3LCTA

Crystal structure of the anaplastic lymphoma kinase catalytic domain
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
308
structure length
308
Chain Sequence
b'NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRAGYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALK tyrosine kinase receptor
publication title Crystal structure of the ALK (anaplastic lymphoma kinase) catalytic domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 102
structure length 308
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lctA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lctA01
3PZEA 4IWOA 4KSQA 5M07A 3ZSIA 3R7OA 4O83A 3RWQA 4DN5A 4FE2A 3UYTA 2OU7A 3MY0A 3QC9A 4RX8A 3V6RA 3GC8A 4ZSLA 4GW8A 3HDNA 2XK9A 4RVMA 3LXLA 2WTCA 4IM0A 4FVPA 4F4PA 2WTKC 4FSWA 2B1PA 2QKWB 1ZYDA 4IJPA 3R04A 3TKHA 3ZLWA 3E5AA 3R22A 4USEA 5BVEA 5HO7A 4RRVA 1KOBA 4XBUA 3ZO4A 4O0VA 4WG3A 2I0YA 2PHKA 4B99A 3HV5A 3FE3A 3IW7A 4O7VA 2HXQA 4M66A 2ITOA 2OZAA 1JSUA 3ROCA 2C6IA 3JVSA 5TKDA 4QMSA 5CEOA 5L4QA 5HOAA 3E62A 4ANBA 5HE2A 4I6BA 5C9CA 4BDEA 4PPBA 2P4IA 4FSZA 3MIAA 4RSSA 5FXRA 4FIIA 4LM5A 4LUEA 4K8AA 5HU3A 3F3TA 5E8UA 2RG5A 2VX3A 3OBGA 4D4SA 4HGSA 4OGRA 4FUYA 5CEQA 3F3UA 4DGOA 4ZSAA 4BGHA 3R7GA 3S00A 4NYEA 3MFTA 4CD0A 3RAIA 2UVXA 3JY0A 4ALUA 4AE9A 4ASDA 3HKOA 2H34A 3MJ1A 4U44A 3U4WA 4O7YA 4TKSA 5I0BA 1UU8A 2BRNA 3AD6A 3DU8A 2X8DA 4X3FC 3Q04A 5AAFA 3MYGA 2YHVA 2B9HA 4Y83A 2IVSA 3LCOA 5AR5A 3IDPA 3A2CA 3F5XA 5AP0A 5HORA 4IM3A 1Y6AA 3BX5A 2WTKB 5G1XA 3EFLA 2CCIA 4XG8A 4AZEA 2CKQA 4XH6A 5FD2A 2OJ9A 1H8FA 4FTCA 4ANSA 4B8LA 4BHZA 1FMOE 5KMMA 2IZSA 4APPA 4CMTA 2GQRA 2V0DA 3DS6A 4AACA 5L2TA 3PY3A 4AT3A 3FQSA 5AV1A 3JR1A 3U55A 3EIDA 4MCVA 3VS1A 2IPXA 3BHYA 2DQ7X 4LRKA 3G9NA 2GCDA 4RC4A 3C1XA 4IZ5A 3LFEA 3U6IA 3IOKA 4LV8A 3PJCA 3TUDA 4B8MA 5KMKA 2PZYA 2A19B 3PWYA 4DEDA 3PVWA 4CRLA 2R5TA 3R7UA 3UZRA 5IQDA 1OECA 3VNTA 4O7TA 4L01A 1PKDA 4LG4A 4O22A 5TT7A 1FGKA 4DLIA 1W8CA 4EH2A 4E6QA 3ALNA 5E8VA 3RI1A 4O84A 4ZS4A 2YN8A 4N0SA 5J7BA 4A4OA 3BELA 1JBPE 4DF3A 4O7RA 5DEWA 4IWQA 5CAOA 3PIXA 3UNZA 4QTBA 4JBQA 3EZVA 4X3FB 3QCXA 3MA3A 3P7AA 3IDBA 4ZS0A 2ETMA 2VTSA 2UW0A 3CBLA 3EN5A 3G33A 1YDRE 3KMUA 3LAUA 4XG9A 3BHHA 3PA4A 2JAVA 1H1PA 1M52A 3RM6A 3AC2A 3Q4TA 1OITA 4R6VA 5JZNA 4BTFA 4CNHA 3R8ZA 3NMUF 1M7NA 1ZRZA 2XK4A 3UYSA 3FMNA 1YXXA 3CJFA 1PF8A 5A3XA 2XNBA 3BEAA 1BI8A 4DFYA 2Q83A 3VQHA 3VULA 4QYFA 3DNDA 4TYGA 4IWPA 2IW8A 1FVRA 3F3WA 3NUXA 3EN6A 3R8VA 1O6KA 3H9OA 4OTQA 5CI6A 4C2WA 5IQBA 2WMAA 3PRIA 4PDOA 4E8AA 5JGDA 1UNGA 1GZ8A 2C6OA 2UZUE 3W8QA 3R7VA 2QURA 4EKLA 1PKGA 2F7XE 3UVRA 2YM8A 5AV4A 5BUEA 4XRLA 5AR4A 2REIA 4DG0E 3KQ7A 3R73A 4MBLA 4XP2A 3DA6A 1H0WA 1ZMWA 3BPRA 3UIUA 4FKRA 3FQHA 1Q41A 4V04A 5AM6A 5L8KA 4TL0A 4HCUA 1XBCA 3RCDA 4XHKB 4AA5A 5M4UA 3LQ8A 2JFMA 3T3VA 3CD3A 3QALE 4MAOA 5DRBA 5K0XA 3TG1A 1YVJA 3DY7A 4WBOA 3TZ7A 1Y57A 4PDPA 4FT5A 4UALA 3WF6A 5CT7A 3EQDA 3UNJA 4ZTQA 3DV3A 1UKIA 4JG6A 3OUNB 3O2MA 1YDTE 2VWZA 2Z7LA 3NAYA 5I9WA 1H1QA 4S31A 4RFYA 5IH4A 4XS2A 5HE3A 2O65A 3BYVA 2B4SB 4FV2A 1GNGA 3UGCA 4IIRA 3DDPA 4PTEA 2IW6A 2JITA 4IH8A 2PYWA 2ACXA 3ERKA 4M69B 5A46A 3V04A 2C6MA 4DCAA 3NVKI 1LPUA 5L8LA 5L2SA 2XBAA 2YIXA 4TWOA 1WBPA 4LOPA 5F95A 5CQWA 2G2FA 3PJ2A 2AC3A 1OMWA 4E5BA 1R0EA 5KO1A 4I5HA 4J96A 4DG2E 4AG8A 4U79A 4FK6A 3NIEA 3KVWA 1XHAA 2BRGA 4TYIA 5F94A 2JGZA 4MVFA 2WMXA 5DPVA 4G17A 4BN1A 5AR3A 5AUXA 4CCUA 2IG7A 4YHTA 3UJGA 4BCFA 4NM5A 1SNXA 4PMSA 5AR7A 3EN9A 5LVMA 2BIYA 3TJDA 2HY81 2W1FA 5A6OA 3PVGA 1H0VA 2JDOA 4BWPA 4D2RA 3WF7A 4FTKA 4BDKA 5L6OA 4EC8A 2ETKA 5AJQA 5IDNA 3EKKA 3PXFA 2C5OA 4OBQA 2HK5A 5E8SA 2DS1A 5EM6A 3R7YA 3R9DA 3SX9A 1V0OA 1ZLTA 2Q0BA 1YQJA 2J50A 2O2UA 3GU6A 3OMVA 1M2QA 3NEWA 3MFUA 4XEYA 5J5SA 1PHKA 2O64A 3QD2B 4GEOA 3QTSA 4PL4A 3JPVA 3O0GA 1MRVA 1W84A 4QQJA 3IKAA 3LCTA 2EB3A 5C27A 3BU5A 3QTXA 4IAKA 2WTDA 3PDTA 3POOA 5IKWA 2JDVA 3LHJA 4BCNA 2WMUA 4OBOA 3SV0A 2ONLA 1UNHA 3BGQA 4FVQA 2YWPA 2BTRA 3TV7A 3WIGA 4FC0A 4R3CA 3VF8A 4A9SA 4ORKA 4JDKA 4BKZA 4TNBA 3WF5A 3FKLA 3BGPA 4P4CA 2OJIA 3FLWA 3NIZA 3KC3A 4EK8A 3DTWA 3OW3A 5IA3A 2Z02A 4YNEA 5BVDA 5LWMA 5BUJA 5CSPA 3P7CA 1B6CB 2G2IA 2YJRA 3F5PA 3BLHA 1XBAA 2QI8A 3ORXA 1FGIA 4KSPA 4KWPA 5BPYA 4FNXA 3Q5ZA 4O86A 3DAKA 4AGUA 4C4EA 5FGKA 3T8OA 4OAUC 3AMBA 4MBIA 4DG3E 4Y85A 3Q53A 1VEBA 4PMMA 4QTCA 5HCZA 3NUSA 2B52A 3B8QA 3R01A 4E4LA 5M09A 4UWBA 2JD5A 3QAME 4O27B 3SXFA 4RWJA 2O5KA 3LFSA 2WOTA 5EH0A 4BDIA 4F09A 1NVSA 4ZMFA 4YTHA 4CXAA 5IQEA 3ROYA 4J8MA 3LXNA 3N4TA 2R7BA 4YJUA 3CTQA 4XOYA 4HZRA 4H05A 4K9YA 3JUHA 5ANGA 4HOKA 4CKIA 3R2YA 4D5KA 2PVKA 3LMGA 3ORMA 1OL7A 2UVYA 2OG8A 3EHAA 5DT3A 2XKFA 3OC1A 3V01A 3LQ3A 5KZIA 2VN9A 1JSVA 4QNAA 3WF9A 2FGIA 2R3LA 3R9HA 4CTBA 1YOLA 5JFVA 4O21A 4RVTA 3UG1A 1ZMUA 3MS9A 5FM3A 4I23A 3SA0A 2W1CA 2OBJA 5ETCA 3E92A 1W0XC 2F57A 2WGJA 1G8SA 1V1KA 2PVJA 3GCQA 4KRDA 5CEKA 1XJDA 1LEWA 4FTIA 3R8LA 3CS9A 1RDQE 5IH5A 3A7GA 2VD5A 4D4RA 5EHOA 2WMBA 2LAVA 2XNEA 1IR3A 2WTJA 2H8HA 3T3UA 3ZS5A 2UZDA 1FOTA 4NU1A 4PP7A 5DR6A 3UG2A 2VO0A 3QZGA 4IM2A 5E8TA 4S33A 4GUEA 4U43A 2WMVA 1H24A 4E1ZA 5LVLA 4BKYA 