4F0FA

Crystal structure of the roco4 kinase domain bound to appcp from d. discoideum
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
276
structure length
276
Chain Sequence
RLPTLADNEIEYEKQIGKGGFGLVHKGRLVKDKSVVAIKSLILGDSEGETEMIEKFQEFQREVFIMSNLNHPNIVKLYGLMHNPPRMVMEFVPCGDLYHRLLDKAHPIKWSVKLRLMLDIALGIEYMQNQNPPIVHRDLRSPNIFLQSLDENAPVCAKVADFGLSQQSVHSVSGLLGNFQWMAPETIGAEEESYTEKADTYSFAMILYTILTGEGPFDEYSYGKIKFINMIREEGLRPTIPEDCPPRLRNVIELCWSGDPKKRPHFSYIVKELSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase, signaling protein
molecule keywords Serine/threonine-protein kinase roco4
publication title Roco kinase structures give insights into the mechanism of Parkinson disease-related leucine-rich-repeat kinase 2 mutations.
pubmed doi rcsb
source organism Dictyostelium discoideum
total genus 80
structure length 276
sequence length 276
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4f0fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4f0fA01
3AC1A 1Q8UA 5D9HA 4QP4A 3ZDIA 4AOJA 4UV0A 4PX6A 4G16A 3P5KA 2XRWA 4QP3A 3R28A 4Q9SA 3CY2A 4IAKA 4KRCA 3AD6A 3BHUA 1IEPA 1S9IA 2UW7A 2UZDA 2JC6A 3UMWA 3RPSA 3TNQB 4GUEA 5KMKA 4ZTLA 4AA4A 1R1WA 3LXPA 4JDHA 1KE5A 4UB7A 2Y6MA 5CF5A 2HXQA 2QU6A 1I44A 4O2ZA 4AZWA 1URWA 1DI8A 4XYFA 2F7EE 4DLJA 5T6KA 4EH6A 4FKRA 4PP7A 4E5AX 2BAJA 2R3MA 4M69A 3R8PA 1OPLA 3MYGA 4HVGA 4RLKA 3I0QA 4OLIA 1QCFA 3CKXA 4V05A 5LVNA 3TG1A 2XZSA 4XRJA 5BVWA 5I9VA 5JN2A 2VTOA 4AT5A 3D2IA 3A7HA 1YXVA 2YCSA 4LFIA 4UZHA 1NW1A 4L6QA 4EHGA 3DB6A 5BUJA 1PHKA 2DQ7X 5AP3A 2C3KA 2XJ2A 3OY1A 3TV6A 1FGKA 1PRYA 4YBJA 4FTJA 3BGZA 4WRSA 3TKUA 1H1RA 2GHGA 2JDSA 3LJ1A 3S00A 3A8XA 5CAPA 3FI3A 4FV3A 4OGRA 4RPVA 4CMUA 2A2AA 2C5NA 2R3JA 5LWNA 4CFFA 5AX3A 3C5IA 4HVIA 3MTLA 2H8HA 2WMWA 5HTCA 4AU8A 3KMUA 2B54A 3QZGA 4A4XA 3JY0A 2QR7A 4QYYA 3SXRA 1PXOA 1H28A 5ANKA 2PZYA 4BDIA 4JVGA 5EI2A 2YN8A 3OD6X 3F7ZA 5DEWA 4E4NA 5BVNA 5L4QA 5LMBA 4YHFA 1OM1A 1FVTA 2GNGA 4WG4A 4WKQA 2R3PA 4XG4A 1HCLA 1WAKA 4M97A 3T8OA 2CNUA 3ZRKA 1WZYA 3DKGA 1MQ4A 3QUDA 5HTIA 4RJ6A 4WD5A 4EH3A 4JS8A 4K0YA 1VEBA 5F1ZA 3F82A 1DI9A 1IR3A 5E8WA 5C26A 5CEKA 3R9NA 4PDOA 3UYSA 3SRVB 3ZO2A 5K4JA 4NL0A 4DEAA 2B53A 3RJCA 3B8QA 5AV3A 3FXXA 4N0SA 4NM5A 5B0XA 4ITIA 3IPHA 2OZOA 1A06A 3WZEA 5IH6A 4LI5A 5EQYA 2XUUA 4L44A 4U79A 5K0XA 3GT8A 3R8UA 3FZPA 4QMQA 1UNHA 2PVLA 3LCDA 4EOLA 2LGCA 4FK6A 5GJFA 4JDJA 4RMZA 4C7TA 3I5ZA 3NYVA 4FX3A 4ACHA 2IW9A 2IN6A 4N6ZA 4AZEA 5IZFA 4X7QA 5JFXA 4FEWA 1PW2A 3PTGA 4W8EA 3I7CA 3U51A 1OL2A 3VJNA 4PMTA 5CTPA 4XP3A 4ANMA 4QMWA 5IDNA 4RZVA 5TKDA 5C03A 4BY9E 4ENXA 1YHSA 3QC9A 3D83A 4BTFA 3V01A 4UWYA 2KTYA 5F94A 2O63A 1U5QA 3DAKA 3ZC6A 1Q97A 2YM6A 2QOQA 5D7VA 5HQ0A 3ALNA 5IMEA 3LPBA 1NA7A 4C4FA 2C69A 5KBQA 1ZARA 4MWHA 3SC1A 3UQFA 4RFZA 3F5XA 4IFGA 2ZV2A 3QRTA 3ODZX 1GZ8A 4CD0A 1XBAA 2VX3A 5IISA 2V5QA 4GIHA 4HOKA 2FSMX 2B4SB 3UC4A 3L9LA 4MKCA 4BCOA 5JKGA 1NT2A 4YHTA 3PXQA 4QP9A 2GHLA 4A9TA 2VTHA 1TVOA 3HAMA 4D55A 2VU3A 4TYHB 5E1SA 3HRCA 5HO6A 3ROCA 4AWIA 4DFBA 3QF9A 4FNXA 3HV5A 2XH5A 4P5QA 5JK3A 3SDJA 2F2CB 4LG4A 4X6RA 2YM8A 5EDPA 2UW9A 4TWOA 5E90A 3SV0A 2C47A 4WOVA 5HE0A 4BCKA 2C1BA 1SZMA 1W98A 4O22A 3LFSA 4F9WA 1XH8A 4QMMA 4IB3A 5M4UA 5FUTA 3SOAA 3OY3A 3P9JA 4U3YA 4DGMA 1GJOA 2VTJA 3R73A 4G2FA 2WAJA 3GC0A 3RK7A 1G8AA 2YWPA 4NJDA 4UEUA 4LOQA 4BIEA 4FE2A 4EBVA 3ID6C 3U4UA 3MVMA 3OWKA 4C33A 1FVRA 3MBLA 4FK3A 4O0YA 2BILB 1NVRA 4L46A 5ETCA 5J1WA 4ASZA 1Q3DA 4TT7A 4IVCA 4B6LA 1OKZA 3DFCB 5AAFA 4X2JA 5J9YA 5ETAA 2JAVA 4ENYA 2HZIA 4PV0A 4AP7A 1HOWA 4C62A 3KGAA 3OCSA 4I92A 3VS2A 4DH5A 2XK4A 3Q6UA 3RK9A 4USFA 4RX7A 3KF4A 4L3PA 3Q2JA 2YIYA 2CKQA 2ZB1A 3PJCA 4BI1A 1IAHA 3FE3A 3LFQA 4DCAA 4JXFA 3C5UA 3FYJX 3O8UA 4XHKB 4IMYA 2E9NA 1GAGA 3BCEA 3UZPA 3SGCA 3A8WA 4PTCA 3NVMB 3NX8A 2VTLA 3IGGA 3AMBA 4G17A 4K8AA 2RIOA 2PMIA 2CGWA 2QR8A 3ZSGA 1J1CA 3R6XA 1OVEA 3CLYA 2QKRA 3NUPA 4CVAA 3MTFA 5G1XA 4L01A 1R0EA 5CSWA 3FEGA 1B39A 3DKOA 3DBEA 1U4DA 4L52A 2B52A 5F9EA 2XJ1A 4I5PA 4N4SA 3O2MA 1LR4A 3O7LB 4EOSA 3UBDA 3ZM4A 4DFNA 4CZUA 2W5BA 3V6RA 1DAWA 3MWUA 5E91A 4EUUA 4KKGA 3D15A 3FSFA 4R7IA 4DH1A 3NAYA 1Q4LA 3KRXA 5D7AA 1FINA 3LCTA 4X2KA 3UGCA 4GJ3A 3OF0A 3KRJA 3LCSA 2PVYA 2JIVA 3JPVA 1KV2A 1OL6A 4FOCA 5B7VA 4ZTMA 3QTZA 5FG8A 1RJBA 3H4JA 1Q24A 3TUBA 4O7YA 2GFSA 2H34A 5D10A 2C3LA 5IMXA 4TTHB 4YBKA 2R3GA 3I6UA 4W4XA 4YJTA 3WBLA 4M13A 2UW3A 3RM7A 1OL1A 2VTPA 2ZV7A 3RPOA 4F9BA 3OW4A 2BVAA 4O7ZA 4U81A 1FGIA 4GMYA 4Z9LA 3ZHPC 3FKLA 5KHXA 4TN6A 4UY9A 1OKWA 4IDTA 3V51A 3R7OA 5M08A 4BTKA 2R7BA 3R1QA 4DE4A 1E1XA 2HW6A 4O1PA 4QP2A 4W4YA 4EK3A 4JOAA 3ORLA 4E6QA 2IPXA 4JBQA 4E4XA 5EKNA 3QGYA 4DEBA 3BLRA 3UQGA 2YA9A 2Y6OA 1GOLA 2CSNA 2Z2WA 5FXSA 5EW8A 4CFWA 1PJKA 2OJ9A 1Q62A 2J0LA 5CLPA 3R30A 2OICA 3E62A 4XG9A 3PZHA 3KQ7A 4O0XA 3ODYX 3GQIA 1ZY4A 1PMVA 4IAZA 4Y85A 5A3XA 2RFDA 2GQGA 3BV3A 2GNFA 3FWQA 5E8UA 2PPQA 2WNTA 2G1TA 3DQWA 4FKJA 5TE0A 3TNIA 4CLIA 3C4FA 2PK9A 3BHYA 4ZY6A 3OFMA 4ZJIA 4ORKA 1GIHA 1OI9A 5HLWA 5E9EA 4UBAA 3QQKA 4TYIA 4ANSA 1REJA 4CTCA 4BZDA 2BPMA 2GNLA 4HJOA 5D41A 1PXKA 4GKIA 4JR3A 3NNUA 3BEAA 4IWOA 3AXWA 2P0CA 2PWLA 4YJQA 2JDRA 4C34A 3GNIB 4I93A 