3LCTA

Crystal structure of the anaplastic lymphoma kinase catalytic domain
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
308
structure length
308
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRAGYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the ALK (anaplastic lymphoma kinase) catalytic domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords ALK tyrosine kinase receptor
total genus 102
structure length 308
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lctA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lctA01
2XNOA 2X4FA 3MTLA 3OP5A 4TZRA 3ZSIA 5DG5A 3O23A 5CVGA 4USDA 1IA8A 3VUMA 1E1VA 1Q41A 3EZVA 5M08A 2O63A 4Y8DA 5I9VA 4NW6A 2VUWA 2VNYA 3MFRA 3HYHA 2XNPA 4MXZA 5AV2A 2CN8A 4FTRA 4K9YA 4FV2A 3BWFA 4BZDA 5HG8A 5AP4A 5HOAA 3UMXA 4XLVA 5LXMA 4NM7A 5E8WA 2RG6A 4M15A 4QP1A 2YIWA 2BROA 5GZ9A 3ROCA 3ZRLA 4DH3A 2JDOA 3CY3A 4FSUA 4L3PA 3I6WA 5AUXA 4KRCA 2R3KA 5AFVA 3DQXA 4WRSA 1FGIA 5JSMA 4FSWA 3R8ZA 3PY0A 3DJ7A 2XNEA 5CF4A 1APME 1XO2B 3QD2B 4BZNA 4NM3A 5CSHA 4IM3A 4M14A 4UWYA 5EHLA 3TN8A 3ZDUA 5A6NA 4FA2A 4L8MA 2ITWA 3QTSA 3MB7A 5AX9A 4U8ZA 4WSYA 4O0VA 4IAYA 3FMJA 4AGCA 4FV8A 2QOQA 4FK3A 3SXFA 1KOAA 2JDRA 5KZ0A 2W17A 3DKOA 4PMTA 4RJ4A 3VF8A 4J96A 3TCPA 4M3QA 4TNDA 1WVXA 3GBZA 1YOMA 3P0MA 5ACBC 3FQEA 2BAKA 5I3OA 3W10A 3JY9A 3LKMA 3Q4CA 5AAEA 2P33A 1YRPA 5ANOA 1ZY5A 3KQ7A 4FTUA 4UZDA 4W4VA 2XKFA 4ZSGA 3FZTA 2E9UA 1PKGA 1OB3A 4MXXA 2FVDA 1ZWSA 3HDNA 4RX7A 4FR4A 4BHZA 3GP0A 2WMTA 2QODA 4KKHA 1V1KA 3U4UA 3VS6A 4H3PA 3R1SA 2X8EA 5DRDA 3K3JA 1AD5A 2WQBA 5C4KA 4PNIA 2R3OA 4AE9A 2W5BA 2B53A 2OJFE 4QP3A 4FV9A 4TWNA 4EWHA 4Z55A 2Q0BA 3CQEA 2GS7A 3BX5A 3R7OA 3EYGA 2XRUA 2WGJA 4GK4A 4KAOA 4BDBA 4EZ7A 1ZYJA 2G1TA 4IAAA 5AUUA 2PVNA 3WOWA 4UYAA 5M09A 4FIFA 3BHVA 4LRKA 4QRCA 3MJ2A 5IA5A 4GYGA 4IACA 4APCA 4A06A 2ERZE 3F2AA 4AZTA 3OF0A 4U7ZA 2PVLA 2QLUA 4X0MA 5LJJA 4OAVB 2IVUA 2YHVA 5HNIX 2ITXA 5IU2A 4WSQA 5E92A 5I0BA 4O82A 4FZ6A 1XH5A 1ZAOA 3E87A 4U42A 2V0DA 3UPZA 3OY1A 4KIKB 4C4EA 4O7WA 1REJA 2WB8A 2X8DA 4Q5EA 2OXYA 4FEUA 5J8IA 4OGRA 2QONA 1IASA 4FG9A 3NCZA 3U87A 1XR1A 4M7IA 2WQMA 3ETAA 4KRDA 2QO2A 5LVMA 2OF4A 2JKQA 4IDTA 4YSJA 3U55A 3LCTA 3I4BA 4JXFA 2WKMA 3KULA 2GCDA 2W99B 3DBDA 4KIOA 4CFVA 1S9IA 5IQAA 5FRIA 4RX5A 3K2LA 3Q52A 3U8WA 5HG5A 1XBCA 3UO6A 5EQEA 4D2RA 4IX3A 4B6LA 3EQIA 5G1XA 2OXDA 3HV4A 4BCNA 3I7CA 5BVNA 3VWAA 4RIXA 2BFXA 3BGQA 3PVWA 4WO5A 3K5UA 4GL9A 4UN0C 4ZTQA 5C8NA 3QA8A 3GCQA 3OCTA 4H05A 4IANA 5C27A 1UU3A 1BI8A 2JIIA 2XIZA 1DAWA 3FHIA 3FDNA 2XBAA 1Y57A 5DI1A 5DR2A 3BHUA 1UNLA 4RWKA 5AMNA 4AZVA 3NX8A 4TY1A 3UYSA 1OIYA 2JAVA 5EG3A 4BCJA 3IG7A 5H8GA 2QKRA 4K18A 2O0UA 2WMXA 3CGFA 3D5WA 4FVQA 2BPMA 3VBQA 2IW6A 2WHBA 3H4JA 4MK0A 4RG0A 5LCJA 4CCUA 3HUCA 2HZ0A 4ACCA 5CT7A 5BYLA 2XVDA 3WF5A 4I20A 4OT5A 4RIOA 2W1FA 2XF0A 5AP0A 2WPAA 3FMNA 4NFNA 3A7JA 4QMMA 4BL1A 4CXAA 3BKBA 4KKEA 1SVGA 2VX1A 4EOIA 3IS5A 2PVMA 4HYHA 4IX6A 4Z3VA 3Q60A 4IB3A 4YBJA 2XB7A 4MBIA 3MH3A 1YHVA 4QTAA 3UIXA 2XS0A 2YCFA 4V01A 5ANDA 2Y7JA 2X2LA 3RPYA 4F6WA 3P4KA 2GNIA 4FSMA 3E5AA 2V7OA 3ORXA 4LOQA 4PL3A 1MP8A 1WBNA 3WYXA 3CLYA 5D41A 3ORIA 3QQHA 1OL1A 3D5XA 4ASZA 3PXQA 2HZIA 4DC2A 4PY1A 4ZTMA 4YC6A 4PDYA 1E9HA 3K3IA 3SW7A 1V0BA 1K9AA 2YDKA 4UWBA 2V55A 2CNQA 4I6BA 1WBOA 2PWLA 4BCMA 4TYIA 2BHHA 3MS9A 1XBAA 3NAXA 4MNFA 3R7VA 4C4IA 1KWPA 3NYNA 3EKNA 4BDHA 4G3GA 2BMCA 1OKWA 4U79A 4DH1A 2IZTA 2Y4IC 2HAKA 3A8XA 2JD5A 2Z7QA 4MKCA 3ZLWA 1J1CA 3Q2MA 3PSBA 3R9DA 4FG8A 2WTKB 4IHPA 3ZFMA 4E5BA 5BQ0A 4KBCA 3HP5A 4FTKA 4U6RA 5AP7A 1U5QA 4P2KA 5EDRA 2WFYA 2YAAA 5KHXA 3C5IA 2XNMA 3A7FA 4QTDA 3NUPA 5FBNC 4BCOA 3ZLYA 2QOLA 4EYJA 2E9OA 4IQ6A 4PPCA 3V51A 4AZWA 5HO6A 2G01A 3W8LA 4UALA 5IQIA 4CFWA 3PVUA 3L1SA 2VO0A 3DJ6A 2R5TA 1OM1A 3ORKA 2UVYA 5KKRC 2BRBA 4EHVA 3FZSA 4NTTA 5FLFA 3ACKA 5HTBA 4RWLA 3ERKA 2JDVA 1IRKA 3C0IA 4YSMA 2UZBA 3NW7A 1QL6A 4CRLA 3LMHA 3AOXA 3H10A 5C9CA 3QKKA 4R3CA 3NUAA 4M84A 3KVWA 2RGPA 3KXZA 4JJRA 5AA9A 1GZKA 3TNWA 4ARKA 3D4QA 3QRTA 4QMSA 4TWPA 3CJFA 2HW6A 4MWIA 2BALA 4YC3A 3O8UA 2F49A 4G2FA 4FYOA 2P55A 2VU3A 3OOGA 3C9WA 3EN6A 1AQ1A 2BRNA 3BE2A 4WUNA 5AM6A 5GIPE 4AA5A 4ORKA 3E7OA 4YJSA 4EK4A 3LFCA 2BILB 2HZ4A 3PE2A 4YJQA 4L53A 5AAFA 2UZNA 3OROA 4AW0A 2X2KA 3TNQB 4JOAA 4XJ0A 3FLZA 3P23A 1VR2A 2FA2A 4QMYA 5DT0A 3V8WA 2CKPA 1ZZ2A 2YN8A 3TJDA 4AN9A 5L2TA 4W8EA 2IZSA 2C6KA 3VBWA 2WXVA 4HYSA 1M17A 3ZUVA 1YXSA 2WMWA 3AXWA 3AD4A 3DTWA 4LI5A 3ZM4A 4FF8A 1BLXA 4V05A 4USEA 4AOIA 3FKLA 1OUYA 3I0QA 1WVWA 4K1BA 5HTIA 5J7HA 3KL8A 4GT5A 5HNGA 5CEOA 4WOVA 4BCKA 3GFEA 3KRLA 3IK3A 2J51A 1TQMA 2EB3A 4W9XA 5M53A 3OFMA 3LFNA 3ZC5A 3PP0A 4N70A 5CY3A 4E6AA 4YURA 2J50A 4MD7E 4EKLA 4O7VA 4RX8A 2QQ7A 3BBTB 2QU6A 1PYXA 3FJQE 4RA5A 1WAKA 2CKOA 4XH6A 5A4LA 2GNJA 1REKA 4E4NA 2B54A 4Y95A 5JQ5A 2WTJA 3MFTA 3DOGA 4QQTA 2EU9A 3L9PA 5L6WL 4I3ZA 4IZAA 4RX9A 3MYGA 3ZXTA 3Q9YA 4BCQA 3O96A 3Q53A 2I40A 2ZYBA 3DLSA 3EN5A 3FWQA 4D2TA 3QALE 3WIKA 3EKKA 2QLQA 2R3FA 4DE4A 3AMYA 2VO6A 1FINA 3DB6A 1Q3DA 2JGZA 2YWVA 3R8VA 4BTMA 3FL5A 5J1VA 3DY7A 3QD4A 3CKXA 2O64A 1V0OA 5IMEA 3FAAA 4NWMA 4F9AA 