3D14A 4DFUA 1CM8A 2C5YA 2XM8A 2GQSA 1JKSA 4FYOA 5CNOA 1PMNA 2GMXA 4XYFA 4RIYB 2JKKA 4XG2A 1Q99A 3ZC5A 3LMHA 3FDNA 4QYEA 1P4OA 5E1EA 2BALA 2PVRA 4NT4A 4O81A 3R21A 4FZ6A 3BE2A 2UV2A 2QOFA 3AT3A 2XJ2A 3NS9A 4IFCA 1E9HA 4IHPA 3SXRA 4YJRA 3A7FA 5DE2A 2BZJA 3NRMA 4MBJA 5D41A 5TF9A 3LKMA 4MNEA 3LW0A 3DK6A 2V5QA 3QZFA 3OEZA 4FKPA 4QP4A 3V8SA 5JQ5A 2C6LA 2XUUA 4FZFB 5A6NA 3CXWA 3IS5A 3OD6X 2XJ1A 3C4ZA 4BCHA 4DITA 4KAOA 2Y4IC 2X9EA 2ZVAA 2CLQA 3L8VA 1JPAA 2R3NA 4CEGA 1QCFA 2YAKA 4RIOA 5JZJA 3VBTA 4IX6A 1H1RA 4I21A 4EQCA 3F2AA 4CQEA 2BAKA 1OPKA 2W1EA 3FLYA 2CCHA 3TZMA 4D9TA 3C4EA 4NWMA 4AN9A 4C33A 5KBRA 3ZLXA 3ORKA 3EQFA 3D2IA 1KV1A 3GC7A 3H30A 3NGAA 4FV3A 3PTGA 4JDJA 4FI1A 4QMYA 5KZ0A 2VX0A 3HV6A 4QP3A 4TWCA 2F7ZE 1DAYA 4D1ZA 5HE0A 4F99A 5DNRA 4IB3A 5AP3A 5DYJA 4WSYA 4Q9ZA 3TZ9A 3WYYA 5KMIA 2YA9A 4IC8A 4BCOA 1GIHA 2C0TA 2WAJA 4DTBA 3GUBA 1AGWA 3IONA 3JXWA 1M2PA 1UWJA 1CMKE 5F20A 2W1ZA 4HYIA 4O1OA 3VHKA 2YCFA 2W1HA 4FV9A 4YLKA 4FSTA 4L3LA 4APCA 4QTEA 2C6TA 3RJCA 4BDBA 4O0YA 5JH6A 2XYUA 3BU6A 4O91A 4RIWB 4YJNA 4QMLA 1I09A 4E4MA 1P14A 4UWYA 4PDSA 2VTNA 3ZHPC 2Y8OA 2R3FA 5M08A 3L9NA 2F7EE 3DBFA 3CSVA 5AR2A 3RALA 4NJ3A 4AA4A 4IVAA 2ZV8A 4N6YA 3LXKA 5ACKA 3DQWA 5E92A 4GG7A 4WO5A 5HG9A 5EI8A 2QLQA 3BV2A 2VZ6A 2Y4IB 2XKCA 4NFNA 3DLZA 2FYSA 4I5CA 1JNKA 2UW5A 2X39A 4U97A 4TRLA 4CKJA 5J8IA 1ZYLA 4BHNA 4Z7HA 4L7FA 2BHHA 2XB7A 2X1NA 3QQFA 5AUYA 2AUHA 3QLFA 4V01A 1URWA 3R6XA 5I5ZA 3GVUA 2W5HA 2IWIA 3AGLA 2OIQA 3QC4A 3DTCA 1J3HA 1DM2A 1GZKA 1PYXA 2YLEA 4UEUA 5FWKK 3PY1A 3WBLA 4EJ7A 3WE4A 4EUUA 2W96B 3DKFA 1AQ1A 4RJ5A 5AIRA 3RAWA 3V8TA 4ZLOA 4G3CA 3UQGA 3C51A 3EQIA 1QPJA 5FEQA 3FLSA 3FI8A 4HGLA 3SXSA 1FVVA 5HHWA 4J97A 2BAJA 4IVCA 3HDMA 5CWZA 3W2SA 4CFXA 1JOWB 4XJ0A 3OWLA 5HNIX 3HV4A 4TNDA 4AT5A 4W4WA 1PXOA 2GNIA 4XG6A 3E87A 3UE4A 1KE9A 3H10A 2C0IA 3NUNA 2DYLA 3KMWA 5E1SA 3HP2A 4R8QA 4E73A 3RK9A 1OI9A 2PUUA 2OJFE 4EJNA 3IQ7A 2C30A 5JGBA 4DGGA 4IX5A 4YJOA 3BV3A 4Y95A 3UO6A 3DLSA 3EYGA 4PNKA 3EOCA 4MXCA 3PWDA 2ZM3A 4O38A 3EFWA 4G3DA 4O2PA 1YXSA 2ZAZA 4RMZA 4RWKA 1OVEA 2BRBA 3P79A 4TT7A 4IW0A 5E8ZA 4CGAA 2PVNA 2B0QA 2ESMA 4AGCA 5CF6A 4PX6A 3NW5A 1J7UA 5FTOA 4CZTA 3FLNC 3CE3A 1MP8A 2RL5A 2FUMA 5ANJA 4MQ1A 4X3FA 4OTPA 3F66A 3UMWA 4CSVA 2QOHA 4L42A 2XRUA 1CTPE 2FA2A 3N4VA 1YW2A 4I92A 2DUVA 5HTBA 5KKRC 1YHSA 4A9UA 2HELA 1H25A 1U5QA 1IRKA 2RGPA 3VBYA 3FZRA 4OTHA 4EHGA 5KMOA 1ZMVA 3QQLA 4I41A 4AXAA 4FKOA 3BBTB 4NM0A 3A61A 3EQGA 2PK9A 3F9NA 4WIHA 5HZNA 3CKWA 5CENA 1KUTA 1HCKA 3PXYA 4QPAA 5HI2A 4W4YA 3CGFA 4O6EA 3MVHA 1OKVA 4FKTA 1F3MC 1OGUA 4H3QA 3QRIA 4LRJA 1IEPA 3G0EA 3F88A 3H9RA 5CSHA 3VS3A 3ZYAA 5KCVA 4JRVA 3DZQA 3V3VA 2X9FA 3FMMA 3NX8A 1ZXEA 4EWHA 4RX9A 2CNUA 1OPJA 4LGHA 2PVHA 2QODA 2WB8A 3QCYA 4FR4A 3DFCB 4OUCA 4ERKA 3UQCA 3CY3A 1ZOHA 4G3GA 5IQCA 1KOAA 4F64A 4BI2A 3UOKA 5I9YA 2F2CB 4O6LA 3UP2A 2I7QA 1ND4A 1A06A 4FEQA 1AD5A 3ZZEA 4UXQA 1M14A 4MK0A 3LZBA 1KV2A 2DWBA 3BYSA 4KIQA 1W83A 4R5SA 1HOWA 3CEKA 5CYIA 3S95A 2C4GA 5HESA 5GIOE 3I5ZA 4KBAA 5CNNA 3MY1A 5KKRB 4XV1A 5M56A 4O82A 2BUJA 3HEGA 4KIKB 4RFZA 4YSJA 3H0ZA 4GK4A 3ZZWA 3DKOA 1PMEA 2HW6A 1H26A 2CJMA 4GSBA 4PV0A 4LL5A 3DBDA 4S30A 4D4YA 3LE6A 1S9JA 4MKCA 5CXZA 4FEXA 4DEHA 1B38A 4I0SA 3KRXA 2BRMA 3UC4A 5HIEA 4U5JA 1MQ4A 3MWUA 4M69A 3U9NA 4AFJA 3N51A 3OT8A 4CLIA 3S0OA 3D5XA 2WFYA 4W9XA 3KEXA 4DINA 1FMKA 2J0IA 2VWBA 2ZYBA 4F0FA 3RK5A 3R1YA 2WMQA 3NUUA 5D12A 3U8WA 5K4JA 4FIFA 5CF5A 2ETRA 2ZB0A 3QRTA 2Z7QA 4OAVB 3QL8A 4HNFA 2PUIA 3MIYA 2VWXA 4LRMA 3AC3A 3BHUA 1W98A 2QG5A 4GU6A 3NNUA 4QTDA 3Q52A 4JG8A 4F7JA 2YCSA 2QHMA 1NXKA 2BCJA 3N9XA 5CSVA 3AD5A 3O8TA 2QLUA 2W9FB 4E6CA 5B2MA 4MXYA 3MESA 1ZYCA 2G9XA 4GH2A 2XIXA 5M44A 5HG5A 1WBOA 1J1CA 3V5WA 3HMNA 5DR2A 4ALVA 2AC5A 2BVAA 2HAKA 3R0TA 1TQPA 1YOMA 3R7IA 3TKIA 2XYNA 3U9CA 2ZV7A 4O0TA 1Y8YA 3WYXA 4F08A 5K5XA 2JKOA 5EM5A 2RFSA 2BHEA 3FUPA 4Q2AA 5EDQA 2PE2A 3EJ1A 3VBXA 4CFVA 1HCLA 4EWQA 3RK7A 4X21A 3KGAA 3QTUA 1VR2A 4FIJA 4DAWA 1VYZA 3CTJA 1APME 4FV6A 4L8MA 3M42A 2A27A 3KXMA 4YBKA 5CZIA 5EYMA 5GJGA 4PP9A 4BCPA 3W2RA 4HJOA 1WBVA 1H1SA 3TIYA 2PSQA 1WCCA 3HUBA 1OL5A 4G5JA 4UXLA 4Y73A 2WEVA 2NP8A 2YWVA 3LXPA 5L3AA 3FBVA 2BAQA 3K54A 5CX9A 2RKUA 3Q4CA 2ZM1A 5CEMA 2E9UA 1PYEA 4H3BA 2E2BA 4IDTA 4Y72A 4UYAA 5AIKA 4FA2A 5C4LA 3ODYX 3BLRA 4LMUA 2JKQA 5EYKA 4XP3A 4JQ8A 5GNKA 2B9JA 3F3VA 3ATTA 4DE4A 2IVVA 5K9IA 3EN7A 3GI3A 1ZYJA 5IA1A 3JVRA 3ELJA 3POZA 4HNIA 4YC3A 3RPRA 5IG1A 2OW3A 4W9WA 3ETAA 4DFLA 2ZMDA 1DI8A 3VO3A 2P0CA 4RWIA 2VV9A 4ZK5A 4HCVA 3P08A 4KS8A 3WE8A 2XNGA 4USFA 3PP0A 5CVGA 3K2LA 5JRQA 2OF2A 2W05A 3FLZA 3KF7A 4J71A 3VJNA 2VWVA 4LQMA 2YIQA 3LPBA 4GCJA 2HENA 4NCTC 4TW9A 2QHNA 3U87A 4EOPA 1OKYA 2GHGA 3E7VA 4I6QA 3KREA 5E4HA 2KULA 4UBAA 4G6LA 5L8JA 2IZRA 5LXMA 2CKOA 4KIOA 3RAKA 1YRPA 1R1WA 5CALA 3SHEA 1P5EA 3KVXA 4RZVA 2OH0E 2ZV2A 4H1JA 5ANOA 4FSNA 2B9FA 2Y6MA 3QTQA 2VTLA 4U40A 5C8MA 1IAJA 1YWVA 5CQUA 4UWCA 2BKKA 1XH6A 1MUOA 2CGVA 3ZOSA 4BRXA 5J9LA 4O0RA 2OIBA 4FUXA 1GIJA 3HLLA 2Y9QA 4GIHA 3W33A 4QRCA 4WNOA 2O0UA 4YJVA 4CMOA 2XNNA 2P33A 3FMJA 1F5QA 4FTAA 2QG7A 4AWIA 4JBVA 5CANA 4HGTA 