3LCTA

Crystal structure of the anaplastic lymphoma kinase catalytic domain
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
308
structure length
308
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRAGYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALK tyrosine kinase receptor
publication title Crystal structure of the ALK (anaplastic lymphoma kinase) catalytic domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 102
structure length 308
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lctA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lctA01
3Q4TA 2XBAA 2PZPA 4WG3A 5DT4A 3QWKA 1PXKA 4LL0A 4FTQA 1J7UA 3WF6A 4N4SA 4MXYA 2C5VA 2GNIA 2RFEA 3NCZA 3OMVA 1VR2A 2W9ZB 3ORIA 3R1YA 4CMUA 4F9WA 3UG1A 5IH5A 4S2ZA 3LPBA 4QT1A 4WG5A 4ACDA 4DT9A 2F57A 3PXQA 5EM7A 1F3MC 1UVRA 4H58A 5GZAA 5JGDA 4L3LA 4G3FA 4E5BA 2VX3A 4JDJA 3S1HA 2Z02A 4HZSA 3VHEA 2O64A 1PYXA 2XRUA 2R3QA 4E3CA 3R7UA 2ZV2A 3OCTA 3SLSA 3R8MA 4O7YA 4YZBA 3C0HA 4MBJA 4ZLYA 1VJYA 2VD5A 1XBCA 2BAKA 2BIYA 2QQ7A 2VAGA 3DJ7A 2G01A 2FB8A 4FR4A 3U87A 4R8QA 4U44A 3PXZA 5ANEA 4ASZA 4F9YA 4O81A 2AUHA 4M69A 2B7AA 3BGPA 3AMAA 2BKKA 4V05A 5I0BA 2DWBA 2X9FA 1NY3A 3UODA 3DNEA 3F3WA 4B9DA 4CG8A 3REPA 4BCKA 4U7ZA 1CDKA 4BCMA 4KABA 3E3BX 3JXWA 5E7RA 5E1SA 3QLGA 1ZYLA 3DDQA 4NUSA 1T46A 4R7HA 5EG3A 3COKA 2BTRA 2JGZA 4FIEA 2EB3A 2ONLC 3GU6A 3Q52A 3AG9A 1KOAA 3WZKA 2YABA 4DEIA 1UWJA 2AC5A 2GHGA 3FQEA 5BPYA 1H24A 3Q9XA 3Q2JA 2XNPA 1Q8WA 2WOTA 4ITIA 1FINA 4AWIA 4CKIA 3H9RA 4CTBA 4FOCA 2ITPA 3JUHA 4HVHA 5BVDA 4DT8A 3RCDA 3ORMA 4M0YA 3P08A 3KY2A 4OBOA 3QX4A 1TVOA 2BDFA 4KSPA 3EZRA 3ZLWA 3OROA 2YM7A 3U9CA 5H2UA 2BR1A 4FSUA 1OMWA 3G5DA 4I0RA 5CSPA 2OF4A 3SHEA 1IAJA 1OPJA 3RGFA 5D7VA 2HZIA 4F6SA 3ORTA 2RF9A 4RX7A 4O7RA 2C5YA 4Q2AA 4IZYA 1BLXA 1ERKA 2XS0A 4LUDA 4RC4A 3BU5A 1UNLA 2PE0A 2WGJA 2OJFE 2Z60A 3AC8A 3GT8A 3ROCA 4YNEA 3V6SA 4BHZA 3F2NA 1K2PA 4XV1A 2C6LA 3SX9A 3ZSHA 3EN5A 3LCTA 1U59A 4ZTNA 4TYEA 5HTCA 4B8LA 2XEYA 1YWVA 4EKKA 3R1SA 5HLWA 4DFBA 4CSVA 4F6UA 2W9FB 4MXXA 3TIYA 3TKUA 2PVMA 4AA5A 3NYNA 5IQIA 2BROA 3GU5A 5IEVA 4J98A 1H08A 3QYZA 5EYKA 4FEWA 5CF8A 4YZMA 2PMIA 5G1XA 3HA8A 2YJRA 1J7IA 4RWLA 2WD1A 3O23A 5L6OA 3D7ZA 4LYNA 1O9UA 3FJQE 3LCDA 4GG5A 3KMMA 4FIJA 1WAKA 4C3PA 4WG4A 3OUNB 4K6ZA 3PUPA 4MH7A 3VBWA 3D5WA 4LI5A 1Z5MA 2QOFA 4FVRA 3FYJX 2GNGA 3FYKX 3U4UA 3VBQA 3TNIA 4DH5A 3LQ3A 4BCOA 3IKAA 4ZSLA 5ETIA 2Z7QA 5AP6A 5JFWA 2FSMX 2JBOA 1ZZLA 2OKRA 3Q4UA 3F7WA 3LFCA 4EQMA 2PU8A 4F70A 5KMJA 1WVXA 4OTWA 4BVUA 4C2VA 4H3PA 4BC6A 4I6FA 5C4LA 2VTHA 2BZIB 2WHBA 3JS2A 3KB7A 2Z7SA 3CTJA 3PIZA 2XCHA 4NM5A 5IKWA 3QD4A 3MSSA 1KSWA 4FKVA 2IVSA 4EKLA 4UX9A 1WMKA 1JWHA 4YHTA 5EYMA 4RVLA 4ZZOA 2WQNA 3BWFA 2CKOA 4CVAA 4HPUE 1UA2A 4HCTA 4JDKA 4USDA 4YZNA 3BLQA 3DLZA 4IFCA 3BHVA 5FBNC 3DZQA 5DRDA 2BHEA 3KXNA 4O0RA 4A9TA 4JR7A 4XMOA 3ZLYA 4O0TA 5LMKA 2WO6A 4FSQA 1XBAA 4JNWA 4JOAA 4ZJJA 3DBCA 4PX6A 3FZ1A 3E92A 5L2TA 3LXNA 4L8MA 3QA8A 3EZVA 4L43A 2YM4A 3BPRA 2IVUA 4DGLC 4ERWA 4R1VA 5AAGA 4O1PA 4JBVA 2PUUA 4IXPA 5JEBA 2C0TA 2P2HA 3LFSA 5JT2A 4J1RA 2V62A 5IUGA 2GPHA 5LWMA 3F5UA 2Y8OA 3OCGA 4QMMA 4HNIA 5B0XA 2R4BA 2WMSA 3GBZA 4AS0A 4JXFA 1A48A 3BELA 4AE6A 5C8KA 1WBPA 4KKEA 3CKXA 4GT3A 3ZCLA 2C3IB 4W4WA 3L8XA 3DKOA 4U6RA 4XYFA 3T9TA 1H8FA 3R28A 4XEYA 4AFJA 5IDPA 2EB2A 3DPKA 5CAOA 5C8MA 1R3CA 2Y0AA 1NVQA 2YAKA 4Y73A 5IUHA 5IQBA 5CU4A 4O7ZA 2PY3A 3LHJA 2YZLA 1IRKA 4KIKB 3MH1A 3FLZA 5GIPE 4YZ9A 2Q0NA 1KOBA 4PF4A 3WF9A 5DYJA 3A61A 3PE1A 2OJ9A 1CKIA 2R3GA 3KRXA 5AP1A 4PTGA 1M17A 1OIRA 3TIZA 4XV2A 5JN2A 4O83A 4FMQA 4P4CA 4GL9A 2OIDA 3P9JA 3UVPA 3BCEA 3W2PA 4AFEA 4QMSA 5HEZA 2QD9A 1ZXEA 5L2IA 3IK3A 1OBDA 5E8VA 2IW6A 3PVUA 4OR5A 4HVGA 2ETMA 3QHRA 4BDAA 3D5XA 2WU7A 2ZV7A 4QYEA 3VUIA 3B2TA 4EK3A 3DLSA 2YCRA 3SXSA 4F99A 3R7OA 4CFMA 4DGGA 1OPLA 2R3HA 5DIAA 2OFVA 4JX7A 2W1GA 2QLUA 2C3JA 3DAEA 1UU3A 4LOQA 5EHYA 3EN7A 3AD6A 1OIQA 3MIYA 3OZ6A 5IH4A 4DFNA 3UOHA 2BMCA 5KMIA 2HXLA 3PLAE 4LGGA 5I9WA 3F5XA 3L9PA 4QTDA 3TKHA 4O1OA 4DTKA 3K3JA 1YI3A 2XKDA 5HD7A 3TN8A 4H39A 3CBLA 4RC3A 4U3ZA 4UZDA 4YNOA 2AC3A 3KQ7A 2OWBA 3B8QA 4QMXA 4E5WA 4BDHA 4KIPA 3A4PA 3LXPA 2ZM3A 3UOLA 4BDBA 2O3PA 2CN5A 4RZWA 3DU8A 3AQVA 3FDNA 3BYSA 4RWJA 1Q8UA 1IASA 3GXLA 3MGYA 2YIQA 4I5MA 1GY3A 5CTPA 3SW7A 2W7XA 1WBNA 3MH2A 4NM3A 4BDFA 4ZSJA 3H0ZA 2CLXA 3R02A 3KC3A 4AG8A 3EL7A 5EHLA 3TV6A 4X7QA 3MPMA 2WTIA 3G6GA 2OXXA 3IDBA 3NW6A 3S3IA 4JDHA 3F2RA 2PVNA 2QO2A 3UGCA 4XLVA 3W32A 4CMTA 2RKUA 3RKBA 3RPOA 2GNJA 4F1TA 2HELA 4A07A 4HVIA 3JVRA 2V22A 4FIHA 1VZOA 3TNWA 4DITA 4JR3A 1RQQA 3FLSA 2QURA 3H3CA 3TXOA 2H9VA 1OL1A 4RIWA 4Z9LA 4C3FA 2IZSA 2R7IA 2YIXA 4JG8A 2OZAB 3RBWA 1QMZA 1U4DA 1UV5A 1ZAOA 3QRIA 4K9YA 2F9GA 5FGKA 5HCXA 3HMNA 3SOAA 3SVVA 3MY1A 3DBDA 2QOHA 4W4VA 5ACKA 3I60A 3V01A 1YOJA 2X4FA 3O17A 4FZ6A 1APME 1JSTA 2YCQA 4JS8A 1PMUA 2R3IA 3N4TA 4S31A 2VTIA 3EN6A 4GK2A 4ZY4A 4F7NA 5IA0A 4II5A 5A4LA 4F65A 5EQPA 2QC6A 1GIIA 3C0GA 5HLPA 3PSCA 2C47A 1O6YA 4FKPA 4AF3A 4FYNA 3VUHA 1BYGA 3QCSA 3GCQA 2VWBA 4RFZA 4AZWA 4BZOA 4XCUA 2FSTX 1SNUA 4IZ5A 4FKWA 2A19B 5D41A 4M7IA 