5A9UA

Structure of c1156y mutant human anaplastic lymphoma kinase in complex with pf-06463922 ((10r)-7-amino-12-fluoro-2,10,16-trimethyl- 15-oxo-10,15,16,17-tetrahydro-2h-8,4-(metheno)pyrazolo(4,3-h)(2,5,11) benzoxadiazacyclotetradecine-3-carbonitrile).
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
309
structure length
292
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGEVYEGQVPLQVAVKTLPEVYSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Resensitization to Crizotinib by the Lorlatinib Alk Resistance Mutation L1198F.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords ALK TYROSINE KINASE RECEPTOR
total genus 98
structure length 292
sequence length 309
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5a9uA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5a9uA01
4IJPA 4AQCA 4BTFA 1WFCA 3E87A 3LJ2A 3ZDIA 1X8BA 5HNIX 5CSPA 2R3GA 1E1XA 3FE3A 1OGUA 1OPLA 2XM8A 4LMUA 1LEWA 2E9OA 1H24A 2UW5A 2OZAA 4CGAA 4AW1A 4EJNA 1IG1A 2CGUA 3Q5ZA 2J2IB 3W2RA 3EQIA 4DH3A 2C47A 5J9ZA 1Q62A 2Y7JA 4IZ5A 4Q5HA 5AADA 5IEVA 3IW5A 5CF8A 3LFNA 2XVDA 3TJCA 4KBCA 1TVOA 4CZYB 3ULZA 2VWWA 3RAHA 5IQBA 4ASDA 4RX7A 4AOTA 4N6ZA 4AE6A 1QPCA 2RG6A 4UMUA 2JIUA 5HG8A 3R00A 3FLNC 3OW3A 4X21A 5EW9A 3B8QA 4F08A 4ACMA 4EZ5A 1O9UA 4ZS0A 4J95A 5C01A 2PMNX 4UWBA 2ITVA 3HMMA 3FQEA 2ITQA 3PJ2A 3EQCA 3RVGA 2PUIA 2WIPA 2RFEA 2WTJA 2X6EA 5FDXA 4FNXA 4OTRA 4DGGA 4OLIA 4EYMA 3RTPA 3COHA 3RAIA 4E4MA 1YDRE 1U4DA 4YJTA 4O86A 5CX9A 2CMWA 3NNVA 4RWIA 3VBXA 3QQUA 3RCJA 1R0PA 2A2AA 2ZV8A 4H36A 4RJ3A 1SNUA 3PXKA 3NNXA 4XG7A 2C6EA 2JBPA 3DT1A 2X8IA 4YC8A 2PE1A 3BGQA 5DR9A 3OMVA 3JYAA 4K1BA 4MQ1A 5HG5A 1F0QA 3KXHA 5AX9A 3SC1A 3QQLA 5CU0A 2UZOA 2GHLA 4O7TA 1KV1A 2VO3A 3UC3A 3CE3A 4IVDA 4UY9A 3L9PA 5T68A 1R3CA 4DLIA 3ZO4A 5CQUA 1YOLA 2OG8A 3PRIA 4BYIA 4CNHA 4F7LA 2VN9A 2QO7A 3GUBA 3HVCA 4XX9A 3VJOA 5M08A 4DT9A 3FY2A 2R0UA 5EOBA 5JFWA 4J7BA 1V1KA 4PPAA 2XYNA 5I5ZA 4UMQA 5KNJA 5M4UA 4E5AX 3L8XA 1ZYSA 4RJ4A 4EH8A 4HVSA 3DFAA 3F2NA 4UWCA 1UA2A 3R01A 5IKWA 1QPJA 4YJOA 2CHLA 3A7FA 5EM6A 4QRCA 1WBPA 2AYPA 3IKAA 4MD9E 1ZYDA 4ENXA 5AR2A 3FPMA 3FUPA 3FLQA 3RBWA 5IQIA 4GMYA 4YZBA 3FMHA 4YJSA 4DTKA 3LMGA 2VD5A 3WYYA 4GG5A 1XWSA 4YZMA 4YR8A 5IA1A 3OROA 2NRUA 2C5XA 3C4ZA 5CU3A 2QQ7A 4A4XA 4J52A 2QVSE 2GSFA 1J1BA 5CF6A 3UZTA 2CLXA 5AWMA 3TV7A 5AAFA 2XK3A 3S2PA 4AGCA 3E92A 3AC2A 5DE2A 3ERKA 4KA3A 4E4NA 5CEKA 2RIOA 4X3JA 3HL7A 3PVUA 4WSYA 4YHTA 3H9OA 5AIRA 4OTFA 5FM3A 3UNKA 2W5BA 3D7ZA 5GIOE 4O7YA 3GC0A 1R78A 4BDDA 5CEPA 5M56A 2PVYA 3QXPA 4YLJA 5HIBA 5H3QA 5AP4A 3TNPC 3UZRA 2HYYA 1RQQA 1JSTA 2OGVA 3MJ1A 4LUDA 5HLNA 5I0BA 2G2HA 4QMUA 3DBEA 3VW6A 3L9NA 3VN9A 3R1QA 4YJPA 5CT7A 2AC5A 4JBQA 4B7TA 2H6DA 4JIKA 5BX0A 4ACDA 2X8DA 2OIBA 5IH4A 3KXZA 1H08A 4GRBA 4I0SA 3GFWA 2C1BA 3KRRA 1Y6BA 1LEZA 1CKIA 2WXVA 2OZOA 5HO8A 4Z9LA 4HVIA 2YISA 4FKGA 5ACBC 4ZK5A 1GZ8A 3R6XA 1XQZA 2HW7A 2PK9A 2C3JA 2HWOA 1STCE 3I6UA 5IDNA 5FLFA 3QLGA 4HPTE 4GK3A 4WO5A 4ENYA 3K5VA 2W05A 3P4KA 3FHIA 4WNMA 5E8ZA 1ZARA 3PFQA 3GBZA 4KB8A 3V5TA 5EYKA 3ANRA 1H01A 3VBWA 4L45A 4FODA 3VS0A 1K9AA 4EOPA 4LUEA 4KRDA 3N4UA 4X2JA 2XF0A 3RWPA 4A9RA 4MYGA 2WMWA 4GSBA 2XYUA 2BIKB 2OXXA 3IDCA 3QGYA 4WRGA 4EWQA 3BKBA 4RRVA 4ZMFA 4MD8E 4AZFA 4BCOA 4NCTC 2REIA 2UVZA 3BV2A 4BGHA 3AMBA 5AP0A 5HOAA 4QQ5A 3F3VA 4BHNA 2EB2A 3IW6A 1TQPA 5LMAA 2GMXA 3UQGA 3R83A 4Q9ZA 1JWHA 1ATPE 4LGHA 1M7QA 1RDQE 4DFYA 1OIRA 3F82A 4WHZA 2XJ2A 4NT4A 3PE2A 2FSLX 3EH9A 3BYMA 3CIKA 4JAJA 4OTGA 5L8JA 3ZBFA 2ZAZA 5EKOA 4PP7A 3HMOA 3COMA 3QA8A 4RVLA 4EH2A 4CMUA 3QX2A 1OI9A 4Y73A 2X4FA 4II5A 2VTOA 4MK0A 1FBNA 4LM5A 3ZUUA 2XIYA 4G3EA 4RFMA 4YPSA 2PMLX 4IWDA 4ZSAA 5M4FA 2ZJWA 4FIFA 3VS5A 2PUNA 3TNWA 1ZRZA 3T9TA 2CCIA 4F4PA 1V0BA 4K2RA 4X7QA 1FVVA 2G1TA 2R0IA 2OH0E 5HIDA 4I5CA 3CPBA 3PWDA 1DM2A 4R1YA 3EQDA 1YHSA 4XBUA 3BELA 3BBTB 3G33A 3CSVA 4QTCA 4F1TA 1MRUA 1ZXEA 2W1DA 4DAWA 4FUYA 4BF2A 3MFRA 4DGMA 3E62A 5EYMA 5TR6A 3ACJA 1U59A 2UZLA 3I5NA 4FOBA 4C2VA 4OBOA 3QQJA 4FSRA 1MRVA 4U81A 3PZEA 3MN3A 1ZOHA 2QOKA 3ZO1A 3ZUTA 2WAJA 1W98A 4AN9A 4BBEA 4FTMA 1QPDA 3SW4A 2QI8A 4TYJA 4ZOGA 3REPA 4C02A 4F9BA 3ZUVA 5KBRA 3G90X 3GB2A 1F5QA 5T6KA 3IONA 2X8EA 3IGGA 4RC3A 4I5HA 4RGJA 4XG9A 4NKAA 4D5HA 3HA8A 2XH5A 2UZBA 1ZY4A 4KNBA 1H1RA 2VUWA 4XP2A 4BCIA 5HNBA 2VO0A 5BYYA 4RBLA 4TWCA 4YJVA 1PY5A 4UXLA 5CSWA 4EUUA 2Z02A 4FKJA 4ZLYA 5LVMA 4N0SA 4O96A 3I0QA 3I1AA 4CT2A 5CWZA 5DT3A 3IW8A 4JAIA 4BCFA 4U3ZA 1ND4A 1OPJA 5JRQA 2RG5A 3VUGA 1A48A 2EU9A 3WARA 2Z8CA 2VRXA 4X6QC 2W9ZB 5CI7A 3KRWA 3QQHA 4BCNA 4GV1A 2QOOA 4S32A 1WAKA 5CNOA 4FGBA 1UU8A 1UU3A 3WI6A 2IO6A 2QOIA 3LW0A 3OBGA 3MVHA 4EI4A 4L9IA 3LQ8A 5BMMA 3W2OA 4AZTA 2B7AA 3A62A 4IWQA 3TUCA 2C6MA 3FMLA 5CAOA 4EHGA 3ZRMA 4NZWB 4ANOA 4FE2A 1BLXA 1WVWA 3D4QA 4WSQA 5C26A 4C57A 4ZZNA 5AR4A 2V62A 4U97A 3ZS5A 1EH4A 2W9FB 3K5UA 4AUAA 3L8PA 4IX5A 3MBLA 1W83A 3EKNA 3NZ0A 4LOOA 4MH7A 3K54A 3TXOA 4XOYA 4BZDA 3H9FA 3UTOA 1CM8A 3F3TA 2YM4A 2BZHB 2H8HA 3OHTA 4ALWA 4FEUA 2YCQA 4JG6A 3TKUA 5E8YA 4EC8A 3ENMA 3D2KA 4FIGA 4L67A 4MKCA 2ZMDA 3HYHA 3PXZA 3F5PA 3T9IA 4D4YA 3LXLA 4MXOA 4XJ0A 4PDYA 5FDPA 2J90A 