IGGA 3CJGA 4LMUA 3VJNA 4A07A 3QTSA 4J8MA 2R0UA 4R78A 4K18A 2Y0AA 3F6XA 3VULA 4FL3A 4F6SA 2ITNA 5HLPA 5CXZA 5IZFA 2WHBA 2P0CA 2C1AA 2WTDA 2XM9A 3OF0A 2CKPA 1OITA 5KMMA 3OMVA 4FTTA 4O22A 4Q2AA 3VBVA 3DCVA 4PF4A 4KSPA 2B52A 3DKFA 1KE5A 5CSXA 5FDXA 4C4GA 3JY0A 4IBMA 3G90X 5I3RA 4FIJA 4YR8A 3FMMA 2EB3A 3DLZA 2BTSA 4WKQA 4EK5A 1KE7A 5M08A 5H8BA 1GZOA 3VQHA 1Q61A 5BUEA 3MA3A 3UTOA 1Q8TA 2QD9A 3GCVA 4KIPA 4C2VA 3FMEA 4NM3A 4ENXA 3VHKA 5K9IA 4AQCA 2BRGA 4KIKA 5L3AA 5KBRA 4I6FA 3PZHA 4FT3A 4KWPA 2C68A 5DR9A 1ZY5A 3REPA 4GSBA 3F3TA 4CQGA 3K54A 5LMKC 2QOCA 3TUCA 2YM3A 4Y85A 1U54A 2RG6A 4AN2A 1OKYA 2B0QA 2Y7JA 3QZGA 4FC0A 5AX3A 2V7OA 2UZBA 3AD6A 3NGAA 4D1ZA 3L1SA 5EDQA 2ACXA 3UNJA 3F5PA 3JVRA 5FG8A 4YURA 4IZAA 3ZLXA 4I22A 4U80A 1LUFA 4FR4A 2J0KA 2PPQA 1G8AA 5GIPE 2JC6A 4G3GA 5EHYA 4TT7A 3RI1A 4RWJA 4DGNA 1GZ8A 1I44A 4XBRA 3PXQA 2GS6A 3PZEA 1YXSA 4FEQA 5HE3A 3BEGA 1JAMA 1OBDA 2WNTA 4JG6A 2W9ZB 2C6LA 4FNWA 3PG3A 3F69A 4J8NA 3KMWA 2WQOA 2W1EA 3PUPA 3Q5IA 3ZFXA 4UYNA 1WZYA 5IA4A 5EI8A 1KE9A 3I6UA 2GDOA 4U45A 1WFCA 3DB6A 2OZOA 2W17A 4DF3A 3KREA 2IVTA 4A4LA 3TI1A 2R3KA 5GZ9A 5AUUA 4YLLA 2QU6A 4X2FA 3EMGA 3DBCA 3P9JA 2YERA 4WOVA 2J0LA 5CS6A 5EFQA 1WBVA 2X6EA 4HPUE 5CALA 2VN9A 2WTJA 3FI8A 1G3NA 3H10A 3IW7A 4IH8A 3SG8A 2CDZA 4KAOA 5IEYA 1AQ1A 3ZM9A 3KRXA 5T6KA 3R0TA 4F6WA 3MY0A 2YN8A 2RFDA 3R8MA 4DG2E 5AUZA 1TQIA 4RBLA 3KXXA 3TNQB 2PZYA 4F65A 1QPDA 3F82A 3G15A 4DC2A 3KVWA 2F7XE 3GCPA 2HAKA 3FMNA 5JH6A 3ACJA 4ZMFA 2UW7A 4FL2A 4G9RA 3BHTA 2PUPA 4XOZA 2F2CB 2WTKB 3ZYAA 3HRFA 4FG9A 3DXNA 4YP8A 3Q4CA 3HAVA 4BDJA 1NY3A 3ETAA 5A4QA 4CTCA 5AUYA 4IW0A 3ATTA 5L4QA 4EQMA 3ELJA 4ALWA 2R3HA 4JBVA 3CQWA 3U9NA 5HBJA 5CASA 5E4HA 4D2WA 4EOSA 2JLDA 3BQCA 3KC3A 2PZIA 1YOLA 5AJQA 1DS5A 3RWPA 3TTJA 1URCA 1MQBA 3ZUTA 2XKCA 4IEBA 4XG3A 2QURA 4DBNA 2YJSA 3QKKA 3R1YA 4FL1A 2J0MB 3PWYA 4XG2A 2Y6OA 4ZTLA 1X8BA 3NAYA 3CD3A 3FBVA 5HCYA 3NW5A 3PVUA 5BX0A 4GV1A 3EKNA 2QOQA 1V0OA 4KKEA 4XS2A 2G15A 3LFNA 3O17A 2CKQA 4L7FA 1Z57A 4S32A 4FV3A 5DG5A 3AT2A 5D7VA 2GQRA 5CXHA 1O6YA 4G9CA 1TQPA 1W84A 4TNDA 5AP4A 4ZLOA 3R7GA 4UMPA 5AP7A 3ZHPC 4XV9A 1ZZ2A 1PMNA 5KO1A 4QNAA 4N6YA 3F3WA 3R9DA 3IS5A 4W9XA 1Q8UA 4ZP5A 5EOBA 5E9EA 4R1VA 1UNGA 3VUIA 3TNWA 2V62A 2C5NA 3BLHA 3E8NA 4G17A 4UZHA 1Q8YA 3F3ZA 4G6NA 5T68A 4A06A 3TZ8A 4JAJA 4RMZA 3ORTA 1YOMA 2Y4IB 1IRKA 5CZIA 3V5PA 4CT1A 3AT4A 4DFZE 5AADA 4RIXB 3CPCA 4FV4A 3UYTA 4U6RA 4K2RA 1H27A 4ZY6A 3Q52A 2WXVA 4R77A 4TRLA 5J87A 3SDJA 3FLNC 3PPZA 5L6PA 3PY3A 2FSTX 4EOPA 2QC6A 3EOCA 3VQUA 5C4LA 4L3JA 3EZVA 1SNUA 3W2OA 5KNJA 4H1MA 3D7TB 4WNOA 2BILB 2C0TA 1S9JA 3HMNA 4QPSA 3C0IA 2UVYA 1W98A 3P7BA 1H01A 2FSOX 5DI1A 3MB6A 1QPJA 4F9YA 2ZYBA 4GG5A 4EH4A 1OMWA 3MIYA 3BQRA 3VW6A 3MIAA 4QTAA 2PL0A 4WUAA 2CNVA 4APPA 5JT2A 2VZ6A 5E8VA 5JEBA 3HV6A 1ZARA 3C4XA 3CTJA 3BV2A 3UE4A 3DJ5A 4EOJA 2BRBA 3U6IA 3FZPA 3FQHA 3PIXA 4JX3A 4M84A 5DYJA 3MFSA 3G6HA 3WYYA 3RALA 4FTUA 3UBDA 3QQKA 5CANA 3C4FA 4YNOA 5I9YA 4O82A 5JFXA 4Q9ZA 2YCRA 4ASZA 3QZIA 3OOGA 3FPMA 3FXWA 1UKHA 4BDIA 4F7JA 4CKRA 4O86A 4H36A 4JX7A 4I3ZA 3O23A 1ZMWA 3ZSHA 5KMIA 3QD3A 3HYHA 3VBQA 4FK3A 4DN5A 5LCKA 4IAYA 4WT6A 2UUEA 2VTNA 3GFWA 3EFKA 2Z8CA 3NCZA 4DG3E 4UWCA 2R3IA 2Z7QA 3LXNA 3DS6A 3A60A 2OZAA 3SXSA 4YJNA 3R28A 3S95A 1A48A 4PX6A 4FKTA 5J7HA 4UMTA 4ERKA 1FBNA 3NNWA 3S3IA 4FOCA 3KXZA 3QTZA 4HGTA 1OL7A 4GIHA 3C7QA 1FMKA 1IAJA 3E93A 2PTKA 5TT7A 5CEKA 2HW7A 3UPXA 2RL5A 3SA0A 3HKOA 4FF8A 5H3QA 4G16A 4F7LA 3G6GA 5D1JA 5AV1A 3NUSA 4YZDA 2R3MA 2R2PA 4BCJA 4BTFA 5I9ZA 4HYIA 3D9VA 4GT4A 2XIKA 4FSQA 4D2RA 3W16A 2UVXA 3OXTA 1OIYA 5KCVA 2YM7A 2BAQA 3QCSA 1P5EA 1Y57A 3UOJA 2JAMA 3UZRA 3BI6A 1DI8A 3CR0A 2Y6MA 4LGDA 3PXZA 4UALA 3TXOA 5L2WA 3Q96A 2UZVA 1DI9A 4XX9A 2P3GX 4L42A 1JSTA 2UZOA 1O6LA 2W1ZA 3THBA 3LOKA 4H3PA 4G3CA 4BIDA 4BHZA 4NM7A 2JITA 4DITA 1OL2A 2Q0BA 3LQ5A 4PNIA 3MY5A 3NCGA 3HRBA 3TT0A 5L8JA 2XKDA 5CVFA 3AC2A 1ZXEA 2XUUA 2E9OA 4EK8A 4CVAA 1OKZA 2A27A 2GTNA 4XUFA 5D10A 5HNBA 5CAVA 3SAYA 1BUHA 4RRVA 5L2SA 4NJ3A 3TJDA 2XYUA 4IADA 4WNPA 4C4JA 4DAWA 2B53A 2EU9A 4B7TA 2ZAZA 5CWZA 2XYNA 4AGWA 5HD4A 4RA5A 4O7LA 1Q3WA 2G01A 2CJMA 4F9BA 1CKIA 1PY5A 3NAXA 3R21A 4BCOA 4JJRA 3GEQA 3NYNA 2GS2A 5FM3A 5JRQA 2C6MA 2P2IA 5JMSA 3NZ0A 4QMPA 2BTRA 4PP9A 3OY3A 4UWBA 5AV4A 4PL4A 4CFWA 2XNNA 4WIHA 4CMTA 3BKBA 2XIXA 2ONLC 5DA3A 3NUXA 1OVEA 3FMDA 3QF9A 4FTCA 3VS5A 4DCEA 1ZOEA 3IOPA 4K33A 4GRBA 4IAZA 4FNZA 2QNJA 3ORKA 3ZBXA 3NVMB 3RZFA 5ICPA 2CLXA 3W18A 3DAJA 3ZC6A 1YDSE 4PUZA 1XH8A 4BI0A 4B0GA 5JQ8A 2IZSA 4IWDA 4BDAA 4Z9LA 4XG4A 4RIWA 1PXMA 3AC4A 4E5WA 3FV8A 3TTIA 4YHJA 3WZUA 4OR5A 3KB7A 3P08A 3F3UA 3FYJX 4O96A 4AOJA 4C2WA 4CMOA 1J1CA 5CQWA 4XG6A 2YLFA 3ZUVA 5K0XA 4RVMA 4RJ8A 3R7UA 1WCCA 3H0ZA 3FY2A 1YXVA 2C0OA 3EN6A 4PL3A 4MNEA 3UOKA 4AX8A 4DH8A 5KBQA 3EQPA 1FINA 2GQSA 2UW9A 3AG9A 4IJ9A 2X4FA 5AR2A 2JBPA 2WU7A 4H58A 3U6HA 5IUHA 3CBLA 5A4TA 1FVVA 5HORA 1FQ1B 2X9FA 3ZO4A 1JWHA 2UV2A 3LM5A 4QP1A 2W4JA 4JDJA 2Z7LA 