5A9UA

Structure of c1156y mutant human anaplastic lymphoma kinase in complex with pf-06463922 ((10r)-7-amino-12-fluoro-2,10,16-trimethyl- 15-oxo-10,15,16,17-tetrahydro-2h-8,4-(metheno)pyrazolo(4,3-h)(2,5,11) benzoxadiazacyclotetradecine-3-carbonitrile).
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
309
structure length
292
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGEVYEGQVPLQVAVKTLPEVYSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Resensitization to Crizotinib by the Lorlatinib Alk Resistance Mutation L1198F.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords ALK TYROSINE KINASE RECEPTOR
total genus 98
structure length 292
sequence length 309
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5a9uA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5a9uA01
3CQUA 2ZVAA 1WVYA 4G3FA 4MNEA 4LG4A 4RX5A 3KL8A 3BHHA 5T3QA 1H28A 2YHVA 3I7BA 3TNWA 5IG1A 1ZYDA 5CVFA 4X3FC 4EQMA 2UV2A 3F82A 1Q61A 4HGLA 1TQPA 3O23A 4EHEA 3QUDA 3E8DA 3D83A 1WBNA 3CJFA 3N51A 4Z9LA 3RBWA 5FM2A 4L46A 3ULZA 3F3TA 3WIGA 3C9WA 4L3JA 5DYJA 4E6AA 1OGUA 3I6UA 5DH3A 5EDRA 3DZQA 2GDOA 2YLFA 2X4FA 4S34A 4S31A 4O7RA 1ERKA 2FSLX 3VIDA 5KX8A 4CG8A 5EYDA 4J7BA 4WRGA 5M4UA 4YJRA 5AP3A 2C69A 2OJJA 1KE7A 3QRUA 2WTIA 3D14A 3EIDA 3QQLA 3CQWA 4IX4A 3L9LA 4EOMA 5DR6A 4JBVA 3NAYA 2C6LA 2Z7SA 4A06A 4QMUA 3SX9A 2AYPA 2J50A 1E1XA 2W1HA 5EKOA 5F94A 5IDPA 4IW0A 5CNNA 5IA4A 2ZB0A 1KWPA 3QUPA 3UO4A 2W9FB 1WZYA 4AW2A 1CKIA 1DI9A 2ITUA 4FVRA 4R3PA 5AR5A 3KXXA 2WIHA 3QUEA 3ZSIA 2R3PA 4DYMA 4NTSA 3UVQA 4W9XA 2RFEA 2ITQA 4GUEA 1UV5A 2J7TA 3FLYA 2W1ZA 4I23A 3W18A 3OOGA 3FSFA 4WUNA 2YISA 4EH4A 3AQVA 2OKRA 4BGGA 2PE1A 1BL7A 1JNKA 4WOVA 4YZCA 4JVGA 4AGWA 5T6KA 1LEWA 1GZKA 3LM5A 1YDRE 4L3PA 3UZPA 4EH2A 4CFUA 5H8GA 4XUFA 2Y0AA 4WBOA 3U8WA 2VWUA 3ZTXA 3PUPA 4BWPA 4ANSA 4ZEGA 4OAVB 2RF9A 4J98A 4PL4A 3SD0A 2OZAA 2WTJA 2OIQA 3NR9A 3HNGA 4UWYA 2W5AA 3CXWA 3UJGA 2O2UA 3A60A 3EQFA 3QHWA 3CIKA 4EC8A 4I92A 3G9LX 3LCDA 2C30A 5AR8A 5CEPA 3EQCA 3SOCA 3BHYA 3TNHA 4TYHA 4MKCA 4AACA 3R8PA 3COIA 1STCE 3NUXA 4PWNA 3MB6A 4L7SA 4BBEA 4EK3A 3ULIA 2GHMA 5AIKA 3LZBA 4U6RA 3TJDA 3PVWA 5AUUA 3S4QA 4GUBA 4PPAA 5KBRA 3F5UA 2C3KA 1BI7A 3UIMA 4GEOA 5DIAA 4O6LA 3Q9ZA 1RDQE 3V8TA 2DUVA 1H1RA 3ORIA 5JH6A 2PULA 5C4LA 3ORMA 3CSVA 2UZWE 3K5VA 2PVLA 3R7YA 5FG8A 4AW0A 4AA5A 1YHWA 4S30A 2C5YA 4MHAA 2BAKA 2XK6A 1YXVA 5EOBA 4AG8A 3ZFYA 5LVLA 1YDTE 4YHJA 3VS4A 4FIFA 4NJ3A 4OTQA 2JBOA 4ZP5A 3R7OA 3HP5A 3FPQA 2R0UA 3RAWA 1BI8A 2OLCA 4HGEA 2W0JA 3FI2A 4YC6A 3WE8A 1BX6A 3AGMA 5EHYA 5L6WL 4AA0A 3QWKA 4CKRA 5AEPA 5EQEA 3SW4A 4YPSA 4RFZA 4G5PA 3PXZA 4BDHA 4RX9A 2BTRA 3PJ1A 2BILB 1QL6A 1WVWA 2RFSA 2RL5A 4C59A 3UIXA 2B7AA 4R1VA 3P5KA 2P55A 3LFEA 4XV1A 2A4LA 3BYOA 3UQFA 1W0XC 2PVFA 5HG5A 3CCNA 3OBJA 4BDIA 3CEKA 2W9ZB 2ZAZA 1UVRA 5A3XA 4IM3A 2C5NA 4YURA 2ZM1A 4O22A 2UW8A 4C33A 3P78A 2OSCA 3I0OA 4O0XA 3UO5A 4C3PA 3R1SA 3GC0A 4CQEA 3PIYA 4DG2E 2AC3A 5IQEA 2YWPA 3BEGA 4RC3A 4UMQA 4BCMA 1O6KA 3ORNA 3ENMA 3ORTA 1Y57A 2HELA 3JXWA 3FZSA 4NKAA 3HUCA 2XNMA 3ZSHA 4HOKA 4AZWA 4JS8A 3FEGA 4FSMA 2CGVA 3LKMA 5AA8A 1R3CA 3FKNA 4QRCA 2WPAA 3C4XA 3ZO3A 2YA9A 2PZRA 3R2BA 4MXZA 4XLVA 3DKCA 4AN9A 3SKCA 4FKGA 2B9JA 3BX5A 1ZWSA 4WIHA 3FJQE 5D1JA 5M53A 4X3FB 4U3YA 1HCLA 3ACJA 4ZK5A 5JN2A 5IQIA 3RJCA 3QD3A 4RJ3A 1PMVA 3WZKA 4YTFA 3IECA 1J7IA 1ZLTA 2XJ2A 5GJDA 4R77A 5GINE 4AN3A 3EFKA 4JXFA 2UVYA 3ERKA 3RAHA 2XNBA 1VYWA 4G1WA 5HCYA 3RNIA 2XNPA 1Y8YA 4Y73A 4IACA 4ALUA 4DTAA 3ACKA 4BTKA 2XUUA 3JYAA 3MH2A 5AAGA 2UZTA 2C6EA 4NIFA 3F9NA 4N57A 3PWYA 2YM8A 4JBOA 4XP0A 3ZM9A 4M15A 5D11A 4ZZNA 2ZV9A 3SXSA 4LRJA 2WTWA 3R04A 3OY3A 3R01A 4DGNA 4NU1A 4RX8A 2GSFA 1YWRA 4QTCA 3R1NA 2I6LA 3HV7A 1SNXA 4F09A 3BKBA 3A8WA 3FLNC 4MQ2A 3SRVB 4Y72A 4NZWB 2GTNA 2FUMA 5F4NA 4TWNA 4UXLA 2YEXA 5CI7A 4I3ZA 4EH5A 3VJOA 4FKLA 4UN0C 2OGVA 5J1WA 3G51A 3HLLA 4FV0A 4NK9A 1Q41A 4CCUA 4TY1A 4FTRA 5AUVA 4BZOA 4G3DA 3HP2A 3UC3A 3VW6A 3UG1A 4JQ8A 3BIZA 4IDTA 3OXTA 4FSZA 1VR2A 5ACBC 2UVZA 1CMKE 2F2CB 2ITPA 4FTKA 4MNFA 3ZO4A 4EWHA 2WTVA 4F1TA 1OI9A 1YOMA 5L8KA 3MTFA 3MB7A 1G8AA 5AA9A 4ZY5A 5L2SA 3DK7A 3IOKA 4FVQA 1OM1A 3R71A 3BBTB 2BTSA 3EJ1A 1H1QA 5CQWA 3F3WA 1DI8A 4FZ7A 3RK9A 5BNJA 1L8TA 1H26A 1R78A 2XKFA 1F5QA 3KB7A 3C0HA 4D2PA 4OAUC 5D7VA 2PMNX 2QONA 5E4HA 4ASZA 1JWHA 2OH4A 5DFPA 4C38A 3CBLA 4YSJA 1H4LA 5C03A 3UMWA 4X2JA 4OTFA 4FSWA 2PK9A 3ZRMA 2GHLA 4A9SA 5CF8A 3MVLA 4R7IA 5CU4A 3ZDIA 3BGQA 1LPUA 5J8IA 2HENA 3KGAA 5HO8A 4IWDA 3WZUA 3KK9A 1J1BA 1OPJA 3KK8A 1XH4A 3P4KA 4I6BA 4L42A 2UVXA 4GG5A 2G9XA 4R3RA 1UKIA 2B53A 5ANIA 3VUGA 4U40A 2IWIA 3EFWA 5CU2A 4IANA 3MTLA 4O27B 4OW8A 4DG0E 3F7ZA 2FA2A 3K3IA 4I5MA 3MPMA 4ACDA 2XH5A 2X8DA 4LRMA 4CMUA 5KUPA 3FY0A 5GIPE 4OR5A 4MD8E 4AWIA 5I0BA 3R02A 1OBGA 4QYHA 1PKDA 4NW5A 2OICA 4MCVA 5EYKA 3A61A 2HXQA 2GQSA 2OXYA 4DEEA 4DE4A 3H0ZA 3CD3A 4FI1A 4KD1A 5I9WA 5DE2A 4XG6A 4LL5A 4D4YA 1Q8YA 3GP0A 5IQBA 3T3VA 3GOKA 2J0KA 3KEXA 4BCPA 3RPOA 4DINA 4DGLC 2WKMA 1KE9A 2XCKA 3TUDA 2QU6A 3DNDA 5AUXA 4YR8A 4ZY4A 3B2WA 4QNAA 3ODZX 2J0IA 2P2IA 2OJFE 3DCVA 3BPRA 4BBFA 2QHNA 4D2RA 2XRWA 3O96A 4BC6A 