2A4LA 2CGXA 2R0UA 2YM4A 2C6MA 4QP6A 3DGKA 3G51A 4UZDA 2JFLA 4FV5A 3KFAA 4MXOA 4G3GA 5FWKK 3QHWA 2XK7A 3CCNA 4H1MA 2IZSA 3QRJA 4DG0E 2WGJA 4MQ1A 4YZBA 5FXRA 4DGNA 4YTIA 4YZNA 2X81A 1DS5A 2X39A 3KRWA 2OW3A 1CMKE 3TTIA 2JDTA 3FZRA 1GZOA 4FIEA 1OUYA 4TXCA 4FT7A 2PY3A 3MESA 3FL5A 4C4IA 2IWIA 2OSCA 4DH8A 4ZY5A 3FMNA 3QC4A 2JDOA 2OFVA 5GJGA 4WIHA 4FEQA 4RIYB 4XLVA 3OXIA 3VS4A 3NYOA 2OI4X 2VTMA 2WFYA 2XCHA 5CY3A 5HBJA 3HMIA 3W8LA 4FT3A 3EMGA 3WIKA 5AAEA 3PA3A 4JG8A 5EI6A 4JJRA 4GK2A 2J5EA 3NSZA 3EOCA 3JUHA 4MTAA 3L9NA 3DOGA 4DITA 1H0VA 4UWBA 3RZFA 4XG7A 3HLLA 3HNGA 3WF5A 1XH9A 2WD1A 3EN4A 3MSSA 4IXPA 4XV9A 5DIAA 3TZ9A 5CU6A 4D4VA 5CAVA 5IA1A 5J9ZA 5KMJA 2VO0A 3DZQA 1R78A 3UJGA 4GV1A 1LPUA 2O5KA 3CXWA 3QGWA 3ORTA 5LVOA 2OBJA 4I6FA 3MPTA 4I5MA 4CQEA 5HX6A 3LAUA 2GS7A 4XV2A 5HKMA 5A6OA 5GIOE 3DCVA 3HA8A 4H36A 2ITYA 5EDQA 5B2MA 4CG8A 3EB0A 1GIJA 4RC2A 1J91A 2EUFB 5CNOA 3BBTB 4QMXA 3VS7A 2V22A 3ZSIA 1J3HA 1H0WA 2J6MA 2NO3A 2QHMA 3RHKA 4F7NA 4X0MA 3H0ZA 1UU7A 4UMTA 4CKJA 1H4LA 4C3PA 5KMLA 2J0MB 5HO8A 2YJSA 3UO5A 2WOTA 3DDPA 3BYSA 3DJ7A 3FC1X 5HCZA 4AUAA 1PXMA 2DYLA 1YVJA 2CJMA 4Z3VA 2XRUA 4IW0A 3NCZA 4JI9A 3A7IA 4AN3A 2OO8X 3LXNA 4WG5A 4DH7A 5CAOA 5J1VA 2IW8A 3F66A 4FTRA 3E64A 3LFDA 4GUBA 3U9CA 1P4OA 4E3CA 4FODA 3GP0A 2E9OA 4FKLA 2C5OA 3GFEA 4FNWA 4FNZA 4FG8A 4MXZA 4BBMA 4C0TA 3CQWA 2XM9A 1R0PA 2UZWE 1U54B 2J0JA 2ZOQA 4IAAA 4ZTHA 3NNWA 2YIWA 4O7VA 4C57A 3NVKI 4QYGA 5AP2A 3ORPA 3EIDA 2C30A 4C4GA 1EH4A 1YW2A 3GU7A 2R3OA 5HBEA 5CF8A 4GFOA 3VBYA 3N9XA 2WMTA 4EUTA 4J8MA 3LM0A 2XVDA 4RRVA 3DXNA 3F7WA 4CLJA 3BZ3A 5CSPA 4I41A 2W1EA 4O0WA 1XO2B 4ZLOA 3A4PA 3L8SA 4IACA 4XP0A 4D2TA 5CF6A 5L2TA 2QODA 2WQMA 4XX9A 5EW9A 5BUEA 3HEGA 5DG5A 5C4LA 3FQEA 4H05A 4RVKA 2UW4A 4DAWA 4IZAA 4J53A 5HE1A 1H8FA 4KKHA 3OT3A 4DBNA 2OJIA 2XNGA 4RFMA 1ND4A 4MCVA 4EOMA 4BDEA 5AM7A 4H1JA 5EQPA 5ANIA 3QTWA 4FR4A 2PTKA 3RAWA 2B7AA 3KXHA 5J87A 1BI7A 2PVNA 4O27B 2C0IA 2F7XE 3BE2A 3EN6A 3VQUA 4RSSA 1OIQA 2W5HA 4TYGA 3WE4A 4F08A 2ITWA 4GK4A 3V8WA 5A14A 3CD8A 1YDRE 3PE1A 2W1IA 5C8MA 3KN6A 3UPZA 3A4OX 1KE8A 3PVGA 4BCPA 3Q32A 4IANA 4UMUA 4A9RA 2HZ0A 2XEZA 3HDMA 4FL3A 4GU9A 5A4QA 3QWJA 5IUGA 2F7ZE 3HMMA 3MW1A 5KMNA 4O6EA 4FF8A 2QU5A 4BCNA 5AUTA 3D5VA 2C6KA 4HCUA 2JIUA 4NWMA 4ZZMA 5LWMA 3NCGA 4F7LA 4APCA 3T9TA 2X0GA 4NH1A 3EQRA 4ASDA 4XS2A 3FMJA 1UU3A 4NU1A 1XH5A 3WF6A 1H1QA 2ONLA 4K18A 5JT2A 3OBJA 4Y72A 2QOCA 1E9HA 3LFNA 2ZV9A 4GFMA 4WNMA 5ACBC 4NK9A 4JRNA 4O2PA 4RFYA 4HYUA 4FV0A 3BWFA 3S95A 4BI2A 4C36A 4IFCA 5KCVA 4NFMA 3R01A 4I5HA 4AW0A 2OIQA 2BTRA 2W5AA 3C4EA 5CYIA 3RPRA 4YUQA 2Y4IB 5ETIA 5HICA 2VTNA 2XKFA 5JGAA 5IUHA 2G2HA 2IW6A 3O8PA 4TPTA 4M69B 2PULA 4L53A 2BUJA 2HW7A 5FQDC 1JSVA 4FSYA 3O7LD 3FI4A 5AV0A 3W1FA 4Y95A 2YDIA 3V3VA 3G0EA 3PP0A 5HHWA 4BWPA 1YOLA 4FIHA 4BKZA 5AUXA 5AMNA 2QC6A 3ZEPA 2VUWA 4AFEA 3N4VA 4D1SA 3VF8A 2QLQA 3Q9ZA 2WTKB 1HCKA 4OTQA 3VUDA 4DT9A 4YZ9A 4XBRA 2P33A 5CF4A 4FTUA 2BHEA 4M8TA 3BV2A 3COIA 5LCJA 3MIYA 3LVPA 3QTQA 3U54A 2P2IA 3G33A 1QPDA 3DY7A 3GGFA 4EZ7A 2PL0A 4EWQA 3C13A 5D12A 4RQKA 4CV8A 1KUTA 1LEWA 4QQ5A 1Y6BA 4IZ7A 3Q96A 5FXQA 4NFNA 3R9HA 3UP7A 1XBCA 5DYJA 3P78A 3QTIA 4D2WA 3FMDA 1J1BA 3DBCA 2R3HA 5F95A 4FVRA 4NM0A 4YJVA 2PVMA 2J0IA 5AV1A 3LZBA 5HCXA 5FP5A 3RAKA 4IHPA 1IASA 2CLQA 3KRLA 2W17A 4BF2A 4FUXA 3EQHA 2R3NA 3E93A 5KUPA 4FSTA 4GRBA 2W1HA 3AC2A 3RALA 5HZNA 3ALOA 3NW5A 4RA5A 2QOHA 3VJOA 2WMVA 4M84A 4QMVA 3QQFA 4F1MA 4GIIA 1DAYA 5GJDA 4EOIA 4EH7A 3TACA 3PIYA 5I9XA 4FZFB 4GS6A 2NNWB 3LCKA 3EQFA 4QTAA 3HX4A 4BDBA 4EK5A 1YI6A 4C61A 3DK3A 2X7FA 2UUEA 2P2HA 4O0UA 3Q53A 3EN5A 1ZRZA 5F20A 4BDJA 1RE8A 1ZLTA 3E88A 4ACGA 4CZYB 4X3JA 2P4IA 4GK3A 3ZBFA 1VYZA 1M14A 4I0TA 3VHKA 4BVUA 5DBXA 5GZ9A 3OS3A 5GZ8A 2BMCA 3UZTA 4FZ6A 3QD2B 4R1VA 4O0RA 4J98A 4TYEA 1Z9XA 2WKMA 2VTRA 1A9UA 2B9JA 4G3EA 3RZBA 3U87A 3GQLA 4AF3A 5E92A 2XEYA 2YAAA 3PXZA 2G15A 4LRMA 3H0YA 4CRLA 4ZZNA 2JKOA 3SQQA 4BHNA 1YI4A 4KABA 5K5NA 3LM5A 5CQUA 1QPCA 5BUIA 2DWBA 4LGDA 2AC3A 2PVJA 2WO6A 3D9VA 3QL8A 5FGKA 3UVQA 4QMTA 2AUHA 3NUXA 3Q04A 2ITXA 4XV1A 4EH2A 5CALA 3COHA 3PJ8A 4D2SA 5DE2A 2HZ4A 4EH9A 4AT3A 5L8KA 3CQEA 3E7OA 3FLZA 3SXFA 5AUYA 4DTAA 3IG7A 3KA0A 3ORKA 4L3LA 3FZ1A 4FKQA 4DF3A 4RZWA 5EFQA 4TYJA 3WZDA 3E8DA 3G2FA 1Q8WA 3UC3A 3LHJA 4ASXA 4OBOA 3FMLA 4L43A 3W55A 2P3GX 4QMPA 3NIEA 3BBWA 4DTKA 5DHJA 4DGLC 4EOJA 2B55A 3DTWA 4WSQA 3ORIA 3F5UA 3TKIA 4M7IA 4MNEB 2A27A 2EXEA 3COMA 5CT0A 3U9NA 2PVKA 3VO3A 4QTBA 4EHZA 5E8XA 3QX4A 3F3VA 1F3MC 3EZVA 3KK9A 5B2LA 5HD4A 2IG7A 4I5CA 4KIPA 5HCYA 1KSWA 3R8VA 3HZTA 4Z7HA 4ACCA 4BDGA 3FSKA 4I22A 1T45A 4IBMA 3HDNA 5EOLA 1M2PA 1W83A 3F5PA 3R8ZA 1VZOA 3I60A 4BFMA 2XIXA 3S3IA 4AW1A 3FYKX 1PYXA 3HKOA 4BCFA 4E4LA 2GHMA 4NIFA 4AW5A 1XH7A 4FVQA 5E8VA 2UZVA 3ZO4A 4BZOA 4YTCA 4ZTRA 3QCXA 4EWHA 3V5QA 4TWNA 2UZUE 1PF8A 2YM7A 1FQ1B 3DAEA 4KIQA 3Q9XA 4N6YA 3T3VA 3IK3A 2VWWA 4NT4A 3TKHA 4YMJA 5KMIA 4F64A 2X4FA 3A60A 3UP2A 4BIBA 3PG3A 4RIWB 4F99A 2PZRA 2R9SA 4IIRA 2J9MA 4NW5A 1YXSA 5A54A 4YHJA 1PKGA 2OH0E 5M56A 2CPKE 5EI8A 3D5XA 3SKCA 3FV8A 5EKOA 3Q4CA 4QPSA 5F4NA 4RT7A 4FTCA 3HP2A 4AG8A 4EK4A 5I3RA 4YZCA 2C4GA 3NUUA 2XK3A 4AGDA 4EC9A 