3EKKA 4GKIA 3ZXTA 1Y6BA 2XK9A 5JMSA 5LMAA 4QQCA 2OBJA 4F9AA 1X8BA 3COMA 4EJ7A 1STCE 2GQSA 4IBMA 4DEEA 2NP8A 1WFCA 4WO5A 4JI9A 5EDRA 2CGWA 2I0VA 4AA0A 3F7ZA 3MIAA 3Q32A 3FI2A 2NO3A 3LZBA 4FKTA 5KMKA 3VUMA 1H07A 4IVAA 1OI9A 2QOKA 4ONAA 5EKOA 4MXOA 1E1XA 1XO2B 4W8EA 5BVEA 2VNYA 2LAVA 2JDSA 3B8RA 3DK3A 2ZB1A 4NIFA 1Z9XA 2BRBA 1TQPA 3CIKA 5BNJA 1L3RE 3FMKA 4RVMA 5J9LA 4BGHA 2BRGA 3UYSA 2YWVA 5JZNA 3ZLSA 2RSVA 4UMTA 3RAWA 2OSCA 1YDRE 1YXUA 3COIA 4MNFA 3F69A 4DFLA 3WILA 4DG2E 3I7BA 4TXCA 3VBXA 3QUDA 5A4EA 4EJNA 5FRIA 4E6QA 1FVVA 2KTYA 4A4XA 4DE4A 2J9MA 3R7GA 5FXSA 4AT4A 2UV2A 1Y6AA 3F5GA 3PJCA 3CS9A 3QAME 3RM7A 2B4SB 3ORKA 4KNBA 5ANJA 3EQGA 4DN5A 4HVDA 5A4CA 3R8ZA 3F82A 3FMJA 4IZ7A 4AU8A 4O0SA 4EQCA 3LVPA 3PG1A 2PVRA 3PRFA 5HESA 4MNEA 2UZDA 2CNQA 2BFYA 3QD3A 5CNNA 3PIYA 4C4EA 3UMXA 1H1WA 2R2PA 1B39A 3EWHA 3PY0A 4FT5A 5L8JA 1KE7A 2UVZA 5AAFA 3EQRA 3PPZA 4FGBA 3VULA 5LMKC 4J96A 1OUYA 1G3NA 4GG7A 3LQ5A 4L42A 4Y72A 5CZIA 2WIPA 4YHFA 1I44A 3IO7A 4E5AX 4EORA 4Q9ZA 5HTBA 3GC9A 4UXQA 1EH4A 3ZC6A 3NUSA 2J5FA 4ASEA 2H96A 4AZVA 4M8TA 4ANQA 2OI4X 4GEOA 2VTLA 4O21A 2V0DA 4QMWA 4B8MA 3FZPA 3QZHA 4L7FA 5HIBA 2UW8A 2UW7A 5IU2A 3R9OA 3KREA 4FA2A 5CSVA 4NKSA 4EOKA 5EDQA 1YI6A 4FZ7A 4PDYA 4IX5A 5EYDA 3FXWA 4FKSA 4MD7E 2BAQA 3PE2A 3A7JA 3HL7A 4YMJA 4I5PA 3DOGA 2VV9A 3V6RA 4R1YA 4YTFA 1XH9A 3KULB 3NVKI 5HVYA 3H10A 1PHKA 2IG7A 2UZNA 3HMOA 3WBLA 5CAPA 1TKIA 3ANQA 3UO6A 5KMOA 3ZYAA 3LOKA 2F7ZE 4KKGA 4C33A 5HG9A 3I4BA 4LOOA 4QQTA 3QTXA 4C61A 2UZWE 5CEMA 3NS9A 2XIYA 3R9DA 2JKMA 4OTRA 1PXLA 3C0IA 3P86A 4ENXA 2VTQA 2YDIA 3OS3A 3FLWA 2IPXA 3GFEA 3BV3A 1JPAA 3OCBA 4X3FB 5CSXA 1FMOE 2A1AB 4IQ6A 3G2FA 5HG7A 2R7BA 5AM6A 5CS6A 4YPSA 4NJDA 2ERKA 2ERZE 4NEUA 5CT7A 2WMWA 3FC2A 2DUVA 3JR1A 4CLJA 3HA6A 3RAKA 3VS1A 3SGCA 1GNGA 2J2IB 4OUCA 5BVFA 2VUWA 3D7TB 2H34A 3NDMA 3GNIB 4YZCA 2F7XE 3EL8A 4BYJA 4E4LA 4H3QA 4YURA 1H0WA 4RX8A 3PY1A 3NMUF 3QUEA 4E8AA 3RHXA 3E64A 5IH6A 4OTFA 3FMDA 5JKGA 4AW5A 1A9UA 5HE3A 4ASDA 3AT4A 1XH8A 1FBNA 4BIEA 2ZV9A 3ZS5A 3ZRMA 3L9LA 2IJMA 5T3QA 5BYYA 4Z16A 3DT1A 2WTJA 4EOOA 4IWOA 3V5WA 4RMZA 5J5SA 4IM2A 2HW7A 1CTPE 3MY0A 3MJ2A 4WIHA 3QQJA 1PMNA 2VWIA 4YZDA 3ZFXA 2YFXA 5EOLA 3U8WA 2XNBA 4RX5A 3AD5A 3IECA 2XBJA 3SC1A 4EI4A 3EN4A 2C5XA 1JAMA 2WMRA 2OXDA 4LRJA 3SAYA 1NT2A 2UZOA 3DTWA 4AT3A 3UQCA 3SXFA 3FSKA 2PULA 3R9RA 2W1EA 3AC5A 2VO7A 4XS2A 4DFXE 5E9EA 3AT2A 1U54A 3R2YA 5TR6A 4OTQA 1PXIA 2IZRA 4CKRA 3ACJA 3FI3A 3LKMA 2OH4A 2XYNA 4BYIA 5ETCA 1MRUA 2B55A 5C03A 3NW5A 2PE1A 1PKDA 3GFWA 4QPMA 4C02A 3KXHA 1OIYA 4P7EA 5I3OA 5EH0A 5BUJA 2PHKA 4G3CA 4MEDA 5F94A 3VUTA 2XRWA 4BDIA 4IE9A 4CZYB 3R63A 4NTSA 5FM2A 4J8NA 1JBPE 5KBQA 2BILB 3BLRA 3L8VA 3ZRLA 4HGLA 2GSFA 2OIBA 2R5TA 3C4CA 2ZMCA 3AXWA 3NCGA 5EYCA 4ANNA 4BI2A 5CF4A 3SG9A 3HGKA 2IVTA 4PMMA 4YJTA 3KCFA 1MQBA 3W33A 2F2CB 2ZOQA 4NJ3A 4IFGA 4U0IA 3W2RA 4XUFA 4ANMA 2VWZA 3P7BA 5K3YA 3UIMA 4RQKA 3RCJA 4TYIA 1LP4A 3QX2A 5IMEA 3SV0A 1WCCA 5KBRA 5L3AA 2J51A 3I7CA 4FT0A 1F0QA 3NUNA 2QU5A 4X3FC 5DT0A 5HQ0A 1NXKA 3LMIA 3BHHA 4BCQA 4DCEA 5HNBA 4RIYB 4CQGA 3IOKA 3K5VA 4RRVA 3O71A 3VQUA 4DEDA 3OTVA 3D2IA 1Y8GA 5DBXA 3RI1A 2XIKA 3P7CA 2BZJA 2LGCA 2X2LA 3TG1A 3C4EA 2HY81 2PVFA 4YSJA 3V5TA 5CAVA 4QQJA 3AC1A 3BX5A 4FL3A 1E1VA 2GQGA 2JDOA 3FKLA 3QD0A 2VWYA 4M14A 5IQEA 4FTAA 5C27A 4EH7A 5TT7A 1YHSA 4A4LA 1M2PA 4FIFA 5FXQA 4YBKA 2HCKA 3LIJA 2PVJA 3RZBA 5DFPA 2GTMA 5KUPA 3F3UA 2PMLX 1JSUA 2XNGA 4O38A 5L2SA 5LOHA 5CU3A 4F7JA 2XA4A 2UZTA 3BQRA 3RTPA 4GU9A 2JC6A 4TNDA 1IA9A 3ALOA 2QONA 2PMOX 4IZAA 1H27A 4MXZA 4WRGA 3JPVA 3VVHA 3FZOA 4U45A 4AAAA 4DH1A 3MFTA 4FT7A 2FO0A 3ORXA 4QD6A 5E8UA 4D2PA 3UZTA 1Q3WA 4HCVA 5H3QA 3NIEA 4FSZA 4G31A 2PWLA 4ZJVA 2BRMA 3GC0A 3NZ0A 4IDTA 3U6HA 3R6XA 3EYGA 3MWUA 4BF2A 5JK3A 5LVMA 4G6OA 4RG0A 1H1QA 4W8DA 4ENYA 1QPJA 2UZLA 4YJPA 2Y4IC 4GSBA 4JBPA 3UPXA 4FEXA 4FKIA 5FDXA 2X8EA 2BDJA 3LFEA 2Z2WA 3S4QA 5HNIX 1GZOA 5EQYA 2OGVA 3F2AA 2QO7A 2HZ4A 4ALVA 4D4VA 5IPJA 3R30A 3QGWA 3UNKA 2QODA 4U40A 4BDCA 3LAUA 4HJOA 3H9OA 4QRCA 5AAEA 1MRVA 3OF0A 4GJ2A 3VO3A 1NVRA 3CQWA 3G0FA 2JIUA 3O0GA 5D12A 2B9FA 3MI9A 3WF5A 5KHWA 4EK6A 3EH9A 5H9BA 4NT4A 1KE6A 3DV3A 1Q8ZA 3C1XA 4DTAA 3ZEPA 1G5SA 2XCKA 4FNWA 4G5JA 5M4FA 4IH8A 3QC4A 3BE9A 4P5ZA 2QR8A 3ROYA 3DJ5A 3A8XA 4AGUA 3BU3A 1DS5A 5FDPA 1XH6A 4TW9A 5ANOA 5LVLA 2PZRA 5IDNA 3EJ1A 2ITYA 5KKRB 2XIXA 1KV1A 1Y57A 4YTHA 4GS6A 1M7QA 2WTKB 3MFUA 5G6VA 3VRYA 2XM9A 4AGCA 4DLJA 4O96A 4YTCA 2W5BA 5JH6A 4BN1A 3GC8A 4M97A 5JRSA 4DG3E 3TNHA 4GUEA 4FTLA 4ACHA 3HYHA 2QO9A 3BEAA 3E88A 3COHA 3W8QA 4FNYA 5EKNA 3MPTA 3CQEA 4H1MA 4O2PA 4WKQA 4G9RA 5J79A 1H1PA 3FY2A 3F3VA 3I0OA 4PTCA 2DQ7X 4UALA 4EOIA 2WMTA 4QMYA 3NNXA 2E2BA 4J71A 4RIXB 4X2GA 5KCVA 3NVMB 2JAMA 4FVQA 4IW0A 3P4KA 2BUJA 3WYXA 4O7WA 3CC6A 4GYGA 1DAWA 3OWLA 4JRNA 2R3OA 3EIDA 1UKIA 5JZJA 5M44A 2WELA 2DS1A 4YP8A 4FV0A 4ZXTA 4E1ZA 4ZAUA 3OHTA 3LE6A 3VBYA 4RQVA 4GH2A 5IEXA 2A0CX 3ZO3A 3BYUA 4QYHA 3SKCA 3MVHA 2CN8A 2V7AA 3ZXZA 1PMVA 5EM6A 3W10A 3O2MA 2OJJA 5EQEA 1SZMA 4AGWA 3LXLA 3T3UA 3Q9YA 4DINA 1H00A 3BI6A 3A7IA 3QC9A 3PZEA 2EXEA 4IC8A 4UBAA 1SVGA 3Q5IA 