5A9UA

Structure of c1156y mutant human anaplastic lymphoma kinase in complex with pf-06463922 ((10r)-7-amino-12-fluoro-2,10,16-trimethyl- 15-oxo-10,15,16,17-tetrahydro-2h-8,4-(metheno)pyrazolo(4,3-h)(2,5,11) benzoxadiazacyclotetradecine-3-carbonitrile).
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
309
structure length
292
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGEVYEGQVPLQVAVKTLPEVYSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords ALK TYROSINE KINASE RECEPTOR
publication title Resensitization to Crizotinib by the Lorlatinib Alk Resistance Mutation L1198F.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 292
sequence length 309
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5a9uA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5a9uA01
5BPYA 2I0EA 4YZCA 1PXLA 4JBQA 4QNYA 4I5PA 2XMYA 3R2BA 4RJ3A 4ZK5A 5TO8A 4QTAA 2XNNA 1UKIA 3EMGA 3OT8A 2XEZA 2XS0A 3SV0A 4DH3A 2RG6A 3FSFA 4FTJA 4DGGA 2BZKB 3E62A 4MXAA 3R2YA 1SM2A 3R9DA 2YZLA 3UTOA 3LFNA 4GW8A 2F49A 4IZ7A 4U43A 5BVWA 3ZRMA 2PL0A 4FKTA 3RHKA 4DH1A 2PZ5A 3IG7A 3CS9A 4GV1A 4O0TA 3BYOA 3TM0A 3CY3A 4O96A 1CSNA 3WF7A 4GFMA 3VS3A 4DFZE 2E2BA 3NW6A 4FSUA 3R9OA 3LM0A 5L2TA 5AUXA 5LOHA 4DBXA 2J2IB 3T3VA 1QMZA 2WQMA 3QWKA 4O2PA 3QD4A 3V5WA 4CYIA 3PFQA 5JFVA 1YRPA 4I20A 4F08A 2WMAA 2BZHB 3OW4A 4EOJA 2XK9A 4YZBA 3Q9XA 1WMKA 4FV4A 3PSBA 4QMXA 4OBQA 2VO6A 3LCOA 5JQ8A 1KE9A 2X6DA 4F09A 3LOKA 4YURA 1LEWA 3CQWA 4F7JA 4O0YA 1G5SA 4ERKA 3QQFA 2YISA 2IW9A 4FL2A 3L9MA 4FSRA 3FMEA 3NUYA 3RINA 3BLRA 3VW6A 4A06A 3CEKA 2VAGA 3FYJX 4QMVA 5BMSA 3FEGA 4AXAA 2JDVA 3OUKA 2O5KA 4FKPA 2ZMDA 4FEXA 3ZUVA 3I1AA 5KZ0A 4F64A 1F5QA 4WBBB 5KE0A 5J1VA 1OIYA 1J7UA 2YA9A 4W4WA 5J7BA 2HZ0A 1PYEA 2XM8A 4BICA 3QHRA 1UU9A 4NM5A 3UO5A 1W7HA 4EUTA 3Q4ZA 3GC8A 1QPCA 5HG5A 4IDTA 4DE4A 3ZTXA 4LG4A 5KKRC 3DY7A 2QLUA 2XK6A 4AT3A 5KCVA 4PF4A 5J9LA 4EBWA 4M3QA 3ALOA 1R39A 2X39A 3AQVA 3Q2MA 4IM3A 4EH7A 5CSVA 3OT3A 1WZYA 4IX5A 3W8QA 4QT1A 4AZTA 4RQKA 5AUZA 4AZWA 4QOXA 3LFQA 3ULZA 3OY1A 2I1MA 4EZ3A 4R77A 3FYKX 1H08A 3OZ6A 4JDIA 4FV2A 4XG3A 2BPMA 2X4ZA 2WMSA 5IZFA 4E93A 2HZIA 3T9IA 3MVLA 4USFA 3ATSA 3VWAA 3F7ZA 2PVFA 4FTQA 2EWAA 3LFFA 2R9SA 4WSQA 4XEYA 5IQDA 4LGDA 1GZKA 2C1BA 4MQ2A 3VNTA 4JNWA 3BHTA 3QQHA 3FLQA 3WZEA 4RRVA 3DB8A 1KV2A 4BDCA 2BTSA 5EG3A 3PY0A 2QG5A 3QZHA 3BX5A 5E7RA 2IN6A 3VS7A 3OCGA 2HYYA 1H0VA 3VAPA 4FOBA 2I40A 4BDBA 5KMJA 2C5NA 4FG7A 2RKUA 2B53A 3NIEA 3MH2A 2YEXA 3UG2A 3CY2A 3EQPA 2NRYA 3HMMA 4NFMA 2VO7A 5IKWA 5AUYA 3F3TA 5BUEA 2YCFA 1XWSA 5HVYA 4OTHA 2XJ1A 3DLZA 2C0TA 2WMWA 4XCUA 2PK9A 3AC2A 3QRJA 5HG7A 4L52A 4MAOA 4PTGA 4HVDA 4FKIA 4OAVB 1OKYA 3EQGA 4CZUA 3L9NA 4FR4A 4TYGA 3IDBA 4V01A 2VV9A 2B7AA 3FY0A 4FSNA 3R7EA 4YO4A 4WUAA 2BRMA 2KTYA 3LMHA 4MWHA 4HNFA 1JSTA 3A7FA 1NW1A 3R9RA 4BDEA 2CNUA 2Y6MA 4R3RA 4J71A 5EM5A 5CZHA 5HIDA 2QOHA 1YDRE 2IVUA 4LOQA 3TNWA 3BHYA 3O71A 4D5HA 2HAKA 4KINA 2GDOA 5HQ0A 3GQLA 4C3PA 4CCUA 3EIDA 3P23A 1CMKE 1Q8WA 2W7XA 4M14A 2WAJA 3Q9YA 4A9YA 4FTLA 2F7ZE 2VN9A 3LFDA 1ZMVA 5HLPA 2VTSA 3NDMA 3LCTA 4EBVA 5DVRA 3KMUA 5FDXA 4BCPA 4EH3A 2IZRA 3LAUA 1SMHA 3C13A 3KXGA 3BI6A 4RSSA 4BKZA 5FXRA 4UMUA 1Q97A 2JD5A 2VRXA 1Q41A 4FV5A 5IH6A 4BHNA 4JJRA 1B38A 3KXHA 4CFXA 3BHVA 2FYSA 4KBKA 4FSWA 5L6WL 4EWQA 2HZNA 2QOBA 4FNZA 3T9TA 2Z60A 4G31A 4GK4A 1XO2B 3IGOA 2JEDA 3QBNA 2PUNA 4QQ5A 4W8DA 3U51A 2HXLA 2BKKA 5L4QA 4GG5A 1OMWA 1TQPA 2C6TA 3O17A 4XRJA 5AIRA 4JX7A 5LWMA 2BRNA 2C3KA 2GFSA 2LGCA 3ZSHA 1GIHA 3BE2A 1LUFA 4JG7A 2XNGA 3OFMA 3QKMA 4I21A 4I92A 3KREA 4FEVA 5AP4A 3NUAA 4FL1A 4GK2A 4IJ9A 3UOLA 3DAKA 2FVDA 4K33A 4CFFA 3GCSA 3PZHA 4HGLA 5CYIA 5ANOA 3C9WA 1ZYLA 4FNXA 2BHHA 2JLDA 5EOLA 5F20A 3UNJA 5B2KA 1U54A 4YNOA 3D14A 5D7AA 3LPBA 2WKMA 2XIYA 4ASZA 3PA3A 4M13A 2Y9QA 4WNMA 2VUWA 4XBUA 3MV5A 1Y8YA 2W5BA 3P08A 5I9XA 4IZ5A 1ZZLA 5DHJA 4ZSLA 4C62A 5AR3A 3TKIA 2O8YA 4DGLC 3BRBA 4E4NA 2HW7A 5CVHA 4JQ8A 5KMLA 4RLKA 2WQOA 4YNEA 3E63A 2XK3A 4HVSA 3H3CA 5AMNA 4L45A 3WIKA 1YOMA 1NY3A 3QQGA 2HENA 3RK9A 3QWJA 5KZIA 4ZJJA 3BYSA 2RF9A 1ZYCA 4EOKA 1PXKA 1ZWSA 5EHOA 1FOTA 4DEEA 4G5PA 3RGFA 2C6LA 1OL7A 3DXNA 5D12A 4XYFA 1NXKA 5IF1A 4IW0A 3BU5A 4PY1A 5BUIA 4IVAA 1Y8GA 2YIWA 1H28A 3U6JA 2ITVA 3KRLA 3HDNA 3ETAA 4FIJA 2R3PA 4GVAA 4IVCA 4F65A 4IFGA 4W8EA 4RQVA 3R21A 3ORPA 4ORKA 2BKZA 2UZNA 3C50A 2JIVA 4E1ZA 3QRKA 3MB7A 2VX3A 3O7LD 2W1HA 3C4EA 4NCTA 3Q53A 4TYJA 1CDKA 3DU8A 2PVYA 4PDPA 4EEVA 1KOAA 4ZMFA 5M44A 2EU9A 3OC1A 3AT3A 3VN9A 3R8VA 3VHEA 3ZXZA 3KCKA 4Q2AA 4UMQA 4J97A 5IH4A 4FKJA 2O2UA 2YJRA 1F3MC 4WSYA 5M4FA 3QX2A 2OJ9A 3VULA 4Y73A 1FVVA 2QO7A 1JKSA 1Z9XA 3A7GA 3R7VA 3KULB 5D41A 3QALE 2P2HA 5IA1A 2Z7SA 4GU9A 3RPSA 5HE1A 4E4XA 2PE2A 3N4TA 3SDJA 2G1TA 3ORTA 2QURA 3FQEA 2QR8A 3CD3A 5CY3A 3ULIA 4AS0A 2HW6A 1OKZA 4NM0A 3HP2A 4HVGA 3JY9A 3D4QA 5HEZA 5TF9A 2ZB1A 4U5JA 4NIFA 5HCZA 2FSOX 3R71A 4DYMA 2VWYA 3WE8A 2OLCA 3ELJA 4GUEA 2GNLA 3R7YA 2F2UA 5AIKA 1XH6A 3IONA 4PDOA 2P3GX 4AQCA 4DT8A 4YTHA 3DXPA 4PTEA 4QMZA 3EL7A 2WIPA 2XRWA 3UZPA 3R6XA 3Q4UA 4FSYA 3IO7A 2C3LA 2XK7A 3DPKA 1U5QA 2RSVA 4UV0A 5EDQA 2BRBA 4GU6A 3UIUA 1Q4LA 1GIIA 2BHEA 