3LCTA

Crystal structure of the anaplastic lymphoma kinase catalytic domain
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
308
structure length
308
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRAGYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords ALK tyrosine kinase receptor
publication title Crystal structure of the ALK (anaplastic lymphoma kinase) catalytic domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 308
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lctA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lctA01
4IWOA 2IWIA 2WELA 4NSTA 4O0XA 3LQ8A 4ASEA 4DHFA 4NTTA 3U6IA 3SXRA 2WMBA 2GNJA 2XH5A 3ATTA 3KRJA 3KY2A 5A4CA 3GCQA 1B38A 4FNWA 4AWIA 3TV4A 4RX5A 3GU6A 4M8TA 5AM6A 3Q4ZA 4IADA 4DEGA 2XNPA 3TZ8A 1OGUA 4WG4A 3TEIA 3JVRA 2R0IA 5CY3A 4RC3A 3UP7A 2QLQA 3L9MA 2OJ9A 3O23A 4PL4A 2WU7A 4UZDA 4DN5A 4A9UA 3C4WA 4UMUA 4F09A 1Q3WA 1V0PA 5HG9A 3G6HA 4AA4A 3NUSA 3Q2JA 4QP1A 4OAVB 2HWPA 2HOGA 5H8EA 1OL6A 3DDPA 1OB3A 3KXXA 2VU3A 3NUNA 2YLEA 3P7BA 4AW0A 3A7JA 5A6OA 4HYIA 4CLJA 5TT7A 2BIYA 3FMDA 3FZRA 4DG0E 3EWHA 2O8YA 2NNWB 3W33A 4L52A 3R2YA 2IVVA 4GK2A 1ZOHA 1YDRE 3A7GA 4N57A 3CQEA 2PK9A 4YHFA 4IC8A 4CLIA 5LMAA 5CEKA 3V01A 2ITQA 4DH1A 3DBDA 4A9SA 4FE2A 2QOBA 5AV1A 3DAKA 3HLLA 4X3FA 3EN6A 4RQVA 2GNHA 4FV6A 4BTJA 3RHKA 4AP7A 4JJRA 1OL7A 3CY2A 3NX8A 4OBOA 3BHUA 4DCEA 4YJVA 3U4UA 2XVDA 3OXIA 5FTOA 2BTSA 4Y46A 4PTEA 3BWFA 5HCYA 5F1ZA 4FV8A 2QC6A 5E8UA 1EH4A 1Q99A 5HLNA 5DI1A 2QD9A 3A4PA 4L3LA 3TZ7A 4AOTA 3LOKA 3AGMA 4O96A 4NJ3A 4RSSA 4IZ5A 1YHVA 3EYGA 4CKIA 2OK1A 2H6DA 2BRGA 4FA2A 3DT1A 4EHZA 2GMXA 3EH9A 4FSUA 4S34A 2WB8A 2RL5A 1LEZA 5DEWA 3OXTA 3T8OA 3VNTA 5FLFA 4ERKA 4XV1A 3OEFX 3MPAA 3UYTA 3QD0A 3W16A 4FSNA 5IA4A 4DINA 5HX6A 3LFEA 5DRDA 3EQRA 5AP4A 5HVYA 4CZYB 4EOMA 4J52A 2PVLA 2JDVA 3CP9A 4BDDA 2BMCA 3R73A 3CIKA 4ZP5A 1S9JA 3PWYA 4L68A 3VBXA 4FI1A 4IH8A 2J2IB 1M17A 1M7NA 2OXDA 3ETAA 4DFXE 2WTVA 3A62A 4FT5A 3AMBA 4IB3A 4MYGA 4R1VA 4RJ4A 3LCSA 3DK6A 3QZFA 3F7ZA 3U4WA 3UO5A 1XJDA 2ZB1A 2XNEA 4QMSA 4WRGA 2RFNA 2V0DA 3D5WA 4C8BA 2ZJWA 2PMOX 3FMJA 3OF0A 5AUVA 5IF1A 2UZWE 4X3FC 3FI3A 5ANGA 3QZGA 5EI6A 2J5EA 1MP8A 5B2KA 5J9YA 4RVKA 3EB0A 2UVXA 1KE8A 2ZAZA 4PMTA 2EWAA 4OTQA 3QU0A 1ZARA 1Q24A 4F0GA 5C8NA 5T68A 4YTCA 3KCFA 4WKQA 4U41A 2P55A 3VBYA 2HZ4A 2XK3A 3MJ2A 3KRLA 2LAVA 4UWBA 2OFVA 4C3RA 2Y4IB 4JL9A 4KSPA 2VTPA 1QMZA 5IISA 3NZ0A 5DIAA 2HK5A 4BYJA 1ATPE 3R0TA 5EYDA 4LRMA 2JKMA 4EHEA 3TTIA 4K6ZA 5AA8A 3QUEA 3LCTA 4QT1A 2YWVA 1QL6A 2QG5A 2VZ6A 4NJDA 4YBJA 4E4NA 3ALNA 3QCSA 5IA0A 2ERKA 3QRIA 5M4IA 4Q5HA 1ZOGA 2XK9A 5GJFA 2WMSA 4C4JA 2WZJA 2X9EA 2X9FA 2C6MA 4HGSA 5HGIA 2CMWA 4K18A 3ZEPA 4GV1A 4BL1A 3HP2A 3UOKA 4FTQA 5I9ZA 4MWHA 4GFGA 1TQIA 5AR7A 1YHSA 4J53A 3OBJA 2G01A 5LXMA 4R3CA 3IW4A 2WO6A 4FKOA 3POOA 3OVVA 3AT4A 1GJOA 5L8LA 3W10A 1M2RA 4HZSA 5IMXA 1YDSE 5BVFA 1JSUA 2CKPA 5HIBA 3F2NA 4ZTSA 4BIEA 1OUYA 2GFCA 3FY2A 5E91A 5DMZA 4TN6A 5KZ0A 1H1QA 4ZXTA 4X6QC 4C36A 3CPBA 2XA4A 3KFAA 5ETAA 3V3VA 3MA6A 5HX8A 4ALVA 5FDPA 2YJRA 4I22A 4U0IA 2BRBA 3R1YA 2DUVA 2X8IA 3VVHA 1U59A 3FUPA 4ZOGA 5BX0A 4J99A 5CEOA 1A48A 2IJMA 2OJIA 4G6NA 2V55A 3UPXA 4EQCA 3W2SA 4JDJA 1NW1A 2W9ZB 3PWDA 1P5EA 4DEDA 2PVKA 5A6NA 3ODZX 2CGVA 3WF9A 3WIKA 5KKRC 2CJMA 4NKAA 4OTHA 2W1EA 3UODA 4W9WA 5EQYA 5C4LA 2WTWA 4IAKA 4YNEA 2BFYA 5F9EA 1KOBA 3NW5A 3TDWA 1H28A 3WI6A 4GK4A 4ZSJA 5IEXA 3EMGA 3RBWA 4CFXA 3R1SA 4XP0A 2B1PA 2OXXA 3HMNA 3PIYA 4JBVA 4QMWA 5E8XA 3TI1A 3ZDUA 3LXPA 3JYAA 3LE6A 3E62A 3QBNA 4V01A 3RTPA 2WQNA 4TNDA 4QRCA 4E73A 1PW2A 2E9UA 4FV3A 4KBCA 3DB6A 4UMRA 5JKGA 3MGYA 3RWQA 3HMIA 5AAEA 4HYSA 1WBOA 5CI7A 2WD1A 3KU2A 4QO9A 3HAMA 2BALA 4AX8A 4I0SA 3BYUA 4BDGA 4EEVA 4E6QA 4GVJA 4CTBA 3QD4A 5CU4A 3S4QA 4J1RA 4XP3A 5EM8A 4C3FA 2R3QA 2Y4PA 4ZTRA 2OH4A 3D5UA 2X39A 5GHVA 4FZ6A 3FPMA 5EOBA 3LFBA 3ZO2A 3NUPA 3QD2B 5J95A 3Q9ZA 1PXIA 3C4FA 2X6EA 2CGXA 3C5UA 1OUKA 2CCHA 3ZUTA 2PWLA 3IQ7A 2C0OA 4V04A 5ANDA 4R77A 4OTRA 3A61A 4N0SA 5E1EA 5BVKA 4CT1A 2PVYA 2FB8A 3DA6A 4ZSLA 1T46A 4KWPA 3F5XA 3SW7A 2CKOA 5T3QA 3CY3A 3DKGA 3OTVA 3ACKA 2R9SA 3OZ6A 1H1WA 3HYHA 4WG5A 1U5RA 4FNYA 5BMMA 4YC3A 4GG5A 3RNYA 5LVNA 3OW4A 4BZOA 3UC3A 3G5DA 1H07A 4KB8A 4WNMA 3RK9A 4BIBA 4GRBA 4BCJA 3NDMA 3SG8A 5CU3A 4HCTA 2IO6A 4LL0A 4NYEA 4FKVA 4W8EA 2W5HA 3EN5A 3GFEA 1OBDA 3IW5A 3B2WA 1Y91A 4BFMA 1Y6BA 3VUIA 4EOQA 4ZJIA 5KMJA 3M42A 4M13A 5IUGA 3R2BA 2V22A 2XNNA 3W2CA 2OO8X 4BDHA 2XP2A 4IWDA 4PPAA 5JEBA 3LJ0A 2R7IA 2J0JA 4CG9A 2ITNA 3GT8A 4IDVA 3NUUA 3ZZEA 2UW4A 5D10A 2JAMA 5BUEA 4G5PA 4FSTA 4FTNA 5E9EA 4DA5A 4DF3A 3NUXA 3ORZA 5E8TA 5L8JA 2C6KA 3AD6A 2R3FA 3QWKA 4O91A 4YGAA 3QWJA 3ZCLA 2VO0A 4EOOA 4EH6A 5LJJA 3ENMA 5DH3A 2E9VA 4KINA 4O6EA 1KE7A 3I0OA 3ZLWA 1K3AA 1UVRA 1FVVA 4FT9A 4TWCA 1SM2A 3EQDA 2YERA 4CFNA 5GIOE 3E3BX 3R9NA 2WIPA 3CKXA 3KVXA 4O81A 4GH2A 3DXQA 4XMOA 3ZFYA 5CXHA 4FTOA 2BAJA 4ZS0A 3R9RA 3DOGA 2QOQA 4BKJA 2PU8A 3Q3BA 1DI9A 4PTGA 5KMLA 4O7YA 3LLTA 1YXUA 3PXKA 2WOUA 3EJ1A 4IZ7A 5HKMA 4B4LA 4XH6A 2WTKB 2C4GA 5M55A 2VV9A 4AZWA 3RVGA 4YLJA 5CU6A 2BKKA 3OUKA 1J7LA 2WQMA 4DG2E 3MPTA 