1Q5KA 3SC1A 5CX9A 5CQWA 1FMOE 3ZUUA 3HMOA 3HRCA 4RLLA 3OWJA 4C0TA 5GZAA 4XP2A 4CYIA 4ERKA 2VGPA 2XM8A 1YWVA 5DBXA 4UMPA 2JKOA 2ETRA 5HBJA 3TWJA 3OG7A 1XHAA 3EB0A 1OZ1A 4RPVA 5AIRA 4RIWA 3KRXA 4BVUA 1QPDA 2C5OA 4KABA 5JKGA 2F9GA 4TRLA 5CTPA 5AUWA 2BTRA 3BHHA 3OT3A 3DAJA 3F2RA 4DFYA 4YJUA 4CYJA 2PVRA 3QZIA 4FTJA 3DAEA 5L2WA 3L8PA 2VTLA 3SV0A 3AC1A 3FYKX 4CFFA 5CVFA 5DVRA 2PHKA 3E63A 4BR3A 4NL0A 4RSSA 3S3IA 5IA3A 3F5XA 4FOBA 3TIYA 1HCKA 1B39A 3PJ1A 2VWBA 3FY2A 4W4XA 2F57A 4ITIA 5FDXA 3DZQA 4DGLC 3HA6A 4O83A 3L8VA 3R22A 4FTMA 5B0XA 3AC2A 1YDRE 4FEQA 2BZJA 4DAWA 3GC9A 3F9NA 4PX6A 4WNPA 4RT7A 2C1BA 4YTHA 3G2FA 3Q04A 4I24A 4RJ3A 4ITHA 1BI7A 1CKIA 3C1XA 5HCYA 2YJSA 3QTWA 3UVRA 4F65A 3L8SA 3FZOA 4LL0A 4HPUE 2O8YA 3QTZA 4EQUA 3A61A 3KKVA 4BI1A 5L6PA 4E5WA 3QGWA 3NVKI 4QMZA 3WARA 1UWJA 2JKKA 4C7TA 5JFXA 3PLSA 3UODA 4B4LA 4YPSA 3F82A 3UO5A 5ACKA 4ZOGA 2YA9A 5C03A 3E62A 5DE2A 5BYZA 2WQNA 4I0RA 1HOWA 3HUBA 5H8EA 3R1QA 2VV9A 3QF9A 4PTGA 3G0EA 3RINA 3Q4TA 4R3PA 2H34A 3IONA 4EUUA 4F64A 4O7ZA 3CQUA 3FLWA 2X7OA 4GG5A 3VAPA 2UUEA 2RKUA 4DG3E 4WNMA 4O7NA 4FK6A 1OIQA 4FSZA 4R8QA 4KUJA 3O8PA 2R3QA 3HKOA 3MY5A 1OIRA 3CD3A 2W0JA 3FZRA 4ZTRA 1M7QA 1YXUA 4XUFA 3TL8A 4UV0A 4FKIA 5C8KA 5C4LA 2CGWA 2R3HA 1M2PA 5KMOA 3MA3A 4RVTA 4Y73A 4Y5HA 1IR3A 5K3YA 4IFCA 4B9DA 4X6QC 3RNIA 4QMOA 3VW8A 2Z02A 1OI9A 1OL7A 5TE0A 3ET7A 4JLCA 4L52A 3N4VA 5J9ZA 2AUHA 3ENHA 3OMVA 2ONLA 5I9YA 2YM6A 1RW8A 3I0OA 4Q5HA 4D5KA 2O65A 5CSPA 2V5QA 3OUKA 5E7RA 3LCSA 4R1YA 3UO4A 3F7WA 2C6DA 4PDPA 3MPMA 4ANLA 2WQEA 3MH2A 1YXVA 2ITPA 3BZ3A 4QOXA 3ODZX 4ZTLA 4EI4A 5JGDA 3NMUF 1UWHA 4BWPA 1AGWA 3GVUA 3VN9A 5IUGA 1YHWA 4L68A 5AP5A 3QQLA 3C4FA 3UDBA 4BIBA 4D2PA 4O91A 4LUDA 3PP1A 4E6CA 4DBNA 4EOKA 3THBA 5KNJA 4FEWA 1J3HA 4ZZNA 3ROYA 3ELJA 2ZV7A 3R6XA 3RMFA 4UMTA 3ZS5A 1JAMA 2XIXA 5M57A 1T45A 2WMRA 5JH6A 2FSLX 2QR8A 5GZ8A 5JFSA 4IE9A 3REPA 4CCBA 3F3UA 2CGXA 1PY5A 2R3GA 4GG7A 2QOHA 4MD9E 4TNBA 4ALVA 1H26A 4QP4A 4JX3A 5AR8A 4E5AX 1ZLTA 2I0VA 3TUDA 3TJCA 3COHA 2P2HA 3QKLA 3TZ8A 4AZSA 3V5PA 1GAGA 4AF3A 1H07A 2CKEA 3D7TA 2ZMDA 5B2KA 1GY3A 1H01A 4EK6A 2ITTA 3BYMA 3E8DA 2A2AA 1Q8UA 4A9SA 5IF1A 5K4IA 2OO8X 5E91A 1J7UA 4MNEA 3QA0A 4KIKA 3PRFA 2HCKA 4AUAA 3S1HA 5M06A 3FPQA 1H1WA 1GZ8A 4I5PA 5IQEA 4E4MA 1YI4A 4KS7A 2XNGA 4EZ5A 4FC0A 2Z7RA 3BRBA 5E8ZA 4C61A 4UXLA 4H36A 3WF7A 1WBTA 3FC1X 4RLKA 5K9IA 4QMUA 3TDVA 4BGGA 3IDBA 1VJYA 2YLEA 4TPTA 4LYNA 3LQ5A 1W84A 4E8AA 3OZ6A 2UZDA 2XCKA 1FPUA 5D1JA 5DH3A 1OL2A 4PDOA 2PVYA 3ZC6A 3F3WA 4JT3A 5CENA 5FXRA 3WZEA 4WKQA 2B9HA 5IH5A 4JBOA 3TKIA 4RIXB 4M97A 3ZRKA 4D55A 5ITAA 3F3ZA 5H9BA 1XBBA 4FKOA 4R3RA 1BKXA 4H58A 4IAZA 3TNPC 3W2CA 2XBJA 4I4EA 5DMZA 2J6MA 4D1XA 1RDQE 4E20A 2I7QA 4IJ9A 2VGOA 4FZFB 3R0TA 4OR5A 2GQSA 2VX0A 4ZXTA 4C4HA 4QTEA 4A9RA 2OXXA 1JBPE 5FTGA 3HECA 3R9NA 4GVJA 2B9JA 1KUTA 5DT3A 5AP6A 3MB6A 5EHOA 1Q24A 4K0YA 2G2IA 2GFSA 3U51A 5A4TA 4P7EA 3KN5A 4UBAA 3ALNA 2YACA 3DXQA 3HLLA 4ZJVA 1TKIA 3R7YA 3D15A 2BIKB 4HCUA 4I6FA 4R7HA 5CEQA 5H3QA 2HWOA 3QUEA 3CJGA 4ANNA 1SYKA 3OT8A 2OG8A 2XNNA 4RJ5A 4FEVA 3NUYA 3LFDA 2ZOQA 3AT3A 2H96A 1NVQA 4XHKB 1F0QA 3WBLA 2YWPA 4FZAB 1Y8GA 2BZHB 3ZUTA 4Y83A 2CHLA 2XMYA 3AT2A 3IQ7A 4EHEA 5CASA 2HXQA 3NVMB 2VO7A 4E6QA 3TTIA 3G15A 4JDIA 3AT4A 3DB8A 1MRYA 2XEZA 2Y4IB 4ZIMA 5TKDA 3VF9A 2WIPA 1NY3A 1FVTA 3S95A 2Q83A 5JN2A 2AC5A 2UZEA 4AW5A 2EWAA 3GT8A 4KBAA 3PXZA 4F1MA 4QQJA 5EM5A 3D83A 1OGUA 1WBWA 2ZB0A 3WF9A 4W4YA 4E4XA 2V62A 4GYIA 4U97A 3WZDA 5IDPA 2VD5A 5A46A 3EQGA 4DFUA 4IFGA 1RE8A 2C6OA 3OUNB 2B4SB 3R63A 5IZFA 3ITZA 1Y6AA 5JMSA 2DUVA 3RPVA 4J71A 1OPJA 3C4CA 3R73A 4HGSA 2WNTA 3MJ1A 1UU8A 3KXGA 4LGGA 4DLIA 4NZWB 4IB5A 4ZS4A 3LJ0A 5HE3A 4K2RA 1OKZA 2YERA 2JDSA 3FSFA 2E9VA 4KSPA 4I93A 3PJCA 3AC3A 4R78A 1H24A 3LJ1A 1Z57A 3ZO4A 3PSCA 3U6JA 3POOA 3BV2A 1EH4A 5CZIA 1JKTA 3II5A 4FNXA 3GCUA 3L9MA 3FKOA 3NS9A 4Y46A 4K77A 1H1RA 3EMGA 3AC5A 3FBVA 3NYVA 3KXHA 4FG7A 3HRFA 5FXSA 3SXRA 4FYNA 3FMMA 2HXLA 3WF6A 5EM6A 3RHKA 3TNIA 2RFEA 4ZJIA 3ZCLA 1Q99A 3KRRA 2ZV8A 3NWWA 4CZTA 3U9CA 2IW8A 3O51A 4OTWA 4W4WA 5J7BA 3PXKA 4OTQA 4AX8A 3UG1A 2OZAB 2I0EA 3HV5A 3UIMA 2WTDA 5AV1A 3N4UA 4FT0A 2PUPA 3P1AA 5CEIA 1FVRA 3KVXA 2J90A 4I1ZA 3G0FA 1URWA 4D9TA 3PFQA 5L8KA 3OEZA 5FTQA 2PE1A 3RAIA 3NRMA 4G6LA 4C35A 3NUUA 4IZ7A 3QUPA 4J52A 4XG4A 5IUIA 3OOMA 4JX7A 3QYWA 2ZAZA 4M12A 4BDJA 2JC6A 3JYAA 4J97A 1DS5A 1OBDA 3DXNA 4D0WA 1M14A 4ZP5A 3PRIA 4Y85A 2X7FA 2OFUA 2OIQA 4CMOA 4C02A 4P5ZA 3OXTA 5IH6A 4UXQA 3W2QA 3RCDA 4MWHA 5HEZA 4U81A 3HAMA 4JG7A 4NKAA 4EOLA 4I6QA 5IH4A 1SZMA 3BLHA 3VUTA 5IA4A 1U4DA 2QHNA 3E8NA 3JVSA 5DR9A 3O0GA 4E7WA 4YZNA 4OW8A 3FV8A 3QLGA 4I21A 3TXOA 4ZK5A 4F9WA 2R3IA 3WZUA 1MQ4A 4ZMFA 4AGWA 1PMUA 3DBFA 2EUFB 3BCEA 4XYFA 5ICPA 2OFVA 3QX2A 4EOPA 2C6EA 3DDQA 5BUEA 4BBEA 1ZMUA 3ANQA 3KRWA 3SVVA 3UQCA 3QFVA 2OIDA 1FBNA 4ENXA 1JPAA 3FLQA 3HMIA 4NJDA 3BQCA 5A4QA 4FKLA 4G31A 4JS8A 2CLXA 1XH7A 4QP2A 2VTPA 3UIUA 5F9EA 4K11A 3RJCA 2EXCX 3MPAA 5DEWA 4Y5QA 5TF9A 4C37A 3OVVA 1PMEA 3VNTA 2Z7LA 4ASEA 3UG2A 3FZ1A 5CSXA 2VAGA 4F9BA 5LMBA 2BRHA 4CG8A 4LV8A 5CU6A 2WD1A 1PXJA 2W5AA 