4YJVA 4D0XA 1BI8A 3FHIA 3O8PA 5E90A 4DAWA 2X7FA 3HMMA 2BFXA 2CCIA 3K2LA 4FV9A 4CV9A 2CNUA 4KUJA 1GAGA 2SRCA 4I4FA 4FODA 4YBJA 4WHZA 5B7VA 4H05A 4CV8A 5LQFA 3HV4A 3F3ZA 4FUXA 3GQIA 4QP6A 3OEZA 5AP0A 4ZTMA 4KIKA 4AGDA 4U42A 3NYXA 3QKMA 4O6EA 3PPKA 5EHOA 3ZO1A 3PWDA 4ALWA 3EOCA 4N57A 1GOLA 3QZFA 3TWJA 3OW4A 1PXMA 4FBXA 3S0OA 1V0OA 4NWMA 4ARKA 3AD4A 3C5UA 1SM2A 4I4EA 2QOOA 2VTOA 3PXKA 1H25A 5CEOA 2VO0A 2QCSA 2XK4A 4WSYA 5FTGA 4IB3A 4YTIA 1ZYSA 1TQIA 1ZOEA 4G3GA 2ITZA 3W2CA 4MK0A 4X2JA 1OITA 1AQ1A 4NW6A 5FM3A 4D2SA 3EHAA 3ZUUA 3MN3A 3QWJA 3IDCA 4Q5EA 1HOWA 4B0GA 2DYLA 4FL1A 4RWKA 3JVSA 3EFLA 5I9YA 4ZMEA 2EUFB 1OKWA 2JFLA 3VUKA 5B2MA 3PXFA 1M14A 3UC4A 4IM3A 3HRBA 4YJNA 4D55A 3SXRA 2J0MB 4FKOA 4TT7A 2QVSE 4O0YA 4M13A 1DI8A 3R21A 4LV8A 4RIOA 3GC7A 3UTOA 3G51A 1P5EA 1TQMA 4F9BA 1OKZA 1BI7A 1W98A 3CTQA 3OOMA 3RWQA 4C7TA 4S30A 1H26A 2ITNA 1W0XC 3F66A 2EXCX 4MXCA 4ZY6A 2C6IA 2YM5A 3DKFA 3UYTA 4GFMA 4ZS0A 4U5JA 4D58A 1UKHA 3P78A 3IW5A 4NW5A 2XM8A 4BI0A 2C1BA 4MWHA 4U41A 3NX8A 2VZ6A 4I24A 4LGHA 5CYIA 2ZVAA 4U8ZA 2QI8A 5M56A 2QOIA 4X2KA 5DG5A 4N0SA 4JDIA 2JDRA 2W05A 4M68A 4EOQA 4FV3A 3OWPA 3QCQA 3RM6A 5CU2A 4BWXA 3QCXA 3R1QA 2HY0A 3ZC5A 4EBVA 1YXXA 3GOKA 3QKLA 5AP2A 3FZTA 4UYAA 2QG5A 3NNUA 4QMUA 2YIRA 5IISA 2ETRA 3UQGA 2J4ZA 2NRUA 3FQSA 1P2AA 1XH7A 3K3IA 4TYHA 4E4MA 5AJQA 4Z7HA 5BVOA 4LRKA 4RJ8A 4EBWA 3ETAA 2P2IA 5EW9A 4A9RA 4OLIA 3P7AA 1OL7A 3EB0A 4X0MA 3VIDA 4EUUA 4BICA 2YLFA 4D2TA 3HECA 2OZAA 4BZNA 4A7CA 3CKWA 5L6WL 4IB0A 4H3BA 2J90A 4HYSA 4F4PA 5M08A 3RPSA 3QRJA 2Z7LA 3MY5A 3L1SA 2PVYA 4IAAA 4YSMA 2FYSA 3NYOA 3PP1A 3EQFA 1ZMVA 4KRCA 4BB4A 4D2WA 3CR0A 2CSNA 3OUKA 3DAKA 4GK3A 3ZSGA 1GZKA 3HLLA 4WNKA 2OF2A 2IW9A 4W4XA 4KS7A 3LJ1A 4QTCA 1U5RA 2Y4PA 3UJGA 4AZTA 2VTJA 3QHWA 3O7LB 3ACKA 3KN6A 3KMWA 1A06A 4TY1A 4PP7A 5IA3A 3AT3A 4N70A 2XB7A 4O7TA 3ZLXA 4OT6A 4AZSA 5I5ZA 3G15A 5EI2A 2BTSA 5L6PA 5CEIA 2HENA 2OXYA 4F7LA 4L3JA 2QOLA 3FXXA 3QBNA 2P4IA 1ZY4A 4CFXA 4L46A 4O0VA 3UP2A 4EC8A 2B54A 4RJ3A 1ZMUA 3V51A 4CT1A 4YU2A 3BYVA 4C57A 4XOYA 4NKAA 3QQHA 4EK5A 2C6OA 3KFAA 4MCVA 3LFFA 4FV5A 3VS0A 4EK8A 2IN6A 1J1CA 2VTNA 1Q62A 3R73A 3OW3A 5AR8A 1ZMWA 2OU7A 3JYAA 4U9AA 3RNIA 3ORLA 4L00A 4IVDA 2WNTA 3UIUA 3C9WA 3HDMA 5AR7A 4C36A 3EFJA 2BALA 3GCPA 4ACCA 2R3PA 2X39A 4GIIA 2FUMA 2G15A 3FHRA 3BV2A 5AUVA 5K0KA 4RBLA 3FKNA 5KX8A 3KF4A 4TWPA 3ATTA 4D5HA 5K5NA 4UMPA 4USFA 5LCJA 3QALE 2JKQA 4XG6A 2W1FA 4OBQA 2YACA 4BKJA 2PPQA 4CYIA 5AWMA 5E91A 1YRPA 5CU0A 2VN9A 4ZZMA 3FY0A 2YAAA 1UNGA 4DFZE 4IMYA 2WQBA 5J87A 4ZY5A 5AIRA 3OFMA 4W4YA 5AP4A 2B9JA 4DFYA 2HZ0A 5DGZA 3F88A 3GU4A 2WIHA 1REKA 3MVJA 5KMMA 3PZHA 3W2OA 2WOUA 1G8SA 2R3KA 2NRYA 3H9FA 4L53A 4WRSA 4C3RA 4DC2A 2YEXA 3A99A 4G16A 4MX9A 3RK5A 3THBA 5BYLA 1UU8A 1Q41A 3ORNA 3HP5A 4X6RA 3D14A 3NUXA 4LG4A 5FG8A 3TDWA 4KIQA 4FTRA 1PY5A 4Q5HA 2R3FA 4YO4A 1NA7A 2HXQA 3ULIA 2BDWA 4XP3A 4J97A 2P0CA 3Q3BA 1YKRA 2FSLX 1UU7A 5M07A 2GS7A 5CT0A 4KD1A 4CFNA 3BYOA 3CY3A 3TUBA 2JIIA 5HG5A 3OXTA 3V5JA 3OT8A 4MYGA 5FUTA 4DFUA 3P1AA 3FE3A 4UWCA 1JNKA 2QHNA 5AP3A 3EQPA 3TZMA 4C4HA 4E6DA 5AV1A 1WBTA 4XNEA 3UZRA 4XG4A 4TYHB 5FP6A 3TDVA 2GS2A 2B52A 2XZSA 4PPCA 4QP8A 3UVRA 4BTJA 3UBDA 2VTPA 4ZTRA 2WQMA 3MA3A 3VS4A 4WT6A 4AUAA 4J52A 4ALUA 4AQCA 4EYJA 3E8NA 4K8AA 1YHVA 3R9NA 5FEEA 5HO8A 3FLNC 5J95A 5AFVA 3DB6A 5AUTA 3ODYX 3KULA 4FG9A 2GNLA 4YJUA 4ZTQA 4E4NA 3I6UA 4GUBA 1YWRA 4LOPA 1GIHA 2CGUA 4QTBA 4G17A 2XIZA 2IZTA 4EH4A 4E26A 4I6HA 5DOSA 4K1BA 3LCKA 5D10A 5E8WA 3R01A 2AYPA 3EFWA 3CQUA 5AR5A 5EOBA 3C4FA 3HNGA 2XF0A 5FLFA 3M1SA 3BZ3A 4QMNA 4A4OA 2PZYA 1IR3A 4M3QA 4BCJA 3QTQA 4HYHA 2J50A 4C38A 1VYWA 4ZP5A 3R7EA 4X3FA 3ZMMA 1MUOA 3L8SA 2PVKA 4DA5A 5A6OA 2G2HA 2GNHA 3PFQA 5JQ5A 2CHLA 1J1BA 5TKDA 3FWQA 2OK1A 4ZTSA 2ZDTA 3OBJA 3TUDA 5DE2A 4G5PA 2YIWA 3P5KA 4ID7A 2QKRA 4XJ0A 4YHJA 3O8UA 5D7AA 2BHHA 3F5PA 3GU8A 3ZTXA 3D7TA 4QP2A 2H6DA 2W96B 3HMPA 3LCSA 2J0KA 3EQCA 3FKOA 3QUPA 1Z57A 4X2FA 5ANGA 4QMQA 5AUZA 2FSOX 1H1RA 2WEVA 3I1AA 3D5VA 4XG3A 2V7OA 5H8BA 2PVLA 4QQ5A 3SG8A 4A9UA 5JGAA 3NUAA 2GHMA 3TUCA 5EW3A 2JFMA 1CM8A 4WUNA 2IVVA 2RG6A 3EFKA 4AN9A 4CLIA 1Q61A 1URWA 3CPCA 3A7HA 2HAKA 1CMKE 1S9IA 5CQUA 3QTUA 4OGRA 2B1PA 4ZSGA 3TZ7A 4CZUA 4XP0A 4V01A 4NL0A 4IWDA 2JAVA 2JIVA 3KVWA 5L4QA 3S00A 2J0IA 4FT3A 4DEGA 1JLUE 2Z7RA 4FL2A 3HEGA 1T45A 2YHVA 3PJ3A 4FT9A 4I22A 3FZSA 3GB2A 1QL6A 2VGOA 1K9AA 1FOTA 5CNOA 5AUUA 2ACXA 3OT3A 1WBOA 3D9VA 3Q6WA 2PUIA 4HYIA 3O50A 3E8CA 5EM8A 3ZDIA 3WZDA 3QFVA 1YI4A 4KA3A 3VN9A 3I81A 4HW7A 5I3RA 3OY3A 3DBQA 5HIEA 4AP7A 3FQHA 3L8PA 2E9VA 1JKTA 3DBEA 3OOGA 2O63A 3NUUA 4IB1A 5M4IA 4WSQA 3VAPA 1GIJA 4GMYA 3EYHA 4QYYA 4L9IA 3FLYA 3DB8A 3LMGA 4A9SA 2Y9QA 2R3RA 3MFRA 4Y85A 1WZYA 3LMHA 3AC2A 4ACMA 3BE2A 4KSQA 5TF9A 5JSMA 5C8NA 4FZAB 4BDGA 2BRNA 3R8UA 4I3ZA 3SQQA 3MVLA 4FV2A 3PA4A 4CQEA 5IA1A 2YISA 1Q5KA 3QRUA 4Y5QA 3HV7A 4EK4A 4MXAA 3K5UA 4EOLA 2B53A 5AUYA 4QTEA 1JVPP 5AV3A 4L67A 4YUQA 5LJJA 3OVVA 3E87A 4L44A 4P5QA 4X21A 4FV1A 4FTIA 5I9VA 5M4CA 3E63A 5J5TA 2HWPA 2CKQA 3ET7A 1SYKA 3BU6A 3POOA 4R7IA 1MP8A 1WBWA 2G2FA 4RIYA 5EI8A 3RMFA 4AN2A 4MTAA 4MVFA 