5CAOA 4R78A 4ZJIA 3I79A 1UWJA 2PE1A 2R3GA 4I23A 4RMZA 3S00A 5T68A 3ZO4A 3V5LA 2C6KA 1RE8A 2XYUA 3PPKA 5IISA 3GGFA 4U81A 5AUVA 5IDPA 3NVMB 2FGIA 3OW3A 4RFZA 4NKAA 3MYGA 2IVSA 5F1ZA 1KWPA 4QP7A 2UZDA 1PXJA 3S1HA 1SVHA 4FIIA 1XBCA 5HVJA 5K0KA 5TE0A 3C0GA 2YWPA 3GCUA 4U3ZA 5JK3A 2UW0A 3QAME 5D11A 5FRIA 5CEQA 4I6BA 4EOPA 3RWQA 5CF5A 4OAUC 3N4VA 4TT7A 4IACA 3I5ZA 3PY3A 1KOBA 4FT9A 3FI2A 4D9TA 2A27A 2XNPA 4BCHA 2XA4A 3M1SA 3PUPA 4IANA 4AZSA 1KE6A 2GQSA 3RZBA 3SD0A 4DGOA 4ANMA 1Q99A 2UZBA 3FZ1A 4F6SA 4BTMA 2NRUA 3QXPA 4NM3A 4CRLA 4XG8A 2XEYA 3FMDA 3GB2A 3I7CA 1MRVA 3NUUA 4EC9A 5I9WA 5EQEA 5T3QA 4YC6A 3NX8A 4PMPA 2R4BA 5EQYA 4UB7A 1RW8A 3JYAA 3PXYA 4IBMA 4R3PA 1TQMA 2XIXA 3TV6A 3QC9A 3ZFYA 3ZONA 4EHVA 2BTRA 4R7HA 4XHKB 2ZV9A 4FV3A 4QD6A 3PE2A 2B9JA 4X3FA 2C5VA 5E8ZA 1YXUA 2XK4A 4CRSA 3QQLA 1SVGA 1AD5A 5ACBC 4TKSA 4XOZA 5DPVA 3BQCA 4DTKA 4IMYA 4JRVA 4AAAA 3DTWA 1YI3A 3E93A 2RFEA 4FZ7A 4F0GA 1YI4A 4CMUA 2BDFA 2W1GA 1M2RA 4K2RA 4M69A 4RIXB 5AEPA 4QP8A 2VGOA 2XJ2A 5E8SA 4EUUA 5HKMA 4XV3A 4XBRA 2OH0E 4RWJA 5DEWA 5E92A 3QTZA 1YOJA 5HU3A 3FZOA 4I3ZA 3LW0A 2QU5A 1IAHA 3OWLA 3R1QA 3BE9A 3RCJA 4DN5A 5DT0A 4ZAUA 4MD8E 3HAMA 3SXFA 5KX8A 2WQEA 3ACJA 3OOGA 3R8UA 2IZTA 2V22A 4IXPA 3Q96A 4RWLA 2ESMA 1ZARA 3BZ3A 3QTWA 4EH4A 4D0WA 1STCE 2QOKA 2R3FA 5J79A 3I60A 5L8LA 3JY0A 3HV3A 4II5A 2X1NA 5GJFA 5CENA 4JOAA 5IA3A 2GU8A 2OJFE 1DAWA 3RVGA 2OGVA 3KY2A 4EHEA 4BIBA 3SQQA 3V01A 4E5WA 2Q0NA 4FT3A 3PE1A 5AP5A 3FV8A 1UA2A 3EN9A 3QFVA 4MKCA 2PHKA 1FINA 2R3HA 4FTKA 3S95A 2YZAA 5L6OA 3F69A 5KMNA 3AC1A 4X2FA 5CT0A 3LFSA 3TACA 4J8NA 3COHA 4N6YA 1ZY5A 3HV5A 3OP5A 1P14A 2CN8A 1JSUA 3F7WA 3PVWA 5GJGA 5FTQA 3VBXA 5HTIA 3PXZA 4EH5A 4RA5A 4ID7A 3FL4A 3PIXA 3VRZA 3OOMA 3GP0A 2QKWB 4BF2A 3ZLXA 4DGNA 2CNQA 3SXRA 5KBQA 2BILB 1OL1A 3KMWA 4BBEA 4M66A 5CU3A 3DS6A 3LCKA 1W82A 3D83A 2ETMA 4IWDA 4KAOA 4MEDA 3VBVA 5EKNA 4DEIA 3FZSA 3F2AA 3ORNA 3C1XA 4L44A 4DT9A 4NUSA 4U42A 3CLYA 4EK8A 4RIWA 4ZLZA 3GOPA 1OL5A 3E8CA 5TR6A 1NVQA 1H1WA 1G8SA 3HV6A 1K2PA 4RA4A 4GRBA 1J1CA 5CXZA 3EN6A 4FZDB 3D7ZA 4FZAB 4EZ7A 3WZJA 4N70A 4PUZA 4ZSJA 5C9CA 3ZBFA 5AAGA 3ROYA 4OBOA 3D7TB 5G1XA 4APPA 5IQBA 3B2WA 1OUKA 2OI4X 4BZNA 2SRCA 1CKPA 3M42A 4YZNA 1PW2A 2XK8A 1SNXA 4LGGA 3IK3A 4WRGA 4C4IA 4BDIA 3RPVA 4CVAA 5HLNA 5LXMA 4N6ZA 4DA5A 5BVOA 4LM5A 4MXZA 1H07A 2OJGA 5HTCA 3BWJA 4ITJA 3DLSA 1QL6A 4PMTA 3PXQA 3IDCA 3FBVA 3MY0A 4IAAA 4BN1A 4CKRA 2ITZA 4DTBA 3BYVA 4KKGA 4P7EA 4HCVA 4U79A 4ACHA 4Y5QA 4AT5A 2ACXA 2VO0A 3E7OA 5DR2A 4FOCA 3UE4A 3R9NA 3EH9A 3K5UA 3DBDA 5HNGA 2R3IA 2XF0A 3TG1A 4F0IA 3LFCA 3SHEA 5A54A 4LUEA 2YM8A 4AG8A 3ACKA 2Z8CA 1LR4A 3LCDA 1YI6A 4LYNA 3FAAA 4BY9E 4BZDA 4UN0C 4GKHA 4H3QA 4O7ZA 4FTIA 3D9VA 4G3EA 3R83A 3R8PA 1AQ1A 4KIKA 4CCBA 5JMSA 3UPZA 4LRMA 1PMNA 4JLCA 4XG2A 4XMOA 3UIMA 3R9HA 3UOHA 5EW8A 4RX5A 4E26A 4WKQA 2OJJA 4I41A 3ZS5A 4MD7E 3PSDA 5AP0A 3A99A 3VUTA 4LUDA 4B8LA 3D2KA 2C3JA 4RX7A 4BRXA 3FQHA 2CGXA 1KUTA 2YCQA 2HOGA 4F7LA 5KUPA 4H05A 3FMNA 4RZVA 4CQEA 2X2KA 5CNNA 3C5IA 2J0LA 4J98A 2IW8A 5AM6A 3KVWA 2GNIA 2GNJA 4JIKA 4UBAA 3DJ6A 4LGHA 3QCQA 3VIDA 4WNPA 2DWBA 1RQQA 2OF4A 4FSQA 4HZSA 4DTAA 3HX4A 4V0GA 3M11A 5CALA 4FKVA 3IW6A 4Z7GA 4E5AX 3MA3A 3F2NA 3BWFA 5BQ0A 5H9BA 2W1CA 4H39A 4M0YA 3D5VA 3DKOA 3V5PA 1V0PA 1YDTE 4U9AA 3SRVB 4B99A 5CEMA 3UYTA 3QZIA 4I6QA 5LCKA 1TQIA 4IZAA 2V0DA 3CBLA 3MH3A 2QOCA 3L8VA 1JSVA 2XKCA 3IS5A 4F6WA 4OBPA 3NZ0A 4YBKA 2CPKE 5DLSA 2W1ZA 4R7IA 4QPSA 3CXWA 4HPUE 4IWOA 4LRJA 4QP3A 4TZRA 2QNJA 4IB0A 4LMUA 4P2KA 4X2GA 5EHYA 1H1QA 3EHAA 4TYEA 5HE0A 4AA5A 2W9ZB 3F6XA 1WFCA 4ZY5A 5I4NA 5LMBA 4E20A 3AC3A 3H30A 3UP7A 3QTRA 3I6UA 5FUTA 3L9PA 5A4EA 4HYHA 5AUTA 4NTSA 4P5QA 3QTUA 2X7FA 4O1OA 4A4OA 5DE2A 3PJ1A 3KF7A 3DB6A 4CGAA 4F99A 4O7SA 1W84A 4KWPA 3QLGA 3SOCA 3LQ8A 4IC7A 1IA8A 4K9YA 4C36A 2BIKB 3RZFA 3BYMA 2ZMCA 4EK5A 4WHZA 5HD7A 4RX8A 5CAUA 2WMRA 4KNBA 1R0EA 4U44A 4ASXA 4LMNA 4D1SA 3RJCA 4U6RA 2CMWA 3FI4A 3EN4A 3IW4A 5LVLA 4AZFA 2W06A 4R1VA 2FUMA 2OU7A 4BCOA 1OL6A 4NK9A 1B39A 1JBPE 5M4UA 3ZZEA 4EWHA 1VJYA 4RPVA 2A0CX 2B9IA 1Q62A 3L8PA 1H27A 1J1BA 5E8WA 5HHWA 3QUEA 2OW3A 1I44A 2OZOA 3Q9WA 4KSQA 1YQJA 4L68A 1BI8A 2BR1A 2W4KA 4GEOA 4M97A 1XH9A 3FMLA 4X6QC 4C57A 3TIZA 3R02A 2OBJA 3FPMA 1PJKA 2CSNA 3FLSA 4DC2A 3HDMA 2GHLA 2YERA 2X2LA 3FSKA 4O6LA 3QU0A 2JITA 2OZAB 4L67A 4DFUA 3G5DA 2WPAA 3EFLA 3C7QA 4YSJA 1PXNA 4F6UA 3L9LA 4M7IA 4C3FA 2PVRA 5FDPA 1OITA 5CF4A 4YUQA 3A62A 3QQUA 4CTBA 5HNBA 4XUFA 3GU6A 3GC7A 5AR2A 3MN3A 5HO6A 2GMXA 4DH5A 3L8XA 1XH5A 3QTSA 4GJ2A 4D9UA 3ZO2A 2QO9A 2PMNX 4WD5A 4FBXA 3BU6A 2VTQA 2W99B 2X0GA 5ETCA 2QOIA 4FEUA 3AT2A 2GTMA 4LOPA 5AP2A 4P90A 2QI8A 2YLEA 4XP2A 4RGJA 4O7YA 4F9CA 4N0SA 3GT8A 5CSPA 3TZ9A 4IWQA 3UNZA 2GFCA 1ZMUA 4TYHA 5CU2A 5M51A 4XV2A 1O6LA 1JVPP 3DBFA 2R64A 4D28A 5I3OA 2B1PA 2JC6A 4PRJA 4UWCA 2P0CA 4QTDA 3RMFA 3E8EA 4AA4A 4J96A 3AMYA 3LHJA 3UZRA 3R28A 4JQEA 5FG8A 2B9HA 4MXCA 1DAYA 5AJQA 2PZPA 4FEQA 3NPCA 4FA2A 3P9JA 4EZ5A 4FEWA 3R30A 3JVRA 3MTLA 3F82A 4XNEA 4PPBA 5FBOA 4J52A 5F4NA 4J1RA 4IWPA 1V0OA 5JGDA 4O86A 4NW5A 1CM8A 4EHZA 4JRNA 3F9NA 5GJDA 3TNHA 3O8PA 4GT3A 4U0IA 4HW7A 4G3FA 