2FUMA 4YNOA 4M0YA 4L7FA 2C0IA 2C3IB 2FSTX 3GXLA 4IX4A 2YAKA 3ULIA 4CMUA 2UW5A 3UP2A 4LOPA 4N6ZA 3VBXA 2C68A 2UW0A 1SMHA 1ATPE 2BZIB 3QRUA 5HX6A 2BCJA 2C4GA 3SLSA 2WU6A 4BB4A 1CKPA 2GMXA 4IBMA 3NCGA 5M51A 2ONLC 1B38A 3ENMA 3VO3A 5IQHA 2PVFA 4GFGA 2GTNA 4AFEA 3DKFA 4DT8A 4QYYA 4D1SA 4FTIA 3L9LA 3VUHA 1JKLA 3HEGA 1ZOHA 5L2IA 3KY2A 2B9FA 3G33A 5HZNA 2FSMX 3Q3BA 3I6UA 4RIWB 4AXAA 2A1AB 5FM3A 3LFBA 4DINA 4FL1A 1LPUA 4IAFA 4QTBA 2OH4A 1YOJA 3QTQA 4GK2A 1CM8A 1VEBA 4TYHA 3MIAA 1YXXA 2WU7A 4J8MA 4PQNA 1JVPP 1U59A 2QNJA 2V22A 4BCHA 1WMKA 2HY0A 4G3EA 5IMXA 2VWVA 3VBYA 5LVNA 2XYNA 3BGZA 3KRJA 5JZNA 4AGUA 1OPKA 1ZYCA 2XCHA 3F69A 3BYSA 4CQEA 4IC7A 2I1MA 4YP8A 3SOAA 3F66A 1CSNA 3VW6A 3ZFYA 1DI8A 4LUEA 5CU4A 1P2AA 3U6IA 1PMVA 5AP3A 2IVSA 4FSTA 5CU2A 1LEWA 2UZVA 2BIYA 4P4CA 5CU0A 3UNJA 2WZJA 3E7VA 4FV3A 3V5LA 4BDIA 4GJ3A 4XBRA 5FEEA 3D0EA 3EHAA 4CTCA 4DF3A 3C4WA 2XM9A 4IWPA 5M4CA 2GSFA 3DJ5A 4I4FA 4UEUA 5JQ8A 3PY1A 4IVDA 1PXIA 2GQRA 3ZTXA 3OTVA 1ERKA 3R2YA 4JBQA 2OLCA 2YLFA 2CMWA 2O5KA 3ZSGA 4EEVA 2JBPA 3QBNA 4FZDB 1WBPA 4EOOA 1OPLA 3BLQA 3P7BA 4QMPA 4PMSA 3JR1A 2HYYA 4IM2A 4ENYA 1GZOA 4PL5A 4CG9A 4BDEA 4DFLA 5IPJA 4YO4A 3PWYA 1O9UA 5CNOA 5HKMA 4APPA 5CXZA 3P08A 3FI2A 4FSQA 4PF4A 3PXYA 3VS0A 3CTQA 4CTBA 2QHMA 1U5RA 4FUXA 2CGUA 3KMWA 4FUYA 1QCFA 3ACJA 5HVJA 2KULA 4FKVA 1JSVA 3A4PA 3PYYA 2WMBA 2ZV9A 4FT7A 4P90A 4ITJA 3HNGA 3UTOA 2XIYA 2ITQA 3BIZA 4LOOA 1QPJA 3WILA 3MY0A 5ANKA 4ANOA 1H00A 4IWDA 4KKGA 4QP7A 5CF6A 5E90A 3VVHA 4DEHA 4PUZA 4QMLA 4FT3A 4RC3A 4MCVA 1L8TA 2BAQA 1W0XC 5C26A 2XJ1A 4I92A 4ZSLA 2BHEA 2H8HA 4YMJA 4RIYA 1YWRA 1A06A 4BFMA 5AR5A 2O3PA 4G5JA 3HV6A 3A99A 3IW6A 4J7BA 3RZFA 3IOKA 4LMUA 4FTTA 4CRSA 4BDCA 5HU9A 1Z5MA 2J2IB 4DG2E 4FL3A 4QYGA 1G3NA 3LIJA 4CD0A 4EH2A 5LWNA 1Q4LA 5EDQA 3VS1A 3TV7A 3V5JA 4BTFA 4CLIA 4KSQA 1YQJA 3QQKA 2GDOA 2IVVA 3DGKA 3R02A 4KD1A 4M66A 4NW5A 1H4LA 5EW9A 3N4TA 4KBKA 1XWSA 4O7TA 2P3GX 1Y6BA 3BI6A 3GCVA 3IW5A 1PXLA 4GV1A 5EOBA 5E1SA 3CS9A 4EOSA 5D10A 3WYYA 3FLYA 3OXIA 4C33A 4AA0A 4U80A 3W1FA 3NNWA 3Q4ZA 3PG3A 3UOLA 2RIOA 4WD5A 1P4FA 1JKSA 3AGMA 2PUUA 5CNNA 5AM7A 3UNZA 5CAQA 4HNFA 4I41A 2ZMCA 2YIRA 1K2PA 3EIDA 3QYZA 4EHZA 3PDTA 5KMLA 4XRJA 2RFNA 3V3VA 3F3TA 5IA1A 4FGBA 3OW3A 2VN9A 1KE8A 4FV4A 1BL6A 2IVTA 4F0FA 2VTRA 5CVHA 2WMSA 4O0WA 1F5QA 2PVKA 4QPSA 4C3PA 2Y6MA 3BYOA 1CDKA 3DLZA 2QOBA 5F4NA 1CMKE 2ETKA 2IO6A 4BTKA 5J79A 2EB2A 1MQBA 5L8JA 1M52A 5CAUA 5CANA 3DDPA 2HOGA 4C62A 3F5GA 4CKJA 4HYUA 2P2IA 3LW0A 1F3MC 3CC6A 3SGCA 4TXCA 2R3LA 4ALUA 4C34A 4R5YA 4OTIA 3R7IA 2VO3A 4PWNA 3KA0A 5IQFA 1HCLA 4GS6A 3I60A 3FLSA 2X8IA 4JQEA 4Y72A 4DFXE 4O7YA 5E1EA 3QTIA 3IW8A 4ZS0A 4RBLA 4CEGA 1TQPA 3GEQA 3UP7A 2J0LA 5I9ZA 4A9YA 2BZKB 4DEBA 5CEKA 4YJRA 4NT4A 2BVAA 3EQBA 2YFXA 3LFAA 2UZOA 3ORNA 2BDJA 3CQWA 3SDJA 5GINE 3AC8A 5EYKA 4DCAA 3GU4A 4NIFA 2XRWA 2ZM3A 4LGHA 4NYEA 2P4IA 5CALA 3NYOA 3IDPA 3K54A 4RFZA 5EM7A 4A07A 4AA4A 2QU5A 4JDJA 4AWIA 3S4QA 4O81A 4XV1A 4DYMA 3MIYA 3SRVA 3P7AA 5IQDA 2WEVA 2RG5A 4TTHB 3PXFA 3QTUA 4TYGA 5HICA 3M42A 4YUQA 3QQJA 4QPAA 1XQZA 5LCKA 3ZRMA 3ANRA 2HIWA 3GU8A 2JDTA 4O0SA 4OTRA 4F99A 4DEDA 2H9VA 2WTVA 4ZLOA 1UKHA 1CTPE 4FIJA 4DH5A 1A48A 2QC6A 2Y8OA 3GU5A 4BZOA 4B8LA 3DBQA 5HESA 2VWWA 4YHFA 4M68A 4U43A 3TIZA 4QMQA 4FIGA 4LG4A 4EHGA 4EJ7A 5I4NA 4G9RA 4D4RA 2B52A 2UW8A 4NTSA 4QT1A 4U0IA 3RNYA 4EC9A 4PDSA 5DIAA 4LMNA 5AP2A 3RI1A 4EONA 4X21A 3D5VA 3WZJA 3NAYA 3G6HA 5EFQA 1H8FA 3R8MA 3GENA 5E8XA 2VTAA 1U54B 5D7AA 4GKHA 4N4SA 4BDKA 1S9JA 3CTJA 2WQOA 2FSOX 2FO0A 2I0HA 3IO7A 4HZRA 2BFYA 3F5UA 4J99A 3R9OA 3W16A 1UU9A 3VUKA 4AACA 4BYJA 5IA2A 4DA5A 5EOLA 5EYMA 3JS2A 1PMNA 2NRYA 4O0XA 4DEGA 3U4WA 3AG9A 4C59A 1UA2A 3ZMMA 4ZY6A 3QAME 2PU8A 4BCPA 4DEIA 4QPMA 4F1TA 4BIEA 4I0SA 4BICA 4OBQA 3VUIA 3C5UA 3FHRA 4JI9A 3D14A 3LZBA 1YI3A 1YDSE 3Q5ZA 1J7IA 3SW4A 3W2PA 5EQYA 1M7NA 3RK9A 2GHMA 3QU0A 2W96B 3QD3A 3QZGA 3CPBA 3F3VA 2JAMA 2OBJA 4FX3A 5I9WA 1OECA 2V7AA 2W1HA 2GFCA 2R3PA 4IAIA 1Z9XA 3DS6A 3PE1A 4WRGA 3OS3A 4DCEA 3R9RA 1TQIA 3P79A 3RBWA 4CQGA 3KK8A 5AUVA 2H6DA 4JDKA 3N51A 5HIDA 4YHTA 2WELA 3LPBA 5BPYA 1W98A 3LHJA 4CMTA 4L44A 1H08A 2R64A 3O71A 4AAAA 2GS2A 5GJFA 5KMIA 3JY0A 2OJ9A 4MXCA 5FWKK 4G6NA 4RFMA 5EKOA 5HNBA 1OL5A 4FKGA 3T3VA 4YU2A 4HGEA 3ZLXA 4F63A 2O2UA 5HORA 3ZXZA 1OBGA 2ZDUA 4HOKA 3NNXA 4O0YA 5DYJA 4FIIA 2CSNA 2XNBA 3T9TA 3ZYAA 5A6OA 5J5SA 3OWLA 2YIYA 4C8BA 3QQFA 5M4UA 1Q8TA 4L3JA 3EL7A 4ZZOA 3ZBFA 5E8TA 1ZARA 4BI0A 3EH9A 2BDFA 3H30A 4AG8A 4GIHA 5FEQA 3R8LA 4AS0A 2Z7SA 4XMOA 3VJOA 3BE9A 4A9TA 4YO6A 4X6RA 2HK5A 3SOCA 3TEIA 5JRQA 2PTKA 4ACGA 3O50A 2R0UA 1U46A 1OVEA 2GQGA 4AT3A 3CSVA 4Z16A 2P0CA 3NR9A 3R1NA 4QMXA 4KS8A 4DBXA 3DNEA 2XKEA 3EQRA 4S32A 4XX9A 1M2QA 4BTJA 4IEBA 5CEMA 2YABA 3H0YA 3UGCA 2OJJA 4QYHA 4RRVA 1WBVA 4TYEA 2UVZA 4IWOA 5FQDC 5TR6A 3ZDIA 3P7CA 4YC8A 2R0IA 2W5HA 3QC4A 4DFZE 2C0OA 4FV1A 3LLAA 2GPHA 4ACHA 5IDNA 4I22A 2AYPA 1W82A 3GNIB 1UU7A 5IUHA 5CQUA 1QPEA 2VTHA 2QURA 2FH9A 3BU6A 3NNUA 2ITUA 4FT5A 5HD7A 3KCFA 4USFA 2ZB1A 2DWBA 5FDPA 3GOPA 4BY9E 3AGLA 5CAPA 3NIEA 3OCBA 3C0HA 2PPQA 4CLJA 5M44A 3FMDA 4H3BA 3R2BA 