4D2TA 3DDQA 2R64A 2PE2A 3LE6A 2GFCA 2WMVA 2NO3A 1Y8YA 2YIWA 2JDVA 3IW5A 3JPVA 2JFMA 5CSVA 3IECA 1GIHA 3DLSA 1PXJA 2YACA 2OSCA 1M7QA 2CGUA 2F7EE 3MVJA 4TKSA 2PVRA 3TKUA 3FL5A 4C7TA 2I7QA 3QRUA 3AMYA 5IKWA 5TR6A 1U59A 1YHVA 4E6QA 3PVGA 2OH0E 4AACA 3GOPA 3JR1A 1OGUA 5ANIA 1JBPE 1H28A 4I24A 4BCNA 3NR9A 3UVRA 3H30A 5JGAA 2QHMA 5EW8A 2QG5A 2I0VA 2F49A 3ZFMA 2LGCA 3CTHA 2GCDA 2PVFA 5CVHA 4J71A 2X7OA 3QWJA 2XJ1A 4G5PA 1YQJA 3PE1A 4N0SA 4CKIA 4F9CA 5L8LA 2UVZA 2C3KA 3M1SA 3QXOA 3KU2A 3DTWA 4IX4A 1H0VA 3PDTA 4Z3VA 4GVJA 2XCKA 3E64A 3Q32A 3OEZA 4BDKA 3VS7A 3NWWA 2V22A 4IXPA 5C8KA 2C47A 3O96A 4XV2A 4CRSA 4D4RA 2UW8A 2JIVA 3W2CA 1XH4A 2VGOA 3RPRA 4EH7A 4DT9A 4S34A 5DR2A 2G9XA 1CDKA 5ETAA 5A14A 2BZIB 3AQVA 3CXWA 4DBXA 1PMUA 3GGFA 2R5TA 4U44A 2SRCA 3BHYA 3NUNA 4I5CA 3IQ7A 3HMMA 2XH5A 4Z7HA 5IQHA 3LVPA 4NCTC 4RIYB 4FTIA 4FSWA 2VTHA 2Q0NA 3QQGA 3OTUA 1ZRZA 2UW3A 5A4CA 2WMSA 1YVJA 3DQXA 4IDTA 3OWJA 2XK3A 1F5QA 1WAKA 3MFUA 3DQWA 3HDMA 1U46A 2XBJA 2EB2A 3UIUA 4L00A 2E9VA 3PJCA 4NFNA 1UU9A 5J5SA 3I60A 3R8ZA 2PVJA 5L2TA 5K5XA 3B8QA 3Q6UA 4OTFA 4YLJA 3GOKA 4BCKA 2QKWB 3NSZA 4KS7A 4U40A 4EUTA 3L9MA 3QUEA 2P2HA 2YAKA 4DT8A 4NWMA 3NX8A 4S31A 5IA0A 4Q5EA 4BYIA 4QP3A 4F09A 1UU3A 4HVGA 3NLBA 4C8BA 3KCFA 5E8YA 5FXSA 2V7AA 5E1SA 1BL6A 2B54A 2WKMA 3COHA 5DN3A 4ZSGA 5IUIA 4ANSA 5CU2A 3QCYA 2C69A 4QO9A 3EYGA 2A19B 3LMIA 2OF2A 3DK7A 3QL8A 5IH4A 3O8UA 2YM8A 4MXXA 5H8GA 5JQ5A 2EWAA 3MWUA 3Q04A 2EUFB 3SHEA 2FSMX 1QCFA 2G2HA 2W9FB 4FI1A 4QPAA 4RQKA 4Y73A 5EM8A 5HNGA 2BFXA 4ONAA 4E4MA 4K9YA 4N57A 4L45A 3RK5A 4HOKA 4IE9A 4QP6A 4X2KA 3VWAA 3FMKA 3LFAA 3QX2A 2P4IA 3FLSA 3S0OA 3KEXA 3KK9A 2QLQA 3R2BA 4XHKB 5C1QB 5FEDA 4ACMA 1OI9A 1XJDA 4C4IA 3EQFA 5FP6A 2C3LA 4IC7A 4AW5A 3UMXA 4I4EA 4FVRA 3TIZA 1SVEA 3ZXTA 4HPTE 4U42A 3TL8A 3PE2A 3AOXA 4D2PA 4ACDA 1E9HA 4AGUA 4BDHA 3FYKX 3QRJA 3I4BA 5DVRA 4AFEA 4LOOA 3RNYA 5LCJA 2O2UA 2I40A 4HNIA 4QQTA 2XRWA 5EOLA 2C6IA 5DE2A 3PPKA 2O65A 1VR2A 3LFFA 4EH3A 4F0IA 2WOUA 5HBEA 4D28A 1Q62A 2E2BA 4GK4A 3SRVA 4M69B 2PVKA 4E6CA 3NNUA 2CSNA 5J1VA 5IMEA 2Y9QA 2CNQA 4FT0A 1M14A 3QYWA 1XKKA 1PXIA 2ITQA 4DHFA 3NMUF 1XBCA 3P79A 5FGKA 4ZY4A 3F7WA 4IFCA 5BMSA 1OL1A 3UQGA 3PY1A 3A4PA 2HYYA 3FHRA 3LCDA 5CF6A 1F0QA 4HZRA 2QG7A 2ZMDA 5E1EA 3EYHA 3ZEPA 4IDVA 4AUAA 3B8RA 2BDWA 4G6OA 2CN8A 3K3JA 2R7BA 4MQ1A 4EC8A 5ETIA 1RE8A 4F0GA 4YZNA 5CEPA 4CLIA 1Q24A 5EW3A 5AR8A 4E5BA 2O5KA 4QYYA 3O8TA 4WBOA 2WTWA 2RIOA 1PMVA 4MWHA 4W8DA 5LVLA 2C6KA 5AUXA 4DEGA 4O0UA 4ZSEA 2UW0A 1Q5KA 3GQIA 3MFRA 3PIZA 5EW9A 1XH5A 3RZBA 5D11A 5BYYA 5EHLA 2PUIA 4OTDA 4EH8A 4IHPA 2W1DA 5HVYA 4PDOA 3GXLA 3FJQE 4W9WA 5HG8A 4Y83A 1LPUA 2IVVA 4R1YA 3VRZA 4AT4A 5DT4A 4TW9A 3I0OA 4D55A 2IZUA 3A7HA 2EXEA 4ZSAA 3KXMA 4KD1A 3Q4TA 3BGZA 4K8AA 1QL6A 3RHKA 4LOQA 5J9LA 2VX1A 4OTRA 5EM6A 2QCSA 3DU8A 4NH1A 3ROYA 2CMWA 4O1PA 4P5QA 4GKIA 5CYIA 1APME 4M14A 3RP9A 4FSNA 4R3PA 4FK6A 2YABA 5C26A 5I5ZA 4RSSA 4NTSA 2OO8X 2LAVA 4EOOA 4GFOA 5HQ0A 3SLSA 3R2YA 1ZY4A 2DWBA 4D2SA 3BPRA 2X2LA 4A9TA 3TDWA 3QCXA 3D5UA 4QMNA 1P2AA 4WNMA 4FV0A 2XKEA 5CU0A 2W4KA 2HZ0A 1P14A 5D7AA 2PULA 1SNXA 4O84A 3GC8A 4HCUA 4P2KA 1H08A 2XNGA 2YIYA 3OWPA 2BKZA 4FV6A 4XP2A 4ANQA 3PP1A 2X0GA 3QFVA 2XP2A 3D2KA 4C37A 5DH3A 3TUBA 5IQEA 1YDRE 4DINA 4GUEA 5JSMA 3PVWA 3Q3BA 4LMNA 5HVKA 2QHNA 4AZEA 4EJNA 4IJPA 1V0BA 2XNOA 2QOLA 3A61A 2YIQA 3WF9A 4FICA 3BYOA 3Q9XA 3R83A 3RTPA 4EZ7A 5AA8A 5GIOE 3AXWA 5M4UA 1H1RA 4XNEA 2I0EA 5CAQA 4P7EA 3LZBA 4UV0A 1ZLTA 1S9IA 3F7ZA 4FNXA 4BWXA 2VU3A 4EOLA 4YU2A 4O0WA 5FBOA 3I7BA 4L8MA 2W5HA 3BGPA 4BWKA 4ACCA 3MN3A 4X3FB 2X2MA 2H6DA 3HMPA 3VBYA 3AC3A 1NVQA 4CZTA 4O21A 4ZTRA 2C6TA 3D14A 2J5EA 5ANGA 1J91A 2ZMCA 3JUHA 3K3IA 2F57A 2QOKA 3PA3A 3POZA 3QKLA 4GJ2A 1FPUA 4IC8A 4BCQA 3WF5A 4C3PA 4DFUA 2QOFA 4HCVA 1ZYLA 2VX0A 3C13A 4JT3A 3OC1A 2PUUA 2OXYA 4QP2A 4QMUA 4GK2A 3KULB 5F94A 3TUDA 4X0MA 5EDPA 4UXLA 4BCGA 4X21A 3N9XA 1H0WA 5ACBC 3WI6A 4BBEA 2A0CX 4JOAA 3UOLA 2BALA 4CD0A 4HVSA 4USEA 4DEAA 4RIOA 4RPVA 3ORMA 5DPVA 3R7YA 2CGVA 1B6CB 1BI7A 2PZRA 3QGYA 4JIAA 3QA8A 4YZBA 5IPJA 3F2AA 4EOMA 2OFUA 4JDIA 5AR5A 3HMIA 5F4NA 3FPQA 3I7CA 1M2RA 4I21A 5G1XA 4TYIA 2NRUA 4S33A 1ZYJA 5LVOA 4FZDB 4O7ZA 2GU8A 3DNEA 5H8EA 3SOCA 3U55A 3GI3A 4M67A 2JEDA 2WB8A 3PJ8A 3LQ3A 1STCE 4CYIA 4E5AX 3JYAA 3L8PA 4L53A 4TWOA 5HO7A 2E9UA 4C59A 4C58A 2WMQA 3KRLA 5ITAA 3HRCA 1PMEA 4QMZA 5IH5A 3GQLA 2WIPA 5J8IA 4YTCA 3DAKA 1ZWSA 3P1AA 4GT5A 3BYSA 4Y5QA 3AD4A 2KULA 3HA6A 2J90A 3QQUA 4CXAA 3GU7A 4QT1A 4M15A 5IQBA 3NRMA 5AUVA 5CENA 3RAHA 2QO9A 4O0TA 4GFMA 3FSFA 3FQEA 1UKIA 2RFEA 4LUEA 5DWRA 5HKMA 3FDNA 2ESMA 4AZFA 1LR4A 3VC4A 1W7HA 3OY1A 4RIXA 2OU7A 1PJKA 3LAUA 4ZZOA 3O71A 4ZJJA 3UMWA 2WTVA 4IX5A 4DH1A 4ITIA 3UQCA 1U5QA 4C3RA 2UZNA 2J4ZA 4A4XA 4UWYA 3UG2A 2J0IA 3EB0A 3IKAA 3ODYX 4MH7A 3QRTA 4FGRA 4BZNA 4KNBA 4ANMA 2ITYA 5FTGA 3R8UA 2Z7RA 3E7OA 3LFQA 3D7TA 4QP7A 3IDPA 4RLKA 3QQHA 2FGIA 3DV3A 4JAIA 3L8VA 4FMQA 4FV7A 5C03A 3ORIA 2J0JA 4XV1A 2BCJA 