4PQNA 2PK9A 5F4NA 3RWPA 3VJOA 2X7OA 3S95A 2VTMA 1QCFA 1OUKA 4P2KA 2ZYBA 5ITAA 4DGMA 3G6HA 3KRLA 2I0HA 4D9UA 3ZM4A 4XOZA 2X9EA 2XJ0A 4DG0E 3R22A 1JQHA 4LM5A 1IAHA 5LXMA 3P0MA 3C4WA 1FGKA 4TNBA 4TRLA 4CCBA 5JGBA 4PNKA 4L7SA 5ANKA 1ZY5A 2G2IA 4Y46A 4HGTA 4YJRA 1KE8A 2WMAA 3D5UA 5CSHA 3M11A 5AX9A 3UG2A 4FX3A 1DM2A 4JBOA 2XUUA 4RWIA 4DYMA 3HAMA 3ZDUA 5KNJA 4FV7A 1PRYA 2ZM1A 3GENA 3KXXA 2VTTA 4G6NA 1WVWA 4BCNA 4Z7GA 5HU9A 2C6EA 5HCZA 3KRJA 3QQLA 4JQEA 4FTCA 4BBMA 3MB7A 3SDJA 5HGIA 2YZAA 3UE4A 4FK3A 4RJ5A 4MD9E 4IX3A 2B9HA 3FPQA 2O65A 4FV8A 3VHKA 2BZHB 2XNEA 3VS5A 2CKEA 1GJOA 1R0PA 2VTSA 4CFUA 4ANLA 4G2FA 1B6CB 2YERA 4RLLA 2ZMDA 2UW3A 3WYYA 3CTHA 2JKOA 3D94A 5EFQA 3DKGA 3NR9A 4E93A 3WZUA 4QMZA 4WNMA 3V8WA 5E8SA 3VJNA 4BHNA 5DWRA 4BCIA 1SVHA 3PJ2A 3DXQA 4L45A 1KUTA 5AV4A 1O6KA 3UNJA 4APPA 2UZUE 5I9UA 5DRBA 3UOJA 3KXMA 1YOLA 3KRRA 3ZZEA 4X2NA 1YXTA 2C30A 3UIBA 2FH9A 1XR1A 3MW1A 3NEWA 3ZZWA 5IA2A 5C4KA 1J3HA 5HICA 3PP0A 4AOTA 4G6LA 3HVCA 1OKVA 4JG6A 4Y83A 4EYMA 5JRQA 5IF1A 4FKUA 3VBTA 3RK9A 4ZTLA 2RFNA 4F9CA 4BDEA 5J1VA 3TJCA 1OPKA 3C50A 3EQHA 4AN3A 5E4HA 2W1CA 4E20A 2W0JA 2HWOA 3IS5A 4CFFA 4D2VA 3FMMA 4IDVA 3AC3A 4CEGA 3WIGA 4KBKA 2BAJA 3RINA 1PW2A 4AT5A 4D1ZA 5BUEA 5DH3A 2RIOA 3CE3A 3HZTA 4DEBA 4RVTA 5AUWA 3OBGA 4V04A 4CNHA 3A7GA 1FVTA 4BGGA 2VWVA 2FGIA 3QRTA 3ZHPC 3QQFA 5F1ZA 5FTQA 3WOWA 4DGOA 2NNWB 2WKMA 4L68A 4ERKA 5BVKA 1R78A 4XBRA 4ZTHA 2PUNA 3V04A 4RFMA 4IIRA 3NRMA 2C6TA 4A9YA 4EQUA 5L2QA 4FEVA 4O6LA 4S32A 3DS6A 5HE1A 3SOCA 4RJ6A 3UVQA 5L2WA 3G9NA 3R71A 2CNVA 4CFWA 5BUIA 4YJQA 5L8KA 3QXOA 2QU6A 2WFYA 3LQ8A 2YCSA 4GRBA 2OO8X 1FPUA 3PJ1A 1CSNA 4IC7A 3PIXA 2W5HA 2QHMA 4G34A 2WXVA 4UXLA 1KWPA 4RIXA 4BKYA 4DF3A 3F6XA 3RP9A 1VEBA 5H8GA 4CXAA 4R3PA 4BTKA 3CGOA 4EWHA 1M2RA 4C4FA 3HV3A 4I5HA 5GNKA 2XK8A 2PZIA 3A2CA 1BL7A 4L01A 1M7NA 3QD2B 3R04A 2XNOA 4GW8A 4U80A 5FP5A 3WARA 1M52A 4CD0A 4E7WA 3W55A 1LEZA 3HDNA 4EH3A 3OC1A 4ZLZA 4RSSA 5CU6A 2UW5A 4JBQA 3R2BA 5C1QB 3FLQA 2PL0A 4ZIMA 5AR2A 3D15A 3Q6UA 4BIBA 4WBOA 3W16A 3HKOA 3UO5A 4O7LA 2WTVA 3ZUVA 3LLTA 5GJGA 4L3PA 3UP7A 2V5QA 3BGQA 3MJ1A 3QKKA 3UDBA 3ZFYA 4B6LA 2Y6OA 3VF9A 4BCGA 3O51A 4KIOA 4UZHA 4FV4A 3PVBA 3GU7A 3H30A 3BBTB 1Q24A 4PNIA 3PSBA 4HOKA 4NM7A 3U54A 4RA4A 1IG1A 1H1SA 2WMXA 2ESMA 4RA5A 4YLLA 3GGFA 2W1ZA 2ZJWA 4MF1A 3KVXA 4NTTA 3VS2A 3A4OX 2XJ1A 4D4YA 4FOBA 3ZFMA 4PTEA 3FEGA 2W5AA 4HNFA 5IEYA 1DAYA 2WPAA 2C0IA 2GHLA 2H8HA 3FZRA 3FBVA 2C68A 3S2PA 3DCVA 4EUTA 3N4UA 3OXIA 3CD3A 1PMEA 1KV2A 1BMKA 4QYFA 3ORPA 4D1XA 3IONA 1DI9A 3MS9A 4XX9A 5DR9A 2B0QA 4O7VA 3ZSIA 4FG8A 4MD8E 3N4VA 1IEPA 5DPVA 5ETAA 5HOAA 4YC6A 2R0IA 4UN0C 2HYYA 2Z8CA 1LPUA 3RHKA 4BDJA 3DY7A 3WE8A 3LXKA 1WVYA 5LARA 3F61A 1PXJA 2A2AA 4I1ZA 3CXWA 3PTGA 1RDQE 1P4OA 3UOKA 5T68A 3MV5A 4ZSAA 4FSTA 4KKHA 5HZNA 3O96A 4IAKA 4RVKA 4MKCA 5HHWA 3TZ8A 4JG7A 5E1EA 4A06A 5DN3A 2RFSA 4RC2A 3VS6A 2UUEA 4IAYA 5I9XA 5J7HA 5CQWA 5I9ZA 3VS7A 4IX6A 4PDSA 4ZK5A 3DAJA 2ITXA 4OTDA 5HORA 4PPBA 3OTUA 5LCKA 3NPCA 4O82A 5JFSA 3RPRA 4D4RA 4D2RA 4YLKA 4Y8DA 5HO7A 4QP4A 3MB6A 4IANA 4MAOA 2J0LA 4BY9E 3DQWA 5IQFA 5AM7A 5A9UA 3DXPA 2ITTA 2QKWB 3UC3A 4N6YA 3CGFA 2QR7A 4U3YA 3U4WA 3SRVB 5CXZA 1ZRZA 3VC4A 2R0UA 2YA9A 3IW4A 3OG7A 4BKZA 3I6WA 3QTWA 3Q2MA 1U5QA 1O6LA 4FKQA 4CGAA 5AADA 1YQJA 4AW2A 3LM0A 3Q4ZA 1LEWA 3DTCA 4GT5A 4OAVB 3MFSA 3R83A 4JQ8A 1H4LA 2C6DA 4QMTA 5K0XA 3V5PA 5ETFA 3AMYA 4UYNA 1FMKA 4EWQA 4X6QC 2PZ5A 1ZARA 5C9CA 4IACA 4TN6A 1PYEA 2YM8A 3E8EA 3E93A 2OJIA 3NLBA 1R0EA 5E8ZA 5FTOA 5M51A 3IG7A 5DHJA 1NVSA 4PDOA 5DR2A 4FEUA 3IPHA 3I5ZA 1ATPE 3PA3A 2GFCA 4D9TA 2VGPA 3F9NA 1U46A 2I6LA 1OVEA 2OW3A 4KWPA 2KULA 4FV6A 3BWJA 5F95A 5A54A 3FMEA 2E9OA 3ZEWA 2WB8A 3HUBA 2JLDA 4WA9A 3TNQB 4BWPA 5M53A 4F09A 4LFIA 5KMLA 5FXRA 3AGLA 1ZYJA 3U51A 4BCHA 1HCKA 5CALA 3RALA 4R77A 4Q9SA 1REJA 4AZEA 3KA0A 4ACGA 4CZTA 3O8TA 4DBXA 4I0SA 4M66A 2C1AA 5ANIA 3MBLA 4KBAA 4XRJA 5IG1A 4BI1A 4I93A 5LVOA 3VUDA 2WU6A 3KK8A 1RE8A 4NK9A 1Q97A 5M06A 5CEQA 5E8TA 4FE2A 2J6MA 2XNNA 3QF9A 3JY0A 4OT5A 4HGEA 4WBBB 4DLIA 3PA5A 4O22A 5GHVA 4ZEGA 3N9XA 5CI6A 5CF5A 4L6QA 3VWAA 4AACA 3U6JA 4M15A 1WBSA 5CENA 4GT4A 3ITZA 1AD5A 3K54A 2UW6A 3BHYA 4NM0A 4OTIA 3HV6A 5DI1A 5DLSA 3MH0A 4JIKA 1BKXA 4FIIA 4J53A 4XG9A 4EZ7A 4KS8A 5AA8A 3WF8A 4QP9A 5KKRC 3U55A 2CGXA 4KINA 2X6DA 3B2WA 4KRDA 4MF0A 3RPYA 1B38A 4OBPA 4BDDA 3BYMA 2WTKC 3QRKA 4PMSA 3E62A 3KKVA 4GCJA 4WOVA 4XBUA 2GTNA 3JY9A 3VS3A 3KGAA 5J9YA 3OWKA 3NYVA 5KZIA 3QL8A 4ZS4A 5CX9A 2X6EA 2ITQA 3CD8A 3UZPA 4XRLA 2VX0A 3A62A 5CWZA 2HW6A 3W1FA 2CKPA 4FSMA 1YVJA 2VTRA 3IOPA 5DR6A 2XIRA 4FTJA 1OB3A 4IJ9A 4XG8A 5CXHA 2X8DA 4V0GB 3FI4A 4K11A 5CVHA 3SA0A 4QP7A 3PSDA 4D0WA 5KMNA 4FVPA 4ITHA 4GYIA 4HCUA 3TTIA 4LMUA 2BIKB 3ENHA 3LW0A 2EWAA 2VU3A 4JLCA 1VYZA 4E6CA 2XP2A 4JVGA 5AIKA 3FAAA 4CRSA 3TL8A 3ULZA 2VWWA 3MVMA 2YIYA 4BZDA 1V0BA 3Q53A 5K9IA 3PYYA 5DVRA 3LFAA 3FMNA 3DK7A 4Y5HA 3UO4A 5E8YA 3CP9A 4K0YA 4PRJA 4QNAA 4RT7A 5ICPA 4FK6A 2OLCA 2C5OA 4WUAA 3I0QA 4J95A 4YPDA 5AMNA 5HO6A 4TL0A 5K4JA 4F08A 4U81A 2BPMA 1M2QA 4UWYA 4B4LA 2XK7A 2GU8A 1UWHA 3G90X 4O0UA 4FSYA 3KF7A 4AOJA 