5IF1A 5HOAA 4ZTNA 3QD3A 1Y6AA 5FTOA 3F3TA 4U41A 2VWIA 4APPA 4BCQA 4C3FA 3MIAA 3L9MA 1RQQA 5LVLA 5AP0A 4C59A 4Z7GA 3KULA 3D0EA 3OP5A 5HE2A 4BN1A 3BYVA 3PA5A 3LFEA 5KZIA 1JKKA 2W05A 4M67A 4BTJA 3E3PA 4JIKA 4ZK5A 4O7LA 2VWYA 3LQ3A 1L3RE 4NEUA 5EM8A 2ITVA 3EFLA 3RWQA 5T68A 3W33A 5DT3A 4W4VA 3GU8A 2J4ZA 3AOXA 4MNFA 3VUKA 5DRBA 4CYJA 2YISA 4B0GA 1G5SA 3R7GA 5A46A 1YI3A 2OJJA 4FVPA 4ZSLA 1Q8YA 2YZAA 3MA6A 3ULZA 4J8NA 5AJQA 4O82A 4Q5EA 3I5NA 4DEHA 3WF8A 4FTAA 2VTAA 4QP7A 5BVKA 3TNWA 5HO7A 2C5VA 2Z7QA 2XIRA 4JAIA 4PP9A 4RWJA 4ZS0A 4C3RA 5C1QB 5LQFA 2Q83A 4U9AA 3BRBA 4EHEA 2CGVA 2X8IA 2Z8CA 5AR7A 5TO8A 3VS5A 2UZLA 3GB2A 4M66A 2DUVA 4RG0A 4NTSA 3VS0A 4RA4A 1Q5KA 4IZYA 4A4OA 3GBZA 3MV5A 3W2RA 4I1ZA 3DS6A 4FTQA 3U4WA 1JKTA 4E1ZA 3P08A 2B9FA 1ZYCA 2BFXA 3HL7A 1OECA 3HA6A 5LJJA 1XQZA 3PFQA 2Y0AA 3MJ2A 4MD8E 3R9OA 4X3FC 3DNEA 4BWKA 3TDWA 2UVYA 3W2OA 3NDMA 4FMQA 5D1JA 4EOPA 2QCSA 1UNGA 2H6DA 4GCJA 3HRBA 4CGAA 3DLZA 5BQ0A 3BLHA 2C68A 3VF9A 3AC4A 5KNJA 2CKPA 2X2LA 4IQ6A 5HD7A 2CCHA 3DK6A 3IW7A 4G34A 1VYWA 2YABA 1TKIA 4W4WA 5E8ZA 1NVQA 3CY3A 4BBEA 1XH4A 3VRYA 1W84A 3Q3BA 3MVLA 3TJDA 1BI8A 4K77A 2A1AB 4OTIA 2XM8A 3NZ0A 4QP8A 4QP1A 5H3QA 3V8SA 5HVYA 4S34A 4DN5A 3VW8A 3VBVA 5L2IA 4JX3A 3KF7A 4BDHA 3HUCA 4USDA 4AZVA 3MB7A 3QLFA 4G6NA 3C9WA 1JSUA 3BGQA 5LOHA 2Z02A 4OR5A 3PIZA 4QD6A 5IPJA 3DTCA 3SXSA 2YDJA 5JGDA 2ESMA 2C6LA 3QD4A 2C6IA 4ACMA 3K5VA 1YHWA 3PUPA 5DN3A 4HNFA 4BBFA 2CHLA 4K1BA 4B8LA 4EQUA 3Q5ZA 2W7XA 5AR8A 3GVUA 5FEQA 2XA4A 3Q5IA 4MWIA 5CZHA 2YERA 2V7OA 3C1XA 1WVWA 3QZFA 4C35A 3P4KA 5CAQA 3FMKA 4IJPA 4E26A 3R71A 3ORMA 3ZRMA 4U5JA 3G9NA 3PA4A 4PF4A 5J8IA 5JFWA 1SVEA 4C8BA 2GQSA 1M2QA 4UXQA 3ANRA 3CPBA 3KU2A 2XJ0A 4BYJA 1OL5A 2V0DA 2FB8A 3VVHA 4DFZE 1YHVA 3OCTA 3JR1A 3Q2MA 3R1SA 3FKNA 4ONAA 2OIBA 2ZYBA 4U80A 4C37A 2FO0A 3OMVA 5C27A 1ZY5A 4IEBA 1PMNA 4MF0A 3UODA 1B6CB 3F88A 3SW7A 5I9WA 1L8TA 5EM5A 4HCVA 4MAOA 4R1YA 5DA3A 5CEQA 1KOAA 5EYDA 4FSUA 4J99A 3Q6WA 5M07A 4CT1A 5BYYA 2UW8A 4F9CA 2IZUA 4QMOA 2A19B 4UMQA 3NUYA 4W9XA 2XCKA 1O6LA 3SW4A 4O86A 3IO7A 3IGOA 1NY3A 4OTRA 5FDPA 1V0OA 3BU5A 4BI0A 2R3KA 4DCEA 3DBQA 4YURA 2OG8A 4QYEA 3O0GA 4JL9A 3F61A 2BZIB 4ID7A 3BYOA 3WI6A 2B9HA 3LQ8A 3NUNA 3FLWA 4O6LA 1JOWB 2BDFA 2ITTA 4BCIA 5CVHA 4YJOA 4YSJA 3SVVA 2B9IA 3EQBA 5BVOA 4AX8A 4QMNA 3OC1A 4FNYA 4MXCA 4O83A 2WZJA 3PG1A 4LV8A 4RWLA 4IC8A 4B8MA 3F3WA 3M1SA 2WU6A 3KK8A 1YDSE 3R1NA 4GH2A 4R3PA 3BEGA 4V04A 4EK8A 5I0BA 3F2RA 4IDVA 5CI7A 2WMXA 4E4MA 4RIXA 2HZNA 3QTUA 4YO4A 4D2RA 3AGLA 3EHAA 4WG3A 5AUUA 3N4TA 4FZAB 5FEEA 4O7WA 3ACKA 2R4BA 3QCYA 4D2PA 2WOUA 5CVGA 4IX3A 2WTDA 2RL5A 4F70A 3GCQA 2ETRA 4PPBA 4AQCA 5L6WL 3KY2A 4HYHA 5CASA 4AA0A 2E9PA 1K3AA 2HY81 3NLBA 2WEVA 3C4XA 3PLSA 3QX2A 4FIFA 4I24A 4MD9E 4RC3A 4XLIA 5M4IA 5IQFA 3OBGA 4GYGA 4QNAA 5AV4A 3VBQA 3ZM9A 3QKKA 3TTJA 4FKVA 3ZONA 4F65A 5TR6A 3G90X 4P4CA 4WO5A 3D2KA 1JBPE 4WUAA 3FLSA 1OIRA 4A4LA 4DT8A 3MVJA 3ZMMA 4Q5HA 5LMAA 4CFMA 4M15A 4JAJA 3TZ8A 3ANQA 3AT3A 4IVAA 4X3FA 4EORA 3S4QA 3SA0A 2JKQA 4BCJA 2V7AA 2OLCA 3OVVA 1KV1A 3ROYA 3V04A 1ZYSA 1JVPP 4CG9A 3O71A 5DWRA 3QXOA 2VX0A 2OF2A 4OBPA 4KSQA 3TI1A 4A9YA 5JQ8A 2G2FA 2OXYA 4NUSA 3UE4A 4ZSEA 4RJ5A 4EHVA 4TKSA 4U8ZA 2C6TA 4KUJA 1CM8A 3MY5A 2O0UA 4MK0A 5J5SA 3G6HA 5LVMA 1T46A 1BKXA 3R8MA 2VWBA 3F3UA 4D58A 5JMSA 2B0QA 2A0CX 3QCSA 5AV2A 3IW5A 5AP4A 4BDAA 2FUMA 3L8PA 4Y83A 1YWNA 4PMPA 4B7TA 2UZBA 3NIZA 3QU0A 4EQMA 4KINA 1J7LA 1WFCA 2FVDA 2CMWA 3LFFA 4S2ZA 3KN5A 3HV4A 4GVAA 1JNKA 3QTSA 4L9IA 4A9UA 4TL0A 1XJDA 1NXKA 2JAMA 4ERKA 1NVSA 1V0BA 3WYXA 4Q9ZA 3FLYA 1LUFA 1ZOGA 4YGAA 4E5BA 3EL8A 4QQCA 4I0SA 3TL8A 1U59A 1Y57A 3RBWA 1LP4A 4FKWA 3RCJA 2W0JA 2OXDA 3IONA 2IO6A 3FZOA 3DQXA 5IQIA 3KKVA 4E6CA 3CGOA 4YSMA 3K3JA 4FYOA 5ANOA 3NS9A 4LGGA 4KS7A 5DT0A 4O84A 5G6VA 1PXNA 3C4WA 2OJFE 2CLXA 4F09A 4H3QA 3AD5A 1BUHA 4IWQA 3PXYA 4GVJA 3JXWA 4IC7A 4LL0A 4LUEA 4BICA 4CRSA 5J9LA 2X7GA 2VO6A 2XNEA 4RC4A 3W2CA 3ORNA 4O7RA 3CR0A 4I0RA 3ZDUA 3GCVA 3IECA 3QQJA 3E5AA 4HGLA 1OITA 5AP6A 3U55A 4BWXA 3O51A 1PXJA 2HWOA 2VV9A 3BHVA 3Q4UA 3RPVA 3DU8A 4AZSA 1MRVA 5LCKA 5L2WA 3PSDA 4FT5A 4G5JA 4RGJA 4RWIA 5EOBA 1ZYLA 4JDIA 5CS6A 4QYFA 5IA5A 4IX5A 3PWDA 4KNBA 3Q4ZA 4C4EA 2ZVAA 1ZMWA 4I4FA 4EBWA 1AD5A 2XK6A 1PYEA 3GOKA 4K9YA 5DGZA 1OKYA 3B2WA 4PUZA 2ZM1A 3PY0A 3ZU7A 2YZLA 4LGHA 4JRVA 2F4JA 5J7BA 4L00A 3H9RA 3EQGA 3PPKA 5CEIA 5BMSA 1WVXA 3LMIA 1P5EA 2CNQA 3ZSHA 1PMUA 2YAKA 4KBCA 4U44A 4ERWA 3MI9A 2XNNA 3CP9A 3FMHA 3II5A 3P79A 3H9OA 5CEPA 1OMWA 3FXZA 3QRKA 3EL7A 4FTIA 3CSVA 3D7TB 3BHTA 3ETAA 3MH1A 1MRUA 2YLFA 4USEA 5CANA 3OZ6A 3G6GA 3ZTXA 1BL7A 2FSTX 4J71A 2BDWA 5HESA 3TNPC 2I0EA 1IRKA 4E5WA 3DXQA 4FGRA 5M06A 4LQMA 4MD7E 3VUMA 3NPCA 4RLLA 2R3IA 3NRMA 4E73A 4JT3A 4IM2A 2YJRA 3TJCA 3TNHA 5I9YA 2WEIA 2R64A 3CIKA 2XYNA 2PUUA 5EYKA 4MH7A 1XWSA 3SX9A 2W1GA 5CXZA 3GU6A 5AR4A 5AEPA 4EZ3A 1RDQE 4NZWB 3NEWA 3M42A 4ZS4A 3LCOA 3IDBA 1APME 3PSCA 2O8YA 4S32A 3PP1A 3PZEA 5DOSA 3TM0A 3UVRA 4L42A 1QL6A 1PY5A 3Q52A 4TNDA 5KMOA 1JKSA 1SNUA 3ELJA 4KIKA 4O0VA 4BCMA 4O81A 1MUOA 1PXIA 2ITOA 2BAQA 3LIJA 4U0IA 4F0FA 4ANNA 2XIKA 3BQRA 4GW8A 4M3QA 3QCQA 3OT8A 2VD5A 3FKOA 3TCPA 