1F0QA 2Y0AA 2XBJA 3PPJA 2I0VA 2YJSA 4G9CA 3RP9A 5C8KA 4BIDA 5B2MA 5CANA 1NVRA 5B7VA 3V04A 2OICA 2ONLA 2X8IA 4IM0A 4O2ZA 3VUGA 4YZ9A 5BNJA 4IAIA 4BCIA 3Q04A 4TWNA 3GFWA 1JKLA 5LWNA 5IQIA 4EQMA 4WBOA 4ZZNA 2WTVA 1IR3A 2C5YA 3AG9A 3Q3BA 3HUBA 5KMIA 4BVUA 4YJNA 4NKSA 4PMSA 4RLLA 3QF9A 4UXLA 3HNGA 3D0EA 2XNOA 3BV2A 4OTPA 3SOAA 3LCSA 3FMKA 1L8TA 4IE9A 2X9FA 4FUYA 4K0YA 5L6PA 1P4FA 1BUHA 3LXNA 3JVSA 4HJOA 4WRSA 4F1OA 5F9EA 2VWIA 4DF3A 4FI1A 1PF8A 4EJNA 2HELA 4ANLA 4GCJA 3TXOA 4AP7A 4EQUA 4NCTC 3LJ1A 1YWVA 2UW6A 1HCLA 3FXWA 4IAYA 5HG8A 4NWMA 3ZU7A 4Y85A 3CQEA 4A7CA 2ETRA 2YDIA 4JR3A 5TKDA 5JFXA 5ANGA 5IQFA 5GZ8A 4JDJA 1XH8A 3PRIA 3RALA 3THBA 3V5TA 1R1WA 2JAVA 1OUYA 1MUOA 5EOBA 3VBTA 5IMXA 4ZSGA 5L2SA 5FTOA 4JX3A 4O84A 3PXKA 2W1DA 2X7OA 2BALA 2JDTA 2PVKA 4KB8A 5HBHA 1JWHA 3R8LA 3ATTA 2AUHA 2F9GA 3MESA 4IAFA 3ZC6A 4DEDA 2PSQA 4K18A 2CJMA 5HNIX 4OW8A 5E91A 2PMLX 4I5HA 4AFEA 5LVOA 4O7LA 4KS8A 3S2PA 4E6QA 4ZTHA 5AFVA 3KGAA 2UUEA 4CV9A 2BFXA 5FXQA 3IGGA 4F9AA 3O8UA 3ORKA 1Q3DA 3LZBA 3PLSA 4M15A 4EK4A 4F63A 3FMMA 4A4XA 3UC3A 4FGRA 2RGPA 2EXEA 3JXWA 2VGPA 3DK6A 3EQBA 4RVTA 2C69A 3WE4A 1ZYDA 5J5TA 1V0BA 3V6RA 4GH2A 4FV0A 4S2ZA 4UXQA 5G6VA 3VS0A 2A19B 2EB2A 2J5FA 2ZOQA 2C6OA 1JNKA 2ERKA 3AGMA 3OD6X 4MBIA 3SVVA 4O0SA 5A4TA 1ZMWA 4ZEGA 4EOLA 3P7CA 2DQ7X 3MJ2A 3QRIA 3D15A 5C1QB 2CKOA 2OIQA 4W4XA 1VYZA 2YHVA 3MW1A 3IKAA 4HCUA 1YHVA 1JLUE 5CLPA 3F5XA 3UMXA 4F9YA 5C4LA 2UZTA 2EB3A 3R0TA 4ZXTA 4XP0A 5EYCA 3KEXA 1APME 4B4LA 1M2QA 5ANIA 1FBNA 1FQ1B 4QQJA 4CD0A 3WIGA 4BGQA 2VTTA 4JIAA 4KIOA 2QKRA 4QTBA 4CLIA 5J9YA 4EHGA 4JXFA 5M4IA 4DH8A 1Z5MA 3CR0A 2UZWE 1PXMA 3VQHA 3Q5IA 3DAEA 3R1YA 4ALWA 4YJTA 4YTCA 1OIQA 5HVKA 3UMWA 3UOJA 2C5XA 3A2CA 3RM6A 3SXSA 1IEPA 4NJDA 4J95A 4O7TA 3WF5A 3F5UA 3TUBA 2PZRA 4RC4A 4PWNA 3NYNA 5H3QA 2EVAA 5AP6A 3ANQA 4MH7A 4I24A 1BI7A 4MTAA 3EFJA 1VZOA 3FMHA 3RPYA 3VW8A 5ETAA 1PXIA 4FV7A 3EQRA 3G6HA 3R8ZA 1REJA 4ACGA 3OROA 4RIYA 4X3FC 3VUKA 3NWWA 5E8YA 2GQGA 2Y4IB 1Q8ZA 4H1MA 4NW6A 5EK7A 2UVZA 1Q3WA 3EQCA 5CASA 4K1BA 3IW8A 4ZIMA 3W18A 3PJCA 4N4SA 5HO7A 4KKHA 3ZLWA 3GNIB 4WA9A 3EQDA 2UW8A 4LOOA 4I5CA 5HIBA 2Y7JA 4V05A 5J1WA 2JAMA 2XNMA 2B55A 3KXNA 2PMIA 2JDOA 3JUHA 5DEYA 2BVAA 3HZTA 1K3AA 2YAKA 3Q32A 2YM5A 3TZ8A 2ZYBA 1E1XA 2QONA 3HV7A 3E3BX 1GZNA 3C4ZA 3QD2B 4MF0A 5D1JA 4YLKA 5IH5A 2RG5A 5L2QA 4KBAA 2H8HA 4BZOA 5CAPA 4HPTE 5J9ZA 2Z02A 3Q9ZA 3VS4A 4HVHA 4J8MA 4UYNA 3ZSGA 4AE6A 4MXOA 3I0OA 3G0EA 1YW2A 1H8FA 4B0GA 4IAKA 3OXTA 5IDNA 2P33A 3QUPA 1GZ8A 2YFXA 3OVVA 4TWOA 2UW5A 3QUDA 2PVJA 4LL5A 4O6EA 5CEIA 4PL3A 3RPOA 4YMJA 4WUNA 2RFNA 3NEWA 4FV8A 4TL0A 5BVDA 2VWWA 3FXZA 5F94A 2YWVA 4KD1A 1T45A 2WGJA 5IQHA 3C4FA 3HYHA 3KU2A 4C37A 1XJDA 5IQCA 5FGKA 3ALNA 3LQ3A 1DM2A 3ZEPA 2OFUA 2JKMA 4FKSA 2BCJA 3T3UA 3ZRLA 3M2WA 1CTPE 2WTKC 3R04A 4E6AA 1RJBA 3IOKA 5M08A 2XM9A 1ZOHA 4OTDA 4YZMA 3ZDUA 5K0XA 3BPRA 3K54A 3ZLSA 4UMPA 4QMNA 2UW4A 3U4UA 5CEKA 3L8SA 4MNEB 2ITPA 3GFEA 3MY5A 1SZMA 2JKOA 3QX4A 5CEOA 3QYWA 4XLVA 4ZLOA 1XH4A 2WO6A 3OWKA 2XBAA 3TKHA 4TNDA 1JQHA 4FK3A 5DRBA 3H9RA 1UNLA 2BROA 3HRFA 3SKCA 5L2IA 4K77A 1UNGA 1RDQE 3HMOA 4GVJA 3ODYX 2YN8A 4S34A 2BZIB 4PMMA 2V55A 4QMLA 5EM6A 4E6CA 5A6OA 1H01A 3HMPA 4HCTA 4EJ7A 2I0HA 2WMTA 5EH0A 4ZTRA 4I0RA 4E5BA 5AX3A 2XP2A 5I9VA 2IVTA 2VD5A 4B6LA 4J99A 5KO1A 2GNFA 2PPQA 2EXCX 3FZTA 4QMUA 4QP4A 2QO2A 1WVWA 2IW6A 5BMMA 4I5MA 4I22A 4OUCA 3EFKA 5DA3A 4Z7HA 4DH7A 1QPDA 1YKRA 5JT2A 4DITA 4FX3A 4UYAA 2Z2WA 2X4FA 4ZSEA 3O96A 4HNIA 3PXFA 3K3IA 1TVOA 2R3LA 3ERKA 4K11A 5DBXA 3CKWA 2ZDUA 2UW9A 4FT7A 3W2RA 3LVPA 4DCAA 4FMQA 2CKEA 3PWYA 4ZTSA 3KVXA 4I1ZA 2OH4A 4GJ3A 3AT4A 5AR8A 4BTFA 4O21A 2UW7A 3R7IA 3LMGA 3EZRA 5AWMA 2VNYA 4O7VA 2QHNA 4H36A 4Z9LA 3GQIA 2CKPA 2ZVAA 4GMYA 4UZHA 4OT6A 3TV7A 3WZDA 4AFJA 4RZWA 4ZZOA 2P55A 3EQFA 4NT4A 2BDWA 2BDJA 2HWOA 4CTCA 1OPJA 1U4DA 3WZUA 4MD9E 4FV6A 1J7IA 2UV2A 4L8MA 3WI6A 2QOLA 4TNBA 5CU4A 2WOUA 3TEIA 4EONA 2WTJA 5K5XA 5M56A 1PRYA 3H9FA 5I3RA 3C4WA 5EI2A 4YTIA 2PMOX 3O51A 4DLJA 3WF6A 2QR7A 4FT5A 3PYYA 2NNWB 2YLFA 4LFIA 3NNXA 4IIRA 4C2VA 4RJ5A 5DT4A 3EYHA 3ITZA 5I9UA 2C5OA 5BVEA 3ZEWA 4NZWB 3V3VA 1JOWB 4BTKA 4FKRA 4YJSA 1H24A 5AR4A 2WMVA 4TRLA 3D5UA 1PKDA 3QL8A 2B52A 2ITQA 4QMTA 5FQDC 4BIEA 3NW7A 3DKGA 2WMXA 4JVGA 3SG9A 2DUVA 4YJQA 4ITHA 4O0UA 4R5SA 5C8MA 3OTUA 3W2PA 4EOQA 3U6IA 4ANQA 2GSFA 2Y4IC 3E7VA 3QCXA 2PZYA 4FYNA 4RT7A 3ORMA 4QQCA 4W9WA 5EKOA 2OXYA 3ZZWA 3UQCA 3BEAA 5AM7A 3UYSA 3ZC5A 4BDDA 2J7TA 3E8DA 3EQIA 2PVNA 3V5QA 4DEAA 4G6OA 3KF4A 5BYZA 3F3WA 4FYOA 1WCCA 4IM2A 2ZDTA 4BGHA 1ZAOA 4IFCA 1PKGA 3AD5A 3DA6A 1O6KA 1Q8YA 1WBNA 3OEZA 3O2MA 5ANDA 4AW5A 3TTJA 4L46A 2WMUA 3ET7A 3R1NA 5LMKC 2ERZE 4JBVA 4BCKA 2J90A 3UJGA 3QQJA 4ENYA 1WBOA 3KK9A 4ZP5A 4D5KA 3P7AA 2O0UA 3UP2A 4YBJA 3BQRA 2A2AA 4G9RA 2FSMX 4BYIA 3PPZA 4Q9ZA 3GU7A 4TW9A 3MVHA 1XBAA 3GUBA 5HCYA 3ENHA 2IZUA 5CF6A 3L1SA 5JQ5A 3QKLA 4BHZA 1YOLA 1YWNA 3TJCA 3FJQE 5IQAA 4ZY6A 3ZLYA 1OIUA 1KE5A 2GNHA 4V04A 4WO5A 4HGTA 4X2JA 4RG0A 4DAWA 4UMRA 3POZA 5IEVA 3KN6A 4FGBA 5CWZA 4NSTA 2VU3A 4PV0A 4F0FA 3ZM9A 2GQRA 2VZ6A 4FKLA 2H6DA 4TPTA 2ZJWA 5L2WA 1R0PA 3QA0A 4TWCA 1R78A 1ZRZA 