4GKHA 2UZVA 3G33A 4BWKA 2WMVA 4FSRA 4RJ7A 3W8LA 2WMQA 1SNXA 3PWYA 5IQCA 2XJ2A 3TEIA 2UVXA 4UV0A 2WAJA 4DH3A 4PL3A 1PF8A 4JRVA 3IW7A 3GI3A 4JAJA 2F7EE 2XEZA 4C62A 2PSQA 4RLKA 4QP3A 4TYGA 3R8VA 4PWNA 4M69B 3DZOA 3MH3A 3VF8A 5DT3A 3NWWA 2JD5A 3R1NA 4ANSA 3IGOA 3N51A 5GZ9A 1QPEA 3W2QA 3PJ8A 5FWKK 4C34A 1ZWSA 3QTRA 4FSWA 5CLPA 2YM3A 4O7SA 4P90A 3RZFA 1XKKA 2GNFA 4XV3A 1FGIA 3NUYA 3PG3A 4C35A 2J7TA 4UEUA 5IQHA 1W84A 4AE9A 3M2WA 5TO8A 3QYWA 1XH5A 4FUYA 3TTJA 4F64A 5A6NA 5KO1A 3LFQA 3HX4A 4PP9A 4O0WA 4W9WA 3Q04A 3NUPA 5A4TA 5DNRA 2BCJA 5I4NA 5GIOE 3DFCB 4PMPA 2GMXA 4ITJA 3A8WA 4CG9A 1ZOGA 2JKKA 3GQLA 4QPSA 2C5NA 3LFDA 5HBEA 5HKMA 4I5CA 3T3VA 4D5KA 2I40A 4LUEA 2YM6A 3L9MA 5HE0A 1JSVA 2ITUA 3HV5A 3D0EA 4GV1A 3VQHA 3Q5ZA 3DGKA 4XLIA 2G9XA 3BHUA 2C6KA 3LLAA 4CRLA 2UW4A 4IWQA 3PLSA 4F0GA 2X81A 4I92A 3FUPA 5HU3A 1OL5A 3HUCA 3BRBA 1CKJA 4WNOA 2UW9A 5EK7A 5BMMA 1Y8YA 1F5QA 4TKSA 4EH5A 4YR8A 4K2RA 2IO6A 2W4OA 4AW0A 2F4JA 3E5AA 3C13A 4AZFA 5BQ0A 4FTUA 3ZH8A 2P3GX 3NNVA 1Y91A 4OTPA 3DNDA 4EOPA 5CSWA 3CJGA 5M57A 3I5NA 2OJGA 4BGQA 4UMUA 2CDZA 4M67A 3EN9A 2PTKA 4J8MA 2ZV8A 1JKLA 2VO3A 1H28A 2ITOA 4IAZA 3NAXA 4IB5A 5T6KA 2W1DA 3R7YA 1XQZA 3BBWA 1E9HA 1V1KA 3MTFA 4H36A 4JAIA 4PL4A 5AR4A 4NCTA 4F63A 2Q83A 5A14A 2E9UA 3IQ7A 4JQ7A 2ZB0A 4C8BA 2I0YA 3Q9ZA 4XV9A 3RAIA 4BR3A 2GQRA 4RX9A 5CEKA 3C4ZA 5JFXA 4FNZA 4FZFB 5C26A 4JIAA 5B2LA 5IQAA 3ZBXA 4BRXA 4PL5A 4EOMA 3QQGA 5A3XA 4EOSA 3EKNA 2XK3A 5D9HA 4IVCA 1ZLTA 4ANBA 1NW1A 1YWNA 4QPAA 3TACA 3R0TA 4G3DA 1Q4LA 3FV8A 5DA3A 4ASXA 2WZJA 1R1WA 4W9XA 3QZGA 4EZ3A 5LVNA 5TE0A 3QQKA 2YJSA 2R3MA 4OTGA 2WQEA 4XG2A 3OD6X 4GVAA 3QXPA 2EU9A 3GEQA 4BL1A 4O91A 2JITA 4BBFA 2OICA 4EC9A 4DHFA 4EH2A 1XHAA 1Q8TA 2X2MA 4EHGA 2O5KA 4F7SA 4NZWB 3WIKA 3ZO2A 5HVJA 1OIUA 3TI1A 4JT3A 3V5LA 3ERKA 3GP0A 3ORZA 3WZJA 2V55A 2P55A 4FICA 4S33A 4CT2A 1UU9A 5LWNA 3Q4CA 3BKBA 4GFOA 4IWPA 5FEDA 5BMSA 5HBJA 2R3JA 3T8OA 2VNWA 4ZZNA 3U9NA 4CCUA 4LL5A 1OL6A 3OY1A 3GVUA 2PVHA 4EHZA 4HZRA 4PV0A 5CANA 5HVKA 1WBVA 2A4LA 4NFMA 3H0YA 3R8PA 3KCKA 3KN5A 3SW4A 2ITVA 3BLHA 4UB7A 2W4KA 4HPTE 2VTAA 3QGYA 4F1MA 4RZVA 2IZUA 4EH8A 4FKJA 5D1JA 1W7HA 1LR4A 5A4QA 5AA9A 4E4XA 1Q8YA 3ANRA 3ELJA 4IADA 5HI2A 1CKPA 2X0GA 4QMVA 5KE0A 3Q60A 3VW8A 3ZU7A 4DBNA 4EZ5A 4CMOA 2YCFA 4PY1A 5HG8A 4BDKA 4DGNA 2JEDA 3DJ6A 3EQBA 4O84A 1KE5A 4HYUA 3C51A 2XYUA 3IW6A 3I79A 3BIZA 3ZUTA 4KAOA 5CVFA 3KEXA 4U79A 4OAUC 3W18A 4EHEA 4M12A 5J7BA 4O86A 2G1TA 4IHPA 3PY3A 3IGGA 4IVBA 5HLNA 3A7FA 1UNHA 4QMOA 4IAIA 3GCVA 1ZZ2A 4K18A 4LRMA 3D83A 1JOWB 4FI1A 5IA5A 3ZONA 2F2UA 3CPBA 1OGUA 4I0TA 5E92A 3DK6A 4AA4A 2QOCA 5IQGA 4ZLOA 3ZM9A 4UMQA 5JFVA 4FTOA 4LMNA 1BUHA 4R7BA 4I94A 4GIHA 4NSTA 4FTMA 2HK5A 3V8SA 1BX6A 3MESA 2X2KA 4G1WA 2C0OA 4D1SA 4E73A 2IW8A 2W17A 2ZDUA 3PXYA 2CMWA 4TYJA 2X7GA 5H8EA 3DKCA 4MBLA 3ENMA 2C4GA 1HCLA 2C69A 3CJFA 3TJDA 3M42A 4BIDA 3TCPA 4CKJA 3ATSA 4TPTA 1P14A 3ZO4A 3NAYA 4R5SA 1YOMA 2GFSA 2FVDA 3D2KA 3BQCA 3R8LA 4FKLA 2REIA 4QMLA 4XHKB 3TKIA 1W83A 3PVGA 3TT0A 5KHXA 5FQDC 2UZBA 1W82A 1QPDA 1L8TA 4BBEA 1H01A 2WMUA 4DH7A 3ZRKA 2HZNA 1J91A 3C7QA 4IJPA 5AP7A 4LV5A 5LMBA 4FSNA 5IZFA 4EH6A 5CI7A 4J99A 4ZJIA 4ZOGA 4PMTA 5IQDA 1KE9A 3MTLA 4HVSA 4Z55A 5F20A 2YITA 2QOQA 2Q0BA 4R3RA 3WZEA 4PUZA 3BEGA 1P4FA 3QLFA 4OW8A 4C4IA 2CPKE 4K33A 4C4GA 4IX4A 2Y6MA 4XG7A 3NNWA 1FQ1B 2YDJA 1XWSA 2XKCA 3F3TA 5E8XA 5M09A 1YDSE 5KZ0A 4F6WA 3VW6A 2X4ZA 4S34A 3CSVA 4O0XA 2W06A 2O8YA 3LJ2A 2I1MA 4GU6A 4K77A 2GDOA 5L8LA 3UPZA 1BL6A 2W1IA 2WTDA 4B7TA 4UY9A 3T9IA 2GS6A 4QNYA 1ZYDA 2HIWA 2JDTA 2PE2A 2UW0A 4RIWB 3G0EA 4XH6A 5AEPA 2P33A 5BVWA 1MRYA 3QTSA 3PXRA 5HCYA 4YC3A 4YC8A 3TV4A 5ACBC 4FGRA 5D11A 2I0EA 3FMLA 3UMWA 1YXVA 3EQIA 3W2SA 2EXMA 5IA4A 1I09A 3RJCA 5TOZA 2J0JA 3ZOSA 4FNXA 2OIQA 2YWPA 2R9SA 4DEHA 5EM5A 3LM5A 1LUFA 3C4XA 4TTHB 5FEQA 3FSFA 2XKEA 3KK9A 4C37A 4I6QA 3QTIA 1JKKA 5M4UA 3POZA 1OKYA 3R7IA 4PPAA 3QZIA 3R00A 4IAFA 1YXSA 5AV2A 5CF6A 3U6IA 2WQOA 4O2ZA 1OECA 2OG8A 3E7OA 3QA0A 4AW1A 3GCSA 3HRCA 2CGVA 3GOPA 2WMBA 3MA6A 4HGSA 1PXPA 4ORKA 2E9PA 2OH0E 2EVAA 3V5QA 3CEKA 1OZ1A 4CTCA 3GUBA 3MYGA 4R3CA 3LJ0A 2BKZA 4EEVA 5HX6A 2ITWA 4QMPA 5K5XA 4R5YA 1R39A 3HAVA 3WI6A 4DTBA 3QQUA 4E6AA 4NCTC 5J9ZA 1J7LA 4JL9A 2BZKB 4I23A 2ONLA 3RK7A 3TZ9A 1Q3DA 2PMNX 2VRXA 3KL8A 5CZHA 5HBHA 4ANOA 5GZ8A 5HNGA 3E7VA 3CCNA 3FC1X 2XVDA 3DDPA 4FTTA 4NIFB 2JBPA 2CCHA 4H1JA 4DH8A 3BHTA 2WTCA 4YJOA 5A46A 4Z3VA 2W99B 2YDKA 5ANDA 3OP5A 3DQXA 1GZNA 5AX3A 4BCFA 5AV0A 2X8IA 3AC4A 2RG5A 5BYZA 2QNJA 2QOBA 4I6BA 3KXGA 4EL9A 3FL5A 2JDVA 2WTWA 4RFYA 2W1HA 4KBCA 4RJ4A 2VWXA 3OEFX 2J5EA 4EONA 3VBVA 3R9HA 1ND4A 3UIXA 4TZRA 1G8AA 3IW8A 4FKRA 2C3KA 3FXZA 3ZBFA 3FI8A 3DBFA 3P23A 5GJDA 2XMYA 3HP2A 2GCDA 3DA6A 4MQ1A 3SRVA 2Y4IB 4I20A 1YDTE 3NSZA 4TWOA 4BTMA 4MNEB 4J7BA 3OXZA 4GK4A 2NPQA 3UNZA 3VNTA 2B9IA 2X1NA 4O27B 2OZOA 2RGPA 5CAUA 5BVNA 1PKGA 1PXNA 2R64A 4JJRA 4FF8A 4PDPA 5BX0A 3OCSA 1S9JA 2XKFA 4WNPA 5HE2A 5DMZA 4AOIA 3FMHA 4IEBA 4OTHA 5FD2A 4YJSA 5DEWA 3RVGA 3E8DA 2UZEA 1QPCA 3E3PA 1FVRA 4FZDB 4QTAA 2O2UA 5HD4A 4O7NA 5AP5A 1XJDA 4FC0A 3WE4A 1RJBA 3TNPC 4FTKA 4FG7A 