5AV0A 4ZLZA 5I5ZA 4QO9A 2B7AA 5JRSA 3R7EA 3R7UA 4D2SA 4HVGA 1FOTA 2UV2A 4RWIA 2YITA 5CAOA 4BDDA 2PMIA 2W06A 3PA4A 3LCKA 5AUYA 4LGDA 5IKWA 2XYUA 2JIVA 3GI3A 1KV1A 3KN6A 4GU6A 4DN5A 1LEZA 2XKCA 4G9CA 3TACA 5J5TA 1OITA 4R6VA 3KB7A 4O7SA 2XUUA 3BEGA 1XH8A 5AX3A 3UZRA 3E3PA 4MH7A 3R9HA 4C57A 4TYHB 3ZM9A 2Q0NA 3UVQA 3FY0A 4BDAA 3NNVA 2GS6A 3HVCA 1L3RE 5K5NA 4AW1A 4DTBA 2PYWA 3QCSA 3FXZA 4C3RA 2JFLA 1LR4A 1JSTA 3PZHA 1GIJA 5M4IA 4S31A 4O7RA 3KGAA 5F20A 4PRJA 4YNEA 2C30A 4B0GA 4O1PA 4WNOA 4BDGA 2PVHA 4YZ9A 4C3FA 2PZ5A 4FMQA 4FTCA 1SNUA 4FKQA 3OWPA 4JL9A 5IG1A 3DTCA 4MQ1A 3RWQA 5A4EA 4EH4A 3H9OA 2A0CX 2IZUA 2X0GA 4KA3A 5DOSA 1SM2A 3BPRA 3HX4A 1JKKA 3TG1A 3UYTA 5L4QA 3V6RA 4FT9A 3KF7A 2RL5A 4FNWA 4HPTE 4RFYA 3QUDA 4WIHA 4YJPA 4CKRA 3SX9A 2PMOX 4UB7A 4BDFA 2PULA 2YZLA 4XV9A 5GIOE 1GIHA 2XK4A 2R2PA 5DA3A 4AZFA 4C2WA 3GB2A 4LV5A 3A7GA 4EWQA 4F0IA 2X6EA 2Y4PA 3HRBA 1I44A 4YPDA 2J0KA 3MW1A 3UVPA 1K3AA 2RF9A 4F9YA 3FUPA 3LAUA 4V0GA 1PKDA 3LJ2A 4CVAA 1G8SA 2OW3A 4I23A 4O84A 2B55A 2XJ0A 3D2KA 3LXPA 4JBVA 5TT7A 2R7BA 3FE3A 4O0TA 4RQVA 2QVSE 2OJGA 3VIDA 3RGFA 2OK1A 4QQ5A 2IG7A 3PVGA 3QHWA 4FTNA 2YISA 3UPXA 3Q5IA 3QWKA 4FI1A 4L01A 1O6KA 4D9UA 4F09A 1WBSA 4XOYA 4H1JA 2PK9A 3NDMA 3RWPA 3EFWA 4DLJA 1JQHA 3LFQA 4GUEA 3B2TA 4BBFA 3QC9A 5BVDA 4IM0A 4DH7A 1FMKA 4CNHA 2OU7A 4FIHA 4PP7A 4I5CA 5KMNA 3W2RA 4O2ZA 5HBHA 2VTIA 3IGGA 3FMEA 3FYJX 4NEUA 5CS6A 4U3YA 4BHNA 3QHRA 2YIXA 3IPHA 3KC3A 3QCXA 2J5EA 1JNKA 3COKA 4IVCA 4FTOA 2F7XE 1YXTA 4YR8A 3NIZA 2A27A 4L42A 3QCYA 4RIYB 2GNLA 2UZWE 3PG1A 4GW8A 5CYIA 1OUKA 4EKKA 3QD0A 5LARA 3PSDA 4O0RA 3CP9A 3I5NA 1OKVA 3LVPA 2X9EA 3VJNA 5EI6A 2JKMA 4TW9A 3UBDA 3OCGA 2B1PA 4NH1A 4X3FB 1H1PA 3AMAA 4XRLA 2XK7A 3JVRA 4N6YA 5CAVA 3CPCA 5LVOA 3EWHA 2QCSA 4RMZA 4ASXA 2ZV2A 4DGMA 3UMWA 4BWKA 3KMUA 3G9LX 2QD9A 3KXMA 5AUTA 4G3DA 3G51A 2WO6A 2R3NA 2W1ZA 4F6SA 3HMPA 3D7TB 3OWKA 2BDWA 2ESMA 4OTDA 3ZOSA 3CBLA 5AAGA 5HGIA 1BUHA 2GHGA 3OBJA 3UC4A 4CV9A 3HL7A 2WTWA 2VWIA 1YI6A 1O6YA 1QMZA 2VTTA 2E2BA 3EL8A 4XP3A 4YZMA 3V5TA 4MXOA 5M4FA 3QXOA 4MNEB 4GFMA 2Z2WA 5E8SA 1VYWA 5KBQA 1J7LA 5LVPA 2YCSA 1X8BA 3I1AA 3VS2A 1UVRA 4HCTA 3ZFXA 2PZPA 4D4VA 1R0EA 3PUPA 2I0YA 3E88A 4X3FC 3NW5A 5BVEA 4AP7A 3MESA 4QNAA 3F2NA 2NRUA 4BKJA 5HX8A 3LQ3A 5GJDA 5DR6A 3O2MA 1PJKA 4FKSA 5HE2A 4L43A 2YCQA 4FODA 3HZTA 3ZEWA 2YDJA 3BU5A 3QTXA 2ETMA 1Q61A 4ANMA 3R7GA 4EK5A 2JITA 2PZRA 1PRYA 4YJTA 3IECA 3KCKA 4XP0A 4YZDA 4E6DA 3RAKA 5C8MA 2F7EE 4C58A 3VUGA 4MX9A 2WOTA 5KCVA 4BC6A 5AUZA 1MRVA 2Z8CA 3DKCA 4ACMA 1TVOA 3BHYA 3NGAA 3KF4A 3PJ8A 3FQSA 2WTKC 4JG8A 4IDVA 4EH7A 1R78A 2XIRA 2R3RA 3HV7A 3LM5A 3T8OA 4CFMA 4AN3A 4OT6A 5LMKC 1FGKA 4WG4A 5EM8A 4IZYA 1BYGA 3R04A 4YLLA 3R83A 4F7NA 3NUNA 5GJGA 2R3MA 3ZO3A 5JGBA 4R7IA 5F95A 2BAJA 5FG8A 1VZOA 3CIKA 2C5XA 4J98A 5ETCA 1FQ1B 5DPVA 5BNJA 4G3FA 4DFBA 2WMAA 2Y6OA 1LP4A 3Q9ZA 5IA0A 4MXAA 4L3LA 4WG3A 3SRVB 1DI9A 4XCUA 4F7LA 1WVYA 5L2SA 5DN3A 1P14A 4NCTC 4GVAA 2HWPA 3KMMA 1Q8ZA 4FICA 4XLIA 4CKIA 4EUTA 5A4CA 2QG5A 4MHAA 4UX9A 5K0XA 3S2PA 3DK7A 3PVBA 1ZYLA 4YLKA 4F7JA 4OTPA 4S34A 3PPKA 3O17A 1DM2A 3QRKA 2QOIA 4YHJA 2PUNA 1RJBA 3BEAA 1IAJA 3P9JA 4MQ2A 4O22A 4O1OA 4CFUA 4GEOA 5JGAA 5IQCA 1Q8YA 2XIKA 4U44A 3Q9WA 4JQ7A 3AC4A 1T46A 3Q4UA 2UZUE 2W1GA 3FC2A 4ZTHA 5D11A 1MRUA 4DITA 2UW4A 1MUOA 3NEWA 4H39A 5D7VA 4CZUA 3EJ1A 4G6OA 4WBOA 4XEYA 3F7ZA 2F2CB 4I6HA 3V6SA 2VZ6A 4CZYB 4ZY4A 3S0OA 2OSCA 4RVKA 4KNBA 4ZZMA 4EJNA 1U54A 4TN6A 5HHWA 4N57A 3KXNA 4PMPA 1ZOEA 3SG8A 5IEYA 5LQFA 5DHJA 5A9UA 1FVVA 3I5ZA 5KMJA 2BKZA 4O96A 4YZCA 3ORZA 2FB8A 2YM7A 2J9MA 1SNXA 2ZM4A 1IG1A 3B8QA 3DU8A 3FMHA 5KX8A 5H8BA 1ZYSA 3M2WA 1KSWA 3MA6A 4MXYA 3R8PA 1A9UA 4F08A 3UOHA 5J9LA 4GSBA 5HD4A 2XJ2A 5DGZA 5HI2A 2DS1A 2PUIA 2OGVA 4M69B 3N9XA 2X6DA 3ID6C 3BWJA 4X2NA 4I5HA 3QZFA 1XH9A 2QOOA 3PLAE 2R9SA 4FNYA 3VS7A 3FMLA 3QQUA 1Q8WA 1R0PA 5DT4A 3RALA 3E93A 3VS4A 2VTJA 1OKYA 4PPAA 4HCVA 4IH8A 3LMIA 2A4LA 4R1VA 4YZBA 5KBRA 3V5WA 5HCZA 3GU6A 2OZAA 3SQQA 2OF2A 3FEGA 2JEDA 3BU3A 4GCJA 3ZZEA 3MDYA 5HCXA 2Z60A 4QNYA 3OW4A 1H25A 2YM3A 3S00A 2Y0AA 3A4OX 3A7HA 3DKGA 4MVFA 4WT6A 4FTAA 1ZRZA 3O8TA 4EYMA 4IIRA 4MEDA 2G2FA 2R4BA 2JBOA 3PTGA 1XKKA 2XK9A 3GQIA 3RPOA 2C5NA 3TZ9A 3UC3A 3WE8A 4BGHA 3EN9A 4IVBA 3FKNA 3OC1A 2QI8A 4ZSAA 2HELA 5LOHA 4KIPA 5IEVA 4JRVA 5DWRA 4JRNA 4ID7A 4W9WA 4X2KA 4MBJA 2DYLA 4LM5A 4AW2A 2UW6A 2NPQA 5JFVA 2VRXA 3AD6A 4MF1A 4GMYA 1OIUA 3PIZA 4WHZA 5EK7A 2VWYA 4II5A 2OKRA 4FZ7A 2ACXA 5E8VA 5L6OA 3F5PA 4AOTA 1LUFA 4HGLA 4EQMA 1KE9A 2C69A 4I0TA 3FPMA 2IWIA 3L9NA 5KMMA 2QO9A 5BUIA 5KUPA 4A9UA 4UZHA 3RTPA 4TWCA 4BGQA 5T6KA 4BRXA 3PWDA 4JR7A 2YM5A 4C36A 3QRJA 2C5YA 3BLRA 1UNHA 4U9AA 2DQ7X 4UWCA 1SVHA 5DRBA 5AP1A 3R71A 1KE6A 4WG5A 4ZJJA 4EH9A 5CSVA 2W9FB 4QQCA 3VRZA 1M2RA 3QTRA 4PV0A 5FTOA 3GC7A 2OZOA 5ANEA 4FKWA 5L3AA 2WEIA 3M1SA 2ERKA 3FZPA 1YVJA 5FEDA 3UE4A 4FTQA 2QOKA 4G17A 5LVLA 4OLIA 3ZO1A 4D2WA 4EOMA 2WMUA 3A7IA 4E26A 2ZJWA 3BQRA 3MVLA 1YHSA 3PIXA 4IW0A 4ZSEA 3SG9A 2WAJA 3MFSA 1URCA 5KHWA 3EOCA 2PVJA 1H27A 3C51A 1RQQA 4XBUA 4J8NA 4JAIA 2JIUA 3A62A 4BN1A 5E9EA 2G2HA 5HU3A 5LMAA 