1JLUE 2IZUA 4EOIA 3R6XA 3E8CA 4QMQA 2ONLC 2UZOA 2B0QA 1XJDA 3DJ5A 4FKQA 4LUDA 3AT2A 5M55A 4YO4A 3THBA 5KMLA 5DOSA 3W16A 4EBWA 3HRFA 3ZYAA 4OBQA 1UU7A 3DFCB 2YJSA 4RT7A 3WOWA 2JGZA 3W1FA 3FDNA 4U42A 3M1SA 3UVPA 4DFNA 4IZ7A 5DNRA 3R9RA 4EHZA 3R7IA 2FH9A 4U7ZA 2CSNA 4O91A 3ORKA 4EH7A 3EZVA 3FYKX 1OKWA 1XH7A 1PY5A 5HE3A 3Q4TA 4K18A 5D10A 3O51A 3T8OA 2V22A 3BU5A 4GK2A 2HAKA 3FXWA 4R7HA 4O86A 4Y83A 5K9IA 3MPAA 4FEWA 3FMDA 3BGPA 3PLSA 1SVEA 4M7IA 5E1EA 2YIWA 3TKHA 3TJCA 4ERWA 2LGCA 4IX6A 5BYZA 5JRQA 3TTJA 3RI1A 4RVLA 4AS0A 4DLIA 4B0GA 4GW8A 4C57A 1P4FA 4I5CA 4H1JA 4JRNA 2W06A 4BTMA 4D55A 3QF9A 4YTCA 1PRYA 2HOGA 2HZ4A 5HVKA 1UU8A 2O8YA 4I0SA 2GNGA 2GNJA 3C4ZA 4KIOA 3VUMA 5IUHA 3HDMA 4JX7A 4USFA 3L8SA 4PUZA 4S32A 3WF5A 2VO6A 4AOIA 5IA0A 3OFMA 2WOTA 3BLHA 4NL0A 2ETMA 2F4JA 4BICA 2QODA 4HNFA 2OZOA 3FMHA 3C13A 2DWBA 3DY7A 5LVNA 2DS1A 3EQGA 3OF0A 4ZTNA 1URCA 4ARKA 4ZZMA 3D15A 4IAKA 5AIRA 5GHVA 3VS3A 3QCXA 3V6RA 3RKBA 3UBDA 5J95A 3LMGA 4EHVA 5CAQA 4MWIA 4DGGA 5CSHA 3NUYA 5CSXA 5HX6A 4MF1A 5BVOA 2W1CA 5CS6A 5EHLA 2QG5A 2UZEA 5IH6A 1BYGA 4AZEA 3CGOA 2BCJA 4XBRA 4AU8A 4BDFA 3VS1A 1BLXA 4C3RA 4DGOA 3UNZA 3UOHA 2A1AB 5EK7A 2OO8X 2OZAB 3KN6A 5IH5A 2WO6A 4LI5A 4OBPA 4FV5A 4D9UA 3F66A 1Q8ZA 3ZMMA 4EOSA 1ZOHA 5CSPA 4QTEA 2X6DA 1OMWA 5CU0A 4RGJA 3CR0A 3C5UA 5DBXA 5J9ZA 1KOBA 3AMBA 3TWJA 3I7CA 3O7LD 5JGAA 2I7QA 4AZVA 3B2TA 4QYGA 4QNYA 2GCDA 2P2HA 4GCJA 1JQHA 4YJPA 5A4CA 2WMQA 5DMZA 4TYHB 3PLAE 4JJRA 4BVUA 3NEWA 4UXQA 5E7RA 1LUFA 1QPDA 3A7GA 3F69A 2OF4A 1XBBA 3KN5A 4O0RA 4FOCA 5CVHA 5HLWA 2BKKA 1JPAA 3OEZA 4LV8A 4UMPA 4EWQA 2R3NA 3HMPA 3GU4A 2ESMA 3E8NA 2C68A 3BQRA 2EXCX 4OUCA 1JKKA 4LL0A 1ZZLA 2CDZA 3NUPA 3LJ0A 3G6HA 5DGZA 4LRKA 3R7VA 2GNFA 2XYUA 3EOCA 1OL7A 1ZY4A 4DFZE 2CGXA 2VZ6A 3D4QA 4Q9ZA 1YWNA 3BYSA 3HDNA 3G0EA 1M52A 4IC8A 3R9HA 2F7EE 3EQBA 4JDHA 3QLGA 4EH8A 4NH1A 5C01A 3GOPA 5HVYA 3GCSA 4QD6A 5E91A 4AOJA 4LQMA 3R9NA 5IDNA 3D5XA 5A46A 4ZMEA 5AAFA 1XHAA 2ERKA 3KRLA 2XKDA 1Q3DA 3F2AA 3CS9A 3OY1A 3F5PA 5KZ0A 2R4BA 3PXQA 4DFUA 4FR4A 4FEVA 3R8UA 2WOUA 3DGKA 4G31A 5TOZA 4CRSA 4B8MA 2REIA 3JVRA 3AG9A 4M0YA 4PDOA 3LPBA 3MESA 1OL6A 2CKQA 4FTJA 4O1PA 3MN3A 3PJ8A 3O7LB 4RJ4A 2HY0A 3QTXA 5C8MA 4GJ3A 3U9NA 1I09A 4WRSA 4ZSEA 4C3FA 4EZ7A 2R3GA 3O0GA 3QZFA 4OBOA 1KOAA 4JIKA 3M11A 4JDIA 4B8LA 3LCKA 1H01A 4DEGA 1NVRA 1P2AA 2XRUA 3HZTA 3VRZA 2JKMA 4GT4A 4DEBA 4YBJA 4QQ5A 4MXCA 4GIHA 3IW4A 3OUKA 5EHOA 3IDBA 1KE8A 3KULB 4FT7A 4HCTA 4C4HA 4X3JA 4GRBA 5C26A 4FTIA 3VBQA 5E92A 2F7XE 4ZTQA 4X21A 1GAGA 4BDGA 5IF1A 1U54B 2QR7A 3DDQA 5JQ5A 1YXXA 1XR1A 4XX9A 1IRKA 3UPXA 2JEDA 2RGPA 3QZIA 4RRVA 5F95A 4C02A 3ALOA 3I60A 5HI2A 5FWKK 5JQ8A 4FIJA 2UZUE 1PXLA 3I4BA 3PVUA 4AGUA 4FSYA 5AV2A 4BN1A 4GVJA 1YQJA 2R2PA 3MVMA 3QA8A 3NYOA 3F5GA 4BL1A 3VUHA 5L2WA 5FD2A 2R5TA 1U54A 3VUIA 4JNWA 5LJJA 4HJOA 3HMNA 3SGCA 4UX9A 4GK4A 3R7GA 1V0PA 4ACMA 4NM7A 4XOYA 2H8HA 1Z9XA 4DH7A 5AP0A 3NCZA 4KSPA 4DT9A 4BCJA 4FYOA 5AP7A 1WFCA 4KBKA 2XEYA 2YCSA 3I1AA 3R21A 4E93A 2XP2A 4JG8A 2W17A 1WCCA 4M68A 5EI2A 3SHEA 4CQGA 3PIXA 2ERZE 3ANRA 3BV3A 3B8QA 3RPVA 4K8AA 2BFXA 3DDPA 3SA0A 5IPJA 1JVPP 5M07A 4ID7A 5E8SA 3VW8A 1NVQA 4Q2AA 4UBAA 5JEBA 4U0IA 3C4WA 4K33A 4BCGA 4D2TA 2OW3A 4A4LA 1OIUA 3EH9A 1ZYCA 3RM7A 4RJ7A 5ANOA 2WZJA 1AQ1A 4JAIA 4IZAA 3V5PA 3VF9A 3BBWA 5KNJA 5EH0A 2QHMA 3MJ1A 5EYCA 3W2SA 2AC5A 2OFVA 3QRJA 4R8QA 4QMMA 3VQUA 4NEUA 3EQDA 4F9WA 3DKOA 1MQBA 2X2MA 2YDKA 5A14A 2X9FA 4BDJA 1PXIA 4ANBA 3G15A 3HGKA 4M12A 2R0IA 5GJFA 3GCVA 4UALA 2C6OA 3H9RA 4ZTLA 3UYSA 1QCFA 4RFYA 3CP9A 2F7ZE 3GU7A 3DS6A 4FT9A 4GFMA 5AV0A 2UZBA 4IM0A 3RHXA 3VBXA 2IVTA 4F7SA 1Q4LA 3MWUA 4L45A 3LQ8A 5CAUA 2C6MA 4XV2A 4XYFA 3ZEWA 4G3EA 4GH2A 4IVAA 4E4LA 3PZEA 3PE2A 5CTPA 5HE0A 3COHA 2WQOA 2G2IA 3EL8A 4CNHA 5M57A 3ATTA 5EQYA 3G0FA 4QTAA 3ORXA 2VAGA 2WQNA 1X8BA 4A9UA 4AT3A 4E26A 3Q52A 2VTRA 2VTIA 4NM3A 4FSUA 4B99A 4FEXA 5CF5A 2C3IB 3FL4A 4DEHA 5L2TA 3EN4A 4BWXA 4RZVA 1WVXA 3HMOA 3F3VA 4JRVA 4J96A 2IZTA 5AV3A 1U5RA 1VEBA 1S9JA 3AXWA 1UKHA 3BE9A 4AE9A 2XK7A 3OROA 1Q97A 1ZAOA 3BHTA 3TUCA 2X4ZA 4V01A 5BMSA 4GMYA 2I0EA 3Q3BA 3PSBA 1Q8WA 4IHPA 1W84A 3D7ZA 3CTQA 4AFJA 4I1ZA 1OL1A 3K3JA 4RVMA 4XS2A 5I3OA 2UZNA 2JIIA 4PTGA 3REPA 3VVHA 2JITA 5DI1A 3LLTA 3VS7A 3KMWA 4U45A 5J5SA 2CKOA 3AD5A 5DG5A 3OW3A 4CLIA 4FV6A 4AZFA 1W82A 5IA3A 4P4CA 3L8VA 4FGBA 4IAFA 4TT7A 4F6WA 5AADA 4EK5A 3JS2A 1R39A 3PE1A 4FV2A 2ITWA 4BIDA 4H58A 2R7IA 3CTJA 3OEFX 1SVGA 2WMVA 2VN9A 3QX2A 5A6OA 4GKIA 3FY2A 4EOJA 2XK4A 4BZDA 4RX7A 3F2NA 4KRDA 3FLSA 3TV6A 3TDVA 2EUFB 3NNVA 3EL7A 4J99A 4UYNA 1Q62A 2EWAA 4FNXA 4WG4A 3M42A 2GQRA 4X2KA 4P7EA 3QLFA 4ZZOA 1YW2A 3PXFA 3QXOA 3MS9A 4LOPA 3H9OA 3F3UA 1TKIA 3G2FA 4NCTA 2Y4IC 3P08A 5CEMA 4CZUA 2B9FA 4UYAA 3EQPA 3Q5ZA 3DBQA 4IE9A 5BMMA 1SMHA 3V04A 5C27A 5AR7A 3QD0A 4FUXA 2QVSE 1FVRA 3V8WA 4IC7A 3C50A 3QFVA 4FG7A 4TPTA 3FMKA 4BWKA 4EH3A 4F64A 5JMSA 2OG8A 2C0IA 1YHVA 4N0SA 4TRLA 1GIHA 4IXPA 4H36A 3RMFA 5A4LA 4J1RA 5IUGA 4BKJA 3PXRA 3OOMA 4M3QA 4FEUA 4X2FA 4D2VA 1YI6A 3SW7A 3H30A 5F20A 1IR3A 4YNOA 1GIJA 4PP7A 4V0GB 4ZTMA 1Q24A 5HCZA 2E9VA 5DT3A 3ZLSA 4KBCA 3CD8A 4Z16A 1AGWA 3AC2A 