3LCTA

Crystal structure of the anaplastic lymphoma kinase catalytic domain
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
308
structure length
308
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRAGYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALK tyrosine kinase receptor
publication title Crystal structure of the ALK (anaplastic lymphoma kinase) catalytic domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 102
structure length 308
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lctA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lctA01
4CQGA 1JAMA 4PTEA 2AC5A 2XIXA 5GNKA 2EXCX 3LOKA 4NKAA 3BI6A 4HGEA 3KGAA 3CSVA 1F3MC 5C8NA 3BV2A 3ACKA 5FGKA 4BWKA 4O1PA 3KFAA 4K77A 5B2LA 1E9HA 4C02A 5HE3A 4ZMEA 1JKTA 1PW2A 3SXRA 3U51A 4F99A 3QQLA 4ZLYA 3EQRA 2IO6A 3JVSA 2WB8A 5IMEA 5GJGA 5ACKA 1A06A 3PXQA 3VULA 4BCNA 1XWSA 2YJSA 4AOJA 1XH4A 3C4FA 4IWQA 3PSDA 4FMQA 1PYXA 2WTKC 4X0MA 5E90A 4AZEA 1AQ1A 1YKRA 2VV9A 4GCJA 3ANRA 5DT0A 3G15A 4GEOA 4ZK5A 3RK5A 5I0BA 3FI3A 3PLAE 5JN2A 2XK4A 3OTVA 5CWZA 4M69A 3TIZA 4I0RA 1YWNA 4G6LA 4S34A 5HORA 4TYEA 3TZ8A 1ZAOA 4XMOA 1IA9A 2JFMA 4BIBA 2GNFA 2AUHA 1BI8A 3NNXA 3MH2A 3BX5A 3FKNA 2PZPA 4HGLA 2BRBA 3IOKA 3KVXA 4P5ZA 1WBTA 4QP3A 2CNVA 3EZVA 3NVKI 5IEVA 2UVYA 3JS2A 2X8IA 5HVKA 4ZZOA 5BYZA 3PXZA 3W55A 2WTKB 5FBOA 3KC3A 3FY0A 4I41A 5HU9A 4AZFA 1CDKA 3BEAA 4E3CA 2C3KA 4F65A 1PXNA 2R7BA 2JDTA 3QCSA 5EHOA 3SW7A 1H01A 3PIYA 4APCA 5CF4A 4IB0A 4UMQA 5AADA 2WU6A 3F3WA 3VS0A 1U54A 2CMWA 3D2IA 2PE2A 5BVKA 4AOIA 4V01A 5ICPA 3D7ZA 4MXYA 4ONAA 3DTCA 4RWIA 2BIKB 1OB3A 2OH4A 1VR2A 3COHA 4RMZA 2ETMA 3PE1A 4XV2A 1W84A 5CSVA 5L2WA 1H00A 2Z02A 5CAQA 5F4NA 2W5HA 2RIOA 2Y6OA 4O91A 4FUYA 5CLPA 3VS4A 1CM8A 1OI9A 2QO9A 3EN9A 4E7WA 3POOA 2X0GA 4XRJA 