4FOCA 1IEPA 5IISA 4M13A 4Z7GA 2C6LA 5AIKA 5FBOA 3LCDA 4RA4A 3PXRA 3DZOA 3F61A 1YOLA 4YBKA 3UJGA 2J0MB 2PSQA 4U41A 5CU3A 5DFPA 4O6EA 2Y9QA 3ORMA 3KXXA 2PL0A 4G3CA 5EDPA 5AADA 4QYFA 4H1MA 3ATSA 3JUHA 3DBCA 1Y8YA 4YGAA 4QMWA 4YJVA 4CT1A 2QG7A 3OHTA 2UVXA 2BTSA 5CXHA 3IW7A 4D4SA 3NSZA 2J7TA 3P78A 4UMRA 3WZKA 4QYEA 2X81A 2J0IA 2VNWA 3HV3A 4NM5A 4C4GA 1YDTE 4O7LA 5AR4A 3AMBA 4CFNA 4HZSA 2UW3A 1H0VA 3AQVA 1ZMWA 3GCSA 5LWMA 3MPTA 2ITNA 5C01A 5AA8A 1PYEA 3B2WA 2J0JA 4ANBA 5HLPA 3TTJA 2PMNX 3E64A 3V8TA 4FEXA 3SHEA 3R1YA 4RJ7A 4RJ8A 1P5EA 4QP8A 4RVLA 3FLNC 3PJ3A 3LFSA 3NPCA 2WMQA 2HY81 4O27B 1XH6A 5HIBA 3GC8A 3RM6A 3G5DA 2B0QA 3SAYA 4K8AA 4X2JA 3IKAA 4OAUC 4HVDA 2X39A 3FI4A 4FKUA 4B99A 3EFJA 1ZMVA 5EW8A 3QZHA 4RVMA 1H28A 2RSVA 3F6XA 5J9YA 2OWBA 5D9HA 5HLNA 3SA0A 4ZEGA 5AV3A 3WI6A 5IEXA 2BRGA 3V5QA 4ZSJA 1R1WA 3DPKA 3G9NA 4EQCA 3LXNA 4NCTA 1JOWB 4FSYA 4XG9A 3TZMA 4IVAA 2J4ZA 3IOPA 4L6QA 2C1AA 4NU1A 4F1OA 3MTFA 4TT7A 2C6TA 5A3XA 5JK3A 3MVJA 3PA5A 4PP9A 2W1IA 5CLPA 3W55A 2E9PA 3A60A 5M07A 4X2FA 2FYSA 2PE0A 4DHFA 4GH2A 4OBOA 4RGJA 3VBTA 3MH1A 3BYVA 3MI9A 5FP6A 3IGOA 2VWUA 2OIBA 3C13A 1GZNA 5JT2A 3G6GA 1NVRA 4XV2A 3WIGA 5HIEA 1R39A 3EQPA 3Q6UA 4A4XA 4BF2A 2X4ZA 5AWMA 2PMLX 4IX5A 5EYDA 3U6HA 1KOBA 4D1ZA 4EH6A 3KEXA 2PZIA 4DT9A 4JVGA 3EQHA 5IQBA 1XJDA 3LE6A 5D12A 4WUAA 3RM7A 1Y91A 4BCIA 5EKNA 5FD2A 4BWXA 2GNFA 4DTAA 3DT1A 4MF0A 4RQKA 1GIIA 4ZTNA 4ANQA 5ANGA 3DK3A 4YJOA 4R7BA 4U45A 3VC4A 3HAVA 3VRYA 5I3RA 3T3UA 2FGIA 4XG2A 2UZLA 5HBEA 3H0ZA 4Z9LA 4QTCA 4M8TA 3C7QA 4C4FA 3AD5A 1YKRA 3D9VA 3R8UA 4FKTA 3OY3A 5TOZA 4JNWA 3KREA 2C6MA 2C6IA 2UZTA 4IMYA 4DEAA 5HQ0A 2W9ZB 1O6LA 1BL7A 5DEYA 4PL4A 4FIEA 5F94A 5T68A 3UIBA 1PW2A 2ITVA 3TUCA 4G16A 4XOZA 2B9IA 5TO8A 3DFAA 5KE0A 4X3FA 3W33A 4AGDA 5AR3A 2X7GA 1ZYDA 3D7ZA 1NT2A 2ITZA 3FL4A 1GNGA 4FVRA 3A8WA 3M11A 4C2VA 5HG7A 3SD0A 2NNWB 4D4YA 3BGPA 4MD8E 3D2IA 4OTGA 5AR7A 3CKWA 3VULA 3ORTA 5M55A 4GU9A 4L9IA 4WBBB 5HTCA 3O7LB 5CF8A 1IA9A 2QOFA 4NUSA 5BVOA 2XP2A 1NVSA 2CPKE 4FKRA 1KE7A 4TKSA 4GIIA 4XS2A 3ORLA 5F1ZA 3SXSA 5EH0A 3WF8A 4R77A 4HVHA 2ZM1A 4L46A 2VWZA 4GKIA 4N0SA 2X1NA 3ORPA 4L67A 5J87A 5A54A 3H9RA 4DG0E 1JLUE 1GJOA 4DGGA 2CJMA 4TWOA 3QLFA 4K6ZA 2CN5A 3UOKA 5AEPA 3VQUA 4MBLA 4CGAA 2NO3A 2YM8A 3OBGA 3RAWA 4E3CA 4CSVA 3LCOA 2E9NA 2GU8A 1OMWA 4XG7A 3TNHA 3ZSHA 2VX3A 3QQGA 3PPJA 4PMMA 2CKQA 5ANIA 4U5JA 5FP5A 4OUCA 4IC8A 2ZDTA 3QXPA 2UW9A 3C50A 4KIQA 4AN2A 2YCRA 1UKIA 2CLQA 3CEKA 4B8MA 4NKSA 4F6UA 1ZOGA 4AT5A 3LM0A 1PXMA 2CGVA 3PZEA 2XK8A 3LFEA 3NW6A 3PPZA 5CEPA 4H3QA 4HVSA 3L8XA 3C4XA 2W4OA 2W4KA 3H9FA 4QP9A 4F9CA 1PXPA 2I6LA 3E92A 4Q9SA 3EQDA 4C38A 3RPRA 2BKKA 1G8AA 4NIFB 2CDZA 2BRMA 2PZYA 3LXKA 4NJ3A 3FQHA 1CKJA 3K5VA 4TL0A 5DLSA 3TI1A 5E8UA 4ZAUA 3MGYA 4D0XA 3MVHA 5I9UA 4GUBA 5LMKA 4EH3A 4G1WA 1BX6A 4BCFA 3COIA 4FV0A 3ZZWA 3QWJA 4DGOA 4M0ZA 1XH4A 3POZA 4UMQA 3Q6WA 3V04A 3UOJA 3DCVA 5HVKA 1B6CB 3CXWA 3MV5A 1WCCA 1YW2A 4YJNA 1PXOA 3RKBA 2PY3A 4S2ZA 4RC2A 4Q9ZA 4FL2A 4ANSA 4DEEA 4GJ2A 5CT0A 3H3CA 4EH5A 2ZVAA 1JSUA 4IWQA 3I7BA 4GT3A 4IAKA 5J1WA 3TV6A 3Q96A 3GGFA 5H2UA 4A7CA 2C3JA 4E4LA 4U3ZA 1BMKA 4AZEA 3E3BX 1IAHA 5HVYA 1G5SA 2GNHA 4IXPA 4BCGA 3KULB 4RJ6A 3EZRA 2IJMA 4KB8A 3U9NA 3T9IA 1PHKA 3JXWA 4ASDA 5L2QA 4EBVA 3GQLA 4W8DA 4HYIA 4MYGA 2YZAA 4NFMA 5EHYA 4EK3A 1ZXEA 4UYNA 5B2LA 4J53A 3ZH8A 4O86A 1H1SA 4FKJA 2AC3A 4OTFA 3C4EA 5E8YA 4IADA 5L8LA 4RZVA 4PTEA 5HO8A 5EW3A 2SRCA 3FI8A 4ZTSA 4FV5A 2JLDA 3MFUA 3ZU7A 1WFCA 3FMKA 2C5VA 3RK7A 4LQMA 1DAYA 3VQHA 4F7SA 4WNKA 4O21A 4IJPA 4YTIA 2F7ZE 5G6VA 4F0GA 2G15A 3Q2JA 4ERWA 4FTLA 1KV2A 2WTIA 2C3KA 1E1XA 1Q3WA 4FSRA 1QPCA 5BMMA 2IZRA 5K5XA 3BHTA 4M69A 4EK8A 2REIA 3DBEA 3RAHA 3TKHA 2XK3A 5K4JA 5GHVA 3W8QA 4QMNA 5ETIA 2J5FA 1ZY4A 3MVMA 4JIKA 2IW9A 3ZEPA 1PF8A 5BX0A 3R21A 3BELA 5EYCA 5T3QA 5BUJA 3DQWA 3GUBA 4M67A 4IB1A 3LQ8A 4LRJA 4XG3A 2IPXA 3GOKA 2YJRA 5FUTA 3C4ZA 2VTMA 5FM2A 2OJIA 4O38A 3PJ2A 4I94A 1UNGA 2BUJA 2XH5A 3KFAA 5EI8A 4HW7A 4HJOA 3V01A 5EQPA 3QGYA 3LOKA 3MSSA 4YLJA 5CSWA 4F4PA 5AV4A 2X2MA 2YM4A 3BBWA 3HMMA 4E1ZA 2W7XA 2XZSA 4EC8A 3F88A 3W18A 4FE2A 1H1QA 3P86A 2A19B 4A4LA 2CCIA 1J91A 5CZHA 3D5UA 2QO7A 3RCJA 3TDWA 4KINA 2VTOA 2OI4X 3D94A 1P4OA 1SVEA 3SKCA 4FSNA 1ZZLA 4XG8A 3W32A 3RK5A 3VUDA 5JZJA 4E73A 1W83A 3IDCA 4L00A 4ZLYA 2OH0E 4FVPA 2RFDA 4ZY5A 2R3JA 5FXQA 4ZMEA 4XG6A 1PXKA 3RPSA 4O6LA 3U54A 2QR7A 4CFXA 2QKWB 3HP2A 4G5PA 4QMVA 4R5SA 3TKUA 3EFKA 3Q32A 4GT4A 4JG6A 3RP9A 3JPVA 2HW7A 3DK6A 3NUSA 5ETFA 3CE3A 4ACDA 2WOUA 3QKMA 5JEBA 3B8RA 3CCNA 1R3CA 4JIAA 2XA4A 2ITYA 3MY1A 4UY9A 4X7QA 4G34A 3FXWA 1W7HA 3UZPA 2EXMA 5AJQA 3RVGA 5HE1A 4BI2A 2LAVA 4RZWA 2EXEA 4QD6A 2ITOA 4JDHA 1NA7A 3KU2A 3NZ0A 2CNVA 3ATTA 3MBLA 3CR0A 3EYHA 2R7IA 3NLBA 3PIYA 1KE5A 4FV7A 2X9FA 4EOQA 4DGNA 4YTFA 5BYYA 4TYJA 2W4JA 3DFCB 2NP8A 3HA8A 4JQ8A 4P5QA 4BYIA 3W2SA 2JFMA 3MWUA 1YWNA 4LFIA 3RHXA 4AQCA 4FV6A 4K33A 4PPBA 3DV3A 4AFJA 2CCHA 4RC4A 4EBWA 5E4HA 3Q9XA 5CI7A 4UMUA 2W05A 3IW4A 5CWZA 1I09A 1V0PA 5KO1A 1H0WA 2WMVA 4BKYA 4F70A 3VHEA 4D2VA 2XEYA 3PA3A 4RWJA 4AOJA 3QRIA 4FKPA 3OD6X 4BKZA 3QL8A 5A14A 4EORA 