4UWCA 3GT8A 1OL2A 3KFAA 3TZ8A 4XP3A 3WZDA 2HZNA 5HD7A 3FQHA 3NPCA 3T9IA 1LEZA 1PYEA 1OKYA 3BEAA 3OW4A 4BI1A 4KINA 2RSVA 2A0CX 3DV3A 2VWIA 4NUSA 2HZ0A 2CNQA 4X3FA 1O6LA 1WMKA 2G15A 3SLSA 5LVPA 2JDTA 4QQTA 2CNUA 2OXXA 3C51A 3MJ2A 3V5LA 1MRUA 2XBAA 4ZLOA 4YP8A 4E4MA 2QU5A 3BQCA 4QMSA 1NT2A 3UOLA 2ITXA 2I0HA 4E6CA 4EKKA 4MX9A 4XV3A 3R1QA 4XBUA 5BVEA 1F0QA 2C4GA 2XNOA 4XMOA 4EK8A 2P33A 3Q2MA 3NSZA 5AX3A 1PXPA 5LMKA 4BR3A 1M17A 4O2ZA 1W98A 4AW1A 4AQCA 3V5QA 5JGDA 2PVJA 4BCQA 3DT1A 1Z57A 1GZ8A 3TI1A 3NUAA 2C1BA 2WMBA 4QP1A 2GHGA 2R3JA 3HMMA 3LFBA 4QP4A 3AD4A 5LMKC 4O0YA 2G1TA 1H1SA 2QKRA 3WF7A 3UO6A 5LQFA 3HX4A 4GFGA 2QO7A 4ONAA 3MY1A 4YJSA 3BCEA 5JZNA 3VBWA 5AX9A 3BHUA 3R00A 1XKKA 4R5SA 4W8EA 3EN6A 1ZY5A 2WMRA 4PF4A 3E3PA 3A7JA 5CT7A 2LAVA 4C8BA 3SVVA 3OXZA 4NFNA 2HW7A 1B6CB 5AJQA 3HAVA 3V51A 4ANMA 4IWOA 4Y95A 1PMEA 4JBPA 4J8NA 1KE6A 2GPHA 3TZ7A 4C35A 1YWVA 5BUJA 4E5WA 4GG7A 3TT0A 4CMTA 5FXSA 4KABA 3C1XA 2X2KA 3RGFA 3EN7A 4YC8A 3EQRA 2G01A 5CF4A 5HHWA 5KBQA 5HLNA 2I40A 3UIUA 5AV1A 5CEQA 3D5WA 1KSWA 2PHKA 4UZHA 3RP9A 2QOKA 1T45A 4GV1A 4MBJA 2WTCA 3S2PA 3LOKA 3SOAA 4CZYB 5IMXA 2JFLA 4RJ5A 1OL5A 5KMIA 2WB8A 3R73A 2WEIA 3OXIA 4MXYA 3MH1A 3U55A 3ZONA 4FKOA 2QG7A 5B2LA 1GIIA 4YGAA 2BKZA 4BTFA 2V7OA 4DGMA 4FV3A 5DHJA 5K4IA 1S9IA 5JFVA 4YTIA 3C4FA 4YHFA 2XKCA 2WTDA 3SG9A 5EG3A 3QTZA 5LWMA 2BVAA 4WUAA 4QP9A 2NNWB 2QI8A 3ZS5A 4CFWA 2QOFA 3NW6A 3LJ1A 2B55A 5JZJA 2IW6A 1YVJA 3AC5A 4U3ZA 2Z02A 1PXNA 4I21A 3FHIA 4X6QC 5GZAA 1J3HA 4YLKA 4ZJJA 2YZAA 3VO3A 3K54A 3ZRLA 2YZLA 4OT5A 4YLLA 4BCHA 2OF2A 3U51A 3FZOA 3WF6A 3AT3A 2YABA 2Q83A 4MVFA 3TXOA 4XCUA 2YLEA 4AX8A 5F1ZA 5BYLA 3MPTA 1H1PA 1OIRA 2VTJA 3KU2A 3L9PA 3QU0A 3TV7A 4PMTA 5FM3A 5HE2A 4CFXA 2Z7RA 4XG9A 2WGJA 2PVKA 3OBGA 4JI9A 3BWFA 4EOOA 1OECA 1YHSA 4KIPA 3W10A 4QMTA 3A4PA 3ZLXA 2XK8A 3KXNA 3R8VA 4R1YA 4GU6A 3SQQA 3W8QA 1DS5A 3NDMA 5LVOA 2J0JA 4N4SA 3LQ3A 5BVFA 1O9UA 5FQDC 3MYGA 4ZSJA 5LVMA 4CSVA 4NSTA 3AC3A 2E9UA 3JR1A 1Y6BA 3S3IA 4BBMA 3WF8A 4FTTA 3NS9A 3WIKA 3ZLWA 5JFSA 3GFEA 4YZBA 5ANKA 4Q5EA 4XG3A 1ZYJA 3A62A 3TKUA 4K77A 3GENA 4A4XA 1QMZA 4EKLA 3PA3A 2B9IA 4FTCA 3R22A 2ITNA 3V6SA 4EL9A 4L53A 4NW6A 5CWZA 4E6QA 5K5XA 3ROYA 3FZTA 2QKWB 4D5HA 2J90A 2C6DA 2VNYA 1U5QA 3GGFA 3VS2A 3R63A 5HE1A 4GL9A 4D58A 5AR3A 3E7VA 4H3QA 1ZYSA 2B52A 3IW7A 5CEKA 4HVDA 4OTWA 4BDAA 4Y46A 3WI6A 3VUKA 3ZRKA 4UV0A 5HICA 4D4SA 3QC9A 2VTHA 5D41A 4FKSA 3UIBA 4F6SA 3DJ7A 2GU8A 2OJIA 4FICA 4RSSA 4FT0A 1IG1A 4OTHA 1V1KA 3NNUA 5AM7A 2BR1A 3NW7A 4FMQA 2YCQA 4YJNA 3NIZA 4IZYA 4CRLA 3DTCA 3AGLA 1FVTA 2W4JA 4GT3A 4C7TA 3UP7A 4ASEA 4ZAUA 4R6VA 3LXPA 5JKGA 4OTIA 2PL0A 1A9UA 2PWLA 3LFFA 5HKMA 3RZFA 4LGHA 3KRWA 5AUTA 2VX3A 5DR2A 4HZRA 2ZJWA 1A48A 3ET7A 2RFDA 4FIIA 4QP8A 2PZPA 2ZV7A 4RPVA 4GK3A 5F9EA 1FMOE 2PVMA 5CEIA 5HG9A 5I9UA 5TR6A 4CT2A 4EHGA 3NRMA 4L6QA 3F88A 4W9WA 1PXKA 3SC1A 4H39A 1B39A 3UNJA 3GXLA 2Q0NA 4Z7GA 3ODYX 5H3QA 5IQFA 1K2PA 3EKKA 3I5ZA 3KMMA 3LFQA 3QQGA 4O7LA 4KIKA 4O2PA 2VTPA 2C6KA 4FG8A 4TYIA 5HESA 2CJMA 4D4RA 4O83A 3I0QA 2WQEA 1MRYA 3NIEA 4WNOA 2UZVA 3EN9A 4O7VA 3OD6X 4NWMA 4YUQA 3NVKI 1FPUA 1OB3A 5CT0A 3PDTA 2ITVA 4FF8A 1MRVA 1TQMA 4XRJA 3JY9A 5AP5A 3WYYA 3ZOSA 5CEOA 4Z3VA 4BY9E 4QP2A 3GC9A 4ZTSA 2O3PA 2PVNA 2VTMA 1PKGA 3P7BA 3QTWA 1IA8A 2GS7A 4GYGA 4B4LA 4WG5A 2WMXA 3JVSA 2YIRA 2W99B 3HKOA 3DA6A 1YXUA 2FSTX 4QMPA 3ZO2A 4RJ8A 2OK1A 3P23A 4RJ6A 3F3ZA 2XEZA 3R2YA 4NFMA 5KMKA 2BRNA 4WD5A 4GU9A 2XYNA 4II5A 2RFNA 2DQ7X 2HCKA 2BFYA 3R28A 4RIXA 4HW7A 1FQ1B 5AUZA 2QC6A 5J1VA 2FB8A 1FOTA 2XNNA 5G6VA 5FDPA 3ZO1A 3OCGA 4L9IA 5DN3A 3A4OX 4D2WA 3E62A 5EM8A 2HK5A 2J5EA 3HV6A 3KF4A 4ITIA 3NX8A 4O7SA 3L9MA 4ZTRA 3UE4A 3ZXZA 5FUTA 2Y4IB 5L2IA 5AP2A 4UB7A 4C4JA 3DLSA 3MFSA 3MIAA 3DPKA 4JQ7A 3QQUA 5LWNA 4O0VA 2YITA 5TO8A 3G9NA 4QPAA 2V55A 1FBNA 2E9NA 3IO7A 4M67A 4H3BA 2R3HA 3A8XA 4NCTC 5CU6A 4JOAA 5DRDA 1QPEA 2C3LA 3POOA 3TN8A 4ASDA 4GSBA 3NWWA 1A06A 1IASA 4EK6A 5AV4A 4BI0A 1R0EA 3ITZA 1H00A 3FLWA 4RA5A 4D9TA 4E3CA 3PWDA 3QWJA 2YDIA 1CKJA 2Z7LA 3NMUF 3E7OA 3IK3A 4K9YA 4EBVA 3BE2A 3FI8A 2JDVA 1XH6A 2BRMA 4JBQA 4KNBA 1BMKA 4L44A 4DA5A 2FYSA 4HVHA 3LAUA 3WYXA 3H10A 5I9ZA 5CNOA 4AZTA 4YMJA 4F9BA 2AUHA 2OXDA 4MF0A 3DBCA 4HYHA 3ZU7A 4CLJA 2C1AA 4FKRA 5EM6A 2JDOA 4BGHA 5KMOA 2VTTA 4J95A 3QTRA 3OUNB 3IGGA 3W2QA 2QOOA 4CFFA 5JT2A 3OMVA 2Y6OA 3UGCA 4ZLYA 1XBCA 4RBLA 3FI3A 2PZIA 2ZV2A 2R3OA 5HNIX 4LFIA 4IEBA 2BDWA 4QMLA 3IGOA 3AMYA 3VS6A 4AAAA 4IADA 2CGWA 3DQWA 3RALA 4BB4A 3C4EA 5KKRC 3K2LA 3RPSA 1J91A 4TKSA 3TG1A 2ONLA 1KV1A 2G2FA 2NO3A 2ITZA 3FXZA 3W2PA 4CTCA 5IISA 4FV4A 3Q96A 3EYGA 2BRHA 4MNEB 3UTOA 2VV9A 3U4WA 4M14A 4TWOA 5T68A 4DFLA 4GIIA 4UMUA 4LYNA 4ZSLA 4FA2A 3C0IA 5EFQA 3HV3A 3W2OA 5KMNA 4K11A 3ZC6A 3E8EA 3NYXA 3HV4A 1I44A 2OBJA 2Z7QA 5DPVA 2A19B 4MXAA 3ZUUA 4EONA 4RQVA 5CQUA 4ITJA 5EKNA 1REJA 4O1OA 3ZH8A 4ACHA 3DXQA 5EQPA 5KHXA 1JSVA 5JK3A 5HEZA 3PPJA 2X7GA 2GQGA 3ORLA 1ZRZA 2VWXA 2YDJA 4LOQA 3RVGA 4HVSA 1RQQA 4XHKB 2F49A 5IQAA 3EFJA 1FGKA 3BLQA 4G9CA 1PXJA 3RAKA 4FC0A 4NKSA 3FV8A 1GNGA 4C37A 4ANLA 4P5ZA 5GZ8A 3S1HA 5BUEA 4FSNA 5KZIA 3UOJA 2J9MA 3KRRA 3DOGA 3HUBA 4FL3A 4O0UA 