5HCXA 3LXKA 3VS1A 4CYJA 3CKWA 4K11A 4C7TA 3JUHA 3Q32A 3SAYA 3DJ7A 2A19B 2WOUA 3LCTA 4EHEA 4F0FA 2W1IA 2IW8A 4I0RA 4BWPA 3VC4A 5KE0A 4EH9A 3IQ7A 1JSVA 3EFLA 2UZNA 3H9RA 4IC7A 4IVCA 4M0YA 5FEQA 1G8AA 3FL4A 4CZTA 3HMNA 3UZPA 5A3XA 1J7LA 3VRZA 2XEZA 4JQ7A 1J7IA 2PTKA 5BVKA 3BU5A 3F66A 1PRYA 5K5XA 5JZNA 2PPQA 5CT0A 3UIXA 4OTQA 5AUZA 3ZLYA 4ACCA 3SOAA 4J1RA 1ZOGA 2QR8A 3QRJA 4HJOA 1ZAOA 2PZRA 5E1SA 5ETAA 4AT5A 4LRKA 3AG9A 4A9TA 3HUBA 2VWBA 2QOQA 1WBTA 3WZEA 4PDPA 3FC1X 2ITXA 1Q61A 2QOCA 3NIEA 3NEWA 4Q2AA 4YHJA 2XCKA 3OT3A 4P2KA 3CJFA 5EQPA 4FC0A 1OZ1A 3VHEA 4RFYA 4IZ7A 4QYEA 4C4JA 4IW0A 3DAJA 3IK3A 2B53A 3G9LX 2BRHA 4QMPA 2H96A 2J7TA 4MXYA 4FG8A 4NM3A 3WE4A 5K4IA 4XV3A 5HHWA 2PVMA 4IFGA 3MWUA 4FKTA 4W9WA 3UOLA 4ITHA 3FSKA 5L6PA 1W84A 3LE6A 1NVSA 2Z60A 3DBFA 3DCVA 4FT5A 3FKNA 2PVKA 1WZYA 1OIUA 4QP6A 3RKBA 5TT7A 2YZAA 3NAXA 4I6HA 2YERA 4NJDA 3VJNA 3QLFA 4D2WA 4HYUA 2Y4IC 3F69A 2OI4X 3BX5A 4C36A 3VUTA 2OLCA 4XYFA 1W82A 2J5FA 4RX5A 4F9YA 2X2LA 3PJ8A 1BKXA 3DTWA 3DDQA 4TN6A 4BRXA 3NLBA 4F65A 3MI9A 2HENA 3KXNA 4NFNA 3TNIA 1ZZ2A 3CXWA 4NSTA 4G5PA 3RP9A 1OIYA 4C4IA 2IZUA 4L52A 4WIHA 3I81A 4LQMA 3C51A 4KIOA 2PE0A 1J7UA 1K3AA 4OAVB 2LGCA 3KA0A 2EWAA 2XIXA 5CU6A 5AUTA 4ZS4A 4J8MA 3R1YA 4EOIA 5BVFA 5CAQA 3R7YA 1Z5MA 3W32A 2VWIA 3SOCA 5FQDC 3GU8A 3PVBA 2QHNA 5D7AA 3SXFA 4IM0A 3WE8A 4ZAUA 3ID6C 1U46A 2ITYA 3R2BA 3K3IA 3FMKA 4CFMA 3KQ7A 4GL9A 5KMKA 2BZIB 5AJQA 3CS9A 3ZONA 2UV2A 2WU6A 2XIZA 1GY3A 4DLJA 3ROCA 5LVOA 2NRYA 2WB8A 3GC9A 4KSPA 3CJGA 5AV0A 3R7UA 3FKOA 3NAYA 2W0JA 4UXQA 4DEDA 4AA4A 1OUYA 1MP8A 4X6RA 4YTIA 1DI8A 4FUXA 4KKHA 4FKVA 2LAVA 4JX7A 3RWQA 4Z55A 3ORNA 4UMTA 4ASZA 4WT6A 4YNEA 2PMOX 3S1HA 5D11A 3G0EA 2XNBA 1CSNA 5H8BA 4QQJA 3R8MA 3VBQA 1J91A 4PDOA 3LXNA 3PA5A 4JDKA 5IZFA 2GQGA 1OVEA 1B6CB 2X7GA 3EWHA 4ITIA 4L3PA 4LOPA 3SDJA 5B7VA 4S33A 2E9VA 4XG4A 3HEGA 2GNJA 4BI1A 5HD4A 3R04A 4H1JA 2R3KA 1Y8YA 3QWKA 3UIUA 2BR1A 5GZ9A 5CQWA 4JRNA 4CCUA 4BDFA 4OTPA 4U5JA 4WG5A 1BYGA 3U6HA 4IDTA 1FVTA 5EI2A 4ANLA 3RJCA 2R7BA 4E4LA 5HX8A 2O0UA 2EXCX 4LL5A 3CY2A 4FTOA 3WZKA 4PDSA 4IAYA 3ZSGA 1JQHA 1JKSA 3BHTA 3A4PA 3NYOA 1S9JA 4PMSA 4OTWA 4PTEA 4MQ2A 4DFBA 3DNEA 2A27A 4TTHB 4FV4A 4WD5A 5EI8A 3DKOA 2BUJA 3GCVA 3NCGA 4NM0A 4LV8A 5TE0A 3KU2A 4TYHA 3Q6UA 4DH8A 4RC4A 3RZBA 2YFXA 2WPAA 3CD3A 3ATSA 2OFUA 4AOJA 3AQVA 1OUKA 2GHGA 3OVVA 4BDHA 4EK8A 3HX4A 3CQWA 4AT4A 3RHXA 4IDVA 5JMSA 2ACXA 3A2CA 3E7VA 3BWJA 4O1PA 4IVBA 2PZ5A 4NEUA 4QMTA 4W4XA 3TT0A 4BGQA 5BUIA 4YZNA 2GS6A 4ZTLA 4GFMA 2G01A 3CEKA 2I0YA 4BCMA 4G17A 2Z7QA 4FK3A 4QP4A 4R1VA 5C8MA 3TL8A 4F6UA 2FVDA 2W1EA 4F9CA 2H34A 5C8NA 3HP5A 1H28A 4GCJA 4JBVA 4KKEA 4TT7A 5KKRB 4FK6A 1FMKA 3F9NA 3H0ZA 3QAME 4FKSA 3R7EA 4FKWA 5A9UA 4C37A 2UZEA 4I6BA 2R4BA 4Z7GA 4FSZA 2DS1A 3H3CA 5J9LA 1DAWA 2BZKB 2IZRA 4U8ZA 3D0EA 4N70A 4CMOA 5IDPA 3OT8A 4G5JA 4USDA 2V7OA 3JS2A 3R7VA 5HVKA 4RZVA 4WG4A 3NVKI 1LUFA 4J96A 3TG1A 1OKYA 2BROA 2C0OA 3COIA 4RVKA 5E9EA 2ERZE 3C0GA 2BZJA 3UO4A 2BIYA 3A4OX 3FL5A 4ZJJA 5GZ8A 2YCSA 3DKGA 3MSSA 3ORIA 2RKUA 4FMQA 2PVRA 5I9VA 3EQGA 4FEVA 3AMYA 2JAVA 4FKQA 2JBOA 2YCRA 3DGKA 4HPUE 4O2PA 3QD3A 3S0OA 3EFKA 5ETFA 4HGSA 4R8QA 4H3BA 4TNDA 4UYNA 3N51A 3U6JA 4XLVA 1H26A 3P79A 4U43A 3UGCA 5A54A 1UNGA 4X2FA 4XRJA 3PDTA 1XH4A 4XHKB 1GJOA 4LRMA 1YXTA 4QTDA 1E1VA 5LMKC 4U9AA 3BU6A 3Q4UA 3OS3A 5EM8A 3ZBXA 1LR4A 3LFDA 2BDFA 4XNEA 4EH6A 4A9UA 2VTRA 4TYIA 4E4XA 4QQTA 1YXUA 3SX9A 5I3RA 2FO0A 3F3ZA 5DOSA 1S9IA 3WF5A 3AGLA 4BDCA 3ZHPC 3GOPA 3ORMA 4EYJA 2W5HA 5HTBA 1RE8A 5HVJA 4ZTHA 5M4IA 4V0GA 3SGCA 1M17A 1XKKA 3ZXTA 2ETKA 2X39A 3TDWA 2WHBA 1GIHA 1PXJA 4FSNA 1H0VA 5AR8A 4R77A 3ZDUA 2HZ0A 3NUYA 3ZM4A 5AMNA 4BN1A 5CANA 3PXQA 5G6VA 4I5MA 4JT3A 5F94A 2PU8A 4BL1A 3MW1A 2W5AA 3QHRA 3MIAA 3VIDA 3PWYA 4M13A 1W8CA 4GK2A 1U5RA 1XBBA 5DBXA 2JDOA 3LOKA 3OEFX 5B2KA 4LYNA 4ASXA 2Y6MA 2EXEA 4FZ6A 3GFEA 5D1JA 5J95A 1GIJA 1BL7A 4BI2A 4CQEA 4FTJA 5AP2A 1JVPP 4O0TA 4QP9A 3O7LD 3UVQA 4X2NA 5HO6A 4F1OA 3MPAA 4BKYA 4FF8A 3WF6A 2OBJA 4YTHA 1H1QA 5JQ5A 3PA4A 4B9DA 1YXVA 4F0IA 5E92A 4QTEA 2OJGA 2J9MA 3VWAA 1YHVA 3POOA 3RMFA 3BIZA 4TKSA 5IQAA 1OKVA 2JLDA 1H4LA 5ANOA 5HE1A 4M8TA 2DQ7X 5LWNA 5HZNA 2XKCA 3EN7A 1YWNA 2NPQA 1WVXA 4O0SA 3AC8A 4RSSA 3CKXA 3TJDA 5AUYA 4IANA 3GU5A 3OF0A 2JIIA 4IXPA 3GC8A 3O0GA 5E90A 4S31A 5HG7A 3W2SA 2VV9A 3UQCA 5ANKA 4O91A 3UG2A 4DITA 3P08A 2PZPA 3ZOSA 2WTVA 3UODA 4R7BA 2JFLA 4RFZA 3KCKA 4L46A 3VUMA 4QMLA 4MAOA 3B8RA 4AT3A 1Y6AA 4DBNA 4FOCA 5DWRA 3O50A 5AIKA 2FSMX 3SA0A 3O23A 4BCKA 4EH5A 1L3RE 4HYHA 5B2LA 3I6WA 5CEOA 1Z57A 4UZDA 2DYLA 3FZOA 3IW4A 4CTCA 3R8PA 2BHHA 3RINA 3O7LB 3F7WA 2R3PA 4L42A 3NUAA 2V0DA 4O83A 5E8UA 5M55A 1AD5A 2VGOA 2X0GA 4JRVA 4OW8A 4HCVA 4R6VA 2ZM3A 5L6WL 3V04A 3UQFA 4CD0A 2OIDA 5FWKK 3PA3A 4EK5A 2J51A 2R3RA 2VTPA 4IJ9A 5E8SA 5AAGA 3CLYA 4IBMA 2ONLC 4RWKA 4O22A 5AP5A 4EOOA 2GQSA 3QZFA 4JR3A 4JQEA 4APPA 2C5VA 5AAEA 3ATTA 4LMNA 4JG8A 3Q9WA 2P2HA 3QRIA 3F5UA 3VUHA 3ORTA 2XRWA 4J53A 2BILB 2YJRA 5AA9A 4FKRA 4RLLA 1L8TA 2ONLA 1CKJA 5BVWA 4EH7A 3Q53A 1Q3DA 1OKZA 1DAYA 3DBDA 1OM1A 2ZOQA 4FICA 2OK1A 3H0YA 3I5ZA 2C6LA 3UMWA 4QMZA 2O63A 1H0WA 3FZPA 