3VS3A 3EQFA 1J1BA 5HLWA 4X2GA 3FSKA 3LFFA 4FNZA 4V04A 2W1DA 3PY3A 4J95A 5KKRB 5IQGA 5BVKA 5B7VA 3QX4A 1UV5A 3KK9A 3CY2A 5EI2A 1GOLA 3TZ7A 5I9XA 3ODYX 4MTAA 5CF5A 2YDIA 4NM0A 4FGRA 3CTHA 2GTMA 3FI3A 3VS5A 3ZLSA 1OL6A 4A4OA 2IN6A 3OCSA 4ONAA 4C4JA 4S30A 3V8SA 3C0GA 3GC0A 4GRBA 4EL9A 5BVWA 4LL5A 3VBVA 3TUBA 3HGKA 4DH8A 5BMSA 5DNRA 3ZHPC 4D58A 5HE0A 3E8CA 3I79A 3R00A 3HMNA 2GHLA 4HGTA 4NSTA 3UQGA 5GNKA 4EH8A 3LMGA 4DFNA 1WZYA 2UW7A 3HDMA 3ZONA 4E93A 4QP6A 3NUXA 1PXNA 2RFSA 3NYXA 4D5HA 3A2CA 4BIDA 3EN7A 1VYZA 4O2PA 3ZBXA 2CNUA 3QCQA 2C47A 4O0UA 2VTQA 3MN3A 3OXZA 2YEXA 2XK6A 3GFWA 3LXLA 3FXXA 4ALWA 4AT4A 3VHKA 2W1EA 4PNKA 3DXPA 2BR1A 4XV3A 4YTCA 3P5KA 3CD8A 5HG9A 2EVAA 3BV3A 4V0GB 5CI6A 4WA9A 4NK9A 5KZIA 4AU8A 4HVIA 2F2UA 3DNDA 2LGCA 4CV8A 5KMKA 2VTNA 4QMTA 5ANJA 3MH0A 4IB0A 4EOJA 2PE2A 3EFLA 3RZBA 5AR2A 4Z7HA 3OTUA 2HENA 3R30A 4DTKA 5JFWA 1NXKA 2W1CA 4KWPA 3BYUA 2YIQA 4MAOA 4S33A 5J95A 3COMA 5HO7A 3GCPA 2WTCA 3LLTA 2C3LA 2GNGA 4L7SA 4B7TA 3W2OA 1STCE 3GU7A 3ULZA 3R01A 3ZO2A 4IZ5A 5BVFA 3TM0A 2KTYA 2C0TA 1JWHA 5FGKA 2VTSA 4L45A 3UQFA 4JR3A 2HZNA 4J1RA 4PTCA 1W8CA 3EN4A 3WE4A 3ALOA 5C1QB 4LRMA 3I81A 3EQCA 2OICA 4GK3A 4I5MA 4D28A 3R28A 4EZ3A 4OBPA 4BBMA 2QOCA 4JBPA 3OEFX 4AE6A 3CGOA 4X3JA 3TV4A 3UZTA 3DA6A 3G90X 4JAJA 5K0KA 4XNEA 1Q62A 3UNKA 1Q97A 2XKDA 2G9XA 4Q2AA 3E8EA 2F4JA 4OTHA 4FBXA 5ETAA 3TT0A 4CT2A 5B2MA 2WIHA 4U40A 5M56A 1NW1A 1ND4A 2VWXA 4GFOA 3O7LD 4HNIA 3DAKA
chains in the Genus database with same CATH superfamily
2XNOA 2X4FA 3MTLA 3OP5A 4TZRA 3ZSIA 5DG5A 3O23A 5CVGA 4USDA 1IA8A 3VUMA 1E1VA 1Q41A 3EZVA 5M08A 4BJJA 2O63A 4Y8DA 5I9VA 4NW6A 2VUWA 2VNYA 3MFRA 3HYHA 2XNPA 4MXZA 5AV2A 2CN8A 4FTRA 4K9YA 4FV2A 3BWFA 4BZDA 5HG8A 5AP4A 5HOAA 3UMXA 4XLVA 5LXMA 4NM7A 5E8WA 2RG6A 4M15A 4QP1A 2YIWA 2BROA 5GZ9A 3ROCA 3ZRLA 4DH3A 2JDOA 3CY3A 4FSUA 4L3PA 3I6WA 5AUXA 4KRCA 2R3KA 5AFVA 3DQXA 4WRSA 1FGIA 5JSMA 4FSWA 3R8ZA 3PY0A 3DJ7A 2XNEA 5CF4A 1APME 1XO2B 3QD2B 4BZNA 4NM3A 5CSHA 3P5JC 4IM3A 4M14A 4UWYA 5EHLA 3TN8A 3ZDUA 5A6NA 4FA2A 4O4EA 4L8MA 2ITWA 3QTSA 3MB7A 5AX9A 4U8ZA 4WSYA 4O0VA 4IAYA 3FMJA 4AGCA 4FV8A 2QOQA 4FK3A 3SXFA 1KOAA 2JDRA 5KZ0A 2W17A 3DKOA 4PMTA 4RJ4A 3VF8A 4J96A 3TCPA 4M3QA 4TNDA 1WVXA 3GBZA 1YOMA 3P0MA 5ACBC 3FQEA 2BAKA 5I3OA 3W10A 3JY9A 3LKMA 3Q4CA 5AAEA 2P33A 1YRPA 5ANOA 1ZY5A 3KQ7A 4FTUA 4UZDA 4W4VA 2XKFA 4ZSGA 3FZTA 2E9UA 1PKGA 1OB3A 4MXXA 2FVDA 1ZWSA 3HDNA 4RX7A 2X0QA 4FR4A 4BHZA 3GP0A 2WMTA 2QODA 4KKHA 1V1KA 3U4UA 3VS6A 4H3PA 3R1SA 2X8EA 5DRDA 3K3JA 1AD5A 2WQBA 5C4KA 4PNIA 2R3OA 4AE9A 2W5BA 2B53A 2OJFE 4QP3A 4FV9A 4TWNA 4EWHA 4Z55A 2Q0BA 3CQEA 2GS7A 3BX5A 3R7OA 3EYGA 2XRUA 2WGJA 4GK4A 4KAOA 4BDBA 4EZ7A 1W2FA 1ZYJA 2G1TA 4IAAA 5AUUA 2PVNA 3WOWA 4UYAA 5M09A 4FIFA 3BHVA 4LRKA 4QRCA 3MJ2A 5IA5A 4GYGA 4IACA 4APCA 1XMLA 4A06A 2ERZE 3F2AA 4AZTA 3OF0A 4U7ZA 2PVLA 2QLUA 4X0MA 5LJJA 4OAVB 2IVUA 2YHVA 5HNIX 2ITXA 5IU2A 4WSQA 5E92A 5I0BA 4O82A 4FZ6A 1XH5A 1ZAOA 3E87A 4U42A 2V0DA 3UPZA 3OY1A 4KIKB 4C4EA 4O7WA 1REJA 2WB8A 2X8DA 4Q5EA 2OXYA 4FEUA 5J8IA 4OGRA 2QONA 1IASA 4FG9A 3NCZA 3U87A 1XR1A 4M7IA 2WQMA 3ETAA 4KRDA 2QO2A 5LVMA 2OF4A 2JKQA 4IDTA 4YSJA 3U55A 3LCTA 3I4BA 4JXFA 2WKMA 3KULA 2GCDA 2W99B 3DBDA 4KIOA 4CFVA 1S9IA 5IQAA 5FRIA 4RX5A 3K2LA 3Q52A 3U8WA 5HG5A 4DDIA 1XBCA 3UO6A 5EQEA 4D2RA 4IX3A 4B6LA 3EQIA 5G1XA 2OXDA 3HV4A 4BCNA 3I7CA 5BVNA 3VWAA 4RIXA 2BFXA 3BGQA 3PVWA 4WO5A 3K5UA 4GL9A 4UN0C 4ZTQA 5C8NA 3QA8A 3GCQA 3OCTA 4H05A 4IANA 5C27A 1UU3A 1BI8A 4AAYA 2JIIA 2XIZA 1DAWA 3FHIA 3FDNA 2XBAA 1Y57A 5DI1A 5DR2A 3BHUA 1UNLA 4RWKA 5AMNA 4AZVA 3NX8A 3NFGB 4TY1A 3UYSA 1OIYA 2JAVA 5EG3A 4BCJA 3IG7A 5H8GA 2QKRA 4K18A 2O0UA 2WMXA 3CGFA 3D5WA 4FVQA 2BPMA 3VBQA 2IW6A 2WHBA 3H4JA 4MK0A 4RG0A 5LCJA 4CCUA 4QEBA 3HUCA 2HZ0A 4ACCA 5CT7A 5BYLA 2XVDA 3WF5A 4I20A 4OT5A 4RIOA 2W1FA 2XF0A 5AP0A 2WPAA 3FMNA 4NFNA 3A7JA 4QMMA 4BL1A 4CXAA 3BKBA 4KKEA 1SVGA 2VX1A 4EOIA 4O4FA 3IS5A 2PVMA 4HYHA 4IX6A 4Z3VA 3Q60A 4IB3A 4YBJA 2XB7A 4MBIA 3MH3A 1YHVA 4QTAA 3UIXA 2XS0A 2YCFA 4V01A 5ANDA 2Y7JA 2X2LA 3RPYA 4F6WA 3P4KA 2GNIA 4FSMA 3E5AA 2V7OA 3ORXA 4LOQA 4PL3A 1MP8A 1WBNA 3WYXA 3CLYA 5D41A 3ORIA 3QQHA 1OL1A 3D5XA 4ASZA 3PXQA 2HZIA 4DC2A 4PY1A 4ZTMA 4YC6A 4PDYA 1E9HA 3K3IA 3SW7A 1V0BA 1K9AA 2YDKA 4UWBA 2V55A 2CNQA 4I6BA 1WBOA 2PWLA 4BCMA 4TYIA 2BHHA 3MS9A 1XBAA 3NAXA 4MNFA 3R7VA 4C4IA 1KWPA 3NYNA 3EKNA 4BDHA 4G3GA 2BMCA 1OKWA 4U79A 4DH1A 2IZTA 2Y4IC 2HAKA 3A8XA 2JD5A 2Z7QA 4MKCA 3ZLWA 1J1CA 3Q2MA 3PSBA 3R9DA 4FG8A 2WTKB 4IHPA 3ZFMA 4E5BA 5BQ0A 4KBCA 3HP5A 4FTKA 4U6RA 5AP7A 1U5QA 4P2KA 5EDRA 2WFYA 2YAAA 5KHXA 3C5IA 2XNMA 3A7FA 4QTDA 3NUPA 5FBNC 4BCOA 3ZLYA 2QOLA 4EYJA 2E9OA 4IQ6A 4PPCA 3V51A 4AZWA 5HO6A 2G01A 3W8LA 4UALA 5IQIA 4CFWA 3PVUA 3L1SA 2VO0A 3DJ6A 2R5TA 1OM1A 3ORKA 2UVYA 5KKRC 2BRBA 4EHVA 3FZSA 4NTTA 5FLFA 3ACKA 5HTBA 4RWLA 3ERKA 2JDVA 1IRKA 3C0IA 4YSMA 2UZBA 3NW7A 1QL6A 4CRLA 3AKKA 3LMHA 3AOXA 3H10A 5C9CA 3QKKA 4R3CA 3NUAA 4M84A 3KVWA 2RGPA 3KXZA 4JJRA 5AA9A 1GZKA 3TNWA 4ARKA 3D4QA 3QRTA 4QMSA 4TWPA 3CJFA 2HW6A 4MWIA 2BALA 4YC3A 3O8UA 2F49A 4G2FA 4FYOA 2P55A 