4QOXA 4RPVA 5M55A 4CYJA 4MHAA 3IDPA 4UMRA 3ODZX 5DEYA 3PPJA 3CY2A 3FPMA 4RGJA 4U43A 3PDTA 1H0VA 4R78A 3L9NA 1YHWA 4ZSEA 5CASA 3SD0A 4AXAA 4EH9A 3C5IA 1PXOA 3KMUA 2OFUA 5GJFA 4NU1A 1IA8A 2CJMA 2C3LA 3OWJA 4EOJA 3WF7A 4FTNA 4TWNA 2F49A 5EI6A 4WD5A 2QG7A 3V3VA 1OL2A 2ZM4A 4YLJA 2C6MA 5J1WA 2UVYA 2XNMA 4M84A 4F1OA 4MBIA 5B2KA 4CFVA 2ZAZA 4B99A 1YW2A 3VUGA 4C0TA 5CY3A 4F0FA 3VRZA 1URCA 4NYEA 5EDPA 3HRFA 3RPVA 2FA2A 1PJKA 4N6ZA 1JKSA 2XK6A 5HTIA 3A60A 3LFBA 1W8CA 3P79A 5C01A 5GINE 4NFNA 4YO6A 1XH4A 3Q96A 4X3JA 2R3NA 1ZYCA 4AX8A 3G9LX 3ID6C 2Y7JA 4D4SA 3EMGA 2W4JA 4FEQA 4L52A 1K3AA 4C58A 4JX3A 4KB8A 3QU0A 4DEAA 4F0IA 4LQMA 3R7VA 5EW8A 3DFAA 4MQ2A 3DXNA 4QP1A 2O0UA 2VO6A 5AUXA 5HIDA 5CEPA 5LVPA 2CLQA 2YLEA 4C4JA 4I41A 3II5A 2RL5A 4TWCA 3V8TA 1MQ4A 1SMHA 5FBOA 2E9NA 3ALNA 4APCA 4DCAA 2RFDA 4BTFA 1OM1A 2R3LA 2VWUA 3MDYA 1RW8A 3AOXA 4FKGA 2I7QA 3NGAA 1AGWA 4QYGA 5IMXA 3NIZA 2QLQA 3TV7A 3PRIA 3QTZA 4G9CA 3BGZA 5K4IA 4ZMFA 1Q99A 3TM0A 1V0PA 4USEA 2PYWA 2BRHA 4GJ3A 3RNYA 4G3EA 2HOGA 2IWIA 3KU2A 3H4JA 4GFGA 5J8IA 4C2WA 4C59A 3KRWA 2VX1A 5HX8A 1ZOHA 4FIGA 4LGDA 3HMIA 4EHVA 2ETKA 4V0GA 4XP2A 3RAHA 3FL4A 3Q9WA 2YN8A 4NH1A 4R6VA 3KXZA 4BCPA 1U54B 3MPAA 5CVGA 2XH5A 5F9EA 1SVEA 1XBBA 3O7LD 3AMBA 4YGAA 2A27A 4QO9A 5AR3A 3EQDA 4GVJA 1GZ8A 3PVWA 3D4QA 4UWBA 4FYOA 4MWIA 4BFMA 2WEIA 5CAQA 4U97A 4IM0A 4M0ZA 5IUIA 4Y95A 1OBGA 3QCYA 3CLYA 3GCUA 3LCOA 3LFNA 3AGMA 3NW7A 5JQ8A 2PUPA 4D28A 4I21A 3UQFA 2BVAA
chains in the Genus database with same CATH superfamily
3Q4TA 2XBAA 2PZPA 4WG3A 5DT4A 3QWKA 1PXKA 4LL0A 4FTQA 1J7UA 3WF6A 4N4SA 4MXYA 2C5VA 2GNIA 2RFEA 3NCZA 3OMVA 1VR2A 2W9ZB 3ORIA 3R1YA 4CMUA 4F9WA 3UG1A 5IH5A 4S2ZA 3LPBA 4QT1A 4WG5A 4ACDA 4DT9A 2F57A 3PXQA 5EM7A 1F3MC 1UVRA 4H58A 5GZAA 5JGDA 4L3LA 4G3FA 4E5BA 2VX3A 4JDJA 3S1HA 2Z02A 4HZSA 3VHEA 2O64A 1PYXA 2XRUA 2R3QA 4E3CA 3R7UA 2ZV2A 3OCTA 3SLSA 3R8MA 4O7YA 4YZBA 3C0HA 4MBJA 4ZLYA 1VJYA 2VD5A 1XBCA 2BAKA 2BIYA 2QQ7A 2VAGA 3DJ7A 2G01A 2FB8A 4FR4A 3U87A 4R8QA 4U44A 3PXZA 5ANEA 4ASZA 4F9YA 4O81A 2AUHA 4M69A 2B7AA 3BGPA 3AMAA 2BKKA 4V05A 5I0BA 2DWBA 2X9FA 1NY3A 3UODA 3DNEA 3F3WA 4B9DA 4CG8A 3REPA 4BCKA 4U7ZA 1CDKA 4BCMA 5BV3A 4KABA 3E3BX 3JXWA 5E7RA 5E1SA 3QLGA 1ZYLA 3DDQA 4NUSA 1T46A 4R7HA 5EG3A 4F78A 3COKA 2BTRA 2JGZA 4FIEA 2EB3A 2ONLC 3GU6A 3Q52A 3AG9A 1KOAA 3WZKA 2YABA 4DEIA 1UWJA 2AC5A 2GHGA 3FQEA 5BPYA 1H24A 3Q9XA 3Q2JA 2XNPA 1Q8WA 2WOTA 4ITIA 1FINA 4AWIA 4CKIA 3H9RA 4CTBA 4FOCA 2ITPA 3JUHA 4HVHA 5BVDA 4DT8A 3RCDA 3ORMA 4M0YA 3P08A 3KY2A 4OBOA 3QX4A 1TVOA 2BDFA 4KSPA 3EZRA 3ZLWA 3OROA 2YM7A 3U9CA 5H2UA 2BR1A 4FSUA 1OMWA 3G5DA 4I0RA 5CSPA 2OF4A 3SHEA 1IAJA 1OPJA 3RGFA 5D7VA 2HZIA 4F6SA 3ORTA 2RF9A 4RX7A 4O7RA 2C5YA 4Q2AA 4IZYA 1BLXA 1ERKA 2XS0A 4LUDA 4RC4A 3BU5A 1UNLA 2PE0A 2WGJA 2OJFE 2Z60A 3AC8A 3GT8A 3ROCA 4YNEA 3V6SA 4BHZA 3F2NA 1K2PA 4XV1A 2C6LA 3SX9A 3ZSHA 3EN5A 3LCTA 1U59A 4ZTNA 4TYEA 5HTCA 4B8LA 2XEYA 1YWVA 4EKKA 3R1SA 5HLWA 4DFBA 4CSVA 4F6UA 2W9FB 4MXXA 3TIYA 3TKUA 2PVMA 4AA5A 3NYNA 5IQIA 2BROA 3GU5A 5IEVA 4J98A 1H08A 3QYZA 5EYKA 4FEWA 5CF8A 4YZMA 2PMIA 5G1XA 3HA8A 2YJRA 1J7IA 4RWLA 2WD1A 3O23A 5L6OA 3D7ZA 4LYNA 1O9UA 3FJQE 3LCDA 4GG5A 3KMMA 4FIJA 1WAKA 4C3PA 4WG4A 3OUNB 4K6ZA 3PUPA 4MH7A 3VBWA 3D5WA 4LI5A 1Z5MA 2QOFA 4FVRA 3FYJX 2GNGA 3FYKX 3U4UA 3VBQA 3TNIA 4DH5A 3LQ3A 4BCOA 3IKAA 4ZSLA 5ETIA 2Z7QA 5AP6A 5JFWA 2XARA 2FSMX 2JBOA 1ZZLA 2OKRA 3Q4UA 3F7WA 3LFCA 4EQMA 2PU8A 4F70A 5KMJA 1WVXA 4OTWA 4BVUA 4C2VA 4H3PA 4BC6A 4I6FA 5C4LA 2VTHA 2BZIB 2WHBA 3JS2A 3KB7A 2Z7SA 3CTJA 3PIZA 2XCHA 4NM5A 5IKWA 3QD4A 1OGYA 3MSSA 1KSWA 4FKVA 2IVSA 4EKLA 4UX9A 1WMKA 1JWHA 4YHTA 5EYMA 4RVLA 4ZZOA 2WQNA 3BWFA 2CKOA 4CVAA 4HPUE 1UA2A 4HCTA 4JDKA 4USDA 4YZNA 3BLQA 3DLZA 4IFCA 3BHVA 5FBNC 3DZQA 5DRDA 2BHEA 3KXNA 4O0RA 4A9TA 4JR7A 4XMOA 3ZLYA 4O0TA 5LMKA 2WO6A 4FSQA 1XBAA 4JNWA 4JOAA 4ZJJA 3DBCA 4PX6A 2AQXA 3FZ1A 3E92A 5L2TA 3LXNA 4L8MA 3QA8A 3EZVA 4L43A 2YM4A 3BPRA 2IVUA 4DGLC 4ERWA 4R1VA 5AAGA 4O1PA 4JBVA 2PUUA 4IXPA 5JEBA 2C0TA 2P2HA 3LFSA 5JT2A 4J1RA 2V62A 5IUGA 2GPHA 5LWMA 3F5UA 2Y8OA 3OCGA 4QMMA 4HNIA 5B0XA 2R4BA 2WMSA 3GBZA 4AS0A 4JXFA 1A48A 3BELA 4AE6A 5C8KA 1WBPA 4KKEA 3CKXA 4GT3A 3ZCLA 2C3IB 4W4WA 3L8XA 3DKOA 4U6RA 4XYFA 3T9TA 1H8FA 3R28A 4XEYA 4AFJA 5IDPA 2EB2A 3DPKA 5CAOA 5C8MA 1R3CA 2Y0AA 1NVQA 2YAKA 4Y73A 5IUHA 5IQBA 5CU4A 4O7ZA 2PY3A 3LHJA 2YZLA 1IRKA 4BJJB 4KIKB 1G8KA 3MH1A 3FLZA 5GIPE 4YZ9A 2Q0NA 1KOBA 4PF4A 3WF9A 5DYJA 3A61A 3PE1A 2OJ9A 1CKIA 2R3GA 3KRXA 5AP1A 4PTGA 1M17A 1OIRA 3TIZA 4XV2A 5JN2A 4O83A 4FMQA 4P4CA 4GL9A 2OIDA 3P9JA 3UVPA 3BCEA 3W2PA 4AFEA 4QMSA 5HEZA 2QD9A 1ZXEA 5L2IA 2XAMA 3IK3A 1OBDA 5E8VA 2IW6A 3PVUA 4OR5A 4HVGA 2ETMA 3QHRA 4BDAA 3D5XA 2WU7A 2ZV7A 4QYEA 3VUIA 3B2TA 4EK3A 3DLSA 2YCRA 3SXSA 4F99A 3R7OA 4CFMA 4DGGA 1OPLA 2R3HA 5DIAA 2OFVA 4JX7A 2W1GA 2QLUA 2C3JA 3DAEA 1UU3A 4LOQA 5EHYA 3EN7A 3AD6A 1OIQA 3MIYA 3OZ6A 5IH4A 4DFNA 3UOHA 2BMCA 5KMIA 2HXLA 4DHZA 3PLAE 4LGGA 5I9WA 3F5XA 3L9PA 4QTDA 3TKHA 4O1OA 4DTKA 3K3JA 1YI3A 2XKDA 5HD7A 3TN8A 4H39A 3CBLA 4RC3A 4U3ZA 4UZDA 4YNOA 2AC3A 3KQ7A 2OWBA 3B8QA 