3FEGA 4C33A 2UW5A 4NKSA 5FEQA 5CNNA 2HIWA 2PUNA 2PMIA 3UMXA 3QTWA 5FWKK 1JSTA 3QLGA 3PA5A 2VTAA 3S3IA 4ZZOA 5M4FA 3ZM4A 4O7TA 2HELA 1UNHA 4I41A 2SRCA 2ZMCA 3OROA 5A54A 4QMNA 3SXSA 5CAUA 5HCXA 3BI6A 4CCBA 3C5IA 2I0HA 2C30A 3C0IA 5EHLA 4I5HA 2XIZA 4XCUA 5CENA 4ALUA 2X2LA 2VWYA 3A7IA 5J7HA 4CVAA 3RZFA 1Y57A 2C6OA 5L2IA 1KUTA 3T3UA 3PG3A 2J7TA 3MH0A 5KMIA 5FRIA 1IAJA 4S32A 1Y8YA 2C0IA 3GI3A 5F4NA 3BKBA 1PMVA 4BI0A 1JAMA 3ID6C 5H8GA 1YXXA 1NY3A 2XKDA 3NSZA 2JKQA 1WZYA 2P4IA 5LWMA 1YXVA 1LPUA 1Q8ZA 3OT8A 4XNEA 2QO9A 3FMLA 3VN9A 4EHVA 5HE3A 4E93A 3KRXA 4OAUC 3BQRA 3COMA 3M11A 2YZLA 3U54A 4GK3A 5G1XA 3HKOA 4G1WA 3QF9A 5LVMA 2WKMA 2YIQA 3ODYX 3EQBA 3OTUA 2QI8A 4FTMA 4OR5A 3DU8A 5HU3A 4QNAA 2Y4IC 5FXRA 5CEIA 3PLSA 4BCHA 3E8NA 1MRYA 2XUUA 3MFUA 4FK3A 3W1FA 2JLDA 3HL7A 3AC2A 3VJOA 4JS8A 4MHAA 2VO7A 5AIRA 1OL2A 3GGFA 4IVDA 3QALE 4Y5QA 2AC3A 3C0HA 3QC9A 2X6DA 4UZHA 3PXYA 4JDHA 4MX9A 4U40A 3R8ZA 4DBNA 2PVNA 3DJ6A 3DK7A 4BC6A 5AUXA 5IH4A 3M1SA 4XOYA 4RLKA 4DFZE 4UYAA 4D4RA 3GFWA 3V5WA 2R0UA 2WTIA 3R1QA 3BYVA 3R8LA 4FKLA 2VTOA 4RT7A 5CSHA 3K3JA 3DJ5A 2PVMA 4I1ZA 3BWJA 4K77A 5HCZA 3RKBA 2OH0E 1B39A 4RJ6A 3IKAA 2I0EA 4OTFA 1OPKA 1YOJA 1PXMA 4FV2A 3ZSGA 2EB2A 1VYWA 2REIA 4JQ8A 5AM7A 5I3OA 1IASA 4K8AA 3G90X 3QTUA 1W82A 2ETKA 1OKWA 5GZ9A 5KBRA 2ITUA 2J5FA 4HCVA 4GT3A 4UEUA 4EYJA 2BZKB 2EUFB 3AC1A 4CMTA 3KRWA 4G9CA 4KRCA 5CI6A 4TL0A 2BR1A 2ZV8A 3NEWA 3OMVA 1H0VA 4BCOA 4FOBA 2YDKA 1ZY4A 3EL8A 3UPZA 2HAKA 2R3MA 4I5MA 4JDKA 3ULZA 3BLHA 1FMKA 3IECA 3ORXA 5IQCA 2FGIA 3NPCA 4U44A 2HZ0A 2JEDA 5J5SA 2C3KA 2Z7LA 1BYGA 2YM7A 3GNIB 1RW8A 4ITIA 2WTJA 3NS9A 4IACA 5JFVA 5AFVA 3H0YA 3FWQA 4QQJA 3QRUA 3CEKA 3OS3A 3SRVA 4EBWA 4C34A 4ACMA 5JFWA 4DBXA 4O0TA 3BZ3A 3FKLA 3ELJA 2OU7A 2YCFA 4PF4A 2YDJA 4AA5A 3QGWA 2BZHB 5CEPA 3LW0A 2ZYBA 3OG7A 3PUPA 3DBQA 3P7CA 3QHWA 2VX3A 2ACXA 3BRBA 3FHRA 2WMRA 4AU8A 3P08A 2BZJA 4OGRA 3W2OA 3ZRKA 4R6VA 5L2TA 4FEUA 2BFXA 2PY3A 3OHTA 4YTIA 4C35A 5H3QA 1JSVA 2HW7A 4NTSA 4XX9A 3TZ9A 1W83A 2XNMA 4PP7A 1XH7A 3TN8A 3PLAE 3DK3A 4FZFB 3MIYA 3PJCA 3FZ1A 5AV3A 3CSVA 4JR7A 3VS0A 1DAYA 4CSVA 2QONA 4RQKA 1K9AA 4OTGA 2B9JA 4XG7A 3FZSA 3OXZA 1H26A 1R3CA 1ZRZA 3PTGA 2X7OA 4FBXA 4FF8A 3OCBA 4JR3A 3L8XA 5JZJA 2BIKB 5IQDA 2VD5A 3VUGA 3Q53A 1U54B 1WAKA 2CGUA 4CMUA 4CYIA 3F2RA 3UOJA 3S0OA 3V5LA 5CVFA 3V51A 3Q32A 4Y85A 4USFA 5AP5A 4XP2A 4BDKA 4D5KA 3R04A 5EW3A 1GY3A 3ZRLA 5JQ8A 5DOSA 3MFRA 2CNQA 4MF0A 3PXZA 4JNWA 5DA3A 3TCPA 4NZWB 4ANBA 1ZWSA 4EH7A 2R3GA 1XKKA 4CT2A 5C9CA 4EUTA 1WBSA 2XRUA 3DXNA 4ALWA 2CLXA 1UNLA 4KKGA 3TNHA 4ERWA 1QPEA 3QXOA 5EDRA 2VWVA 3QQGA 1F3MC 3NYXA 4D0XA 3I0QA 4DTKA 4DH8A 4F9YA 4L43A 3H9RA 4QPMA 3OBGA 4YJTA 5JFXA 4QMZA 4ARKA 2XM8A 4PMMA 4EH2A 2C6LA 1LP4A 2WMUA 3AC4A 3BGZA 1NVQA 1ZAOA 3IOPA 3QTIA 4M7IA 5CAQA 2UUEA 5LWNA 5CAOA 3DJ7A 1YI6A 4IVAA 5E8SA 3N4TA 2QOHA 2Z2WA 2P2IA 1IRKA 2XIYA 2J6MA 4DFLA 5CSPA 4HYHA 3G9NA 4U45A 1VZOA 1OECA 3QZHA 2W1DA 3FXWA 5CF8A 2UZDA 1V0BA 5H2UA 5HORA 1O6KA 4A4OA 3V8TA 4ITJA 4A9YA 5EM5A 4Y8DA 4IE9A 2OIBA 2FVDA 3QKKA 4WNKA 2OJFE 4IX5A 3VS3A 2P3GX 4RMZA 4NK9A 4TWPA 3AD5A 4KBKA 3ANQA 4BF2A 4YO6A 3MTLA 2Z7RA 3SAYA 3HDNA 1OKZA 3BYSA 3HRFA 3FMHA 3E8EA 5HBHA 2ONLA 3V5JA 5AA9A 4FEVA 2WMWA 3FDNA 1OKYA 3BHTA 2ITVA 3MY5A 3R71A 4O7ZA 4MKCA 4BTFA 5DT0A 5F95A 3O2MA 2WTKC 3DLZA 5EM6A 3ZU7A 1LUFA 2H9VA 3PY0A 3AC8A 3ZS5A 2DS1A 3LFDA 3THBA 4H3QA 4W4VA 3FYJX 3VS5A 4RC4A 2CDZA 1K2PA 4BDBA 3Q60A 2VO3A 1BLXA 5I9VA 2WGJA 2VNYA 2CN8A 2OIDA 3ORLA 4FZDB 4PWNA 1NXKA 4E20A 4F64A 2RKUA 4IEBA 5HG8A 1E1VA 2VGPA 2HY0A 3ZYAA 4YMJA 5KMNA 1H1RA 1REKA 4GT4A 3MJ1A 2Z60A 4RIOA 1Q3DA 4XV2A 5HIEA 4IFGA 3PVUA 2B4SB 5HICA 1DM2A 2HCKA 3HA8A 3HUCA 2F7ZE 4M69B 4XYFA 5EW8A 2VTJA 2XIRA 3H30A 5IDNA 5EQEA 5CX9A 5DWRA 2IZTA 3VUHA 2ZM1A 3QKLA 4UWYA 3IDCA 3IW6A 4CQGA 2C0TA 3DPKA 3AD4A 2R3RA 2WMXA 3AXWA 1J1CA 4XOZA 3H9FA 4B6LA 4C38A 4CQEA 4LFIA 3LMGA 3UYSA 4QMQA 3U51A 3LCOA 5CAPA 4L45A 4FIIA 4ACCA 5KNJA 3KA0A 1U5QA 5IUHA 4YTHA 3LFCA 5AP3A 3A99A 1LEWA 3QHRA 1AGWA 5AAGA 5AV4A 2ITXA 5CS6A 4EH3A 2YABA 3CS9A 3I81A 4L7SA 4YJQA 5AADA 3UIBA 1MRUA 3V6RA 4HYUA 4RWIA 2HZNA 4I6HA 3VBQA 1QPJA 2BVAA 4ZY4A 5C8KA 3UTOA 1JOWB 2ITYA 3F82A 2O64A 3NYOA 2ONLC 4N4SA 3RWPA 1E1XA 4XG6A 2CHLA 2O65A 5EFQA 3C1XA 3CLYA 3WARA 4D4SA 3UNKA 3R21A 3EQGA 1CKJA 4C37A 2PZYA 4F4PA 3NW6A 5HESA 4BB4A 5HU9A 2XJ0A 4QP3A 5FP5A 4H1MA 2Y9QA 4TW9A 1DI8A 2C68A 4O22A 4JT3A 4FZ7A 4XV3A 3TNWA 5IA3A 4C59A 4L6QA 4ANMA 1Q8WA 2YISA 4G5JA 3BEAA 4YJNA 3RPVA 2J50A 2HXLA 5M09A 5CXZA 5GZAA 4FSMA 1DS5A 3BU6A 3RCDA 4RJ7A 4JIAA 4IB0A 4CFMA 4O83A 4FKTA 2QKWB 4D2RA 1OI9A 2C5XA 5IG1A 3ZRMA 4A4LA 5JRSA 3DXPA 5EHYA 3CPCA 5A4EA 3BEGA 2PULA 4UXLA 3P1AA 4AG8A 3PDTA 4HPTE 3FKNA 1TVOA 1U54A 3DKFA 3Q5ZA 3G6GA 3GCUA 3IW8A 3QYZA 4FNXA 4FV9A 1ZZ2A 2HYYA 3A7HA 4S33A 3IOKA 1LR4A 3MFTA 4FIJA 3BX5A 3JPVA 4FTLA 5HE2A 3WBLA 5J9LA 1H24A 4DEHA 5AP1A 1UNGA 3SLSA 3ZEWA 4X2JA 4CV9A 3Q52A 4EK5A 2O5KA 1KSWA 3G0EA 5IDPA 4CYJA 1H4LA 2BHEA 2ITOA 4RIXA 5I9YA 4O7NA 3KK9A 4DFUA 4EYMA 1OIRA 5CAVA 4LMNA 3QCYA 5HIDA 4V0GB 4N6YA 3E3PA 4I94A 5KZIA 4DAWA 2ZVAA 4EBVA 