2QU5A 5BVEA 3U6JA 2PVNA 4F7SA 4TWPA 3G0EA 3C5UA 4FUXA 2BZKB 3LIJA 3MH2A 4LRMA 4XBUA 4AG8A 2WQNA 4OTWA 3V5JA 5L6OA 5HICA 1J7LA 1W0XC 3ALNA 2IO6A 2C4GA 2ZV8A 2VO7A 4YBJA 5LVPA 4I5HA 2ZV2A 4ZLZA 2FB8A 2XJ2A 3VF9A 4FSYA 3IK3A 4F0FA 4BGQA 4NUSA 1MRUA 4RA4A 5AV3A 5E91A 3F61A 3IPHA 4AP7A 3ODZX 4FSZA 1SVHA 1YDTE 3ZM4A 2GFSA 2OJGA 3QZFA 5IEXA 3KQ7A 3NIEA 5I9WA 3O2MA 5ANEA 1ZYSA 2HOGA 2XEZA 1REJA 2DUVA 4M12A 4RT7A 4IB3A 2Z2WA 4FV5A 5M07A 1BKXA 3F88A 3SG9A 1U54B 2QR8A 4YSMA 5ANDA 2C1BA 4DLJA 2O8YA 3FQSA 4AZTA 2UZUE 1CMKE 5CSWA 4AF3A 4CG8A 2X6DA 3FMHA 3RHXA 3F2NA 1UNHA 4FIGA 4PMSA 4FKVA 4NKSA 1Q3DA 2XB7A 3DBQA 4FTQA 2YDKA 3ZCLA 4F64A 2O64A 1BL7A 5FDPA 4BBMA 5AX9A 5EM5A 3DBEA 4AWIA 1KV2A 2VTRA 1UVRA 3VO3A 1WBPA 4FKUA 2CKEA 1YI4A 5L8KA 3JXWA 3U4UA 2WEVA 3QQJA 1GJOA 4F1MA 2HWPA 1AD5A 4V0GB 3M42A 4G1WA 3MH1A 4JVGA 4U5JA 1QMZA 2XEYA 3VUMA 4EBWA 4JQ8A 5A6NA 2J51A 3R7OA 5JZNA 1FVTA 3MB7A 2XIYA 4FTNA 5E8TA 5KMNA 4I0TA 4PV0A 4XP3A 4A9RA 5I9VA 5M4FA 3TG1A 1PYXA 5AP6A 3DKOA 3BWFA 4EONA 5CEQA 4PMMA 4XG9A 3OG7A 3Q9YA 3WZKA 3MJ2A 1W83A 2H34A 5H2UA 4EBVA 4YZ9A 2ETMA 2YITA 3DK3A 3CGFA 4O83A 4YHFA 2KTYA 4E4XA 4IANA 4OBOA 3TACA 5ETCA 4LV8A 4HYUA 4HZSA 3R9OA 5CQUA 3O50A 2IVSA 1IA9A 1ERKA 2YHVA 2W1GA 2VWVA 1MP8A 4ORKA 3SXRA 4MF1A 4O7TA 2YIXA 4A4OA 3BHHA 3TIYA 2JD5A 5C01A 4J97A 4P4CA 3QXPA 2I1MA 2VNYA 3R22A 4CCBA 1VZOA 5IA2A 1TKIA 3UOHA 4BIBA 3H9FA 4YC8A 4FA2A 2XMYA 2B4SB 2X7GA 2VTMA 3EN7A 5BQ0A 3QRIA 2FA2A 5CF8A 5F95A 5KKRB 2FVDA 2E9NA 4U97A 4PWNA 3KN6A 2DQ7X 1WMKA 2ZB0A 1PW2A 2C6OA 3LQ8A 5BVFA 4YC3A 2OG8A 3PFQA 4HCTA 3QLGA 5CAPA 5JK3A 3LHJA 4BTMA 4ITJA 1SM2A 3ULZA 2NPQA 2W06A 3FMJA 3LXLA 4FODA 4ITHA 2IW8A 1RJBA 1Y6BA 2ZJWA 4FTKA 5DT0A 5DT3A 5HIDA 4IM3A 3ZO2A 3FI4A 1LP4A 3KMUA 3C4WA 2GPHA 4FKJA 3QD2B 2P55A 4BC6A 1OBGA 4DE4A 3KMMA 4ARKA 4AT5A 4EK4A 4F6UA 3R63A 4GU9A 3VIDA 1YHSA 4YJQA 3FHIA 4JRVA 3HAMA 4M68A 3VNTA 4ZTSA 2OH4A 4A9SA 5IQFA 3BU3A 3OP5A 4I5PA 4NW6A 5TF9A 4BTJA 4QTDA 5JKGA 4WHZA 3BELA 4MXAA 2W99B 3Q4UA 1OUYA 4HGSA 3VS6A 4DFYA 5LVMA 5EQPA 2IW9A 3RK9A 4DTAA 1NVSA 3V5TA 4TYEA 5CT0A 4NK9A 4D4SA 3FKNA 3VUTA 3TEIA 4D1XA 5AEPA 3PLAE 5FBNC 3RCDA 5KHWA 4QYFA 2CGWA 4KBKA 1A9UA 3K5UA 1QPEA 4LRKA 2GSFA 3MA6A 2B55A 2WMXA 4RFZA 1J7IA 4FTOA 4ANBA 4I0RA 3T3VA 3ID6C 3LFSA 4UMQA 2RG5A 4PMPA 1KOBA 1Q8ZA 3SX9A 4FIFA 5IA5A 1KOAA 4L7SA 2A4LA 3FZRA 4Y46A 4HYSA 2PUNA 2WQEA 4BN1A 4ZJIA 2YM6A 1YW2A 4O38A 2JBOA 3E8DA 4LM5A 4GH2A 2VO6A 3CS9A 3RCJA 4PTEA 3V8SA 5HE2A 5GJDA 2VRXA 1R78A 4EKLA 1A06A 4EWQA 3B2TA 2GHGA 2A1AB 4FV8A 3EN9A 4FVPA 4G31A 2ZDTA 3R9RA 4YHTA 2R0IA 1UV5A 4LYNA 3QX4A 3E62A 4YTIA 4E8AA 4FKGA 3N4VA 2PYWA 3KCKA 3HVCA 1WVWA 2OIBA 2AC5A 3KRWA 3MH3A 5EYMA 3TKHA 4E4NA 2BVAA 2IJMA 1UWJA 5E8ZA 2YIRA 3EWHA 4K11A 4YGAA 5JZJA 2P33A 4MXYA 3RBWA 3C0GA 5BUJA 3EFLA 4KIOA 4OGRA 4EZ3A 2AUHA 3W10A 3WF7A 3H3CA 4IB5A 4AGDA 5FM2A 5K4IA 1IAHA 4R7BA 3H9RA 2OIQA 5CNNA 4PNKA 4ZZMA 3V04A 1NXKA 3VS4A 5HNIX 1R3CA 4ZTMA 4DEIA 1HOWA 4FG8A 4FSMA 4I23A 4AA4A 5GJGA 3R71A 3WOWA 3LFBA 4F70A 3RM6A 4BICA 4D0WA 4USDA 1BI8A 4O91A 3GT8A 2B9IA 3IOKA 4CFFA 1YXUA 5EQEA 4H3QA 3QHRA 3RAIA 2OXDA 2CPKE 3EQHA 1ZZLA 4FKIA 3SXFA 3TV4A 4BCPA 1LEZA 5FTOA 4PPBA 5HG7A 2H9VA 4FYNA 5IA1A 3DTCA 2H96A 4WA9A 5DLSA 4RIYA 3QA0A 3PPJA 2WPAA 3G33A 4BY9E 2ERZE 3CCNA 4F9AA 5LMAA 1JOWB 3CTQA 4J52A 4YPDA 4U3ZA 3PXYA 4GS6A 3QALE 3MPAA 1NA7A 4I0SA 4ZSLA 2WAJA 3GU8A 4BDDA 2W4OA 3HUCA 5EHOA 4II5A 3E63A 3NNXA 1EH4A 4AW1A 4B6LA 1KE6A 2GNJA 5K5NA 5B2MA 4CMUA 1IA8A 2Q83A 3KKVA 4ANLA 1H1QA 2OXXA 2XNPA 3DK6A 3A8XA 4F99A 3WARA 4D4YA 3HV4A 2WMAA 1Y8GA 3FLWA 1H24A 2JIIA 2W1CA 1OZ1A 2VO0A 4O0RA 3PXRA 3TZMA 2IZRA 2C3IB 5JGBA 4IVBA 4GU6A 1UA2A 3KF7A 1TQMA 3FUPA 4U3YA 1DAYA 1IASA 2YA9A 3FZOA 4KBAA 4PTGA 5DRDA 3LFCA 4KINA 2X7FA 4UXQA 3LW0A 2CHLA 1HCLA 3G9NA 3IDCA 2BIKB 4YJTA 2GNFA 5CSHA 5GZ8A 3BX5A 4PDYA 1T45A 2J50A 3NEWA 3ZLWA 4BZOA 5A9UA 1KV1A 4C62A 4CV9A 3BU5A 1O9UA 4JQ7A 4M66A 2ZV9A 4BDEA 4D9TA 1NT2A 2YM5A 5JFVA 3OFMA 4LL5A 4CZUA 4BZDA 4NJDA 4FKSA 4JG8A 2GNIA 5JRSA 1FVRA 4J99A 4I5MA 5DBXA 3BYUA 2XIZA 3COMA 4EH9A 2JDRA 3EZRA 3BCEA 4TYHB 4IIRA 3WYXA 3MVHA 2PVHA 4LRJA 3F3VA 4RX9A 4YLKA 4D58A 1Q99A 2YEXA 4ZSJA 3LXKA 3MBLA 3EQCA 3P86A 4OBPA 4G3EA 5DEWA 3O7LB 3FSKA 1G5SA 3QTWA 3EN5A 3A7GA 3VW8A 2PMIA 2YCSA 2XRUA 4EOQA 4OUCA 2VD5A 3GBZA 4L3LA 4HJOA 3SW7A 2NNWB 4YNEA 3HP2A 3R02A 4V01A 3LCTA 2W05A 1M2QA 4IAIA 4AS0A 3ZEWA 2WZJA 1J1BA 3PJ3A 4CT2A 2IZTA 3MTLA 3HZTA 2ITUA 3D5XA 5AR4A 4EI4A 4M97A 1KWPA 4CFUA 3LMHA 4M69A 3HNGA 3OBJA 1ZOHA 3BHUA 2VTOA 4P90A 5DR6A 4MHAA 3W2PA 1Q41A 4QMLA 2WFYA 5HCZA 3OZ6A 4ERWA 2YAAA 2GQGA 4ZAUA 4KUJA 3OW3A 3UO4A 1H8FA 3BEAA 4TXCA 2R4BA 3WZEA 3UO5A 4MD8E 5K0KA 3ZOSA 1L8TA 3E3PA 2B9JA 3T8OA 3DOGA 3E92A 3GC9A 2IPXA 4KA3A 3DJ6A 2CN5A 5B7VA 4Y5HA 4LQMA 3BYMA 4G3FA 3KXHA 1XQZA 3QUPA 3R7EA 4AGCA 4E3CA 4DH5A 1URWA 1XH6A 3R7VA 4YJUA 3MFTA 4D2VA 3ZH8A 5B2KA 5KMJA 4JBOA 3PLSA 3Q9ZA 4FT5A 3PWDA 4XH6A 5HESA 