3UZTA 3RP9A 5HD7A 4RIYA 3Q9YA 1QL6A 4FT7A 3DNEA 3OWKA 2Z8CA 4YGAA 4RZWA 4D5HA 3QHWA 1UU7A 4D0WA 3PLSA 4KNBA 3DXPA 3O71A 5HLWA 3TIZA 3OTVA 3V51A 4X2GA 3VQUA 4XP0A 2YERA 2UZNA 4I6FA 4EH9A 4ZOGA 2W4JA 4M7IA 2J90A 1P4FA 2UVZA 3R02A 3CLYA 5CVFA 3DK7A 4GYGA 2OGVA 3AXWA 5IEXA 3RPYA 2X6EA 2C68A 4L46A 4JG7A 4DBNA 4X2JA 4FEWA 4R3PA 1PXJA 3Q3BA 4U0IA 4E7WA 3DBEA 3W8LA 2J7TA 3QF9A 4GFGA 3S3IA 1MQBA 1H00A 2BKZA 3BIZA 4D2PA 4FG8A 4GV1A 3WZEA 4D9UA 4YTFA 5IISA 4L45A 1IG1A 2VTJA 4RQVA 4TZRA 3WOWA 3OY1A 1OL6A 4AGWA 3UMXA 2G01A 5IQGA 5DG5A 2KTYA 5I4NA 3D94A 4HVHA 3ZBFA 1OL2A 2W1GA 3EKNA 1OPLA 5AUTA 3LOKA 3E7OA 3PSDA 5LCKA 1OUKA 2CKEA 4XMOA 1LUFA 4G3FA 4NEUA 4QP1A 4N57A 1DI9A 4LFIA 3QKLA 3U6HA 4NL0A 5AFVA 5I3RA 2GS7A 3OXTA 4CFUA 3KRJA 4NTTA 2V62A 3EQHA 3KRRA 3OEFX 5FXSA 3HA6A 3ACKA 2R3QA 4ZTHA 4WT6A 3GOPA 1YI3A 3W10A 3ORTA 4AZSA 5DH3A 5AAEA 3GOKA 2BMCA 3NUPA 4MD8E 4A06A 5HD4A 2XK6A 4GJ3A 3FPQA 2VRXA 3EZRA 4RIWA 3ZCLA 4IZAA 5J9YA 2ZB1A 1OBGA 4TXCA 5HGIA 1R78A 3BGZA 3HRFA 5LVPA 4EHEA 2C47A 4MXXA 4FIEA 3VS4A 5KE0A 3HL7A 3KK8A 1YKRA 4L52A 2B7AA 2W7XA 3E3PA 3QQGA 5IMXA 3G15A 5GINE 1YI4A 2B53A 1Q97A 3NVMB 4BYIA 4J7BA 4BDJA 5KMLA 1YHVA 4RX7A 4K33A 1UVRA 3FY0A 2BROA 4AZVA 2Z2WA 3AG9A 3UO5A 5IQIA 4FKGA 4L9IA 3I0QA 1Q8ZA 1PY5A 4IEBA 5KHXA 3W55A 3ANRA 5CS6A 5A4CA 1V0PA 1OIRA 3QA8A 4PWNA 5GZ9A 4FNWA 2CNVA 3R1NA 1Q61A 4O7NA 3RTPA 4G16A 5M53A 1IA8A 3LQ5A 5LVNA 2WD1A 4FT0A 5HVJA 5CXHA 2ITZA 5BYZA 4U3ZA 2GNFA 4CTCA 3G0FA 3W32A 2Y0AA 4O96A 3OY3A 5IF1A 1UA2A 3HAMA 2J51A 4LOOA 4A9YA 2QOQA 2VTIA 2IO6A 4G6NA 3U54A 4U8ZA 2PVLA 3GXLA 5ETFA 5FEDA 3VUKA 1OM1A 3LLTA 3C7QA 4DA5A 3R9RA 4FV0A 2JAMA 2VAGA 2R3PA 1JVPP 2RSVA 4Q9SA 4IE9A 4FTTA 3ORZA 2PWLA 3SAYA 2R64A 4O0SA 2NPQA 5JFSA 4I94A 2HZNA 3VUIA 3DAEA 4ZJIA 3L9LA 3A8WA 2RFDA 3E93A 5BVKA 2HWOA 3OG7A 1GAGA 1JKTA 2YAAA 3MSSA 5EW3A 3RINA 3FWQA 5EM7A 3LJ2A 4FV5A 4F6SA 5T68A 3FL4A 4ARKA 4C7TA 3LFAA 5JEBA 3KXXA 3C4XA 4CLJA 5JQ8A 4BCKA 4CG9A 2OI4X 3HV3A 3O23A 4YPDA 5IA5A 3ID6C 2PZPA 3HZTA 5BMSA 3L8XA 4M14A 1WZYA 3VBWA 4DT9A 5M57A 4IX3A 2GPHA 4NTSA 3FXWA 3EQPA 3KXZA 5FDXA 1T46A 4FEVA 4DFXE 3HV7A 4FTQA 3ZLYA 4C4HA 4F1MA 4ZZOA 2XEYA 4IZYA 5HVYA 2ZV9A 2CPKE 4TWNA 3R71A 1KE6A 4XV2A 4C4GA 3QD0A 3KN6A 3OCTA 1OB3A 3FHRA 4PRJA 5H8BA 4D4VA 2YZLA 1IASA 3RAHA 4ENYA 3WZKA 5A4EA 5IA2A 5ANIA 3WZDA 1BUHA 4JNWA 5HBEA 1RJBA 2CHLA 2FB8A 3HMPA 3PJ8A 4JVGA 3NYOA 3MFSA 4EZ7A 4PDYA 3MN3A 1DS5A 3MY5A 1Q8WA 4F6UA 4XG7A 5J7HA 5EKNA 3OXIA 3W2PA 5EQYA 3ANQA 3GCVA 4CKRA 4BDFA 3L8SA 3MA6A 5JMSA 2E9VA 4F9YA 3R63A 2ITNA 1M2RA 2OJJA 3FI3A 3GCUA 3GEQA 4EOQA 5LOHA 1MRUA 4QMQA 4RJ6A 3HMOA 3R00A 4YO4A 3AT4A 5IQAA 2QCSA 3T9IA 1XKKA 3FSFA 3IGGA 5AP6A 3RGFA 4EOKA 4QMTA 4R77A 1ZY5A 3VBQA 3QZHA 5FBOA 4QQTA 2W5BA 3ZH8A 3TJCA 3CJGA 3DOGA 4JX3A 4AOTA 2Y6OA 3P78A 4U80A 3VUHA 4FSMA 2PUPA 1UNLA 1J91A 3E8EA 2WQOA 3O50A 4QYGA 3S1HA 4E5AX 2O63A 4D2SA 2C6EA 3ALOA 4A7CA 3AC4A 4JL9A 4FSUA 4XNEA 5IZFA 4R7BA 4D1XA 2XKDA 3MVLA 3GQIA 3LM0A 5F9EA 4QMXA 3TNPC 3ZMMA 4KIKA 3Q6UA 4LMNA 4JRNA 3P1AA 3EL7A 3QHRA 3BRBA 3SW7A 4AF3A 5IMEA 4DEBA 3QD3A 4QMWA 3VS7A 2B55A 4C8BA 5CF8A 1U54B 2J0MB 2FH9A 2XVDA 4C58A 5GIPE 1H08A 1U5RA 3O8UA 4FNZA 4C02A 3IPHA 4YJTA 1URCA 3Q32A 5AWMA 3ZFXA 3FYKX 4RVKA 3FI2A 5KX8A 3G6HA 1QMZA 1Z57A 5AA9A 3F82A 1GZOA 4BCQA 4F7SA 3HMMA 2JDTA 3KB7A 4ZY6A 3C4CA 1W7HA 4CV8A 2XK7A 3I6WA 4JIAA 4HPUE 2ZMCA 5E8YA 1YDSE 2CSNA 2H9VA 2Q0NA 3C4WA 4E6AA 2WEIA 1NW1A 3FKNA 2QR8A 3O7LD 3KL8A 3LFCA 4HYSA 4KD1A 4C59A 2VTMA 3NCZA 2P3GX 3ENMA 5CSXA 2R3JA 4IAFA 5D9HA 1RQQA 3C0IA 4FICA 3A99A 1KE8A 1WBWA 3A7JA 3PE1A 3V5TA 4EK6A 4CQGA 2W06A 2W4KA 3R1SA 3ZFMA 2GNGA 3II5A 2X2MA 5B2LA 4IC7A 4RLLA 2Y7JA 4TWPA 4Z16A 5CAPA 3PA5A 3PPKA 2QOIA 3QQKA 2YFXA 3UOJA 5CF4A 1G3NA 4OT5A 4U7ZA 3KK9A 4I4EA 3NNXA 3RM7A 3P9JA 2OXYA 4FKVA 4NKSA 2BFYA 2XIKA 1Y6BA 3ZONA 2RG6A 4R1YA 4L43A 4DYMA 5IQFA 4YLLA 1FPUA 3I1AA 4EORA 3KY2A 5CU3A 3TTIA 3BYUA 3QUEA 2IN6A 4ITIA 1WVWA 2ITUA 2X8IA 4O7WA 1YOJA 3BWJA 3TXOA 3FAAA 2BTSA 2UW6A 4RWLA 3K5UA 5J95A 5EI2A 3ZEWA 3FC1X 3TNQB 3MDYA 4JS8A 5ACBC 3QYZA 4R1VA 2PE1A 4Z3VA 5C01A 1NVQA 4XBRA 3RNIA 4QPSA 2PL0A 3BQCA 3MTFA 3ZTXA 3LMIA 2H96A 4GK3A 2E9OA 3I5NA 4AAAA 4YR8A 4L7SA 1ZARA 3SLSA 5J79A 4X7QA 1I44A 2E9PA 2X7FA 3C9WA 4UZHA 3B2WA 2YABA 4X6QC 3UIXA 4BI1A 3BCEA 2CGXA 3ZEPA 3HA8A 3O96A 2W5AA 4FSQA 3MB7A 4KUJA 2HIWA 2HZ0A 3FLQA 1UU9A 5GZAA 4U41A 5HNBA 2BRHA 3SC1A 4I6HA 5IA0A 1WBSA 4UY9A 4ZZNA 2P2HA 3OOMA 4E3CA 4ZMEA 4QMZA 2WQMA 3VHEA 4NUSA 1O6LA 1PXPA 3BHTA 5FP6A 4YJPA 5HX8A 3Q96A 3LJ0A 2NRUA 4A07A 3FEGA 3COMA 3O7LB 2WXVA 4RBLA 4RVLA 3IW5A 4GJ2A 3RZFA 4AP7A 3UIMA 4BVUA 4KA3A 2R3KA 4NM7A 3PJ1A 4L6QA 2ITXA 4WNMA 2JIVA 5EFQA 3VS2A 3GU5A 1H4LA 3QKMA 4GIIA 2NNWB 3QRJA 2A0CX 5LMAA 4BCJA 2J6MA 5J5TA 2HWPA 3LCDA 3BQRA 2OH4A 3NCGA 3VS0A 4FOCA 4UMRA 3WARA 4QP8A 4JIKA 5L6PA 2VWYA 3HNGA 4W4XA 1IAHA 4MF1A 2ZDUA 3SGCA 3NNVA 4BIEA 3FC2A 1VYWA 1SYKA 1PXNA 4HVGA 3COKA 3SG8A 5HTIA 2A1AB 4IANA 2J0KA 5DOSA 3DXNA 3JS2A 5ETAA 3MV5A 4YBJA 3VWAA 2ITQA 4HYHA 4ID7A 4IZ7A 4K11A 1PXMA 2QONA 4JLCA 4XLVA 4FNYA 3UO4A 5M51A 2XIYA 3BI6A 