4KSQA 4EWHA 4Z7HA 4M68A 4DTBA 4W8DA 4YU2A 3P86A 4K33A 3R1NA 3QKMA 2BTRA 2BRNA 2W1CA 4FGRA 3SDJA 3WE4A 2OBJA 3D9VA 4AW2A 5L2SA 4CFVA 4QP4A 2CGWA 3T9TA 4ZIMA 4FKGA 5TE0A 4J98A 3ZLSA 1WCCA 2PZ5A 5CEQA 4O6LA 1STCE 4WIHA 2ITTA 1APME 3UP2A 5CF5A 2W1HA 3JY0A 4CZTA 2PMNX 5I3RA 4KAOA 3QD3A 5LOHA 4F0FA 3R8MA 4IWQA 5M07A 3DBCA 2PVHA 5HBJA 5E8WA 3MBLA 2WOTA 4G3CA 4FL2A 4I24A 3KXNA 4Y72A 2I40A 4ZLYA 4I20A 4XV9A 5L2QA 5J1WA 3VW6A 1E9HA 4LGDA 1XBAA 1KE5A 4QMPA 3V5PA 4WA9A 4QPAA 2F2UA 2UW3A 2IVSA 3FJQE 2GS7A 3E7VA 4IX4A 4OUCA 2PSQA 3Q04A 5CF4A 3F3UA 5JMSA 2NPQA 3E88A 4O0YA 5FGKA 4EONA 4F9WA 3KMUA 3EQCA 5KHWA 4ASXA 5L8KA 4O0RA 4I6QA 2CKQA 4DEIA 4NW5A 3RGFA 1XQZA 3LPBA 4I6BA 4JBOA 5M56A 2CPKE 5DT4A 1WMKA 2QHMA 3P9JA 3ZUUA 4OW8A 4G6OA 4TNBA 4FSRA 3EQFA 4I92A 2RG6A 3Q5IA 1JVPP 4OTWA 4ZSEA 2ZDTA 3SKCA 3SXFA 5DBXA 3LVPA 3OUNB 3LFAA 4FG7A 2C6TA 4Q5EA 4R3PA 3HZTA 5KE0A 4ANNA 3KKVA 2WAJA 4C4EA 4F6WA 3C13A 4HVSA 3OY1A 4EOJA 3ZO4A 2OZAA 3OT3A 4RPVA 1UU7A 3LIJA 5DLSA 2W99B 2Z8CA 3COIA 3UE4A 2F7EE 4PPBA 4EH9A 4DYMA 3FAAA 4I0TA 4FKJA 2FSOX 3C9WA 4YZCA 2QO7A 2QU6A 2W5AA 2W7XA 4IMYA 1I09A 4DC2A 4EK6A 1FBNA 1I44A 3GVUA 4GG7A 2XNOA 2BHHA 3P78A 2RG5A 2X7GA 1Q8TA 4OBQA 4X2FA 4EC9A 4L42A 3S1HA 3UOHA 3E5AA 1OL1A 1U4DA 3NLBA 3E64A 4KRDA 2YZAA 3RHXA 4RVLA 4JXFA 1H0WA 4M69A 3HP5A 3EFLA 1SYKA 3W2PA 1BMKA 2XRWA 4K0YA 1BI7A 4C61A 4QYYA 4TYHB 2OZOA 1H01A 2X1NA 1URCA 5AIKA 3AC3A 4G17A 2VTRA 2WXVA 2EXEA 2JBPA 3CXWA 2A4LA 5CF6A 2C1BA 5J5TA 4EZ5A 3P23A 5HE1A 5DR2A 4F6UA 3MVLA 2QVSE 1O6YA 4IZYA 3WF5A 1Q8YA 4DH7A 5BQ0A 2CSNA 4FIEA 4E3CA 3UBDA 4X0MA 3PE2A 4G34A 1MQ4A 2VTTA 1QPDA 5IH5A 5KMMA 2QCSA 4X6RA 2Y6MA 3A7FA 3P5KA 5HHWA 2PVJA 4D4VA 4QYFA 3HECA 1SMHA 4ZTQA 4KIKB 4IFCA 4IIRA 4MCVA 3TKIA 4CV8A 4XBUA 4I5PA 4BDCA 2JAVA 3LCDA 2Q83A 3ZONA 2EXMA 3C0GA 3SQQA 5J9ZA 4L3JA 3HNGA 5L2WA 3CQUA 1BKXA 2UZOA 4FTUA 1YXSA 4USEA 4ZMEA 4RIWB 3CTQA 2W9FB 4EZ3A 5IQEA 4RX8A 4L67A 4FYNA 5EG3A 2IZSA 4ZMFA 2XEZA 1SVGA 2RF9A 3D7TB 4RC2A 4YJRA 5A4QA 2WMAA 1WBPA 3VUMA 2C3IB 1CMKE 1FGIA 1JNKA 1GZKA 2FUMA 4EUUA 5IZFA 2VWUA 3HAVA 2B55A 4E5WA 2Z02A 1KE6A 5A3XA 3QTZA 1UKIA 3RPRA 5IEVA 5CQUA 5D11A 4O0WA 3D2IA 5JGDA 1H00A 4YJSA 3G15A 2BAKA 5AJQA 4B0GA 3AMAA 3OD6X 3QCXA 2XBJA 3PP0A 4I5CA 4RLLA 1Z5MA 2IW9A 3R8UA 5CWZA 5M44A 3D2KA 1Z9XA 3KVWA 5FQDC 4BIDA 3PJ3A 5EI2A 4DCAA 2JDRA 5K9IA 2GS6A 2R3OA 1FGKA 1RQQA 2BDFA 3I1AA 4DFYA 5L6OA 3PSCA 4F08A 2VTMA 5BUJA 5TOZA 5KMKA 2W4JA 2C1AA 4B9DA 3EQHA 1PXKA 2VTHA 4HNFA 4TKSA 4TTHB 2VX1A 3GQLA 4PDOA 4RGJA 4DGMA 3QZIA 1AD5A 4V0GA 4JRNA 3FC2A 2PE0A 2XCKA 4FICA 5D9HA 3AGLA 4FL3A 3AT3A 3L9NA 2BILB 4DLIA 2EB3A 5AUYA 3R9HA 2G1TA 4EJNA 3B8QA 3F5PA 3MVMA 3OC1A 2J0IA 3FLNC 3RM7A 3GCVA 4MTAA 1BI8A 3HUBA 3GBZA 4MBLA 4CKRA 4HGEA 3BBTB 3FY0A 4G3EA 4NM7A 4AN3A 4QYEA 3FHIA 1PXJA 4H39A 1GZOA 3HV5A 1PYXA 4QYHA 3SC1A 4D1SA 5I9UA 4F9AA 2OLCA 2IN6A 2R3HA 3PA3A 4FTCA 2PE2A 4P5ZA 1H25A 5EHOA 3UQCA 4Q9ZA 4RJ3A 4AZEA 2IG7A 2QG7A 4O7RA 3NMUF 5DR6A 3OWPA 3R30A 2F49A 2OF2A 2W4KA 1PHKA 2IVTA 2VTNA 3KL8A 3NAYA 4KIOA 4PV0A 3FLQA 3HV3A 2XBAA 1J7IA 3FMKA 2JDOA 1HCLA 1YOLA 4KS7A 4NUSA 4XBRA 3RK7A 2G9XA 3ACJA 1JQHA 3H4JA 4YSMA 3WILA 4TYEA 1ZXEA 3OP5A 4Y5HA 4ITHA 4D55A 4L8MA 5BVDA 2YA9A 5J1VA 5BYLA 4YLKA 3H9OA 2J0MB 4P7EA 3VUDA 3N4VA 3QQFA 2BCJA 1FMOE 2A1AB 2XK7A 4L44A 2HENA 2R5TA 3H0ZA 1Q61A 2ZB0A 5CANA 2CNVA 1B6CB 4RFMA 3EFWA 2UZVA 4CFUA 2F9GA 2C6EA 1S9IA 2C3JA 3IO7A 1NVRA 4JG8A 4IDTA 4OT6A 3IONA 3TKHA 3E93A 4BY9E 2I7QA 2OSCA 5HVJA 3C7QA 3K3IA 1XO2B 2QODA 3BGQA 3GENA 5AR2A 3PE1A 4AACA 5M53A 2XZSA 2WQEA 3TM0A 3EN4A 4GL9A 5EW9A 4GS6A 1Y8GA 2H8HA 3FL5A 3PJ1A 3VS2A 3VBTA 3MWUA 4GMYA 4AFJA 4AUAA 1CSNA 2ETRA 4UY9A 4NWMA 2UZUE 3FI2A 3UNZA 5TO8A 4FV1A 2PL0A 3TTJA 3I6UA 5AR8A 5IKWA 3R8PA 3LFQA 4F1TA 2XIKA 4KA3A 4FEXA 5CU0A 3RAIA 5JRQA 4U9AA 3LJ1A 4HVGA 3R28A 3DZOA 5E90A 3S2PA 4WUNA 2YFXA 3R7UA 4FKIA 3E8CA 3P4KA 5C8MA 4KIPA 3KF4A 5J87A 5TF9A 5CNOA 4EKLA 4EQUA 3II5A 4M0YA 3OOMA 3TWJA 4CD0A 1ERKA 3SHEA 3F5GA 3VUTA 3RMFA 4QMOA 3COKA 2IPXA 4QTBA 2XYNA 5DE2A 5J8IA 3FZOA 3E63A 1FVTA 1PJKA 3ORIA 2C5NA 4CGAA 4X2NA 1GNGA 1W7HA 3ITZA 3P0MA 1XBCA 4MXYA 3R8VA 3ORKA 4FKPA 3R01A 1PXPA 5A9UA 5LCJA 2X2MA 3OFMA 3GU7A 3HV6A 4KS8A 2GCDA 1M14A 4AZVA 3DQXA 3PIZA 5J79A 1XH9A 3IPHA 3MH1A 4O27B 3VQHA 4C2WA 2C5OA 5CQWA 5D7AA 4FYOA 5L3AA 4IM3A 5KMOA 3C4XA 3KEXA 4GU6A 3FLWA 4R3RA 4O1OA 2B52A 3QXPA 4CKJA 3KMMA 3U9CA 3GU8A 4PMPA 4E6CA 5FEEA 2GTMA 3FKOA 4TPTA 4TY1A 3MVHA 3TNPC 2GNIA 2V62A 3K5UA 4MQ1A 1NVSA 2FO0A 3F3VA 4TYIA 2A19B 4I23A 4LYNA 4QNYA 4BDIA 2CNUA 3D7ZA 4I0RA 5HD4A 3RAHA 1P2AA 4AGUA 4IM0A 2XYUA 3EYHA 4FTJA 2XJ2A 4RIWA 1HCKA 5T6KA 2OJJA 2NRYA 3EHAA 3FLYA 4CFFA 4BR3A 4FV5A 3KREA 2X4FA 3FSKA 4KKHA 1OMWA 4HPUE 3L1SA 5LVPA 3D5XA 3VHKA 2IZUA 2OW3A 2ZV2A 4FKQA 1L8TA 2RSVA 5IA2A 4M84A 3EKNA 5JGAA 2VTSA 2HWOA 4V05A 2W05A 3RZBA 2KULA 3W2RA 4B7TA 4KIQA 3LLAA 5DG5A 4PP9A 4BWPA 3HMOA 3QAME 2W4OA 4M14A 3T9IA 4HOKA 3KXGA 5BPYA 5L6WL 3BLRA 3OCTA 3Q9YA 1OPJA 3P79A 3EOCA 2QNJA 4PUZA 3NRMA 4BI2A 3ALOA 3SA0A 3VUKA 3G33A 4BI1A 3Q9WA 4YURA 5GIPE 2G15A 3EZVA 3IG7A 4JI9A 