1H4LA 2XKFA 3IW7A 4NFNA 3RK5A 4C2WA 4FT0A 4KS7A 3QXOA 4BKJA 3CSVA 3NCGA 1ZXEA 3R7OA 4JAJA 2WQBA 3EB0A 2XB7A 5A9UA 4FTTA 3TUCA 2QVSE 4EOMA 2ZM4A 3CTQA 2XIRA 3QTIA 4ZTLA 4ASEA 4G34A 4MXXA 3Q2JA 4BDHA 4C33A 4FG9A 5EYKA 2HY0A 4I93A 3DFCB 5M4CA 5IU2A 1G3NA 4GYGA 3FUPA 2I6LA 3GI3A 4JAIA 5CVFA 5D7VA 2R5TA 1XR1A 4EORA 5E9EA 4D2VA 5ANEA 3A61A 4O0XA 2Z7RA 5DIAA 4EQCA 4QYFA 2HCKA 5TT7A 1YXVA 3COKA 1ZLTA 3MJ1A 3H10A 5J8IA 2ITOA 4JDHA 3AXWA 4B7TA 4Z16A 5IEYA 3NVKI 3F3ZA 3OCTA 3OBJA 4R7BA 4FODA 2ITWA 3EYGA 4FTAA 2V62A 4ZJVA 4L42A 3V8WA 3UNKA 4BI0A 4QNAA 3QRTA 3DBQA 3MPAA 1YHSA 4MWIA 4MYGA 2G01A 4WG4A 2BRHA 1QPJA 4BYJA 3OTVA 4X21A 2GS7A 4CEGA 4JG8A 2XVDA 1P5EA 2XRUA 4XV1A 4YPDA 1OI9A 4FNWA 3TTIA 3AMAA 1U54B 1FGIA 2CCIA 4FZFB 4D1ZA 4S33A 4F4PA 3GENA 3VBQA 4YGAA 4W4YA 3GCQA 4MXYA 3TKUA 4LV5A 5CSHA 5CU6A 2W1IA 4Z3VA 3AOXA 3W2CA 2WQNA 4CKJA 4D2RA 1EH4A 3FI3A 3N4UA 3A4PA 4ACDA 2OWBA 4CMOA 2FA2A 2A1AB 3HL7A 4H3BA 4J53A 5ETIA 3UVPA 4DCEA 2WELA 5F95A 2QOQA 4FVPA 4QMQA 1ZYSA 2BRGA 3NLBA 2XUUA 4D2WA 3E5AA 4HYSA 1Y57A 4UWBA 4QQTA 2JIUA 5KMKA 2R3NA 3MB6A 4FTCA 4FNYA 4XX9A 2ZAZA 3AD4A 3EN5A 4NL0A 3S0OA 2XKEA 3S3IA 3I6WA 5IUGA 4I94A 3P78A 4LV8A 4G3GA 4DBNA 4K6ZA 1Q61A 3LLTA 5EM8A 2WZJA 2WNTA 3C0HA 4AGCA 4E8AA 4HOKA 3FDNA 2VWBA 3GVUA 4FTRA 5LARA 5BUJA 4APCA 2DYLA 1IA9A 2VTRA 2H96A 3EJ1A 1S9IA 4AN3A 1YXSA 3HLLA 4DFLA 4FKWA 2VTOA 3VBWA 4IB3A 3LXPA 4L6QA 4UZDA 4OT5A 4QPAA 4C38A 3MSSA 2XJ0A 5FLFA 5GZAA 3IECA 5M09A 3GOKA 2GCDA 2CGVA 2X6EA 3KN5A 4PP9A 3ZUUA 5IG1A 2ZV8A 5KHXA 3DQXA 3QD0A 5HBJA 2G2IA 3LFAA 5CI6A 3D2IA 3FZRA 4ACCA 5DGZA 4KKEA 2PUPA 3UOKA 4CQGA 5GZ9A 5J87A 5HG9A 2DS1A 5DT3A 4S32A 1IG1A 5HLWA 4ZY4A 2B4SB 1ZY4A 2AC3A 2GTNA 2VTLA 4CG9A 2VX0A 2WTIA 1K9AA 1GOLA 5HBEA 4C0TA 4ENXA 1M2PA 1YVJA 1OGUA 2E9UA 3A7HA 4AUAA 3SGCA 5JKGA 2X9EA 4ANBA 4DFXE 3HMNA 3H9OA 2B9FA 1FPUA 4FKOA 3EKNA 4QTCA 1ZOEA 3RNIA 2WTCA 3NAXA 3N9XA 4C4HA 3FXXA 1E9HA 4B8MA 4GKIA 3R22A 3G51A 4E4LA 4NIFB 2G15A 1FMOE 2IPXA 3UBDA 3CD8A 4C8BA 4BGGA 5FM2A 3SA0A 3GBZA 4FSTA 4L3PA 5AP1A 4AWIA 2UVXA 3EWHA 3ORIA 1ZYJA 4L7SA 4UEUA 3LFEA 2X81A 4AZVA 4X7QA 1PMVA 4OLIA 3HAVA 3P7BA 5CAQA 2ZB0A 4DG3E 1FVRA 4L7FA 2FO0A 4UALA 1XQZA 3QC4A 3MVMA 3F66A 2BAQA 3ZDIA 4IQ6A 1UU7A 3F3VA 4MCVA 3FKLA 3KL8A 4JS8A 3B8RA 4N57A 2V5QA 3ZFMA 2ITTA 4F1MA 3K2LA 3QLFA 3R00A 3KCFA 4FC0A 1MQBA 4ZS4A 1YHWA 1BMKA 3NUXA 4FTNA 3Q60A 3AC5A 4UWYA 1OKWA 1Y6AA 2UZUE 2WEVA 5C01A 4MQ1A 5DFPA 1OVEA 3DT1A 3Q5ZA 3RM7A 3VJOA 4I6FA 4RC2A 4PDYA 2HWPA 3DJ5A 2CDZA 3KXZA 2ITXA 3JS2A 3R73A 4IX4A 4EL9A 4IX6A 2R3RA 4L53A 5CQWA 4QP2A 1OL2A 2F4JA 1TKIA 2X2MA 3COIA 4RC3A 1GJOA 5CSXA 3UC4A 4AACA 3DQWA 4C61A 5DH3A 4QMMA 1NT2A 4DLIA 3MFSA 1PY5A 2PTKA 4KABA 4DINA 5C8NA 4BCMA 3TIYA 4YU2A 3W10A 3ZMMA 4D55A 2QD9A 5FWKK 5HI2A 2PYWA 5CF8A 4QYHA 1PHKA 4FTMA 1G8AA 3REPA 3WF8A 5JZJA 4GIHA 2WMBA 3VF9A 2WXVA 3VS5A 4BI1A 3NRMA 5IA0A 4M84A 4DEHA 3E64A 3AC8A 3ZFXA 4AT4A 1DS5A 1Q5KA 3EKKA 3FE3A 3DKFA 4X2KA 3Q52A 3RCDA 3A7JA 3KKVA 2QU6A 3KULA 2OF2A 2R3OA 3CPBA 3HA6A 3R7GA 4RJ8A 2J0IA 4X3FB 4OTQA 4YHFA 2W9FB 3FHIA 5AV3A 2C68A 2YIXA 4JBPA 3NMUF 2PZIA 4TYIA 4ZS0A 5HO8A 1JKKA 3QQKA 3NUNA 2H9VA 4CFUA 3WARA 1O6YA 4BDGA 3KRWA 4EH2A 4U41A 4C35A 4M69B 1PXOA 5IA5A 3AGLA 5HZNA 1Y6BA 3HKOA 3H0ZA 3TJDA 2ITNA 3DNEA 4BL1A 1VYWA 4CG8A 1W98A 2QCSA 4DG2E 2W5HA 3NUPA 4HVIA 4XP3A 4F7NA 4ARKA 4HGSA 4IDVA 4C4FA 3LQ5A 2C6IA 2WHBA 5JZNA 3F3UA 3FLWA 3TZMA 2VNWA 4CSVA 2HZ4A 4KIPA 4OTWA 3FWQA 4D2PA 2C30A 4GYIA 4ALUA 2PULA 3QTXA 2A4LA 2ZV7A 3OBGA 4XG9A 4EH6A 4GK3A 3O0GA 2XCKA 5LVMA 4IC8A 4FIHA 3A8XA 4O91A 2G9XA 1R3CA 1X8BA 5JGAA 4FV9A 5TOZA 5E90A 5M55A 4AN2A 4X2NA 4FG8A 4QYYA 3TZ7A 5LVPA 5GIPE 5L3AA 1YXTA 1A06A 1OZ1A 5HGIA 3VUIA 4DFYA 5A4LA 4OTRA 3RI1A 4FK6A 3UIXA 3VO3A 1W83A 3UQFA 3C51A 4EYJA 1SYKA 4ZZMA 3UDBA 3U9NA 3CC6A 2YDKA 3EQHA 3U54A 5BVKA 4C59A 2JDRA 2REIA 2WTKB 1Q24A 3BIZA 3KB7A 4IB5A 4QMSA 5A14A 1M7NA 4WOVA 2J9MA 1PMUA 3NSZA 5IUIA 3I4BA 4LRKA 5DOSA 2C47A 2JIIA 4L00A 4C4EA 2R7BA 4C3RA 4FSMA 4E3CA 1ND4A 3G90X 3WYXA 4MF1A 3CTJA 3AMBA 1ATPE 3BGPA 4O82A 2GPHA 5DNRA 5AV4A 1YDSE 2RFSA 4G16A 3WF9A 4AE9A 5DMZA 5KBRA 3RAHA 4GG7A 4AGDA 3R01A 3NR9A 2PUIA 5KHWA 3QYZA 5FD2A 2YM3A 4I4FA 4RIWB 3VUHA 4DEGA 3UIBA 1IAJA 3CIKA 3ZM4A 4O7WA 4C7TA 2W96B 3KRRA 4FVRA 5H8EA 5J95A 5HTBA 5GIOE 2YACA 5ACKA 3VS1A 1OM1A 4CV8A 3OY3A 3PY1A 1ERKA 4O7RA 2FB8A 3RK7A 1T46A 4FE2A 3PA5A 2R3KA 4RIXA 4Y46A 5D10A 4RIOA 4B9DA 5JN2A 4CMTA 3ZOSA 4DHFA 4PNKA 3H0YA 1BLXA 3V8TA 1HCKA 1VEBA 4NJ3A 1Q8TA 1UNHA 1WBPA 2YM4A 3PVGA 4MVFA 5T6KA 3PG3A 3UQGA 2C1AA 1NA7A 2Q83A 4YLLA 5AV0A 4PNIA 3MI9A 3MIYA 3MPTA 2PU8A 3PSCA 4P5ZA 3GCVA 4EH9A 2VX1A 3VRYA 4A9TA 4ZMEA 5HX8A 5CU0A 1WBTA 3PP1A 3DDQA 4QMOA 4E6DA 4A07A 2CNVA 3ZRKA 3PG1A 3ZUTA 2OSCA 1U59A 3RAWA 4RBLA 5AX9A 1J3HA 2CGUA 4KIKB 3H4JA 3RKBA 4MBJA 4AW1A 1GNGA 5FP6A 4CFNA 3PLAE 2PVHA 4KRCA 5E8VA 3UO4A 3RNYA 4AGUA 4RFYA 3HV4A 4KSPA 4O7NA 3PWDA 4H1JA 5H8BA 2J0JA 3GXLA 1U46A 3HGKA 5EYDA 5CVGA 1PYXA 4PP7A 2J0MB 1VR2A 4S30A 3ENMA 2E9OA 3HA8A 4G3CA 4YJRA 2IJMA 2PUUA 2C3IB 2YM7A 2YCRA 3G33A 3KRJA 4FKQA 3AD6A 4AOJA 3PVUA 1OBDA 5FXSA 4QPMA 