5HX6A 2VGOA 5IH4A 2V7OA 3TV7A 4O27B 4Z16A 4FKRA 4R1VA 5HQ0A 4S32A 3C9WA 4AN2A 3QCYA 5J9YA 3CTQA 3RK7A 3E7OA 3RBWA 4ZJVA 4MHAA 5ANKA 2VWYA 3ATTA 3DJ7A 3Q6WA 3E93A 1H8FA 1XO2B 4PDSA 2R3FA 4RC2A 4L3LA 5IEXA 4LI5A 2QURA 2YABA 5HOAA 2O2UA 2WQMA 4AT5A 3ZYAA 3VJNA 3TUBA 4U81A 4EYJA 1FPUA 3TDWA 4IM0A 2EB2A 5C01A 4E6QA 1BMKA 5CANA 4PPAA 3JY9A 3F7ZA 2PULA 4GG7A 2YN8A 4EH4A 4U80A 3DXQA 2C47A 3QGWA 4WG4A 2YDKA 5KO1A 3ZH8A 3IDCA 3TDVA 4E6DA 3O17A 2UVZA 4RC4A 5DH3A 2YITA 4F9YA 5HE2A 3NGAA 4K11A 4BCPA 3Q4TA 4FT9A 3LCKA 3Q2MA 3QC9A 2ITWA 2REIA 2W1DA 3R9NA 4N6ZA 3QC4A 3THBA 5DN3A 4FBXA 1TQMA 4JG6A 3ZBFA 4EOKA 4C0TA 3MFSA 3KXZA 2Y4IB 3F61A 2XIRA 3GC9A 3R21A 4FKVA 4OT5A 1OL2A 2QG5A 3UC3A 3F5XA 4XG8A 3A99A 4GYIA 5CI6A 3EFJA 4AP7A 5L6PA 4NIFA 4GVJA 1YDSE 3G33A 4V0GB 5BUJA 4F1OA 4FYNA 1UNHA 2CKQA 3Q5IA 5IU2A 4LOOA 2IVSA 4DE4A 2W05A 2QI8A 3NDMA 3QD0A 3ENMA 3KF4A 4NW5A 1UU3A 4HYIA 4DFXE 4HNFA 4QP1A 4NCTC 1M2PA 4I0SA 3FV8A 4OTGA 4K1BA 4UEUA 2C3LA 2BROA 2X2KA 3KK8A 3ULIA 4BTJA 5A4CA 3LCSA 2VD5A 2BRGA 3UYSA 4AQCA 4D4VA 1JOWB 4U5JA 4RWKA 2RFEA 4AN9A 1OL1A 4AS0A 4DA5A 3ZO1A 4F6WA 4GT5A 2XF0A 5CU4A 5EQYA 5BMSA 3G51A 1DS5A 5GZ9A 2C1AA 2GQGA 3HA8A 4OGRA 4ACGA 3WF5A 3R1NA 4XOYA 2XYUA 3AT2A 2UZWE 3CEKA 4RFMA 4WHZA 4CD0A 3EN6A 4TPTA 2UZDA 4A9RA 1FGKA 5IZFA 5A4LA 3DFAA 3P86A 2QNJA 3FXZA 3ZTXA 3TM0A 3ORNA 2X7GA 5EYMA 1J1CA 2X9FA 5IQAA 4PMPA 2C6KA 4G31A 3EQDA 1TQPA 3V3VA 4FKUA 4AFEA 3OD6X 4KIKA 5DVRA 4CKIA 5LXMA 4BDEA 5LMBA 4F64A 3FI4A 2X7FA 1CTPE 4YTHA 4ASEA 4BY9E 4QTCA 3RAIA 3Q9YA 4M84A 1YDTE 5AX9A 2XJ1A 3L9LA 1YOJA 3BPRA 2OZAB 3ZU7A 3AC5A 2HW7A 2W1ZA 1YI4A 2GQSA 4QQCA 4UYNA 5BNJA 2WELA 4IANA 3NAXA 1ATPE 3TNQB 4KB8A 2C0TA 4NFNA 4ZSGA 4EOJA 5D1JA 4KIOA 5K5NA 3LIJA 5EHYA 5ITAA 5LQFA 4WG5A 3LFSA 3GVUA 2WTDA 3H4JA 