3EH9A 4FF8A 4IAYA 3HP5A 4OBPA 4MWHA 4EYMA 2VO3A 2R3MA 4EQMA 3F2RA 4AE6A 4BDHA 4EZ5A 2YACA 4NCTA 4ZJVA 3IDCA 3OCSA 4G9RA 5HEZA 4EH3A 3DGKA 2W0JA 3FZTA 5LMKC 3OP5A 3R30A 5HBHA 3CTHA 4BBFA 2YEXA 2WTWA 2I0VA 4YU2A 3QRUA 4LI5A 4O0XA 4O1PA 5HIDA 2OF4A 3P23A 3HYHA 4G3EA 3OF0A 5JFWA 3CR0A 3FZ1A 4BKJA 5DBXA 3FXXA 4LGGA 5J87A 2X0GA 4A9RA 4ZLZA 3HRCA 3KULB 3PIYA 2YM5A 4PNIA 5CY3A 4ANOA 4J98A 4ACGA 4DCEA 4FL2A 4BBEA 4BDDA 2CGWA 4TYHB 2V7OA 4C3PA 4EI4A 2QC6A 3GCPA 3H3CA 1UV5A 3R8PA 4V05A 4BBMA 3WI6A 1BL6A 3D9VA 4RT7A 5FM2A 4D55A 2JBPA 1L3RE 4KBKA 5BVNA 2W9ZB 4EHVA 5C8NA 2ZJWA 3MW1A 3QU0A 3NLBA 3VBVA 3GNIB 5ANEA 3EQCA 2GQGA 4BR3A 3UC3A 4ZIMA 3UTOA 5KMNA 1S9IA 4AN3A 4PPAA 5EYDA 4PUZA 3ORNA 3R9NA 3MB6A 4BDGA 3I60A 3UOHA 1XQZA 4B0GA 1PJKA 2JEDA 3I7BA 5TE0A 4ZEGA 4YP8A 4Z9LA 5I9ZA 1YWNA 3L9PA 4MD9E 5CT0A 3ZUVA 3FMLA 3SDJA 2ITVA 3DPKA 3E63A 3QCQA 4AU8A 5A9UA 4AOJA 3MH3A 2X7OA 4ZSGA 4KB8A 4ANMA 4FKIA 4IAZA 2XCHA 5LQFA 2X4FA 3ZM9A 5DT4A 4BYJA 3EQRA 1Q3WA 4FSRA 2WU6A 4XV9A 4EKKA 3UQFA 5T3QA 4MF0A 1XH4A 3ZXTA 3Q4ZA 3UBDA 5TR6A 2OXXA 1PXLA 3L1SA 4JT3A 4BWKA 3R7EA 2V55A 3CQEA 4JX7A 5A4TA 3IG7A 3TWJA 5J1VA 2ERZE 3PY0A 1F0QA 2F49A 5CU4A 3DJ6A 4AFEA 3DKCA 3MH0A 3HGKA 3IECA 4FTNA 4EZ3A 1K3AA 1WVXA 4UX9A 3TT0A 4GVJA 3MPMA 3VS6A 4DT8A 2G15A 4O7ZA 4ZTSA 4DEEA 2C0OA 3H9FA 2UUEA 3G6GA 3D0EA 3NUYA 5H3QA 2C3KA 4BL1A 4C35A 5M06A 4E6DA 3LFBA 2VWWA 5AADA 3QXOA 2V7AA 4BCMA 3RZBA 3NSZA 3OCBA 3NW6A 5DVRA 4FTMA 4YTIA 4FTOA 3R83A 2F9GA 1BX6A 4C34A 4ENXA 5LWNA 4C4FA 4XLIA 4JXFA 3DDQA 2XF0A 3AC8A 2R3RA 3MPAA 5L2WA 2QOBA 4U9AA 4WHZA 3VVHA 4D58A 3E8NA 1ZYSA 5H8EA 3TDVA 4TPTA 3BWFA 2ITTA 3S2PA 4DGLC 3TTJA 4EONA 4GMYA 4WBBB 5CLPA 2W4OA 4GYIA 3OTUA 5AV2A 3UVPA 3MVJA 3U51A 1B39A 3IW4A 3KXHA 3PXKA 4FT3A 5AUWA 3F7WA 4RA5A 1L8TA 3E8DA 4OW8A 4I4FA 4YZBA 4AZTA 3LFQA 4IX4A 4FZDB 4TN6A 4X6RA 3RCJA 4CFWA 2G1TA 4WRGA 4I24A 3OZ6A 1ZAOA 3KU2A 2QQ7A 4I3ZA 1O9UA 3ZRKA 4R7HA 5LARA 3MH1A 3FZSA 1PXIA 2BFXA 4FKSA 3DZOA 1GOLA 4ACMA 3CY2A 2WMSA 4L68A 3LJ1A 4GT4A 4BGQA 3ACJA 3W16A 3F6XA 4FKQA 4QMOA 4WG5A 4Z7GA 3HVCA 2XA4A 3C0HA 2X7GA 5A4QA 3Q60A 4HZSA 4WNPA 3NUAA 2WZJA 4FTUA 2JDSA 2VNYA 5HNGA 3UP7A 3VUMA 5HTCA 4ALWA 3ULIA 4CZYB 1OKWA 4ANLA 5M4FA 1XBBA 4LYNA 3I6UA 5HIBA 2B9IA 1FVTA 4YMJA 5FEEA 4TY1A 4HVIA 3FZOA 3L8PA 3OW4A 2OIDA 5AEPA 3RHKA 4BTJA 4XUFA 3FMKA 3RPOA 4ANNA 5CTPA 3BKBA 4BB4A 3QKKA 4MD7E 4CT1A 3DK3A 2WO6A 4ZZMA 5FXQA 5HQ0A 3HECA 4JAIA 5DFPA 3UZPA 4GUBA 4WUNA 2I6LA 3CKXA 5I9UA 1NT2A 4B4LA 2PE0A 4JI9A 4UMTA 4H1MA 5I9XA 2EB2A 2J4ZA 5IH6A 1XH9A 3D4QA 4FKWA 4HYUA 3A62A 3D7TB 5AX9A 2VTHA 1W82A 2UW9A 3C13A 1E1XA 2YZAA 4IVBA 4JBPA 5GHVA 2O3PA 4MXOA 4IDVA 4IXPA 3OXZA 1JAMA 5J1WA 1CKPA 2YDJA 4KKGA 4DTKA 1WMKA 5L2QA 3IO7A 3V8WA 5HICA 4K1BA 1UWHA 2GHLA 5E91A 4QO9A 4UMUA 1GY3A 4TYEA 3NNWA 1TQIA 2R3IA 1PRYA 3PFQA 4GVAA 5CI7A 2OSCA 4FL1A 3V5LA 5KBQA 3BU3A 5CASA 3DJ7A 4XOZA 4UMPA 5JFXA 4WNKA 4GG5A 4ONAA 3CPCA 3TEIA 2C3JA 2X2KA 2YM3A 3I7CA 4OLIA 1U54A 4E26A 1OL1A 4F0IA 4DBXA 2XK3A 5C26A 3TCPA 2ITYA 4EUTA 4GT5A 3VRYA 3PXQA 4LV5A 4P7EA 5AP7A 4PQNA 3SRVB 1XH5A 2XK8A 3ULZA 4EK4A 2R3GA 3ZSGA 1XO2B 1ZOEA 2BDWA 4XCUA 3U4UA 1NVRA 4MQ2A 4QQCA 4QYHA 2PTKA 2I1MA 2CGUA 3GCSA 3SOAA 5CAUA 5FTGA 3COHA 2F4JA 2P2IA 3EL8A 3D5UA 3G5DA 3QX2A 4BDAA 2W1IA 4CYJA 3CQWA 2XIRA 2GTNA 2PUNA 4O7SA 2Z7RA 4PPCA 2IW9A 2X4ZA 3MFRA 1WVYA 3UOLA 2FSMX 3RPSA 3EFKA 4EOIA 5EDRA 5HCYA 1Q3DA 4JQ7A 2YCRA 3PSBA 3VUGA 1G5SA 2IZTA 2ERKA 2HCKA 3FMHA 3R28A 2NO3A 3UDBA 4L53A 4PL3A 3GQLA 1RW8A 2X2LA 4ZTNA 4I5PA 3DKGA 3AQVA 4CCBA 4NFMA 3KRLA 1YXUA 5DMZA 1REJA 3RMFA 4ITJA 4EOSA 4K6ZA 5AP2A 4C36A 3C0GA 4EQUA 2YIWA 4JDIA 3PUPA 3NYNA 2R0IA 2YDKA 3FI4A 4FSYA 1PW2A 3ITZA 4GL9A 4I22A 3ZFYA 5B7VA 1WFCA 4YJQA 1LR4A 1STCE 4F1TA 1Q4LA 2UW7A 3VRZA 5JRSA 4LGDA 5EYCA 4MWIA 4J95A 5AUVA 5HLPA 4D1SA 2A4LA 2CLXA 3HRBA 1R39A 5E8XA 4NK9A 4H36A 3GFEA 2WPAA 2WELA 2EWAA 4GU9A 4W8EA 3ZUUA 4M15A 2R3OA 5T6KA 4C2VA 4B9DA 5K5NA 4RJ3A 4RLKA 4PY1A 4BICA 2X8EA 1OIQA 4EH6A 4F1OA 5JSMA 5HLNA 3VC4A 4NIFB 4GT3A 5G6VA 4ZSEA 2OFUA 3CGOA 4QD6A 4FGBA 4E20A 3D5VA 2UZTA 3BYOA 3DAJA 5ETIA 2OFVA 4ITHA 4KRCA 4RA4A 2JIUA 3F61A 3W18A 3G9LX 3LVPA 1TVOA 3NWWA 3P5KA 4RC3A 2QR7A 2WIPA 3LFNA 3PIZA 2OXDA 4BCIA 4N70A 5IA4A 2VU3A 3DB8A 2OKRA 2UW4A 3OS3A 3QWKA 5H2UA 1Q24A 3ZDUA 5JGAA 5BNJA 5IQHA 3BEGA 3FXZA 1FINA 4J53A 2BILB 3MVMA 2PZ5A 5DR9A 1WAKA 3N4UA 3QWJA 3K3IA 2GSFA 4FIHA 1ZZ2A 5B0XA 1K9AA 4D0XA 4F9WA 4L67A 3BBWA 5ITAA 3KA0A 4F9CA 2QU5A 2RFEA 2XM9A 5DIAA 1YXVA 1YXTA 4M97A 5AV0A 3A60A 3QQJA 3UIBA 3P4KA 4DEIA 4F65A 4ERWA 2GNLA 2C6DA 3CCNA 1ATPE 3OBJA 1REKA 4FV1A 4OTIA 4Q5HA 4QQ5A 4YC8A 3NPCA 2HOGA 4FIGA 5IUGA 5LVOA 3MJ2A 2UZEA 4L00A 1Q62A 2FSLX 5AUUA 2YIRA 2VX1A 3FV8A 1SNUA 3TI1A 2FSOX 2QOCA 3AC5A 1GZNA 3TNHA 4DEAA 3GU8A 1J7IA 5BMMA 3PP1A 2EUFB 3ZDIA 2WTIA 4H3PA 5DLSA 1M7QA 5HX6A 2IZUA 4JR3A 2JIIA 3QTZA 1G8AA 4QNYA 3D7ZA 4X2FA 2YITA 3DFAA 2XH5A 4QTAA 3VUDA 4AUAA 2XBJA 5CAQA 4WKQA 3TV4A 2WQEA 4C62A 5CU6A 1SVGA 2IVUA 1BYGA 4ZY5A 1XR1A 2XRWA 3GU4A 2YM7A 5D7VA 1XH8A 3KN5A 4J52A 4QPMA 2GHMA 4IADA 2BR1A 1T45A 1U59A 3E64A 3PYYA 