3JR1A 2VTPA 2J50A 3TWJA 4JT3A 3DZOA 1KE8A 3DOGA 2QC6A 2Z7LA 2AC5A 3CP9A 4FL3A 3N51A 1ZZ2A 4FF8A 1PMEA 2YABA 3FLNC 5I9ZA 1OB3A 1Q8UA 4IZYA 4W9XA 5DN3A 4CXAA 1A48A 5J5SA 4V0GB 3SLSA 4EK6A 5IUHA 4G6NA 1KV1A 4K8AA 1MRYA 4O22A 2J5EA 2OO8X 3ODZX 4RVLA 4Y8DA 5EW9A 2HY81 2XYNA 1WVYA 4M67A 3LLAA 1Z57A 2JKQA 3E3PA 5C27A 4EOSA 4JBOA 4USEA 3F2RA 3FC1X 3D7TA 1KSWA 2C0OA 3QTQA 4IEBA 4WG5A 3TV4A 2JFMA 2EUFB 2PWLA 1H00A 3E92A 4JI9A 3MIAA 4AZEA 4OTGA 4QP1A 3G9LX 5IEXA 4QMPA 3ORZA 2VTJA 1WBVA 4FKUA 4H58A 1QCFA 4I0SA 4QYEA 5CX9A 3E8NA 3Q6UA 2OJIA 3V6SA 5K5NA 3LJ0A 4KA3A 5EYMA 5LJJA 3BYUA 4D0XA 3MFRA 2BAKA 4GUBA 3B8QA 1M17A 4A4LA 4FIEA 2BAJA 2FSLX 4M8TA 4PX6A 3CKXA 5AUUA 4GL9A 4BI2A 1H1PA 4BDJA 1P4OA 2BMCA 2VO3A 2ZV2A 3OCBA 5IQEA 1SVEA 4IVDA 1URCA 5CAVA 5M57A 2W1FA 5BX0A 3SC1A 1BL6A 1JPAA 5FTGA 2OXDA 5EDPA 3BV3A 3DAJA 4BKYA 4G6LA 4QO9A 3VS2A 5J7HA 3NCZA 3BKBA 1NVSA 3QHWA 3P5KA 5HE3A 1FVTA 3KRXA 2E9VA 3LXKA 5IA2A 2VTMA 3RWPA 5ITAA 3ZYAA 2UW3A 4AW0A 4TN6A 2JGZA 2I0YA 4AF3A 1XH7A 4U8ZA 3W32A 3W2OA 4F70A 2JDSA 4O0VA 4ITIA 2H34A 3MVJA 3QA8A 5LCJA 3I7BA 4O27B 4YLJA 3R7UA 4U7ZA 2V7AA 3UGCA 4BCQA 1WBWA 4I6HA 4O38A 4C34A 4YO6A 3EFWA 3NNVA 4UMTA 5AUWA 4D58A 4DGMA 4GIIA 3FLZA 4GT5A 3W2SA 1BL7A 5AP7A 5AAFA 4A9RA 3GCPA 4D2TA 3E87A 4EC8A 3FI8A 4YC8A 4R1YA 2LAVA 4GFOA 4RWIA 3K3JA 2OIDA 3NUSA 4IADA 1M52A 4ZTMA 5M06A 4ALVA 5L8JA 2GNGA 2VTIA 1URWA 3I5NA 4BCGA 2YCSA 1W8CA 1YWRA 3QZGA 1W0XC 4BCJA 3SAYA 4YTFA 3RAIA 3PJ8A 2OFVA 4X3JA 3MBLA 4QP6A 5E1SA 5FBNC 4NU1A 4BC6A 4U40A 5K4JA 2B0QA 3NNUA 2UZLA 3SRVA 4G1WA 3VHKA 4QYGA 4YJVA 3P86A 5LVNA 3MH0A 1S9JA 5ANKA 2CLQA 2CCHA 5ICPA 1M7QA 2WU7A 5AV1A 4CZYB 5EFQA 3MWUA 3A4OX 4KBCA 2O64A 4QMYA 4NH1A 5CTPA 4BCFA 2PY3A 2UZVA 2IVVA 2BFYA 3SX9A 5HORA 4RVMA 4XG4A 4FIFA 4HGEA 4JDKA 4FTOA 4KRDA 3WILA 4CFWA 2C6DA 1OPLA 4CT1A 4ZSAA 3DBCA 4TYHB 1IRKA 2BZJA 3ZHPC 4YSMA 3VC4A 4TXCA 2QOOA 1H1SA 3HRCA 3W2QA 4MK0A 5B2LA 2RL5A 3C0IA 4RFMA 5D9HA 4IJPA 3UPXA 2YDJA 5EM7A 4RX9A 3MFUA 4CYJA 3PTGA 4AA0A 2OKRA 3R8MA 2R0UA 2PE0A 3TDWA 1H25A 5IQGA 1OIRA 3GU4A 2WTWA 4M12A 4OGRA 4R3CA 4WG3A 3CJGA 3C4XA 3I81A 3W55A 2NPQA 1WAKA 2WTDA 3FHRA 5AV2A 3TI1A 4O1PA 1E1VA 4O83A 4P4CA 1B6CB 1J91A 3KXMA 4XG6A 2NO3A 3DBEA 4OTIA 4R6VA 4DFBA 2R7IA 4MNFA 1I09A 3OWPA 4MHAA 5E8UA 2V7OA 3F5GA 2ETKA 2YIYA 3F61A 4PPCA 4D4RA 3SW7A 3HVCA 1V1KA 3GC0A 4G17A 3VVHA 4ANOA 4EH8A 4E73A 3C5UA 1L3RE 1U5RA 4XG7A 5CSWA 5AA8A 3V51A 1LPUA 2HXQA 2WB8A 4R5YA 5HCXA 3IPHA 2JBOA 4AGWA 4PL4A 5M07A 3MDYA 3MTFA 5EQPA 3U6HA 2XNEA 4ASDA 3U55A 1IASA 3PJ2A 3OMVA 5EW3A 5KNJA 3RPRA 4F7SA 4L01A 3QCYA 3RBWA 2WMQA 3ANRA 3W8LA 3ZBXA 3BHHA 2OZAA 2IO6A 4GFGA 4A9SA 2Y6OA 3TUDA 4HYIA 3Q6WA 4JR7A 4U80A 5CT7A 3R63A 5K3YA 4BWPA 2C0IA 3A60A 4EYMA 3NYVA 1LP4A 2EXMA 2QQ7A 5E1EA 1MQ4A 5FM3A 4AN9A 3OHTA 3FC2A 4Y95A 4AX8A 5KMOA 4KUJA 2WIHA 4F9WA 4OTFA 3BU3A 5I5ZA 4O0RA 3PA4A 5C03A 4BFMA 3V8SA 5K9IA 2OG8A 4U3YA 3ZXTA 3CPCA 4E4MA 4QMWA 2FSTX 2E9PA 1UVRA 2F57A 3OG7A 4FIGA 3UODA 4IAZA 3WZKA 2G2FA 4ERWA 2WOTA 4G5JA 2C6EA 3O8TA 3DDPA 3IDPA 5EDRA 4W4VA 3LXLA 3ZH8A 5HESA 3IQ7A 3PIYA 4ANSA 1UU8A 2QG7A 4C4GA 2R3MA 4XLIA 4EKLA 2XKDA 3MPMA 4EKKA 3BLHA 3ROCA 2GHMA 2VWXA 3UVRA 3TCPA 4RJ4A 4XS2A 4BWXA 4D2SA 2VWVA 2OK1A 2X8DA 3GU5A 3DV3A 3CGFA 3F5PA 4M68A 5E8XA 4C02A 3PJ3A 2I7QA 1XKKA 1UV5A 2ZM1A 4ANNA 3W16A 5AA9A 4XH6A 4DFNA 3WYYA 1PXPA 5LQFA 3DNDA 4NYEA 2J51A 4IH8A 3VQUA 1DI9A 2JKKA 3QGWA 3LMIA 4NM7A 2O63A 4PQNA 1BYGA 4YC3A 2ITYA 3RAKA 3KFAA 1REKA 5BVFA 5CQUA 3KQ7A 3OS3A 5L8KA 2VTNA 3BCEA 4YHTA 5AADA 1GZOA 3QRUA 3TNIA 2UZOA 3LE6A 2YIRA 3OUNB 4EOIA 4G3DA 2CKQA 4FZ6A 2W0JA 3Q4CA 5ETFA 1CKJA 4YJUA 3ORLA 3NYOA 4BDFA 3P4KA 1UWHA 2YM6A 3MS9A 4Q5EA 3GU8A 1QPEA 3NAYA 1GY3A 5CNOA 4CT2A 2W1EA 2CGWA 4IHPA 4E7WA 5AP3A 4H3PA 4LL0A 5HD4A 3MA6A 1SNUA 3HP5A 4UY9A 1OBGA 3QGYA 4HYUA 5DR9A 2HIWA 3DXQA 3R1SA 4YZDA 4D1XA 4D4VA 3DJ7A 4NEUA 4G2FA 4QTEA 4U45A 2O65A 3U8WA 3BLQA 3SW4A 4BCNA 2XH5A 1H0WA 1BX6A 3OF0A 2GHGA 3FY2A 3FPQA 4YR8A 3D5WA 3EZVA 4YJPA 3V5JA 3DCVA 5E8TA 3LIJA 4JG6A 4FSZA 3ORXA 1CKIA 4FV1A 4PPAA 2BIYA 5B0XA 5BYYA 2QODA 4FVQA 3PRFA 2XIZA 2J6MA 5HU9A 4Y83A 4XOYA 3BHUA 3D5XA 5FEDA 1JAMA 4IVBA 4C4JA 2VWZA 5FEEA 5KMMA 5EI8A 3FZPA 3QZFA 5BYLA 3MFTA 5JRSA 4RIYB 2XNBA 1WVXA 2QLQA 3NW5A 4L43A 4WT6A 5HOAA 4XV9A 3TN8A 5CZIA 3FLYA 3POOA 3DK3A 5IPJA 4FUXA 3QD3A 2VWUA 3AC4A 3CJFA 4YJOA 4BTJA 2UVYA 4AOIA 4MBLA 2RFDA 3TNQB 5JFSA 1FGKA 3PP0A 4M0ZA 3BGQA 3CE3A 4JL9A 4QP9A 4ZTQA 5CI7A 4X0MA 3T8OA 2R0IA 4AOTA 3ZSIA 3HRBA 2W5AA 2R2PA 1OECA 2UZEA 4BBMA 1DI8A 4Z55A 2QOFA 5H2UA 3OEFX 4U97A 3A8WA 3CCNA 1P2AA 3NS9A 4GSBA 5A46A 3E88A 4Y5HA 5LMAA 1O9UA 3W1FA 1OKVA 4IB1A 4R8QA 2WU6A 5HE2A 3HMIA 3MY1A 2IZSA 1BKXA 3HUCA 4TY1A 1MP8A 4XRLA 2XIKA 5A4CA 4TTHB 5JRQA 4XJ0A 2WEIA 3IW5A 3PIZA 2PVLA 3KK8A 3ZO3A 5DWRA 4BBFA 4LI5A 2J4ZA 3C4CA 5H8GA 3EN7A 2YAAA 4O81A 3UZTA 2ONLC 4ZTNA 3HECA 3RHXA 3DGKA 1GIJA 2J0KA 1UKHA 4ONAA 4CLJA 5IMEA 2WFYA 1H1RA 5EHLA 3HEGA 1M14A 4BDKA 3OXZA 3OXIA 4WIHA 3EL8A 4NTTA 3LKMA 3VF8A 2OIBA 4GS6A 1GAGA 2W4OA 4EI4A 3UG1A 5DI1A 3PVBA 1LEZA 2Y8OA 5M53A 5E4HA 3O50A 2PVMA 3II5A 3KA0A 4YPSA 3B2TA 