3LFFA 2H34A 3S0OA 3GGFA 4OTDA 3DB6A 1OIQA 3MH0A 3SDJA 2PE1A 5C27A 4BZDA 4QQTA 4DEDA 1J3HA 3QYZA 5CEPA 4YMJA 4EH3A 3RVGA 5HZNA 4KUJA 4K18A 2XKCA 2XIZA 4II5A 4BCGA 3TNPC 4FL1A 3PRFA 3ZLSA 4O6EA 4TYGA 4WSQA 2JEDA 4FG9A 2GS2A 1HCLA 3FJQE 3UIUA 4GYGA 4WOVA 4FZ7A 1JLUE 5J8IA 3KKVA 2YZAA 1ZXEA 3PWDA 2C6EA 4WNPA 4FV9A 3B2WA 4L8MA 1PKGA 3OY1A 3LXKA 3E62A 5HIEA 3O8PA 4RVLA 4FV4A 2OIQA 2R3JA 3QRUA 1YHWA 4JVGA 1KUTA 1KE6A 3O50A 3ORIA 4FTCA 3QD4A 4YJSA 4ZY6A 4AF3A 4ANNA 1R1WA 2FVDA 3DB8A 4YHTA 4APPA 4KWPA 3RAHA 2ZJWA 3C7QA 3A7FA 4R3RA 4W4XA 4YPDA 2R3PA 2QHMA 3QZIA 3ROYA 5JFSA 4YURA 3R9OA 1XH8A 3BU3A 3ZLXA 4GH2A 5HI2A 1H1WA 5A46A 3QTXA 4FKOA 2QOFA 2FUMA 3D83A 5GZAA 4O86A 4JNWA 2UW5A 3ORXA 4L43A 3BYVA 4PDPA 4Q5HA 3MV5A 4XUFA 5ANJA 3AD6A 1UNGA 4KIQA 4IAIA 3TT0A 3NUUA 4BRXA 2VUWA 4NSTA 2DUVA 5KMOA 3KXMA 2WIPA 3P5KA 1JWHA 3G9LX 3D5WA 4UZDA 4D4SA 2O63A 3R8UA 2XVDA 4XOZA 4C59A 4F9AA 4P2KA 5FQDC 5L2QA 4Y5QA 4C34A 2EB3A 3PXRA 3VRYA 4PPCA 3TNWA 4PRJA 4OTHA 2FYSA 5IQCA 1H4LA 3CD3A 5DR9A 1IRKA 2WO6A 4QTDA 5EYCA 2OI4X 2UZTA 2ZMCA 4ZTRA 5B0XA 4MK0A 4YZBA 3IW4A 4H39A 2QONA 3ORKA 1CKIA 3OBGA 5D9HA 4ZEGA 5JT2A 1SVEA 2CCIA 2HOGA 2PZRA 3CPBA 1YWVA 2YIYA 3OEZA 4ACHA 5HO7A 4FEXA 3I1AA 3AG9A 1PXIA 5TR6A 2R9SA 4R7HA 2WFYA 4O21A 4X2NA 4L46A 5EOLA 3WOWA 4IAFA 1ZLTA 4JBPA 2IJMA 3LPBA 5K5XA 2DWBA 2R3MA 3TACA 2VTLA 4D0WA 3CLYA 1Z9XA 1W8CA 4IB5A 4ANSA 2XP2A 4TWCA 3G5DA 3KRWA 2BHEA 3WE4A 3ZXZA 3ZUVA 4U6RA 4F9BA 5AR7A 3KK9A 5A6NA 1JQHA 5EHLA 4F0GA 1P4FA 4IADA 4NT4A 3GC0A 4RWJA 4AAAA 5JFWA 4TYJA 4IDTA 2VTSA 4O83A 4Y85A 2V0DA 3QBNA 2BAKA 3GT8A 1KE9A 3NSZA 3PJ1A 1Z57A 4MYGA 2R2PA 4TYIA 3PIZA 2QKWB 1Q8WA 1R0PA 2R3LA 2ZDTA 1O6YA 1P4OA 3H30A 4L53A 4A9TA 4A06A 5HNIX 3VVHA 3QKLA 4AW0A 4O0SA 4YZMA 3LW0A 2I40A 3UZRA 3K5UA 2V62A 