4QP6A 5HTCA 3QTUA 2W7XA 2UW3A 4TN6A 4FSRA 4TXCA 4KBAA 4DH8A 3DKGA 3E92A 2ZMCA 3FHRA 1URWA 4RFMA 5J87A 4QMZA 5CASA 2WIPA 3WF9A 2YM7A 4ANQA 2JIUA 3NYNA 3LHJA 4FTAA 4XLIA 3GBZA 5TF9A 3FYJX 3RWPA 4HVGA 1GY3A 2YM5A 5HBJA 5HIEA 2W5BA 3F7WA 4CG9A 3U6HA 1ZMUA 4A9TA 4EYMA 4LOOA 5D12A 4ZSGA 1NXKA 3P7AA 1WAKA 2PMLX 4G3CA 5IH4A 2PUUA 5M06A 2NRYA 3DNEA 2HWPA 4CYIA 4YNEA 2QQ7A 2JBPA 2WMUA 5E1SA 4F4PA 3GVUA 4NIFB 2UZLA 4ACCA 5BVWA 4WSQA 2ZMDA 3G6GA 3BYUA 4JDJA 2WMSA 2J6MA 5E8TA 3ANQA 4CZTA 2RG5A 4HZSA 4U81A 4O0SA 2HXLA 1H1WA 4MYGA 4YO6A 5ACKA 2V5QA 4MTAA 3WARA 3RCDA 3NZ0A 3GU5A 3CPCA 3S00A 3MW1A 4QO9A 3QAME 3AT4A 3QTQA 5DT4A 3LW0A 3GI3A 4I5PA 4BHNA 2VWVA 4TW9A 4C0TA 1MUOA 4EZ3A 3QXPA 3SRVA 3HL7A 3E63A 4FIGA 1P5EA 3KVXA 3QQKA 4IAZA 1CM8A 2QR8A 2X8EA 4FV7A 3NCGA 3FBVA 3LJ2A 5C8KA 2WQMA 4O21A 4UWBA 4BDBA 1RW8A 4D1XA 1JKSA 4JR7A 4L3LA 5FTGA 1OUYA 4XEYA 2PMIA 4HVIA 2WMTA 3QQJA 3IW6A 4OTPA 4A07A 4AXAA 3LLAA 3DXNA 2PE2A 2F9GA 4H1MA 4WG3A 4HPUE 4O82A 4FG9A 4PMSA 1IAJA 4R78A 4UMRA 4EC9A 5I9YA 3IW5A 1ATPE 1M7QA 4QYFA 4FZAB 1REKA 2QO2A 3UVRA 2O63A 3PPZA 4JIAA 1QPJA 3BV2A 4EI4A 2VO3A 3AC4A 4M66A 3QKMA 4FK3A 4L7FA 4KKHA 2CLXA 2QD9A 4FIEA 5IQHA 3UP2A 2Y9QA 4MBIA 4R3CA 5EM7A 5L8LA 2YM4A 4FX3A 4M13A 4ZXTA 3HRCA 3NGAA 4I93A 5DEYA 2QOHA 2ZDUA 2P4IA 4XG2A 5CENA 3KRXA 4C2VA 5C8NA 1J7LA 4MH7A 3FQEA 3U6JA 2IVVA 2W1FA 3I5NA 4K6ZA 1YKRA 2Z2WA 5M09A 3II5A 4W8DA 4ACGA 2BAQA 3BWJA 4ZJVA 1KUTA 5CALA 3DAKA 3C5IA 4I94A 4FUYA 3D7TA 3Q4ZA 2UW0A 1YRPA 4G34A 1JSTA 3C4CA 1Y6AA 3GU8A 3LFDA 3MVHA 4IWPA 4JG6A 3SXFA 4WSYA 1NVSA 4I41A 3UQGA 4XNEA 4YZDA 4APPA 5C9CA 4C4FA 1EH4A 3QALE 5HU3A 2PUIA 3EHAA 3IPHA 2PUNA 1H0WA 1VJYA 5IU2A 1OKVA 5BUIA 4G9RA 4ASXA 1OVEA 3PP1A 3QA0A 4RA4A 4HNIA 4Y85A 5CX9A 3SV0A 3TIZA 4BFMA 4ENYA 3D7TB 3DXPA 1Q8TA 2E9OA 2H6DA 4IX5A 4ZOGA 1H0VA 3AC8A 4K0YA 5CY3A 4AOTA 4EH6A 4IJ9A 4F9YA 3PA4A 2W05A 4AFEA 2JFMA 5HD4A 2IO6A 3HECA 4BIBA 2VWZA 5DLSA 3A99A 1HCKA 2JKOA 2BROA 5HCXA 2XZSA 4U79A 1ZZ2A 3GQIA 4EORA 3KCFA 5KMMA 4UY9A 4F1OA 3FMEA 3R7EA 5LOHA 2W1GA 4L67A 4ZSAA 3U6IA 2PTKA 2XCHA 3PIZA 3ROCA 4E6DA 2JAVA 3JY0A 4FNWA 4O7TA 2I1MA 1JSUA 3UOKA 3MFTA 3DBFA 5JSMA 3PSCA 4HGTA 2VTQA 3TCPA 2UW9A 3COKA 3FE3A 3FMLA 5HORA 2JKKA 4MBLA 2HIWA 3OHTA 2XVDA 5IA5A 5D9HA 5E8YA 3QRIA 2YN8A 2WQBA 3DFAA 4YPDA 5CXHA 4O7NA 4B6LA 4ENXA 4M97A 2WNTA 5G1XA 5J7HA 3QQFA 5A6NA 4YJVA 1G3NA 3PVBA 3Q4UA 4AA4A 3LMHA 4ORKA 4KS7A 4NM0A 1XQZA 4YBKA 4IZ5A 1M2RA 4FVPA 3DTWA 5B7VA 4XRLA 2CCHA 3Q5IA 3CTHA 4MWHA 1OBDA 4QTBA 4FT5A 2C0OA 4Q5HA 3QBNA 2C47A 5E8XA 2V0DA 2IVUA 5HOAA 4BDEA 4DN5A 2VRXA 4FYNA 1PXOA 1VZOA 2V62A 1OIYA 4PTCA 4BCKA 2IJMA 4IQ6A 4HCVA 3W55A 4DBNA 4DEIA 3HMIA 4XJ0A 4CVAA 4BIEA 1FINA 3NAXA 4IFCA 4KIKB 4Y8DA 5AMNA 5H8BA 4TL0A 3VS5A 4YU2A 5DVRA 3A2CA 3OT8A 1FGIA 4FZDB 3KC3A 3KRJA 3ZSGA 3DK3A 3MGYA 3OCBA 2XIZA 3GB2A 3R7UA 1DAYA 4BGQA 1YXSA 5AM6A 2F2UA 3RHKA 2XS0A 4F08A 3BYVA 3PXKA 1XH5A 3PYYA 3ZUTA 4LMUA 4YTHA 3CJGA 3OWLA 2WMWA 3E88A 4K2RA 2P3GX 2UW6A 4FKJA 4DH3A 2BRBA 3QTSA 4E5BA 3MBLA 2WU6A 3P9JA 3JUHA 4QMOA 2J4ZA 4EOKA 4CT1A 4AP7A 5K3YA 5LCKA 3ETAA 5IQGA 3KKVA 3QGWA 3CKWA 2X9EA 2ITYA 4ZY6A 2YFXA 2BMCA 2BALA 3IOPA 3Q9WA 4FGRA 2C6IA 3MH3A 3RM6A 4CD0A 4DLJA 5ITAA 3BZ3A 2XM9A 2GFSA 4AGCA 2BAJA 4PPCA 4MAOA 3PRIA 3VULA 1ZMWA 4QPMA 4IJPA 3GCUA 4TNBA 4V04A 2B1PA 5C4KA 3FI4A 4X2GA 3Q04A 1U4DA 3W32A 5B2KA 5FDXA 3FAAA 5FGKA 1PMNA 3OWKA 4BI2A 4E20A 2BHEA 3PVGA 3PZHA 3H4JA 3I79A 2EB2A 2XK9A 2OFUA 5CSVA 3PA5A 1OIQA 4FTLA 1V0OA 3PTGA 2WHBA 4E5AX 5M51A 2O5KA 3H9FA 3RPRA 4J52A 5D7AA 2ITTA 5IQDA 3IONA 3FC1X 1BUHA 2C5XA 5B2MA 4FZ6A 4WNPA 2Y7JA 3LXLA 5JRSA 4E7WA 2XK3A 3E93A 3PFQA 3HA8A 3TNQB 4P90A 5CAPA 5LXMA 4FODA 4OT6A 3DB6A 1SYKA 3I6WA 2RG6A 2Y8OA 4QP3A 4C34A 5ICPA 1IAHA 4NJDA 3V01A 5L8JA 4NM5A 1GZNA 4FBXA 4U5JA 2Q0BA 4O96A 4UMTA 4RMZA 1WBWA 2PYWA 4MXXA 2XIXA 2C5VA 3GEQA 3MA6A 4XG4A 3TEIA 4E73A 2JC6A 4FTUA 5LARA 3GC7A 3RWQA 5H9BA 5AAEA 1UWHA 5GJGA 4YSMA 3GQLA 2YAKA 4FNYA 3MDYA 4FTOA 1VYZA 4JX3A 5AR4A 4F7LA 4AUAA 1PW2A 2BIKB 4C4EA 4IFGA 3VAPA 5CANA 5HU9A 3D5UA 5CAVA 3OS3A 1K3AA 2W1DA 4ZTHA 5FP6A 3LCOA 3VUTA 1SZMA 2YM6A 2PUPA 4WO5A 3AMAA 4DITA 5A4EA 2HW6A 4DEDA 4IIRA 4IAAA 2W1IA 4WNKA 2A2AA 2GNIA 3PY0A 1BL6A 5IEVA 3KXZA 3IG7A 3OWJA 3WILA 3EQIA 3TZMA 2PVRA 4QMVA 2C6TA 5JGBA 2Y6MA 3K5UA 1YI4A 2ZDTA 5BVNA 5KMJA 3Q6WA 4AT5A 3D5VA 4PL3A 5AP6A 4BCOA 2BDFA 3MY0A 2KTYA 4ZIMA 5HZNA 1H07A 4KS8A 4H3PA 5IMEA 2W1EA 2W4OA 4G16A 2XBJA 2EXEA 2DYLA 4YJQA 3ZBFA 2C3JA 3KULA 3ORZA 4LUEA 4MD9E 4CEGA 3DAEA 5FEQA 3VS0A 5E9EA 4GKHA 2BHHA 3U87A 4U9AA 4RIYB 3WZJA 2J0MB 2PSQA 3ZBXA 4CFVA 3Q60A 5ETIA 3QGYA 1JKLA 3ZFMA 3PY3A 4DH1A 1NY3A 3UMXA 2P0CA 5CZIA 3ZXTA 1G8SA 2VNWA 3TUBA 4L43A 1JKTA 5EM5A 3BI6A 2XM8A 5EDPA 5BYYA 3T9TA 2I0VA 2YERA 4HGSA 3NW5A 3SDJA 2H96A 3MIYA 4D5KA 3FUPA 4RLLA 3QCQA 4F9CA 5EYMA 5L2QA 2R3RA 4CFMA 5AUWA 2J51A 3VUDA 4RZWA 4O38A 3KA0A 4PDSA 1H24A 4C61A 4ZS4A 3UC4A 1GJOA 4RIYA 5BX0A 3M2WA 5LMBA 2CKPA 1TQIA 3F2RA 2PMOX 4WKQA 1YI3A 4RIWA 3V3VA 5IEXA 4ZMFA 4GS6A 2X1NA 2VU3A 4D1ZA 3NNXA 5FLFA 4EK4A 1FMKA 1XH8A 2VWBA 4RLKA 5AP1A 4IB5A 4DHFA 5A4TA 3IW8A 2X39A 