4IZAA 4NFMA 4OLIA 5E1SA 5CU2A 4W4XA 1TKIA 4K9YA 2WEVA 4JBPA 5JSMA 1YI4A 1M7QA 4RZVA 3MA3A 1OPLA 4CRLA 3VRYA 3Q6UA 2GNLA 3MY1A 3QLFA 4FKSA 5FG8A 3UDBA 3O17A 5BVWA 1G3NA 3IDPA 4LV8A 2CLQA 4RFYA 4GKIA 3FQHA 1MRVA 4UB7A 4F1OA 3TV6A 3NVMB 3BLQA 4ZTMA 5M57A 2AYPA 3QA8A 3R7IA 3FSFA 3N9XA 4MD8E 3ZDIA 1W84A 3O7LD 2W1GA 4F70A 4KBAA 4N6ZA 4MXCA 1PRYA 5B2LA 4R5SA 2BZIB 1JBPE 4YBKA 3A2CA 5IA5A 4XHKB 5KHXA 5JK3A 5ACKA 1G5SA 4BDEA 3I7CA 2PVRA 5EKNA 4I93A 3LFSA 5AV2A 4BDJA 4H1JA 1IA9A 4EQMA 4O2PA 2P33A 2XMYA 3BGPA 2R3IA 4U81A 4FT0A 5EYKA 3IS5A 3PPKA 4IVCA 1SZMA 5I4NA 4TRLA 3LXKA 2YN8A 5AV0A 3PSBA 4BICA 3F69A 3BE9A 3DTCA 4NM5A 5CSWA 4ZEGA 2V7AA 3TJCA 4ZTHA 4DGGA 3RNIA 2V5QA 1PXLA 5AMNA 3BYMA 1O6LA 5K0KA 4ASDA 4QQTA 2X81A 2WQBA 5HD7A 4JIKA 4G3GA 2O2UA 2X4ZA 3TV7A 2R2PA 1PYEA 4WSYA 2E9PA 4QOXA 5KCVA 5EQPA 4DEEA 4W4YA 3BCEA 2GS2A 4M15A 3MVJA 3SOAA 4YR8A 2YWPA 4BCQA 4M66A 2O63A 4XRLA 1PMUA 1PXOA 3ZOSA 3MESA 4GUEA 1JKSA 3R7VA 5ETIA 1T45A 3PG1A 2W06A 1CDKA 4GYIA 3I6WA 5A46A 3CJFA 3NYVA 4IAIA 1REJA 4TZRA 5DEYA 5FEDA 4EH4A 3O0GA 4F63A 3ZM9A 3AOXA 3F6XA 2XJ1A 5LVOA 4E7WA 2ZDUA 4R7HA 4YO4A 4MD7E 5G6VA 3CCNA 3VW8A 3C4EA 3DLSA 1YQJA 4D2PA 3MTFA 3NW7A 2X2KA 3DFCB 3DKCA 3F2AA 1YXTA 4J96A 4ZLOA 2JIUA 4AS0A 4MAOA 1MQBA 1QCFA 3HRCA 3NIZA 3UIMA 4QP2A 4R5YA 4NL0A 2GHMA 3SOCA 5CYIA 1YKRA 3WZUA 4F0IA 3ZFXA 3NUAA 2JDTA 3LM0A 3M2WA 4L46A 4Y73A 1W98A 1IEPA 3DGKA 2KTYA 2GPHA 3ZSHA 3BHVA 4RA5A 3C51A 2UW7A 1KV1A 3MB7A 4D2VA 2JDSA 3TNIA 4S2ZA 4NU1A 4APPA 1VR2A 3ZLXA 1XH4A 5DYJA 4FKUA 3WZJA 4E5AX 3ZMMA 5IQFA 4L00A 5C03A 4J8MA 3OWLA 2VUWA 2Y6OA 1WVXA 3MB6A 4K11A 2X8DA 3FE3A 3I7BA 4DT9A 2GQSA 4EH5A 3JXWA 4Z9LA 1PXNA 4HCUA 1FOTA 2FA2A 5B2MA 3DBFA 5IU2A 5JGBA 4AGCA 2EU9A 4M12A 4X2KA 3SVVA 3CBLA 2R64A 3VS4A 3BELA 4GKHA 4O7VA 4FTAA 2XS0A 4DFBA 3EQPA 3HV7A 3TXOA 2OG8A 2NO3A 2UVYA 2CCIA 3KF7A 4D2SA 3KXHA 4I4EA 4D1ZA 4CCUA 2C5VA 4IW0A 4PDSA 4B8MA 4YC6A 4CXAA 4FOCA 4HW7A 5KX8A 3LQ3A 3UIUA 3V04A 4FIFA 4YJOA 3DBEA 2WFYA 4PL3A 4RVMA 3UOLA 3U6JA 4ZY6A 4QTCA 4RFZA 5AX3A 4F99A 3TKUA 4D1XA 2GFSA 3WYYA 5LMKA 4GJ3A 4X7QA 3JVSA 4OBPA 4BBMA 4AFEA 5FBOA 2CN5A 4O0SA 4C4IA 5EDQA 3RK5A 3CTHA 2GDOA 5AR4A 4DGLC 4DITA 3N4UA 3PY3A 3CR0A 3F61A 4PX6A 4QMYA 4AOIA 4X3JA 2C6DA 3R7GA 5IQIA 2WQOA 4ZZMA 1FVRA 4C4GA 5ACBC 4F9BA 4BCGA 1JKTA 4HVIA 1FINA 4QMUA 4WRSA 3FI8A 2PVFA 5HLWA 4LGGA 4AZFA 4Z3VA 5KUPA 2WTDA 5AX9A 3CGFA 3UG2A 4A07A 3EIDA 2GQGA 4EOLA 1W8CA 2W1FA 3VBWA 4A7CA 5AUUA 3F7WA 4JAIA 5LCKA 3BHYA 4G6LA 4E6DA 4IX3A 3UZPA 1BL7A 5C26A 4RBLA 4IAZA 5FTGA 3QTXA 3F66A 2J9MA 2VWBA 5I5ZA 3MFSA 2XNBA 1GZNA 4FTRA 1BX6A 4FTKA 4D28A 4YC8A 2QURA 2YJSA 3RPSA 2CKEA 1R1WA 4QTEA 1PY5A 1ZMWA 4AW5A 2P2HA 3FBVA 4II5A 4YZ9A 3H3CA 3OOGA 2YM8A 1YHWA 4EK3A 4BBEA 1TQPA 3A8XA 3LAUA 3UQFA 3VS7A 3PPJA 3E92A 4IB5A 4C4HA 2RFDA 4YHJA 4PDYA 3A60A 1Q4LA 4R7BA 5DNRA 3KN6A 5CT7A 5I9XA 3IDBA 1H1SA 2YM4A 4XLVA 3WOWA 3QX2A 2QLUA 1YWNA 2YM5A 2WMTA 4U80A 4FT3A 5C01A 4X2GA 2UV2A 3UQGA 3AT2A 4E4MA 2PUUA 4P4CA 4P5QA 5LMKC 2YDIA 4L7FA 3HEGA 4ANLA 5JN2A 4JX3A 3ZXZA 3VAPA 3D15A 2WTCA 4AOJA 2WU6A 2UZEA 3D4QA 3DNDA 3ZHPC 4WUAA 5IH6A 5HO7A 3MYGA 3D5VA 4WNPA 5AP7A 5AUWA 4DGNA 1PMEA 3WF8A 4MEDA 2PE1A 4PL5A 2ZM4A 3AMYA 5EH0A 4UMPA 5ITAA 4H3BA 4ACGA 5M08A 3Q4TA 4BHZA 1OIQA 1UU9A 4JAJA 4TYGA 2JIIA 4QYGA 5BYYA 4GEOA 2BDJA 3KULB 2WEIA 2BUJA 4GU9A 3I60A 4IHPA 4JLCA 4XEYA 5HG7A 5GNKA 2BKZA 4DGOA 4NCTC 5EYCA 4FV4A 2YHVA 4ZY5A 4ZS4A 3OY3A 3POZA 4M3QA 4FC0A 1KOAA 3G9LX 4M67A 1UKHA 2VRXA 1H08A 2ESMA 4O0VA 2VN9A 3GU4A 4RX9A 4FG9A 3ZLYA 3Q4UA 4J8NA 2A2AA 2EVAA 2YM6A 5JQ5A 3QUPA 4GT5A 4YZMA 5E7RA 4XG2A 4GUBA 3GC9A 4RJ8A 4QTDA 3RAWA 3ZC6A 1Z57A 2QR8A 5TKDA 4UN0C 4ZAUA 4FX3A 4QD6A 3FLSA 5GJGA 3FV8A 2UVZA 4O21A 1XH8A 4Y83A 3EN7A 1VEBA 4QMLA 4DH3A 5EK7A 4FKRA 3RM6A 4EOIA 4MK0A 1YDTE 4FVQA 4IVBA 3PIXA 1SNXA 4IANA 4WSQA 4X21A 3R22A 4P2KA 3VIDA 4U43A 1V0OA 3E7OA 3VJNA 3VF8A 4CEGA 3VULA 5FM3A 1A06A 3QTSA 2HW6A 5B0XA 3ZSIA 1IG1A 4JRVA 4K2RA 2G2HA 5BVNA 4U7ZA 5A14A 1ZZLA 1CKPA 3NAXA 2BDWA 4U79A 4AT3A 2Z7QA 2ITZA 1ZYCA 3L9LA 4GYGA 1GIHA 3R7OA 3ZTXA 4ANOA 3IGGA 4NW6A 5CT0A 3MS9A 4IBMA 3ZO3A 3PYYA 3O50A 2YEXA 3NWWA 4KABA 3DS6A 3V8WA 5BUIA 2PZRA 4FTIA 5D1JA 2R3KA 5HBEA 2J0LA 2IVUA 2Z7SA 3D94A 4IAYA 4L53A 3GOPA 5AP0A 2VTLA 4ZLZA 2UZNA 4H3PA 4IB1A 3WZDA 2PUPA 2QU5A 3CKWA 4CTCA 4G3DA 4WBOA 2R3JA 4PMSA 4EK4A 4DEAA 1WVYA 5M4CA 1UWJA 3QC4A 4YZNA 3L9PA 4ASZA 2XK4A 4LRKA 4AT4A 3R83A 3U87A 4E4LA 5K5NA 2OJGA 4D2TA 2R4BA 4L3PA 4NIFB 3NR9A 4RWLA 4FZAB 4C57A 3QQHA 4BKZA 3KK8A 4YTFA 2B9FA 5HTCA 1VJYA 3UIXA 3SD0A 5E4HA 3DB8A 3DV3A 3R9DA 4A06A 3O71A 1QPCA 1M2PA 3VQUA 4AW1A 4AF3A 4F7JA 3PY1A 4KD1A 5E8ZA 3KCKA 3LFFA 4MXAA 3ANRA 3COHA 4O7WA 5CALA 5HO6A 3IK3A 4QQ5A 1Y6AA 4A9TA 3VHEA 5FXSA 3MV5A 5CSXA 2UZBA 2IZRA 4HNIA 3CE3A 2W5BA 4Z55A 5C1QB 4LMUA 1U46A 1ZMVA 2BRHA 2C69A 4TXCA 4XJ0A 4BHNA 1RE8A 4L9IA 4AN2A 4BWXA 4GSBA 4F65A 3ZH8A 4E26A 3ORNA 5CTPA 1PKGA 5EI8A 5JZNA 3QUDA 5K4JA 3JY9A 4MF1A 4J71A 3BYOA 2IW6A 3NGAA 4XG4A 4G2FA 5F94A 1UU3A 3OCGA 3BU5A 3NUYA 5CEMA 3FMMA 2XK6A 3GC8A 3PXFA 5DHJA 2UW8A 1GAGA 3G51A 5I9WA 