5AV4A 2NO3A 3O8UA 4XEYA 3KB7A 3OD6X 5L2QA 2WELA 1NVQA 4PWNA 3JY9A 4CZUA 2WNTA 4AW2A 2E9UA 2FB8A 4KINA 5IISA 5CVHA 2VU3A 3EIDA 4EUTA 2NNWB 4M3QA 3PRFA 4ZY4A 4U7ZA 4YJNA 4O7LA 4PMTA 3MB6A 5JGDA 2YCFA 5AP3A 2RF9A 4C58A 1FPUA 1K2PA 4X0MA 4EOJA 3RNYA 3QUPA 2CKEA 3JPVA 4EQCA 4WNKA 3ZEPA 3UJGA 4C4EA 5BVNA 3L1SA 4PPCA 4I20A 5IG1A 3LM0A 4TWNA 5C27A 2ITPA 4QYYA 4GJ2A 5CNNA 4FSWA 5E91A 3JXWA 4ERKA 3NMUF 5BVOA 3SVVA 3FQHA 4YTCA 2EB3A 1PMVA 2WZJA 4JI9A 3F7ZA 3OXZA 2BAQA 4JDJA 3PSBA 4B0GA 4DFLA 5CI6A 1VZOA 5DI1A 2JC6A 2PHKA 2W4KA 4RG0A 2GNHA 2QU5A 2J0LA 1PMUA 4DG2E 1M7NA 2XZSA 5FXQA 2Y4IB 3MFUA 4GS6A 2O2UA 5KMIA 4RWLA 5TF9A 3R63A 3WOWA 2XK7A 4IQ6A 5CXZA 3AD4A 2GDOA 4F09A 4I5PA 2PULA 4DEBA 2J4ZA 3TDVA 4W9XA 2YIQA 4K0YA 4TYGA 3V8SA 4CFVA 2UUEA 3W10A 3MB7A 4XS2A 4FT3A 2YIRA 2EXMA 4C4HA 2XM9A 3F5XA 5DIAA 2X6DA 3OTUA 2F9GA 2JKKA 2PUUA 2ITTA 2XJ1A 4DN5A 2HXLA 2IJMA 2YIXA 3SXSA 5C8KA 5L2IA 4NCTA 3NW5A 2HY81 4GT4A 2XK8A 5HGIA 2P33A 5I9YA 1ZY5A 3FLYA 3QFVA 4KIKA 4ZIMA 3T3UA 3BPRA 4BTMA 5AFVA 1YW2A 4FKLA 5CSHA 4O1OA 3ZZWA 3QQKA 2VZ6A 2F7ZE 3CD8A 1O6LA 4QTBA 3GGFA 3FPQA 2JITA 3BBWA 1IASA 4AP7A 3F3UA 4BDIA 5I9XA 2W4OA 2VWUA 2P0CA 3UIMA 5HCZA 5FTOA 4PMMA 4RIXA 3CQUA 4YJRA 2HZIA 2J5EA 3ZM9A 3PSCA 4ZJIA 4RIOA 3E88A 3LJ0A 1PXNA 4O0YA 3D5VA 5J87A 4KUJA 2BVAA 3AXWA 3MS9A 4RWJA 4E6CA 2XKEA 2ZDTA 4OUCA 5M09A 3HKOA 1T46A 3QL8A 5M51A 2YDJA 4ID7A 3OG7A 3F2AA 2W06A 4XOZA 5EK7A 3U8WA 4EORA 2WFYA 5J8IA 4BKJA 4FVQA 2J0KA 2YDIA 1Y57A 3GU4A 4QTAA 2GFSA 2ITUA 5GIPE 4YSMA 5CENA 4EHZA 2HOGA 4K9YA 4NW5A 4OGRA 3VULA 5KHWA 3NNWA 4Q9SA 3R7IA 4FIHA 4BTJA 3N4TA 3PLSA 4WBBB 5IQGA 5HORA 4IZAA 1NY3A 3KK9A 4FNYA 4MXAA 3BHYA 3ODZX 4JL9A 5DG5A 4ORKA 2VWVA 4RA4A 4NW6A 3ORZA 1PKGA 3PJCA 2WMUA 4S30A 3KRXA 4C3FA 2PL0A 1FOTA 3KF4A 1KWPA 2UZVA 2ZM4A 1CTPE 4JBOA 4AGUA 4GKHA 2R5TA 3KXGA 5A6NA 4BCHA 2E2BA 1JOWB 1BMKA 4FSUA 3ZFYA 4FVPA 3HDMA 3QYWA 2RFSA 3P7CA 4Y46A 3NGAA 4CFFA 4O84A 3TWJA 3CBLA 4QP8A 4WUNA 5DH3A 3FKLA 3P78A 4F6WA 2QG5A 4DCEA 4CXAA 4GT3A 4YPDA 3L8VA 5D12A 2UW9A 5JK3A 2PVFA 3D14A 3EKKA 1G8SA 2JGZA 5C9CA 4IFCA 1T45A 3VO3A 5H9BA 4YTFA 1GZOA 4EH3A 4L00A 4AF3A 4A4LA 4RZWA 4I0TA 5FP5A 4E5BA 4QPSA 2VTIA 3AC5A 3FV8A 3OCSA 5M44A 1MUOA 4U79A 2W99B 2FGIA 3VUDA 3MJ2A 2DWBA 3A8WA 4MNEB 3S95A 4CMTA 4IB1A 4UV0A 4YJUA 1XH8A 5CU4A 3CP9A 5JFVA 1M2PA 1LPUA 3I60A 3ZFXA 3EZVA 3ZSHA 3ZRLA 3QA0A 3TKHA 4KIPA 2GHMA 4QMOA 5F4NA 2CNVA 4BDEA 3DXNA 3AC4A 4GIHA 4M15A 4O2ZA 4XP3A 2WIHA 3TV6A 2V5QA 3KKVA 5L8KA 4BCGA 4HNIA 1QMZA 4JDHA 5L6OA 4IC8A 2W96B 2KULA 4DHFA 2ITWA 4LOQA 2YZLA 1UVRA 5LWMA 3TV4A 2PVLA 2WQNA 5AV1A 3DAEA 1GZKA 1KV2A 2GNFA 4I3ZA 4TW9A 2A1AB 1PXMA 1UWHA 3FZRA 3E8EA 3LLTA 1TQIA 4AU8A 4C59A 2J6MA 3A99A 3QBNA 5IQEA 5BUEA 4IM2A 4ARKA 2Q0BA 2WGJA 2ZYBA 3VS6A 5IMEA 1W0XC 2HCKA 5FTGA 1YWVA 3W2CA 2JKOA 2GNIA 2R3LA 4TYEA 5DFPA 3VQUA 1BX6A 3TUDA 2W1FA 2BDWA 4GT5A 3RPSA 1IR3A 4A06A 3IDBA 3IDPA 4KAOA 4KS7A 4RPVA 3RPRA 1M14A 2YWVA 5JN2A 3QALE 3O51A 3UNZA 2QNJA 4O27B 4XCUA 3UIBA 3GOKA 2VTNA 5ANGA 1PYXA 5FTQA 3VQHA 5L4QA 1JSUA 4G31A 4DEGA 4UYAA 1OITA 3DQWA 1RJBA 3II5A 3TTIA 1WBNA 2Z7LA 3KVWA 5AM6A 3O17A 3W2QA 1F3MC 2W1HA 5HU3A 4MTAA 1PXLA 4QMVA 4IX3A 2FH9A 5AV2A 2WD1A 1WCCA 3PP1A 2EUFB 4JBPA 4I6FA 4NTSA 1NA7A 2AUHA 2WO6A 4DBXA 5E1EA 4BCQA 3VS2A 4C2WA 5JFXA 3VUKA 1PYEA 1NXKA 5I9UA 5DYJA 3RK5A 2YN8A 4HNFA 4DEAA 4MNEA 3POZA 3OUKA 1MQ4A 4FL2A 4YZDA 4EOMA 3ACKA 4FSTA 3GCQA 3DK7A 4R3PA 3WYXA 4JX3A 4HZSA 2QONA 3V5QA 3OXIA 4FV6A 5BYZA 5JKGA 4FG7A 4FV3A 3DOGA 5CY3A 4GEOA 1B39A 5DA3A 4EBVA 5CSXA 5IMXA 3VF8A 3FMNA 4QO9A 3UOHA 3VUIA 4GYGA 4W4VA 4HVHA 5JT2A 5HVYA 3JY0A 5FD2A 4C35A 2VTSA 3QTXA 1Q4LA 4XV1A 3DV3A 4ZLOA 3M42A 2PZYA 5HBHA 4DFZE 3UO5A 2IVVA 3D7TB 3QTUA 1U54B 4UALA 3WZJA 2IZTA 2WQMA 2GNLA 3R21A 4GFGA 4G3CA 4HCUA 1UNHA 4K6ZA 2RFDA 3P9JA 4EOKA 5HU9A 3RK7A 1ZYCA 3PTGA 4RJ6A 4AFEA 1YOMA 4E3CA 2YM8A 3F88A 5HE2A 5I4NA 5AUWA 1PF8A 4O38A 1OL2A 3NUXA 4AZSA 2C0IA 2UVXA 1I09A 3FWQA 3Q4TA 2WMSA 4RVMA 2XNEA 3DDPA 5LVLA 3FQSA 5AR7A 4FV1A 1OECA 2UVYA 3R1SA 4XG8A 2ZDUA 4CLIA 1SYKA 1WBSA 3PPKA 1VEBA 4WKQA 1GNGA 4OR5A 2BMCA 1AQ1A 4YU2A 2NP8A 1KOBA 3ZZEA 4F7JA 4C4FA 5CVFA 3OOGA 4ZY6A 4CG8A 3R1NA 4ZZMA 4ANMA 1ZYJA 3D7TA 2QHMA 4F99A 4ZTSA 3AT2A 3K3JA 3FJQE 4D5KA 3ALNA 3LXPA 2C5YA 3VS7A 5DEWA 5IA3A 3FI8A 5L3AA 4CG9A 2CGWA 5LJJA 1PXOA 3W1FA 3Q60A 4D55A 5IUHA 4F0GA 1M2RA 2B9JA 2GCDA 2CJMA 3HNGA 4EZ3A 1PKDA 3U54A 3Q04A 4YLLA 5JEBA 5AEPA 2PVHA 4XH6A 5L2SA 2WEIA 3VBVA 3DNDA 3MVMA 4C38A 3SRVB 5BPYA 4QP7A 3W16A 1VYWA 2OWBA 4M0ZA 2OW3A 5EDPA 2XIKA 1J3HA 5KBQA 3QQFA 2OJ9A 4ZZOA 3C9WA 2QG7A 3P0MA 4RMZA 1W7HA 3EJ1A 3BGPA 3VF9A 1Q41A 3PIYA 4L68A 5EFQA 3GQIA 3GQLA 2JKMA 4I6QA 3FEGA 2P55A 2QKRA 2WTWA 1KE5A 2XK6A 4KIQA 3GP0A 2CKQA 3T3VA 3S4QA 3NNUA 2CDZA 5LVNA 3R8LA 4L6QA 2CNUA 3HV6A 4BDJA 3W18A 1A06A 2ITNA 4J71A 4XUFA 4FTQA 4FTUA 3T8OA 5LVPA 3QD0A 4BIBA 2UW4A 2X9EA 3HA6A 2C6TA 4RVTA 3HMPA 3KRLA 5D9HA 3WZDA 4D58A 4NWMA 2QC6A 3PG1A 3C4CA 3QKLA 3QTIA 2VX0A 4IX4A 5EW3A 5IA4A 5KX8A 3ORPA 1VYZA 4RC2A 4ASEA 2F7XE 2Y6OA 4QYGA 4CFUA 4U45A 4ZP5A 3QTQA 1OL7A 4XV9A 2B52A 2C69A 4AGWA 4I94A 3TEIA 2BALA 