3NYOA 2JGZA 3LJ0A 4FBXA 2HXQA 2QONA 3DB8A 1OECA 4JS8A 2B1PA 4NIFB 4WG4A 2C6EA 4L52A 3W8QA 2R3PA 4DH7A 5AA9A 3FLQA 3D4QA 4ID7A 3ALOA 3ZZEA 3UPZA 5CF5A 2R3QA 4RX8A 5ANOA 1RW8A 3NW6A 3DJ7A 4H1JA 3EFJA 3Q53A 2CLQA 5GHVA 4C34A 4Z7GA 5EKNA 4OW8A 2IVUA 1DAWA 3HA8A 3DFAA 4BCIA 4JR3A 2HELA 4AT3A 2R3RA 3DA6A 1SZMA 3P5KA 3DNDA 4KS8A 5FXQA 2C30A 2WELA 1GOLA 3TM0A 1YXTA 4FIHA 2XNEA 4XG7A 3UG1A 2J2IB 4B8LA 2AC3A 4FTLA 3EIDA 5A4EA 2BDFA 2IWIA 4JQEA 2WTKC 3AMAA 4OT6A 5FEEA 3V01A 3BWJA 3CGOA 1ZMVA 4PRJA 3ZSGA 2W1FA 5HOAA 4MF0A 4NZWB 1GIIA 1PXLA 3QTRA 4ZTQA 5J9YA 1FGKA 4AZWA 1B38A 1R0PA 2HY0A 3BBWA 4UMRA 4AXAA 2OLCA 5AUTA 4QMSA 3ERKA 4K77A 3ZS5A 3R8PA 2XZSA 4KKHA 4CFMA 4O7YA 5AV2A 2OJIA 3BLRA 3NYXA 5M09A 2W5BA 4QD6A 2C3JA 3C51A 2OKRA 4CCUA 5HCXA 3C4ZA 3O7LD 5FTQA 3SOAA 5I9UA 1PKGA 5HG9A 1KSWA 2XK9A 1H1PA 4RWKA 3RMFA 4BYJA 2PZ5A 3ZUUA 2F7ZE 1K9AA 4W8EA 3PXKA 4QQCA 4WRSA 3E3BX 4LGGA 5IISA 3TV7A 2JKQA 4O2ZA 2YZLA 4FSUA 5IMXA 3OT3A 2Z60A 5LWMA 1K2PA 5AP2A 2OJFE 4UB7A 1TVOA 2Y4IC 3MGYA 5D12A 2R3NA 2E9PA 3E8EA 3LCOA 3D5WA 3O0GA 3OVVA 4L67A 2QODA 2JDOA 5ANKA 3G0FA 3VRYA 3WZJA 4EEVA 2HY81 4JRNA 4GYIA 4IZ5A 4R5YA 3UZPA 1RQQA 4X3FA 1IG1A 2FO0A 2OWBA 3OS3A 3OXZA 5CY3A 5EM7A 5HBHA 4DEBA 3ACKA 3BBTB 4FUYA 5E92A 3PYYA 3ZBFA 4AU8A 4TL0A 3QTQA 4UEUA 4XJ0A 1UU7A 5HZNA 2CCHA 3AC8A 4YO6A 5I0BA 3N4UA 1JVPP 1OIRA 3ZC5A 2RSVA 3MSSA 4RJ4A 5TE0A 4NU1A 1P4FA 4MYGA 4EH6A 4IAFA 3UODA 5LOHA 1V0PA 3DBDA 3TN8A 3CLYA 3DKGA 3V5LA 3ZRLA 3MPTA 3KULA 3V3VA 4PP7A 1OB3A 4BDGA 2PY3A 2RFSA 2W1HA 2XNBA 5HGIA 3ORXA 4L46A 3E5AA 3V5QA 4A9UA 4I6QA 2JKKA 4WNKA 3E87A 5DIAA 1P4OA 2HCKA 2O63A 3Q2MA 3AGMA 3VS2A 4N4SA 5KE0A 4A9YA 4AOIA 4BKJA 1O6KA 3FWQA 5IG1A 2A2AA 1OUKA 2RFNA 4JI9A 3DZQA 5BMMA 4ZJVA 3QD4A 5J95A 3EQIA 4D0XA 4DFXE 2PU8A 1YI3A 3QQFA 4ANNA 5HE1A 4DEHA 2Y4PA 5HX8A 3D15A 3QCQA 2WTIA 1V1KA 5E8XA 1JNKA 2J7TA 3PP0A 2YLEA 3ZONA 4BF2A 3PSCA 2V5QA 3F66A 4XRJA 3P0MA 5LARA 5L6WL 4RLLA 4EHZA 5J9ZA 1OPKA 5DRBA 1Z5MA 3ANQA 2UZEA 2XNMA 4NM0A 3RPVA 4IQ6A 4O7VA 4FNYA 4LOPA 3R7IA 5BYZA 5M55A 4TZRA 1XH7A 4QP4A 3UQFA 4I20A 5FWKK 4HNFA 3AC5A 4XV3A 3DXQA 5F1ZA 3MESA 3VJOA 4FKQA 2J5FA 1PF8A 3QU0A 4ENYA 2O3PA 4CZYB 2B9FA 3U87A 3LM0A 3EL7A 5CTPA 3ULIA 1XWSA 2F2UA 4OTIA 4XLVA 2ZM1A 5DOSA 3ZZWA 5AAFA 4Y72A 4L3PA 3S1HA 3EJ1A 2VTTA 2BMCA 2FUMA 3VF8A 2VWUA 3K2LA 4E4LA 5M57A 2EXMA 2QLUA 3I0QA 2UZWE 2XK4A 4X2GA 5TOZA 4NYEA 3UIBA 2PWLA 4AFJA 1FGIA 1YHWA 3ORZA 4DGGA 4BTKA 4U0IA 5AV0A 4DTKA 3FEGA 4IAKA 3QUDA 3TNHA 2V55A 1LEWA 3IONA 5KHXA 3VHEA 2DS1A 3S00A 5EDRA 5AFVA 3HEGA 2YCQA 4YJPA 4YTHA 2R3GA 2R9SA 4FTMA 4YMJA 4ZY5A 3OTVA 2QI8A 4WD5A 3UO6A 5CI7A 3FLZA 5T3QA 3BLQA 2XJ0A 4UY9A 3MS9A 2QOOA 5BUIA 4AW0A 3I81A 3KN5A 2VTJA 1GY3A 3FY0A 2WQMA 5BNJA 4KBCA 2BUJA 4YZCA 3NUUA 4BB4A 4BCHA 3C4CA 5HLWA 5CVGA 1U4DA 3DY7A 3L8SA 2FH9A 4WO5A 1PYEA 4IX3A 5CI6A 5E7RA 4BGGA 5HI2A 4E6DA 2BRHA 3OHTA 3FZTA 4USFA 4JG7A 3ZRKA 4M13A 4C4HA 2ZVAA 3MJ1A 4DFNA 1ZYDA 3PRIA 4QTEA 3LCKA 3PSDA 5AP1A 3G9LX 3UVPA 3W55A 2XM8A 2JFLA 4EOIA 2HK5A 4H3BA 4OT5A 2I0YA 1OM1A 2VTPA 3C0HA 4R3RA 4CLJA 1CM8A 5AIKA 1R39A 5HHWA 5HVJA 3R8LA 4DFLA 5IQGA 4I6BA 1QPCA 2AYPA 5AAEA 3R73A 1L3RE 4GVAA 3ZO3A 1WBSA 3V6SA 3LJ2A 3L9PA 4WUNA 3GU6A 3TNIA 4EORA 4YO4A 4H39A 5TO8A 3AT3A 4M7IA 3ROCA 3D83A 2OICA 3NYVA 3TWJA 3UYSA 2RF9A 3VS0A 1B39A 5HTBA 2BPMA 4BGHA 4J1RA 4BL1A 4IAAA 3C9WA 4EQUA 2WMWA 5EYCA 1J3HA 3RPSA 4OAUC 4U7ZA 4RVKA 4CEGA 2DYLA 3A7FA 4C4EA 4JIKA 4QMQA 3F9NA 2J6MA 4M3QA 3I5NA 1YXXA 2PK9A 4FT7A 4DEEA 5HD7A 5ACKA 4CV8A 3MI9A 4EZ5A 4UYAA 4R3CA 5D41A 3DKCA 5BVOA 5AMNA 3EKKA 5IA3A 2GHMA 4BKYA 4NKAA 5EK7A 3KA0A 3POOA 5HIBA 3R9NA 2FSLX 1VJYA 3V51A 3BHVA 4DFBA 3FKLA 3QKMA 4E26A 4D5HA 3LMGA 4FKPA 3U8WA 1JSUA 4EYJA 4D5KA 4C4FA 2BZHB 3KXNA 1WVXA 4V0GA 2XIRA 3A4OX 3SD0A 2ITPA 4LUDA 4DTBA 5J79A 3DFCB 2ETKA 2Y8OA 3KL8A 5AM6A 3IGOA 3C4EA 3EN4A 3LFDA 4PDPA 4EKKA 3FE3A 3P78A 4EHGA 5IH6A 5M51A 1OL5A 5TKDA 4PPAA 1SMHA 4GYGA 4X6QC 5M44A 5E8WA 2HXLA 2BROA 4I6HA 5FLFA 5KZ0A 3UGCA 3PTGA 4BFMA 4ZS0A 5CSPA 3NNVA 3O51A 3D7ZA 2HZ4A 4QYHA 5AP0A 1BX6A 3FC1X 2VWYA 4X3JA 5GNKA 1HCKA 5J5TA 3W2QA 2IG7A 4C0TA 3H9OA 5HTCA 1YKRA 1Q8WA 4Z55A 1CKPA 4RC2A 5A54A 4WSYA 2OF4A 2WMBA 4PTCA 4CGAA 4ZMEA 4GEOA 2PZPA 2JIUA 2ZDUA 4F1OA 3GP0A 4QOXA 2ITWA 3BGQA 3Q6WA 4O27B 5BVDA 3LXPA 4GMYA 4WBBB 4TYGA 4RQVA 4EJ7A 5GINE 4EYMA 1SVGA 2X4ZA 4RWIA 3OCSA 1VYWA 3L9NA 4KIKB 4TY1A 1E1VA 4U8ZA 5KMOA 2W0JA 4F7NA 4O6EA 4AA5A 3FMLA 1WVYA 2XS0A 2ZV7A 3KFAA 3QYZA 4JNWA 4YJRA 3S2PA 3BU6A 2PMLX 3Q9WA 3U9CA 4C57A 3AMBA 2ITXA 2OI4X 4HGLA 4CRLA 4RZVA 3RINA 4I93A 3NUPA 4ZTHA 2VTQA 4Q9SA 2GNLA 1KUTA 1E1XA 1M7NA 3HX4A 4X2JA 4BRXA 4IFGA 2PVYA 3HV5A 3LCSA 4IB1A 4TPTA 4E6AA 4ZS4A 3U54A 3F2RA 4BDBA 1OKWA 3I5ZA 4L6QA 3VUKA 4IMYA 3NVKI 3E7VA 3BV3A 5FP5A 3ORLA 4UZDA 2OJ9A 2XA4A 3DGKA 3R04A 3DDPA 4LFIA 2BDJA 4QMOA 3MW1A 4QYEA 4WG5A 5K3YA 2VV9A 3QGWA 4OTQA 3WBLA 1M17A 5IQDA 1JLUE 2BHHA 3ORNA 4UN0C 5BPYA 4FKOA 4F4PA 4JLCA 