3VW6A 3KXGA 1YOJA 4AS0A 1H1WA 2ZDTA 4TRLA 2BKZA 3UOJA 4AE6A 3EKNA 4ZEGA 3ZLXA 3ZO3A 1ZOEA 3TZMA 5I5ZA 2WPAA 1IA8A 2NRYA 4LMNA 2VRXA 5I3OA 4F6UA 3VRZA 2J90A 3EYHA 4FIJA 4FSMA 4ZOGA 3NYNA 3WZKA 4P5ZA 3IW4A 3NNXA 4LV5A 5HI2A 1PXPA 4B99A 5JGBA 3S0OA 3D94A 4M0YA 2OF4A 4PMSA 4U3ZA 1OIUA 5K3YA 4JNWA 4CFUA 2CN8A 4V0GB 4MEDA 3LJ0A 4U42A 1Q41A 3KCKA 3KRRA 2W1CA 2ITPA 3MN3A 2UZEA 4I94A 4S31A 3P0MA 2XYUA 4WSYA 1U5RA 2QO2A 1ZAOA 2IZTA 2R7IA 3FI2A 3F2AA 4QPAA 5T3QA 1UWJA 4KS8A 4NTTA 1FMKA 4BDCA 1O6YA 3LMHA 4D0WA 5M57A 4JBOA 2UVZA 3R9RA 2G9XA 2WHBA 4EJ7A 2WTVA 4JBVA 2PE2A 3OROA 4YJUA 2NPQA 3MH3A 1JKLA 2P55A 1R3CA 3UPXA 2QONA 5LARA 2DS1A 4YC6A 2JGZA 4EK6A 3UIMA 3I7BA 1ZYDA 3FL4A 4IAFA 3VIDA 3QUPA 1UKIA 2W4JA 5JSMA 4QMYA 2OFUA 5L2SA 4CEGA 1OBDA 3POOA 3MPAA 5C4KA 4OTWA 4IE9A 2XF0A 3BGPA 2RGPA 5DR9A 4WA9A 2EXCX 4MHAA 3VHEA 4D9UA 4YTHA 4FTOA 2QD9A 2X1NA 5CEMA 5CXHA 2WQNA 3C0GA 5IA4A 3KXXA 1Q8ZA 3O8TA 3FPMA 3GC8A 4R77A 3DJ5A 3LLAA 3GU4A 3ZBXA 3D14A 4KKEA 4LOPA 4BDKA 4FV1A 3KVWA 4ZZOA 3LKMA 3A99A 4O21A 4IAIA 3QHRA 4LM5A 3LLTA 2BIYA 3VNTA 3WARA 3JVRA 4G3FA 3ZOSA 1ZMUA 4NIFB 1OGUA 2H96A 3CJFA 4FTMA 5CVFA 4YZMA 3QYWA 3QQUA 2OWBA 3GUBA 3QZHA 4X2GA 3UIUA 5ANGA 3HV3A 1Y91A 1OL7A 1ZMVA 2XKDA 3NYXA 3AC3A 3UTOA 1K9AA 3NGAA 1P2AA 1KE7A 3JVSA 3VUHA 2ACXA 2QO9A 2QQ7A 4QRCA 3PLAE 1OIYA 4RJ3A 3OWJA 5KBRA 2Y4IC 4MX9A 1JSTA 1H25A 2GPHA 2UV2A 2WU7A 2W4KA 3CTJA 1H26A 1W7HA 3QZIA 4PQNA 4XG2A 4YPSA 2GQRA 5IEXA 4UYNA 4AFJA 2B1PA 5H8BA 4H3PA 2IZRA 1BYGA 4FTLA 4UMPA 2QOLA 3TN8A 4IAYA 4ZMFA 4FV7A 4ZJVA 3R04A 5C8NA 2F57A 2YCQA 3E87A 3ZLYA 4GG5A 3E8EA 3HVCA 4UYAA 3ZLSA 3BI6A 5DVRA 2ETMA 1J7UA 4RJ4A 3W18A 5DR6A 3PYYA 4KSPA 4ANLA 2WTKC 3MFSA 5JEBA 2XKCA 4CMOA 4EZ5A 4ZXTA 2UZTA 4XCUA 3OXTA 1TQIA 2YACA 3HRFA 5ANDA 5J5TA 4I3ZA 2BZKB 3RTPA 2PVHA 2J0KA 3AD4A 3P1AA 1SVHA 2VO7A 3CJGA 4EH5A 4PMMA 4CXAA 4R3RA 5FDXA 2W96B 5AAGA 3F5GA 4PDPA 5K0KA 3RNIA 5M4CA 3S1HA 3W2SA 2WTCA 1PMEA 3WF9A 2OXXA 4D2VA 4XOYA 2VAGA 3MPMA 2XNPA 4NKAA 4IVBA 2BIKB 3O50A 3DBFA 2IJMA 3PSBA 3QTXA 4DFUA 2BRBA 3Q9YA 4HGEA 4EJNA 5IH5A 4TZRA 4BCGA 4BDDA 3C0IA 3I79A 5DRDA 4FTTA 2GCDA 4DBXA 1LEZA 3TUCA 4RWKA 4JQEA 2CDZA 2VWUA 5EM7A 4EL9A 4JG6A 4UN0C 3HV7A 4ZLZA 4LMUA 3OOMA 2HK5A 4FSWA 5M53A 3R22A 2YM3A 5H8GA 5DPVA 3T3UA 2ITZA 5A4CA 4F7JA 4A06A 3I1AA 2QG5A 1WMKA 2O64A 1PKDA 5CAUA 1CKIA 1BLXA 3THBA 3BQCA 3DJ6A 3A7FA 3FZSA 4FL1A 3UOKA 5KKRB 3WE8A 1XR1A 1SMHA 2R3RA 3LW0A 3D7ZA 3OTUA 4J97A 1P4FA 2I1MA 5E1EA 3VN9A 2F9GA 1MQBA 4WUNA 4HVHA 3TT0A 3BKBA 3K54A 2C0OA 2WQBA 3UIXA 2OZAA 5KE0A 3U6IA 3ZO1A 5EQEA 1YOMA 2ZM4A 4PDSA 2NRUA 3OEFX 2PU8A 2WXVA 3V5WA 4H3BA 2C5XA 4NM3A 3DDQA 5EHOA 1ZZLA 3RPYA 4ALVA 3FMEA 3GI3A 1XHAA 2XB7A 4JLCA 5AR5A 2Y9QA 3EQDA 3IW8A 3HGKA 4FKSA 2I0HA 3FHIA 2XBAA 3B2TA 4X2FA 4HNIA 3K3IA 2X6EA 4OTFA 2PMLX 3UMXA 5IQCA 1SYKA 3O17A 4RIOA 3UZRA 4CFXA 1OUKA 2PE1A 3PJ1A 2J2IB 4GSBA 5AP1A 3Q4TA 4BKYA 1GIIA 3FLQA 4BC6A 4L7FA 2YM5A 3H10A 5JRQA 3LFCA 2GNIA 3KXMA 5CSXA 1W0XC 3EQIA 4EH4A 5CU0A 1G3NA 4ITJA 3GC7A 5FLFA 4YLJA 5AA8A 4GFGA 2GS2A 1Z5MA 1Z57A 4NCTC 1U46A 4RVTA 3BU6A 3RVGA 3R83A 3EN9A 3A7JA 4EONA 2XIZA 3GU5A 5JH6A 3DT1A 1M7QA 4QPMA 3KMWA 2RFNA 3DV3A 2BCJA 1BMKA 3PY3A 4ARKA 1SM2A 4IWPA 5CU2A 1IAJA 4CZTA 4BHZA 4A7CA 2OJGA 2JBOA 2WMAA 2Q0BA 1AQ1A 4Z16A 4G5PA 4ITHA 1QPEA 4DLIA 3JY9A 3DA6A 4MXYA 5HVKA 3H30A 1H24A 4J52A 5CI6A 4FSNA 2GDOA 4KWPA 5DNRA 4S33A 3IW6A 4XMOA 3R7UA 5C8KA 3GXLA 2OIDA 4RJ7A 5EM6A 2ZDUA 2VTIA 2QOFA 3MB6A 1Y8GA 3SHEA 4DEDA 4L3JA 2Y4PA 2BZJA 5FTQA 3ZRLA 2EXMA 3VQHA 5HORA 4IJ9A 2HYYA 3SG8A 3MVHA 2QO7A 5B2KA 5AM6A 2YHVA 3PVUA 3R02A 4G6LA 4R78A 1AGWA 4XBUA 3W2PA 3PY1A 4TWPA 4U40A 1ZOHA 1CKPA 3EFKA 4F0IA 4GKHA 5AUWA 4EI4A 1IA9A 4CTBA 4FGBA 1KWPA 3D5UA 2PHKA 4BB4A 3KREA 4AN2A 2W1FA 4DHFA 4O7TA 5BPYA 4OUCA 4Y73A 4QNYA 5A4EA 2REIA 4HPUE 4O91A 2OK1A 3VS1A 4UX9A 3CTHA 1FPUA 3NMUF 2I6LA 4YO6A 3V8TA 3DAJA 2XKEA 3PRIA 4IB5A 4BZNA 3UNKA 4N70A 3TV7A 2WTIA 3AG9A 1TQMA 4RIXB 2LAVA 3NAXA 3UG2A 5AP5A 4ALUA 5BVFA 1JPAA 2O2UA 3LXKA 4BDFA 4CSVA 4H58A 3QQHA 4B9DA 3FQSA 4FA2A 3FMMA 5H2UA 3F2NA 4K2RA 2C0TA 5IUIA 4BGGA 1B38A 3CD3A 1MP8A 3HUBA 2CN5A 2I0YA 4AGUA 4J95A 4Y5QA 1BX6A 5E8TA 4FC0A 4WT6A 3UQCA 4JIAA 3VBXA 4NKSA 1JQHA 5L8JA 3ZH8A 4PRJA 3ZEWA 4FT9A 3EWHA 3ZXTA 3C4ZA 3N51A 5AWMA 1O9UA 4A9SA 5LMKC 3JYAA 4QO9A 4XH6A 4C38A 4Z55A 4GT4A 3P23A 1MRYA 4G9CA 5DFPA 4QQTA 3D5WA 2BRHA 4NJ3A 2WMQA 1CKJA 2PE0A 4P90A 4RJ8A 1H08A 4RX8A 5CEOA 3GCUA 3TIYA 4K11A 1G8SA 3MGYA 3R63A 2C6DA 3LQ5A 4RX9A 2PUPA 5JZJA 1ATPE 4G3DA 3KCFA 4X3FB 1YXXA 4JDKA 3P86A 3W16A 4LRKA 3ITZA 5GINE 4D28A 3OW3A 4E7WA 3DBDA 3QRIA 4QTCA 5HG9A 3ZFYA 5KX8A 3H9FA 3OOGA 3MS9A 2GTMA 4Y5HA 3EQPA 5HX8A 1H01A 1SVGA 3QKMA 1GNGA 2SRCA 3A2CA 4YLLA 5FM2A 4AGCA 3ORZA 4OT6A 2V62A 2GFCA 2PZ5A 3QALE 4BKJA 5HU9A 4GL9A 3DFAA 4U97A 3AC5A 2OH4A 3MH2A 3OEZA 3PJ3A 5EW3A 5DT4A 4IH8A 4RX5A 3MJ1A 2EWAA 4DGOA 4TWCA 3KL8A 4HZRA 4IWDA 3I4BA 5CU3A 1KE6A 3TZ7A 3RAHA 3UDBA 1PXLA 4CKIA 2PUIA 3R00A 5CWZA 3P7CA 4AN9A 2YDKA 3E8NA 3AC8A 4ZP5A 4PNIA 3R7VA 2OU7A 2XS0A 3CTQA 4D5HA 3A61A 4XG3A 3POZA 3TUDA 1OPJA 2IVSA 5TOZA 4F1OA 3REPA 5IG1A 2Y8OA 3ZFMA 4YP8A 4NCTA 