2GQRA 3KVWA 1MP8A 3QGYA 3HP5A 2XUUA 4I0TA 2J5FA 3TIYA 4JL9A 3CQEA 1ZMWA 1VYZA 3A60A 1HCKA 3KCKA 2J7TA 4IDVA 4PP7A 4RZVA 4I21A 2CGVA 5L8KA 3F82A 1Z5MA 4A4LA 4PMTA 3Q96A 2UW9A 4QMUA 3UVRA 3G2FA 3FPQA 5IDPA 2QOIA 3LZBA 2HZNA 2VX3A 3TTIA 3LLAA 3FMNA 3W8QA 4IJPA 4GKIA 3BYUA 5LJJA 3F3TA 4QMZA 3TUDA 4QMLA 3JVRA 1YW2A 1H25A 5DNRA 4E5WA 3QHWA 3PPJA 2PL0A 4HPUE 3CY2A 3DZOA 4YJVA 3UP2A 4FEWA 3CXWA 4EJ7A 4D2VA 3Q9XA 4WRSA 1YVJA 3S95A 5AP4A 4ZTSA 3UBDA 2E9OA 4YLLA 3DTWA 3KULB 5CT7A 1M2QA 5CU6A 3FQSA 5IF1A 4UALA 3KRXA 2EXMA 2C6LA 5CVHA 4MTAA 4LV8A 5HBEA 3PP0A 3QZHA 4NJ3A 2CDZA 3NR9A 2BZIB 3RI1A 1R39A 3W8LA 4EEVA 3IKAA 4ZSAA 1WBPA 2YDJA 3AC8A 4MNFA 4FT3A 3ZS5A 4EC9A 3SG8A 4O22A 3R6XA 4A9UA 4DEHA 3EL7A 3GENA 4R6VA 4D5HA 3BHUA 5IQBA 2C5OA 2GNGA 3H0YA 2I0VA 3R8VA 2VO6A 2QLQA 4K2RA 4DEBA 2WU7A 4B7TA 1GJOA 1YXVA 3S4QA 3NUAA 4G5JA 4G6OA 4EOMA 4QPSA 1REJA 1U59A 4FTAA 4J8NA 2ZDUA 3NCGA 2X4FA 3UOKA 5EKNA 2FGIA 3C4ZA 3MA6A 4ZTMA 1SNXA 3PTGA 4LYNA 5CU2A 3B8RA 3QX2A 2J51A 4JDIA 3VS6A 4KD1A 2PHKA 3QXOA 1G5SA 4IAAA 1GZNA 3A7HA 3V51A 4W8DA 1YOMA 2WIHA 4Y83A 3DKOA 3NWWA 1TVOA 4FOBA 5AM7A 5A9UA 1OIYA 4GSBA 3EHAA 4NW6A 5KMNA 1W0XC 1XJDA 1LP4A 5M44A 2A19B 4DGOA 5BYLA 3FKOA 2RKUA 4IVBA 4CFXA 5L2TA 3TZ9A 3F66A 5E8TA 2EVAA 3F3UA 4XLVA 4E4XA 3ORLA 3P7AA 3QTZA 4F1TA 3QWJA 4D58A 5LMKA 5JK3A 5I3RA 3I7BA 2IZUA 3E8CA 3HMIA 4AGWA 1NT2A 5FTGA 1GIJA 2ACXA 4RT7A 3OWKA 4ZIMA 2IVTA 3DXPA 3V5JA 5IQFA 2VTOA 3KY2A 2X7OA 3KRRA 4HVIA 5F20A 4IH8A 3UOLA 2JKQA 4QMNA 4DEEA 2I1MA 3D5VA 3R1YA 4TXCA 1YDRE 4RJ4A 3BKBA 3GI3A 4NTTA 2R5TA 3QUEA 2VO7A 4FKSA 3B8QA 3BLHA 5HE0A 1GAGA 3U54A 5FLFA 2BFXA 3DLSA 2G15A 5ETCA 3AMYA 3SA0A 1XH5A 5JRQA 3OCSA 3JR1A 1PJKA 2YM6A 3SW4A 3UGCA 3KXGA 3T3VA 3EIDA 4YU2A 4ZSEA 4G2FA 4AZTA 3LQ8A 4HYSA 4I6FA 4QTBA 