4ZOGA 1SYKA 4XG8A 1JKLA 1KE8A 4QRCA 3LLAA 4JDKA 1AGWA 2QOBA 1GNGA 1VYZA 1R0EA 1JKKA 2G2IA 2GTMA 4RVLA 5CU6A 3V6RA 3W32A 3C1XA 3QWKA 2BZJA 3A7IA 3VN9A 1MQ4A 3BIZA 3GU5A 4PPCA 3IW4A 5CU4A 5F9EA 5HU3A 1PRYA 1WBNA 3AD5A 3NIZA 4GL9A 3QTUA 4RG0A 5CX9A 1ZYCA 3LJ1A 3QQLA 4K1BA 4OTPA 2XVDA 5HO8A 5IEVA 5JFSA 2CNUA 2OJJA 1Q4LA 1UWHA 1ZMUA 3B2WA 4QTBA 5CEOA 4ASXA 4IM2A 2GS7A 4F9WA 4I94A 4LG4A 4O7SA 4MNFA 4OTGA 4A7CA 2YFXA 4O7WA 2EVAA 5A4LA 2WMTA 5KZIA 3T9TA 1XH9A 5EYKA 2VTIA 3NDMA 4JL9A 4DLIA 3MV5A 2VNWA 4G2FA 4BR3A 4TNBA 3QC9A 3HECA 3IO7A 3ANRA 5D9HA 1H07A 3EQDA 4LI5A 5KUPA 3BYVA 1ZOGA 3BE9A 4NL0A 2OIDA 3UP7A 4FIEA 4G34A 2BAKA 3W8LA 4LL0A 3KVXA 4FTJA 4QPMA 3FI2A 2XCHA 4MXOA 5FEQA 4ZTNA 3TV6A 3CD8A 5LMKA 4RC4A 2UW5A 3PIYA 3CEKA 4W4WA 4BI1A 1WBWA 2YDJA 4R5SA 5EH0A 2BRMA 4WG3A 4I1ZA 3VUGA 4FEWA 2H8HA 3PJ1A 5FD2A 5HLNA 4C33A 3II5A 4KB8A 5I4NA 4WSQA 4ZXTA 1H1SA 4FSTA 3R1QA 4O1OA 4YPSA 5E8SA 5L2QA 2OFVA 4CFVA 3RPYA 3A8WA 1YWVA 1K3AA 4YBKA 3SW4A 3O8PA 4EWHA 4OTHA 1NW1A 4MXCA 5IDPA 5DMZA 4KABA 1IEPA 3LFEA 5DFPA 3COIA 4CNHA 2ETRA 1MRYA 2ITVA 4MCVA 4OBQA 2W7XA 3HV7A 3ZTXA 4E20A 1Z9XA 3RAWA 2HZNA 3D0EA 4U9AA 4W4XA 4JBQA 3OWLA 4D4VA 4BDFA 3OCTA 2WGJA 4K6ZA 1RDQE 4GJ3A 3ZO1A 4GT3A 4C02A 5JFWA 3WIGA 1PXNA 4I4FA 3QBNA 2VWWA 2VTLA 4TN6A 4BI2A 4F1TA 3S4QA 1H26A 1U5RA 5F20A 2I0HA 2XKFA 3GB2A 5IF1A 4JR7A 4EH2A 4Q5HA 3ZRMA 4GIIA 4NTTA 4E7WA 3GUBA 4CKJA 2ZM4A 2R3FA 2BRNA 2C5OA 5LWNA 2PMOX 4IACA 3VAPA 3VBWA 4EC9A 2BAJA 2HW6A 1CKJA 3LLTA 4UMUA 3HLLA 4X7QA 4FEUA 5BVNA 4J95A 4DG0E 3WE8A 5EYDA 4C35A 5GJFA 4R7HA 1OPJA 2QVSE 4WRGA 3FKOA 4MWIA 2R3JA 4DA5A 2EXCX 3EQBA 4U81A 4ALVA 2VGPA 1JSVA 4S30A 4KKGA 1BLXA 2CGXA 3KY2A 4OLIA 4X6RA 3TZ9A 3EL8A 3FL4A 4DH3A 4ZK5A 4EHEA 3EQGA 3IDBA 2XBAA 5DEYA 5ANJA 3N51A 3DT1A 3GNIB 5A3XA 2Z7SA 3T9IA 4AZSA 3RPOA 4MXZA 4I41A 3E8CA 1Y91A 4L68A 1GAGA 3CQEA 3ZDIA 3MH0A 4IX6A 5AR3A 3UVQA 4IWQA 4EHVA 4FTRA 5C8NA 3HP5A 5AP3A 2UZDA 3VS1A 5A46A 2UW4A 3PXFA 3R00A 2X8IA 2ZOQA 3A62A 1I09A 4IZ7A 4NSTA 4O0SA 4RGJA 4DYMA 3PJ2A 2I6LA 5EG3A 5KMLA 3D2IA 3GFEA 4FZAB 1XO2B 5LMBA 3L8XA 4FT9A 3PG1A 3U51A 3ITZA 4FKWA 3NUYA 4TYHA 4EK6A 4HYHA 1YOJA 3PSBA 4HVDA 1OIUA 3F5GA 4XOYA 2WO6A 4MKCA 2OZAB 3R9HA 4ACGA 4C36A 2ITOA 4RFMA 1M52A 1WBOA 2PVLA 4UX9A 4NM5A 3OOMA 2WMRA 4RJ5A 4MBJA 4L01A 1H00A 2G2FA 3UC4A 3R01A 3TKIA 4IWPA 2HENA 4B8MA 4FSRA 4GCJA 2WMUA 3JY9A 4FKRA 4IWOA 4N6ZA 4YC6A 2GMXA 4MVFA 5BVKA 3SKCA 4Z16A 3F5UA 4IVAA 1CTPE 1XBBA 3RNIA 5AR7A 2JAVA 3NS9A 3RKBA 4HVIA 4AE6A 4YSJA 4XMOA 4DGMA 2PE1A 2WQBA 1GIJA 3I79A 3OT8A 4U41A 5M53A 2FYSA 2X8EA 3FC2A 3CQUA 1JQHA 1OKVA 4BBFA 3CIKA 5C27A 5LQFA 5EI6A 4W4YA 3I6WA 5EKOA 2NRYA 4FVQA 4QMWA 3C50A 3G2FA 3GCSA 4XLIA 4FX3A 4FGBA 5DNRA 4C38A 4DGOA 3KK8A 1Y6AA 4O7NA 2HWOA 2O0UA 1ND4A 4DEDA 3PA5A 3NUAA 2YZAA 3ZU7A 3H4JA 4AA0A 2ZB1A 4XP0A 5DGZA 5B2LA 4G3DA 4B99A 3LKMA 4JDHA 3ZSIA 2XK7A 3GC0A 4CQEA 2C5VA 3GENA 3P23A 3V8TA 5BYLA 4AOTA 4FIIA 4X3FC 4FV1A 4QP9A 3WE4A 4NIFA 3DAEA 1H1WA 3UC3A 3VS3A 4DGLC 2YISA 3CY2A 4FZ6A 5CAUA 3WF6A 4MBIA 3FI3A 4CFXA 1JKSA 2C5XA 4QQJA 4CFNA 4H05A 4MAOA 3C5IA 2ITZA 5J7BA 2ITTA 4RZWA 2RGPA 3OCGA 4QNYA 3QLFA 1PXKA 4BCMA 3FXXA 3KF4A 3M11A 3ENMA 5M56A 4MD9E 4RVTA 4CYJA 4IZYA 1XBAA 3FZ1A 4M0ZA 4XCUA 4FG7A 4EH5A 3EHAA 2JDSA 2UW6A 2X8DA 3FZSA 3MDYA 2QR7A 5HIEA 3KRJA 5EQYA 4G5JA 3TZ7A 3OCBA 4XYFA 2BHEA 4FZFB 5CZHA 1BMKA 4XRLA 5IUGA 5C9CA 5JGDA 5HO6A 5AM7A 3H0YA 4AE9A 4L9IA 4MX9A 3P7CA 4D9UA 3Q2JA 4AZVA 4MBLA 5IQIA 5CNOA 5AP5A 4RIWB 3RAKA 4V04A 2PVMA 3MVLA 4BCFA 2B7AA 4BIEA 2GNHA 4YZMA 4S2ZA 3MVMA 2X1NA 4YUQA 4DCAA 2OBJA 4O2PA 2VAGA 2VUWA 2G1TA 1VEBA 5HX6A 3HV3A 1YWRA 5HU9A 5M4IA 2BR1A 3HL7A 4QQ5A 5HG5A 1XR1A 3LPBA 2WU6A 5HEZA 4TTHB 3OROA 4EQCA 1G8SA 5KX8A 4PQNA 4MNEB 1H4LA 3VUHA 4C3FA 4CTBA 5JN2A 3CC6A 4KSQA 5LXMA 3RVGA 1MUOA 2PSQA 2WD1A 4FEVA 3QTIA 3SC1A 1DM2A 3R8VA 3ZLSA 2Z02A 1IR3A 3W2SA 1OIQA 2X39A 3EFWA 4O6LA 5CU3A 2JKOA 2XK6A 3QAME 3OBGA 4APCA 3DZOA 5FXRA 2VWZA 4GK3A 1Q97A 2VO3A 2BIYA 3VUDA 3SGCA 1T46A 4O0YA 5G6VA 2YJRA 4MEDA 3QRKA 4B4LA 2X81A 4QMYA 3U4WA 5E8UA 4BKZA 1FMOE 3Q5ZA 2PHKA 2WIHA 5H9BA 4PDSA 4MK0A 2JKMA 4GG7A 5ETFA 5KMKA 2YWVA 5J1WA 5AWMA 3QHWA 3Q4ZA 4ZEGA 3RJCA 5CEMA 5L2IA 2YM4A 5DHJA 4O7RA 4BDCA 4CSVA 3T3UA 4LGHA 3GVUA 3OXIA 3ZMMA 4O81A 3MY1A 4U79A 4AAAA 3OEFX 2QO7A 4GFGA 2NP8A 4KRDA 3A7JA 2X9EA 2YCFA 2WTCA 2ONLA 3GC7A 1OPLA 4QMMA 3W1FA 4HVHA 3L9LA 4N70A 4U43A 3ZLYA 4ACHA 3CKWA 3JS2A 3RK7A 5BVWA 3G5DA 3P7AA 3R6XA 4HGEA 1YWNA 4TWCA 2VTAA 3HMOA 5CEIA 2HIWA 5K4JA 3CKXA 4ZZNA 1JPAA 2IN6A 2HZIA 3D94A 3OWKA 4FTAA 2QQ7A 5CF4A 3CSVA 3OD6X 4C61A 3DBFA 2VX3A 2OW3A 2QOHA 4M0YA 3UP2A 3VBXA 4FEXA 5AUWA 4ZIMA 3V8WA 4B9DA 2QKRA 4K0YA 1FOTA 2RKUA 3HUBA 4ALUA 4O0XA 2QO2A 4ASDA 1GZKA 3OUKA 4IM0A 1MRVA 4EOKA 2ERKA 4Y95A 1PXPA 4M8TA 3PA4A 4QYGA 4J96A 3RWQA 3UDBA 4ASEA 3FXZA 3BRBA 1BYGA 3BZ3A 4E73A 1REKA 4FZ7A 1PXOA 4RC3A 3UZTA 4RX5A 5FUTA 3OW4A 2PE0A 2B9HA 3FAAA 3CPBA 3CP9A 3A2CA 3Q60A 