3V5JA 2VGPA 3R1YA 4J7BA 3QLGA 3G5DA 4L68A 5IA0A 3PXRA 2BDJA 2ITQA 4QT1A 1WBNA 4R3CA 2ERZE 2PSQA 3BLQA 5GNKA 3NR9A 5HIBA 3KXZA 4MNEA 1UNLA 5HNBA 1F0QA 3U6JA 3CKWA 4M68A 3GOPA 4G9RA 4QMLA 1VJYA 2VTQA 3NWWA 2OKRA 4K33A 5D11A 1ZZ2A 3VWAA 1JWHA 3LFBA 3K5UA 5CX9A 3SG9A 3PXKA 3UOLA 5A4TA 1QMZA 4AW2A 4DEGA 5AUVA 5FRIA 5L6OA 4BL1A 3RI1A 4O7SA 3PRFA 4ZTQA 3QTRA 3UNZA 3KB7A 2RF9A 1UV5A 3G0FA 1UU8A 2WMSA 2JD5A 4D1XA 2HXLA 3M11A 3MDYA 3MFTA 4FICA 3VAPA 5IEVA 2BHHA 2WIHA 5K5XA 2YEXA 5HG8A 3NNVA 2ZAZA 4G6OA 4RIWA 5C01A 4OBQA 3C51A 4EH8A 3CS9A 5E8YA 1UKHA 2Q0NA 3WZUA 4CQGA 2VX1A 1H07A 5EG3A 2X4ZA 3R2BA 1ZYJA 4QOXA 3SOCA 2I40A 1VR2A 3JS2A 2FA2A 2VTSA 5HBHA 3FJQE 3ZFXA 3PVWA 4M12A 3OTVA 3OUNB 2KULA 2WTWA 4Q2AA 5HG5A 4ANQA 2GNJA 5TF9A 2HY0A 3DKFA 3QXPA 5DH3A 5AUZA 3QA8A 3H3CA 5CU4A 2PMOX 4TY1A 1H27A 4I4EA 5HNIX 2VWXA 3P7BA 4WBBB 3RM6A 3ZZEA 4DFLA 4JG7A 2UW6A 4HW7A 5IQAA 3MY0A 2ZMDA 2G01A 1YWVA 2JIIA 4MBJA 3WILA 4ACDA 4DEIA 5AADA 3WYYA 4FKIA 2YCFA 1FBNA 1SNXA 1Q99A 1GZKA 3GFWA 4G1WA 5BVDA 2PVRA 2BRNA 2VTTA 4UXLA 5FM3A 4CV9A 4NM7A 4E20A 3ERKA 1CSNA 4KD1A 4FV2A 3MY1A 4DH3A 1KOBA 1R39A 5AR3A 5FP6A 4CNHA 3DNDA 3ZZWA 4AAAA 4X6QC 3E92A 4CMTA 4F7SA 1URCA 5CNNA 4I6BA 3L8XA 4FKTA 3C4CA 4WBOA 4KIKB 4CKRA 2R0IA 4F0GA 3I0OA 4FL2A 2XIYA 2GMXA 2BAKA 5K9IA 3TV4A 4YLKA 4ZIMA 3SRVA 4AZFA 1Q61A 2WB8A 5C9CA 4F63A 3VULA 5LMKA 3PPZA 1OB3A 2EB3A 5EYMA 3DLSA 2GNHA 2UZNA 2R3QA 4K6ZA 5CT7A 1Q8TA 2W1DA 1BL6A 2RSVA 4YC3A 3ENHA 4C58A 4R5SA 1GY3A 4GYIA 4NYEA 3MFRA 2X8DA 4C02A 1GZNA 2HENA 4AGWA 4N57A 4S30A 5IQGA 4ZJJA 4I23A 5IQHA 3VUGA 2C6EA 1YQJA 5BMMA 3V5PA 3EJ1A 3ZS5A 4C2VA 2CKOA 1UWHA 3IS5A 2XMYA 1OKVA 3RAIA 2R5TA 2W06A 3OWLA 4I21A 3UG1A 4EKKA 1J7IA 1ERKA 4L45A 2J51A 4YPDA 4KIOA 5BYZA 4FI1A 4DFXE 4LL5A 5HGIA 4M14A 4AXAA 4FZ7A 3WOWA 3HYHA 2IVUA 2X6DA 2Z60A 5ANJA 3M2WA 1OBGA 2XBJA 5A9UA 3RGFA 3RK5A 1JAMA 2XP2A 3QD0A 4AT4A 5L8LA 1JLUE 3IDCA 4F1TA 4FV4A 5KO1A 4ZY4A 3R7EA 3PPJA 1W82A 2E2BA 2ERKA 2QOBA 2W9ZB 2QVSE 4FV8A 4YJRA 4FKOA 4H39A 3B8RA 3EFWA 5EH0A 5DR2A 2VO3A 2VWZA 2WELA 3LOKA 5L2QA 2CNVA 3IQ7A 3QA0A 3KXNA 4O0SA 3WF7A 4AOTA 3W10A 3VUIA 4EEVA 4TYHA 4HGTA 2IVTA 4QMZA 5EDRA 3ZLWA 4YR8A 2C3JA 3EZRA 5CSVA 2I7QA 2UW5A 3R21A 3FLNC 4RVMA 5I9UA 4CCUA 5AX9A 3I81A 4QYHA 3OUKA 3PJ2A 2YIXA 5J95A 3DK7A 2YIQA 4FOBA 5HE3A 4HZSA 1V1KA 1P14A 2WMBA 3W8QA 3BIZA 3ZUVA 4UWCA 5KMMA 1H00A 2YLEA 4L67A 4O38A 4KBAA 2BKKA 5GIPE 3BX5A 4BYIA 2FGIA 2XNBA 3EH9A 4IX6A 5J7HA 4O1OA 5ANEA 3W32A 5HNGA 3E7VA 4RVLA 4ASEA 2W99B 5FBOA 3ZUTA 4E8AA 4L8MA 2PZPA 1Y8YA 2J50A 3F3ZA 3FQHA 3I6WA 3MFUA 4HPTE 2ONLC 4I6QA 4FKPA 4PPCA 4DEEA 3GENA 4E6AA 4AZTA 4FIGA 4DA5A 3ZYAA 3TIZA 1M17A 4W8DA 5E8SA 4C4HA 3OHTA 3GCSA 2C3IB 4GG7A 3QKLA 5H9BA 2UW0A 4UMRA 2CKEA 2FH9A 4IADA 4FSZA 3VC4A 3UO6A 1YKRA 3R8LA 3NUSA 4PL5A 4ZSAA 4WNKA 4J96A 4XV3A 2GSFA 5GHVA 4EOOA 3ZUUA 2JLDA 4PWNA 3FUPA 2WQOA 2H9VA 4PPAA 3ATSA 1WCCA 4FEXA 1X8BA 4YNEA 4QTDA 3LE6A 3L1SA 5EYCA 4E93A 4PL4A 4TNBA 5ITAA 3EQCA 4FG7A 4MYGA 3NUAA 4DGGA 2HIWA 3BPRA 2QG7A 3ORXA 5L6PA 3HMOA 4Y46A 4PTGA 4EOKA 1W8CA 2J7TA 3CGFA 5ETFA 3EFJA 3SAYA 2HELA 2X9FA 4HVDA 2E9UA 4IB1A 5IA3A 2W1ZA 2XNOA 5AR2A 2JITA 5E7RA 2R2PA 4KB8A 4XRLA 5LVPA 2Z7LA 3N4UA 1YXUA 3F9NA 3RWPA 2EB2A 3Q9WA 2RFSA 1FOTA 4A07A 2RG5A 2Y7JA 3RCDA 4D4RA 2VNYA 4QMSA 3CEKA 4BCHA 5M44A 1WBTA 2EVAA 3PXFA 5DMZA 1KE9A 2PZIA 5JZNA 4KA3A 2ITNA 1YDTE 4IM3A 4YC8A 4GEOA 3HP5A 1YRPA 4GJ2A 4P7EA 3BYMA 2XK9A 3D4QA 4XP2A 5CZIA 1A48A 2X9EA 3QAME 2R3LA 3QBNA 3U6HA 4QQJA 4CYIA 3BU3A 5FD2A 4F4PA 3RHXA 4ZLYA 2PMNX 4PY1A 3LMGA 4GT3A 4IX4A 4ZSGA 1XH6A 5JQ5A 4AACA 2AYPA 4MVFA 3RP9A 4FSRA 3HAVA 3V6SA 4MBIA 4F9YA 5HU3A 3KVXA 4JQ8A 3V5TA 3GCPA 3A7GA 2QI8A 2UZOA 3IOKA 3OXZA 2C5YA 2WMRA 3TXOA 4F9AA 2JDVA 4OTHA 2QOOA 3CPCA 1F5QA 2VGOA 3U8WA 3ZXZA 2HCKA 5HTBA 1REKA 4PL3A 2PYWA 1FVVA 4FV6A 4BIDA 2F49A 4L7SA 2GU8A 3AMAA 3QUEA 2WTJA 2BRMA 2C6OA 3PIXA 1UA2A 2ETKA 2VN9A 5HVJA 2VZ6A 3MA3A 3QFVA 3ZC5A 4X21A 2HAKA 4OT5A 4YTFA 2OZAB 3SLSA 3DB8A 3E8CA 4LUDA 1OPKA 2WIPA 4MXAA 3OWPA 5HEZA 4CFVA 4PNKA 4FEVA 5E4HA 5AP7A 2JKKA 1K2PA 2CCIA 4XJ0A 2BROA 5AFVA 3Q60A 4PDYA 2BTSA 1ZXEA 4NSTA 3G15A 2QHNA 3PE2A 5DI1A 1UU9A 5FTGA 2Z7SA 4XG8A 3G9LX 4XOZA 1WBOA 3OG7A 3PDTA 1O6KA 5IQBA 3DZOA 3GEQA 2CGUA 4WNOA 4LRJA 4BGQA 3COKA 4YJPA 2XK8A 2PUNA 4D4SA 4FIIA 4AE9A 2I0VA 4FUYA 5KHWA 2VNWA 5I4NA 4M0ZA 4BTMA 2J5FA 3L8VA 4W9WA 5CSHA 1WVYA 3KEXA 3VS3A 5JFVA 3QWKA 4HCTA 3FZTA 4FSQA 4EYJA 4IM0A 3UVPA 3QQGA 3F69A 5BX0A 5LXMA 2YIRA 4JX7A 1XBBA 5M09A 2JKMA 5L3AA 4U43A 4D1ZA 3IKAA 4LYNA 3HECA 3FXWA 4FBXA 2ZB0A 2QOKA 4FTNA 4MXXA 3R0TA 1CDKA 4BRXA 2QKWB 4BR3A 2GTNA 4ANOA 3BWJA 4IVDA 4DC2A 2VWVA 1ZWSA 4XUFA 2E9VA 3FY2A 3K2LA 4O0TA 5DEYA 3R9DA 4GT5A 1YXTA 2V55A 5HIDA 3GC9A 5IEYA 4OTDA 3E3BX 3MH0A 3UNJA 3UYTA 5A6NA 5AIKA 2JEDA 2F2UA 3QQLA 3O23A 5FEDA 4DTBA 3BELA 5H8EA 4ALWA 3QYZA 4JBPA 3IOPA 1WBVA 4IZ5A 5AIRA 3WZJA 4C2WA 4TW9A 4WHZA 4RIYA 3VBTA 3ZCLA 4D4YA 5HIEA 3HMPA 4E6DA 5BNJA 5M51A 1WBPA 1M52A 3NW6A 3PVBA 2Z7RA 4R7BA 4GU6A 4DG3E 5IQDA 1OZ1A 2X7OA 4FZDB 3T9IA 2PVFA 4ZTSA 5J79A 2RG6A 3ULIA 1M2RA 2ITUA 1CTPE 3CE3A 2QOIA 4EOQA 3CC6A 5TT7A 4KAOA 1DM2A 