2Z2WA 2YM5A 3CTJA 3FZSA 2VNWA 2GPHA 4HGEA 4QMQA 4GKIA 1UNLA 5EKNA 1SNXA 1OL6A 4Z3VA 3V51A 3BEAA 3TIYA 4H3PA 3ITZA 3R02A 2QO9A 3NYNA 4ZSGA 4IAAA 3UVRA 3LFEA 4IADA 4AG8A 1Y8GA 3NCZA 4LG4A 3GEQA 4RX9A 4UX9A 1YVJA 3HAVA 2YA9A 2YJSA 2B54A 1FGIA 4DGNA 3U55A 4G9RA 5HCYA 4UZHA 5ANIA 3MFTA 4YZ9A 1OMWA 2RFNA 4FG9A 4E8AA 1U54A 4MD7E 4G6LA 4IB3A 3ZXZA 3FYKX 5HLPA 3KMWA 3IOPA 4YP8A 3OFMA 4U3YA 1OB3A 3E5AA 4TWOA 3RM7A 4UMPA 4Z16A 5IU2A 2UZUE 3NDMA 3WBLA 2F2UA 4FL1A 3RAKA 3KXMA 2UZWE 2WMBA 5HIEA 4CV8A 5A4TA 2X1NA 3EMGA 4ACGA 3IG7A 3P5KA 4D2RA 1XBAA 4O0UA 4RIYB 4CTBA 2R7IA 2YACA 5GZAA 1FINA 3QD4A 5EI6A 2C6KA 4N57A 2OO8X 4IMYA 4QD6A 4M12A 4QMMA 3NSZA 3CTHA 5GJGA 5AUUA 3DPKA 1G3NA 3QTZA 4O0WA 4NH1A 1P4FA 4E20A 3KULA 4V05A 2Y0AA 4CEGA 4EZ7A 5HKMA 2BRGA 4CKJA 1ZWSA 4RA5A 5FG8A 2O3PA 3PYYA 4DE4A 1M2QA 1KSWA 3VNTA 4QP2A 3OBJA 3OWLA 4TZRA 5EQYA 5K5NA 4QP1A 3O8PA 4YBJA 4JQ8A 2IW9A 3QCYA 1GOLA 2WU7A 3AGMA 3V5JA 4G6NA 4I41A 4IIRA 5E8TA 5A6OA 2X9FA 3EN9A 3LCKA 4L8MA 3U4WA 5LARA 2XRUA 3BYOA 2VTMA 2B4SB 3WF9A 4BDBA 2WQEA 4BICA 3PIZA 3A60A 4IAFA 3LIJA 1XH9A 2OKRA 2VWYA 3LM5A 5FBNC 4IWPA 3SXRA 4IM3A 3RGFA 3NUPA 2H9VA 3UP2A 1XH5A 3U87A 5DN3A 4MHAA 2ITOA 4BI0A 4FA2A 3TN8A 2CNQA 4ALUA 4RX8A 3RM6A 4AACA 1YHWA 2Q83A 3NYXA 2WTDA 3UMXA 5JH6A 1NT2A 1WVYA 3OTVA 3R2YA 4C3PA 2HZ4A 2VTHA 3HV4A 3L8SA 3G2FA 3MGYA 1LP4A 4E93A 5HQ0A 1KE8A 2O64A 4QMSA 4YNOA 5J5TA 4JJRA 3N4VA 5EM7A 5B0XA 4D28A 4BFMA 1PHKA 3OY1A 1QL6A 4AZVA 4MXXA 4GUEA 3BGZA 4F1MA 3UBDA 5AR3A 4BWKA 1PMNA 5AX3A 1BI7A 3QX4A 4FEQA 2PMIA 5J1WA 3ZLXA 5LQFA 2OF4A 5IQCA 3S3IA 3QD2B 2PZIA 4FV9A 4HYSA 3A61A 4C3RA 3RCDA 2PYWA 4NK9A 4HCTA 2R3NA 3QC4A 2G15A 4PTCA 5DEYA 5EDRA 3MTFA 4I92A 4MF0A 3TIZA 1H1WA 4ZTQA 1MQBA 2WTKC 3E64A 3RPYA 3Q6WA 2XNPA 3V6RA 4HVGA 3DK3A 4L43A 4X3FC 2OJJA 3FAAA 4UB7A 3NX8A 5CZHA 4DG0E 3PG3A 5HBEA 3MY0A 3IW7A 3Q52A 4U42A 4PY1A 5K4JA 4DH5A 4D4SA 3LZBA 5A4QA 4P5ZA 3THBA 3FMJA 2ETRA 3HV7A 3QYZA 3BU3A 3ROYA 2XBAA 2EVAA 4AAAA 1R1WA 5CU2A 3RK9A 3LFSA 5KMMA 2X81A 2VGPA 1NW1A 2RSVA 3DLZA 3LFQA 3KREA 3UG1A 2R3IA 3F3WA 4JS8A 4PL4A 2WMAA 2WQOA 4MNFA 5E8WA 4M66A 3DKFA 4M97A 4Y85A 1CDKA 4E6DA 3I0OA 3SD0A 4M69B 4XV2A 3ZTXA 2X4ZA 3UO6A 2GU8A 5F1ZA 4I22A 1PJKA 2V7AA 3QKMA 4QMNA 5M4CA 1SMHA 4E6AA 4Y5QA 2G2FA 3NW6A 2V55A 4OBQA 4TY1A 4DTAA 2UW7A 2X7OA 4BDKA 2CN8A 4DFXE 2GS2A 4D1SA 2F49A 4CRSA 4FSQA 1FVRA 2W17A 4E6QA 4CVAA 1HOWA 4MBLA 3HAMA 1OIQA 4QMYA 4KWPA 2C3IB 2IVUA 4EQUA 4YLKA 1YKRA 2C1AA 3WF7A 2C6DA 4H1MA 3K2LA 4RIWB 5H8GA 4GFOA 3CC6A 4D9UA 4FGRA 3C0HA 5JFSA 4O7SA 3VS3A 3MVJA 5FBOA 2OIQA 3B2WA 4WA9A 2YEXA 1ZMWA 3MIYA 4XP0A 4EKKA 1SZMA 2G9XA 3QTRA 3FY0A 3ZCLA 4FKPA 5LMBA 2Z7SA 4S34A 4NYEA 5BYLA 1SVGA 4KSQA 4MCVA 2BTRA 3CR0A 3DY7A 4IHPA 4DT8A 3BRBA 3KY2A 4E1ZA 1YXSA 5CEMA 2SRCA 3U51A 4NUSA 3HMIA 2ITZA 4TWPA 4BHZA 1IAHA 2OXYA 1VJYA 2OU7A 2XNMA 4FTKA 5EG3A 4QQCA 5HEZA 1YXXA 4M67A 2UZDA 4QMXA 3TNQB 3O8TA 3G5DA 4NJ3A 5HI2A 5LCJA 4BR3A 2RGPA 4AOIA 2WTKB 1HCLA 2VTTA 4R5YA 4FZAB 4B4LA 4BZNA 2RL5A 3C0IA 1Q3WA 4K33A 3TZ7A 4FEWA 4F6SA 4FV8A 4IZYA 5FXRA 1Z9XA 3LJ1A 4PL5A 2HZNA 4RT7A 1URCA 2O65A 5J7BA 3R22A 5AA8A 3HLLA 4XRLA 5DR2A 1UKIA 4JVGA 3NRMA 3P1AA 5HTCA 3KN5A 4IAZA 4DGOA 1CMKE 5BVDA 3PXRA 3OWPA 2OXDA 5IPJA 2YM7A 5IA2A 4U40A 5DT4A 3MV5A 3QXOA 3TUBA 2YLEA 3EQBA 4V04A 2A0CX 2I0HA 3PUPA 3ZSIA 4EHVA 3D2IA 3GU6A 5FXSA 5ICPA 4PF4A 5GHVA 3BZ3A 4KBKA 4GU6A 2YIYA 4FX3A 4G3GA 3Q9YA 5EDQA 4EOQA 5B2MA 4DA5A 1IA8A 4TRLA 4GUBA 4BYJA 3IGOA 4O7RA 4ANNA 4FEXA 3GCSA 3R71A 2B55A 5EOLA 4ZSJA 1PXKA 3FMMA 4FYNA 5CS6A 3BWFA 3ZLSA 3SKCA 2WEVA 4R78A 1Q8TA 4G3DA 3CQEA 5DRBA 4ZTNA 4HOKA 2X7FA 1V0OA 4AXAA 2ZV7A 1ZZLA 3TZ9A 3PPJA 2P4IA 3KK8A 3E8NA 4EH4A 5M06A 2CPKE 3HZTA 3QRKA 3R8ZA 3DJ5A 3FSFA 3ZC5A 4UWYA 3TZ8A 4BIDA 3QCQA 4DG3E 4YURA 4NL0A 4BCJA 5K9IA 3AT4A 4AA5A 2YHVA 2O5KA 5EM5A 4P5QA 3UOJA 2P2IA 2VO7A 2KTYA 4FR4A 1OL5A 4EK3A 5A14A 1OBGA 1PMEA 2JIVA 4TL0A 4G3FA 3MY1A 3FC2A 3PIXA 4M14A 5CZIA 2VWZA 3ET7A 4FTIA 3QUDA 2CSNA 2YM6A 4PTGA 3EQRA 1YI4A 3UE4A 4F9AA 3ZMMA 4BKZA 3LKMA 1UV5A 4LL0A 4YGAA 5CYIA 3EHAA 3EZRA 1CKPA 3AOXA 4AS0A 4USFA 4X2KA 1FMOE 4D1XA 3LMHA 4FKIA 4S2ZA 2R64A 3CCNA 3PVGA 4EQMA 3FDNA 5EW8A 3VW8A 3IOKA 5HD7A 3RPVA 3FBVA 3G0FA 3NS9A 2ZV2A 3BE9A 3GU7A 3LFFA 5DHJA 4QT1A 4C0TA 3RALA 5T3QA 3H30A 2E9NA 3OCTA 3ODYX 4Y83A 5IUIA 4W8EA 3PP0A 4ZLZA 3KMMA 3KULB 3MH2A 4L3LA 3ALOA 3FZ1A 2X2MA 2OFVA 1XR1A 2CGVA 1ZMVA 4JIAA 4H58A 5CSVA 1O6KA 3OC1A 5AUVA 4APCA 3RNIA 4ZXTA 3WIGA 3COKA 5K0XA 4WNOA 5HE0A 2QOHA 3HRCA 4FIIA 4PMPA 3R9DA 5A4CA 2R3OA 2W1GA 2XCHA 4FTCA 3FLZA 4LI5A 5E8VA 2I0VA 5CVGA 5AR5A 3R9NA 2BFYA 2GQRA 2C4GA 2JFMA 4AZEA 4CFWA 4QPMA 4C4GA 2J50A 3EFWA 1DI9A 1YWRA 2B1PA 2YABA 3I7BA 4OT5A 5FGKA 4FV5A 4B6LA 3O2MA 1JPAA 1REKA 2I0EA 3FZTA 3CY3A 3KRJA 3PSDA 1JKLA 2Q0NA 3QUEA 3BI6A 2WMQA 4I93A 5EHLA 4AX8A 4I4FA 2WQBA 4E7WA 4D2PA 5IH6A 4YC6A 5KMNA 2HW6A 3I7CA 5ACKA 5GJDA 4OAUC 3DB8A 4GVJA 4FTLA 4ONAA 3AD5A 3E63A 4IH8A 4Z7HA 4EKLA 2PY3A 5KHXA 3HUCA 4M69A 5HLWA 2BHEA 2R3QA 3BHVA 3LVPA 3GNIB 3F6XA 4LFIA 3QKKA 3LHJA 4TNBA 5KZIA 2CLQA 2JAMA 2W1CA 3E8DA 3EOCA 5CF4A 1JKKA 4I4EA 4XG3A 4AZWA 