2VU3A 3OOGA 3C9WA 3EN6A 1AQ1A 2BRNA 3BE2A 4WUNA 5AM6A 5GIPE 4AA5A 4ORKA 3E7OA 4YJSA 4EK4A 3LFCA 2BILB 1XMMA 2HZ4A 3PE2A 4YJQA 4L53A 5AAFA 4QDVA 2UZNA 3OROA 4AW0A 2X2KA 3TNQB 4JOAA 4XJ0A 3FLZA 3P23A 1VR2A 2FA2A 4QMYA 5DT0A 3V8WA 2CKPA 3W0NA 1ZZ2A 2YN8A 3TJDA 4AN9A 5L2TA 4W8EA 2IZSA 2C6KA 3VBWA 2WXVA 4HYSA 4O4CA 1M17A 3ZUVA 1YXSA 2WMWA 3AXWA 3AD4A 3DTWA 4LI5A 3ZM4A 4FF8A 1BLXA 4V05A 4USEA 4AOIA 3FKLA 1OUYA 3I0QA 1WVWA 4K1BA 5HTIA 5J7HA 3KL8A 4GT5A 5HNGA 5CEOA 4WOVA 4BCKA 3GFEA 3KRLA 3IK3A 2J51A 1TQMA 2EB3A 4W9XA 5M53A 3OFMA 3LFNA 3ZC5A 3PP0A 4N70A 5CY3A 4E6AA 4YURA 2J50A 4MD7E 4EKLA 4O7VA 4RX8A 2QQ7A 3BBTB 2QU6A 1PYXA 3FJQE 4RA5A 1WAKA 2CKOA 4XH6A 5A4LA 2GNJA 1REKA 4E4NA 2B54A 4Y95A 5JQ5A 4DHJA 2WTJA 3MFTA 3DOGA 4QQTA 2EU9A 3L9PA 5L6WL 4I3ZA 4IZAA 4RX9A 3MYGA 3ZXTA 3Q9YA 4BCQA 3O96A 3Q53A 2I40A 2ZYBA 3DLSA 3EN5A 3FWQA 4D2TA 3QALE 3WIKA 3EKKA 2QLQA 2R3FA 4DE4A 3AMYA 2VO6A 1FINA 3DB6A 1Q3DA 2JGZA 2YWVA 3R8VA 4BTMA 3FL5A 5J1VA 3DY7A 3QD4A 3CKXA 2O64A 1V0OA 5IMEA 2AEGA 3FAAA 4NWMA 4F9AA 1Q5KA 3SC1A 5CX9A 5CQWA 1FMOE 3ZUUA 3HMOA 3HRCA 4RLLA 3OWJA 4C0TA 5GZAA 4XP2A 4CYIA 4ERKA 2VGPA 2XM8A 1YWVA 5DBXA 4UMPA 4DDGA 2JKOA 2ETRA 5HBJA 3TWJA 3OG7A 1XHAA 3EB0A 1OZ1A 4RPVA 5AIRA 4RIWA 3KRXA 4BVUA 1QPDA 2C5OA 4KABA 5JKGA 2F9GA 4TRLA 5CTPA 5AUWA 2BTRA 3BHHA 3OT3A 3DAJA 3F2RA 4DFYA 4YJUA 4CYJA 2PVRA 3QZIA 4FTJA 3DAEA 5L2WA 3L8PA 2VTLA 3SV0A 3AC1A 3FYKX 4CFFA 5CVFA 5DVRA 2PHKA 3E63A 4BR3A 4NL0A 4RSSA 3S3IA 5IA3A 3F5XA 4FOBA 3TIYA 1HCKA 1B39A 3PJ1A 2VWBA 3FY2A 4W4XA 2F57A 4ITIA 5FDXA 3DZQA 4DGLC 3HA6A 4O83A 3L8VA 3R22A 4FTMA 5B0XA 3AC2A 1YDRE 4FEQA 2BZJA 4DAWA 3GC9A 3F9NA 4PX6A 4WNPA 4RT7A 2C1BA 4YTHA 3G2FA 3Q04A 4I24A 4RJ3A 4ITHA 1BI7A 1CKIA 3C1XA 5HCYA 2YJSA 3QTWA 3UVRA 4F65A 3L8SA 3FZOA 4LL0A 4HPUE 2O8YA 3QTZA 4EQUA 3A61A 3KKVA 4BI1A 5L6PA 4E5WA 3QGWA 3NVKI 4QMZA 3WARA 1UWJA 2JKKA 4C7TA 5JFXA 3PLSA 3UODA 4B4LA 4YPSA 3F82A 3UO5A 5ACKA 4ZOGA 2YA9A 5C03A 3E62A 5DE2A 5BYZA 2WQNA 4I0RA 3W16A 1HOWA 3HUBA 5H8EA 3R1QA 2VV9A 3QF9A 4PTGA 3G0EA 3RINA 3Q4TA 4R3PA 2H34A 3IONA 4EUUA 4F64A 4O7ZA 3CQUA 3FLWA 2X7OA 4GG5A 3VAPA 2UUEA 2RKUA 4DG3E 4WNMA 4O7NA 4FK6A 1OIQA 4FSZA 4R8QA 4KUJA 3O8PA 2R3QA 3HKOA 3MY5A 1OIRA 3CD3A 2W0JA 3FZRA 4ZTRA 1M7QA 1YXUA 4XUFA 3TL8A 4UV0A 4FKIA 5C8KA 4JMQA 5C4LA 2CGWA 3NFFB 2R3HA 1M2PA 5KMOA 3MA3A 4RVTA 4Y73A 4Y5HA 1IR3A 5K3YA 4IFCA 4B9DA 4X6QC 3RNIA 4QMOA 3VW8A 2Z02A 1OI9A 1OL7A 5TE0A 3ET7A 4JLCA 4L52A 3N4VA 5J9ZA 2AUHA 3ENHA 3OMVA 2ONLA 5I9YA 2YM6A 1RW8A 3I0OA 4Q5HA 4D5KA 2O65A 5CSPA 2V5QA 3OUKA 5E7RA 3LCSA 4R1YA 3UO4A 3F7WA 2C6DA 4PDPA 3MPMA 4ANLA 2WQEA 3MH2A 1YXVA 2ITPA 3BZ3A 4QOXA 3ODZX 4ZTLA 4EI4A 5JGDA 3NMUF 1UWHA 4BWPA 1AGWA 3GVUA 3VN9A 5IUGA 1YHWA 4L68A 5AP5A 3QQLA 3C4FA 3UDBA 4BIBA 4D2PA 4O91A 4LUDA 3PP1A 4E6CA 4DBNA 4EOKA 3THBA 5KNJA 4FEWA 1J3HA 4ZZNA 3ROYA 3ELJA 2ZV7A 3R6XA 3RMFA 4UMTA 3ZS5A 1JAMA 2XIXA 5M57A 1T45A 2WMRA 1ST4A 5JH6A 2FSLX 2QR8A 5GZ8A 5JFSA 4IE9A 3REPA 4CCBA 3F3UA 2CGXA 1PY5A 2R3GA 4GG7A 2QOHA 4MD9E 4TNBA 4ALVA 1H26A 4QP4A 4JX3A 5AR8A 4E5AX 1ZLTA 2I0VA 3TUDA 3TJCA 3COHA 2P2HA 3QKLA 3TZ8A 4AZSA 3V5PA 1GAGA 4AF3A 1H07A 2CKEA 3D7TA 2ZMDA 5B2KA 1GY3A 1H01A 4EK6A 2ITTA 3BYMA 3E8DA 2A2AA 1Q8UA 4A9SA 5IF1A 5K4IA 2OO8X 5E91A 1J7UA 4MNEA 3QA0A 4KIKA 3PRFA 2HCKA 4AUAA 3S1HA 5M06A 3FPQA 1H1WA 1GZ8A 4I5PA 5IQEA 4E4MA 1YI4A 4KS7A 2XNGA 4EZ5A 4FC0A 2Z7RA 3BRBA 5E8ZA 4C61A 4UXLA 4H36A 3WF7A 1WBTA 3FC1X 4RLKA 5K9IA 4QMUA 3TDVA 4BGGA 3IDBA 1VJYA 2YLEA 4TPTA 4LYNA 3LQ5A 1W84A 4E8AA 3OZ6A 2UZDA 2XCKA 1FPUA 5D1JA 5DH3A 1OL2A 4PDOA 2PVYA 3ZC6A 3F3WA 4JT3A 5CENA 5FXRA 3WZEA 4WKQA 2B9HA 5IH5A 4JBOA 3TKIA 4RIXB 4M97A 3ZRKA 4D55A 5ITAA 3F3ZA 5H9BA 1XBBA 4FKOA 4R3RA 1BKXA 4H58A 4IAZA 3TNPC 3W2CA 2XBJA 4I4EA 5DMZA 2J6MA 4D1XA 1RDQE 4E20A 2I7QA 4IJ9A 2VGOA 4FZFB 3R0TA 4OR5A 2GQSA 2VX0A 2NYAA 4ZXTA 4C4HA 2X0OA 4QTEA 4A9RA 2OXXA 1JBPE 5FTGA 3HECA 3R9NA 4GVJA 2B9JA 1KUTA 5DT3A 5AP6A 3MB6A 5EHOA 1Q24A 4K0YA 2G2IA 2GFSA 3U51A 5A4TA 4P7EA 3KN5A 4UBAA 3ALNA 2YACA 3DXQA 3HLLA 4ZJVA 1TKIA 3R7YA 3D15A 2BIKB 4HCUA 4I6FA 4R7HA 5CEQA 5H3QA 2HWOA 3QUEA 3CJGA 4ANNA 1SYKA 3OT8A 2OG8A 2XNNA 3ML1A 4RJ5A 4FEVA 3NUYA 3LFDA 2ZOQA 3AT3A 2H96A 1NVQA 4XHKB 1F0QA 3WBLA 2YWPA 4FZAB 1Y8GA 2BZHB 3ZUTA 4Y83A 2CHLA 2XMYA 3AT2A 3IQ7A 4EHEA 5CASA 2HXQA 3NVMB 2VO7A 4E6QA 3TTIA 3G15A 4JDIA 3AT4A 3DB8A 1MRYA 2XEZA 2Y4IB 4ZIMA 5TKDA 3VF9A 2WIPA 1NY3A 1FVTA 3S95A 2Q83A 5JN2A 2AC5A 2UZEA 4AW5A 2EWAA 3GT8A 4KBAA 3PXZA 4F1MA 4QQJA 5EM5A 3D83A 1OGUA 1WBWA 2ZB0A 3WF9A 4W4YA 4E4XA 2V62A 4GYIA 4U97A 3WZDA 5IDPA 2VD5A 5A46A 3EQGA 4DFUA 4IFGA 1RE8A 2C6OA 3OUNB 2B4SB 3R63A 5IZFA 3ITZA 1Y6AA 5JMSA 2DUVA 3RPVA 4J71A 1OPJA 3C4CA 3R73A 4HGSA 2WNTA 3MJ1A 1UU8A 3KXGA 4LGGA 4DLIA 4NZWB 4IB5A 4ZS4A 3LJ0A 5HE3A 4K2RA 1OKZA 2YERA 2JDSA 3FSFA 2E9VA 4KSPA 4I93A 3PJCA 3AC3A 4R78A 1H24A 4AXCA 3LJ1A 1Z57A 3ZO4A 3PSCA 3U6JA 3POOA 3BV2A 1EH4A 5CZIA 1JKTA 3II5A 4FNXA 3GCUA 3L9MA 3FKOA 3NS9A 4Y46A 4K77A 1H1RA 3EMGA 3AC5A 3FBVA 3NYVA 3KXHA 4FG7A 3HRFA 5FXSA 3SXRA 4FYNA 3FMMA 2HXLA 3WF6A 5EM6A 3RHKA 3TNIA 