3AMYA 3KULB 3C0HA 3EYGA 2BR1A 3ENMA 4RQVA 1STCE 5EHYA 3LJ2A 4MQ2A 3CBLA 5EK7A 4DYMA 2RFEA 4OTPA 3UIBA 4II5A 3LFAA 5HLNA 3QRUA 5JRSA 4OW8A 1XKKA 5K4IA 2RKUA 4FV9A 4XNEA 2YITA 2W4OA 4F6SA 4ZMEA 4YZDA 1IG1A 2YFXA 2HWPA 2QNJA 1Q3WA 3BE9A 1E1VA 3R2YA 5IQEA 4ZSJA 4CFNA 3FPQA 2ZJWA 4ZAUA 3RKBA 5FBNC 2HOGA 5A4LA 4I20A 4D9TA 1QPJA 3OCBA 4WRGA 4EQCA 3AT4A 4JR7A 3D7TA 4YNOA 4EC8A 3O96A 2X2KA 4AA5A 2C1AA 2FYSA 4XEYA 2AC5A 2FSLX 2XNMA 5HLPA 3BYUA 2WQEA 4EYMA 3TDVA 4DFYA 3FC2A 4D0XA 3TEIA 2BFYA 3FBVA 4NW6A 4XG6A 3UOHA 3ACJA 5KZ0A 5I9ZA 1S9JA 4HVSA 4G31A 4RBLA 5EHLA 5IH4A 4F6WA 3LXLA 4KRDA 4C4JA 4HYSA 3ATTA 4G3CA 2OGVA 4AOIA 4OAVB 1WBSA 5AA9A 2O3PA 2IVVA 4FT0A 4FYNA 4IB0A 2W9FB 3R7IA 4D5KA 2O65A 3TWJA 3E63A 4R8QA 3V5LA 5IA2A 3VUTA 4U7ZA 2WMUA 4J1RA 2YCRA 1U54A 3DKCA 2G2IA 4LOOA 4U45A 4UALA 4V01A 2NP8A 5M4FA 4O7NA 3VBWA 4MF1A 4CCBA 3OCGA 4R5YA 5CENA 3HMNA 3EN7A 4OTGA 3RMFA 4YJSA 1WBWA 3AQVA 3P7AA 3FHRA 3S2PA 3VS6A 4Y8DA 3F6XA 4YJNA 3RNYA 4HGSA 4P2KA 1V0PA 3L9PA 3BHHA 3HV6A 4FKUA 3PWYA 5CQWA 3IDPA 2YWVA 2R3FA 3CQUA 4PTEA 3C7QA 1M7NA 5M55A 5KKRC 2QURA 4QMUA 1H1PA 1TQPA 4FEUA 2ZM3A 4ANBA 4FTKA 4X2NA 2FSOX 1YWRA 2QLUA 5ACKA 4V0GA 3FY0A 4JQ7A 3KC3A 3FDNA 4U6RA 3NW7A 3W2QA 3RINA 4B4LA 1H1SA 3C50A 5IKWA 2X8EA 5BYLA 2X2MA 4BGHA 3WIGA 3DXPA 1UVRA 2JFMA 5BVEA 3UO4A 4QTEA 2UVXA 4WNPA 4YU2A 5IU2A 1I09A 4R7HA 4HYIA 3AGMA 4FKGA 3DPKA 2BALA 2BZHB 4EKLA 2BRGA 2ZMCA 5ICPA 2GS6A 4CT2A 5GZAA 2EU9A 4FG9A 4OAUC 1FMOE 3FAAA 3AT2A 4O96A 3FI8A 3EKKA 3KMMA 4DINA 3R7YA 5JFSA 3A62A 4I6HA 5IDPA 2ZV8A 3ET7A 4MBLA 5DLSA 2JBPA 4KBKA 4DG2E 5HG7A 1RW8A 4R6VA 3SD0A
chains in the Genus database with same CATH superfamily
3AC1A 1Q8UA 5D9HA 4QP4A 3ZDIA 4AOJA 4UV0A 4PX6A 4G16A 3P5KA 1W2CA 2XRWA 4QP3A 3R28A 4Q9SA 3CY2A 4IAKA 4KRCA 3AD6A 3BHUA 1IEPA 1S9IA 2UW7A 2UZDA 2JC6A 3UMWA 3RPSA 3TNQB 4GUEA 5KMKA 4ZTLA 4AA4A 1R1WA 3LXPA 4JDHA 1KE5A 4UB7A 2Y6MA 5CF5A 2HXQA 2QU6A 1I44A 4O2ZA 4AZWA 1URWA 1DI8A 4XYFA 2F7EE 4DLJA 5T6KA 4EH6A 4FKRA 4PP7A 4E5AX 2BAJA 2R3MA 4M69A 3R8PA 1OPLA 3MYGA 4HVGA 4RLKA 3I0QA 4OLIA 1QCFA 3CKXA 4V05A 5LVNA 3TG1A 2XZSA 4XRJA 5BVWA 5I9VA 5JN2A 2VTOA 4AT5A 3D2IA 3A7HA 1YXVA 2YCSA 4LFIA 4UZHA 1NW1A 4DDIA 4L6QA 4EHGA 3DB6A 5BUJA 1PHKA 2DQ7X 5AP3A 2C3KA 2XJ2A 3OY1A 3TV6A 4LDTA 1FGKA 4AQKA 1PRYA 4YBJA 4FTJA 3BGZA 4WRSA 3TKUA 4FJVA 4FRFA 1H1RA 2GHGA 2JDSA 3LJ1A 3S00A 3A8XA 5CAPA 3FI3A 4FV3A 4OGRA 4RPVA 4CMUA 2A2AA 2C5NA 2R3JA 5LWNA 4CFFA 5AX3A 3C5IA 4HVIA 3MTLA 2H8HA 2WMWA 5HTCA 4AU8A 3KMUA 2B54A 3QZGA 4A4XA 3JY0A 2QR7A 4QYYA 3SXRA 1PXOA 1H28A 5ANKA 2XARA 2PZYA 4BDIA 4JVGA 5EI2A 2YN8A 3OD6X 3F7ZA 5DEWA 4E4NA 5BVNA 5L4QA 5LMBA 4YHFA 1OM1A 1FVTA 2GNGA 4WG4A 4WKQA 2R3PA 4XG4A 1HCLA 1WAKA 4M97A 3T8OA 2CNUA 3ZRKA 1WZYA 3DKGA 1MQ4A 3QUDA 5HTIA 4RJ6A 4WD5A 4EH3A 4JS8A 4K0YA 1VEBA 5F1ZA 3F82A 1DI9A 1IR3A 5E8WA 5C26A 5CEKA 3R9NA 4PDOA 3UYSA 3SRVB 3ZO2A 5K4JA 4NL0A 4DEAA 2B53A 3RJCA 3B8QA 5AV3A 3FXXA 4N0SA 4NM5A 5B0XA 4ITIA 1ST0A 3IPHA 2OZOA 1A06A 3WZEA 5IH6A 4LI5A 5EQYA 2XUUA 4L44A 4U79A 5K0XA 3GT8A 3R8UA 3FZPA 4QMQA 1UNHA 2PVLA 3LCDA 4EOLA 2LGCA 4FK6A 5GJFA 4JDJA 4RMZA 4C7TA 3I5ZA 3NYVA 4FX3A 4ACHA 2IW9A 2IN6A 4N6ZA 4AZEA 5IZFA 4X7QA 5JFXA 4FEWA 1PW2A 3PTGA 4W8EA 3I7CA 3U51A 1OL2A 3VJNA 4PMTA 5CTPA 4XP3A 4ANMA 4QMWA 5IDNA 4RZVA 5TKDA 5C03A 4BY9E 4ENXA 1YHSA 3QC9A 3NFGB 3D83A 4BTFA 3V01A 4UWYA 2KTYA 5F94A 2O63A 1U5QA 3DAKA 3ZC6A 1Q97A 2YM6A 2QOQA 5D7VA 5HQ0A 3ALNA 5IMEA 3LPBA 1NA7A 4C4FA 2C69A 5KBQA 1ZARA 4MWHA 3SC1A 3UQFA 4RFZA 3F5XA 3UDTA 4IFGA 2ZV2A 3QRTA 3ODZX 1GZ8A 4CD0A 1XBAA 2VX3A 5IISA 2V5QA 4GIHA 4HOKA 2FSMX 2B4SB 3UC4A 3L9LA 2X0PA 4MKCA 4MUQA 4BCOA 5JKGA 1NT2A 4YHTA 3PXQA 4QP9A 2GHLA 4A9TA 2VTHA 1TVOA 3HAMA 4D55A 2VU3A 4TYHB 5E1SA 3HRCA 5HO6A 3ROCA 4AWIA 4DFBA 3QF9A 4FNXA 3KIOC 3HV5A 2XH5A 4P5QA 5JK3A 3SDJA 2F2CB 4LG4A 4X6RA 2YM8A 5EDPA 2UW9A 4TWOA 5E90A 3W0QA 3SV0A 2C47A 4WOVA 5HE0A 4BCKA 2C1BA 1SZMA 1W98A 4O22A 3LFSA 4F9WA 1XH8A 4QMMA 4IB3A 5M4UA 5FUTA 3SOAA 3OY3A 3P9JA 4U3YA 4DGMA 1GJOA 2VTJA 3R73A 4G2FA 2WAJA 3GC0A 3RK7A 1G8AA 2YWPA 4NJDA 4UEUA 4LOQA 4BIEA 4FE2A 4EBVA 3ID6C 3U4UA 3MVMA 3OWKA 4C33A 1FVRA 3MBLA 4FK3A 4O0YA 2BILB 1NVRA 4L46A 5ETCA 5J1WA 4ASZA 1Q3DA 4TT7A 4IVCA 4B6LA 1OKZA 3DFCB 5AAFA 4X2JA 5J9YA 5ETAA 2JAVA 4ENYA 2HZIA 4PV0A 4AP7A 1HOWA 4C62A 3KGAA 3OCSA 4I92A 3VS2A 4DH5A 2XK4A 3Q6UA 3RK9A 4USFA 4RX7A 3KF4A 4L3PA 3Q2JA 2YIYA 2CKQA 2ZB1A 3PJCA 4BI1A 1IAHA 3FE3A 3LFQA 4DCAA 4JXFA 3C5UA 3FYJX 3O8UA 4XHKB 4IMYA 2E9NA 1GAGA 3BCEA 3UZPA 3SGCA 3A8WA 4PTCA 3NVMB 3NX8A 2VTLA 3IGGA 3AMBA 4G17A 3W0OA 4K8AA 2RIOA 2PMIA 2CGWA 2QR8A 3ZSGA 1J1CA 3R6XA 1OVEA 3CLYA 2QKRA 3NUPA 4CVAA 3MTFA 5G1XA 4L01A 1R0EA 5CSWA 3FEGA 1B39A 3DKOA 3DBEA 1U4DA 4L52A 2B52A 5F9EA 2XJ1A 4I5PA 4N4SA 3O2MA 1LR4A 3O7LB 4EOSA 3UBDA 3ZM4A 4DFNA 4CZUA 2W5BA 3V6RA 1DAWA 3MWUA 5E91A 4EUUA 4KKGA 3D15A 3FSFA 4R7IA 4DH1A 3NAYA 1Q4LA 3KRXA 5D7AA 1FINA 3LCTA 4X2KA 3UGCA 4GJ3A 3OF0A 3KRJA 3LCSA 2PVYA 2JIVA 3JPVA 1KV2A 1OL6A 4FOCA 5B7VA 4ZTMA 3QTZA 5FG8A 1RJBA 3H4JA 1Q24A 3TUBA 4O7YA 2GFSA 2H34A 5D10A 2C3LA 5IMXA 4TTHB 4YBKA 2R3GA 3I6UA 4W4XA 4YJTA 3WBLA 4M13A 2UW3A 