3UNKA 5FXQA 3D0EA 3FZ1A 4NYEA 4PDYA 4JT3A 4WHZA 4F7NA 3VNTA 4FKIA 3L1SA 1WBSA 2WMAA 5ETAA 2CMWA 1OZ1A 4QYYA 4TWPA 4I6QA 5JFXA 2HYYA 3NNWA 5M4IA 3QC4A 4PDPA 3ZM4A 4RIWB 4O7WA 3D2KA 3LCSA 4CTBA 3QCYA 4QYEA 4EUTA 4I4FA 1YXTA 3FL5A 5E8UA 2ACXA 5CU3A 2CN8A 2IW9A 3CKXA 3TL8A 4G2FA 4YZ9A 3TZ9A 4I6FA 3W2CA 1SNUA 4CGAA 5K0KA 4N6ZA 4ZS0A 3GNIB 3OVVA 5HG7A 4M0ZA 3EMGA 3P0MA 3R1YA 4FKUA 5EI8A 4IB3A 3CC6A 2JKQA 1CSNA 5KCVA 4PQNA 1P14A 3HRBA 2CHLA 4F6UA 3GC8A 3E5AA 2HWOA 2YCRA 4W4XA 1XH9A 3UODA 2VGPA 2HY81 3EWHA 4OTDA 4YJUA 1E9HA 3DZOA 1Y91A 3L8XA 5KO1A 2O64A 4IX3A 2VX1A 4CXAA 2WEVA 2QCSA 4KB8A 5CAOA 4IAYA 3OWPA 2G2HA 5HGIA 1WBVA 3O8TA 4I24A 5I4NA 2QO9A 4HCUA 5DT0A 3KXMA 4IDVA 4LV5A 4XH6A 3KXGA 2VD5A 5HTBA 3HV5A 4E8AA 1J7UA 4IMYA 1OPKA 2PE0A 5TE0A 2W5HA 3LFSA 4IAIA 3DJ6A 3LQ5A 1NA7A 4N70A 1XBAA 4I6HA 1JAMA 3E64A 4K1BA 4USDA 1UNLA 3LE6A 4DH5A 4O6EA 5ANJA 5IA2A 3FSKA 3QX4A 4LGGA 2XJ0A 4QP7A 3D2IA 3PP0A 4QMNA 4OGRA 5A9UA 2BZHB 3RAIA 3KF7A 4RWIA 2IVSA 4HYUA 5TKDA 2UW7A 3PRFA 3D94A 2ZB1A 4LGDA 2YIXA 3EZRA 3R30A 4G17A 4J8MA 4CFNA 3UZRA 4JDKA 4Q9SA 2CCIA 1W83A 4L01A 4GYIA 3HVCA 3IKAA 1CTPE 4DEAA 3ZC5A 4PV0A 3DAJA 1G5SA 4PL5A 4PY1A 3OTVA 4FKVA 1XWSA 2QOIA 3LFNA 3KMUA 4F9AA 3FLQA 2GMXA 5KHWA 4AGDA 2FGIA 1UA2A 4Y5QA 2BIYA 4GVAA 4KAOA 1GOLA 3TKIA 1O6YA 3RTPA 3MH0A 3OCSA 2I0YA 4HYSA 4FK6A 5HIDA 2CKEA 1B38A 2VWWA 3C0GA 3OG7A 4O84A 4YZNA 3TACA 3LCTA 1UWJA 5M44A 3MFRA 5FBOA 5BQ0A 4EQCA 5I5ZA 3PG1A 2VO0A 2X8IA 3R8ZA 4MXOA 2ZM3A 3FMMA 3OP5A 4ALWA 4XOZA 2CN5A 5HIBA 4Y5HA 2J5FA 2GNLA 3PY1A 3PJ3A 4OTGA 1P4OA 2XKEA 3I81A 4V05A 1L3RE 4WT6A 3HYHA 4EOPA 4D2SA 4YZMA 5HLPA 3GU6A 4KKEA 2VGOA 3PXYA 1W7HA 4QT1A 2CPKE 4FSQA 3ZDUA 1Y8GA 4KKGA 4PTEA 1WBPA 1YDSE 3F5XA 3KVWA 3NUNA 5ANGA 4BCNA 4L00A 1H8FA 3VHEA 3O8UA 2JAMA 3DBDA 3CE3A 1CKPA 3LM0A 2WFYA 4N6YA 4RWJA 4U43A 5CLPA 3AD6A 4AF3A 4FTQA 4EOQA 3GUBA 3O71A 3RPYA 4F65A 2FSMX 3R9OA 2JD5A 5E8VA 3MSSA 4RWLA 4XV9A 4ZJIA 1YOLA 4J53A 5E8ZA 1IA9A 4BZNA 3ELJA 2VTAA 2IZSA 3CGFA 4F1MA 2FO0A 4FKPA 3VQHA 3ZLYA 4V0GA 3QRKA 4KRCA 1W8CA 4X2NA 3IDCA 2R3LA 2WELA 3IQ7A 3NYVA 4FL1A 4I22A 4R5YA 5M56A 2XNEA 2VTSA 3OCTA 4X6RA 4O7YA 3QTIA 2UZDA 1MQ4A 3CLYA 4JL9A 1XO2B 2QOBA 5DRBA 5EW3A 4BHZA 4DG3E 2W96B 4I5HA 4U80A 4C36A 3OTUA 4JLCA 5I9XA 5ETFA 2R3MA 3BLRA 4FOBA 4G6LA 4RIOA 2O65A 2QNJA 5FRIA 2UUEA 4HYIA 3TNPC 2ITOA 3BU3A 1ND4A 4RC4A 3O8PA 3LVPA 1TVOA 2PZ5A 4UEUA 3V5JA 1PJKA 4NTTA 4ZLZA 4FTNA 4FEQA 1FVVA 3PG3A 2F57A 4RG0A 2J2IB 3RK7A 3ZEPA 3DK6A 4DAWA 2R64A 3S95A 3DQXA 3VN9A 4PPBA 4F0FA 3TM0A 4KWPA 4DBXA 4W4VA 3HA6A 4TNDA 5CSWA 4E1ZA 2WU7A 3FWQA 5IEYA 1H25A 2WAJA 3GCQA 4FNZA 2E9PA 4XG7A 3FMNA 4YC3A 2IZRA 4FL2A 3T3UA 2WD1A 5K5NA 4BKYA 5ANEA 3Q2JA 2WTKB 2GFCA 2WXVA 2R3QA 2VTOA 3V8SA 4EQUA 2O0UA 4MK0A 5L4QA 4PNKA 3DB8A 3TV4A 5KKRB 4TYGA 5DA3A 1OUKA 3QYZA 3B8RA 4GT5A 5CZHA 3G33A 3N9XA 1PMUA 1ZARA 2XA4A 5AUYA 3FC2A 5BPYA 3Q32A 5CXZA 4APCA 3FZRA 2OH0E 2Z8CA 3LMIA 2CLQA 4IVBA 5I3RA 1U59A 1IEPA 3MI9A 5GNKA 3LFCA 3QZGA 5J9LA 3ENHA 2XF0A 4X0MA 4KSQA 5M08A 5H8EA 3LFAA 3RCJA 4CYJA 2BPMA 3PSDA 3PJCA 4C62A 3UQCA 2GNHA 2CGUA 4IWQA 5FXRA 4R7BA 5HVJA 2R3KA 5EI6A 3RK5A 5HTIA 5GZ9A 1KE5A 4CV9A 3W2RA 4ANOA 3U4UA 4Z7HA 3ORPA 5A4QA 3NVMB 4MQ1A 3ALNA 2YM3A 3FKOA 1NW1A 3AOXA 3V5TA 3COMA 3SG8A 5CVGA 3BGZA 1SM2A 3R83A 3TDWA 1K9AA 4A7CA 2BZKB 2V7AA 4EUUA 5E8WA 5HX8A 3LXNA 4O0TA 5BVKA 2EU9A 4FE2A 3ZHPC 2RIOA 4EEVA 2X7FA 5IZFA 2NP8A 4IB0A 1PYXA 2ZOQA 5HNGA 2R9SA 1F3MC 4YJOA 4QMXA 2GS6A 3EKNA 3P7CA 4E4NA 2R3FA 3DBEA 2YAAA 1OPLA 2OJ9A 2XIYA 3QRTA 4UZDA 2CNVA 3HEGA 2H9VA 3WBLA 4P2KA 1WBTA 3BRBA 2BZJA 5K0XA 3W8LA 4RC2A 2X2LA 3G90X 2QOQA 4PNIA 5HBHA 5J9YA 1U46A 4CCBA 4G6NA 3A7IA 3NLBA 1Q99A 4JG7A 3VBVA 1LR4A 1UNHA 4D0WA 2OIBA 4IBMA 3QQHA 3FLZA 2VTLA 3DKFA 5I9VA 4DTBA 3EQHA 1M14A 5HQ0A 2B9HA 3QYWA 5EW9A 5IUIA 2X6EA 2VX0A 3VRYA 4EOLA 4AW5A 1Q8UA 2HZIA 2FVDA 4QQJA 4I0RA 5LCJA 1UNGA 2ETRA 3LXKA 3H3CA 5DEWA 3P1AA 4BRXA 5M4FA 2IPXA 3CY2A 4D1SA 3RINA 2R3IA 3RNYA 2PVYA 4F0IA 3R8MA 2J0LA 4C58A 3RZBA 1JOWB 1R0PA 2PPQA 4NT4A 4IB1A 5CF6A 2H34A 3BELA 5FBNC 3SXRA 2YIQA 3ZZEA 3P79A 4PP9A 3KQ7A 4RQKA 4BCFA 4EH9A 4PX6A 4ERKA 3QD4A 2GS2A 4HPTE 5BVDA 4DT8A 3BHVA 2C5OA 2VO7A 5FTOA 5JFWA 3TTIA 2YCFA 4G6OA 4C4IA 3EFLA 4MEDA 4TYJA 1GZOA 3QZHA 2PVHA 4FIHA 1RJBA 1YOJA 2KULA 4O0WA 3MY5A 3JPVA 4W4YA 4QTDA 2ETKA 4FTMA 4D4VA 2OU7A 4IVCA 4FV9A 4FZFB 4KA3A 2XNGA 2QLQA 1SVHA 5EOLA 3VBYA 3GFWA 4G5JA 3QL8A 3UYTA 1M2QA 3Q53A 4I4EA 2YJRA 4XG8A 5H2UA 4AE6A 4E4XA 4DCEA 4L52A 3UZTA 2PU8A 5CYIA 3L9NA 3HAMA 2W4KA 3VJNA 5J5TA 4TWCA 1ZOEA 3KREA 1UU9A 2OJGA 4I20A 4J71A 5IKWA 4KUJA 2ZYBA 3G5DA 3H0YA 4M8TA 5FEEA 3BU6A 2E2BA 3W33A 5DR9A 4H05A 4DCAA 4PRJA 3FMJA 1MP8A 5HBEA 4M69B 5AFVA 3O50A 2FSOX 4S2ZA 1RE8A 2IN6A 4TZRA 4DTKA 1CDKA 2IW8A 3KY2A 1J1CA 3EN5A 5FTQA 4QQCA 1H08A 4S33A 1DAWA 3WZEA 4U8ZA 4L68A 4EJNA 5HG8A 4FKWA 5M4CA 3L8PA 3SAYA 2X7OA 4CV8A 3ATSA 3U54A 3IS5A 4P5QA 4YHTA 3UDBA 1H27A 3PPKA 4AT4A 4DF3A 2XMYA 4C2WA 3UPZA 2EVAA 2UW5A 1Q3WA 4U97A 4AZSA 3CPBA 3FQSA 5L6PA 4DC2A 3N4TA 3AC1A 3R0TA 4M69A 2XB7A 2B54A 4CKIA 4JR3A 4OLIA 3IDPA 3VWAA 4FKTA 5L3AA 2BRGA 4PMMA 