3I79A 3HECA 4F63A 3A7IA 3LCDA 4GYIA 4WRSA 2YM3A 4X3FB 3TM0A 1KE9A 2QKWB 1NVRA 4ANSA 5A4LA 1PW2A 4FTRA 1KE6A 3QCSA 3WF8A 2R3JA 3Q4ZA 3IECA 4ZSEA 4L44A 2OH4A 4JR7A 4TXCA 3D83A 2XKFA 3G15A 5IQFA 2V22A 3A7JA 3NIZA 4FV0A 2YITA 4KRCA 5KZ0A 4AW0A 2QLQA 4HW7A 1FGKA 3VRYA 5AM7A 5IA0A 2W4JA 3EQHA 3LQ5A 4FTNA 5DMZA 5HESA 5FUTA 4YBKA 5HE3A 5TKDA 3FI4A 1M52A 3Q2MA 3HRBA 3NR9A 4YHFA 4YC3A 3B2TA 4P7EA 3EFJA 3AC3A 2VX3A 4GIIA 5HNGA 4CLJA 5M57A 3PVWA 1JKTA 4DH7A 2QOLA 3AC1A 5ANDA 4D4RA 4F9WA 3EQFA 3UPXA 4PX6A 4MXCA 2XMYA 4QPAA 4WBOA 5DPVA 1XBCA 2R3HA 3ELJA 5DVRA 1Q8WA 4GH2A 5ETCA 4C62A 3FXWA 3DAKA 4RIWA 1KE7A 5HBJA 3HV5A 5CEIA 4ACHA 1I44A 4U44A 4OTDA 3SQQA 1WBOA 4YMJA 3DU8A 4MBIA 4O0VA 3FLSA 3D5XA 4RIYA 2Y9QA 1GAGA 2G2IA 5GJFA 2ERKA 5JZJA 1TQMA 3UOKA 3BCEA 3M11A 3DJ6A 3PY0A 3Q2JA 3NW7A 4J8NA 5ETIA 4BBMA 2PVJA 1IA9A 1U5QA 4Y95A 3R9RA 2QR7A 2YAKA 4CKIA 4UN0C 3HV3A 3UPZA 3N9XA 3R30A 2XEYA 4F70A 2R9SA 5LOHA 3D5UA 1PXPA 4G16A 2YWPA 4RJ5A 2BCJA 4DEHA 5E4HA 4LGGA 2WMTA 3H10A 5CF5A 4UBAA 4RQKA 4CRLA 3PE1A 5CEQA 4D1ZA 4EL9A 4EOLA 2QURA 2HELA 4ZJVA 3TKIA 4CQGA 4E73A 2IZSA 4CKRA 3MVLA 2BAJA 3ORXA 4WUAA 4AFJA 4BCPA 4O7NA 4R3RA 4H39A 3GCPA 3EL8A 5IH5A 5I9WA 4U80A 3QQGA 4WNPA 3RAWA 2JKQA 5IA5A 4G2FA 3W8LA 5EQEA 2GFCA 4D0XA 4C33A 3M1SA 3KXXA 3S00A 2CKOA 4FL3A 2UW0A 2VX1A 4I21A 5ITAA 3R9OA 2CN5A 4JLCA 4IAIA 2ZMCA 5AV3A 4B99A 3HDNA 1MRYA 2XP2A 3OZ6A 2A4LA 2OZAB 1WMKA 4JNWA 4NIFB 4Y72A 3ZO3A 4ZMEA 1OPKA 1UWJA 4AGDA 3OXTA 4A9YA 4U6RA 5K0KA 3FXZA 3ZEWA 3ZC6A 3SV0A 1Q8YA 1XJDA 4BDAA 2AC3A 1XH7A 3EN6A 4DCAA 5KKRC 3KF7A 3V3VA 2XIRA 3RZFA 2IW6A 3QWJA 3VBTA 3ZYAA 5IQDA 1Q8ZA 4Y8DA 4O81A 3V01A 3E3PA 2BKKA 1R0EA 1XHAA 2JEDA 3C50A 3NUUA 2ZVAA 4O7ZA 3BQRA 1BI8A 4D2SA 2XNGA 1WBVA 2JDSA 4RJ7A 5E7RA 3Q96A 4R7IA 3DTCA 3LFCA 4FI1A 3NUSA 3QHWA 2FA2A 2I6LA 4A7CA 5FP6A 5CALA 4DEEA 5FRIA 1JAMA 3W55A 4IAKA 5BUJA 3JVRA 2C5NA 4UMRA 3ZU7A 5K3YA 4BC6A 3QRUA 2E9PA 2FYSA 1XO2B 3PY3A 3QZGA 3LFBA 2GTMA 4RLKA 2XNNA 3F5GA 3ZO2A 4CFNA 2Y4PA 3U9NA 4NIFA 3PPZA 2XKDA 4PUZA 3V6SA 3GC7A 2DUVA 3KEXA 3ANQA 5TO8A 3VBYA 2WMVA 3DFCB 4LV5A 4MF1A 3R7GA 4C34A 3L9MA 5JSMA 4UEUA 3EL7A 1UU9A 3OW4A 3C1XA 3QZIA 3R0TA 3LFAA 3NYVA 2XS0A 3CPCA 2IVTA 4KKGA 4PP9A 4XLIA 4XMOA 5DGZA 4FSYA 4XG6A 4ANBA 4CSVA 5JGAA 2VWXA 2PE2A 3MH1A 4DC2A 4IACA 2OICA 2FUMA 3PJ3A 3R8UA 2Y8OA 4C8BA 3ULIA 3UP7A 1SM2A 1UU7A 1APME 3R9HA 4DFNA 3Q9XA 4WG3A 4E26A 4CT1A 3NPCA 4DH1A 4FNWA 2HXQA 2UW8A 3RI1A 1QCFA 3MDYA 3KVXA 2PWLA 5GINE 5LMKA 3EYGA 5ANEA 4BDGA 4P90A 4QMWA 3V5LA 4H3QA 5F95A 2HIWA 2QO2A 4L53A 4YZCA 3DXQA 2R2PA 3TCPA 2B9FA 5L2WA 3W33A 4EOSA 5D41A 3FMEA 4RIXB 1IRKA 5CAVA 1HCKA 3P86A 4G1WA 2WMXA 5EYCA 4EEVA 3A7GA 3EN4A 3ZH8A 4AE9A 2ETMA 3R28A 4M84A 4XG2A 1OBDA 3G6HA 4GU9A 3KN6A 4O0XA 4B8MA 3C5UA 4O7WA 5I3OA 4DINA 2JD5A 4I24A 4K8AA 3ORKA 4I23A 3CTQA 3BYUA 3D94A 2O8YA 3OOMA 5EH0A 4O6LA 3LPBA 3OUNB 1R39A 4RQVA 2C30A 1URWA 3CGFA 3G9NA 3EYHA 1H8FA 4J98A 1REJA 2B9IA 4D9TA 2I40A 3MY5A 2R3FA 4MBJA 4P4CA 3D15A 3MA3A 2C3KA 1H00A 5C03A 4YO6A 1ZYLA 1FQ1B 3V5PA 3LCOA 4ZSLA 4U41A 3IPHA 3OCGA 3L9LA 4N6YA 3MH0A 5DRDA 4OT6A 3IO7A 3IS5A 5EHYA 2ESMA 5KMJA 2PUPA 3DXPA 3BE2A 1O6YA 1ERKA 4FYOA 2VO6A 3P7BA 3DBCA 3DS6A 4GG7A 2C6OA 4G9CA 4IEBA 4PV0A 4IVAA 1H07A 4W4YA 2BPMA 4QNAA 3UYTA 4DFUA 2QU6A 3C4FA 4KS8A 3TTJA 4B8LA 3FI3A 2C6IA 4NM7A 3C4WA 2WMRA 3QGWA 4BGGA 1XH6A 4D0WA 3HRFA 5C4LA 4FV2A 4O0RA 4X2GA 4ZEGA 3LQ3A 2FSOX 3U9CA 4FKOA 5M53A 4IB5A 1YI3A 1VR2A 3FLWA 1Y91A 3DBQA 4L7FA 3FMDA 5IUGA 1SVHA 5KCVA 3MPMA 5HICA 4TYHB 5JRSA 4IE9A 5FEEA 4FT9A 2XUUA 5KMLA 5IEXA 3OWKA 3PXYA 4FIEA 3KMUA 4G34A 5GNKA 3ENHA 4BB4A 2IPXA 3KL8A 4PRJA 1JLUE 2CCHA 2VNYA 4QYHA 5D7VA 4DGLC 1YDTE 5LCKA 4DTBA 4FTAA 2B9HA 2F57A 3BEGA 3FI2A 1OKWA 5DLSA 4R5SA 4FZDB 5IF1A 3PLAE 2GS7A 1P5EA 2QOFA 3OCBA 2C5OA 2J0IA 3HP2A 5H8EA 3EN5A 4ITJA 5BVEA 5M07A 5CAPA 3UYSA 3I4BA 4LRJA 4NKSA 4BVUA 2BAKA 4MVFA 4FKUA 4W4WA 2J0JA 3F2RA 2F4JA 4ZY5A 3ZFMA 3QTWA 1Q8UA 2XBJA 2IN6A 5J7HA 4RJ8A 5JGBA 3QU0A 2YAAA 3ORLA 4CCBA 3DZOA 4IX6A 2VTQA 3DA6A 4AW5A 3BYVA 4N4SA 4MEDA 5AP7A 4D2VA 3NVMB 3H4JA 4BY9E 4CV9A 3LMIA 3ETAA 5BQ0A 3M2WA 3F61A 2GNGA 3Q4CA 5DT0A 4USEA 5A46A 3DK6A 2BDJA 3BV3A 2HY0A 3PY1A 4O6EA 4GJ3A 2YDKA 3A8XA 3LCSA 3GVUA 5J79A 5JQ8A 3VS4A 1H25A 4L01A 3Q3BA 3GT8A 3QC9A 3LAUA 4FVRA 3C4XA 3SHEA 3ZRKA 5C4KA 3E8CA 4OBPA 3C4EA 2ZM1A 2VTJA 3WIKA 4L7SA 5EYDA 4HVDA 2HAKA 5HG9A 2BFXA 5D10A 2FSTX 1G5SA 3SRVA 4ANQA 3UNJA 4EK6A 5L2TA 4HYIA 4V01A 1H1PA 4FT0A 3QF9A 4IB0A 4NU1A 3RPOA 4C61A 1Q5KA 3OY3A 5F20A 3G6GA 3MFSA 4FZFB 1BUHA 4QOXA 2CGXA 3AMAA 4PNIA 4MXZA 4XBRA 3DKCA 3D5WA 4JG7A 5ANJA 2C68A 4YJQA 1UKHA 3PXFA 1A9UA 2WTIA 4L3JA 2PVNA 3DQXA 5I9ZA 3DZQA 4NM5A 3PZHA 3W8QA 4U0IA 2Z7RA 4D2TA 5FM2A 1Q97A 3V8WA 1IEPA 4V0GB 3TI1A 4E5WA 3KC3A 4MX9A 1GIIA 2YLFA 4W8DA 2P3GX 3C7QA 3Q5IA 1H27A 5KUPA 1JBPE 3RHKA 5BMSA 4GW8A 4D4VA 2WOTA 4GK4A 1YOJA 2XA4A 1YQJA 5CASA 1H1SA 4FIJA 2JDVA 3FYJX 3DLSA 2C0TA 1Q99A 4BZOA 3U6IA 3SG9A 2ZB0A 3PJ1A 3W2PA 2B0QA 2BRBA 5FEDA 2GTNA 2OJFE 4GVAA 4NFMA 4CYIA 1J1CA 3EB0A 3FXXA 4YO4A 4F64A 2BKZA 2QLUA 3A7HA 5KMOA 3DB6A 5J1VA 4HZRA 5LXMA 5L8LA 2PSQA 