3QD0A 3VVHA 5IDNA 3R1SA 1ZAOA 4W4VA 3F5XA 3IG7A 2C6DA 1PHKA 3K5VA 2QOIA 3MPMA 4GW8A 5E90A 4AN9A 5LJJA 4EUUA 2UZLA 3RGFA 3UJGA 2CCIA 3IW8A 4LV5A 5AIRA 3WIKA 4FE2A 1R1WA 3MYGA 4QMTA 4AW2A 5FRIA 2JDTA 1W8CA 2F9GA 4J53A 3IW6A 4RJ6A 1CSNA 4TWNA 1OL6A 4R6VA 4QTCA 5AAGA 1UNLA 4FOBA 3KRRA 4PL5A 5A6OA 2R7IA 4KRCA 3GCUA 3ORPA 3R30A 4I92A 4GUBA 3VBTA 5LVNA 4EK3A 3ET7A 4V05A 3ZXZA 2PMNX 3P4KA 3UNKA 1YI6A 1XHAA 2OK1A 3HGKA 2YDIA 4NEUA 5FQDC 3WF8A 4RX7A 3W33A 4P5ZA 4JBPA 5CAOA 3G51A 4PMTA 3DPKA 3MTFA 3PRFA 3ENHA 5HE0A 4QMVA 4E1ZA 3WILA 5I3OA 3GCQA 2VWIA 2REIA 2GHLA 3TJCA 5M06A 3HDNA 4ANOA 1W82A 2R3LA 2XK8A 4O0VA 4YJSA 3OUNB 4NW5A 4ZLYA 3AGLA 1NVRA 4XEYA 4CG9A 3D5VA 4FV2A 5EI2A 4F63A 4E93A 3E88A 3A99A 4BWPA 4IVCA 2C0IA 3I1AA 5B0XA 3GU4A 1UU8A 3QC4A 4PY1A 5M4CA 3TNPC 3WZDA 4Y8DA 4L44A 2W1IA 5KKRC 2X2KA 4JXFA 4FYOA 5IQAA 3SVVA 4NFMA 2XF0A 4RJ3A 4UBAA 4GKHA 2VWXA 3PY0A 3EH9A 4G6LA 4MTAA 4BVUA 3TDVA 1WBTA 4D1SA 4NCTA 3ATSA 4RWLA 3EQRA 4OAVB 2J9MA 4AN3A 5I9XA 3CE3A 3SRVB 3RM7A 4MD7E
chains in the Genus database with same CATH superfamily
3ZFYA 5C4KA 1H25A 3COKA 4BHNA 3UNZA 3KGAA 4QMXA 4F08A 3FLYA 2C5YA 3AC1A 3SQQA 5GZAA 1GZNA 2W5AA 3UIXA 3NPCA 2F4JA 1JKTA 4NT4A 3KXGA 2VWBA 5C8MA 3QZHA 2WEIA 4QP8A 2OGVA 4FV9A 4KIQA 2V0DA 4RFYA 4IVDA 3SV0A 3PVBA 5HTIA 2IW6A 3UIMA 4EL9A 3TCPA 2BKKA 3V5WA 4YJVA 3CJFA 1PKDA 3NW7A 3CY3A 3R1NA 2GNGA 2UZTA 3W2RA 3N4TA 3ZDUA 4YTFA 4RJ7A 2CKOA 5IQCA 4J7BA 4L43A 2R3OA 3KIOC 2YWPA 4R7IA 5IU2A 4FKLA 1J7UA 3BE2A 1M2PA 4R8QA 4MQ2A 2VTSA 5CT7A 1ATPE 4LDTA 1F3MC 3JVSA 4HW7A 4TYJA 4IB0A 2ZM3A 2W96B 2WOTA 4J98A 4X2NA 1YRPA 3M2WA 4YJOA 3DXPA 5CLPA 2BFYA 3QTXA 3IGGA 3CJGA 4LMUA 3VJNA 4A07A 3QTSA 4J8MA 2R0UA 4R78A 4K18A 2Y0AA 3F6XA 3VULA 4FL3A 4F6SA 2ITNA 5HLPA 5CXZA 5IZFA 2WHBA 2P0CA 2C1AA 2WTDA 2XM9A 3OF0A 2CKPA 1OITA 5KMMA 3OMVA 4FTTA 4O22A 4Q2AA 3VBVA 3DCVA 4PF4A 4KSPA 2B52A 3DKFA 1KE5A 5CSXA 5FDXA 4C4GA 3JY0A 4IBMA 3G90X 5I3RA 4FIJA 4YR8A 3FMMA 2EB3A 3DLZA 2BTSA 4WKQA 4EK5A 1KE7A 5M08A 5H8BA 1GZOA 3W0MA 3VQHA 1Q61A 5BUEA 3MA3A 3UTOA 1Q8TA 2QD9A 3GCVA 4KIPA 4C2VA 3FMEA 4NM3A 4ENXA 3VHKA 5K9IA 4AQCA 2BRGA 4KIKA 5L3AA 5KBRA 4I6FA 3PZHA 4FT3A 4KWPA 2C68A 5DR9A 1ZY5A 3REPA 4GSBA 3F3TA 4CQGA 3K54A 5LMKC 2QOCA 3TUCA 4QDVA 2YM3A 4Y85A 1U54A 2RG6A 4AN2A 1OKYA 2B0QA 2Y7JA 3QZGA 4FC0A 5AX3A 2V7OA 2UZBA 3AD6A 3NGAA 4D1ZA 3L1SA 5EDQA 2ACXA 3UNJA 3F5PA 3JVRA 5FG8A 4YURA 4IZAA 3ZLXA 4I22A 4U80A 1LUFA 4FR4A 2J0KA 2PPQA 1G8AA 5GIPE 2JC6A 4G3GA 5EHYA 4TT7A 3RI1A 4RWJA 4DGNA 1GZ8A 1I44A 4XBRA 3PXQA 2GS6A 3PZEA 1YXSA 4FEQA 5HE3A 3BEGA 1JAMA 1OBDA 2WNTA 4JG6A 2W9ZB 2C6LA 4FNWA 1XMMA 3VONA 3PG3A 3F69A 4J8NA 3KMWA 2WQOA 2W1EA 3PUPA 3Q5IA 3ZFXA 4UYNA 1WZYA 5IA4A 5EI8A 1KE9A 3I6UA 2GDOA 4U45A 1WFCA 3DB6A 2OZOA 2W17A 4DF3A 3KREA 2IVTA 4A4LA 3TI1A 2R3KA 4AXDA 5GZ9A 5AUUA 4YLLA 2QU6A 4X2FA 3EMGA 1OGYA 3DBCA 3P9JA 2YERA 4WOVA 2J0LA 5CS6A 5EFQA 1WBVA 2X6EA 4HPUE 5CALA 2VN9A 2WTJA 3FI8A 1G3NA 3H10A 3IW7A 4IH8A 3SG8A 2CDZA 4KAOA 5IEYA 1AQ1A 3ZM9A 3KRXA 5T6KA 3R0TA 4F6WA 3MY0A 2YN8A 2RFDA 3R8MA 4DG2E 5AUZA 1TQIA 4RBLA 3KXXA 3TNQB 2PZYA 4F65A 1QPDA 3F82A 3G15A 4DC2A 3KVWA 2F7XE 3GCPA 2HAKA 3FMNA 5JH6A 3ACJA 4ZMFA 2UW7A 4FL2A 4G9RA 3BHTA 2PUPA 4XOZA 2F2CB 2WTKB 3ZYAA 3HRFA 4FG9A 3DXNA 4YP8A 3Q4CA 3HAVA 4BDJA 1NY3A 3ETAA 5A4QA 4CTCA 5AUYA 4IW0A 3ATTA 5L4QA 4EQMA 3ELJA 4ALWA 2R3HA 4JBVA 3CQWA 3U9NA 5HBJA 5CASA 5E4HA 4D2WA 4EOSA 2JLDA 3BQCA 3KC3A 2PZIA 1YOLA 5AJQA 1DS5A 3RWPA 3TTJA 1URCA 1MQBA 3ZUTA 2XKCA 4IEBA 4XG3A 2QURA 4DBNA 2YJSA 3QKKA 3R1YA 4FL1A 2J0MB 3PWYA 4XG2A 2Y6OA 4ZTLA 1X8BA 3NAYA 3CD3A 3FBVA 5HCYA 3NW5A 3PVUA 5BX0A 4GV1A 3EKNA 2QOQA 1V0OA 4KKEA 4XS2A 2G15A 3LFNA 3O17A 2CKQA 4L7FA 1Z57A 4S32A 4FV3A 5DG5A 3AT2A 5D7VA 2GQRA 5CXHA 1O6YA 4G9CA 1TQPA 1W84A 4TNDA 5AP4A 4ZLOA 3R7GA 4UMPA 5AP7A 3ZHPC 4XV9A 1ZZ2A 1PMNA 5KO1A 4QNAA 4N6YA 3F3WA 3R9DA 3IS5A 4W9XA 1Q8UA 4ZP5A 5EOBA 5E9EA 4R1VA 1UNGA 3VUIA 3TNWA 2V62A 2C5NA 3BLHA 3E8NA 4G17A 4UZHA 1Q8YA 3F3ZA 4G6NA 5T68A 4A06A 3TZ8A 4JAJA 4RMZA 3ORTA 1YOMA 2Y4IB 1IRKA 5CZIA 3V5PA 4CT1A 3AT4A 4DFZE 5AADA 4RIXB 3CPCA 4FV4A 3UYTA 4U6RA 4K2RA 1H27A 4LV7A 4ZY6A 3Q52A 1G8KA 2WXVA 4R77A 4O4EA 4TRLA 5J87A 3SDJA 3FLNC 3PPZA 5L6PA 3PY3A 2FSTX 4EOPA 2QC6A 3EOCA 3VQUA 5C4LA 4L3JA 3EZVA 1SNUA 3W2OA 5KNJA 4H1MA 3D7TB 4WNOA 2BILB 2C0TA 1S9JA 3HMNA 4QPSA 3C0IA 2UVYA 1W98A 3P7BA 1H01A 2FSOX 5DI1A 3MB6A 1QPJA 4F9YA 2ZYBA 4GG5A 4EH4A 1OMWA 3W0SA 3MIYA 3BQRA 3VW6A 3MIAA 4QTAA 2PL0A 4WUAA 2CNVA 4APPA 5JT2A 2VZ6A 5E8VA 5JEBA 3HV6A 1ZARA 3C4XA 3CTJA 3BV2A 3UE4A 3DJ5A 4EOJA 2BRBA 3U6IA 3FZPA 3FQHA 3PIXA 4JX3A 4M84A 5DYJA 3MFSA 3G6HA 3WYYA 3RALA 4FTUA 3UBDA 3QQKA 5CANA 3C4FA 4YNOA 5I9YA 4O82A 5JFXA 4Q9ZA 2YCRA 4ASZA 3UDSA 3QZIA 3OOGA 3FPMA 3FXWA 1UKHA 4BDIA 4F7JA 4CKRA 4O86A 4H36A 4JX7A 4I3ZA 3O23A 1ZMWA 3ZSHA 5KMIA 3QD3A 3HYHA 3VBQA 4FK3A 4DN5A 5LCKA 4IAYA 4WT6A 2UUEA 2VTNA 3GFWA 3EFKA 2Z8CA 3NCZA 4DG3E 2ZFYA 4UWCA 