4F7SA 3GC0A 2GNFA 3RCJA 4ACHA 4Z7GA 5GINE 3SX9A 2J4ZA 2I0YA 4ZJJA 2NP8A 2WMQA 3VS1A 3W8LA 2EXCX 4I3ZA 4GW8A 4O7SA 1YWRA 3MSSA 3EZRA 2BROA 3QRJA 1J7UA 4OTDA 4O82A 2VWIA 4RZWA 5ANOA 2ZMDA 2ITPA 4Q9SA 4BCNA 3D14A 4A4XA 3TUCA 2V7OA 1J1BA 1ZYJA 1GIIA 3F3ZA 5HNBA 2Q0BA 3SW4A 5JFSA 1YOMA 2C6IA 4E6AA 2DQ7X 3QFVA 1NA7A 1ZYSA 5D7VA 4JVGA 1ZOEA 3G0FA 4GFOA 1G8AA 2E9OA 2GQRA 3FMNA 3HMPA 4G31A 1R0EA 1R78A 2G2IA 2QOCA 3GCSA 4F7LA 1KE9A 1P4FA 5DN3A 4C4FA 4TT7A 2AC5A 3PVWA 4K1BA 2P0CA 5ANJA 3ZC5A 3DNEA 4GVAA 2YIYA 3U6HA 3L8SA 4B8LA 4FKWA 5DGZA 2PYWA 4DLJA 3ENHA 3UVPA 4FSZA 4RWKA 1Q97A 4MXZA 4EOPA 3VC4A 1W0XC 3LM5A 5M51A 3HA6A 4HVDA 2XF0A 4FMQA 4MWIA 4IC7A 2BPMA 3MH3A 3VS6A 5A4TA 2ERZE 1GZ8A 4DG3E 3KULA 3PXRA 1YRPA 3FYKX 3W8QA 3QTQA 4B99A 3I5ZA 4NM3A 3FXZA 3ROYA 4YP8A 5TR6A 3V5QA 2DYLA 3RP9A 2QOKA 3UJGA 4CRSA 1J3HA 2VX0A 2XM9A 4UWCA 3UO6A 4CZUA 5KBQA 4PNIA 4R78A 1ZLTA 5IA1A 3SG9A 2J51A 3VWAA 3FC1X 5FP6A 2VTIA 4FNZA 5GZ8A 3NYNA 3TDVA 2XKEA 4O84A 2PPQA 5EDPA 3ATSA 4J97A 4J95A 4FEWA 4F7NA 4LQMA 4BDFA 4QMXA 5H9BA 4IJ9A 5FM2A 1JKKA 4O0UA 5ETCA 3BV2A 4MBIA 3R7EA 1H27A 2PZIA 2GSFA 4D0WA 5IMEA 3ET7A 5DRBA 5AR5A 5DVRA 4YLLA 4PRJA 4U3YA 3DDQA 4G9RA 3EKKA 4W4WA 3W32A 4AGWA 5K3YA 4E8AA 4RA4A 3R00A 3PJ2A 4BTMA 4NEUA 2R3LA 3EFJA 1WBWA 3PFQA 4IAFA 5EM7A 4CNHA 3TUBA 5C27A 4H36A 4ZZNA 4S31A 5HE0A 3R7YA 4M0ZA 3S00A 3CD3A 3D83A 3U55A 4I21A 3RJCA 4ZJVA 2F4JA 2UW9A 4OTPA 4Y95A 2YACA 3OW3A 3W2QA 4C58A 3NNXA 4G16A 3JR1A 5HZNA 1YWVA 1OZ1A 2I0VA 5HTBA 4IM2A 4BGGA 4CFWA 4O2ZA 2X0GA 4EOKA 4XRJA 4QMTA 3U8WA 1NT2A 2YIXA 4AT5A 4WBBB 1OBGA 2Y8OA 3B8RA 4D4YA 3OEZA 2UW0A 3ZFMA 4C0TA 2RIOA 2C47A 4PNKA 3K54A 2VO6A 3B2TA 2UZLA 3MN3A 2R3NA 3ZXTA 1XHAA 2UW6A 3CGOA 4Z16A 2H96A 2YCSA 5ANKA 4F6SA 2X8EA 4DFNA 3BHHA 3HV4A 3KRRA 4AN9A 4ENXA 1WBVA 5LQFA 2H34A 4NIFA 2WPAA 1M52A 4EWQA 4GJ2A 2G2FA 2YCRA 3O51A 4LOOA 2XKCA 2QQ7A 2QR7A 3TT0A 3QRKA 4JQEA 4G3FA 4WT6A 2FSTX 3AG9A 3DCVA 4QP6A 4WOVA 4ENYA 5M06A 1CKIA 2JKKA 3LXLA 3SRVB 5IEYA 4YPSA 2JIVA 2XIXA 3QL8A 3F3TA 4FUYA 3SV0A 4F1MA 3GC7A 3KN5A 4RRVA 2A27A 4U42A 5HG5A 1IAHA 2R3PA 2OI4X 4ZSAA 3MH2A 4AA0A 4DEBA 4MD9E 4QP9A 4MNEB 4LI5A 3I4BA 4D9TA 4E5BA 3TUDA 2XCHA 3MW1A 4MVFA 3K5VA 4LOQA 2YIWA 4QTAA 2B9HA 1KV2A 3KC3A 5AP2A 2JC6A 5AP6A 3V5TA 4H05A 4O7LA 5CZIA 4ACDA 3WF6A 5BVOA 5ANIA 2C5YA 4OT5A 4AQCA 3R6XA 4YHTA 4YUQA 3LZBA 2B9IA 5KO1A 4TWNA 5D12A 5E8VA 2YLFA 5BNJA 4D58A 4A9RA 2GHGA 2B7AA 2W0JA 4NFNA 5A4LA 4FSWA 4FIHA 4YJPA 4J7BA 4FL1A 1OIYA 3TL8A 3ZBFA 5EOLA 4FR4A 4QP7A 2F7XE 3WZKA 3ZZWA 5CVHA 4BRXA 4XG3A 3D0EA 2YIRA 4WD5A 4L01A 3TNQB 4EJ7A 4IXPA 1SNUA 2QKRA 3EN9A 2PHKA 4FVRA 4FUXA 4TYHA 2FYSA 3QQKA 4YJUA 4DE4A 4GIIA 2VWZA 3ERKA 3FZPA 3BPRA 4BN1A 1AQ1A 2PUIA 1URWA 3NVKI 5K0XA 4BCFA 2PZPA 2XEYA 3DTWA 3EQIA 4U5JA 2VNWA 4Q2AA 3CD8A 1J91A 3PRFA 4BCKA 5FTQA 1G8SA 4R7IA 4UV0A 1ND4A 5F20A 3PVBA 3HRBA 3Q96A 4IJPA 4MQ2A 2O3PA 3PVGA 3H10A 2E9NA 3LFNA 4XG8A 2ZOQA 2B0QA 5CSVA 4AE6A 3NCZA 4FODA 3I79A 3QQUA 5CVGA 3UC4A 4W9XA 4WG3A 4LOPA 3C50A 4C3PA 4JG7A 3CQWA 1GOLA 3FZTA 3GXLA 4KIKA 3VF9A 2VGOA 3PZHA 3F5UA 4AZSA 3QRTA 5E8YA 3GOKA 5HTIA 2W1IA 3GCPA 3C4ZA 4ID7A 3BBWA 3LXNA 3UO4A 1TQMA 4UYNA 1O9UA 2WMVA 5B7VA 4RVTA 2XKFA 3ROCA 4DH5A 3FPQA 5HNIX 1SVHA 1OIUA 3HDMA 4TWOA 4I6FA 3U9NA 2X7FA 3D7TA 4F9CA 3BE2A 3RAKA 1FPUA 1CTPE 3QYWA 4R8QA 5ETFA 5FD2A 4AAAA 3PA4A 2PTKA 4LV5A 2OF4A 4O1PA 4FSQA 1H1PA 5CZHA 5D41A 3KQ7A 2RGPA 1PMNA 2W96B 2QOLA 4GFMA 1UWHA 3DY7A 3FQEA 4D5HA 2OKRA 5HI2A 3DAJA 4MNFA 4KUJA 2A0CX 1L3RE 4FGBA 1RDQE 2UZTA 4BZNA 3UZTA 3WIGA 3MIAA 3KMWA 3P7AA 3L8PA 4E1ZA 3QA0A 2QOFA 5LARA 3O8TA 2QOIA 1VYZA 3GB2A 2ITWA 3AQVA 3Q2MA 2VAGA 2W1ZA 1OM1A 2GHLA 4PQNA 3PSDA 3GUBA 5HO8A 4CG8A 1XWSA 4NT4A 4LUEA 5IQHA 3R63A 5HOAA 5HLPA 3UVQA 3JUHA 5E92A 4D2WA 2QOOA 4D9UA 4WNOA 5L4QA 3C4CA 1JWHA 4C02A 3E8DA 3UG1A 1M2QA 4PTCA 3MPMA 2IW8A 4RIYB 3UGCA 4JX7A 5K5XA 3ORPA 4EH8A 4EL9A 2ZV9A 1BL6A 3F3WA 3GP0A 3PZEA 4FK6A 3DZQA 1ZYDA 4JBQA 4XG9A 5JH6A 4C7TA 3AC5A 4UMTA 1JPAA 3QX4A 3WF7A 4C2VA 2AUHA 3O8UA 3PXQA 4YPDA 5EKOA 4S30A 4RG0A 1WBNA 1WBTA 1FQ1B 1ZYLA 2OGVA 2OIQA 3DKOA 3FI4A 4FEQA 4GIHA 2FSMX 2E2BA 5H8BA 2HY81 5IQGA 4ANSA 2YM3A 4UX9A 3TACA 4IX6A 1CM8A 3MDYA 4FV7A 1SVEA 3NNWA 4BTKA 2GTNA 4ZSGA 4QPSA 5DR9A 4C62A 3MY0A 3QGYA 3QCQA 4EHGA 4NM0A 5IUIA 2F57A 2XB7A 2XNGA 2Y7JA 2I1MA 1OITA 2W17A 3EL7A 1F0QA 4FV0A 5EYMA 4U8ZA 2JFLA 1F5QA 2JFMA 1JKLA 2Q0NA 3ORMA 2QHNA 3GU5A 4USDA 5GJDA 4QP8A 4AE9A 4QMVA 4XUFA 2YITA 3WYXA 5BMSA 3T3VA 3ZO1A 4BGHA 4IWPA 5CLPA 4MH7A 3CTJA 5AWMA 5HEZA 2WIHA 4H58A 1WFCA 4UALA 3VRZA 5BVEA 2J90A 5JT2A 4UXQA 4U6RA 4MNEA 4HVHA 5I0BA 3TIYA 1YI3A 2JBOA 3KXZA 3QTRA 4AXAA 4E4XA 3WZEA 2R7BA 4IAAA 4BCIA 3LMHA 5CASA 3N51A 1P14A 2BAQA 5AR3A 4EK8A 1Q8UA 2YAAA 3BIZA 2GU8A 3W55A 5IPJA 4BWKA 3LCKA 4KKEA 3O7LB 2QO2A 3HVCA 4LG4A 4APCA 5M4UA 4FG8A 4R1YA 4BZDA 3RINA 2WHBA 4P90A 2XK8A 2O0UA 4XLIA 4BYIA 4KNBA 1WVWA 4X3FB 3HX4A 1GIJA 4YZBA 3OCSA 3A8WA 3TIZA 3DAEA 2JKOA 5AUTA 3TG1A 4EC8A 4PPCA 3ZUVA 3Q4CA 4LL5A 4QMMA 3O8PA 3NNUA 4IQ6A 1R0PA 4YSJA 2F2CB 3O96A 2YCQA 4MXXA 3ULIA 5LVLA 1H8FA 5K4IA 