3K5VA 2VTAA 4A9UA 4TWPA 3WBLA 5I9YA 3DK7A 4CZTA 4PTCA 3BBTB 3PZEA 5C26A 5EI6A 4AU8A 2FH9A 4CFMA 3SG8A 3CTHA 3F88A 3DZQA 3BEGA 5HX6A 5KKRB 3PXRA 3IOPA 2F7EE 4EK3A 5GINE 4UX9A 3KC3A 3D94A 2F7XE 3U9CA 2R3QA 3TDVA 3FL5A 3A7IA 5FEQA 4YP8A 3G2FA 4L3LA 1WBSA 3LM5A 3GC9A 2IG7A 4L9IA 4ZOGA 4ACMA 5A4QA 4OR5A 2JBPA 3LJ2A 4USDA 3G0FA 4J7BA 4EOOA 1JKTA 5CXHA 4IX3A 3S4QA 2G2HA 2CHLA 2OXXA 2NP8A 2W4JA 2KULA 3VUDA 3P0MA 1MRUA 4Q9SA 3WOWA 3FKOA 5A3XA 4BDAA 3PDTA 5HIEA 5DYJA 2P2IA 1H26A 1YXXA 3KMMA 2W05A 3VUMA 3DKCA 4CFVA 5GHVA 2X8EA 5IA4A 4RVKA 2XCHA 2Z7QA 2ZM3A 3FMJA 4WNKA 5K4IA 2JFLA 2WD1A 1KE7A 2E9NA 3U4WA 3CGOA 1XBBA 3BELA 3VJNA 5LMKA 4MX9A 2F2CB 2GS2A 2P4IA 3QKKA 3BBWA 3G6GA 4Q5HA 3W33A 3TNPC 3UVQA 2QHMA 2R3JA 3NYXA 3KXXA 4RJ6A 3P1AA 5I0BA 3O7LB 4AW2A 3NGAA 2IWIA 3I0QA 5JEBA 3G15A 4L3JA 1ZOGA 5CS6A 5DRDA 4F9BA 1Y91A 4JQ7A 2HK5A 5AR7A 3RTPA 3P79A 4RJ7A 4CNHA 3BGZA 3OWJA 4FKGA 2GS6A 2RIOA 4C58A 3QCSA 4CKIA 4F1TA 4X6RA 4BWKA 3NIZA 2BUJA 2VTHA 1A9UA 4S31A 3ZCLA 5JH6A 1OPKA 4O0WA 4QRCA 5FP5A 3VS6A 2X7GA 2Y4PA 2YITA 4I4EA 4PDSA 2C6MA 2ITUA 5C4KA 2B54A 2CLXA 5DG5A 5AAEA 3FKNA 4BR3A 2W17A 5JGBA 4WNOA 2C4GA 3COMA 3OCSA 4I0TA 4PL5A 1AGWA 4LQMA 4BB4A 1J7LA 5DR6A 3FQSA 5HICA 3CQUA 4ZLYA 3MGYA 5GNKA 5CEPA 1UU3A 4YHJA 1XHAA 5BVNA 4DEBA 4MNEA 2CN5A 3MH1A 3EOCA 4FTUA 3Q4TA 4FICA 1HOWA 4Y72A 3NNWA 2O3PA 3DFAA 4HZRA 3LFBA 5AR5A 3TT0A 2Q0BA 5JFWA 5ANJA 2YIQA 5JSMA 3TL8A 2XZSA 3G9NA 3GEQA 4GT4A 3UO6A 4D4YA 2AYPA 3VBYA 3ID6C 4DG0E 1FMKA 4RWKA 5A6NA 3O23A 3ZO1A 3DTCA 3U87A 4D4SA 4KIQA 3JPVA
chains in the Genus database with same CATH superfamily
5BPYA 2I0EA 4YZCA 1PXLA 4JBQA 4QNYA 4I5PA 2XMYA 3R2BA 4RJ3A 4ZK5A 5TO8A 4QTAA 2XNNA 1UKIA 3EMGA 3OT8A 2XEZA 2XS0A 3SV0A 4DH3A 2RG6A 3FSFA 4FTJA 4DGGA 2BZKB 3E62A 4MXAA 3BL9A 3R2YA 1SM2A 3R9DA 2YZLA 3UTOA 3LFNA 4GW8A 2F49A 4IZ7A 4U43A 5BVWA 3ZRMA 2PL0A 4FKTA 3RHKA 4DH1A 2PZ5A 4DHJA 3IG7A 3CS9A 4GV1A 4O0TA 3BYOA 3TM0A 3CY3A 4O96A 1CSNA 3WF7A 4GFMA 3VS3A 4DFZE 3UDSA 2E2BA 3NW6A 4FSUA 3R9OA 3LM0A 5L2TA 5AUXA 5LOHA 4DBXA 2J2IB 3T3VA 1QMZA 2WQMA 3QWKA 4O2PA 3QD4A 3V5WA 4CYIA 3PFQA 5JFVA 1YRPA 4I20A 4F08A 2WMAA 2BZHB 3OW4A 4EOJA 2XK9A 4YZBA 3Q9XA 1WMKA 4FV4A 3PSBA 4QMXA 4OBQA 2VO6A 3LCOA 5JQ8A 1KE9A 2X6DA 4F09A 3LOKA 4YURA 1LEWA 3CQWA 4F7JA 4O0YA 1G5SA 4ERKA 3QQFA 2YISA 2IW9A 4FL2A 3L9MA 4FSRA 3FMEA 3NUYA 3RINA 3BLRA 3VW6A 4A06A 3CEKA 2VAGA 3FYJX 4QMVA 5BMSA 3FEGA 4AXAA 2JDVA 3OUKA 2O5KA 4FKPA 2ZMDA 4FEXA 3ZUVA 3I1AA 5KZ0A 4F64A 1F5QA 4WBBB 5KE0A 5J1VA 1OIYA 1J7UA 2YA9A 4W4WA 5J7BA 2HZ0A 1PYEA 2XM8A 4BICA 3QHRA 1UU9A 4NM5A 3UO5A 1W7HA 4EUTA 3Q4ZA 3GC8A 1QPCA 5HG5A 4IDTA 4DE4A 3ZTXA 4LG4A 5KKRC 3DY7A 2QLUA 2XK6A 4AT3A 5KCVA 4PF4A 5J9LA 4EBWA 4M3QA 3ALOA 1R39A 2X39A 3AQVA 3Q2MA 4IM3A 4EH7A 5CSVA 3OT3A 1WZYA 4IX5A 3W8QA 4QT1A 4AZTA 4RQKA 5AUZA 4AZWA 4QOXA 3LFQA 3ULZA 3OY1A 2I1MA 4EZ3A 4R77A 3FYKX 1H08A 3OZ6A 4JDIA 4FV2A 4XG3A 2BPMA 2X4ZA 2WMSA 5IZFA 4E93A 2HZIA 3T9IA 3MVLA 4USFA 3ATSA 3VWAA 4FRFA 3F7ZA 2PVFA 4FTQA 2EWAA 3LFFA 2R9SA 4WSQA 4XEYA 5IQDA 4LGDA 1GZKA 2C1BA 4MQ2A 3VNTA 4JNWA 3BHTA 3QQHA 3FLQA 3WZEA 4RRVA 3DB8A 1KV2A 4BDCA 2BTSA 5EG3A 3PY0A 2QG5A 3QZHA 3BX5A 5E7RA 2IN6A 3VS7A 3OCGA 2HYYA 1H0VA 3VAPA 4FOBA 2I40A 4BDBA 5KMJA 2C5NA 4FG7A 2RKUA 2B53A 3NIEA 3MH2A 2YEXA 3UG2A 3CY2A 3EQPA 2NRYA 3HMMA 4NFMA 2VO7A 5IKWA 5AUYA 3F3TA 5BUEA 2YCFA 1XWSA 5HVYA 4OTHA 2XJ1A 3DLZA 2C0TA 2WMWA 4XCUA 2PK9A 3AC2A 3QRJA 5HG7A 4L52A 4MAOA 4PTGA 4HVDA 4FKIA 4OAVB 1OKYA 3EQGA 4CZUA 3L9NA 4FR4A 4TYGA 3IDBA 4V01A 2VV9A 2B7AA 3FY0A 4FSNA 3R7EA 3PFYA 4YO4A 4WUAA 2BRMA 2KTYA 3LMHA 4MWHA 4HNFA 1JSTA 3A7FA 1NW1A 3R9RA 4DHZA 4BDEA 2CNUA 2Y6MA 4R3RA 4J71A 5EM5A 5CZHA 5HIDA 2QOHA 1YDRE 2IVUA 4LOQA 3TNWA 3BHYA 3O71A 4D5HA 2HAKA 4KINA 2GDOA 5HQ0A 3GQLA 4C3PA 4CCUA 3EIDA 3P23A 1CMKE 1Q8WA 2W7XA 4M14A 2WAJA 3Q9YA 4A9YA 4FTLA 2F7ZE 2VN9A 3LFDA 1ZMVA 5HLPA 2VTSA 3NDMA 3LCTA 4EBVA 5DVRA 3KMUA 5FDXA 4BCPA 4EH3A 2IZRA 3LAUA 1SMHA 3C13A 3KXGA 3BI6A 4RSSA 4BKZA 5FXRA 4UMUA 1Q97A 2JD5A 2VRXA 1Q41A 4FV5A 5IH6A 3W0PA 4BHNA 4JJRA 1B38A 3KXHA 4CFXA 3BHVA 2FYSA 4KBKA 4FSWA 5L6WL 4EWQA 2HZNA 2QOBA 4FNZA 3T9TA 2Z60A 4G31A 4GK4A 1XO2B 3IGOA 2JEDA 3QBNA 2PUNA 4QQ5A 4W8DA 3U51A 2HXLA 2BKKA 5L4QA 4GG5A 1OMWA 1TQPA 2C6TA 3O17A 4XRJA 5AIRA 4JX7A 5LWMA 2BRNA 2C3KA 2GFSA 2LGCA 3ZSHA 1GIHA 3BE2A 1LUFA 4JG7A 2XNGA 3OFMA 3QKMA 4I21A 4I92A 3KREA 4FEVA 5AP4A 3NUAA 4FL1A 4GK2A 4IJ9A 3UOLA 3DAKA 2FVDA 4K33A 4CFFA 4QEBA 3GCSA 3PZHA 4HGLA 5CYIA 5ANOA 3C9WA 1ZYLA 4FNXA 2BHHA 2JLDA 5EOLA 5F20A 3UNJA 5B2KA 1U54A 4YNOA 3D14A 5D7AA 3LPBA 2WKMA 2XIYA 4ASZA 3PA3A 4M13A 2Y9QA 4WNMA 2VUWA 4XBUA 3MV5A 1Y8YA 2W5BA 3P08A 5I9XA 4IZ5A 1ZZLA 5DHJA 4ZSLA 4C62A 5AR3A 3TKIA 2O8YA 4DGLC 3BRBA 4E4NA 2HW7A 5CVHA 4JQ8A 5KMLA 4RLKA 2WQOA 4YNEA 3E63A 2XK3A 4HVSA 3H3CA 5AMNA 4L45A 3WIKA 1YOMA 4FJVA 4O4BB 1NY3A 3QQGA 2HENA 2X0PA 3RK9A 3QWJA 5KZIA 4ZJJA 3BYSA 2RF9A 1ZYCA 4EOKA 1PXKA 1ZWSA 5EHOA 1FOTA 4DEEA 4G5PA 3RGFA 2C6LA 1OL7A 3DXNA 5D12A 4XYFA 1NXKA 5IF1A 4IW0A 3BU5A 4PY1A 5BUIA 4IVAA 1Y8GA 2YIWA 1H28A 3U6JA 2ITVA 3KRLA 3HDNA 3ETAA 4FIJA 2R3PA 4GVAA 