4MNFA 5GJDA 3W2OA 4C37A 4D28A 2VTPA 2ZDTA 2QD9A 2RF9A 4P90A 4YO6A 2QOOA 3RPVA 3VUTA 4DH7A 4QP6A 4EK5A 5KHWA 4Y46A 4UV0A 2PMOX 3KXGA 4U45A 3W2QA 2XS0A 3ZM4A 5EHLA 4YSMA 3PXZA 4XV3A 5AV3A 4QMUA 2AYPA 4FKLA 5DHJA 3WILA 3OROA 4F7LA 4FX3A 4M84A 5D10A 3DBQA 2ITWA 4XG4A 1CSNA 5EQEA 4ACHA 3FMEA 5BUIA 2H6DA 2I0HA 3CD8A 3KXNA 4EK3A 1KWPA 2X6DA 3RKBA 5FRIA 3PJ3A 2C1BA 4RIXB 1Q8YA 4BC6A 3QYWA 3OOGA 4C3FA 3KULA 3KMMA 2V22A 3LIJA 2QOKA 3I79A 4TYHA 4DHFA 3DBCA 2JBOA 5IPJA 1SVHA 4BWXA 5CU2A 1KE7A 4O0UA 4WOVA 3TN8A 5M4IA 2UZVA 4OTGA 4KABA 2X81A 3C50A 3A4OX 3LM5A 2GNJA 4R5YA 4EH8A 4G5PA 2VTOA 3C5UA 2BIKB 4D2WA 4E4XA 4EHZA 5H8GA 4DH5A 3ZXZA 4JOAA 1PXKA 2LGCA 3ORIA 2PVMA 3Q4UA 3QTWA 3QA0A 4V0GB 3VS5A 4AW5A 1R0PA 2WNTA 3QTIA 4EH4A 1A48A 3MPTA 2VGOA 4Y5QA 2WMTA 1U46A 4KBCA 3MBLA 4GFMA 4IQ6A 2CDZA 4PMTA 5M4CA 5C8KA 5C1QB 3LLAA 4ZXTA 4FTRA 4I0RA 1Q5KA 4F63A 4JDHA 1OIUA 3R9OA 4CV9A 3Q6WA 3E3BX 4ZAUA 2FVDA 2GFSA 4UMQA 4I0TA 4AW2A 5LMKA 3A7IA 1H01A 4WA9A 2HXLA 2PMNX 4FTLA 4FG9A 4IMYA 4OTRA 4DH1A 3QBNA 3QD4A 5LJJA 1EH4A 4M8TA 2WKMA 3R8UA 5DRDA 4ZLYA 3F5GA 4IB5A 4II5A 4R3RA 3TDWA 4I20A 2GTMA 4FGRA 3KRWA 2W1DA 3BYMA 3SKCA 1MRYA 1CDKA 4D2VA 2F2UA 4HW7A 3QZIA 2VGPA 3TZ8A 3V5PA 5JKGA 3EQBA 3C5IA 3QUDA 5ANDA 1SM2A 1JQHA 2GNHA 3TUCA 1Q8TA 2CN8A 4M0ZA 2PMIA 3GB2A 3QX4A 3DXQA 3ODZX 5A14A 2O8YA 3PSCA 3VIDA 3QXPA 4ZP5A 5HCXA 1UU3A 2ITPA 2NRYA 5CU0A 5L2IA 2E9NA 1Y91A 3OFMA 4W8DA 3SG9A 1BL7A 1ZY4A 4DLJA 4IVDA 2C69A 5AUZA 2BPMA 4U3YA 2OO8X 5E8WA 5E7RA 3FMDA 4DH8A 2G2HA 4TYJA 1X8BA 4JBOA 3RVGA 2EXEA 3NDMA 3OCGA 4QMMA 4WRSA 1R3CA 2PVYA 3NYVA 4HCTA 4LL0A 4ZTLA 4E4NA 5GJFA 3THBA 4R7IA 5FTQA 4EYJA 5HBJA 3LCSA 5HVKA 1J7LA 3EMGA 4K2RA 5IUIA 4E5WA 1KE5A 3FSKA 4NH1A 2B54A 5I3OA 3I81A 2FO0A 4FKUA 1Y8GA 4DFNA 3Q5IA 5H9BA 1Z5MA 1H27A 2ZM4A 5GZ8A 4M0YA 4YNOA 3O8PA 4UN0C 5F1ZA 1QPCA 2Y4PA 2HYYA 4MXAA 4ZSJA 5ICPA 1TQMA 2GDOA 4FVRA 4DGNA 2JDRA 4M3QA 3DQXA 4NJDA 3MH2A 4Z55A 4MXZA 2GU8A 2OZAB 2QU6A 1PMUA 4DEGA 4RJ8A 3R1QA 2PMLX 3NZ0A 1IA9A 2J5EA 3GENA 4HVDA 4FOBA 4AW0A 5BVFA 3UNKA 4BI0A 5AP1A 4B6LA 2VUWA 2C5NA 1J1BA 3F3ZA 2J2IB 4JJRA 2QNJA 3QGWA 5FBNC 3PLAE 4CFNA 2WIHA 4YURA 4DC2A 1ZOGA 3I0OA 4M12A 1PMVA 4XX9A 4BDCA 3VW6A 3QFVA 4QT1A 5L6WL 2CN5A 4AN2A 3B2TA 3EYHA 4F0GA 4IAAA 1XH7A 3HAVA 4BCGA 2YM6A 1ZZLA 3TNIA 1FQ1B 2I0EA 3FJQE 4NZWB 5B2KA 2BZHB 2XZSA 4YJSA 3KKVA 5D7AA 5EI6A 4OTFA 3UODA 4C38A 2PPQA 4ASZA 1JSTA 1VZOA 3QLGA 4G6OA 4JAJA 2C3LA 3A7HA 3LFDA 3ET7A 3ZO2A 2IJMA 4C57A 4RJ4A 5HU9A 4DTAA 2VTQA 3ZSHA 2VTRA 3D83A 1CKIA 3D7TA 5CZHA 3OWJA 4MYGA 3VF9A 4CRSA 3F69A 3WF8A 3R8MA 4F70A 4CT2A 1BMKA 3PVUA 1LEZA 2YIYA 2XKEA 4FK3A 3I4BA 4FT9A 4M68A 4O0WA 4C4JA 4EL9A 4C4IA 4EOOA 3TM0A 4WUAA 5D1JA 4Y8DA 2VTAA 1H07A 2WOUA 3G51A 4XRJA 2OWBA 4OT6A 5CAVA 5EW9A 4ZTMA 1QPEA 4EOMA 3FHIA 4WG4A 2CNQA 1YWRA 1E1VA 2QVSE 4NM3A 5HG8A 5AX3A 5BX0A 3IOPA 2VO7A 2C3IB 4YUQA 3FL5A 4QYYA 2UZOA 3NR9A 4BIDA 3HUCA 5HE1A 4PL5A 3ZRMA 2BZKB 4A9TA 2SRCA 3SRVA 5D11A 3VAPA 3M11A 5CEPA 3DJ5A 2PZRA 4YZMA 4B7TA 5AM7A 2XJ0A 4G9CA 2WQNA 4G2FA 4EEVA 4FMQA 4IFGA 3SOCA 3ZRLA 4EOLA 3TUBA 3R2BA 4RX5A 2PVFA 4FG7A 2EXMA 3O17A 4DH3A 4F6WA 2YJSA 2VWUA 4J1RA 4Q5EA 2Z60A 3V6SA 3DT1A 2XNPA 2Z7SA 1OZ1A 3GC9A 3CP9A 2BDFA 4UB7A 3P7BA 4DGMA 2XIZA 4FODA 4YLJA 2HW7A 4U42A 4YHFA 3AMAA 3ENHA 4GS6A 3QQHA 4IB1A 3GU7A 3KFAA 4ASXA 3PG3A 1A9UA 4GK2A 3OT3A 5EOBA 3ZC6A 4EOJA 2XCKA 4ZJJA 5DA3A 4BF2A 4AX8A 5IEYA 4RFMA 3W1FA 4UYNA 4WD5A 5DT0A 1NA7A 4FYNA 3UVQA 4I5MA 2QO2A 4HVSA 1DAWA 3DB6A 4G34A 3WZJA 4NW5A 3ZO3A 4RPVA 4EH5A 5BVOA 5FP5A 3U6JA 3SQQA 5AAGA 2PY3A 3ZLSA 4KS7A 3Q9WA 4MHAA 2OJGA 3EN4A 3K3JA 3BLQA 3CQUA 3NW7A 1FBNA 3RWPA 3ORLA 4X2NA 3D5WA 4N6ZA 4YHJA 3Q9XA 4W4VA 4YZDA 4YZNA 3AGMA 3NAXA 1ERKA 1GJOA 3MTLA 5AMNA 3PG1A 4BFMA 4XG3A 5C03A 5K4IA 1JLUE 2XNMA 2WQBA 4GFOA 5A54A 1WBTA 3H0YA 3PZHA 1QPDA 3FYJX 4KKEA 2A2AA 3QUPA 4IAIA 4ANQA 1TKIA 2UZBA 4LOQA 4CFMA 2C5XA 4NIFA 3RNYA 3FQEA 5EQPA 4BIBA 2OK1A 3RHXA 1YI6A 2R7IA 4LUDA 2P55A 1WBNA 3B8RA 4AZFA 3ZBXA 5AP5A 4M67A 4C61A 2BZIB 3QCSA 2R9SA 3VJOA 3KF4A 4AA0A 3NYXA 4ZY4A 3QRKA 5DEYA 3H4JA 5TO8A 5JK3A 2ONLC 3KCFA 4H39A 3PA3A 4FBXA 4FV8A 3BHVA 3FY2A 5FQDC 3AOXA 3IW6A 1RE8A 3PXRA 4FZ7A 2PZIA 1YHWA 2WMRA 5CSWA 3M1SA 5LMBA 3F7ZA 1SVEA 2JFLA 5C4KA 4FV7A 5EHYA 4GKIA 3OWPA 3TL8A 4G1WA 5BYLA 3D2KA 3WZUA 3OUKA 3COIA 4QP2A 3CC6A 4FZAB 5IEVA 2UZWE 2EXCX 4P5QA 2RIOA 5EOLA 4ASEA 2QKRA 4OTDA 4RC2A 1H1WA 3GGFA 4ZTRA 5AR8A 2C1AA 2HZIA 2R3HA 3IK3A 2W17A 4BZDA 4PF4A 2R2PA 5M55A 2QOLA 2XNOA 4L3PA 5A4LA 5BQ0A 3F2NA 2R4BA 1OBDA 5CVHA 1JKKA 4E93A 2OLCA 2CMWA 2YLFA 2BDJA 5DI1A 4FEUA 3EFJA 3O51A 3P0MA 3LFFA 1BI7A 5EK7A 3ZUTA 3PE2A 4FTJA 4X2KA 5K3YA 3DCVA 1JKLA 2WHBA 2R0UA 4A4LA 3FZPA 4JQEA 1GIIA 3G2FA 4YPSA 1OUYA 4AZWA 4OTWA 4YC6A 4BY9E 2JLDA 3HX4A 5EM8A 5HKMA 4AT4A 3P86A 3AMYA 4YTCA 2UZLA 5LCJA 4U6RA 5ANKA 4GKHA 3PPJA 4MH7A 2HZ4A 4OR5A 2C6KA 4H58A 4HPTE 4UZDA 4O7LA 4BZOA 5F4NA 3AT2A 2YISA 5JN2A 2J9MA 5E90A 4F7NA 3L9MA 5TOZA 3D15A 3UPZA 1Q8UA 1P2AA 5KMJA 5HG7A 2RFNA 4WSQA 4N4SA 4Y5HA 4IACA 2WU7A 3EB0A 3T9TA 3GP0A 3C4FA 2GS2A 3EWHA 4I1ZA 4AQCA 1BLXA 