3L1SA 4FR4A 5DT3A 3NW7A 4YP8A 4RBLA 3TCPA 3WI6A 5AV2A 3JPVA 1PXKA 3VRZA 1ZOGA 4RG0A 4FT0A 5KUPA 2H96A 4F4PA 2JDVA 4IHPA 4BBFA 2BPMA 4ERKA 5L6WL 5FBNC 3OWPA 4GS6A 4YNOA 3JXWA 2ITQA 3PVGA 5EW9A 2OIBA 3D7TB 3ZFXA 3R8PA 3OOMA 2B54A 3KN5A 5ETFA 4JBOA 5BUIA 2ETRA 3ZO2A 4FV5A 1NVRA 2XB7A 3P08A 4MEDA 3U6IA 2JGZA 2WNTA 4CT2A 2R3RA 3KQ7A 4DFBA 3ZC5A 3N4UA 1DAWA 2WOUA 3UC4A 5FXSA 4RIYA 5CSXA 4HCVA 2WTCA 4XBUA 4DGGA 3UJGA 2UW0A 1UKHA 4Y5HA 1M52A 1M14A 4M66A 4JX3A 4Q2AA 3R8MA 3U87A 4DAWA 1V1KA 3OTUA 5JRSA 3OBJA 4RLKA 1BYGA 4FT7A 4H3QA 2O0UA 5E7RA 3V5QA 3FHIA 1E1XA 4UXQA 3TV6A 3VUKA 3ZFMA 3MA3A 4ANQA 4CXAA 2GHMA 3NLBA 4R5YA 4WBBB 4XRLA 4YC8A 2OZAA 5IUIA 1A9UA 3TL8A 4BTFA 3NIZA 3DDQA 4IWPA 5TO8A 1B39A 3G6GA 3FMEA 4O7LA 3ZFYA 2GMXA 4ALVA 3FC1X 4JDHA 5HVJA 4MBIA 1QL6A 1Y6BA 4CTBA 4GG5A 3G90X 1VYWA 2HWPA 5EYKA 4N70A 2YM7A 4DHFA 4ORKA 4QMSA 2NRYA 1ND4A 4CFWA 3P78A 1UV5A 3LE6A 3MBLA 3UNJA 5J5SA 3BV3A 2J9MA 4AG8A 4RQKA 4MNEB 3QQJA 5CEQA 1KOAA 1O9UA 4WG3A 4TTHB 5I9WA 5L8JA 4FV6A 4O7SA 4GUBA 4XCUA 4DF3A 4FTIA 1J7UA 1OIUA 4YTCA 2ZV7A 2GU8A 2W96B 2YIXA 4DEGA 3PXYA 2W99B 4C8BA 2PUPA 4NTSA 5C1QB 2YDIA 3OEFX 4EZ3A 5DE2A 4TRLA 5L2IA 5F1ZA 5M57A 2P3GX 1IAHA 1PHKA 5AP3A 2PUUA 5AA9A 5FP6A 1OITA 4FKTA 2YIWA 4F08A 2PYWA 2VTPA 5EOBA 4LUDA 4S30A 4IWOA 4UWYA 3LCOA 4WNOA 4CYJA 2CNUA 3P0MA 2QVSE 1DI9A 4FSUA 4OW8A 4AA0A 2PMNX 4EH5A 3BGPA 4JI9A 3FHRA 2ITTA 3TJCA 4CG8A 2PWLA 4QYEA 2OKRA 4Y73A 3BE2A 3BYMA 4RJ5A 5C9CA 5JZNA 1Q5KA 2XYNA 2HY81 3DT1A 3GFEA 3EL8A 4JBVA 3S2PA 5KKRC 2R3KA 3NZ0A 4MKCA 1XHAA 4EBWA 3BGQA 2AC3A 2PVMA 4O96A 5FXRA 4E4NA 5KZ0A 5AM6A 2RFDA 2V55A 3HL7A 3PVBA 3W2PA 3QAME 4I20A 5IUGA 4MQ1A 4QNYA 4MWIA 2C5VA 4FSRA 4FUXA 4C33A 3VNTA 5HLNA 5CSWA 4ARKA 4R5SA 5IDNA 3DKCA 4IZAA 3MPAA 5KE0A 4WIHA 2GTMA 4BVUA 