4IVCA 4F65A 4IFGA 4W8EA 4RQVA 3R21A 3ORPA 2IEWA 4ORKA 2BKZA 2UZNA 3C50A 2JIVA 4E1ZA 3QRKA 3MB7A 2VX3A 3O7LD 2W1HA 3C4EA 4NCTA 3Q53A 4TYJA 1CDKA 3DU8A 2PVYA 4PDPA 4EEVA 1KOAA 4ZMFA 5M44A 2EU9A 3OC1A 3AT3A 3VN9A 3R8VA 3VHEA 3ZXZA 3KCKA 4Q2AA 4UMQA 4J97A 5IH4A 4FKJA 2O2UA 2YJRA 4DDGA 1F3MC 4WSYA 5M4FA 3QX2A 2OJ9A 3VULA 4Y73A 1FVVA 2QO7A 5BV3A 1JKSA 1Z9XA 3A7GA 3R7VA 3KULB 5D41A 3QALE 2P2HA 5IA1A 2Z7SA 4GU9A 3RPSA 5HE1A 4E4XA 2PE2A 3N4TA 3SDJA 2G1TA 3ORTA 2QURA 3FQEA 2QR8A 3CD3A 5CY3A 3ULIA 4AS0A 2HW6A 1OKZA 4NM0A 3HP2A 4HVGA 3JY9A 3D4QA 5HEZA 5TF9A 4AXCA 2ZB1A 4U5JA 4NIFA 5HCZA 2FSOX 3R71A 4DYMA 2VWYA 3WE8A 2OLCA 3ELJA 4GUEA 2GNLA 3R7YA 2F2UA 5AIKA 1XH6A 3IONA 4PDOA 2P3GX 4AQCA 1G8KA 4DT8A 4YTHA 3DXPA 4PTEA 4QMZA 3EL7A 2WIPA 2XRWA 3UZPA 3R6XA 3Q4UA 4FSYA 3IO7A 2C3LA 2XK7A 3DPKA 1U5QA 2RSVA 4UV0A 5EDQA 2BRBA 4GU6A 3UIUA 1Q4LA 1GIIA 2BHEA 5CAOA 4R78A 1TFFA 4ZJIA 3I79A 1UWJA 2PE1A 3AKKA 2R3GA 4I23A 4RMZA 3S00A 5T68A 3ZO4A 3V5LA 2C6KA 1RE8A 2XYUA 3PPKA 5IISA 3GGFA 4U81A 5AUVA 5IDPA 3NVMB 2FGIA 3OW3A 4RFZA 4NKAA 3MYGA 2IVSA 5F1ZA 1KWPA 4QP7A 2UZDA 1PXJA 3S1HA 1SVHA 4FIIA 1XBCA 5HVJA 5K0KA 5TE0A 3C0GA 2YWPA 3GCUA 4U3ZA 5JK3A 2UW0A 3QAME 5D11A 5FRIA 5CEQA 4I6BA 4EOPA 3RWQA 5CF5A 4OAUC 3N4VA 4TT7A 4IACA 3I5ZA 3PY3A 1KOBA 4FT9A 3FI2A 4D9TA 2A27A 2XNPA 4BCHA 2XA4A 3M1SA 3PUPA 4IANA 4AZSA 1KE6A 2GQSA 3RZBA 3SD0A 4DGOA 4ANMA 1Q99A 2UZBA 3FZ1A 4F6SA 4BTMA 2NRUA 3QXPA 4NM3A 4CRLA 4XG8A 2XEYA 3FMDA 3GB2A 3I7CA 1MRVA 3NUUA 4EC9A 5I9WA 5EQEA 5T3QA 4YC6A 3NX8A 4PMPA 2R4BA 5EQYA 4UB7A 1W2FA 1RW8A 3JYAA 3PXYA 4IBMA 4R3PA 1TQMA 2XIXA 3TV6A 3QC9A 3ZFYA 3ZONA 4EHVA 2BTRA 4R7HA 4XHKB 2ZV9A 4FV3A 4QD6A 3PE2A 2B9JA 4X3FA 2C5VA 5E8ZA 1YXUA 2XK4A 4CRSA 3QQLA 1SVGA 1AD5A 5ACBC 4TKSA 4XOZA 5DPVA 3BQCA 4DTKA 4IMYA 4JRVA 4AAAA 3DTWA 1YI3A 3E93A 2RFEA 4FZ7A 4F0GA 3W0QA 1YI4A 4CMUA 2BDFA 1ST4A 2W1GA 1M2RA 4K2RA 4M69A 4RIXB 5AEPA 4QP8A 2VGOA 2XJ2A 5E8SA 4EUUA 5HKMA 4XV3A 4XBRA 2OH0E 4RWJA 5DEWA 5E92A 3QTZA 1YOJA 5HU3A 3FZOA 4I3ZA 3LW0A 2QU5A 1IAHA 3OWLA 3R1QA 3BE9A 3RCJA 4DN5A 5DT0A 4ZAUA 4MD8E 3HAMA 3SXFA 5KX8A 2WQEA 3ACJA 3OOGA 3R8UA 2IZTA 2V22A 4IXPA 3Q96A 4RWLA 2ESMA 1ZARA 3BZ3A 3QTWA 4EH4A 4D0WA 1STCE 2QOKA 2R3FA 5J79A 3I60A 5L8LA 3JY0A 3HV3A 4II5A 2X1NA 5GJFA 5CENA 4JOAA 5IA3A 2GU8A 2OJFE 1DAWA 3RVGA 2OGVA 3KY2A 4EHEA 4BIBA 3SQQA 3V01A 4E5WA 2Q0NA 4FT3A 3PE1A 5AP5A 3FV8A 1UA2A 3EN9A 3QFVA 4MKCA 2PHKA 1FINA 2R3HA 4FTKA 3S95A 2YZAA 5L6OA 3F69A 5KMNA 3AC1A 4X2FA 5CT0A 3LFSA 4O4DA 3TACA 4J8NA 3COHA 4N6YA 1ZY5A 4O4FA 3HV5A 3OP5A 1P14A 2CN8A 1JSUA 3F7WA 3PVWA 5GJGA 5FTQA 3VBXA 5HTIA 3PXZA 4EH5A 4RA5A 4ID7A 3FL4A 3PIXA 3VRZA 3OOMA 3GP0A 2QKWB 4BF2A 3ZLXA 4DGNA 2CNQA 3SXRA 5KBQA 2BILB 1OL1A 3KMWA 4BBEA 4M66A 5CU3A 3DS6A 3LCKA 1W82A 3D83A 2ETMA 4IWDA 4KAOA 4MEDA 3VBVA 2AEGA 5EKNA 4DEIA 3FZSA 3F2AA 3ORNA 3C1XA 4L44A 4DT9A 4NUSA 4U42A 3CLYA 4EK8A 4RIWA 4ZLZA 3GOPA 1OL5A 3E8CA 5TR6A 1NVQA 1H1WA 1G8SA 3HV6A 1K2PA 4RA4A 4GRBA 1J1CA 5CXZA 3EN6A 4FZDB 3D7ZA 4FZAB 4EZ7A 3WZJA 4N70A 4PUZA 4ZSJA 5C9CA 3ZBFA 5AAGA 3ROYA 4OBOA 3D7TB 5G1XA 4APPA 5IQBA 3B2WA 1OUKA 2OI4X 4BZNA 2SRCA 1CKPA 3M42A 4YZNA 1PW2A 2XK8A 1SNXA 4LGGA 3IK3A 4WRGA 4C4IA 4BDIA 3RPVA 4CVAA 5HLNA 5LXMA 4N6ZA 4DA5A 5BVOA 4LM5A 4MXZA 1H07A 2OJGA 5HTCA 3BWJA 4ITJA 3DLSA 1QL6A 4PMTA 3PXQA 3IDCA 3FBVA 3MY0A 4IAAA 4BN1A 4CKRA 2ITZA 4DTBA 3BYVA 4KKGA 4P7EA 4HCVA 4U79A 4ACHA 4Y5QA 4AT5A 3UDZA 2ACXA 2VO0A 3E7OA 5DR2A 4FOCA 3UE4A 3R9NA 3EH9A 3K5UA 3DBDA 5HNGA 2R3IA 2XF0A 3TG1A 4F0IA 3LFCA 3SHEA 5A54A 4LUEA 2YM8A 4AG8A 3ACKA 2Z8CA 1LR4A 3LCDA 1YI6A 4LYNA 3FAAA 4BY9E 4BZDA 4UN0C 4GKHA 4LDTA 4H3QA 4O7ZA 4FTIA 3D9VA 4G3EA 3R83A 3R8PA 1AQ1A 4KIKA 4CCBA 5JMSA 3UPZA 4LRMA 1PMNA 4JLCA 4XG2A 4XMOA 3UIMA 3R9HA 3UOHA 5EW8A 4RX5A 4E26A 4WKQA 2OJJA 4I41A 3ZS5A 4MD7E 3PSDA 5AP0A 3A99A 3VUTA 4LUDA 4B8LA 3D2KA 2C3JA 4RX7A 4BRXA 3FQHA 2CGXA 1KUTA 2YCQA 2HOGA 4F7LA 5KUPA 4H05A 3FMNA 4RZVA 4CQEA 2X2KA 5CNNA 3C5IA 2J0LA 4J98A 2IW8A 5AM6A 3KVWA 2GNIA 2NYAA 2GNJA 4JIKA 4UBAA 3DJ6A 4LGHA 3QCQA 3VIDA 4WNPA 2DWBA 1RQQA 2OF4A 4FSQA 4HZSA 4DTAA 3HX4A 4V0GA 3M11A 5CALA 4FKVA 3IW6A 4Z7GA 4E5AX 3MA3A 3F2NA 3BWFA 5BQ0A 5H9BA 2W1CA 4H39A 4M0YA 3D5VA 3DKOA 3V5PA 1V0PA 1YDTE 4U9AA 3SRVB 4B99A 5CEMA 3UYTA 3QZIA 4I6QA 5LCKA 1TQIA 4IZAA 2V0DA 3CBLA 3MH3A 2QOCA 3L8VA 1JSVA 2XKCA 3IS5A 4F6WA 4OBPA 3NZ0A 4YBKA 2CPKE 5DLSA 2W1ZA 4R7IA 4QPSA 3CXWA 4HPUE 4IWOA 4LRJA 4QP3A 4TZRA 2QNJA 4IB0A 4LMUA 4P2KA 4X2GA 5EHYA 1H1QA 3EHAA 4TYEA 5HE0A 4AA5A 2W9ZB 3F6XA 1WFCA 4ZY5A 5I4NA 5LMBA 4E20A 3AC3A 3H30A 3UP7A 3QTRA 3ML1A 3I6UA 5FUTA 3L9PA 5A4EA 4HYHA 5AUTA 4NTSA 1VLRA 4P5QA 4F78A 3QTUA 2X7FA 4O1OA 4A4OA 5DE2A 3PJ1A 3KF7A 3DB6A 4CGAA 4F99A 4O7SA 1W84A 4KWPA 3QLGA 3SOCA 3LQ8A 4IC7A 1IA8A 4K9YA 4C36A 2BIKB 3RZFA 3BYMA 2ZMCA 4EK5A 4WHZA 5HD7A 4RX8A 5CAUA 2WMRA 4KNBA 1R0EA 4U44A 4ASXA 4LMNA 4D1SA 3RJCA 4U6RA 2CMWA 3FI4A 3EN4A 3IW4A 5LVLA 4AZFA 2W06A 4R1VA 2FUMA 2OU7A 4BCOA 1OL6A 4NK9A 1B39A 1JBPE 5M4UA 3ZZEA 4EWHA 1VJYA 4RPVA 2A0CX 2B9IA 1Q62A 3L8PA 1TZDA 1H27A 1J1BA 5E8WA 5HHWA 3QUEA 2OW3A 1I44A 2OZOA 3Q9WA 4KSQA 1YQJA 