2XNOA 3GENA 1BL6A 1PXIA 1KUTA 3MPTA 4A07A 3P7AA 2JDTA 2CKPA 4J97A 1TKIA 2YIWA 4AA0A 4DEIA 4O82A 3WZUA 4J99A 2QCSA 2I7QA 4FZ7A 2VAGA 4F7SA 4FT7A 4X3FA 5J5SA 3O96A 5AUXA 2IG7A 1JNKA 4LGDA 4R3CA 1ZOEA 3E3BX 4FV7A 1YRPA 5G1XA 5DR6A 4O21A 4FBXA 4A4OA 2QOBA 3EQPA 3QTSA 4KIKB 3KCFA 5DNRA 5KO1A 4JDIA 3BLQA 1Q24A 2ZB1A 3E7OA 1E9HA 5HX6A 4WOVA 3BHHA 3WILA 3TNHA 3BQCA 2HWPA 1P4OA 1B38A 3QZHA 3JVSA 4JOAA 4ALVA 2IVSA 4PNKA 4K77A 4QYFA 3SW7A 4H05A 4O7VA 2XK9A 5AP6A 5TOZA 4ZTMA 4JXFA 1P2AA 4HGLA 3BLRA 5CXHA 4EBWA 4EJ7A 3MTLA 3SG8A 4BWXA 2OJIA 4M68A 3LLAA 2QODA 2BRMA 5CLPA 3OEZA 5F9EA 4I1ZA 3C5IA 3E93A 3G51A 4AN2A 3GI3A 3Q9ZA 4A9SA 3D9VA 2WTCA 3VHKA 3QRTA 4PQNA 4R7HA 4ERWA 2XB7A 3CGOA 5IEYA 4ZTRA 3BHUA 4IWOA 4AWIA 4F7NA 1DS5A 2UW3A 4MWIA 5IQHA 4BBFA 3NUNA 4Q5EA 3UDBA 2I1MA 3TACA 4K18A 4YUQA 2W1ZA 3KFAA 1YDSE 3V5WA 3V8TA 4BTKA 2BTSA 3R7OA 2BRNA 4CFXA 3MESA 3MH3A 1V0PA 2HK5A 4G6OA 3FHRA 3HGKA 3MYGA 5CAUA 4MWHA 4FNZA 2XJ0A 4OTIA 2OF2A 4YSJA 3OP5A 3GXLA 3TZMA 1YI6A 2VTAA 4HGTA 1RW8A 1SVEA 5HTIA 2XK4A 3MA6A 3NWWA 3JR1A 4OTHA 3P23A 3U4UA 3ZLWA 5CTPA 3O71A 5E8XA 2WKMA 3BLHA 3QCXA 5H2UA 4KD1A 2OSCA 2F2CB 1AGWA 4KABA 4FSMA 4M7IA 4PPBA 3UC4A 3UVPA 3VVHA 5A4EA 5C1QB 4PL3A 2W7XA 2VTLA 2QD9A 3GCUA 4NTTA 5AP1A 1KOAA 2IWIA 3R8VA 5HO7A 1OL1A 2X2KA 5EHOA 5BNJA 2C3LA 4EC9A 3AT3A 1P14A 1IAJA 2JDRA 3AD6A 2F7EE 4EK4A 4EWHA 4QNYA 1ZLTA 3SLSA 4BIEA 3KGAA 1QPEA 4FTTA 1ZMUA 3C13A 4KBAA 4Y5HA 3BYSA 4DF3A 4DYMA 2R3MA 2J0MB 1WBWA 2UW6A 1GZNA 2ZV9A 3OWJA 4TPTA 4AN3A 4EONA 3VAPA 2UZTA 4QP3A 5J9YA 3R73A
chains in the Genus database with same CATH superfamily
4IJPA 4AQCA 4BTFA 1WFCA 3E87A 3LJ2A 3ZDIA 1X8BA 5HNIX 5CSPA 2R3GA 1E1XA 3FE3A 1OGUA 1OPLA 2XM8A 4LMUA 3O5AA 1LEWA 2E9OA 1H24A 2UW5A 2OZAA 4CGAA 4AW1A 4EJNA 1IG1A 2CGUA 3Q5ZA 2J2IB 3W2RA 3EQIA 4DH3A 2C47A 5J9ZA 1Q62A 2Y7JA 4IZ5A 4Q5HA 5AADA 5IEVA 3IW5A 5CF8A 3LFNA 2XVDA 3TJCA 4KBCA 3W0PA 1TVOA 4CZYB 3ULZA 2VWWA 3RAHA 5IQBA 4ASDA 4RX7A 4AOTA 4N6ZA 4AE6A 1QPCA 2RG6A 4UMUA 2JIUA 5HG8A 3R00A 3FLNC 3OW3A 4X21A 5EW9A 3B8QA 4F08A 4ACMA 4EZ5A 1O9UA 4ZS0A 4J95A 5C01A 2PMNX 4UWBA 2ITVA 3W0NA 3HMMA 2AEGA 3FQEA 2ITQA 3PJ2A 3EQCA 3RVGA 2PUIA 2WIPA 2RFEA 2WTJA 2X6EA 5FDXA 4FNXA 4OTRA 4DGGA 4OLIA 4EYMA 3RTPA 3COHA 3RAIA 4E4MA 1YDRE 1U4DA 4YJTA 4O86A 5CX9A 2CMWA 3NNVA 4RWIA 3VBXA 1W2FA 3QQUA 3RCJA 1R0PA 2A2AA 2ZV8A 4H36A 4RJ3A 1SNUA 3PXKA 3NNXA 4XG7A 2C6EA 2JBPA 3DT1A 2X8IA 4YC8A 2PE1A 3BGQA 5DR9A 3OMVA 3JYAA 4K1BA 4MQ1A 5HG5A 1F0QA 3KXHA 5AX9A 3SC1A 3QQLA 5CU0A 2UZOA 2GHLA 4O7TA 1KV1A 2VO3A 3UC3A 3CE3A 4IVDA 4UY9A 3L9PA 5T68A 1R3CA 4DLIA 3ZO4A 5CQUA 1YOLA 2OG8A 3PRIA 4BYIA 4CNHA 4F7LA 2VN9A 2QO7A 3GUBA 3HVCA 4XX9A 3VJOA 5M08A 4DT9A 3FY2A 2R0UA 5EOBA 5JFWA 4J7BA 1V1KA 4PPAA 2XYNA 5I5ZA 2X0PA 4UMQA 5KNJA 5M4UA 4E5AX 3L8XA 1ZYSA 4RJ4A 4EH8A 4HVSA 3DFAA 3F2NA 4UWCA 1UA2A 3R01A 5IKWA 3W0OA 1QPJA 4YJOA 2CHLA 3A7FA 5EM6A 4QRCA 1WBPA 2AYPA 3IKAA 4MD9E 1ZYDA 4ENXA 5AR2A 3FPMA 3FUPA 3FLQA 3RBWA 5IQIA 4GMYA 4YZBA 3FMHA 4YJSA 4DTKA 3LMGA 2VD5A 3WYYA 4GG5A 1XWSA 4YZMA 4YR8A 5IA1A 3OROA 2NRUA 2C5XA 3C4ZA 5CU3A 2QQ7A 4A4XA 4J52A 2QVSE 2GSFA 1J1BA 5CF6A 3UZTA 2CLXA 5AWMA 3TV7A 5AAFA 2XK3A 3S2PA 4AGCA 3E92A 3AC2A 5DE2A 3ERKA 4KA3A 4E4NA 5CEKA 2RIOA 4X3JA 3HL7A 3PVUA 4WSYA 4YHTA 3H9OA 5AIRA 4OTFA 5FM3A 3UNKA 2W5BA 3D7ZA 5GIOE 4O7YA 3GC0A 1R78A 4BDDA 5CEPA 5M56A 2PVYA 3QXPA 4YLJA 5HIBA 5H3QA 5AP4A 3TNPC 3UZRA 2HYYA 1RQQA 1JSTA 2OGVA 3MJ1A 4LUDA 5HLNA 5I0BA 2G2HA 4QMUA 3DBEA 3VW6A 3L9NA 3VN9A 3R1QA 4YJPA 5CT7A 2AC5A 4JBQA 4B7TA 2H6DA 4JIKA 5BX0A 4ACDA 2X8DA 2OIBA 5IH4A 4DDGA 3KXZA 1H08A 4GRBA 4I0SA 3GFWA 2C1BA 3KRRA 1Y6BA 1LEZA 1CKIA 2WXVA 2OZOA 5HO8A 4Z9LA 4HVIA 2YISA 4FKGA 5ACBC 4ZK5A 1GZ8A 3R6XA 1XQZA 2HW7A 2PK9A 2C3JA 2HWOA 1STCE 3I6UA 5IDNA 5FLFA 3QLGA 4HPTE 4GK3A 4WO5A 4ENYA 3K5VA 2W05A 3P4KA 3FHIA 4WNMA 5E8ZA 1ZARA 3PFQA 3GBZA 4KB8A 3V5TA 5EYKA 3ML1A 3ANRA 1H01A 3VBWA 4L45A 4FODA 3VS0A 1K9AA 4EOPA 4LUEA 1XMLA 4KRDA 3N4UA 4X2JA 2XF0A 3RWPA 4A9RA 4MYGA 2WMWA 4GSBA 2XYUA 2BIKB 2OXXA 3IDCA 3QGYA 4WRGA 4EWQA 3BKBA 4RRVA 4ZMFA 4MD8E 4AZFA 4BCOA 4NCTC 2REIA 2UVZA 3BV2A 4BGHA 2AQXA 3AMBA 5AP0A 5HOAA 4QQ5A 3F3VA 4BHNA 2EB2A 3IW6A 1TQPA 5LMAA 2GMXA 3UQGA 3R83A 4Q9ZA 1JWHA 1ATPE 4LGHA 1M7QA 3BLAA 1RDQE 4DFYA 1OIRA 3F82A 4WHZA 2XJ2A 4NT4A 3PE2A 2FSLX 3EH9A 3BYMA 3CIKA 4JAJA 2XANA 4OTGA 5L8JA 3ZBFA 2ZAZA 5EKOA 4PP7A 3HMOA 3COMA 3QA8A 4RVLA 4EH2A 4CMUA 3QX2A 1OI9A 4Y73A 2X4FA 4II5A 2VTOA 4MK0A 1FBNA 4LM5A 3ZUUA 2XIYA 4G3EA 4RFMA 4YPSA 2PMLX 4IWDA 4ZSAA 5M4FA 2ZJWA 4FIFA 3VS5A 2PUNA 3TNWA 1ZRZA 3T9TA 2CCIA 4F4PA 1V0BA 4K2RA 4X7QA 1FVVA 2G1TA 2R0IA 2OH0E 5HIDA 4I5CA 3CPBA 3PWDA 1DM2A 4R1YA 3EQDA 1YHSA 4XBUA 3BELA 3BBTB 3G33A 3CSVA 4QTCA 4F1TA 1MRUA 1ZXEA 2W1DA 4DAWA 4FUYA 4BF2A 3MFRA 4DGMA 3E62A 5EYMA 5TR6A 3ACJA 1U59A 2UZLA 3I5NA 4FOBA 4C2VA 4OBOA 3QQJA 4FSRA 1MRVA 4U81A 3PZEA 3MN3A 1ZOHA 2QOKA 3ZO1A 3ZUTA 2WAJA 1W98A 4AN9A 4BBEA 4FTMA 1QPDA 3SW4A 2QI8A 4TYJA 4ZOGA 3REPA 4C02A 4F9BA 3ZUVA 5KBRA 3G90X 3GB2A 1F5QA 5T6KA 3IONA 2X8EA 3IGGA 4RC3A 4I5HA 4RGJA 4XG9A 4NKAA 4D5HA 3NFGB 3HA8A 2XH5A 2UZBA 1ZY4A 