1AD5A 3O17A 4B7TA 1M2PA 4FT3A 2ZM4A 4W4WA 4PMPA 4F99A 4EYJA 4OTRA 4WBBB 4X7QA 1ZOGA 5ANDA 3ID6C 2EB3A 2EXMA 3O2MA 1M7NA 3DLZA 2VWYA 5L6OA 3FXXA 4CMOA 5IQCA 4RVKA 1UU3A 4FV1A 3VF8A 2C0TA 5HNBA 4BCIA 2A27A 3QKKA 4EJ7A 3A7FA 5AWMA 3E87A 2JDRA 5A54A 1DM2A 4LM5A 4BDCA 5EDQA 1QPCA 4WA9A 2B4SB 3OZ6A 4J97A 4L8MA 4BF2A 4F63A 2BDJA 2GTMA 4DFYA 3Q9YA 5E90A 1LP4A 2ZV8A 4JQEA 2BZIB 1PF8A 2YIYA 4B9DA 3WE4A 1ZXEA 2IG7A 3QCSA 1KV2A 1T46A 2UW4A 2OWBA 3U9CA 2PZYA 3QHRA 4IM2A 4U41A 2OIDA 4IVDA 4JAJA 4QOXA 5AR2A 3ZZWA 1PXMA 4RIXB 5IA1A 4XP2A 5HO6A 1JBPE 3C7QA 2NRUA 3FPMA 4TTHB 2YWVA 3QD2B 4GFOA 3ZUVA 3E3BX 5K4JA 4BDKA 5LMAA 5ETCA 2X81A 4F70A 5J79A 4A4OA 3P86A 2Y4PA 3MV5A 4BYIA 1Q5KA 3TIYA 3NUUA 3N4UA 4FSTA 3Q9XA 1WBOA 3MVJA 3CY3A 4AN2A 3A7HA 5B0XA 3R8LA 2XIKA 2PY3A 3VC4A 2X0GA 1R1WA 3VBTA 3BYMA 3Q6UA 4I0TA 3ZFXA 4BTJA 3EYHA 4LMNA 5AP4A 4QPSA 4EZ5A 4DFBA 3GCPA 3MFUA 4M84A 4A9YA 2VTNA 4U44A 2VUWA 1HOWA 2R7BA 5KE0A 4DFXE 1APME 2SRCA 3OT3A 4QMWA 4BDDA 3TNIA 4RWKA 4YLJA 4BKZA 2XJ1A 4ANNA 4A9RA 4RVTA 3F6XA 5J7BA 4USEA 4ALVA 3FKLA 3F61A 4FV8A 4G3GA 4ITHA 5DWRA 1OITA 3D9VA 5FP5A 2QURA 2BUJA 4D28A 3MA3A 2JIVA 4Z55A 2YACA 3DU8A 3Q4CA 3S0OA 4BYJA 5HO7A 1V0BA 1OKZA 4D0XA 4TYEA 3OC1A 2QOLA 2NPQA 2QLUA 4IH8A 5TT7A 5C1QB 4O7ZA 5CI6A 3PJ2A 2RKUA 4KIQA 4CKJA 4GJ2A 3N4VA 5EW8A 4C4GA 3QKLA 1ZMVA 5GIOE 2XIRA 2JDSA 3CQEA 4YJTA 3POZA 3UG2A 3VHKA 4WNMA 2JLDA 2Z60A 3NUSA 3R9DA 3KXHA 1E1VA 1Z5MA 2QOCA 4F0GA 3V5WA 3KCKA 1BKXA 5FEDA 4F7JA 2WTKC 4O81A 1ZYLA 4MD7E 3ZCLA 1PHKA 3EB0A 3LIJA 2OI4X 4QMYA 3FZPA
chains in the Genus database with same CATH superfamily
3CQUA 2ZVAA 1WVYA 4G3FA 4MNEA 4LG4A 4RX5A 3KL8A 3BHHA 5T3QA 1H28A 2YHVA 3I7BA 3TNWA 5IG1A 1ZYDA 5CVFA 4X3FC 4EQMA 2UV2A 3F82A 1Q61A 4HGLA 1TQPA 3O23A 4JMQA 4EHEA 3QUDA 3E8DA 3D83A 1WBNA 3CJFA 3N51A 4Z9LA 3RBWA 5FM2A 4L46A 3ULZA 3F3TA 3WIGA 3C9WA 4L3JA 5DYJA 4E6AA 1OGUA 3I6UA 5DH3A 5EDRA 3DZQA 2GDOA 2YLFA 2X4FA 4S34A 4S31A 4O7RA 1ERKA 2FSLX 3VIDA 5KX8A 4CG8A 5EYDA 4J7BA 4WRGA 5M4UA 4YJRA 5AP3A 2C69A 2OJJA 1KE7A 3QRUA 2WTIA 3D14A 3EIDA 3QQLA 3CQWA 4IX4A 3L9LA 4EOMA 5DR6A 4JBVA 3NAYA 2C6LA 2Z7SA 4A06A 4QMUA 3SX9A 2AYPA 2J50A 1E1XA 2W1HA 5EKOA 5F94A 5IDPA 4IW0A 5CNNA 5IA4A 2ZB0A 1KWPA 3QUPA 3UO4A 2W9FB 1WZYA 4AW2A 1CKIA 1DI9A 2ITUA 4FVRA 4R3PA 5AR5A 3KXXA 2WIHA 3QUEA 3ZSIA 2R3PA 4DYMA 4NTSA 3UVQA 4W9XA 2RFEA 2ITQA 4GUEA 1UV5A 2J7TA 3FLYA 2W1ZA 4I23A 3W18A 3OOGA 3FSFA 4WUNA 2YISA 4EH4A 3AQVA 2OKRA 4BGGA 2PE1A 1BL7A 1JNKA 4WOVA 4YZCA 4JVGA 4BJJB 4AGWA 5T6KA 1LEWA 1GZKA 3LM5A 1YDRE 4L3PA 3UZPA 4EH2A 4CFUA 5H8GA 4XUFA 2Y0AA 4WBOA 3U8WA 2VWUA 3ZTXA 3PUPA 2XARA 4BWPA 4ANSA 4ZEGA 4OAVB 2RF9A 4J98A 4PL4A 3SD0A 2OZAA 2WTJA 2OIQA 3NR9A 3HNGA 4UWYA 2W5AA 3CXWA 3UJGA 2O2UA 3A60A 3EQFA 3QHWA 3CIKA 4EC8A 4I92A 3G9LX 3LCDA 2C30A 5AR8A 5CEPA 3EQCA 3SOCA 3BHYA 3TNHA 4TYHA 4MKCA 4AACA 3R8PA 3COIA 1STCE 3NUXA 4PWNA 3MB6A 4L7SA 4BBEA 4EK3A 3ULIA 2GHMA 5AIKA 3LZBA 4U6RA 3TJDA 3PVWA 5AUUA 3S4QA 4GUBA 4PPAA 5KBRA 3F5UA 2C3KA 1BI7A 3UIMA 4GEOA 5DIAA 4O6LA 3Q9ZA 1RDQE 3V8TA 2DUVA 1H1RA 3ORIA 5JH6A 2PULA 5C4LA 3ORMA 3CSVA 2UZWE 3K5VA 2PVLA 3R7YA 4DDGA 5FG8A 4AW0A 4AA5A 1YHWA 1W2CA 4S30A 2C5YA 4MHAA 2BAKA 2XK6A 1YXVA 5EOBA 4AG8A 3ZFYA 5LVLA 1YDTE 4YHJA 3VS4A 4FIFA 4NJ3A 4OTQA 2JBOA 4ZP5A 3R7OA 3HP5A 3FPQA 2R0UA 3RAWA 1BI8A 2OLCA 4HGEA 2W0JA 3FI2A 4YC6A 3WE8A 1BX6A 3AGMA 5EHYA 5L6WL 4AA0A 3QWKA 4CKRA 5AEPA 5EQEA 3SW4A 4YPSA 1W2FA 4RFZA 4G5PA 3PXZA 4BDHA 4RX9A 2BTRA 3PJ1A 2BILB 1QL6A 1WVWA 2RFSA 2RL5A 4C59A 3UIXA 2B7AA 4R1VA 3P5KA 2P55A 3LFEA 4O4EA 2A4LA 3BYOA 4XV1A 3UQFA 1W0XC 2PVFA 5HG5A 3CCNA 3OBJA 4BDIA 3CEKA 2W9ZB 2ZAZA 1UVRA 5A3XA 4IM3A 2C5NA 4YURA 2ZM1A 4O22A 2UW8A 4C33A 3P78A 2OSCA 3I0OA 4O0XA 3UO5A 4C3PA 3R1SA 3GC0A 4CQEA 3PIYA 4DG2E 2AC3A 3NFGB 5IQEA 2YWPA 3BEGA 4RC3A 4UMQA 4BCMA 1O6KA 3ORNA 3ENMA 3ORTA 1Y57A 2HELA 3JXWA 3FZSA 4NKAA 3HUCA 2XNMA 3ZSHA 4HOKA 4AZWA 4JS8A 3FEGA 4FSMA 2CGVA 3LKMA 5AA8A 1R3CA 3FKNA 4QRCA 2WPAA 3C4XA 3ZO3A 2YA9A 2PZRA 3KIOC 3R2BA 4MXZA 4XLVA 3DKCA 4AN9A 3SKCA 4FKGA 2B9JA 3BX5A 1ZWSA 4WIHA 3FJQE 5D1JA 5M53A 4X3FB 4U3YA 1HCLA 3ACJA 4ZK5A 5JN2A 5IQIA 3RJCA 3QD3A 4RJ3A 1PMVA 3WZKA 4YTFA 3IECA 1J7IA 1ZLTA 2XJ2A 5GJDA 4R77A 5GINE 4AN3A 3EFKA 4JXFA 2UVYA 3ERKA 3RAHA 2XNBA 1VYWA 4G1WA 5HCYA 3RNIA 2XNPA 1Y8YA 4Y73A 4IACA 4ALUA 4DTAA 3ACKA 4BTKA 2XUUA 3JYAA 3MH2A 5AAGA 2UZTA 2C6EA 4NIFA 3F9NA 4N57A 3PWYA 2YM8A 4JBOA 4XP0A 3ZM9A 4M15A 5D11A 4ZZNA 2ZV9A 3SXSA 4LRJA 3BL9A 2WTWA 3R04A 3OY3A 3R01A 4DGNA 4NU1A 4RX8A 2GSFA 1YWRA 4QTCA 3R1NA 2I6LA 3HV7A 1SNXA 4F09A 3BKBA 3A8WA 3FLNC 4MQ2A 3SRVB 4Y72A 4NZWB 2GTNA 2FUMA 5F4NA 4TWNA 4UXLA 2YEXA 5CI7A 4I3ZA 4EH5A 3VJOA 2X0OA 4FKLA 4UN0C 2OGVA 5J1WA 3G51A 3HLLA 4FV0A 4NK9A 1Q41A 4CCUA 4TY1A 4FTRA 5AUVA 4BZOA 4G3DA 3HP2A 3UC3A 3VW6A 3UG1A 4JQ8A 3BIZA 4IDTA 3OXTA 4FSZA 1VR2A 5ACBC 2UVZA 1CMKE 2F2CB 2ITPA 4FTKA 4MNFA 3ZO4A 4EWHA 2WTVA 4F1TA 1OI9A 1YOMA 5L8KA 3MTFA 3MB7A 1G8AA 5AA9A 4ZY5A 5L2SA 3DK7A 3IOKA 4FVQA 1OM1A 3R71A 3BBTB 2BTSA 3EJ1A 1H1QA 5CQWA 3F3WA 1DI8A 4FZ7A 3RK9A 5BNJA 1L8TA 1H26A 1R78A 2XKFA 1F5QA 3KB7A 3C0HA 4D2PA 