4L68A 1BI8A 2BR1A 2W4KA 4GEOA 4M97A 1XH9A 3FMLA 4X6QC 4C57A 3TIZA 3R02A 2OBJA 3FPMA 1PJKA 2CSNA 3FLSA 4DC2A 3HDMA 2GHLA 2YERA 2X2LA 3FSKA 4O6LA 3QU0A 2JITA 2OZAB 4L67A 4DFUA 3G5DA 2WPAA 3EFLA 3C7QA 4YSJA 1PXNA 4F6UA 3L9LA 4M7IA 4C3FA 2PVRA 5FDPA 1OITA 5CF4A 4YUQA 3A62A 3QQUA 4CTBA 5HNBA 4XUFA 3GU6A 3GC7A 5AR2A 3MN3A 5HO6A 2GMXA 4DH5A 3L8XA 1XH5A 3QTSA 4GJ2A 4D9UA 3ZO2A 2QO9A 2PMNX 4WD5A 4FBXA 3BU6A 2VTQA 2W99B 2X0GA 5ETCA 2QOIA 4FEUA 3AT2A 2GTMA 4LOPA 5AP2A 4P90A 2QI8A 2YLEA 4XP2A 4RGJA 4O7YA 4F9CA 4N0SA 3GT8A 5CSPA 3TZ9A 4IWQA 3UNZA 2GFCA 1ZMUA 4TYHA 5CU2A 5M51A 4XV2A 1O6LA 1JVPP 3DBFA 2R64A 4D28A 5I3OA 2B1PA 2JC6A 4PRJA 4UWCA 2P0CA 4QTDA 3RMFA 3E8EA 4AA4A 4J96A 3AMYA 3LHJA 3UZRA 3R28A 4JQEA 5FG8A 2B9HA 4MXCA 1DAYA 5AJQA 2PZPA 4FEQA 3NPCA 4FA2A 3P9JA 4EZ5A 4FEWA 3R30A 3JVRA 3MTLA 3F82A 4XNEA 4PPBA 5FBOA 4J52A 5F4NA 4J1RA 4IWPA 1V0OA 5JGDA 4O86A 4NW5A 1CM8A 4EHZA 4JRNA 3F9NA 5GJDA 3TNHA 3O8PA 4GT3A 4U0IA 4HW7A 4G3FA 1F0QA 2Y0AA 2XBJA 3PPJA 2I0VA 2YJSA 4G9CA 3RP9A 5C8KA 4BIDA 5B2MA 5CANA 1NVRA 5B7VA 3V04A 2OICA 2ONLA 2X8IA 4IM0A 4O2ZA 3VUGA 4YZ9A 5BNJA 4IAIA 4BCIA 3Q04A 4TWNA 3GFWA 1JKLA 5LWNA 5IQIA 4EQMA 4WBOA 4ZZNA 2WTVA 1IR3A 2C5YA 3AG9A 3Q3BA 3HUBA 5KMIA 4BVUA 4YJNA 4NKSA 4PMSA 4RLLA 3QF9A 4UXLA 3HNGA 3D0EA 2XNOA 3BV2A 4OTPA 3SOAA 3LCSA 3FMKA 1L8TA 4IE9A 2X9FA 4FUYA 4K0YA 5L6PA 1P4FA 1BUHA 3LXNA 3JVSA 2X0OA 4HJOA 4WRSA 4F1OA 2VWIA 5F9EA 4FI1A 1PF8A 4EJNA 2HELA 4ANLA 4GCJA 3TXOA 4AP7A 4EQUA 4NCTC 3LJ1A 1YWVA 2UW6A 1HCLA 3FXWA 4IAYA 5HG8A 4NWMA 3ZU7A 4Y85A 3CQEA 4A7CA 2ETRA 2YDIA 4JR3A 5TKDA 5JFXA 4I6LA 5ANGA 5IQFA 5GZ8A 4JDJA 1XH8A 3PRIA 3RALA 3THBA 3V5TA 1R1WA 2JAVA 1OUYA 1MUOA 5EOBA 3VBTA 5IMXA 4ZSGA 5L2SA 5FTOA 4JX3A 4O84A 3PXKA 2W1DA 2X7OA 2BALA 2JDTA 2PVKA 4KB8A 5HBHA 1JWHA 3R8LA 3ATTA 2AUHA 2F9GA 3MESA 4IAFA 3ZC6A 4DEDA 2PSQA 4K18A 1XMMA 2CJMA 5HNIX 4OW8A 5E91A 2PMLX 4I5HA 4AFEA 5LVOA 4O7LA 4KS8A 4BJJA 3S2PA 4E6QA 4ZTHA 5AFVA 3KGAA 2UUEA 4CV9A 2BFXA 5FXQA 3IGGA 4F9AA 3O8UA 3ORKA 1Q3DA 3LZBA 3PLSA 4M15A 4EK4A 4F63A 3FMMA 4A4XA 3UC3A 4FGRA 2RGPA 2EXEA 3JXWA 2VGPA 3DK6A 3EQBA 4RVTA 2C69A 3WE4A 1ZYDA 5J5TA 1V0BA 3V6RA 4AXFA 4GH2A 4FV0A 4S2ZA 4UXQA 5G6VA 3VS0A 2A19B 2EB2A 2J5FA 2ZOQA 2C6OA 1JNKA 2ERKA 3AGMA 3OD6X 4MBIA 3SVVA 4O0SA 3W0MA 5A4TA 1ZMWA 4ZEGA 4EOLA 3P7CA 3W0RA 2DQ7X 3MJ2A 3QRIA 3D15A 5C1QB 2CKOA 2OIQA 4W4XA 1VYZA 2YHVA 3MW1A 3IKAA 4HCUA 1YHVA 3KIOC 1JLUE 5CLPA 3F5XA 3UMXA 4F9YA 5C4LA 2UZTA 2EB3A 3R0TA 4ZXTA 4XP0A 5EYCA 3KEXA 1APME 4B4LA 1M2QA 5ANIA 1FBNA 1FQ1B 4QQJA 4CD0A 3WIGA 4BGQA 2VTTA 4JIAA 4KIOA 2QKRA 4QTBA 4CLIA 5J9YA 4EHGA 4JXFA 5M4IA 4DH8A 1Z5MA 3CR0A 2UZWE 1PXMA 3VQHA 3Q5IA 3DAEA 3R1YA 4ALWA 4YJTA 4YTCA 1OIQA 5HVKA 3UMWA 3UOJA 2C5XA 3A2CA 3RM6A 3SXSA 1IEPA 4NJDA 4J95A 4O7TA 3WF5A 3F5UA 3TUBA 2PZRA 4RC4A 1W2DA 4PWNA 3NYNA 5H3QA 2EVAA 5AP6A 3ANQA 4MH7A 4I24A 1BI7A 4MTAA 3EFJA 1VZOA 3FMHA 3RPYA 3VW8A 5ETAA 1PXIA 4FV7A 3EQRA 3G6HA 3R8ZA 1REJA 4ACGA 3OROA 4RIYA 4X3FC 3VUKA 3NWWA 5E8YA 2GQGA 2Y4IB 1Q8ZA 4H1MA 4NW6A 3W0OA 5EK7A 2UVZA 1Q3WA 3EQCA 5CASA 4K1BA 3IW8A 4ZIMA 3W18A 3PJCA 4N4SA 5HO7A 4KKHA 3ZLWA 3GNIB 4WA9A 3EQDA 2UW8A 4LOOA 4I5CA 5HIBA 2Y7JA 4V05A 5J1WA 2JAMA 2XNMA 2B55A 3KXNA 2PMIA 2JDOA 3JUHA 5DEYA 2BVAA 3HZTA 1K3AA 2YAKA 3Q32A 2YM5A 3TZ8A 2ZYBA 1E1XA 2QONA 3HV7A 3E3BX 1GZNA 3C4ZA 3QD2B 4MF0A 5D1JA 4YLKA 5IH5A 2RG5A 5L2QA 4KBAA 2H8HA 4BZOA 5CAPA 4HPTE 5J9ZA 2Z02A 3Q9ZA 3VS4A 4HVHA 4J8MA 4UYNA 3ZSGA 4AE6A 4MXOA 3I0OA 3G0EA 1YW2A 1H8FA 4B0GA 4IAKA 3OXTA 5IDNA 2P33A 3QUPA 1GZ8A 2YFXA 3OVVA 4TWOA 2UW5A 3QUDA 2PVJA 4LL5A 4O6EA 5CEIA 4PL3A 3RPOA 4YMJA 4WUNA 2RFNA 3NEWA 4FV8A 4TL0A 5BVDA 2VWWA 3FXZA 5F94A 2YWVA 4KD1A 1T45A 2WGJA 5IQHA 3C4FA 3HYHA 3KU2A 4C37A 1XJDA 3PUFC 5IQCA 5FGKA 3ALNA 3LQ3A 1DM2A 3ZEPA 2OFUA 2JKMA 4FKSA 2BCJA 3T3UA 3ZRLA 3M2WA 1CTPE 2WTKC 3R04A 4E6AA 1RJBA 3IOKA 5M08A 2XM9A 1ZOHA 4OTDA 4YZMA 3ZDUA 5K0XA 3BPRA 3K54A 3ZLSA 4UMPA 4QMNA 2UW4A 3U4UA 5CEKA 3L8SA 4MNEB 2ITPA 3GFEA 3MY5A 1SZMA 2JKOA 3QX4A 5CEOA 3QYWA 4XLVA 4ZLOA 1XH4A 2WO6A 3OWKA 2XBAA 3TKHA 4TNDA 1JQHA 4FK3A 5DRBA 3H9RA 1UNLA 2BROA 3HRFA 3SKCA 5L2IA 4K77A 1UNGA 1RDQE 3HMOA 4GVJA 3ODYX 2YN8A 4S34A 2BZIB 4PMMA 2V55A 4QMLA 5EM6A 4E6CA 5A6OA 1H01A 3HMPA 4HCTA 4EJ7A 2I0HA 2WMTA 5EH0A 4ZTRA 4I0RA 4E5BA 5AX3A 2XP2A 5I9VA 2IVTA 2VD5A 4B6LA 4J99A 5KO1A 2GNFA 2PPQA 2EXCX 3FZTA 4QMUA 4QP4A 2QO2A 1WVWA 2IW6A 5BMMA 4I5MA 4I22A 4OUCA 3W0SA 3EFKA 5DA3A 4Z7HA 4DH7A 1QPDA 1YKRA 5JT2A 4DITA 4FX3A 4UYAA 2Z2WA 2X4FA 4ZSEA 3O96A 4HNIA 3PXFA 3K3IA 1TVOA 2R3LA 3ERKA 4K11A 5DBXA 3CKWA 2ZDUA 2UW9A 4FT7A 3W2RA 3LVPA 4DCAA 4FMQA 2CKEA 3PWYA 4ZTSA 3KVXA 4I1ZA 2OH4A 4GJ3A 3AT4A 5AR8A 4BTFA 4O21A 2UW7A 3R7IA 3LMGA 3EZRA 5AWMA 2VNYA 4O7VA 2QHNA 4H36A 4Z9LA 3GQIA 2CKPA 2ZVAA 4GMYA 4UZHA 4OT6A 3TV7A 3WZDA 4AFJA 4RZWA 4ZZOA 2P55A 3EQFA 4NT4A 2BDWA 2BDJA 2HWOA 4CTCA 1OPJA 1U4DA 3WZUA 4MD9E 4FV6A 1J7IA 2UV2A 4L8MA 3WI6A 2QOLA 4TNBA 5CU4A 2WOUA 3TEIA 4EONA 2WTJA 5K5XA 5M56A 1PRYA 3H9FA 5I3RA 3C4WA 5EI2A 4YTIA 2PMOX 3O51A 4DLJA 3WF6A 2QR7A 4FT5A 3PYYA 2NNWB 2YLFA 4LFIA 3NNXA 4IIRA 4C2VA 4RJ5A 5DT4A