4UMQA 1HOWA 4EOSA 5FDXA 4JG6A 4BGQA 1DAWA 4LRJA 4U97A 3DQWA 2YAKA 3CJGA 3OWKA 5BYZA 3KB7A 3I5NA 1XBBA 5AAFA 4RIXB 4UBAA 3S95A 3ZBXA 4ZTLA 3BV3A 3PRIA 4DT8A 4HZRA 2JD5A 2ZM3A 3KXMA 2I6LA 3HGKA 1Q5KA 4AZTA 2OFUA 3G2FA 2B53A 3FXXA 4HGTA 4LGHA 3REPA 3HMMA 5C4KA 4ANQA 3OWJA 1Q62A 3Q9XA 1PF8A 3RALA 2Y0AA 3BU3A 4LM5A 4EKKA 4MXOA 5J7BA 4RWJA 3WE8A 4EORA 1OVEA 2VTQA 2WNTA 3LHJA 4BKYA 3PJ8A 4O38A 2PMLX 4O86A 2FSLX 3DFAA 4BBFA 4JOAA 3UNJA 1XH6A 3IW7A 3NNVA 4CMOA 1UU8A 2NRUA 4RX7A 5L6PA 2HZIA 3FQSA 3UMWA 1XH5A 3F88A 1R39A 3A4OX 4GCJA 3RPOA 4BCMA 4EI4A 4BCPA 3E87A 3W18A 5HVKA 3LQ5A 3MI9A 5AUZA 2GNGA 5LMBA 4ZK5A 4ORKA 2OXYA 4YZDA 3JS2A 3VO3A 1P4OA 3FL4A 4EZ7A 2DWBA 4LUDA 2RFSA 4DTAA 3V8SA 5ANEA 3BQCA 3KGAA 4NCTA 5DT3A 2HXQA 4ZTNA 3LJ2A 5IQBA 1BUHA 4BDAA 3PPZA 3Q6WA 1MUOA 4MBJA 1IA8A 1PKDA 3IGOA 3QQJA 3K2LA 2FH9A 5KKRB 5ICPA 4FT7A 1XR1A 3CC6A 2LGCA 2OWBA 3FLZA 3R02A 4M97A 1JLUE 3UZRA 2RFEA 1ZY5A 4NH1A 1YVJA 4JQ7A 3F9NA 2ETMA 1OKVA 3NCGA 4PDPA 4WHZA 1X8BA 5IQAA 3V6SA 1KWPA 4JDIA 2OZAB 4QQCA 2B54A 3L8VA 4U3ZA 4XS2A 3ORTA 3PP1A 4TYJA 5DPVA 3LKMA 3SGCA 4RJ5A 5AEPA 4AGDA 2JGZA 1A9UA 2JITA 1OL5A 5DFPA 1RJBA 5HQ0A 4YNOA 4OTIA 1UV5A 2VWWA 5FBNC 4HGLA 3TJDA 1IR3A 4FIGA 3QQLA 2OICA 2C3LA 3NIEA 2BRMA 4ONAA 4HJOA 4PY1A 4N70A 3RPYA 4FVPA 3LMIA 3GEQA 5FUTA 1YW2A 5HNGA 1UA2A 4I4FA 4WO5A 1Q41A 2VWXA 5FXQA 4RIYA 1ZMUA 4FTTA 3R9OA 3TZMA 3VBVA 2J0KA 4FSYA 4BVUA 3EFKA 3FMEA 3GQIA 3RI1A 3UVRA 2ZV7A 1V1KA
chains in the Genus database with same CATH superfamily
4IWOA 2IWIA 2WELA 4NSTA 4O0XA 3LQ8A 4ASEA 4DHFA 4NTTA 3U6IA 3SXRA 2WMBA 2GNJA 2XH5A 3ATTA 3KRJA 3KY2A 5A4CA 4JMQA 3GCQA 1B38A 4FNWA 4AWIA 3TV4A 4RX5A 3GU6A 4M8TA 5AM6A 3Q4ZA 4IADA 4DEGA 2IEWA 2XNPA 3TZ8A 1OGUA 4WG4A 3TEIA 3JVRA 2R0IA 5CY3A 4RC3A 3UP7A 2QLQA 3L9MA 2OJ9A 3O23A 4PL4A 2WU7A 4UZDA 4DN5A 4A9UA 3C4WA 4UMUA 4F09A 1Q3WA 1V0PA 5HG9A 3G6HA 4AA4A 3NUSA 3Q2JA 4QP1A 4OAVB 2HWPA 2HOGA 5H8EA 1OL6A 3DDPA 1OB3A 3KXXA 2VU3A 3NUNA 2YLEA 3P7BA 4AW0A 3A7JA 5A6OA 4HYIA 4CLJA 5TT7A 2BIYA 3FMDA 3FZRA 4DG0E 3EWHA 2O8YA 2NNWB 3W33A 4L52A 4DHIB 3R2YA 2IVVA 4GK2A 1ZOHA 1YDRE 3A7GA 4N57A 3CQEA 2PK9A 4YHFA 4IC8A 4CLIA 5LMAA 5CEKA 3V01A 2ITQA 4DH1A 3DBDA 4A9SA 4FE2A 2QOBA 5AV1A 3DAKA 3HLLA 4X3FA 3EN6A 4RQVA 2GNHA 4FV6A 4BTJA 3RHKA 4AP7A 4JJRA 1OL7A 2X0QA 3CY2A 3NX8A 4OBOA 3BHUA 4DCEA 4YJVA 3U4UA 2XVDA 3OXIA 5FTOA 2BTSA 4Y46A 4PTEA 1TZDA 3BWFA 5HCYA 5F1ZA 4FV8A 2QC6A 5E8UA 1EH4A 1Q99A 5HLNA 5DI1A 2QD9A 3W0SA 3A4PA 4L3LA 3TZ7A 4AOTA 3LOKA 3AGMA 4O96A 4NJ3A 4RSSA 4IZ5A 1YHVA 3EYGA 4CKIA 2OK1A 2H6DA 2BRGA 4FA2A 3DT1A 4EHZA 2GMXA 3EH9A 4FSUA 4S34A 2WB8A 2RL5A 1LEZA 5DEWA 3OXTA 3T8OA 3VNTA 5FLFA 4ERKA 4XV1A 3OEFX 3MPAA 3UYTA 3QD0A 3W16A 4FSNA 5IA4A 4DINA 5HX6A 3LFEA 5DRDA 3EQRA 5AP4A 5HVYA 4CZYB 4EOMA 4J52A 2PVLA 2JDVA 3CP9A 4BDDA 2BMCA 3R73A 3CIKA 4ZP5A 1S9JA 3PWYA 4L68A 3VBXA 4FI1A 4IH8A 2J2IB 1M17A 1M7NA 2OXDA 3ETAA 4DFXE 2WTVA 3A62A 4FT5A 3AMBA 4IB3A 4MYGA 4R1VA 4RJ4A 3LCSA 3DK6A 3QZFA 3F7ZA 3U4WA 3UO5A 1XJDA 2ZB1A 2XNEA 4QMSA 4WRGA 2RFNA 2V0DA 3D5WA 4C8BA 2ZJWA 2PMOX 3FMJA 3OF0A 5AUVA 5IF1A 2UZWE 4X3FC 3FI3A 5ANGA 3QZGA 5EI6A 2J5EA 1MP8A 5B2KA 5J9YA 4RVKA 3EB0A 2UVXA 1KE8A 2ZAZA 4PMTA 2EWAA 4OTQA 3QU0A 1ZARA 1Q24A 4F0GA 5C8NA 5T68A 4YTCA 3KCFA 4WKQA 4U41A 1ST4A 2P55A 3VBYA 2HZ4A 2XK3A 3MJ2A 3KRLA 2LAVA 4UWBA 2OFVA 4C3RA 2Y4IB 4JL9A 4KSPA 2VTPA 1QMZA 5IISA 3NZ0A 5DIAA 2HK5A 4BYJA 1ATPE 3R0TA 5EYDA 4LRMA 2JKMA 4EHEA 3TTIA 4K6ZA 5AA8A 3QUEA 3LCTA 4QDEA 4QT1A 2YWVA 1QL6A 2QG5A 2VZ6A 4NJDA 4YBJA 4E4NA 3ALNA 3QCSA 5IA0A 2ERKA 3QRIA 5M4IA 4Q5HA 1ZOGA 2XK9A 5GJFA 2WMSA 4C4JA 2WZJA 2X9EA 2X9FA 2C6MA 4HGSA 5HGIA 2CMWA 4K18A 3ZEPA 4GV1A 4BL1A 3HP2A 3UOKA 3AKLA 4FTQA 5I9ZA 3TYKA 4MWHA 4GFGA 1TQIA 5AR7A 1YHSA 4J53A 3OBJA 2G01A 5LXMA 4R3CA 3IW4A 2WO6A 4FKOA 3POOA 3OVVA 4DHZA 3AT4A 1GJOA 5L8LA 3W10A 1M2RA 4HZSA 5IMXA 1YDSE 5BVFA 1JSUA 2CKPA 5HIBA 3F2NA 4ZTSA 4BIEA 1OUYA 2GFCA 3FY2A 5E91A 5DMZA 4TN6A 5KZ0A 1H1QA 4ZXTA 4X6QC 4C36A 3CPBA 2XA4A 3VONA 3KFAA 5ETAA 3V3VA 3MA6A 5HX8A 4ALVA 5FDPA 2YJRA 4I22A 4U0IA 2BRBA 3R1YA 2DUVA 2X8IA 3VVHA 1U59A 3FUPA 4ZOGA 5BX0A 4J99A 5CEOA 1A48A 2IJMA 2OJIA 4G6NA 2V55A 3UPXA 4EQCA 3W2SA 4JDJA 1NW1A 2W9ZB 3PWDA 1P5EA 4DEDA 2PVKA 5A6NA 3ODZX 2CGVA 3WF9A 3WIKA 5KKRC 2CJMA 4NKAA 4OTHA 2W1EA 3UODA 3W0OA 4W9WA 5EQYA 5C4LA 2WTWA 4IAKA 4YNEA 2BFYA 5F9EA 1KOBA 3NW5A 3TDWA 1H28A 3WI6A 3KIOC 4GK4A 4ZSJA 5IEXA 3EMGA 3RBWA 4CFXA 3R1SA 4XP0A 2B1PA 2OXXA 3HMNA 3PIYA 4JBVA 4QMWA 5E8XA 3TI1A 3ZDUA 3LXPA 3JYAA 3LE6A 3E62A 3QBNA 4V01A 3RTPA 2WQNA 4TNDA 4QRCA 4E73A 1PW2A 2E9UA 4FV3A 4KBCA 3DB6A 4UMRA 5JKGA 3MGYA 3RWQA 3HMIA 5AAEA 4HYSA 1WBOA 5CI7A 2WD1A 3KU2A 4QO9A 3HAMA 2BALA 4AX8A 1W2CA 4I0SA 3BYUA 4O4EA 4BDGA 4EEVA 2NYAA 4E6QA 4GVJA 4CTBA 3QD4A 5CU4A 3S4QA 4J1RA 4XP3A 5EM8A 4C3FA 2R3QA 2Y4PA 4ZTRA 2OH4A 3D5UA 2X39A 5GHVA 4FZ6A 3FPMA 5EOBA 3LFBA 3ZO2A 3NUPA 3QD2B 5J95A 3Q9ZA 1PXIA 3C4FA 2X6EA 2CGXA 3C5UA 1OUKA 2CCHA 4O4FA 3ZUTA 2PWLA 3IQ7A 2C0OA 4V04A 5ANDA 4R77A 4OTRA 3A61A 4N0SA 5E1EA 5BVKA 4CT1A 2PVYA 2FB8A 3DA6A 4ZSLA 1T46A 4KWPA 3F5XA 