1CKJA 3REPA 2J0JA 3OHTA 4F9AA 5AP4A 4EBWA 3Q9ZA 1SMHA 3F5UA 4P5ZA 4RQKA 4X0MA 3Q2MA 2WMWA 4QOXA 1BKXA 5DGZA 3Q2JA 1K2PA 3PVBA 3QGYA 5EW8A 4S32A 4USDA 3TKUA 4HGEA 4PTGA 4S2ZA 2UW3A 5HO6A 4KIPA 2JKMA 5I9VA 4CZUA 4KINA 2VTTA 5FG8A 3ZO1A 1LP4A 2JC6A 3CPBA 3K5VA 4AW1A 4RGJA 2HY0A 4RIXA 5BYYA 3G90X 3WIKA 5CEIA 4BTMA 3GBZA 4IJ9A 4KKHA 4QP9A 3SVVA 3BZ3A 4QP7A 2XP2A 4K18A 3JYAA 5KUPA 1U4DA 4PMPA 3BE9A 4S34A 3QTRA 4GRBA 4U81A 4DFZE 2C5VA 3OVVA 5FDPA 2J0LA 3PPZA 2QO7A 4G31A 5EDPA 4CVAA 2J5FA 4O2ZA 4NSTA 3MI9A 2VO6A 3GC0A 4A4XA 2UW8A 3AD4A 2OICA 1JWHA 5EG3A 3W2CA 2QO9A 4V0GA 4NKAA 4C0TA 2GS6A 4RG0A 4D2TA 2ZOQA 4MTAA 1UKHA 4ACDA 4QMPA 4CYIA 1V0BA 5DWRA 3GT8A 3FKOA 2W99B 4FL3A 3TV6A 4IBMA 4BZNA 5K0KA 3TNWA 4IB0A 4CMUA 5FLFA 5AA8A 3S4QA 5KNJA 5E9EA 3VW8A 3E8CA 4CG8A 2XMYA 2WTVA 3A8XA 4NW6A 4DFBA 5BVWA 5FUTA 2I40A 3KCKA 3A4PA 4K77A 1SZMA 5EKOA 1NY3A 3ZU7A 2VWIA 2YCQA 4MEDA 4EC9A 4IWDA 2CKPA 2VNWA 1ZWSA 4J99A 2XEZA 3PRFA 3HMIA 3RBWA 4FKJA 5IUHA 5IU2A 2EVAA 3ORPA 4J8NA 4BGGA 5DN3A 4EBVA 4TTHB 4CFFA 3MGYA 4I93A 4L44A 4X3JA 2YM4A 3GFWA 4RJ7A 4K0YA 1XWSA 4M13A 4YZ9A 3SD0A 4L3JA 4BTKA 4C3RA 4AOIA 3V5JA 4QMNA 1KSWA 1Z9XA 3AC1A 1OKZA 3TACA 1VJYA 1OIYA 3QQUA 3UPXA 4YZCA 3ATSA 2PULA 4PTCA 2FSTX 4QMVA 1H28A 2PU8A 2IVTA 2YDIA 4MNEB 4F9BA 3IW8A 3E88A 3CIKA 2GFCA 3SW4A 4ACCA 1O6YA 4P2KA 1M17A 2EU9A 3IGOA 3FPMA 4AS0A 5JT2A 3JY9A 4EH7A 4FV4A 5IDPA 4MX9A 4R78A 3LCKA 5J9ZA 4AGDA 3M2WA 5HO8A 4JR7A 3V5QA 3VN9A 2OZOA
chains in the Genus database with same CATH superfamily
3PZEA 4IWOA 4KSQA 5M07A 3ZSIA 3R7OA 4O83A 3RWQA 4DN5A 4FE2A 3UYTA 2OU7A 3MY0A 3QC9A 4RX8A 3V6RA 3GC8A 4ZSLA 4GW8A 3HDNA 2XK9A 4RVMA 3LXLA 2WTCA 4IM0A 4FVPA 4F4PA 2WTKC 4FSWA 2B1PA 2QKWB 1ZYDA 4IJPA 3R04A 3TKHA 3ZLWA 3E5AA 3R22A 4USEA 5BVEA 5HO7A 4RRVA 1KOBA 4XBUA 3ZO4A 4O0VA 4WG3A 2I0YA 2PHKA 4B99A 3HV5A 3FE3A 3IW7A 4O7VA 2HXQA 4M66A 2ITOA 2OZAA 1JSUA 3ROCA 2C6IA 3JVSA 5TKDA 4QMSA 5CEOA 5L4QA 5HOAA 3E62A 4ANBA 5HE2A 4I6BA 5C9CA 4BDEA 4PPBA 2P4IA 4FSZA 3MIAA 4RSSA 5FXRA 4FIIA 4LM5A 4LUEA 4K8AA 5HU3A 3F3TA 5E8UA 2RG5A 2VX3A 3OBGA 4D4SA 4HGSA 4OGRA 4FUYA 5CEQA 3F3UA 4DGOA 4ZSAA 4BGHA 3R7GA 3S00A 4NYEA 3MFTA 4CD0A 3RAIA 2UVXA 3JY0A 4ALUA 4AE9A 4ASDA 3HKOA 2H34A 3MJ1A 4U44A 3U4WA 2XARA 3AKJA 4O7YA 4TKSA 5I0BA 1UU8A 2BRNA 3AD6A 3DU8A 2X8DA 4X3FC 3Q04A 5AAFA 3MYGA 2YHVA 2B9HA 4Y83A 2IVSA 3LCOA 5AR5A 3IDPA 3A2CA 3F5XA 5AP0A 5HORA 4IM3A 1Y6AA 3BX5A 2WTKB 5G1XA 3EFLA 2CCIA 4XG8A 4AZEA 2CKQA 4XH6A 5FD2A 2OJ9A 1H8FA 4FTCA 4ANSA 4B8LA 4BHZA 1FMOE 5KMMA 2IZSA 4APPA 4CMTA 2GQRA 2V0DA 3DS6A 4AACA 5L2TA 3PY3A 4AT3A 3FQSA 5AV1A 3JR1A 3U55A 3EIDA 4MCVA 3VS1A 2IPXA 3BHYA 2DQ7X 4LRKA 3G9NA 2GCDA 4RC4A 3C1XA 4IZ5A 3LFEA 3U6IA 3BL7A 4DHIB 3PUFC 3IOKA 4LV8A 3PJCA 3TUDA 4B8MA 5KMKA 4AQKA 2PZYA 2A19B 3PWYA 4DEDA 3PVWA 4CRLA 2R5TA 3R7UA 3UZRA 5IQDA 1OECA 3VNTA 4O7TA 4L01A 1PKDA 4LG4A 4O22A 5TT7A 1FGKA 4DLIA 1W8CA 4EH2A 4E6QA 3ALNA 5E8VA 3RI1A 4O84A 4ZS4A 2YN8A 4N0SA 5J7BA 4A4OA 3BELA 1JBPE 4DF3A 4O7RA 5DEWA 4IWQA 5CAOA 3PIXA 3UNZA 4QTBA 4JBQA 3EZVA 4X3FB 3QCXA 3MA3A 3P7AA 3IDBA 4ZS0A 2ETMA 2VTSA 2UW0A 3CBLA 3EN5A 3G33A 1YDRE 3KMUA 3LAUA 4XG9A 3BHHA 3PA4A 2JAVA 1H1PA 1M52A 3RM6A 3AC2A 3Q4TA 1OITA 4R6VA 5JZNA 4BTFA 4CNHA 3R8ZA 3NMUF 1M7NA 1ZRZA 2XK4A 3UYSA 3FMNA 1YXXA 3CJFA 1PF8A 5A3XA 2XNBA 3BEAA 1BI8A 4DFYA 2Q83A 3VQHA 3VULA 4QYFA 3DNDA 4TYGA 4IWPA 2IW8A 1FVRA 3F3WA 3NUXA 3EN6A 3R8VA 1O6KA 3H9OA 4OTQA 5CI6A 4C2WA 5IQBA 2WMAA 3PRIA 4PDOA 4E8AA 5JGDA 1UNGA 1GZ8A 2C6OA 2UZUE 3W8QA 3R7VA 2QURA 4EKLA 1PKGA 2F7XE 3UVRA 2YM8A 5AV4A 5BUEA 4XRLA 5AR4A 2REIA 4DG0E 3KQ7A 3R73A 4MBLA 4XP2A 3DA6A 1H0WA 1ZMWA 3BPRA 3UIUA 4FKRA 3FQHA 1Q41A 4V04A 5AM6A 5L8KA 4TL0A 4HCUA 1XBCA 3RCDA 4XHKB 4AA5A 5M4UA 3LQ8A 2JFMA 3T3VA 3CD3A 3QALE 4MAOA 5DRBA 5K0XA 3TG1A 1YVJA 3DY7A 4WBOA 3TZ7A 1Y57A 4PDPA 4FT5A 4UALA 3WF6A 5CT7A 3EQDA 3UNJA 4ZTQA 3DV3A 1UKIA 4JG6A 3OUNB 3O2MA 1YDTE 2VWZA 2Z7LA 3NAYA 5I9WA 1H1QA 4S31A 4RFYA 5IH4A 4XS2A 5HE3A 2O65A 3BYVA 2B4SB 4FV2A 4F78A 1GNGA 3UGCA 4IIRA 3DDPA 4PTEA 2IW6A 2JITA 4IH8A 2PYWA 2ACXA 3ERKA 4M69B 5A46A 3V04A 2C6MA 4DCAA 3NVKI 1LPUA 5L8LA 5L2SA 2XBAA 2YIXA 4TWOA 1WBPA 4LOPA 5F95A 5CQWA 2G2FA 3PJ2A 2AC3A 1OMWA 4E5BA 1R0EA 5KO1A 4I5HA 4J96A 4DG2E 4AG8A 4U79A 4FK6A 3NIEA 3KVWA 1XHAA 2BRGA 4TYIA 5F94A 2JGZA 4MVFA 2WMXA 5DPVA 4G17A 4BN1A 5AR3A 5AUXA 4CCUA 2IG7A 4YHTA 3UJGA 4BCFA 4NM5A 1SNXA 4PMSA 5AR7A 3EN9A 5LVMA 2BIYA 3TJDA 2HY81 2W1FA 5A6OA 3PVGA 1H0VA 2JDOA 4BWPA 4D2RA 3WF7A 4FTKA 4BDKA 5L6OA 4EC8A 2ETKA 5AJQA 5IDNA 3EKKA 3PXFA 2C5OA 4OBQA 2HK5A 5E8SA 2DS1A 5EM6A 3R7YA 3R9DA 3SX9A 1V0OA 1ZLTA 2Q0BA 1YQJA 2J50A 2O2UA 3GU6A 3OMVA 1M2QA 3NEWA 3MFUA 4XEYA 5J5SA 1PHKA 2O64A 3QD2B 4GEOA 3QTSA 4PL4A 3JPVA 3O0GA 1MRVA 1W84A 4QQJA 3IKAA 3LCTA 2EB3A 5C27A 4AXCA 3BU5A 3QTXA 4IAKA 2WTDA 3PDTA 3POOA 5IKWA 2JDVA 3LHJA 4BCNA 2WMUA 4OBOA 3SV0A 2ONLA 1UNHA 3BGQA 4FVQA 2YWPA 2BTRA 3TV7A 3WIGA 4FC0A 4R3CA 3VF8A 4A9SA 4ORKA 4JDKA 4BKZA 3O5AA 4TNBA 3WF5A 3FKLA 3BGPA 4P4CA 2OJIA 3FLWA 3NIZA 3KC3A 4EK8A 3DTWA 3OW3A 5IA3A 2Z02A 4YNEA 5BVDA 5LWMA 5BUJA 