4QMXA 4E5WA 4BDHA 4KIPA 3A4PA 3LXPA 2ZM3A 3UOLA 4BDBA 2O3PA 2CN5A 4RZWA 3DU8A 3AQVA 3FDNA 3BYSA 4RWJA 1Q8UA 1IASA 3GXLA 3MGYA 2YIQA 4I5MA 1GY3A 5CTPA 3SW7A 2W7XA 1WBNA 3MH2A 4NM3A 4BDFA 4ZSJA 3H0ZA 2CLXA 3R02A 3KC3A 4AG8A 3EL7A 5EHLA 3TV6A 4X7QA 3MPMA 2WTIA 3G6GA 2OXXA 3IDBA 3NW6A 3S3IA 4JDHA 3F2RA 2PVNA 2QO2A 3UGCA 4XLVA 3W32A 4CMTA 2RKUA 3RKBA 3RPOA 2GNJA 4F1TA 2HELA 4A07A 4HVIA 3JVRA 2V22A 4FIHA 1VZOA 3TNWA 4DITA 4JR3A 1RQQA 3FLSA 2QURA 3H3CA 1XMLA 3TXOA 2H9VA 1OL1A 4RIWA 4Z9LA 4C3FA 2IZSA 2R7IA 2YIXA 4JG8A 2OZAB 3BL7A 3RBWA 3O5AA 3UDTA 1QMZA 1U4DA 1UV5A 1ZAOA 3QRIA 1W2CA 2F9GA 4K9YA 5FGKA 3HMNA 5HCXA 3SOAA 3SVVA 3VONA 3MY1A 3DBDA 2QOHA 4W4VA 5ACKA 3I60A 3V01A 1YOJA 2X4FA 3O17A 4FZ6A 1APME 1JSTA 2YCQA 4JS8A 1PMUA 2R3IA 3N4TA 4S31A 2VTIA 3EN6A 4GK2A 4ZY4A 4F7NA 5IA0A 4II5A 5A4LA 4F65A 5EQPA 2QC6A 1GIIA 3C0GA 5HLPA 3PSCA 2C47A 1O6YA 4FKPA 4AF3A 4FYNA 3VUHA 1BYGA 3QCSA 3GCQA 2VWBA 4RFZA 4AZWA 4BZOA 4XCUA 2FSTX 1SNUA 4IZ5A 4FKWA 2A19B 5D41A 4M7IA 3EKKA 4GKIA 3ZXTA 1Y6BA 2XK9A 5JMSA 5LMAA 4QQCA 2OBJA 4F9AA 1X8BA 3COMA 4EJ7A 1STCE 2GQSA 4IBMA 4DEEA 2NP8A 1WFCA 4WO5A 4JI9A 5EDRA 2CGWA 2I0VA 4AA0A 3F7ZA 3MIAA 3Q32A 3FI2A 2NO3A 3LZBA 4FKTA 5KMKA 3VUMA 1H07A 4IVAA 1OI9A 2QOKA 4ONAA 5EKOA 4MXOA 1E1XA 1XO2B 4W8EA 5BVEA 2VNYA 2LAVA 2JDSA 3B8RA 3DK3A 2ZB1A 4NIFA 1Z9XA 2BRBA 1TQPA 3CIKA 5BNJA 4QEBA 1L3RE 3FMKA 4RVMA 5J9LA 4BGHA 2BRGA 3UYSA 2YWVA 5JZNA 3ZLSA 2RSVA 4UMTA 3RAWA 2OSCA 1YDRE 1YXUA 3COIA 4MNFA 3F69A 4DFLA 3WILA 4DG2E 3I7BA 4TXCA 3VBXA 3QUDA 5A4EA 4EJNA 5FRIA 4E6QA 1FVVA 2KTYA 4A4XA 4DE4A 2J9MA 3R7GA 5FXSA 4AT4A 2UV2A 1Y6AA 3F5GA 3PJCA 3CS9A 3QAME 3RM7A 2B4SB 3ORKA 4KNBA 5ANJA 3EQGA 4DN5A 4HVDA 5A4CA 3R8ZA 3F82A 3FMJA 4IZ7A 4AU8A 4O0SA 4EQCA 3LVPA 3PG1A 2PVRA 3PRFA 5HESA 4MNEA 2UZDA 2CNQA 2BFYA 3QD3A 5CNNA 3PIYA 4C4EA 3UMXA 1H1WA 2R2PA 1B39A 3EWHA 3PY0A 4FT5A 5L8JA 1KE7A 2UVZA 5AAFA 3EQRA 3PPZA 4FGBA 3VULA 5LMKC 4J96A 1OUYA 1G3NA 4GG7A 3LQ5A 4L42A 4Y72A 5CZIA 2WIPA 4YHFA 1I44A 3IO7A 4E5AX 4EORA 4Q9ZA 5HTBA 3GC9A 4UXQA 1EH4A 3ZC6A 3NUSA 2J5FA 4ASEA 2H96A 4AZVA 4O4EA 4M8TA 4ANQA 2OI4X 4GEOA 2VTLA 4O21A 2V0DA 4QMWA 4B8MA 1W2FA 3FZPA 3QZHA 4L7FA 5HIBA 2UW8A 2UW7A 5IU2A 3R9OA 3BLAA 3KREA 4FA2A 5CSVA 4NKSA 4EOKA 5EDQA 1YI6A 4FZ7A 4PDYA 4IX5A 5EYDA 3FXWA 4FKSA 4MD7E 2BAQA 3PE2A 3A7JA 3HL7A 4YMJA 4I5PA 3DOGA 2VV9A 3V6RA 4R1YA 4YTFA 1XH9A 3KULB 3NVKI 5HVYA 3H10A 1PHKA 2IG7A 3TMOA 2UZNA 3HMOA 3WBLA 5CAPA 1TKIA 3ANQA 3UO6A 5KMOA 3ZYAA 3LOKA 2F7ZE 4KKGA 4C33A 5HG9A 3I4BA 4LOOA 4QQTA 3QTXA 4C61A 2UZWE 5CEMA 3NS9A 2XIYA 3R9DA 2JKMA 4OTRA 1PXLA 3C0IA 3P86A 4ENXA 2VTQA 2YDIA 3OS3A 3FLWA 2IPXA 3GFEA 3BV3A 1JPAA 3OCBA 4X3FB 5CSXA 1FMOE 2A1AB 4IQ6A 3G2FA 5HG7A 2R7BA 5AM6A 5CS6A 4YPSA 4NJDA 2ERKA 2ERZE 4NEUA 5CT7A 2WMWA 3FC2A 2DUVA 3JR1A 4CLJA 3HA6A 3RAKA 3VS1A 3SGCA 3UDZA 1GNGA 2J2IB 4OUCA 5BVFA 2VUWA 3D7TB 2H34A 3NDMA 3GNIB 4YZCA 2F7XE 3EL8A 2X0OA 4BYJA 4H3QA 4E4LA 1H0WA 4YURA 4RX8A 3PY1A 3NMUF 3QUEA 4E8AA 3RHXA 3E64A 5IH6A 4OTFA 3FMDA 5JKGA 4AW5A 1A9UA 5HE3A 4ASDA 3AT4A 1XH8A 1FBNA 4BIEA 2ZV9A 3ZS5A 3ZRMA 3W0MA 3L9LA 2IJMA 5T3QA 5BYYA 4Z16A 3DT1A 2WTJA 4EOOA 4IWOA 3V5WA 4RMZA 5J5SA 4IM2A 2HW7A 4AAYA 1CTPE 3MY0A 3MJ2A 4WIHA 3QQJA 1PMNA 2VWIA 4YZDA 3ZFXA 2YFXA 5EOLA 3U8WA 2XNBA 4RX5A 3AD5A 3IECA 2XBJA 3SC1A 4EI4A 3EN4A 2C5XA 1JAMA 2WMRA 2OXDA 4LRJA 3SAYA 1NT2A 2UZOA 3DTWA 4AT3A 3UQCA 3SXFA 3FSKA 2PULA 3R9RA 2W1EA 3AC5A 2VO7A 4XS2A 4DFXE 5E9EA 3AT2A 1U54A 3R2YA 5TR6A 4OTQA 1PXIA 2IZRA 4CKRA 3ACJA 3FI3A 3LKMA 2OH4A 2XYNA 4BYIA 5ETCA 1MRUA 2B55A 5C03A 3NW5A 2PE1A 1PKDA 3GFWA 4QPMA 4C02A 3KXHA 1OIYA 4P7EA 5I3OA 5EH0A 5BUJA 2PHKA 4G3CA 4MEDA 5F94A 3VUTA 2XRWA 4BDIA 4IE9A 4CZYB 3R63A 4NTSA 5FM2A 4J8NA 1JBPE 5KBQA 2BILB 3BLRA 3L8VA 3ZRLA 4HGLA 2GSFA 2OIBA 2R5TA 3C4CA 2ZMCA 3AXWA 3NCGA 5EYCA 4ANNA 4BI2A 5CF4A 3SG9A 3HGKA 2IVTA 4PMMA 4YJTA 3KCFA 1MQBA 3W33A 2F2CB 2ZOQA 4AQKA 4NJ3A 4IFGA 4U0IA 3W2RA 4XUFA 4ANMA 2VWZA 3P7BA 5K3YA 3UIMA 4RQKA 3RCJA 4TYIA 1LP4A 3QX2A 5IMEA 3SV0A 1WCCA 5KBRA 5L3AA 2J51A 3I7CA 4FT0A 1F0QA 3NUNA 2QU5A 4X3FC 5DT0A 5HQ0A 1NXKA 3LMIA 3BHHA 4BCQA 4DCEA 5HNBA 4RIYB 4CQGA 3IOKA 3K5VA 4RRVA 3O71A 3VQUA 4DEDA 3OTVA 3D2IA 1Y8GA 5DBXA 3RI1A 2X0PA 2XIKA 3P7CA 2BZJA 2LGCA 2X2LA 3TG1A 3C4EA 2HY81 2PVFA 4YSJA 3V5TA 5CAVA 4QQJA 3AC1A 3BX5A 4FL3A 1E1VA 2GQGA 2JDOA 3FKLA 3QD0A 2VWYA 4M14A 5IQEA 4FTAA 5C27A 4EH7A 5TT7A 1YHSA 4A4LA 1M2PA 4FIFA 5FXQA 4YBKA 2HCKA 3LIJA 2PVJA 3RZBA 5DFPA 2GTMA 5KUPA 3F3UA 2PMLX 1JSUA 2XNGA 4O38A 5L2SA 5LOHA 5CU3A 4F7JA 2XA4A 2UZTA 3BQRA 3RTPA 4GU9A 2JC6A 4TNDA 1IA9A 3ALOA 2QONA 2PMOX 4IZAA 1H27A 4MXZA 4WRGA 3JPVA 3VVHA 3FZOA 4U45A 4AAAA 4DH1A 3MFTA 4FT7A 2FO0A 3ORXA 4QD6A 5E8UA 4D2PA 3UZTA 1Q3WA 4HCVA 5H3QA 3NIEA 4FSZA 3NFGB 4G31A 2PWLA 4ZJVA 2BRMA 3GC0A 3NZ0A 4IDTA 3U6HA 3R6XA 3EYGA 3MWUA 4BF2A 5JK3A 5LVMA 4G6OA 4RG0A 1H1QA 4W8DA 4ENYA 1QPJA 2UZLA 4YJPA 2Y4IC 4GSBA 4JBPA 3UPXA 4FEXA 4FKIA 5FDXA 2X8EA 2BDJA 3LFEA 2Z2WA 3S4QA 5HNIX 1GZOA 5EQYA 2OGVA 3F2AA 2QO7A 2HZ4A 4ALVA 4D4VA 5IPJA 3R30A 3QGWA 3UNKA 2QODA 4U40A 4BDCA 3LAUA 4HJOA 