3SW7A 2CKOA 5T3QA 3CY3A 3DKGA 3OTVA 3ACKA 2R9SA 3OZ6A 1H1WA 3HYHA 4WG5A 1U5RA 4FNYA 5BMMA 4YC3A 3W0MA 4GG5A 3RNYA 5LVNA 3OW4A 4BZOA 3UC3A 3G5DA 1H07A 4KB8A 4WNMA 3RK9A 4BIBA 4GRBA 4BCJA 3NDMA 3SG8A 5CU3A 4HCTA 2IO6A 4LL0A 4NYEA 4FKVA 4W8EA 2W5HA 3EN5A 3GFEA 1OBDA 3IW5A 3B2WA 1Y91A 4BFMA 1Y6BA 3VUIA 4EOQA 4ZJIA 5KMJA 3M42A 4M13A 5IUGA 3R2BA 2V22A 2XNNA 3W2CA 2OO8X 4BDHA 2XP2A 4IWDA 4PPAA 5JEBA 3LJ0A 2R7IA 2J0JA 4CG9A 2ITNA 3GT8A 4IDVA 3NUUA 3ZZEA 2UW4A 5D10A 2JAMA 5BUEA 4G5PA 4FSTA 4FTNA 5E9EA 4DA5A 4DF3A 3NUXA 3ORZA 5E8TA 5L8JA 2C6KA 4FJVA 3AD6A 2R3FA 3QWKA 4O91A 4YGAA 3QWJA 3ZCLA 2VO0A 4EOOA 4EH6A 3UDSA 5LJJA 3ENMA 5DH3A 2E9VA 4KINA 4O6EA 1KE7A 3I0OA 3ZLWA 1K3AA 1UVRA 1FVVA 4FT9A 4TWCA 1SM2A 3EQDA 2YERA 4CFNA 5GIOE 3E3BX 3R9NA 2WIPA 3CKXA 3KVXA 4O81A 4GH2A 3DXQA 4XMOA 3ZFYA 5CXHA 4FTOA 2BAJA 4ZS0A 3R9RA 3DOGA 2QOQA 4BKJA 2PU8A 3Q3BA 1DI9A 4PTGA 5KMLA 4O7YA 3LLTA 1YXUA 3PXKA 2WOUA 3EJ1A 4IZ7A 5HKMA 4B4LA 4XH6A 2WTKB 2C4GA 5M55A 2VV9A 4AZWA 3RVGA 4YLJA 5CU6A 2BKKA 3OUKA 1J7LA 2WQMA 4DG2E 3MPTA 4O4BB 3FEGA 4C33A 2UW5A 4NKSA 5FEQA 5CNNA 2HIWA 2PUNA 2PMIA 3UMXA 3QTWA 5FWKK 1JSTA 3QLGA 3PA5A 2VTAA 3S3IA 4ZZOA 5M4FA 3ZM4A 4O7TA 2HELA 1UNHA 4I41A 2SRCA 2ZMCA 3OROA 5A54A 4QMNA 3SXSA 5CAUA 5HCXA 3BI6A 4CCBA 3C5IA 2I0HA 2C30A 3C0IA 5EHLA 4I5HA 2XIZA 4XCUA 5CENA 4ALUA 2X2LA 2VWYA 3A7IA 5J7HA 4CVAA 3RZFA 1Y57A 2C6OA 5L2IA 1KUTA 3T3UA 3PG3A 2J7TA 3MH0A 5KMIA 5FRIA 1IAJA 4S32A 1Y8YA 2C0IA 3GI3A 5F4NA 3BKBA 1PMVA 4BI0A 1JAMA 3ID6C 5H8GA 1YXXA 1NY3A 2XKDA 3NSZA 2JKQA 1WZYA 2P4IA 5LWMA 1YXVA 1LPUA 1Q8ZA 3OT8A 4XNEA 2QO9A 3FMLA 3VN9A 4EHVA 5HE3A 4E93A 3KRXA 4OAUC 3BQRA 3COMA 3M11A 2YZLA 3U54A 4GK3A 5G1XA 3HKOA 4G1WA 3QF9A 5LVMA 2WKMA 2YIQA 3ODYX 3EQBA 3OTUA 2QI8A 4FTMA 4OR5A 3DU8A 5HU3A 4QNAA 2Y4IC 5FXRA 5CEIA 3PLSA 4BCHA 3E8NA 1MRYA 2XUUA 3MFUA 4FK3A 3W1FA 2JLDA 3HL7A 3AC2A 3VJOA 4JS8A 4MHAA 2VO7A 5AIRA 1OL2A 3GGFA 4IVDA 3QALE 4Y5QA 3W0QA 2AC3A 3C0HA 3QC9A 2X6DA 4UZHA 3PXYA 4JDHA 4MX9A 4U40A 3R8ZA 4DBNA 2PVNA 3DJ6A 3DK7A 4BC6A 5AUXA 5IH4A 3M1SA 4XOYA 4RLKA 4DFZE 4UYAA 4D4RA 3GFWA 3V5WA 2R0UA 2WTIA 3R1QA 3BYVA 3R8LA 4FKLA 2VTOA 4RT7A 5CSHA 3K3JA 3DJ5A 2PVMA 4I1ZA 3BWJA 4K77A 5HCZA 3RKBA 2OH0E 1B39A 4RJ6A 3IKAA 2I0EA 4OTFA 1OPKA 1YOJA 1PXMA 4FV2A 3ZSGA 2EB2A 3UDZA 1VYWA 2REIA 4JQ8A 5AM7A 5I3OA 1IASA 4K8AA 3G90X 3QTUA 1W82A 2ETKA 1OKWA 5GZ9A 5KBRA 2ITUA 2J5FA 4HCVA 4GT3A 4UEUA 4EYJA 2BZKB 2EUFB 3AC1A 4CMTA 2XARA 3ML1A 3KRWA 4G9CA 4KRCA 5CI6A 4TL0A 2BR1A 2ZV8A 3NEWA 3OMVA 1H0VA 4BCOA 4FOBA 2YDKA 2ZFYA 1ZY4A 4F78A 3EL8A 3UPZA 2HAKA 4DHJA 2R3MA 4I5MA 4JDKA 3ULZA 3BLHA 1FMKA 3IECA 3ORXA 5IQCA 2FGIA 3NPCA 4U44A 2HZ0A 2JEDA 5J5SA 2C3KA 2Z7LA 1BYGA 2YM7A 3GNIB 1RW8A 4ITIA 2WTJA 3NS9A 4IACA 5JFVA 5AFVA 3H0YA 3FWQA 4QQJA 3QRUA 3CEKA 3OS3A 3SRVA 4EBWA 4C34A 4ACMA 5JFWA 4DBXA 4O0TA 3BZ3A 3FKLA 3ELJA 2OU7A 2YCFA 4PF4A 2YDJA 4AA5A 3QGWA 2BZHB 5CEPA 3LW0A 2ZYBA 3OG7A 3PUPA 3DBQA 3P7CA 3QHWA 2VX3A 2ACXA 3BRBA 3FHRA 2WMRA 4AU8A 3P08A 2BZJA 4OGRA 3W2OA 3ZRKA 4R6VA 5L2TA 4FEUA 2BFXA 2PY3A 3OHTA 4YTIA 4C35A 5H3QA 1JSVA 2HW7A 4NTSA 4XX9A 3TZ9A 1W83A 2XNMA 4PP7A 1XH7A 3TN8A 3PLAE 3DK3A 4FZFB 3MIYA 3PJCA 3FZ1A 5AV3A 3CSVA 4JR7A 3VS0A 1DAYA 4CSVA 2QONA 4RQKA 1K9AA 4OTGA 2B9JA 4XG7A 3FZSA 3OXZA 1H26A 1R3CA 1ZRZA 3PTGA 2X7OA 4FBXA 4FF8A 3OCBA 4JR3A 3L8XA 5JZJA 2BIKB 5IQDA 2VD5A 3VUGA 3Q53A 1U54B 1WAKA 2CGUA 4CMUA 4CYIA 3F2RA 3UOJA 3S0OA 3V5LA 5CVFA 3V51A 3P5JC 3Q32A 4Y85A 4USFA 5AP5A 4XP2A 4BDKA 4D5KA 3R04A 5EW3A 1GY3A 3ZRLA 5JQ8A 5DOSA 3MFRA 2CNQA 4MF0A 3PXZA 4JNWA 5DA3A 3TCPA 4NZWB 4ANBA 1ZWSA 4EH7A 2R3GA 1XKKA 4CT2A 4DDGA 5C9CA 4EUTA 1WBSA 2XRUA 3DXNA 4ALWA 2CLXA 1UNLA 4KKGA 3TNHA 4ERWA 1QPEA 3QXOA 5EDRA 2VWVA 3QQGA 1F3MC 3NYXA 4D0XA 3I0QA 4DTKA 4DH8A 4F9YA 4L43A 1OGYA 3H9RA 4QPMA 3OBGA 4YJTA 5JFXA 4QMZA 4ARKA 2XM8A 4PMMA 4EH2A 2C6LA 1LP4A 2WMUA 3AC4A 3BGZA 1NVQA 1ZAOA 3IOPA 3QTIA 4M7IA 5CAQA 2UUEA 5LWNA 5CAOA 3DJ7A 1YI6A 4IVAA 5E8SA 3N4TA 2QOHA 2Z2WA 2P2IA 1IRKA 2XIYA 2J6MA 4DFLA 5CSPA 4HYHA 3G9NA 4U45A 1VZOA 1OECA 3QZHA 2W1DA 3FXWA 5CF8A 2UZDA 1V0BA 5H2UA 5HORA 1O6KA 4A4OA 3V8TA 4ITJA 4A9YA 5EM5A 4Y8DA 4IE9A 2OIBA 2FVDA 3QKKA 3BL9A 4WNKA 2OJFE 4IX5A 3VS3A 2P3GX 4RMZA 4NK9A 4TWPA 3AD5A 4KBKA 3ANQA 4BF2A 4YO6A 3MTLA 2Z7RA 3SAYA 3W0NA 3HDNA 1OKZA 3BYSA 3HRFA 3FMHA 3E8EA 5HBHA 2ONLA 3V5JA 5AA9A 4FEVA 2WMWA 3FDNA 1OKYA 3BHTA 2ITVA 3MY5A 3R71A 4O7ZA 4MKCA 4BTFA 5DT0A 5F95A 3O2MA 2WTKC 3DLZA 5EM6A 3ZU7A 4LV7A 1LUFA 2H9VA 3PY0A 3AC8A 3ZS5A 2DS1A 3LFDA 3THBA 4H3QA 4W4VA 3FYJX 3VS5A 4RC4A 2CDZA 1K2PA 4BDBA 3Q60A 2VO3A 1BLXA 5I9VA 2WGJA 2VNYA 2CN8A 2OIDA 3ORLA 4FZDB 4PWNA 1NXKA 4E20A 4F64A 2RKUA 4IEBA 5HG8A 1E1VA 2VGPA 2HY0A 3ZYAA 4YMJA 5KMNA 1H1RA 1REKA 4GT4A 3MJ1A 2Z60A 4RIOA 1Q3DA 4XV2A 5HIEA 4IFGA 3PVUA 2B4SB 5HICA 1DM2A 2HCKA 3HA8A 3HUCA 2F7ZE 4M69B 4XYFA 5EW8A 2VTJA 1XMMA 2XIRA 3H30A 5IDNA 5EQEA 5CX9A 5DWRA 2IZTA 3VUHA 2ZM1A 3QKLA 4UWYA 3IDCA 3IW6A 4CQGA 2C0TA 3DPKA 3AD4A 2R3RA 2WMXA 3AXWA 1J1CA 4XOZA 3H9FA 4B6LA 4C38A 4CQEA 4LFIA 3LMGA 3UYSA 4QMQA 3U51A 3LCOA 5CAPA 4L45A 4FIIA 