2RFEA 4ZJIA 3ZCLA 1Q99A 3KRRA 2ZV8A 3NWWA 4CZTA 3U9CA 2IW8A 3O51A 4OTWA 4W4WA 5J7BA 3PXKA 4OTQA 4AX8A 3UG1A 2OZAB 2I0EA 3HV5A 3UIMA 2WTDA 5AV1A 3N4UA 4FT0A 2PUPA 3P1AA 5CEIA 1FVRA 3KVXA 2J90A 4I1ZA 3G0FA 1G8JA 1URWA 4D9TA 3PFQA 4O4BB 3OEZA 5FTQA 5L8KA 2PE1A 3RAIA 3NRMA 4G6LA 4C35A 3NUUA 4IZ7A 3QUPA 4J52A 4XG4A 5IUIA 3OOMA 4JX7A 3QYWA 2ZAZA 4M12A 4BDJA 2JC6A 3JYAA 4J97A 1DS5A 1OBDA 3DXNA 4D0WA 1M14A 4ZP5A 3PRIA 4Y85A 2X7FA 2OFUA 2OIQA 4CMOA 4C02A 4P5ZA 3OXTA 5IH6A 4UXQA 3W2QA 3RCDA 4MWHA 5HEZA 4U81A 3HAMA 4JG7A 4NKAA 4EOLA 4I6QA 5IH4A 1SZMA 3BLHA 3VUTA 5IA4A 1U4DA 2QHNA 3E8NA 3JVSA 5DR9A 3O0GA 4E7WA 4YZNA 4OW8A 3FV8A 3QLGA 4I21A 3TXOA 4ZK5A 4F9WA 2R3IA 3WZUA 1MQ4A 4ZMFA 4AGWA 1PMUA 3DBFA 2EUFB 3BCEA 4XYFA 5ICPA 2OFVA 3QX2A 4EOPA 2C6EA 3DDQA 5BUEA 4BBEA 1ZMUA 3ANQA 3KRWA 3SVVA 3UQCA 3QFVA 2OIDA 1FBNA 4ENXA 1JPAA 3FLQA 3HMIA 4NJDA 3BQCA 5A4QA 4FKLA 4G31A 4JS8A 2CLXA 1XH7A 4QP2A 2VTPA 3UIUA 5F9EA 4K11A 3RJCA 2EXCX 3MPAA 5DEWA 4Y5QA 5TF9A 4C37A 3OVVA 1PMEA 3VNTA 2Z7LA 4ASEA 3UG2A 3FZ1A 5CSXA 2VAGA 4F9BA 5LMBA 2BRHA 4CG8A 4LV8A 5CU6A 2WD1A 1PXJA 2W5AA 2FUMA 4YNOA 4M0YA 4L7FA 2C0IA 2C3IB 2FSTX 3GXLA 4IX4A 2YAKA 3ULIA 4CMUA 2UW5A 3UP2A 4LOPA 4N6ZA 3VBXA 2C68A 2UW0A 1SMHA 1ATPE 2BZIB 3QRUA 5HX6A 2BCJA 2C4GA 3SLSA 2WU6A 4BB4A 1CKPA 2GMXA 4IBMA 3NCGA 5M51A 2ONLC 1B38A 3ENMA 3VO3A 5IQHA 2PVFA 4GFGA 2GTNA 4AFEA 3DKFA 4DT8A 4QYYA 4D1SA 4FTIA 3L9LA 3VUHA 1JKLA 3HEGA 1ZOHA 5L2IA 3KY2A 2B9FA 3G33A 5HZNA 2FSMX 3Q3BA 3I6UA 4RIWB 4AXAA 2A1AB 5FM3A 3LFBA 4DINA 4FL1A 1LPUA 4IAFA 4QTBA 2OH4A 1YOJA 3QTQA 4GK2A 1CM8A 1VEBA 4TYHA 3MIAA 1YXXA 2WU7A 4J8MA 4PQNA 1JVPP 1U59A 2QNJA 2V22A 4BCHA 1WMKA 2HY0A 4G3EA 5IMXA 2VWVA 3VBYA 5LVNA 2XYNA 3BGZA 3KRJA 5JZNA 4AGUA 1OPKA 1ZYCA 2XCHA 3F69A 3BYSA 4CQEA 4IC7A 2I1MA 4YP8A 3SOAA 3F66A 1CSNA 3VW6A 3ZFYA 1DI8A 4LUEA 5CU4A 1P2AA 3U6IA 1PMVA 5AP3A 2IVSA 4FSTA 5CU2A 1LEWA 2UZVA 2BIYA 4P4CA 5CU0A 3UNJA 2WZJA 3E7VA 4FV3A 3V5LA 4BDIA 4GJ3A 4XBRA 5FEEA 3D0EA 3EHAA 4CTCA 4DF3A 3C4WA 2XM9A 4IWPA 5M4CA 2GSFA 3DJ5A 4I4FA 4UEUA 5JQ8A 3PY1A 4IVDA 1PXIA 2GQRA 3ZTXA 3OTVA 1ERKA 3R2YA 4JBQA 2OLCA 2YLFA 2CMWA 2O5KA 3ZSGA 4EEVA 2JBPA 3QBNA 4FZDB 1WBPA 4EOOA 1OPLA 3BLQA 3P7BA 4QMPA 4PMSA 3JR1A 2HYYA 4IM2A 4ENYA 1GZOA 4PL5A 4CG9A 4BDEA 4DFLA 5IPJA 4YO4A 3PWYA 1O9UA 5CNOA 5HKMA 4APPA 5CXZA 3P08A 3FI2A 4FSQA 4PF4A 3PXYA 3VS0A 3CTQA 4CTBA 2QHMA 1U5RA 4FUXA 2CGUA 3KMWA 4FUYA 1QCFA 3ACJA 5HVJA 2KULA 4FKVA 1JSVA 3A4PA 3PYYA 2WMBA 2ZV9A 4FT7A 4P90A 4ITJA 3HNGA 3UTOA 2XIYA 2ITQA 3BIZA 4LOOA 1QPJA 3WILA 3MY0A 5ANKA 4ANOA 1VLRA 3W0QA 1H00A 4IWDA 4KKGA 4QP7A 5CF6A 5E90A 3VVHA 4DEHA 4PUZA 4QMLA 4FT3A 4RC3A 4MCVA 1L8TA 2BAQA 1W0XC 5C26A 2XJ1A 4I92A 4ZSLA 2BHEA 4AXFA 2H8HA 4YMJA 4RIYA 1YWRA 1A06A 4BFMA 5AR5A 2O3PA 4G5JA 3HV6A 3A99A 3IW6A 4J7BA 3RZFA 4DHZA 3IOKA 4LMUA 4FTTA 4CRSA 4BDCA 5HU9A 1Z5MA 2J2IB 4DG2E 4FL3A 4QYGA 1G3NA 3LIJA 4CD0A 4EH2A 5LWNA 1Q4LA 5EDQA 3VS1A 3TV7A 3V5JA 4BTFA 4CLIA 4KSQA 1YQJA 3QQKA 2GDOA 2IVVA 3DGKA 3R02A 4KD1A 4M66A 4NW5A 1H4LA 5EW9A 3N4TA 4KBKA 1XWSA 4O7TA 2P3GX 1Y6BA 3BI6A 3GCVA 3IW5A 1PXLA 4GV1A 5EOBA 5E1SA 3CS9A 4EOSA 5D10A 3WYYA 3FLYA 3OXIA 4C33A 4AA0A 4U80A 3W1FA 3NNWA 3Q4ZA 3PG3A 3UOLA 2RIOA 4WD5A 1P4FA 1JKSA 3AGMA 2PUUA 5CNNA 5AM7A 3UNZA 5CAQA 4HNFA 4I41A 2ZMCA 2YIRA 1K2PA 3EIDA 3QYZA 4EHZA 3PDTA 5KMLA 4XRJA 2RFNA 3V3VA 3F3TA 5IA1A 4FGBA 3OW3A 2VN9A 1KE8A 4FV4A 1BL6A 2IVTA 4F0FA 2VTRA 5CVHA 2WMSA 4O0WA 1F5QA 2PVKA 4QPSA 4C3PA 2Y6MA 3BYOA 1CDKA 3DLZA 2QOBA 5F4NA 1CMKE 3BL9A 2ETKA 2IO6A 4BTKA 5J79A 2EB2A 1MQBA 5L8JA 1M52A 5CAUA 5CANA 3DDPA 2HOGA 4C62A 3F5GA 4CKJA 4HYUA 2P2IA 3LW0A 1F3MC 3CC6A 3SGCA 4TXCA 2R3LA 4ALUA 4C34A 4R5YA 4OTIA 3R7IA 2VO3A 4PWNA 3KA0A 5IQFA 1HCLA 4GS6A 3I60A 3FLSA 2X8IA 4JQEA 4Y72A 4DFXE 4O7YA 5E1EA 3QTIA 3IW8A 4ZS0A 4RBLA 4CEGA 1TQPA 3GEQA 3UP7A 2J0LA 5I9ZA 4A9YA 2BZKB 4DEBA 5CEKA 4YJRA 4NT4A 2BVAA 3EQBA 2YFXA 3LFAA 2UZOA 3ORNA 2BDJA 3CQWA 3SDJA 5GINE 3AC8A 5EYKA 4DCAA 3GU4A 4NIFA 2XRWA 2ZM3A 4LGHA 4NYEA 2P4IA 5CALA 3NYOA 3IDPA 3K54A 4RFZA 5EM7A 4AXDA 4A07A 4AA4A 2QU5A 4JDJA 4AWIA 3S4QA 4O81A 4XV1A 4DYMA 3MIYA 3SRVA 3P7AA 5IQDA 2WEVA 2RG5A 4TTHB 3PXFA 3QTUA 4TYGA 5HICA 3M42A 4YUQA 3QQJA 4QPAA 1XQZA 5LCKA 3ZRMA 3ANRA 2HIWA 3GU8A 2JDTA 4O0SA 4OTRA 4F99A 4DEDA 2H9VA 2WTVA 4ZLOA 1UKHA 1CTPE 4FIJA 4DH5A 1A48A 2QC6A 2Y8OA 3GU5A 4BZOA 4B8LA 3DBQA 5HESA 2VWWA 4YHFA 4M68A 4U43A 3TIZA 4QMQA 4FIGA 4LG4A 4EHGA 4EJ7A 5I4NA 4G9RA 4D4RA 2B52A 2UW8A 4NTSA 4QT1A 4U0IA 3RNYA 4EC9A 4PDSA 5DIAA 4LMNA 5AP2A 3RI1A 4EONA 4X21A 3D5VA 3WZJA 3NAYA 3G6HA 5EFQA 3UDZA 1H8FA 3R8MA 3GENA 5E8XA 2VTAA 1U54B 5D7AA 4GKHA 4N4SA 4BDKA 1S9JA 3CTJA 2WQOA 2FSOX 2FO0A 2I0HA 3IO7A 4HZRA 2BFYA 3F5UA 4J99A 1TZDA 3R9OA 1UU9A 3VUKA 4AACA 4BYJA 5IA2A 4DA5A 5EOLA 5EYMA 3JS2A 1PMNA 2NRYA 4O0XA 4DEGA 3U4WA 3AG9A 4C59A 1UA2A 3ZMMA 4ZY6A 3QAME 2PU8A 4BCPA 4DEIA 4QPMA 4F1TA 4BIEA 4I0SA 4BICA 4OBQA 3VUIA 3C5UA 3FHRA 4JI9A 3D14A 3LZBA 1YI3A 1YDSE 3Q5ZA 1J7IA 3SW4A 3W2PA 5EQYA 4I6LA 1M7NA 3RK9A 2GHMA 3QU0A 2W96B 3QD3A 3QZGA 3CPBA 3F3VA 2JAMA 2OBJA 4FX3A 5I9WA