3RM7A 1OL1A 2VTPA 2ZV7A 3RPOA 4F9BA 3OW4A 2BVAA 4O7ZA 4I6LA 4U81A 1FGIA 4GMYA 4Z9LA 3ZHPC 3FKLA 5KHXA 4QDEA 4TN6A 4UY9A 1OKWA 4IDTA 3V51A 3R7OA 5M08A 4BTKA 2R7BA 3R1QA 4DE4A 1E1XA 2HW6A 4O4DA 4O1PA 4QP2A 4W4YA 4EK3A 4JOAA 3ORLA 4E6QA 2IPXA 4JBQA 4E4XA 5EKNA 3QGYA 4DEBA 3BLRA 3UQGA 2YA9A 2Y6OA 1GOLA 2CSNA 2Z2WA 5FXSA 5EW8A 4CFWA 1PJKA 2OJ9A 1Q62A 2J0LA 5CLPA 3R30A 2OICA 3E62A 4XG9A 3PZHA 3KQ7A 4O0XA 3ODYX 3GQIA 1ZY4A 1PMVA 4IAZA 4Y85A 5A3XA 2RFDA 4AXEA 2GQGA 3BV3A 2GNFA 3FWQA 5E8UA 2PPQA 2WNTA 2G1TA 3DQWA 4FKJA 5TE0A 3TNIA 4CLIA 3C4FA 2PK9A 3BHYA 4ZY6A 3OFMA 4ZJIA 4ORKA 1GIHA 1OI9A 5HLWA 5E9EA 4UBAA 3QQKA 4TYIA 4ANSA 1REJA 4CTCA 4BZDA 2BPMA 2GNLA 4HJOA 5D41A 1PXKA 4GKIA 4JR3A 3NNUA 3BEAA 4DHIB 4IWOA 3AXWA 2P0CA 2PWLA 4YJQA 2JDRA 4C34A 3GNIB 4I93A 2A4LA 2CGXA 2R0UA 2YM4A 2C6MA 4QP6A 3DGKA 3G51A 4UZDA 2JFLA 4FV5A 3KFAA 4MXOA 1ST4A 4G3GA 5FWKK 3QHWA 2XK7A 3CCNA 4H1MA 2IZSA 3QRJA 4DG0E 2WGJA 4MQ1A 4YZBA 5FXRA 4DGNA 4YTIA 4YZNA 2X81A 1DS5A 2X39A 3KRWA 2OW3A 1CMKE 3TTIA 2JDTA 3FZRA 1GZOA 4FIEA 1OUYA 4TXCA 4FT7A 2PY3A 3MESA 3FL5A 4C4IA 2IWIA 2OSCA 4DH8A 4ZY5A 3FMNA 3QC4A 2JDOA 2OFVA 5GJGA 4WIHA 4FEQA 4RIYB 4XLVA 3OXIA 3VS4A 3NYOA 2OI4X 2VTMA 2WFYA 2XCHA 5CY3A 5HBJA 3HMIA 3W8LA 4FT3A 3EMGA 3WIKA 5AAEA 3PA3A 4JG8A 5EI6A 4JJRA 4GK2A 2J5EA 3NSZA 3EOCA 3JUHA 4MTAA 3L9NA 3DOGA 4DITA 1H0VA 4UWBA 3RZFA 3ML1A 4XG7A 3HLLA 3HNGA 3WF5A 1XH9A 2WD1A 3EN4A 3MSSA 4IXPA 4XV9A 5DIAA 3TZ9A 5CU6A 4D4VA 5CAVA 5IA1A 5J9ZA 4QDVA 5KMJA 2VO0A 3DZQA 1R78A 3UJGA 4GV1A 1LPUA 2O5KA 3CXWA 3QGWA 3ORTA 5LVOA 2OBJA 4I6FA 3MPTA 4I5MA 4CQEA 5HX6A 3LAUA 2GS7A 4XV2A 5HKMA 5A6OA 5GIOE 3DCVA 3HA8A 4H36A 2ITYA 5EDQA 5B2MA 4CG8A 3EB0A 1GIJA 4RC2A 1J91A 2EUFB 5CNOA 3BBTB 4QMXA 3VS7A 2V22A 3ZSIA 1J3HA 1H0WA 2J6MA 2NO3A 2QHMA 3RHKA 4F7NA 4X0MA 3H0ZA 1UU7A 4UMTA 4CKJA 1H4LA 4C3PA 5KMLA 2J0MB 5HO8A 2YJSA 3UO5A 2WOTA 3DDPA 3BYSA 3DJ7A 3FC1X 5HCZA 4AUAA 1PXMA 2DYLA 1YVJA 2CJMA 4Z3VA 3AKKA 2XRUA 4IW0A 3NCZA 4JI9A 3A7IA 4AN3A 2OO8X 3LXNA 4WG5A 4DH7A 5CAOA 5J1VA 2IW8A 3F66A 4FTRA 3E64A 3LFDA 4GUBA 3U9CA 1P4OA 4E3CA 4FODA 3GP0A 2E9OA 4FKLA 2C5OA 3GFEA 4FNWA 4FNZA 4FG8A 4MXZA 4BBMA 4C0TA 3CQWA 2XM9A 1R0PA 2UZWE 1U54B 2J0JA 2ZOQA 4IAAA 4ZTHA 3NNWA 2YIWA 4O7VA 4C57A 3NVKI 4QYGA 5AP2A 3ORPA 3EIDA 2C30A 4C4GA 1EH4A 1YW2A 3GU7A 2R3OA 5HBEA 5CF8A 4GFOA 3VBYA 3N9XA 2WMTA 4EUTA 4J8MA 3LM0A 2XVDA 4RRVA 3DXNA 3F7WA 4CLJA 2X0QA 3BZ3A 5CSPA 4I41A 2W1EA 4O0WA 1XO2B 4ZLOA 3A4PA 3L8SA 4IACA 4XP0A 4D2TA 5CF6A 5L2TA 2QODA 2WQMA 4XX9A 5EW9A 1OGYA 5BUEA 3HEGA 5DG5A 5C4LA 3FQEA 4H05A 4RVKA 2UW4A 4DAWA 4IZAA 4J53A 5HE1A 1H8FA 4KKHA 3OT3A 4DBNA 2OJIA 1XMLA 2XNGA 4RFMA 1ND4A 4MCVA 4EOMA 4BDEA 5AM7A 3P5JC 4H1JA 5EQPA 5ANIA 3QTWA 4FR4A 2PTKA 3RAWA 2B7AA 3KXHA 5J87A 1BI7A 2PVNA 4O27B 2C0IA 2F7XE 3BE2A 3EN6A 3VQUA 4RSSA 1OIQA 2W5HA 4TYGA 3WE4A 4F08A 2ITWA 4GK4A 3V8WA 5A14A 3CD8A 1YDRE 3PE1A 2W1IA 5C8MA 3KN6A 3UPZA 3A4OX 1KE8A 3PVGA 4BCPA 3Q32A 4IANA 4UMUA 4A9RA 2HZ0A 2XEZA 3HDMA 4FL3A 4GU9A 5A4QA 3QWJA 5IUGA 2F7ZE 3HMMA 3MW1A 5KMNA 4O6EA 4FF8A 2QU5A 4BCNA 5AUTA 3D5VA 2C6KA 4HCUA 2JIUA 4NWMA 4ZZMA 5LWMA 3NCGA 4F7LA 4APCA 3T9TA 2X0GA 4NH1A 3EQRA 4ASDA 4XS2A 3FMJA 1UU3A 4NU1A 1XH5A 3WF6A 1H1QA 2ONLA 4K18A 5JT2A 3OBJA 4Y72A 2QOCA 1E9HA 3LFNA 2ZV9A 4GFMA 4WNMA 5ACBC 4NK9A 4JRNA 4O2PA 4RFYA 4HYUA 4FV0A 3BWFA 3S95A 4BI2A 4C36A 4IFCA 5KCVA 4NFMA 3R01A 4I5HA 4AW0A 2OIQA 2BTRA 2W5AA 3C4EA 5CYIA 3RPRA 4YUQA 2Y4IB 5ETIA 5HICA 2VTNA 2XKFA 5JGAA 5IUHA 2G2HA 2IW6A 3O8PA 4TPTA 4M69B 2PULA 4L53A 2BUJA 2HW7A 5FQDC 1JSVA 4FSYA 3O7LD 3FI4A 5AV0A 3W1FA 4Y95A 2YDIA 3V3VA 3G0EA 3PP0A 5HHWA 4BWPA 1YOLA 4FIHA 4BKZA 5AUXA 5AMNA 2QC6A 3ZEPA 2VUWA 4AFEA 3N4VA 4D1SA 3VF8A 2QLQA 3Q9ZA 2WTKB 1HCKA 4OTQA 3VUDA 4DT9A 4YZ9A 4XBRA 2P33A 5CF4A 4FTUA 2BHEA 4M8TA 3BV2A 3COIA 5LCJA 3MIYA 3LVPA 3QTQA 3U54A 2P2IA 3G33A 1QPDA 3DY7A 3GGFA 4EZ7A 2PL0A 4EWQA 3C13A 5D12A 4RQKA 4CV8A 1KUTA 1LEWA 4QQ5A 1Y6BA 4IZ7A 3Q96A 5FXQA 4NFNA 3R9HA 3UP7A 1XBCA 5DYJA 3P78A 3QTIA 4D2WA 3FMDA 1J1BA 3DBCA 2R3HA 5F95A 4FVRA 4NM0A 4YJVA 2PVMA 2J0IA 5AV1A 3LZBA 5HCXA 5FP5A 3RAKA 4IHPA 1IASA 2CLQA 3KRLA 2W17A 4BF2A 4FUXA 3EQHA 2R3NA 3E93A 5KUPA 4FSTA 4GRBA 2W1HA 3AC2A 3RALA 5HZNA 3ALOA 3NW5A 4RA5A 2QOHA 3VJOA 2WMVA 4M84A 4QMVA 3QQFA 4F1MA 4GIIA 1DAYA 5GJDA 4EOIA 4EH7A 3TACA 3PIYA 5I9XA 4FZFB 4GS6A 2NNWB 3LCKA 3EQFA 4QTAA 3HX4A 4BDBA 4EK5A 1YI6A 4C61A 3DK3A 2X7FA 2UUEA 2P2HA 4O0UA 3Q53A 3EN5A 1ZRZA 5F20A 4BDJA 1RE8A 1ZLTA 3E88A 4ACGA 4CZYB 4X3JA 2P4IA 4GK3A 3ZBFA 1VYZA 1M14A 4I0TA 3VHKA 4BVUA 5DBXA 5GZ9A 3OS3A 5GZ8A 2BMCA 3UZTA 4FZ6A 3QD2B 4R1VA 4O0RA 4J98A 4TYEA 1Z9XA 2WKMA 2VTRA 1A9UA 2B9JA 4G3EA 3RZBA 3U87A 3GQLA 4AF3A 5E92A 2XEYA 2YAAA 3PXZA 2G15A 4LRMA 3H0YA 4CRLA 4ZZNA 2JKOA 3SQQA 4BHNA 1YI4A 4KABA 5K5NA 3LM5A 5CQUA 1QPCA 5BUIA 2DWBA 4LGDA 2AC3A 2PVJA 2WO6A 3D9VA 3QL8A 5FGKA 3UVQA 4QMTA 2AUHA 3NUXA 3Q04A 2ITXA 4XV1A 4EH2A 5CALA 3COHA 3PJ8A 4D2SA 5DE2A 2HZ4A 4EH9A 4AT3A 5L8KA 3CQEA 3E7OA 3FLZA 3SXFA 5AUYA 4DTAA 3IG7A 3KA0A 3ORKA 4L3LA 3FZ1A 4FKQA 4DF3A 4RZWA 5EFQA 4TYJA 3WZDA 3E8DA 3G2FA 1Q8WA 3UC3A 3LHJA 4ASXA 4OBOA 3FMLA 4L43A 