5CSPA 3P7CA 1B6CB 2G2IA 2YJRA 3F5PA 3BLHA 1XBAA 2QI8A 3ORXA 1FGIA 4KSPA 4KWPA 5BPYA 4FNXA 3Q5ZA 4O86A 3DAKA 4AGUA 4C4EA 5FGKA 3T8OA 4OAUC 3AMBA 4MBIA 4DG3E 4Y85A 3Q53A 1VEBA 4PMMA 4QTCA 5HCZA 3NUSA 2B52A 3B8QA 3R01A 4E4LA 5M09A 4UWBA 2JD5A 3QAME 4O27B 3SXFA 4RWJA 2O5KA 3LFSA 2WOTA 5EH0A 4BDIA 4F09A 1NVSA 4ZMFA 4YTHA 4CXAA 5IQEA 3ROYA 4J8MA 3LXNA 3N4TA 2R7BA 4YJUA 3CTQA 4XOYA 4HZRA 4H05A 4K9YA 3JUHA 5ANGA 4HOKA 4CKIA 3R2YA 4D5KA 2PVKA 3LMGA 3ORMA 1OL7A 2UVYA 2OG8A 3EHAA 5DT3A 2XKFA 3OC1A 3V01A 3LQ3A 5KZIA 2VN9A 1JSVA 4QNAA 3WF9A 2FGIA 2R3LA 3R9HA 4CTBA 1YOLA 5JFVA 4O21A 4RVTA 3UG1A 1ZMUA 3MS9A 5FM3A 4I23A 3SA0A 2W1CA 2OBJA 5ETCA 3E92A 1W0XC 2F57A 2WGJA 1G8SA 1V1KA 2PVJA 3GCQA 4KRDA 3UDTA 5CEKA 1XJDA 1LEWA 4FTIA 3R8LA 3CS9A 1RDQE 5IH5A 3A7GA 2VD5A 4D4RA 5EHOA 2WMBA 2LAVA 2XNEA 1IR3A 2WTJA 2H8HA 3T3UA 3ZS5A 2UZDA 1FOTA 4NU1A 4PP7A 5DR6A 3UG2A 2VO0A 3QZGA 4IM2A 5E8TA 4S33A 4GUEA 4U43A 2WMVA 1H24A 4E1ZA 5LVLA 4BKYA 3D14A 4DFUA 1CM8A 2C5YA 2XM8A 2GQSA 1JKSA 4FYOA 5CNOA 1PMNA 2GMXA 4XYFA 4RIYB 2JKKA 4XG2A 1Q99A 3ZC5A 3LMHA 3FDNA 4QYEA 1P4OA 5E1EA 2BALA 2PVRA 4NT4A 4O81A 3R21A 4FZ6A 2X0PA 3BE2A 2UV2A 2QOFA 3AT3A 2XJ2A 3NS9A 4IFCA 1E9HA 3W0RA 4IHPA 3SXRA 4YJRA 3A7FA 5DE2A 2BZJA 3NRMA 4MBJA 5D41A 5TF9A 3LKMA 4MNEA 3LW0A 3DK6A 2V5QA 3QZFA 3OEZA 4FKPA 4QP4A 3V8SA 5JQ5A 2C6LA 2XUUA 4FZFB 5A6NA 3CXWA 3IS5A 3OD6X 2XJ1A 3C4ZA 4BCHA 4DITA 4KAOA 2Y4IC 2X9EA 2ZVAA 2CLQA 3L8VA 1JPAA 2R3NA 4CEGA 1QCFA 2YAKA 4RIOA 5JZJA 3VBTA 4IX6A 1H1RA 4I21A 4EQCA 3F2AA 4CQEA 2BAKA 1OPKA 2W1EA 3FLYA 2CCHA 3TZMA 4D9TA 3C4EA 4NWMA 4AN9A 4C33A 5KBRA 3ZLXA 3ORKA 3EQFA 3D2IA 1KV1A 3GC7A 3H30A 3NGAA 4FV3A 3PTGA 4JDJA 4FI1A 4QMYA 5KZ0A 2VX0A 3HV6A 4QP3A 4TWCA 2F7ZE 1DAYA 4D1ZA 5HE0A 4F99A 5DNRA 4IB3A 5AP3A 5DYJA 4WSYA 4Q9ZA 3TZ9A 3WYYA 5KMIA 2YA9A 4IC8A 4BCOA 1GIHA 2C0TA 2WAJA 4DTBA 3GUBA 1AGWA 4MUQA 3IONA 3JXWA 1M2PA 1UWJA 1CMKE 5F20A 2W1ZA 4HYIA 4O1OA 3VHKA 2YCFA 2W1HA 4FV9A 4YLKA 4FSTA 4L3LA 4APCA 4QTEA 2C6TA 3RJCA 4BDBA 4O0YA 5JH6A 2XYUA 3BU6A 4O91A 4RIWB 4YJNA 4QMLA 1I09A 4E4MA 4LDTA 1P14A 4UWYA 4PDSA 2VTNA 3ZHPC 2Y8OA 2R3FA 3VONA 5M08A 3L9NA 2F7EE 3DBFA 3CSVA 5AR2A 3RALA 4NJ3A 4AA4A 4IVAA 2ZV8A 4N6YA 3LXKA 5ACKA 3DQWA 5E92A 4GG7A 4WO5A 5HG9A 5EI8A 2QLQA 3BV2A 2VZ6A 2Y4IB 2XKCA 4NFNA 3DLZA 2FYSA 4I5CA 1JNKA 2UW5A 2X39A 4U97A 4TRLA 4CKJA 5J8IA 1ZYLA 4BHNA 4Z7HA 4L7FA 2BHHA 2XB7A 2X1NA 3QQFA 5AUYA 2AUHA 3QLFA 4V01A 1URWA 3R6XA 5I5ZA 3GVUA 2W5HA 2IWIA 3AGLA 2OIQA 3QC4A 3DTCA 1J3HA 1DM2A 1GZKA 1PYXA 2YLEA 4UEUA 5FWKK 3PY1A 3WBLA 4EJ7A 3WE4A 4EUUA 2W96B 3DKFA 1AQ1A 4RJ5A 5AIRA 3RAWA 3V8TA 4ZLOA 4G3CA 3UQGA 3C51A 3EQIA 1QPJA 5FEQA 3FLSA 3FI8A 4HGLA 3SXSA 1FVVA 5HHWA 4J97A 2BAJA 4IVCA 3HDMA 5CWZA 3W2SA 4CFXA 1JOWB 4XJ0A 3OWLA 5HNIX 4JMQA 3HV4A 4TNDA 4AT5A 4W4WA 1PXOA 2GNIA 4XG6A 3E87A 3UE4A 1KE9A 3H10A 2C0IA 3NUNA 2DYLA 3KMWA 5E1SA 3HP2A 4R8QA 4E73A 3RK9A 1OI9A 2PUUA 2OJFE 4EJNA 3IQ7A 2C30A 5JGBA 4DGGA 4IX5A 4YJOA 3BV3A 4Y95A 3UO6A 3DLSA 3EYGA 4PNKA 3EOCA 4MXCA 3PWDA 2ZM3A 4O38A 3EFWA 4G3DA 4O2PA 1YXSA 2ZAZA 4RMZA 4RWKA 1OVEA 2BRBA 3P79A 4TT7A 4IW0A 5E8ZA 4CGAA 2PVNA 2B0QA 2ESMA 4AGCA 5CF6A 4PX6A 3NW5A 1J7UA 5FTOA 4CZTA 3FLNC 3CE3A 1MP8A 2RL5A 2FUMA 5ANJA 4MQ1A 4X3FA 4OTPA 4AXEA 3F66A 3UMWA 4CSVA 2QOHA 4L42A 2XRUA 1CTPE 2FA2A 3N4VA 1YW2A 4I92A 2DUVA 5HTBA 5KKRC 1YHSA 4A9UA 2HELA 1H25A 1U5QA 1IRKA 2RGPA 3VBYA 3FZRA 4OTHA 4EHGA 5KMOA 1ZMVA 3QQLA 4I41A 4AXAA 4FKOA 3BBTB 4NM0A 3A61A 3EQGA 2PK9A 3F9NA 4WIHA 5HZNA 3CKWA 5CENA 1KUTA 1HCKA 3PXYA 4QPAA 5HI2A 4W4YA 3CGFA 4O6EA 3MVHA 1OKVA 4FKTA 1F3MC 1OGUA 4H3QA 3QRIA 4LRJA 1IEPA 3G0EA 3F88A 3H9RA 5CSHA 3VS3A 3ZYAA 5KCVA 4JRVA 3DZQA 3V3VA 2X9FA 3FMMA 3NX8A 1ZXEA 4EWHA 4RX9A 2CNUA 1OPJA 4LGHA 2PVHA 2QODA 2WB8A 3QCYA 4FR4A 3DFCB 4OUCA 4ERKA 3UQCA 3CY3A 1ZOHA 4G3GA 5IQCA 1KOAA 4F64A 4BI2A 3UOKA 5I9YA 2F2CB 4O6LA 3UP2A 2I7QA 1ND4A 1A06A 4FEQA 1AD5A 3ZZEA 4UXQA 1M14A 4MK0A 3LZBA 1KV2A 2DWBA 3BYSA 4KIQA 1W83A 4R5SA 1HOWA 3CEKA 5CYIA 3S95A 2C4GA 5HESA 5GIOE 3I5ZA 4KBAA 5CNNA 3MY1A 5KKRB 4XV1A 5M56A 4O82A 2BUJA 3HEGA 4KIKB 4RFZA 4YSJA 3H0ZA 4GK4A 3ZZWA 3DKOA 1PMEA 2HW6A 1H26A 2CJMA 4GSBA 4PV0A 4LL5A 3DBDA 4S30A 4D4YA 3LE6A 1S9JA 4MKCA 5CXZA 4FEXA 4DEHA 1B38A 4I0SA 3KRXA 2BRMA 3UC4A 5HIEA 4U5JA 1MQ4A 3MWUA 4M69A 3U9NA 4AFJA 3N51A 3OT8A 4CLIA 3S0OA 3D5XA 2WFYA 4W9XA 3KEXA 4DINA 1FMKA 2J0IA 2VWBA 2ZYBA 4F0FA 3RK5A 3R1YA 2WMQA 3NUUA 5D12A 3U8WA 5K4JA 4FIFA 5CF5A 2ETRA 2ZB0A 3QRTA 2Z7QA 4OAVB 3QL8A 4HNFA 2PUIA 3MIYA 2VWXA 4LRMA 3AC3A 3BHUA 1W98A 2QG5A 4GU6A 3NNUA 4QTDA 3Q52A 4JG8A 4F7JA 2YCSA 2QHMA 4O4BB 1NXKA 2BCJA 3N9XA 5CSVA 3AD5A 3O8TA 2QLUA 2W9FB 4E6CA 5B2MA 4MXYA 3MESA 1ZYCA 2G9XA 4GH2A 2XIXA 5M44A 5HG5A 1WBOA 4DHZA 1J1CA 3V5WA 3HMNA 5DR2A 4ALVA 2AC5A 2BVAA 2HAKA 3R0TA 1TQPA 1YOMA 3R7IA 3TKIA 2XYNA 3U9CA 3W0OA 2ZV7A 4O0TA 1Y8YA 4DDGA 3WYXA 4F08A 5K5XA 2JKOA 5EM5A 2RFSA 2BHEA 3FUPA 4Q2AA 5EDQA 2PE2A 3EJ1A 3VBXA 4CFVA 1HCLA 4EWQA 3RK7A 4X21A 3KGAA 3QTUA 1VR2A 4FIJA 4DAWA 1VYZA 3CTJA 1APME 4FV6A 4L8MA 3M42A 2A27A 3KXMA 4YBKA 5CZIA 5EYMA 5GJGA 4PP9A 4BCPA 