4KNBA 1H1RA 2VUWA 4XP2A 4BCIA 5HNBA 2VO0A 5BYYA 4RBLA 4TWCA 4YJVA 1PY5A 4UXLA 5CSWA 4EUUA 2Z02A 4FKJA 4ZLYA 5LVMA 4N0SA 4O96A 3I0QA 3I1AA 4CT2A 5CWZA 5DT3A 3IW8A 4JAIA 4BCFA 4U3ZA 1ND4A 1OPJA 5JRQA 2RG5A 3VUGA 1A48A 2EU9A 3WARA 2Z8CA 2VRXA 4X6QC 2W9ZB 5CI7A 3KRWA 4BJJB 3QQHA 4BCNA 4GV1A 2QOOA 4S32A 1WAKA 5CNOA 4FGBA 1UU8A 1UU3A 3WI6A 2IO6A 2QOIA 3LW0A 3OBGA 3MVHA 4EI4A 4L9IA 3LQ8A 5BMMA 3W2OA 4AZTA 2B7AA 4QDVA 3A62A 4IWQA 3TUCA 2C6MA 3FMLA 5CAOA 4EHGA 3ZRMA 4NZWB 4ANOA 4FE2A 1BLXA 1WVWA 3D4QA 4WSQA 5C26A 4C57A 4ZZNA 5AR4A 2V62A 4U97A 3ZS5A 1EH4A 2W9FB 3K5UA 4AUAA 3L8PA 4IX5A 3MBLA 1W83A 3EKNA 3NZ0A 4LOOA 4MH7A 3K54A 3TXOA 4XOYA 4BZDA 3H9FA 3UTOA 1CM8A 4O4BB 3F3TA 2YM4A 2BZHB 2H8HA 3OHTA 4ALWA 4FEUA 2YCQA 4JG6A 3TKUA 5E8YA 4EC8A 3ENMA 3D2KA 4FIGA 4L67A 4MKCA 2ZMDA 3HYHA 2X0OA 3PXZA 3F5PA 3T9IA 4D4YA 3LXLA 4MXOA 4XJ0A 4PDYA 5FDPA 2J90A 5HCXA 3LXKA 3VS1A 4CYJA 3CKWA 4K11A 4C7TA 3JUHA 3Q32A 3VONA 3SAYA 3DJ7A 2A19B 2WOUA 3LCTA 4EHEA 4F0FA 2W1IA 2IW8A 4I0RA 4BWPA 3VC4A 5KE0A 4EH9A 3IQ7A 1JSVA 3EFLA 2UZNA 3H9RA 4IC7A 4IVCA 4M0YA 5FEQA 1G8AA 3FL4A 4CZTA 3HMNA 3UZPA 5A3XA 1J7LA 3VRZA 2XEZA 4JQ7A 1J7IA 2PTKA 5BVKA 3BU5A 3F66A 1PRYA 5K5XA 5JZNA 2PPQA 5CT0A 3UIXA 4OTQA 5AUZA 3ZLYA 4ACCA 3SOAA 4J1RA 1ZOGA 2QR8A 3QRJA 4HJOA 1ZAOA 2PZRA 5E1SA 5ETAA 4AT5A 4LRKA 3AG9A 4A9TA 3HUBA 2VWBA 2QOQA 1WBTA 3WZEA 4PDPA 3FC1X 2ITXA 1Q61A 2QOCA 3NIEA 3NEWA 4Q2AA 4YHJA 2XCKA 3OT3A 4P2KA 3CJFA 5EQPA 4FC0A 1OZ1A 3VHEA 4RFYA 4IZ7A 4QYEA 4C4JA 4IW0A 3DAJA 3IK3A 2B53A 3G9LX 2BRHA 4QMPA 2H96A 2J7TA 4MXYA 4FG8A 4NM3A 3WE4A 5K4IA 4XV3A 5HHWA 2PVMA 4IFGA 3MWUA 4FKTA 4W9WA 3UOLA 4ITHA 3FSKA 5L6PA 1W84A 1W2DA 3DBFA 1NVSA 2Z60A 3DCVA 3LE6A 3FKNA 2PVKA 4FT5A 1WZYA 1OIUA 4QP6A 3RKBA 5TT7A 2YZAA 3NAXA 4I6HA 2YERA 4NJDA 3VJNA 3QLFA 4D2WA 4HYUA 2Y4IC 3F69A 2OI4X 3BX5A 4C36A 3VUTA 2OLCA 4XYFA 1W82A 2J5FA 4RX5A 4F9YA 2X2LA 3PJ8A 1BKXA 3DTWA 3DDQA 4TN6A 4BRXA 3NLBA 4F65A 3MI9A 2HENA 3KXNA 4NFNA 3TNIA 1ZZ2A 3CXWA 4NSTA 4G5PA 3RP9A 1OIYA 4C4IA 2IZUA 4L52A 4WIHA 3I81A 4LQMA 3C51A 4KIOA 2PE0A 1J7UA 1K3AA 4OAVB 2LGCA 3KA0A 2EWAA 2XIXA 5CU6A 5AUTA 4ZS4A 4J8MA 3R1YA 4EOIA 5BVFA 5CAQA 3R7YA 1Z5MA 3P5JC 3W32A 2VWIA 3SOCA 5FQDC 3GU8A 3PVBA 2QHNA 5D7AA 3SXFA 4IM0A 3WE8A 4ZAUA 3ID6C 1U46A 2ITYA 3R2BA 3K3IA 3FMKA 4CFMA 3KQ7A 4GL9A 5KMKA 2BZIB 5AJQA 3CS9A 3ZONA 2UV2A 2WU6A 2XIZA 1GY3A 4DLJA 3ROCA 5LVOA 2NRYA 2WB8A 3GC9A 4KSPA 3CJGA 5AV0A 3R7UA 3FKOA 3NAYA 2W0JA 4UXQA 4DEDA 4AA4A 1OUYA 1MP8A 4X6RA 4YTIA 1DI8A 4FUXA 4KKHA 4FKVA 2LAVA 4JX7A 3RWQA 4Z55A 3ORNA 4UMTA 4ASZA 4WT6A 4YNEA 2PMOX 3S1HA 5D11A 3G0EA 2XNBA 1CSNA 5H8BA 4QQJA 3R8MA 3VBQA 1J91A 4PDOA 3LXNA 3PA5A 4JDKA 5IZFA 2GQGA 1OVEA 1B6CB 2X7GA 3EWHA 4ITIA 4L3PA 4LOPA 3SDJA 5B7VA 4S33A 2E9VA 4XG4A 3HEGA 2GNJA 4BI1A 5HD4A 3R04A 4H1JA 2R3KA 1Y8YA 3QWKA 3UIUA 2BR1A 5GZ9A 5CQWA 4JRNA 4CCUA 4BDFA 4OTPA 4U5JA 4WG5A 1BYGA 3U6HA 4IDTA 1FVTA 5EI2A 4ANLA 3RJCA 2R7BA 4E4LA 5HX8A 2O0UA 2EXCX 4LL5A 3CY2A 4FTOA 3WZKA 4PDSA 4IAYA 3ZSGA 1JQHA 1JKSA 3BHTA 3A4PA 3NYOA 4LDTA 1S9JA 4PMSA 4OTWA 4PTEA 4MQ2A 4DFBA 3DNEA 2A27A 4TTHB 4FV4A 4WD5A 5EI8A 3DKOA 2BUJA 3GCVA 3NCGA 4NM0A 3AKKA 4LV8A 5TE0A 3KU2A 4TYHA 3Q6UA 4DH8A 4RC4A 3RZBA 2YFXA 2WPAA 3CD3A 3ATSA 2OFUA 4AOJA 3AQVA 1OUKA 2GHGA 3OVVA 4BDHA 4EK8A 3HX4A 3CQWA 4AT4A 3RHXA 4IDVA 5JMSA 2ACXA 3A2CA 3E7VA 3BWJA 4O1PA 4IVBA 2PZ5A 4NEUA 4QMTA 4W4XA 3TT0A 4BGQA 5BUIA 4YZNA 2GS6A 4ZTLA 4GFMA 2G01A 3CEKA 2I0YA 4BCMA 4G17A 2Z7QA 4FK3A 4QP4A 4R1VA 5C8MA 3TL8A 4F6UA 2FVDA 2W1EA 4F9CA 2H34A 5C8NA 3HP5A 1H28A 4GCJA 4JBVA 4KKEA 4TT7A 5KKRB 4FK6A 1FMKA 3F9NA 3H0ZA 3QAME 4FKSA 3R7EA 4FKWA 5A9UA 4C37A 2UZEA 4I6BA 2R4BA 4Z7GA 4FSZA 2DS1A 3H3CA 5J9LA 1DAWA 2BZKB 2IZRA 4U8ZA 3D0EA 4N70A 4CMOA 5IDPA 3OT8A 4G5JA 4USDA 2V7OA 3JS2A 3R7VA 5HVKA 4RZVA 4WG4A 3NVKI 1LUFA 4J96A 3TG1A 1OKYA 2BROA 2C0OA 3COIA 4RVKA 5E9EA 2ERZE 3C0GA 2BZJA 3UO4A 2BIYA 3A4OX 3FL5A 4ZJJA 5GZ8A 2YCSA 3DKGA 3MSSA 3ORIA 2RKUA 4FMQA 2PVRA 5I9VA 3EQGA 4FEVA 3AMYA 2JAVA 4FKQA 2JBOA 1TZDA 2YCRA 3DGKA 4HPUE 4O2PA 3QD3A 3S0OA 3EFKA 5ETFA 4HGSA 4R8QA 4H3BA 4TNDA 4UYNA 3N51A 3U6JA 4XLVA 1H26A 3P79A 4U43A 3UGCA 5A54A 1UNGA 4X2FA 4XRJA 3PDTA 1XH4A 4XHKB 1GJOA 4LRMA 1YXTA 4QTDA 3AKLA 1E1VA 5LMKC 4U9AA 3BU6A 3Q4UA 3OS3A 5EM8A 3ZBXA 1LR4A 3LFDA 2BDFA 4XNEA 4EH6A 4A9UA 2VTRA 4TYIA 4E4XA 4QQTA 1YXUA 3SX9A 5I3RA 2FO0A 3F3ZA 5DOSA 1S9IA 3WF5A 3AGLA 4BDCA 3ZHPC 3GOPA 3ORMA 4EYJA 2W5HA 5HTBA 1RE8A 5HVJA 4ZTHA 5M4IA 4V0GA 3SGCA 1M17A 1XKKA 3ZXTA 2ETKA 2X39A 3TDWA 2WHBA 1GIHA 1PXJA 4FSNA 1H0VA 5AR8A 4R77A 3ZDUA 2HZ0A 3NUYA 3ZM4A 5AMNA 4BN1A 3BL7A 5CANA 3PXQA 5G6VA 4I5MA 4JT3A 5F94A 2PU8A 4BL1A 3MW1A 2W5AA 3QHRA 3MIAA 3VIDA 3PWYA 4M13A 1W8CA 4GK2A 1U5RA 1XBBA 5DBXA 2JDOA 3LOKA 3OEFX 5B2KA 4LYNA 4ASXA 2Y6MA 2EXEA 4FZ6A 3GFEA 5D1JA 5J95A 1GIJA 1BL7A 4BI2A 4CQEA 4FTJA 5AP2A 1JVPP 4O0TA 4QP9A 3O7LD 3UVQA 4X2NA 5HO6A 4F1OA 3MPAA 4BKYA 4FF8A 3WF6A 2OBJA 4YTHA 1H1QA 5JQ5A 3PA4A 4B9DA 1YXVA 4F0IA 5E92A 4QTEA 2OJGA 2J9MA 3VWAA 1YHVA 3POOA 3RMFA 3BIZA 4TKSA 5IQAA 1OKVA 2JLDA 1H4LA 5ANOA 5HE1A 4M8TA 2DQ7X 5LWNA 5HZNA 2XKCA 3EN7A 1YWNA 