2R3IA 2Z7QA 3LXNA 3DS6A 3A60A 2OZAA 3SXSA 4YJNA 3R28A 3S95A 1A48A 4PX6A 4FKTA 5J7HA 4UMTA 4ERKA 1FBNA 3NNWA 3S3IA 4FOCA 3KXZA 4DHJA 3QTZA 4HGTA 1OL7A 4GIHA 3C7QA 1FMKA 1IAJA 3E93A 2PTKA 5TT7A 5CEKA 2HW7A 3UPXA 2RL5A 3SA0A 3HKOA 4FF8A 5H3QA 4G16A 4F7LA 3G6GA 5D1JA 5AV1A 3NUSA 4YZDA 2XANA 2R3MA 2R2PA 4BCJA 4BTFA 5I9ZA 4HYIA 3D9VA 4GT4A 2XIKA 4FSQA 4D2RA 3W16A 2UVXA 3OXTA 1OIYA 5KCVA 2YM7A 2BAQA 3QCSA 1P5EA 1Y57A 3UOJA 2JAMA 3UZRA 3BI6A 1DI8A 3CR0A 2Y6MA 4LGDA 3PXZA 4UALA 3TXOA 5L2WA 3Q96A 2UZVA 1DI9A 4XX9A 2P3GX 4L42A 1JSTA 2UZOA 1O6LA 2W1ZA 3THBA 3LOKA 4H3PA 4G3CA 4BIDA 4BHZA 4NM7A 2JITA 4DITA 1OL2A 2Q0BA 3LQ5A 4PNIA 3MY5A 3NCGA 3HRBA 3TT0A 5L8JA 2XKDA 5CVFA 3AC2A 1ZXEA 2XUUA 2E9OA 4EK8A 4CVAA 1OKZA 2A27A 2GTNA 4XUFA 5D10A 5HNBA 4DHIB 5CAVA 3SAYA 1BUHA 4RRVA 5L2SA 4NJ3A 3TJDA 2XYUA 4IADA 4WNPA 4C4JA 4DAWA 2B53A 3W0PA 2EU9A 4B7TA 2ZAZA 5CWZA 2XYNA 4AGWA 5HD4A 4RA5A 4O7LA 4DDIA 1Q3WA 2G01A 2CJMA 4F9BA 1CKIA 1PY5A 3NAXA 3R21A 4BCOA 4JJRA 3GEQA 3NYNA 2GS2A 5FM3A 5JRQA 2C6MA 2P2IA 5JMSA 3NZ0A 4QMPA 2BTRA 4PP9A 3OY3A 4UWBA 5AV4A 4PL4A 4CFWA 2XNNA 4WIHA 4CMTA 3BKBA 2XIXA 2ONLC 5DA3A 3NUXA 1OVEA 3FMDA 3QF9A 4FTCA 3VS5A 4DCEA 1ZOEA 3IOPA 4K33A 4GRBA 4IAZA 4FNZA 2QNJA 3ORKA 3ZBXA 2AEGA 3NVMB 3RZFA 5ICPA 2CLXA 3W18A 3DAJA 3ZC6A 1YDSE 4PUZA 1XH8A 4BI0A 4B0GA 5JQ8A 2IZSA 4IWDA 4BDAA 4Z9LA 4XG4A 4RIWA 1PXMA 3AC4A 4E5WA 3FV8A 3TTIA 4YHJA 3WZUA 4OR5A 3KB7A 3P08A 3F3UA 3FYJX 4O96A 4AOJA 4C2WA 4CMOA 1J1CA 5CQWA 4XG6A 2YLFA 3ZUVA 5K0XA 4RVMA 4RJ8A 3R7UA 1WCCA 3H0ZA 3FY2A 1YXVA 2C0OA 3EN6A 4PL3A 4MNEA 3UOKA 4AX8A 4DH8A 4O4DA 5KBQA 3EQPA 1FINA 2GQSA 2UW9A 3AG9A 4IJ9A 2X4FA 5AR2A 2JBPA 2WU7A 4H58A 3U6HA 5IUHA 3CBLA 5A4TA 1FVVA 5HORA 1FQ1B 2X9FA 3ZO4A 1JWHA 2UV2A 3LM5A 4QP1A 2W4JA 4JDJA 2Z7LA 4D2TA 3DDQA 2R64A 2PE2A 3NFFB 3LE6A 2GFCA 2WMVA 2NO3A 1Y8YA 2YIWA 2JDVA 3IW5A 3JPVA 2JFMA 5CSVA 3IECA 1GIHA 3DLSA 1PXJA 2YACA 2OSCA 1M7QA 2CGUA 2F7EE 3MVJA 4TKSA 2PVRA 3TKUA 3FL5A 4C7TA 2I7QA 3QRUA 3AMYA 5IKWA 5TR6A 1U59A 1YHVA 4E6QA 3PVGA 2OH0E 4AACA 3GOPA 3JR1A 1OGUA 5ANIA 1JBPE 1H28A 4I24A 4BCNA 3NR9A 3UVRA 3H30A 5JGAA 2QHMA 5EW8A 2QG5A 2I0VA 2F49A 3ZFMA 2LGCA 3CTHA 2GCDA 2PVFA 5CVHA 4J71A 2X7OA 3QWJA 2XJ1A 4G5PA 1YQJA 3PE1A 4N0SA 4CKIA 4F9CA 5L8LA 2UVZA 2C3KA 3M1SA 3QXOA 3KU2A 3DTWA 4IX4A 1H0VA 3PDTA 4Z3VA 4GVJA 2XCKA 3E64A 3Q32A 3OEZA 4BDKA 3VS7A 3NWWA 2V22A 4IXPA 5C8KA 2C47A 3O96A 4XV2A 4CRSA 4D4RA 2UW8A 2JIVA 3W2CA 2XALA 1XH4A 2VGOA 3RPRA 4EH7A 4DT9A 3AKLA 4S34A 5DR2A 2G9XA 1CDKA 5ETAA 5A14A 2BZIB 3AQVA 3CXWA 4DBXA 1PMUA 3GGFA 2R5TA 4U44A 2SRCA 3BHYA 3NUNA 4I5CA 3IQ7A 3HMMA 2XH5A 4Z7HA 5IQHA 3LVPA 4NCTC 4RIYB 4FTIA 4FSWA 2VTHA 2Q0NA 3QQGA 3OTUA 1ZRZA 2UW3A 5A4CA 2WMSA 1YVJA 3DQXA 4IDTA 3OWJA 2XK3A 1F5QA 1WAKA 3MFUA 3DQWA 3HDMA 1U46A 2XBJA 2EB2A 3UIUA 4L00A 2E9VA 3PJCA 4NFNA 1UU9A 5J5SA 3I60A 3R8ZA 2PVJA 5L2TA 5K5XA 3W0NA 3B8QA 3Q6UA 4OTFA 4YLJA 3GOKA 4BCKA 2QKWB 3NSZA 4KS7A 4U40A 4EUTA 3L9MA 3QUEA 2P2HA 2YAKA 4DT8A 4NWMA 3NX8A 4S31A 5IA0A 4Q5EA 4BYIA 4QP3A 4F09A 1UU3A 4HVGA 3NLBA 4C8BA 3KCFA 5E8YA 5FXSA 2V7AA 5E1SA 1BL6A 2B54A 2WKMA 3COHA 5DN3A 4ZSGA 5IUIA 4ANSA 5CU2A 3QCYA 2C69A 4QO9A 3EYGA 2A19B 3LMIA 2OF2A 3DK7A 3QL8A 5IH4A 3O8UA 2YM8A 4MXXA 5H8GA 5JQ5A 2EWAA 3MWUA 3Q04A 2EUFB 3SHEA 3TMOA 2FSMX 1QCFA 2G2HA 2W9FB 4FI1A 4QPAA 4RQKA 4Y73A 5EM8A 5HNGA 2BFXA 4ONAA 4E4MA 4K9YA 4N57A 4L45A 3RK5A 4HOKA 4IE9A 4QP6A 4X2KA 3VWAA 3FMKA 3LFAA 3QX2A 2P4IA 3FLSA 3S0OA 3KEXA 3KK9A 2QLQA 3R2BA 4XHKB 5C1QB 5FEDA 4ACMA 1OI9A 1XJDA 4C4IA 1ST4A 3EQFA 5FP6A 2C3LA 4IC7A 4AW5A 3UMXA 4I4EA 4FVRA 3TIZA 1SVEA 3ZXTA 4HPTE 4U42A 3TL8A 3PE2A 3AOXA 4D2PA 4ACDA 1E9HA 4AGUA 4BDHA 3FYKX 3QRJA 3I4BA 5DVRA 4AFEA 4LOOA 3RNYA 5LCJA 2O2UA 2I40A 4HNIA 4QQTA 2XRWA 5EOLA 2C6IA 5DE2A 3PPKA 2O65A 1VR2A 3LFFA 4EH3A 4F0IA 2WOUA 5HBEA 4D28A 1Q62A 2E2BA 4GK4A 3SRVA 4M69B 2PVKA 4E6CA 3NNUA 2CSNA 5J1VA 5IMEA 2Y9QA 2CNQA 4FT0A 1M14A 3QYWA 1XKKA 1PXIA 2ITQA 4DHFA 3NMUF 1XBCA 3P79A 5FGKA 4ZY4A 3F7WA 4IFCA 5BMSA 1OL1A 3UQGA 3PY1A 3A4PA 2HYYA 3FHRA 3LCDA 5CF6A 1F0QA 4HZRA 2QG7A 2ZMDA 5E1EA 3EYHA 3ZEPA 4IDVA 4AUAA 3B8RA 2BDWA 4G6OA 2CN8A 3K3JA 2R7BA 4MQ1A 4EC8A 5ETIA 1RE8A 4F0GA 4YZNA 5CEPA 4CLIA 1Q24A 5EW3A 5AR8A 4E5BA 2O5KA 4QYYA 3O8TA 4WBOA 2WTWA 2RIOA 1PMVA 4MWHA 4W8DA 5LVLA 2C6KA 5AUXA 4DEGA 4O0UA 4ZSEA 2UW0A 1Q5KA 3GQIA 3MFRA 3PIZA 5EW9A 1XH5A 3RZBA 1XMLA 5D11A 5BYYA 5EHLA 2IF8A 2PUIA 4OTDA 4EH8A 4IHPA 2W1DA 5HVYA 2XAOA 4PDOA 3GXLA 3FJQE 4W9WA 5HG8A 4Y83A 1LPUA 2IVVA 4R1YA 3VRZA 4AT4A 5DT4A 4TW9A 3I0OA 4D55A 2IZUA 3A7HA 2EXEA 4ZSAA 3KXMA 4KD1A 3Q4TA 3BGZA 4K8AA 1QL6A 3RHKA 4LOQA 5J9LA 2VX1A 4OTRA 5EM6A 2QCSA 3DU8A 4NH1A 3ROYA 2CMWA 4O1PA 4P5QA 4GKIA 5CYIA 1APME 4M14A 3RP9A 4QDEA 4FSNA 4R3PA 4FK6A 2YABA 5C26A 5I5ZA 4RSSA 4NTSA 2OO8X 2LAVA 4EOOA 4GFOA 5HQ0A 3SLSA 3R2YA 1ZY4A 2DWBA 4D2SA 3BPRA 2X2LA 4A9TA 3PUFC 3QCXA 3TDWA 3D5UA 4QMNA 1P2AA 4WNMA 4FV0A 2XKEA 5CU0A 2W4KA 2HZ0A 1P14A 