4OAUC 5D7VA 2PMNX 2QONA 5E4HA 4ASZA 1JWHA 2OH4A 5DFPA 4C38A 3CBLA 4YSJA 1H4LA 5C03A 3UMWA 4X2JA 4OTFA 4FSWA 2PK9A 3ZRMA 2GHLA 4A9SA 5CF8A 3MVLA 4R7IA 5CU4A 3ZDIA 3BGQA 1LPUA 5J8IA 2HENA 3KGAA 5HO8A 4IWDA 3WZUA 3KK9A 1J1BA 1OPJA 3KK8A 1XH4A 3P4KA 4I6BA 4L42A 2UVXA 4GG5A 2G9XA 4R3RA 1UKIA 2B53A 5ANIA 3VUGA 4U40A 2IWIA 3EFWA 5CU2A 4IANA 3MTLA 4O27B 4OW8A 4DG0E 3F7ZA 2FA2A 3K3IA 4I5MA 3MPMA 4ACDA 2XH5A 2X8DA 4LRMA 4CMUA 5KUPA 3FY0A 5GIPE 4OR5A 4MD8E 4AWIA 5I0BA 3R02A 1OBGA 4QYHA 1PKDA 4NW5A 2OICA 4MCVA 5EYKA 3A61A 2HXQA 2GQSA 2OXYA 4DEEA 4DE4A 3H0ZA 3CD3A 4FI1A 4KD1A 5I9WA 5DE2A 4XG6A 4LL5A 4D4YA 1Q8YA 3GP0A 5IQBA 3T3VA 3GOKA 2J0KA 3KEXA 4BCPA 3RPOA 4DINA 4DGLC 2WKMA 1KE9A 2XCKA 3TUDA 2QU6A 3DNDA 5AUXA 4YR8A 4ZY4A 3B2WA 4QNAA 3ODZX 4DHZA 2J0IA 2P2IA 2OJFE 3DCVA 3BPRA 4BBFA 2QHNA 4D2RA 2XRWA 3O96A 4BC6A 1JLUE 2IZUA 4EOIA 3R6XA 3E8CA 4QMQA 2ONLC 2UZOA 2B0QA 4I6LA 1XJDA 3DJ5A 4FKQA 4LUDA 3AT2A 5M55A 4YO4A 3THBA 5KMLA 5DOSA 3W16A 4EBWA 3HRFA 3ZYAA 4OBQA 1UU7A 3DFCB 2YJSA 4RT7A 3WOWA 2JGZA 3W1FA 3FDNA 4U42A 3M1SA 3UVPA 4DFNA 4IZ7A 5DNRA 3R9RA 4EHZA 3R7IA 2FH9A 4U7ZA 2CSNA 4O91A 3ORKA 4EH7A 3EZVA 3FYKX 1OKWA 1XH7A 1PY5A 5HE3A 3Q4TA 4K18A 5D10A 3O51A 3T8OA 2V22A 3BU5A 4GK2A 2HAKA 3FXWA 4R7HA 1W2DA 4O86A 4Y83A 5K9IA 3MPAA 4FEWA 3FMDA 3BGPA 3PLSA 1SVEA 4M7IA 5E1EA 2YIWA 3TKHA 3TJCA 4ERWA 2LGCA 4IX6A 5BYZA 5JRQA 3TTJA 3RI1A 4RVLA 4AS0A 4DLIA 4B0GA 4GW8A 4C57A 1P4FA 4I5CA 4H1JA 4JRNA 2W06A 4BTMA 4D55A 3QF9A 4YTCA 1PRYA 2HOGA 2HZ4A 5HVKA 1UU8A 2O8YA 4I0SA 2GNGA 2GNJA 3C4ZA 4KIOA 3VUMA 5IUHA 3HDMA 4JX7A 4USFA 3L8SA 4PUZA 4S32A 3WF5A 2VO6A 4AOIA 5IA0A 3OFMA 2WOTA 3BLHA 4NL0A 2ETMA 2F4JA 4QEBA 4BICA 2QODA 4HNFA 2OZOA 3FMHA 3C13A 2DWBA 3DY7A 5LVNA 2DS1A 3EQGA 3OF0A 4ZTNA 1URCA 4ARKA 4ZZMA 3D15A 4IAKA 5AIRA 5GHVA 3VS3A 3QCXA 3V6RA 3RKBA 3UBDA 5J95A 3LMGA 4EHVA 5CAQA 4MWIA 4DHJA 4DGGA 5CSHA 3NUYA 5CSXA 5HX6A 4MF1A 5BVOA 2W1CA 5CS6A 5EHLA 2QG5A 2UZEA 5IH6A 1BYGA 4AZEA 3CGOA 2BCJA 4XBRA 4AU8A 4BDFA 3VS1A 1BLXA 4C3RA 4DGOA 3UNZA 3UOHA 2A1AB 5EK7A 2OO8X 2OZAB 3KN6A 5IH5A 2WO6A 4LI5A 4OBPA 4FV5A 4D9UA 1Q8ZA 3F66A 3ZMMA 4EOSA 1ZOHA 5CSPA 4QTEA 2X6DA 1OMWA 5CU0A 4RGJA 3CR0A 3C5UA 5DBXA 5J9ZA 1KOBA 3AMBA 3TWJA 3I7CA 3O7LD 5JGAA 2I7QA 4AZVA 3B2TA 4QYGA 4QNYA 3AKLA 2GCDA 2P2HA 4GCJA 1JQHA 4YJPA 5A4CA 2WMQA 5DMZA 4TYHB 3PLAE 4JJRA 4BVUA 3NEWA 4UXQA 5E7RA 1LUFA 1QPDA 3A7GA 3F69A 2OF4A 1XBBA 3KN5A 4O0RA 4FOCA 5CVHA 5HLWA 2BKKA 1JPAA 3OEZA 4LV8A 4UMPA 4EWQA 2R3NA 3HMPA 3GU4A 2ESMA 3E8NA 2C68A 3BQRA 2EXCX 4DHIB 4OUCA 1JKKA 4LL0A 1ZZLA 2CDZA 3NUPA 3LJ0A 3G6HA 5DGZA 4LRKA 3R7VA 2GNFA 2XYUA 3EOCA 1OL7A 1ZY4A 4DFZE 2CGXA 2VZ6A 3D4QA 4Q9ZA 1YWNA 3BYSA 3HDNA 3G0EA 1M52A 4IC8A 3R9HA 2F7EE 3EQBA 4JDHA 3QLGA 4EH8A 4NH1A 5C01A 3GOPA 5HVYA 3GCSA 4QD6A 5E91A 4AOJA 4LQMA 3R9NA 5IDNA 3D5XA 5A46A 4ZMEA 5AAFA 1XHAA 2ERKA 3KRLA 2XKDA 1Q3DA 3F2AA 3CS9A 3OY1A 3F5PA 5KZ0A 2R4BA 3PXQA 4DFUA 4FR4A 4FEVA 3R8UA 2WOUA 3DGKA 4G31A 5TOZA 4CRSA 4B8MA 2REIA 3JVRA 3AG9A 4M0YA 4PDOA 3LPBA 3MESA 1OL6A 2CKQA 4FTJA 4O1PA 3MN3A 3PJ8A 3O7LB 4RJ4A 2HY0A 3QTXA 5C8MA 4GJ3A 3U9NA 1I09A 4WRSA 4ZSEA 4C3FA 4EZ7A 2R3GA 3O0GA 3QZFA 4OBOA 1KOAA 4JIKA 3M11A 4JDIA 4B8LA 3LCKA 1H01A 4DEGA 1NVRA 1P2AA 3PFYA 2XRUA 3HZTA 3VRZA 2JKMA 4GT4A 4DEBA 4YBJA 4QQ5A 4MXCA 4GIHA 3IW4A 3OUKA 5EHOA 3IDBA 1KE8A 3KULB 4FT7A 4HCTA 4C4HA 4X3JA 3UDSA 4GRBA 5C26A 4FTIA 3VBQA 5E92A 2F7XE 4ZTQA 4X21A 1GAGA 4BDGA 5IF1A 1U54B 2QR7A 3DDQA 5JQ5A 1YXXA 1XR1A 4XX9A 1IRKA 3UPXA 2JEDA 2RGPA 3QZIA 4RRVA 5F95A 4C02A 4LDTA 3ALOA 3I60A 5HI2A 5FWKK 5JQ8A 4FIJA 2UZUE 1PXLA 3I4BA 3PVUA 4AGUA 4FSYA 5AV2A 4BN1A 4GVJA 1YQJA 2R2PA 3MVMA 3QA8A 3NYOA 3F5GA 4BL1A 3VUHA 5L2WA 5FD2A 2R5TA 1U54A 3VUIA 4JNWA 5LJJA 4HJOA 3HMNA 3SGCA 4UX9A 4GK4A 3R7GA 1V0PA 4ACMA 4NM7A 4XOYA 2H8HA 1Z9XA 4DH7A 5AP0A 3NCZA 4KSPA 4DT9A 4BCJA 4FYOA 5AP7A 1WFCA 4KBKA 2XEYA 2YCSA 3I1AA 3R21A 4E93A 2XP2A 4JG8A 2W17A 1WCCA 4M68A 5EI2A 3SHEA 4CQGA 3PIXA 2ERZE 3ANRA 1XMLA 3BV3A 3B8QA 3RPVA 4K8AA 2BFXA 3DDPA 3SA0A 5IPJA 1JVPP 5M07A 4ID7A 5E8SA 3VW8A 1NVQA 4Q2AA 4UBAA 5JEBA 4U0IA 3C4WA 4K33A 4BCGA 4D2TA 2OW3A 4A4LA 1OIUA 3EH9A 1ZYCA 3RM7A 4RJ7A 5ANOA 2WZJA 1AQ1A 4JAIA 4IZAA 3V5PA 3VF9A 3BBWA 5KNJA 5EH0A 2QHMA 3MJ1A 5EYCA 3W2SA 2AC5A 2OFVA 3QRJA 4R8QA 4QMMA 3VQUA 4NEUA 3EQDA 4F9WA 3DKOA 1MQBA 2X2MA 2YDKA 5A14A 2X9FA 4BDJA 1PXIA 4ANBA 3G15A 3HGKA 4M12A 2R0IA 5GJFA 3GCVA 4UALA 2C6OA 3H9RA 4ZTLA 3UYSA 1QCFA 4RFYA 3CP9A 2F7ZE 3GU7A 3DS6A 4FT9A 4GFMA 5AV0A 2UZBA 4IM0A 3RHXA 3VBXA 2IVTA 4F7SA 4AXCA 1Q4LA 3MWUA 4L45A 3LQ8A 5CAUA 2C6MA 4XV2A 4XYFA 3ZEWA 3W0SA 4G3EA 4GH2A 4IVAA 4E4LA 3PZEA 3PE2A 5CTPA 5HE0A 3COHA 2WQOA 2G2IA 3EL8A 4CNHA 5M57A 3ATTA 5EQYA 3G0FA 4QTAA 3ORXA 2VAGA 2WQNA 1X8BA 4A9UA 4AT3A 4E26A 3Q52A 2VTRA 2VTIA 4NM3A 4FSUA 4B99A 4FEXA 5CF5A 2C3IB 3FL4A 4DEHA 5L2TA 3EN4A 4BWXA 4RZVA 1WVXA 3HMOA 3F3VA 4JRVA 4J96A 2IZTA 5AV3A 1U5RA 1VEBA 1S9JA 3AXWA 1UKHA 3BE9A 4AE9A 2XK7A 3OROA 1Q97A 1ZAOA 3BHTA 3TUCA 3AKKA 2X4ZA 4V01A 5BMSA 4GMYA 2I0EA 3Q3BA 3PSBA 1Q8WA 4IHPA 1W84A 3D7ZA 3CTQA 4AFJA 1ST0A 4I1ZA 1OL1A 3K3JA 4RVMA 4XS2A 5I3OA 2UZNA 