3W2RA 3PFYA 4HJOA 1WBVA 1H1SA 3TIYA 2PSQA 1WCCA 3HUBA 1OL5A 4G5JA 4UXLA 4Y73A 2WEVA 2NP8A 2YWVA 3LXPA 5L3AA 3FBVA 3KIOC 2BAQA 1VLRA 3K54A 5CX9A 2RKUA 3Q4CA 2ZM1A 5CEMA 2E9UA 1PYEA 4H3BA 2E2BA 4IDTA 4Y72A 4UYAA 5AIKA 4FA2A 5C4LA 3ODYX 3BLRA 4LMUA 2JKQA 5EYKA 4XP3A 4JQ8A 5GNKA 2B9JA 3F3VA 3ATTA 4DE4A 2IVVA 5K9IA 3EN7A 3GI3A 1ZYJA 5IA1A 3JVRA 3ELJA 3POZA 4HNIA 4YC3A 3RPRA 5IG1A 2OW3A 4W9WA 3ETAA 4DFLA 2ZMDA 1DI8A 3VO3A 2P0CA 4RWIA 2VV9A 4ZK5A 4HCVA 3P08A 4KS8A 3WE8A 2XNGA 4USFA 3PP0A 5CVGA 3K2LA 5JRQA 2OF2A 2W05A 3FLZA 5BV3A 3KF7A 4J71A 3VJNA 2VWVA 4LQMA 2YIQA 3LPBA 4GCJA 2HENA 4NCTC 4TW9A 2QHNA 3U87A 4EOPA 1OKYA 2GHGA 3E7VA 4I6QA 3KREA 5E4HA 2KULA 4UBAA 4G6LA 5L8JA 2IZRA 5LXMA 2CKOA 4KIOA 3RAKA 1YRPA 1R1WA 5CALA 3SHEA 1P5EA 3KVXA 4RZVA 2OH0E 2ZV2A 4H1JA 5ANOA 4FSNA 2B9FA 2Y6MA 3QTQA 2VTLA 4U40A 5C8MA 1IAJA 1YWVA 5CQUA 4UWCA 2BKKA 1XH6A 1MUOA 2CGVA 3ZOSA 4BRXA 5J9LA 4O0RA 2OIBA 4FUXA 1GIJA 3HLLA 2Y9QA 4GIHA 3W33A 4QRCA 4WNOA 2O0UA 4YJVA 4CMOA 2XNNA 2P33A 3FMJA 1F5QA 4FTAA 2QG7A 4AWIA 4JBVA 2IF8A 5CANA 4HGTA 3UZTA 3RP9A 5HD7A 4RIYA 3Q9YA 1QL6A 4FT7A 3DNEA 3OWKA 2Z8CA 4YGAA 4RZWA 4D5HA 3QHWA 1UU7A 4D0WA 3PLSA 4KNBA 3DXPA 3O71A 5HLWA 3TIZA 3OTVA 3V51A 4X2GA 3VQUA 4XP0A 2YERA 2UZNA 4I6FA 4EH9A 4ZOGA 2W4JA 4M7IA 2J90A 1P4FA 2UVZA 3R02A 3CLYA 5CVFA 3DK7A 4GYGA 2OGVA 3AXWA 5IEXA 3RPYA 2X6EA 2C68A 4L46A 4JG7A 4DBNA 4X2JA 4FEWA 4R3PA 1PXJA 3Q3BA 4U0IA 4E7WA 3DBEA 3W8LA 2J7TA 3QF9A 4GFGA 3S3IA 1MQBA 1H00A 2BKZA 3BIZA 4D2PA 4FG8A 4GV1A 3WZEA 4D9UA 4YTFA 5IISA 4L45A 1IG1A 2VTJA 4RQVA 4TZRA 3WOWA 3OY1A 1OL6A 4AGWA 3UMXA 2G01A 5IQGA 5DG5A 2KTYA 5I4NA 3D94A 4HVHA 3ZBFA 1OL2A 2W1GA 3EKNA 1OPLA 5AUTA 3LOKA 3E7OA 3PSDA 5LCKA 1OUKA 2CKEA 4XMOA 1LUFA 4G3FA 4NEUA 4QP1A 4N57A 1DI9A 4LFIA 3QKLA 3U6HA 4NL0A 5AFVA 5I3RA 2GS7A 3OXTA 4CFUA 3KRJA 4NTTA 2V62A 3EQHA 3KRRA 3OEFX 5FXSA 3HA6A 3ACKA 2R3QA 4ZTHA 4WT6A 3GOPA 1YI3A 3W10A 3ORTA 4AZSA 5DH3A 5AAEA 3GOKA 2BMCA 3NUPA 4MD8E 4A06A 5HD4A 2XK6A 4GJ3A 3FPQA 2VRXA 3EZRA 4RIWA 3ZCLA 4IZAA 5J9YA 2ZB1A 1OBGA 4TXCA 5HGIA 1R78A 1G8KA 3BGZA 3HRFA 5LVPA 4EHEA 2C47A 4MXXA 4FIEA 3VS4A 5KE0A 3HL7A 3KK8A 1YKRA 4L52A 2B7AA 2W7XA 3E3PA 3QQGA 5IMXA 3G15A 5GINE 1YI4A 2B53A 1Q97A 3NVMB 4BYIA 4J7BA 4BDJA 5KMLA 1YHVA 4RX7A 4K33A 1UVRA 3FY0A 2BROA 4AZVA 2Z2WA 3AG9A 3UO5A 5IQIA 4FKGA 4L9IA 3I0QA 1Q8ZA 1PY5A 4IEBA 5KHXA 3W55A 3ANRA 5CS6A 5A4CA 1V0PA 1OIRA 3QA8A 4PWNA 5GZ9A 4FNWA 2CNVA 3R1NA 1Q61A 4O7NA 3RTPA 4G16A 5M53A 1IA8A 3LQ5A 5LVNA 2WD1A 4FT0A 5HVJA 5CXHA 2ITZA 5BYZA 4U3ZA 2GNFA 4CTCA 3G0FA 3W32A 2Y0AA 4O96A 3OY3A 5IF1A 1UA2A 3HAMA 2J51A 4LOOA 4A9YA 2QOQA 2VTIA 2IO6A 4G6NA 3U54A 4U8ZA 2PVLA 3GXLA 5ETFA 5FEDA 3VUKA 1OM1A 3LLTA 3C7QA 4DA5A 3R9RA 4FV0A 2JAMA 2VAGA 2R3PA 1JVPP 2RSVA 4Q9SA 4IE9A 4FTTA 3ORZA 2PWLA 3SAYA 2R64A 4O0SA 2NPQA 5JFSA 4I94A 2HZNA 3VUIA 3DAEA 4ZJIA 3L9LA 3A8WA 2RFDA 3E93A 5BVKA 2HWOA 3OG7A 1GAGA 1JKTA 2YAAA 3MSSA 5EW3A 3RINA 3FWQA 5EM7A 2X0QA 3LJ2A 4FV5A 4F6SA 5T68A 3FL4A 4ARKA 4C7TA 3LFAA 5JEBA 3KXXA 3C4XA 4CLJA 5JQ8A 4BCKA 4CG9A 2OI4X 3HV3A 3O23A 4YPDA 5IA5A 3ID6C 2PZPA 3HZTA 5BMSA 3L8XA 4M14A 3UDSA 1WZYA 3VBWA 4DT9A 5M57A 4IX3A 2GPHA 4NTSA 3FXWA 3EQPA 3KXZA 5FDXA 1T46A 4QDEA 4FEVA 4DFXE 3HV7A 4FTQA 3ZLYA 4C4HA 4F1MA 4ZZOA 2XEYA 4IZYA 5HVYA 2ZV9A 2CPKE 4TWNA 3R71A 1KE6A 4XV2A 4C4GA 3QD0A 3KN6A 3OCTA 1OB3A 3FHRA 4PRJA 5H8BA 4D4VA 2YZLA 1IASA 3RAHA 4ENYA 3WZKA 5A4EA 5IA2A 5ANIA 3WZDA 1BUHA 4JNWA 5HBEA 1RJBA 2CHLA 2FB8A 3HMPA 3PJ8A 4JVGA 3NYOA 3MFSA 4EZ7A 4PDYA 3MN3A 1DS5A 3MY5A 1Q8WA 4F6UA 4XG7A 5J7HA 5EKNA 3OXIA 3W2PA 5EQYA 3ANQA 3GCVA 4CKRA 4BDFA 3L8SA 3MA6A 5JMSA 2E9VA 4F9YA 3R63A 2ITNA 1M2RA 2OJJA 3FI3A 3GCUA 3GEQA 4EOQA 5LOHA 1MRUA 4FJVA 4QMQA 4RJ6A 3HMOA 3R00A 4YO4A 3AT4A 5IQAA 2QCSA 3T9IA 1XKKA 3FSFA 3IGGA 5AP6A 3RGFA 4EOKA 4QMTA 4R77A 1ZY5A 3VBQA 3QZHA 5FBOA 4QQTA 2W5BA 3ZH8A 3TJCA 3CJGA 3DOGA 4JX3A 4AOTA 2Y6OA 3P78A 4U80A 3VUHA 4FSMA 2PUPA 1UNLA 1J91A 3E8EA 2WQOA 3O50A 4QYGA 3S1HA 4E5AX 2O63A 4D2SA 2C6EA 3ALOA 4A7CA 3AC4A 4JL9A 4FSUA 4XNEA 5IZFA 4R7BA 4D1XA 2XKDA 3MVLA 3GQIA 3LM0A 5F9EA 4QMXA 3TNPC 3ZMMA 4KIKA 3Q6UA 4LMNA 4JRNA 3P1AA 3EL7A 3QHRA 3BRBA 3SW7A 4AF3A 5IMEA 4DEBA 3QD3A 4QMWA 3VS7A 2B55A 4C8BA 5CF8A 1U54B 2J0MB 2FH9A 2XVDA 4C58A 5GIPE 1H08A 1U5RA 3O8UA 4FNZA 4C02A 3IPHA 4YJTA 1URCA 3Q32A 5AWMA 3ZFXA 4QEBA 3FYKX 4RVKA 3W0NA 3FI2A 5KX8A 3G6HA 1QMZA 1Z57A 5AA9A 3F82A 1GZOA 4BCQA 4F7SA 3HMMA 2JDTA 3KB7A 4ZY6A 3C4CA 1W7HA 4CV8A 2XK7A 3I6WA 1ST4A 4JIAA 4HPUE 2ZMCA 5E8YA 1YDSE 2CSNA 2H9VA 2Q0NA 3C4WA 4E6AA 2WEIA 1NW1A 3FKNA 2QR8A 3O7LD 3KL8A 3LFCA 4HYSA 4KD1A 4C59A 2VTMA 3NCZA 2P3GX 3ENMA 5CSXA 2R3JA 4IAFA 5D9HA 1RQQA 3C0IA 4FICA 3A99A 1KE8A 3A7JA 1WBWA 3PE1A 2IEWA 3V5TA 4CQGA 2W06A 2W4KA 3R1SA 3ZFMA 2GNGA 4EK6A 3II5A 2X2MA 5B2LA 4IC7A 4RLLA 2Y7JA 4TWPA 4Z16A 5CAPA 3PA5A 3PPKA 2QOIA 3QQKA 2YFXA 3UOJA 5CF4A 1G3NA 4OT5A 4U7ZA 3KK9A 4I4EA 3NNXA 3RM7A 3P9JA 2OXYA 4FKVA 4NKSA 2BFYA 2XIKA 1Y6BA 3ZONA 2RG6A 4R1YA 4L43A 4DYMA 5IQFA 4YLLA 1FPUA 3I1AA 4EORA 3KY2A 5CU3A 3TTIA 4BJJB 3BYUA 3QUEA 2IN6A 4ITIA 1WVWA 2ITUA 2X8IA