5D7AA 2PULA 1SNXA 4O84A 3GC8A 4HCUA 4P2KA 1H08A 2XNGA 2YIYA 3OWPA 2BKZA 4FV6A 4XP2A 4ANQA 3PP1A 2X0GA 3QFVA 2XP2A 3D2KA 4C37A 5DH3A 3TUBA 5IQEA 1YDRE 4DINA 4GUEA 5JSMA 3PVWA 3Q3BA 4LMNA 5HVKA 2QHNA 4AZEA 4EJNA 4IJPA 1V0BA 2XNOA 2QOLA 3A61A 2YIQA 3WF9A 4FICA 3BYOA 3Q9XA 3R83A 3RTPA 4EZ7A 5AA8A 5GIOE 3AXWA 5M4UA 1H1RA 4XNEA 2I0EA 5CAQA 4P7EA 3LZBA 4UV0A 1ZLTA 1S9IA 3F7ZA 4FNXA 4BWXA 2VU3A 4EOLA 4YU2A 4O0WA 5FBOA 3I7BA 4L8MA 2W5HA 3BGPA 4BWKA 4ACCA 3MN3A 4X3FB 2X2MA 4AAYA 2H6DA 3HMPA 3VBYA 3AC3A 1NVQA 4CZTA 4O21A 4ZTRA 2C6TA 3D14A 2J5EA 5ANGA 1J91A 2ZMCA 3JUHA 3K3IA 2F57A 2QOKA 3PA3A 3POZA 3QKLA 4GJ2A 1FPUA 4IC8A 4BCQA 3WF5A 4C3PA 4DFUA 2QOFA 4HCVA 1ZYLA 2VX0A 3C13A 4JT3A 3OC1A 2PUUA 2OXYA 4QP2A 4QMUA 4GK2A 3KULB 5F94A 3TUDA 4X0MA 5EDPA 4UXLA 4BCGA 4X21A 3N9XA 4DDGA 1H0WA 5ACBC 3WI6A 4BBEA 2A0CX 4JOAA 3UOLA 2BALA 4CD0A 4HVSA 4USEA 4DEAA 4RIOA 4RPVA 3ORMA 5DPVA 3R7YA 2CGVA 1B6CB 1BI7A 2PZRA 3QGYA 4JIAA 3QA8A 4YZBA 5IPJA 3F2AA 4EOMA 2OFUA 4JDIA 5AR5A 3HMIA 5F4NA 3FPQA 3I7CA 1M2RA 4I21A 5G1XA 4TYIA 2NRUA 4S33A 1ZYJA 5LVOA 4FZDB 4O7ZA 2GU8A 3DNEA 5H8EA 3SOCA 3U55A 3GI3A 4M67A 2JEDA 2WB8A 3PJ8A 3LQ3A 1STCE 4CYIA 4E5AX 3JYAA 3L8PA 4L53A 4TWOA 5HO7A 2E9UA 4C59A 4C58A 2WMQA 3KRLA 5ITAA 3HRCA 1PMEA 4QMZA 5IH5A 1ST0A 3GQLA 2WIPA 5J8IA 4YTCA 3DAKA 1ZWSA 3P1AA 4GT5A 3BYSA 4Y5QA 3AD4A 2KULA 3HA6A 2J90A 3QQUA 4CXAA 3GU7A 4QT1A 4M15A 5IQBA 3NRMA 5AUVA 2X0PA 5CENA 3RAHA 2QO9A 4O0TA 4GFMA 3FSFA 3FQEA 1UKIA 2RFEA 4LUEA 5DWRA 5HKMA 3FDNA 2ESMA 4AZFA 1LR4A 3VC4A 1W7HA 3OY1A 4RIXA 2OU7A 1PJKA 3LAUA 4ZZOA 3O71A 4ZJJA 3UMWA 2WTVA 4IX5A 4DH1A 4ITIA 3UQCA 1U5QA 4C3RA 2UZNA 2J4ZA 4A4XA 4UWYA 3UG2A 2J0IA 3EB0A 3IKAA 3ODYX 4MH7A 3QRTA 4FGRA 4BZNA 4KNBA 4ANMA 2ITYA 5FTGA 3R8UA 2Z7RA 3E7OA 3LFQA 3D7TA 3W0QA 4QP7A 4AQKA 3IDPA 4RLKA 3QQHA 2FGIA 3DV3A 4JAIA 3L8VA 4FMQA 4FV7A 5C03A 3ORIA 2J0JA 4XV1A 2BCJA 2QU5A 5BVEA 3U6JA 2PVNA 4F7SA 4TWPA 3G0EA 3C5UA 4FUXA 2BZKB 3LIJA 3MH2A 4LRMA 4XBUA 4AG8A 2WQNA 4OTWA 3V5JA 5L6OA 5HICA 1J7LA 1W0XC 3ALNA 2IO6A 2C4GA 2ZV8A 2VO7A 4YBJA 5LVPA 4I5HA 2ZV2A 4ZLZA 2FB8A 2XJ2A 3VF9A 4FSYA 3IK3A 4F0FA 4BGQA 4NUSA 1MRUA 4RA4A 5AV3A 5E91A 3F61A 3IPHA 4AP7A 3ODZX 4FSZA 1SVHA 1YDTE 3ZM4A 2GFSA 2OJGA 3QZFA 5IEXA 3KQ7A 3NIEA 5I9WA 3O2MA 5ANEA 1ZYSA 2HOGA 2XEZA 1REJA 2DUVA 4M12A 4RT7A 4IB3A 2Z2WA 4FV5A 5M07A 1BKXA 3F88A 3SG9A 1U54B 2QR8A 4YSMA 5ANDA 2C1BA 4DLJA 2O8YA 3FQSA 4AZTA 2UZUE 1CMKE 5CSWA 4AF3A 4CG8A 2X6DA 3FMHA 3RHXA 3F2NA 1UNHA 4FIGA 4PMSA 4FKVA 4NKSA 1Q3DA 2XB7A 3DBQA 4FTQA 2YDKA 3ZCLA 4F64A 2O64A 1BL7A 5FDPA 4BBMA 5AX9A 4AXFA 5EM5A 3AKJA 3DBEA 4AWIA 1KV2A 2VTRA 1UVRA 3VO3A 1WBPA 4FKUA 2CKEA 1YI4A 5L8KA 3JXWA 3U4UA 2WEVA 3QQJA 1GJOA 4F1MA 2HWPA 1AD5A 4V0GB 3M42A 4G1WA 3MH1A 4JVGA 4U5JA 1QMZA 2XEYA 3VUMA 4EBWA 4JQ8A 5A6NA 2J51A 3R7OA 5JZNA 1FVTA 3MB7A 2XIYA 3AKKA 4FTNA 5E8TA 5KMNA 4I0TA 4PV0A 4XP3A 4A9RA 5I9VA 5M4FA 3TG1A 1PYXA 5AP6A 3DKOA 3BWFA 4EONA 5CEQA 4PMMA 4XG9A 3OG7A 3Q9YA 3WZKA 3MJ2A 1W83A 2H34A 5H2UA 4EBVA 4YZ9A 2ETMA 2YITA 3DK3A 3CGFA 4O83A 4YHFA 2KTYA 4E4XA 4IANA 4OBOA 3TACA 5ETCA 4LV8A 4HYUA 4HZSA 3R9OA 5CQUA 3O50A 2IVSA 1IA9A 2YHVA 1ERKA 2W1GA 2VWVA 1MP8A 4ORKA 3SXRA 4MF1A 4O7TA 2YIXA 4A4OA 3BHHA 3TIYA 2JD5A 5C01A 4J97A 4P4CA 3QXPA 2I1MA 2VNYA 3R22A 4CCBA 1VZOA 5IA2A 1TKIA 3UOHA 4BIBA 3H9FA 4YC8A 4FA2A 2XMYA 4AXEA 2B4SB 2X7GA 2VTMA 3EN7A 5BQ0A 3QRIA 2FA2A 5CF8A 5F95A 5KKRB 2FVDA 2E9NA 4U97A 4PWNA 3KN6A 2DQ7X 1WMKA 2ZB0A 1PW2A 2C6OA 3LQ8A 5BVFA 4YC3A 2OG8A 3PFQA 4HCTA 3QLGA 5CAPA 5JK3A 3LHJA 4BTMA 4ITJA 1SM2A 3ULZA 2NPQA 2W06A 3FMJA 3LXLA 4FODA 4ITHA 2IW8A 1RJBA 1Y6BA 2ZJWA 4FTKA 5DT0A 5DT3A 5HIDA 4IM3A 3ZO2A 3FI4A 1LP4A 3KMUA 3C4WA 2GPHA 4FKJA 3QD2B 2P55A 4BC6A 1OBGA 4DE4A 3KMMA 4ARKA 4AT5A 4EK4A 4F6UA 3R63A 4GU9A 3VIDA 1YHSA 4YJQA 3FHIA 4JRVA 3HAMA 4M68A 3VNTA 4ZTSA 2OH4A 4A9SA 5IQFA 3BU3A 3OP5A 4I5PA 4NW6A 5TF9A 4BTJA 4QTDA 5JKGA 4WHZA 3BELA 4MXAA 2W99B 3Q4UA 1OUYA 4HGSA 3VS6A 4DFYA 5LVMA 5EQPA 2IW9A 3RK9A 4DTAA 1NVSA 3V5TA 4TYEA 5CT0A 4NK9A 4D4SA 3W0RA 3FKNA 3VUTA 3TEIA 4D1XA 5AEPA 3PLAE 5FBNC 3RCDA 5KHWA 4QYFA 2CGWA 4KBKA 1A9UA 3K5UA 1QPEA 4LRKA 2GSFA 3MA6A 2B55A 2WMXA 4RFZA 1J7IA 4FTOA 4ANBA 4I0RA 3T3VA 3ID6C 3LFSA 4UMQA 4MUQA 2RG5A 4PMPA 1KOBA 1Q8ZA 3SX9A 2IEWA 4FIFA 5IA5A 1KOAA 4L7SA 2A4LA 3FZRA 4Y46A 4HYSA 2PUNA 2WQEA 4BN1A 4ZJIA 2YM6A 1YW2A 4O38A 2JBOA 3E8DA 4LM5A 4GH2A 2VO6A 3CS9A 3RCJA 4PTEA 3V8SA 5HE2A 5GJDA 2VRXA 1R78A 4EKLA 1A06A 4EWQA 3B2TA 2GHGA 2A1AB 4FV8A 3EN9A 4FVPA 4G31A 2ZDTA 3R9RA 4YHTA 4O4CA 2R0IA 1UV5A 4LYNA 3QX4A 3E62A 4YTIA 4E8AA 4FKGA 3N4VA 2PYWA 3KCKA 3HVCA 1WVWA 2OIBA 2AC5A 3KRWA 3MH3A 5EYMA 3TKHA 4E4NA 2BVAA 2IJMA 1UWJA 5E8ZA 2YIRA 3EWHA 4K11A 4YGAA 5JZJA 2P33A 4MXYA 3RBWA 3C0GA 5BUJA 3EFLA 4KIOA 4OGRA 4EZ3A 2AUHA 3W10A 3WF7A 3H3CA 4IB5A 4AGDA 5FM2A 5K4IA 1IAHA 4R7BA 3H9RA 2OIQA 5CNNA 4PNKA 4ZZMA 3V04A 1NXKA 3VS4A 5HNIX 1R3CA 4ZTMA 4DEIA 1HOWA 4FG8A 4FSMA 4I23A 4AA4A