3W55A 2P3GX 4QMPA 3PFYA 3NIEA 3BBWA 4DTKA 5DHJA 4DGLC 4BJJA 4EOJA 2B55A 3DTWA 4WSQA 3ORIA 3F5UA 3TKIA 4M7IA 4MNEB 2A27A 2EXEA 3COMA 5CT0A 3U9NA 2PVKA 3VO3A 4QTBA 4EHZA 5E8XA 3QX4A 3F3VA 1F3MC 3EZVA 3KK9A 5B2LA 5HD4A 2IG7A 4I5CA 4KIPA 5HCYA 1KSWA 3R8VA 3HZTA 4Z7HA 4ACCA 4BDGA 3FSKA 4I22A 1T45A 4IBMA 3HDNA 5EOLA 1M2PA 1W83A 3F5PA 3R8ZA 1VZOA 3I60A 4BFMA 2XIXA 3S3IA 4AW1A 3FYKX 1PYXA 3HKOA 4BCFA 4E4LA 2GHMA 4NIFA 4AW5A 1XH7A 4FVQA 5E8VA 2UZVA 3ZO4A 4BZOA 4YTCA 4ZTRA 3QCXA 4EWHA 3V5QA 4TWNA 2UZUE 1PF8A 2YM7A 1FQ1B 3DAEA 4KIQA 3Q9XA 4N6YA 3T3VA 4QEBA 3IK3A 2VWWA 4NT4A 3TKHA 4YMJA 5KMIA 4F64A 2X4FA 3A60A 3UP2A 4BIBA 3PG3A 4RIWB 4F99A 2PZRA 2R9SA 4IIRA 2J9MA 4NW5A 1YXSA 5A54A 2ZFYA 4YHJA 1PKGA 2OH0E 5M56A 2CPKE 5EI8A 3D5XA 3SKCA 3FV8A 5EKOA 3Q4CA 4QPSA 5F4NA 4RT7A 4FTCA 3HP2A 4AG8A 4EK4A 5I3RA 4YZCA 4O4EA 2C4GA 3NUUA 2XK3A 4AGDA 4EC9A 5IF1A 5HOAA 4ZTNA 3QD3A 1Y6AA 5FTOA 3F3TA 4U41A 2VWIA 4APPA 4BCQA 4C3FA 3MIAA 3L9MA 1RQQA 5LVLA 5AP0A 4C59A 1G8JA 4Z7GA 3KULA 3D0EA 3OP5A 5HE2A 4BN1A 3BYVA 3PA5A 3LFEA 5KZIA 1JKKA 2W05A 4M67A 4BTJA 3E3PA 4JIKA 4ZK5A 4O7LA 2VWYA 3TMOA 3LQ3A 1L3RE 4NEUA 5EM8A 2ITVA 3EFLA 3RWQA 5T68A 3W33A 5DT3A 4W4VA 3GU8A 2J4ZA 3AOXA 4MNFA 3VUKA 5DRBA 4O4CA 4CYJA 2YISA 4B0GA 1G5SA 3R7GA 5A46A 1YI3A 2OJJA 4FVPA 4ZSLA 3UDSA 1Q8YA 2YZAA 3MA6A 3ULZA 4J8NA 5AJQA 1VLRA 4O82A 4Q5EA 3I5NA 4DEHA 3WF8A 4FTAA 2VTAA 4QP7A 5BVKA 3TNWA 5HO7A 2C5VA 2Z7QA 2XIRA 4JAIA 4PP9A 4RWJA 4ZS0A 4C3RA 5C1QB 5LQFA 2Q83A 4U9AA 3BRBA 4EHEA 2CGVA 2X8IA 2Z8CA 5AR7A 5TO8A 3VS5A 2UZLA 3GB2A 4M66A 2DUVA 4AXFA 4RG0A 4NTSA 3VS0A 4RA4A 1Q5KA 4IZYA 4A4OA 3GBZA 3MV5A 3W2RA 4I1ZA 3DS6A 4FTQA 3U4WA 1JKTA 4E1ZA 3P08A 2B9FA 1ZYCA 2BFXA 3HL7A 1OECA 3HA6A 5LJJA 1XQZA 3PFQA 2Y0AA 3MJ2A 4MD8E 3R9OA 4X3FC 3DNEA 4BWKA 3TDWA 2UVYA 3W2OA 3NDMA 4FMQA 5D1JA 4EOPA 2QCSA 1UNGA 2H6DA 4GCJA 3HRBA 4CGAA 3DLZA 5BQ0A 3BLHA 2C68A 3O5AA 3VF9A 3AC4A 5KNJA 2CKPA 2X2LA 4IQ6A 5HD7A 2CCHA 3DK6A 3IW7A 4G34A 1VYWA 2YABA 1TKIA 4W4WA 5E8ZA 1NVQA 2AEGA 3CY3A 4BBEA 1XH4A 3VRYA 1W84A 3Q3BA 3MVLA 3TJDA 1BI8A 4K77A 2A1AB 4OTIA 2XM8A 3NZ0A 4QP8A 4QP1A 5H3QA 3V8SA 5HVYA 4S34A 4DN5A 3VW8A 3VBVA 5L2IA 4JX3A 3KF7A 4BDHA 3HUCA 4USDA 4AZVA 3MB7A 3QLFA 4G6NA 3C9WA 1JSUA 3BGQA 5LOHA 2Z02A 4OR5A 3PIZA 4QD6A 5IPJA 3DTCA 3SXSA 2YDJA 5JGDA 2ESMA 2C6LA 3QD4A 2C6IA 4ACMA 3K5VA 1YHWA 3PUPA 5DN3A 4HNFA 4BBFA 4AXCA 2CHLA 4K1BA 4B8LA 4EQUA 3Q5ZA 2W7XA 5AR8A 3GVUA 5FEQA 2XA4A 3Q5IA 4MWIA 5CZHA 2YERA 2V7OA 3C1XA 1WVWA 3QZFA 4C35A 3P4KA 5CAQA 3FMKA 4IJPA 4E26A 3R71A 3ORMA 3ZRMA 4U5JA 3G9NA 3PA4A 4PF4A 5J8IA 5JFWA 1SVEA 4C8BA 2GQSA 3W0PA 1M2QA 4UXQA 3ANRA 3CPBA 3KU2A 2XJ0A 4BYJA 1OL5A 2V0DA 2FB8A 3VVHA 4DFZE 1YHVA 3OCTA 3JR1A 3Q2MA 3R1SA 3AKJA 3FKNA 4ONAA 2OIBA 2ZYBA 4U80A 4C37A 2FO0A 3OMVA 5C27A 1ZY5A 4AAYA 4IEBA 1PMNA 4MF0A 3UODA 1B6CB 3F88A 3SW7A 5I9WA 1L8TA 5EM5A 4HCVA 4MAOA 4R1YA 5DA3A 5CEQA 1KOAA 5EYDA 4FSUA 4J99A 3Q6WA 3BL7A 5M07A 4CT1A 5BYYA 2UW8A 4F9CA 2IZUA 4QMOA 2A19B 4UMQA 3NUYA 4W9XA 2XCKA 1O6LA 3SW4A 4O86A 3IO7A 3IGOA 1NY3A 4OTRA 5FDPA 1V0OA 3BU5A 4BI0A 2R3KA 4DCEA 3NFFB 3DBQA 4YURA 2OG8A 4QYEA 3O0GA 4JL9A 3F61A 2BZIB 4ID7A 3BYOA 3WI6A 2B9HA 3LQ8A 3NUNA 3FLWA 4O6LA 1JOWB 2BDFA 2ITTA 4BCIA 5CVHA 4YJOA 4YSJA 3SVVA 2B9IA 3EQBA 5BVOA 4AX8A 4QMNA 3OC1A 4FNYA 4MXCA 4O83A 2WZJA 3PG1A 4LV8A 4RWLA 4IC8A 4B8MA 3F3WA 3M1SA 2WU6A 3KK8A 1YDSE 3R1NA 4GH2A 4R3PA 3BEGA 4V04A 4EK8A 5I0BA 3F2RA 4IDVA 5CI7A 2WMXA 4E4MA 4RIXA 2HZNA 3QTUA 4YO4A 4D2RA 3AGLA 3EHAA 4WG3A 5AUUA 3N4TA 4FZAB 5FEEA 4O7WA 3ACKA 2R4BA 3QCYA 4D2PA 2WOUA 5CVGA 4IX3A 2WTDA 2RL5A 4F70A 3GCQA 2ETRA 4PPBA 4AQCA 5L6WL 3KY2A 4HYHA 5CASA 4AA0A 2E9PA 1K3AA 2HY81 3NLBA 2WEVA 3C4XA 3PLSA 3QX2A 4FIFA 4I24A 4MD9E 4RC3A 4XLIA 5M4IA 5IQFA 3OBGA 4GYGA 4QNAA 5AV4A 3VBQA 3ZM9A 3QKKA 3TTJA 4FKVA 3ZONA 4F65A 5TR6A 3G90X 4P4CA 4WO5A 3D2KA 1JBPE 4WUAA 3FLSA 1OIRA 4A4LA 4DT8A 3MVJA 3ZMMA 4Q5HA 5LMAA 4CFMA 4M15A 4JAJA 3TZ8A 3ANQA 3AT3A 4IVAA 4X3FA 4EORA 3S4QA 3SA0A 2JKQA 4BCJA 2V7AA 2OLCA 3OVVA 1KV1A 3ROYA 3V04A 1ZYSA 1JVPP 4CG9A 3O71A 5DWRA 3QXOA 2VX0A 2OF2A 4OBPA 4KSQA 3TI1A 4A9YA 5JQ8A 2G2FA 2OXYA 4NUSA 3UE4A 4ZSEA 4RJ5A 4EHVA 4TKSA 4U8ZA 2C6TA 4KUJA 1CM8A 3MY5A 2O0UA 4MK0A 5J5SA 3G6HA 5LVMA 1T46A 1BKXA 3R8MA 2VWBA 3F3UA 4D58A 5JMSA 2B0QA 2A0CX 3QCSA 5AV2A 3IW5A 5AP4A 4BDAA 2FUMA 3L8PA 4Y83A 1YWNA 4PMPA 4B7TA 2UZBA 3NIZA 3QU0A 4EQMA 4KINA 1J7LA 1WFCA 2FVDA 2CMWA 3LFFA 4S2ZA 3KN5A 3HV4A 4GVAA 1JNKA 3QTSA 4L9IA 4A9UA 4TL0A 1XJDA 1NXKA 2JAMA 4ERKA 1NVSA 1V0BA 3WYXA 4Q9ZA 3FLYA 1LUFA 1ZOGA 4YGAA 4E5BA 3EL8A 4QQCA 4I0SA 3TL8A 1U59A 1Y57A 3RBWA 1LP4A 4FKWA 3RCJA 2W0JA 2OXDA 3IONA 2IO6A 3FZOA 3DQXA 5IQIA 3KKVA 4E6CA 3CGOA 4YSMA 3K3JA 4FYOA 5ANOA 3NS9A 4LGGA 4KS7A 5DT0A 4O84A 5G6VA 1PXNA 3C4WA 2OJFE 2CLXA 4F09A 4H3QA 3AD5A 1BUHA 4IWQA 3PXYA 4GVJA 3JXWA 4IC7A 4LL0A 4LUEA 4BICA 4CRSA 5J9LA 2X7GA 2VO6A 2XNEA 4RC4A 3W2CA 3ORNA 4O7RA 3CR0A 4I0RA 3ZDUA 3GCVA 3IECA 3QQJA 3E5AA 4HGLA 1OITA 5AP6A 3U55A 4BWXA 3O51A 1PXJA 2HWOA 2VV9A 2A98A 3BHVA 3Q4UA 3DU8A 3RPVA 1MRVA 5LCKA 4AZSA 5L2WA 3PSDA 4FT5A 4G5JA 4RGJA 4RWIA 5EOBA 1ZYLA 4JDIA 5CS6A 4QYFA 5IA5A 4I