3H9OA 4QRCA 5AAEA 1MRVA 3OF0A 4GJ2A 3VO3A 1NVRA 3CQWA 3G0FA 2JIUA 3O0GA 5D12A 2B9FA 3MI9A 3WF5A 5KHWA 4EK6A 3EH9A 5H9BA 3TYKA 4NT4A 1KE6A 3DV3A 1Q8ZA 3C1XA 4DTAA 3ZEPA 1G5SA 2XCKA 4FNWA 4G5JA 5M4FA 4IH8A 3QC4A 3BE9A 4P5ZA 2QR8A 3ROYA 3DJ5A 3A8XA 4AGUA 3BU3A 1DS5A 1TFFA 5FDPA 1XH6A 4TW9A 4I6LA 5ANOA 5LVLA 2PZRA 5IDNA 3EJ1A 2ITYA 5KKRB 2XIXA 1KV1A 1Y57A 4YTHA 4GS6A 1M7QA 2WTKB 3MFUA 5G6VA 3VRYA 2XM9A 4AGCA 4DLJA 4O96A 4YTCA 2W5BA 5JH6A 4BN1A 3GC8A 3W0SA 4M97A 5JRSA 4DG3E 3TNHA 4GUEA 4FTLA 4ACHA 3HYHA 2QO9A 3BEAA 3E88A 3COHA 3W8QA 4FNYA 5EKNA 3MPTA 3CQEA 4H1MA 4O2PA 4WKQA 4G9RA 4MUQA 5J79A 1H1PA 3FY2A 3F3VA 3I0OA 4PTCA 2DQ7X 4UALA 4EOIA 2WMTA 4QMYA 3NNXA 2E2BA 4J71A 4RIXB 4X2GA 5KCVA 3NVMB 2JAMA 4FVQA 4IW0A 3P4KA 2BUJA 3WYXA 4O7WA 3CC6A 4GYGA 1DAWA 3OWLA 4JRNA 2R3OA 3EIDA 1UKIA 5JZJA 5M44A 2WELA 2DS1A 4YP8A 4FV0A 4ZXTA 4E1ZA 4ZAUA 3OHTA 3LE6A 3VBYA 4RQVA 4GH2A 5IEXA 2A0CX 3ZO3A 3BYUA 4QYHA 3SKCA 3MVHA 2CN8A 2V7AA 3ZXZA 1PMVA 5EM6A 3W10A 3O2MA 2OJJA 5EQEA 1SZMA 4AGWA 3LXLA 3T3UA 3Q9YA 4DINA 1H00A 3BI6A 3A7IA 3QC9A 3PZEA 2EXEA 4IC8A 4UBAA 1SVGA 3Q5IA 4YJVA 4D0XA 1BI8A 3FHIA 3O8PA 5E90A 4DAWA 2X7FA 3HMMA 2BFXA 2CCIA 3K2LA 4FV9A 4CV9A 2CNUA 4KUJA 1GAGA 2SRCA 4I4FA 4FODA 4YBJA 4WHZA 5B7VA 4H05A 4CV8A 5LQFA 3HV4A 3F3ZA 4FUXA 4BJJA 3GQIA 4QP6A 3OEZA 5AP0A 4ZTMA 4KIKA 4AGDA 4U42A 3NYXA 3QKMA 4O6EA 3PPKA 5EHOA 3ZO1A 3PWDA 4ALWA 3EOCA 4N57A 1GOLA 3QZFA 3TWJA 3OW4A 1PXMA 4FBXA 3S0OA 1V0OA 4NWMA 4ARKA 3AD4A 3C5UA 1SM2A 2X0QA 4I4EA 2QOOA 2VTOA 3PXKA 1H25A 5CEOA 2VO0A 2QCSA 2XK4A 4WSYA 5FTGA 4IB3A 4YTIA 1ZYSA 1TQIA 1ZOEA 4G3GA 2ITZA 3W2CA 4MK0A 4X2JA 1OITA 1AQ1A 4NW6A 5FM3A 4D2SA 3EHAA 3ZUUA 3MN3A 3QWJA 3IDCA 4Q5EA 1HOWA 4B0GA 2DYLA 4FL1A 4RWKA 3JVSA 3EFLA 5I9YA 4ZMEA 2EUFB 1XMMA 1OKWA 2JFLA 3VUKA 5B2MA 3PXFA 1M14A 3UC4A 4IM3A 3HRBA 4YJNA 4D55A 3SXRA 2J0MB 4FKOA 4TT7A 2QVSE 4O0YA 4M13A 1DI8A 3R21A 4LV8A 4RIOA 3GC7A 3UTOA 3G51A 1P5EA 1TQMA 4F9BA 1OKZA 1BI7A 1W98A 3CTQA 3OOMA 3RWQA 4C7TA 4S30A 1H26A 2ITNA 1W0XC 3F66A 2EXCX 4MXCA 4ZY6A 2C6IA 2YM5A 3DKFA 3UYTA 4GFMA 4ZS0A 4U5JA 4D58A 1UKHA 3P78A 3IW5A 4NW5A 2XM8A 4BI0A 2C1BA 4MWHA 4U41A 3NX8A 2VZ6A 4I24A 4LGHA 5CYIA 2ZVAA 4U8ZA 2QI8A 5M56A 2QOIA 4X2KA 5DG5A 4N0SA 4JDIA 2JDRA 2W05A 4M68A 4EOQA 4FV3A 3OWPA 3QCQA 3RM6A 5CU2A 4BWXA 3QCXA 3R1QA 2HY0A 3ZC5A 4EBVA 1YXXA 3GOKA 3QKLA 5AP2A 3FZTA 4UYAA 2QG5A 3NNUA 4QMUA 2YIRA 5IISA 2ETRA 3UQGA 2J4ZA 2NRUA 3FQSA 1P2AA 1XH7A 3K3IA 4TYHA 4E4MA 5AJQA 4Z7HA 5BVOA 4LRKA 4RJ8A 4EBWA 3ETAA 2P2IA 5EW9A 4A9RA 4OLIA 3P7AA 1OL7A 3EB0A 4X0MA 3VIDA 4EUUA 4BICA 2YLFA 4D2TA 3HECA 2OZAA 4BZNA 4A7CA 3CKWA 5L6WL 4IB0A 4H3BA 2J90A 4HYSA 4F4PA 5M08A 3RPSA 3QRJA 2Z7LA 3MY5A 3L1SA 2PVYA 4IAAA 4YSMA 2FYSA 3NYOA 3PP1A 3EQFA 1ZMVA 4KRCA 4BB4A 4D2WA 3CR0A 2CSNA 3OUKA 3DAKA 4GK3A 3ZSGA 1GZKA 3HLLA 4WNKA 2OF2A 2IW9A 4W4XA 4KS7A 3LJ1A 4QTCA 1U5RA 2Y4PA 3UJGA 4AZTA 2VTJA 3QHWA 3O7LB 3ACKA 3KN6A 3KMWA 1A06A 4TY1A 4PP7A 5IA3A 3AT3A 4N70A 2XB7A 4O7TA 3ZLXA 4OT6A 4AZSA 5I5ZA 3G15A 5EI2A 2BTSA 5L6PA 5CEIA 2HENA 2OXYA 4F7LA 4L3JA 2QOLA 3FXXA 3QBNA 2P4IA 1ZY4A 4CFXA 4L46A 4O0VA 3UP2A 4EC8A 2B54A 4RJ3A 1ZMUA 3V51A 4CT1A 4YU2A 3BYVA 4C57A 4XOYA 4NKAA 3QQHA 4EK5A 2C6OA 3KFAA 4MCVA 3LFFA 4FV5A 3VS0A 4EK8A 2IN6A 1J1CA 2VTNA 1Q62A 3R73A 3OW3A 5AR8A 1ZMWA 2OU7A 3JYAA 4U9AA 3RNIA 3ORLA 4L00A 4IVDA 2WNTA 3UIUA 3C9WA 3HDMA 5AR7A 4C36A 3EFJA 2BALA 3GCPA 4ACCA 2R3PA 2X39A 4GIIA 2FUMA 2G15A 3FHRA 3BV2A 5AUVA 5K0KA 4RBLA 3FKNA 5KX8A 3KF4A 4TWPA 3ATTA 4D5HA 5K5NA 4UMPA 4USFA 5LCJA 3QALE 2JKQA 4XG6A 2W1FA 4OBQA 2YACA 4BKJA 2PPQA 4CYIA 5AWMA 1TZDA 5E91A 1YRPA 5CU0A 2VN9A 4ZZMA 3FY0A 2YAAA 1UNGA 4DFZE 4IMYA 2WQBA 5J87A 4ZY5A 5AIRA 3OFMA 4W4YA 5AP4A 2B9JA 4DFYA 2HZ0A 5DGZA 3F88A 3GU4A 2WIHA 3PFYA 1REKA 3MVJA 5KMMA 3PZHA 3W2OA 2WOUA 1G8SA 2R3KA 2NRYA 3H9FA 4L53A 2NYAA 4WRSA 4C3RA 4DC2A 2YEXA 3A99A 4G16A 4MX9A 3RK5A 3THBA 5BYLA 1UU8A 1Q41A 3ORNA 3HP5A 4X6RA 3D14A 3NUXA 1W2DA 4LG4A 5FG8A 3TDWA 4KIQA 4FTRA 1PY5A 4Q5HA 2R3FA 4YO4A 1NA7A 2HXQA 3ULIA 2BDWA 4XP3A 4J97A 2P0CA 3Q3BA 1YKRA 2FSLX 1UU7A 1ST4A 5M07A 2GS7A 5CT0A 4KD1A 4CFNA 3BYOA 3CY3A 3TUBA 2JIIA 5HG5A 3OXTA 3V5JA 3OT8A 4MYGA 5FUTA 4DFUA 3P1AA 3FE3A 4UWCA 1JNKA 2QHNA 5AP3A 3EQPA 3TZMA 4C4HA 4E6DA 5AV1A 1WBTA 4XNEA 3UZRA 4XG4A 4TYHB 5FP6A 3TDVA 2GS2A 2B52A 2XZSA 4PPCA 4QP8A 3UVRA 4BTJA 3UBDA 2VTPA 4ZTRA 2WQMA 3MA3A 3VS4A 4WT6A 4AUAA 4J52A 4ALUA 4AQCA 4EYJA 3E8NA 4K8AA 1YHVA 3R9NA 5FEEA 5HO8A 3FLNC 5J95A 5AFVA 3DB6A 5AUTA 3ODYX 3KULA 4FG9A 2GNLA 4YJUA 4ZTQA 4E4NA 3I6UA 4GUBA 1YWRA 4LOPA 4QDVA 1GIHA 2CGUA 4QTBA 4G17A 2XIZA 2IZTA 4EH4A 4E26A 4I6HA 5DOSA 4K1BA 3LCKA 5D10A 5E8WA 3R01A 2AYPA 3EFWA 3CQUA 5AR5A 5EOBA 3C4FA 3HNGA 2XF0A 5FLFA 3M1SA 3BZ3A 4QMNA 4A4OA 2PZYA 3PUFC 1IR3A 4M3QA 4BCJA 3QTQA 4HYHA 2J50A 4C38A 1VYWA 4ZP5A 3R7EA 4X3FA 3ZMMA 1MUOA 3L8SA 2PVKA 4DA5A 5A6OA 2G2HA 2GNHA 3PFQA 5JQ5A 2CHLA 1J1BA 5TKDA 3FWQA 2OK1A 4ZTSA 2ZDTA 3OBJA 3TUDA 5DE2A 4G5PA 2YIWA 3P5KA 4ID7A 2QKRA 4XJ0A 4YHJA 3O8UA 5D7AA 2BHHA 3F5PA 3GU8A 3ZTXA 3D7TA 4QP2A 2H6DA 2W96B 3HMPA 3LCSA 2J0KA 3EQCA