2NPQA 1WVXA 4O0SA 3AC8A 4RSSA 3CKXA 3TJDA 5AUYA 4IANA 3GU5A 3OF0A 2JIIA 4IXPA 3GC8A 3O0GA 5E90A 4S31A 5HG7A 3W2SA 2VV9A 3UQCA 5ANKA 4O91A 3UG2A 4DITA 3NFFB 3P08A 2PZPA 3ZOSA 2WTVA 3UODA 4R7BA 2JFLA 4RFZA 3KCKA 4L46A 3VUMA 4QMLA 4MAOA 3B8RA 4AT3A 1Y6AA 4DBNA 4FOCA 5DWRA 3O50A 5AIKA 4DHJA 2FSMX 3SA0A 3O23A 4BCKA 4EH5A 1L3RE 4HYHA 5B2LA 3I6WA 5CEOA 1Z57A 4UZDA 2DYLA 3FZOA 3IW4A 4CTCA 3R8PA 2BHHA 3RINA 3O7LB 3F7WA 2R3PA 4L42A 3NUAA 2V0DA 4AAYA 4O83A 5E8UA 5M55A 1AD5A 2VGOA 2X0GA 4JRVA 4OW8A 4HCVA 4R6VA 2ZM3A 5L6WL 3V04A 3UQFA 4CD0A 2OIDA 5FWKK 3PA3A 4EK5A 2J51A 2R3RA 2VTPA 4IJ9A 5E8SA 5AAGA 3CLYA 4IBMA 2ONLC 4RWKA 4O22A 5AP5A 4EOOA 2GQSA 3QZFA 4JR3A 4JQEA 4APPA 2C5VA 5AAEA 3ATTA 4LMNA 4JG8A 3Q9WA 2P2HA 3QRIA 3F5UA 3VUHA 3ORTA 2XRWA 4J53A 2BILB 2YJRA 5AA9A 4FKRA 4RLLA 1L8TA 2ONLA 1CKJA 5BVWA 4EH7A 3Q53A 1Q3DA 1OKZA 1DAYA 3DBDA 3UDTA 1OM1A 2ZOQA 4FICA 2OK1A 3H0YA 3I5ZA 2C6LA 3UMWA 4QMZA 2O63A 1H0WA 3FZPA 5AV4A 2NO3A 3O8UA 4XEYA 3KB7A 3OD6X 5L2QA 2WELA 1NVQA 4PWNA 3JY9A 4CZUA 3TMOA 2WNTA 2A98A 4AW2A 2E9UA 2FB8A 4KINA 5IISA 5CVHA 2VU3A 3EIDA 4EUTA 2NNWB 4M3QA 3PRFA 4ZY4A 4U7ZA 4YJNA 4O7LA 1XMMA 4PMTA 3MB6A 5JGDA 2YCFA 5AP3A 2RF9A 4C58A 1FPUA 1K2PA 4X0MA 4EOJA 3RNYA 3QUPA 4FRFA 2CKEA 3JPVA 1ST0A 4EQCA 4WNKA 3ZEPA 3UJGA 4C4EA 5BVNA 3L1SA 4PPCA 4I20A 5IG1A 3LM0A 4TWNA 5C27A 2ITPA 4DHZA 4QYYA 4GJ2A 5CNNA 4FSWA 5E91A 3JXWA 4ERKA 3NMUF 5BVOA 3SVVA 3FQHA 4YTCA 2EB3A 1PMVA 2WZJA 4JI9A 3F7ZA 3OXZA 2BAQA 4JDJA 3PSBA 1OGYA 4B0GA 4DFLA 5CI6A 1VZOA 5DI1A 2JC6A 2PHKA 2W4KA 4RG0A 2GNHA 2QU5A 2J0LA 1PMUA 4DG2E 1M7NA 2XZSA 5FXQA 2Y4IB 3MFUA 4GS6A 2O2UA 5KMIA 4RWLA 5TF9A 3R63A 3WOWA 2XK7A 4IQ6A 5CXZA 3AD4A 2GDOA 4F09A 4I5PA 2PULA 4DEBA 2J4ZA 3TDVA 4W9XA 2YIQA 4K0YA 4TYGA 3V8SA 4CFVA 2UUEA 3W10A 3MB7A 4XS2A 4FT3A 2YIRA 2EXMA 4C4HA 2XM9A 3F5XA 5DIAA 4AXCA 2X6DA 3OTUA 2F9GA 2JKKA 2PUUA 2ITTA 2XJ1A 4DN5A 2HXLA 2IJMA 2YIXA 3SXSA 5C8KA 5L2IA 4NCTA 3NW5A 2HY81 4GT4A 2XK8A 5HGIA 4AQKA 2P33A 5I9YA 1ZY5A 3FLYA 3QFVA 4KIKA 4ZIMA 3T3UA 3BPRA 4BTMA 5AFVA 1YW2A 4FKLA 5CSHA 4O1OA 3ZZWA 3QQKA 2VZ6A 2F7ZE 3CD8A 1O6LA 4QTBA 3GGFA 3FPQA 2JITA 3BBWA 1IASA 4AP7A 3F3UA 4BDIA 5I9XA 2W4OA 2VWUA 2P0CA 3UIMA 5HCZA 5FTOA 4PMMA 4RIXA 3CQUA 4YJRA 2HZIA 2J5EA 3ZM9A 3PSCA 4ZJIA 4RIOA 3E88A 3LJ0A 1PXNA 4O0YA 3D5VA 5J87A 4KUJA 2BVAA 3AXWA 3MS9A 4RWJA 4E6CA 2XKEA 2ZDTA 4OUCA 5M09A 3HKOA 1T46A 3QL8A 5M51A 2YDJA 4ID7A 3OG7A 3F2AA 2W06A 4XOZA 5EK7A 3U8WA 4EORA 2WFYA 5J8IA 4BKJA 4FVQA 2J0KA 2YDIA 1Y57A 3GU4A 4QTAA 2GFSA 2ITUA 5GIPE 4YSMA 5CENA 4EHZA 2HOGA 4K9YA 4NW5A 4OGRA 3VULA 5KHWA 3NNWA 4Q9SA 3R7IA 4FIHA 4BTJA 3N4TA 3PLSA 4WBBB 5IQGA 5HORA 4IZAA 1NY3A 3KK9A 4FNYA 4MXAA 3BHYA 3ODZX 4JL9A 5DG5A 4ORKA 2VWVA 4RA4A 4NW6A 3ORZA 1PKGA 3PJCA 2WMUA 4S30A 3KRXA 4C3FA 2PL0A 1FOTA 3KF4A 1KWPA 2UZVA 2ZM4A 1CTPE 4JBOA 4AGUA 3W0MA 4GKHA 2R5TA 3KXGA 5A6NA 4BCHA 2E2BA 1JOWB 1BMKA 4FSUA 3ZFYA 4FVPA 3HDMA 2IEWA 3QYWA 2RFSA 3P7CA 4Y46A 3NGAA 4CFFA 4O84A 3TWJA 3CBLA 4QP8A 4WUNA 5DH3A 3FKLA 3P78A 4F6WA 2QG5A 4DCEA 4CXAA 4GT3A 4YPDA 4O4EA 3L8VA 5D12A 2UW9A 5JK3A 2PVFA 3D14A 3EKKA 1G8SA 2JGZA 5C9CA 4IFCA 1T45A 3VO3A 5H9BA 4YTFA 1GZOA 4EH3A 4L00A 4AF3A 4A4LA 4RZWA 4I0TA 5FP5A 3W0QA 4E5BA 4QPSA 3W0RA 2VTIA 3AC5A 3FV8A 3OCSA 5M44A 4O4DA 1MUOA 4U79A 2W99B 2FGIA 3VUDA 3MJ2A 2DWBA 3A8WA 4MNEB 3S95A 4CMTA 4IB1A 4UV0A 4YJUA 1XH8A 5CU4A 3CP9A 5JFVA 1M2PA 4AXDA 1LPUA 3I60A 3ZFXA 3EZVA 3ZSHA 3ZRLA 3QA0A 3TKHA 4KIPA 2GHMA 4QMOA 5F4NA 2CNVA 4BDEA 3DXNA 3AC4A 4GIHA 4M15A 4O2ZA 4XP3A 2WIHA 3TV6A 2V5QA 3KKVA 5L8KA 4BCGA 4HNIA 1QMZA 4JDHA 5L6OA 4IC8A 2W96B 2KULA 4DHFA 2ITWA 4LOQA 2YZLA 1UVRA 3BL9A 5LWMA 3TV4A 2PVLA 2WQNA 5AV1A 3DAEA 1GZKA 1KV2A 2GNFA 4I3ZA 4TW9A 2A1AB 1PXMA 1UWHA 3FZRA 3E8EA 3LLTA 1TQIA 4AU8A 4C59A 2J6MA 3A99A 3QBNA 5IQEA 5BUEA 4IM2A 4ARKA 2Q0BA 2WGJA 2ZYBA 3VS6A 5IMEA 1W0XC 2HCKA 5FTGA 1YWVA 3W2CA 2JKOA 2GNIA 2R3LA 4TYEA 5DFPA 3VQUA 1BX6A 3TUDA 2W1FA 2BDWA 4GT5A 3RPSA 1IR3A 4A06A 3IDBA 3IDPA 4KAOA 4KS7A 4RPVA 3RPRA 1M14A 2YWVA 5JN2A 3QALE 3O51A 3UNZA 2QNJA 4O27B 4XCUA 3UIBA 3GOKA 2VTNA 5ANGA 1PYXA 5FTQA 3VQHA 5L4QA 1JSUA 4G31A 4DEGA 4UYAA 1OITA 3DQWA 1RJBA 3II5A 3TTIA 1WBNA 2Z7LA 3KVWA 5AM6A 3O17A 3W2QA 1F3MC 2W1HA 5HU3A 4MTAA 1PXLA 4QMVA 4IX3A 2FH9A 5AV2A 2WD1A 1WCCA 3PP1A 2EUFB 4JBPA 4I6FA 4JMQA 4NTSA 1NA7A 2AUHA 2WO6A 4DBXA 5E1EA 4BCQA 3VS2A 4C2WA 5JFXA 3VUKA 1PYEA 1NXKA 5I9UA 5DYJA 3RK5A 2YN8A 4HNFA 4DEAA 4MNEA 3POZA 3OUKA 1MQ4A 4FL2A 4YZDA 4EOMA 3ACKA 4FSTA 3GCQA 3DK7A 4R3PA 3WYXA 1G8KA 4JX3A 4HZSA 2QONA 3V5QA 3OXIA 4FV6A 5BYZA 5JKGA 1VLRA 4FG7A 4FV3A 3DOGA 5CY3A 4GEOA 1B39A 5DA3A 4EBVA 5CSXA 5IMXA 3VF8A 3FMNA 4QO9A 3UOHA 3VUIA 4GYGA 4W4VA 4HVHA 5JT2A 5HVYA 3JY0A 5FD2A 4C35A 2VTSA 2IF8A 3QTXA 1Q4LA 4XV1A 3DV3A 4ZLOA 3M42A 2PZYA 5HBHA 4DFZE 3UO5A 2IVVA 3D7TB 3QTUA 1U54B 4UALA 3WZJA 2IZTA 2WQMA 2GNLA 3R21A 4GFGA 4G3CA 4HCUA 1UNHA 4K6ZA 2RFDA 3P9JA 4EOKA 5HU9A 3RK7A 1ZYCA 3PTGA 4RJ6A 4AFEA 1YOMA 4E3CA 2YM8A 3F88A 5HE2A 5I4NA 5AUWA 1PF8A 4O38A 1OL2A 3NUXA 4AZSA 2C0IA 2UVXA 1I09A 3FWQA 3Q4TA 2WMSA 4RVMA 2XNEA 3DDPA 5LVLA 3FQSA 5AR7A 4FV1A 1OECA <