2JIIA 4PTGA 3REPA 3VVHA 2JITA 5DI1A 3LLTA 3VS7A 3KMWA 4U45A 5J5SA 2CKOA 3AD5A 5DG5A 3OW3A 4CLIA 4FV6A 4AZFA 1W82A 5IA3A 4P4CA 3L8VA 4FGBA 4IAFA 4TT7A 4F6WA 5AADA 4EK5A 3JS2A 1R39A 3PE1A 4FV2A 2ITWA 4QDVA 4BIDA 4H58A 2R7IA 3CTJA 3OEFX 1SVGA 2WMVA 2VN9A 3QX2A 5A6OA 4GKIA 3FY2A 4EOJA 4AXEA 2XK4A 4BZDA 4RX7A 3F2NA 4KRDA 3FLSA 3TV6A 3TDVA 2EUFB 3NNVA 3EL7A 4J99A 4UYNA 1Q62A 2EWAA 4FNXA 4WG4A 3M42A 2GQRA 4X2KA 4P7EA 3QLFA 4ZZOA 1YW2A 3PXFA 3QXOA 3MS9A 4LOPA 3H9OA 3F3UA 1TKIA 3G2FA 4NCTA 2Y4IC 3P08A 5CEMA 4CZUA 2B9FA 4UYAA 3EQPA 3Q5ZA 3DBQA 4IE9A 5BMMA 1SMHA 3V04A 5C27A 5AR7A 3QD0A 4FUXA 2QVSE 1FVRA 3V8WA 4IC7A 3C50A 3QFVA 4FG7A 4TPTA 3FMKA 4BWKA 4EH3A 4F64A 5JMSA 2OG8A 2C0IA 1YHVA 4N0SA 4TRLA 1GIHA 4IXPA 4H36A 3RMFA 5A4LA 4J1RA 5IUGA 4BKJA 3PXRA 3OOMA 4M3QA 4FEUA 4X2FA 4D2VA 1YI6A 3SW7A 3H30A 5F20A 1IR3A 4YNOA 1GIJA 4PP7A 4V0GB 4ZTMA 1Q24A 5HCZA 2E9VA 5DT3A 3ZLSA 4KBCA 3CD8A 4O4CA 4Z16A 1AGWA 3AC2A 4UWCA 3GT8A 1OL2A 3KFAA 3TZ8A 4XP3A 3WZDA 2HZNA 5HD7A 3FQHA 3NPCA 3T9IA 1LEZA 1PYEA 1OKYA 3BEAA 3OW4A 4BI1A 4KINA 2RSVA 2A0CX 3DV3A 2VWIA 3W0MA 4NUSA 2HZ0A 2CNQA 4X3FA 1O6LA 1WMKA 2G15A 3SLSA 5LVPA 2JDTA 4QQTA 2CNUA 2OXXA 3C51A 3MJ2A 3V5LA 1MRUA 2XBAA 4ZLOA 4YP8A 4E4MA 2QU5A 3BQCA 4QMSA 1NT2A 3UOLA 2ITXA 2I0HA 4E6CA 4EKKA 4MX9A 4XV3A 3R1QA 4XBUA 5BVEA 1F0QA 2C4GA 2XNOA 4XMOA 4EK8A 2P33A 3Q2MA 3NSZA 5AX3A 1PXPA 5LMKA 4BR3A 1M17A 4O2ZA 1W98A 4AW1A 4AQCA 3V5QA 5JGDA 2PVJA 4BCQA 3DT1A 1Z57A 1GZ8A 3TI1A 3NUAA 2C1BA 2WMBA 4QP1A 2GHGA 2R3JA 3HMMA 3LFBA 4QP4A 3AD4A 5LMKC 4O0YA 2G1TA 1H1SA 2QKRA 3WF7A 3UO6A 5LQFA 3HX4A 4GFGA 2QO7A 4ONAA 3MY1A 4YJSA 3BCEA 5JZNA 3VBWA 5AX9A 3BHUA 3R00A 1XKKA 4R5SA 4W8EA 3EN6A 1ZY5A 2WMRA 4PF4A 3E3PA 3A7JA 5CT7A 2LAVA 4C8BA 3SVVA 3OXZA 4NFNA 2HW7A 1B6CB 5AJQA 3HAVA 3V51A 4ANMA 4IWOA 4Y95A 1PMEA 4JBPA 4J8NA 1KE6A 2GPHA 3TZ7A 4C35A 1YWVA 5BUJA 4E5WA 4GG7A 3TT0A 4CMTA 5FXSA 4KABA 3C1XA 2X2KA 3RGFA 3EN7A 4YC8A 3EQRA 2G01A 5CF4A 5HHWA 5KBQA 5HLNA 2I40A 3UIUA 5AV1A 5CEQA 3D5WA 1KSWA 2PHKA 4UZHA 3RP9A 2QOKA 1T45A 4GV1A 4MBJA 2WTCA 3S2PA 3LOKA 3SOAA 4CZYB 5IMXA 2JFLA 4RJ5A 1OL5A 5KMIA 2WB8A 3R73A 2WEIA 3OXIA 4MXYA 3MH1A 3U55A 3ZONA 4FKOA 2QG7A 5B2LA 3W0PA 1GIIA 4YGAA 2BKZA 4BTFA 2V7OA 4DGMA 4FV3A 5DHJA 5K4IA 1S9IA 5JFVA 4YTIA 2XAMA 3C4FA 4YHFA 2XKCA 2WTDA 3SG9A 5EG3A 3QTZA 5LWMA 2BVAA 4WUAA 4QP9A 2NNWB 2QI8A 3ZS5A 4CFWA 2QOFA 3NW6A 3LJ1A 2B55A 5JZJA 2IW6A 1YVJA 3AC5A 4U3ZA 2Z02A 1PXNA 4I21A 3FHIA 4X6QC 5GZAA 1J3HA 4YLKA 4ZJJA 2YZAA 3VO3A 3K54A 3ZRLA 2YZLA 4OT5A 4YLLA 4BCHA 2OF2A 3U51A 3FZOA 3WF6A 3AT3A 2YABA 2Q83A 4MVFA 3TXOA 4LV7A 4XCUA 2YLEA 4AX8A 5F1ZA 5BYLA 3MPTA 1H1PA 1OIRA 2VTJA 3KU2A 3L9PA 3QU0A 3TV7A 4PMTA 5FM3A 5HE2A 4CFXA 2Z7RA 4XG9A 2WGJA 2PVKA 3OBGA 4JI9A 3BWFA 4EOOA 1OECA 1YHSA 4KIPA 3W10A 4QMTA 3A4PA 3ZLXA 2XK8A 3KXNA 3R8VA 4R1YA 4GU6A 3SQQA 3W8QA 1DS5A 3NDMA 5LVOA 2J0JA 4N4SA 3LQ3A 5BVFA 1O9UA 5FQDC 3MYGA 4ZSJA 5LVMA 4CSVA 4NSTA 3AC3A 2E9UA 3JR1A 1Y6BA 3S3IA 4BBMA 3WF8A 4FTTA 3NS9A 3WIKA 3ZLWA 5JFSA 3GFEA 4YZBA 5ANKA 4Q5EA 4XG3A 1ZYJA 3A62A 3TKUA 4K77A 3GENA 4A4XA 1QMZA 4EKLA 3PA3A 2B9IA 4FTCA 3R22A 2ITNA 3V6SA 4EL9A 4L53A 4NW6A 5CWZA 4E6QA 5K5XA 3ROYA 3FZTA 2QKWB 4D5HA 2J90A 2C6DA 2VNYA 1U5QA 3GGFA 3VS2A 3R63A 5HE1A 4GL9A 4D58A 5AR3A 3E7VA 4H3QA 1ZYSA 2B52A 3IW7A 5CEKA 4HVDA 4OTWA 4BDAA 4Y46A 3WI6A 3VUKA 3ZRKA 4UV0A 5HICA 4D4SA 3QC9A 2VTHA 5D41A 4FKSA 3UIBA 4F6SA 3DJ7A 2GU8A 2IF8A 2OJIA 4FICA 4RSSA 4FT0A 1IG1A 4OTHA 1V1KA 3NNUA 5AM7A 2BR1A 3NW7A 4FMQA 2YCQA 4YJNA 3NIZA 4IZYA 4CRLA 3DTCA 3AGLA 1FVTA 2W4JA 4GT3A 4C7TA 3UP7A 4ASEA 4ZAUA 4R6VA 3LXPA 5JKGA 4OTIA 2PL0A 1A9UA 2PWLA 3LFFA 5HKMA 3RZFA 4LGHA 3KRWA 5AUTA 2VX3A 5DR2A 4HZRA 2ZJWA 1A48A 3ET7A 2RFDA 4FIIA 4QP8A 2PZPA 2ZV7A 4RPVA 4GK3A 5F9EA 1FMOE 2PVMA 4FRFA 5CEIA 5HG9A 5I9UA 5TR6A 4CT2A 4EHGA 3NRMA 4L6QA 3F88A 4W9WA 1PXKA 3SC1A 4H39A 1B39A 3UNJA 3GXLA 2Q0NA 4Z7GA 3ODYX 5H3QA 5IQFA 1K2PA 3EKKA 3I5ZA 3KMMA 3LFQA 3QQGA 2AEGA 4O7LA 3TYKA 4KIKA 4O2PA 2VTPA 2C6KA 4FG8A 4TYIA 5HESA 2CJMA 4D4RA 4O83A 3I0QA 2WQEA 1MRYA 3NIEA 4WNOA 2UZVA 3EN9A 4O7VA 3OD6X 4NWMA 4YUQA 3NVKI 1FPUA 1OB3A 5CT0A 3PDTA 2ITVA 4FF8A 1MRVA 1TQMA 4XRJA 3JY9A 5AP5A 3WYYA 3ZOSA 5CEOA 4Z3VA 4BY9E 4QP2A 3GC9A 4ZTSA 2O3PA 2PVNA 2VTMA 1PKGA 3P7BA 3QTWA 1IA8A 2GS7A 4GYGA 4B4LA 4WG5A 2WMXA 3JVSA 2YIRA 2W99B 3HKOA 3DA6A 1YXUA 2FSTX 4QMPA 3ZO2A 4RJ8A 2OK1A 3P23A 4RJ6A 3F3ZA 2XEZA 3R2YA 4NFMA 5KMKA 2BRNA 4WD5A 4GU9A 2XYNA 4II5A 2RFNA 2DQ7X 2HCKA 2BFYA 3R28A 4RIXA 4HW7A 1FQ1B 5AUZA 2QC6A 5J1VA 2FB8A 1FOTA 2XNNA 5G6VA 5FDPA 3ZO1A 5BV3A 3OCGA 4L9IA 5DN3A 3A4OX 4D2WA 3E62A 5EM8A 2HK5A 2J5EA 3HV6A 3KF4A 4ITIA 3NX8A 4O7SA 3L9MA 4ZTRA 3UE4A 3ZXZA 5FUTA 2Y4IB 5L2IA 5AP2A 4UB7A 4C4JA 3DLSA 3MFSA 3MIAA 3DPKA 4JQ7A 3QQUA 5LWNA 4O0VA 2YITA 5TO8A 3G9NA 4QPAA 2V55A 1FBNA 2E9NA 3IO7A 4M67A 4H3BA 2R3HA 3A8XA 4NCTC 5CU6A 4JOAA 5DRDA 1QPEA 2C3LA 3POOA 3TN8A 4ASDA 4GSBA 3NWWA 1A06A 1IASA 4EK6A 5AV4A 4BI0A 1R0EA 3ITZA 1H00A 3FLWA 4RA5A 4D9TA 4E3CA 3PWDA 3QWJA 2YDIA 1CKJA 2Z7LA 3NMUF 3E7OA 3IK3A 4K9YA 4O4FA 3BE2A 4EBVA 2JDVA 3FI8A 1XH6A 2BRMA 4JBQA 4KNBA 1BMKA <