4ACCA 5KNJA 3KA0A 1U5QA 5IUHA 4YTHA 3LFCA 5AP3A 3A99A 1LEWA 3QHRA 1AGWA 5AAGA 5AV4A 2ITXA 5CS6A 4EH3A 2YABA 3CS9A 3I81A 4L7SA 4YJQA 5AADA 3UIBA 1MRUA 3V6RA 4HYUA 4RWIA 2HZNA 4I6HA 1TFFA 3VBQA 1QPJA 2BVAA 4ZY4A 5C8KA 3UTOA 1JOWB 2ITYA 3F82A 2O64A 3NYOA 2ONLC 4N4SA 3RWPA 1E1XA 4XG6A 2CHLA 2O65A 5EFQA 3C1XA 3CLYA 3WARA 4D4SA 3UNKA 3R21A 3EQGA 1CKJA 4C37A 2PZYA 4F4PA 3NW6A 5HESA 4BB4A 5HU9A 2XJ0A 4QP3A 5FP5A 4H1MA 2Y9QA 4TW9A 1DI8A 2C68A 4O22A 4JT3A 4FZ7A 4XV3A 3TNWA 5IA3A 4C59A 4L6QA 4ANMA 1Q8WA 2YISA 4G5JA 3BEAA 4YJNA 3RPVA 2J50A 2HXLA 4O4DA 5M09A 5CXZA 5GZAA 4FSMA 1DS5A 3BU6A 3RCDA 4RJ7A 4JIAA 4IB0A 4CFMA 4O83A 4FKTA 2QKWB 4D2RA 1OI9A 2C5XA 5IG1A 3ZRMA 4A4LA 5JRSA 3DXPA 5EHYA 3CPCA 5A4EA 3BEGA 2PULA 4UXLA 3P1AA 4AG8A 3PDTA 4HPTE 3FKNA 1TVOA 1U54A 3DKFA 3Q5ZA 3G6GA 3GCUA 3IW8A 3QYZA 4FNXA 4FV9A 1ZZ2A 2HYYA 3A7HA 4S33A 3IOKA 1LR4A 3MFTA 4FIJA 3BX5A 3JPVA 4FTLA 5HE2A 3WBLA 5J9LA 1H24A 4DEHA 5AP1A 1UNGA 3SLSA 3ZEWA 4X2JA 4CV9A 3Q52A 4EK5A 2O5KA 1KSWA 3G0EA 5IDPA 4CYJA 1H4LA 2BHEA 2ITOA 4RIXA 5I9YA 4O7NA 3KK9A 4DFUA 4EYMA 1OIRA 5CAVA 4LMNA 3QCYA 5HIDA 4V0GB 4N6YA 3E3PA 4I94A 5KZIA 4DAWA 2ZVAA 4EBVA 4KSQA 4EWHA 4Z7HA 4M68A 4DTBA 4W8DA 4YU2A 3P86A 4K33A 3R1NA 3QKMA 2BTRA 2BRNA 2W1CA 4FGRA 3SDJA 3WE4A 2OBJA 3D9VA 4AW2A 5L2SA 4CFVA 4QP4A 2CGWA 3T9TA 4ZIMA 4FKGA 5TE0A 4J98A 3ZLSA 1WCCA 2PZ5A 5CEQA 4O6LA 1STCE 4WIHA 2ITTA 1APME 3UP2A 5CF5A 2W1HA 3JY0A 4CZTA 2PMNX 5I3RA 4KAOA 3QD3A 5LOHA 4F0FA 3R8MA 4IWQA 5M07A 3DBCA 2PVHA 5HBJA 5E8WA 3MBLA 2WOTA 4G3CA 4FL2A 4I24A 3KXNA 4Y72A 2I40A 4ZLYA 4I20A 4XV9A 5L2QA 5J1WA 3VW6A 1E9HA 4LGDA 1XBAA 1KE5A 4QMPA 3V5PA 4WA9A 4QPAA 2F2UA 2UW3A 2IVSA 3FJQE 2GS7A 3E7VA 4IX4A 4OUCA 2PSQA 3Q04A 5CF4A 3F3UA 5JMSA 2NPQA 3E88A 4O0YA 5FGKA 4EONA 4F9WA 3KMUA 3EQCA 5KHWA 4ASXA 5L8KA 4O0RA 4I6QA 2CKQA 4DEIA 4NW5A 3RGFA 1XQZA 3LPBA 4I6BA 4JBOA 5M56A 2CPKE 5DT4A 1WMKA 2QHMA 3P9JA 3ZUUA 4OW8A 4G6OA 4TNBA 4FSRA 3EQFA 4I92A 2RG6A 3Q5IA 1JVPP 4OTWA 4ZSEA 2ZDTA 3SKCA 3SXFA 5DBXA 3LVPA 3OUNB 3LFAA 4FG7A 2C6TA 4Q5EA 4R3PA 3HZTA 5KE0A 4ANNA 3KKVA 2WAJA 4C4EA 4F6WA 3C13A 4HVSA 3OY1A 4EOJA 3ZO4A 3UDTA 2OZAA 3OT3A 4RPVA 1UU7A 3LIJA 5DLSA 2W99B 2Z8CA 3COIA 3UE4A 2F7EE 4PPBA 4EH9A 4DYMA 3FAAA 4I0TA 4FKJA 2FSOX 3C9WA 4YZCA 2QO7A 2QU6A 2W5AA 2W7XA 2A98A 4IMYA 1I09A 4DC2A 4EK6A 1FBNA 1I44A 3GVUA 4GG7A 2XNOA 2BHHA 3P78A 2RG5A 2X7GA 1Q8TA 4OBQA 4X2FA 4EC9A 4L42A 3S1HA 3UOHA 3E5AA 1OL1A 1U4DA 3NLBA 3E64A 4KRDA 2YZAA 3RHXA 4RVLA 4JXFA 1H0WA 4M69A 3HP5A 3EFLA 1SYKA 3W2PA 1BMKA 2XRWA 4K0YA 1BI7A 4C61A 4QYYA 4TYHB 2OZOA 1H01A 2X1NA 1URCA 5AIKA 3AC3A 4G17A 2VTRA 2WXVA 2EXEA 2JBPA 3CXWA 2A4LA 5CF6A 2C1BA 5J5TA 4EZ5A 3P23A 5HE1A 5DR2A 4F6UA 3MVLA 2QVSE 1O6YA 4IZYA 3WF5A 1Q8YA 4DH7A 5BQ0A 2CSNA 4FIEA 4E3CA 3UBDA 4X0MA 3PE2A 4G34A 1MQ4A 2VTTA 1QPDA 5IH5A 5KMMA 2QCSA 4X6RA 2Y6MA 3A7FA 3P5KA 5HHWA 2PVJA 4D4VA 4QYFA 3HECA 1SMHA 4ZTQA 4KIKB 4IFCA 4IIRA 4MCVA 3TKIA 4CV8A 4XBUA 4I5PA 4BDCA 2JAVA 3LCDA 2Q83A 3ZONA 2EXMA 3C0GA 3SQQA 5J9ZA 4L3JA 3HNGA 5L2WA 3CQUA 1BKXA 2UZOA 4FTUA 1YXSA 4USEA 4ZMEA 4RIWB 3CTQA 2W9FB 4EZ3A 5IQEA 4RX8A 4L67A 4FYNA 5EG3A 2IZSA 4ZMFA 2XEZA 1SVGA 2RF9A 3D7TB 4RC2A 4YJRA 5A4QA 2WMAA 1WBPA 3VUMA 2C3IB 3BL7A 1CMKE 1FGIA 1JNKA 1GZKA 2FUMA 4EUUA 5IZFA 2VWUA 3HAVA 2B55A 4E5WA 2Z02A 1KE6A 5A3XA 3QTZA 1UKIA 3RPRA 5IEVA 5CQUA 5D11A 4O0WA 3D2IA 5JGDA 1H00A 4YJSA 3G15A 2BAKA 5AJQA 4B0GA 3AMAA 3OD6X 3QCXA 2XBJA 3PP0A 4I5CA 4RLLA 1Z5MA 2IW9A 3R8UA 5CWZA 4FRFA 5M44A 3D2KA 1Z9XA 3KVWA 5FQDC 4BIDA 3PJ3A 5EI2A 4DCAA 2JDRA 1G8KA 5K9IA 2GS6A 2R3OA 1FGKA 1RQQA 2BDFA 3I1AA 4DFYA 5L6OA 3PSCA 4F08A 2VTMA 5BUJA 5TOZA 5KMKA 2W4JA 2C1AA 4B9DA 3EQHA 1PXKA 2VTHA 2XANA 4HNFA 4TKSA 4TTHB 2VX1A 3GQLA 4PDOA 4RGJA 4DGMA 3QZIA 1AD5A 4V0GA 4JRNA 3FC2A 2PE0A 2XCKA 4FICA 5D9HA 3AGLA 4FL3A 3AT3A 3L9NA 2BILB 4DLIA 2EB3A 5AUYA 3R9HA 2G1TA 4EJNA 3B8QA 3F5PA 3MVMA 3OC1A 2J0IA 3FLNC 3RM7A 3GCVA 4MTAA 1BI8A 3HUBA 3O5AA 3GBZA 4MBLA 4CKRA 4HGEA 3BBTB 3FY0A 4G3EA 4NM7A 4AN3A 4QYEA 3FHIA 1PXJA 4H39A 1GZOA 3HV5A 1PYXA 4QYHA 3SC1A 4D1SA 5I9UA 4F9AA 2OLCA 2IN6A 2R3HA 3PA3A 4FTCA 2PE2A 4P5ZA 1H25A 5EHOA 3UQCA 4Q9ZA 4RJ3A 4AZEA 1VLRA 2IG7A 2QG7A 4O7RA 3NMUF 5DR6A 3OWPA 3R30A 2F49A 2OF2A 2W4KA 1PHKA 2IVTA 2VTNA 3KL8A 3NAYA 4KIOA 4PV0A 3FLQA 3HV3A 2XBAA 1J7IA 3FMKA 2JDOA 1HCLA 1YOLA 4KS7A 4NUSA 4XBRA 3RK7A 2G9XA 3ACJA 1JQHA 3H4JA 4YSMA 3WILA 4TYEA 1ZXEA 3OP5A 4Y5HA 4ITHA 4D55A 4L8MA 5BVDA 2YA9A 5J1VA 5BYLA 4YLKA 3H9OA 2J0MB 4P7EA 3VUDA 3N4VA 3QQFA 2BCJA 1FMOE 2A1AB 2XK7A 4L44A 2HENA 2R5TA 3H0ZA 1Q61A 2ZB0A 5CANA 2CNVA 1B6CB 4RFMA 3EFWA 2UZVA 4CFUA 2F9GA 2C6EA 1S9IA 2C3JA 3IO7A 1NVRA 4JG8A 4IDTA 4OT6A 3IONA 3TKHA 3E93A 4BY9E 2I7QA 2OSCA 5HVJA 3C7QA 3K3IA 1XO2B 2QODA 3BGQA 3GENA 5AR2A 3PE1A 4AACA 5M53A 2XZSA 2WQEA 3TM0A 3EN4A 4GL9A 5EW9A 4GS6A 1Y8GA 2H8HA 3FL5A 3PJ1A 3VS2A 3VBTA 3MWUA 4GMYA 4AFJA 4AUAA 1CSNA 4AXFA 2ETRA 4UY9A 4NWMA 2UZUE 3FI2A 3UNZA 5TO8A 4FV1A 2PL0A 3TTJA 3I6UA 2IF8A 5AR8A 5IKWA 3R8PA 3LFQA 4F1TA 2XIKA 4KA3A 4FEXA 5CU0A 1W2DA 3RAIA 4U9AA 5JRQA 3LJ1A 4HVGA 3R28A 3DZOA 5E90A 3S2PA