2I0HA 3G0EA 2E9PA 3LFCA 4X3FA 4LRKA 4U3YA 3UPXA 4BGHA 2IW9A 5E8WA 2ZAZA 5CF6A 3R9DA 3H3CA 3WF9A 4F7LA 3DJ6A 4JS8A 4KNBA 4QP7A 4C3PA 4BCKA 5IISA 4DG3E 3ALOA 3GFWA 4GIIA 4YC3A 5DMZA 4U41A 5CQUA 3CKWA 4I6BA 5GINE 2PTKA 5KKRB 1OKWA 4EOPA 4PNIA 1Q3WA 5DLSA 4PUZA 3VW6A 5CXZA 1LPUA 4CFFA 2WQEA 5CF8A 5E8UA 3DNDA 4PMMA 1WVXA 2JKKA 3QLFA 3VHKA 3DAJA 3E3BX 1H0WA 2E9VA 3W2QA 4OAUC 3LXLA 4G3DA 4KBKA 4KS8A 5ACBC 2R64A 3KF7A 3V8WA 1M17A 2CN8A 1SM2A 3MW1A 4FK6A 1SYKA 4YLKA 2Q83A 3LQ3A 3FMLA 3C0HA 4H1MA 3FAAA 3FZSA 5FEDA 5J1WA 3KREA 2BZKB 2XMYA 4IM2A 2W0JA 4IAKA 4Y72A 3GP0A 4AUAA 4H3BA 3VW8A 4FTJA 3IGGA 5C8MA 2OXXA 3R7UA 4IMYA 5L8LA 3VQHA 3IG7A 3AT3A 3FYJX 3KXNA 3BBTB 4Y8DA 5K0XA 4FV8A 3IDBA 2FSTX 2ITVA 3MY0A 4B8LA 2WTJA 3DBDA 4KSPA 1Q8YA 3RALA 4EKLA 3VUIA 3QHRA 3L8VA 3UZPA 1WBWA 2B53A 3C0IA 4CMOA 3R83A 4EC8A 4W4YA 3HV7A 4CLIA 2GDOA 1WBOA 5IA0A 3GC8A 3RK9A 3D5UA 4M8TA 3ZSHA 4AFJA 4AE6A 4BB4A 3QQGA 4WNMA 5AR8A 5CU0A 2HZ0A 5E8YA 4HCUA 3FBVA 3I5ZA 5DEWA 5EH0A 2VWXA 3BHTA 4RIOA 3ID6C 2QC6A 1UWHA 3F88A 4GMYA 3SGCA 4L44A 3KA0A 2V22A 1B38A 4XV9A 3D15A 4MF1A 1U5RA 4AWIA 3R7IA 1YHSA 4E93A 1W7HA 2CJMA 3B2TA 1R0EA 1K3AA 2OXYA 2Z7RA 2WHBA 1ZWSA 3LM0A 2HELA 3M1SA 4FSMA 4BDGA 3L8PA 1SVGA 3LM5A 4J97A 1Y91A 3PA3A 2BKKA 3FI8A 2OXDA 1AD5A 4XHKB 1H08A 5AUUA 4FKPA 2DQ7X 2X1NA 5EM7A 3SD0A 4YO4A 3IS5A 3BU5A 5BMMA 4R3CA 1OPLA 2OO8X 3D2KA 3IW8A 3SX9A 4ACMA 4HJOA 2QU5A 4I4EA 4BC6A 4DG0E 4FL3A 4D1SA 4E1ZA 3JYAA 5HIDA 5C03A 3U4WA 3S00A 4AGDA 5FD2A 4FIGA 4TYHA 1YRPA 3RAKA 3V5WA 4CVAA 3UE4A 4AZSA 5D12A 1FVRA 5H9BA 4N57A 1H1QA 2Y6MA 3PJ2A 4LUEA 4IX3A 4UMRA 2J90A 2W17A 3IDPA 4FKWA 4IFCA 4L68A 4QYGA 3UO4A 4EK3A 2I0YA 4MF0A 3DLZA 4L6QA 2QOHA 1UU9A 2BRMA 3QUDA 2W1GA 4BWXA 4JG7A 3NUNA 5TKDA 3R9HA 5BVOA 1GNGA 4O7NA 3VBVA 1KE8A 2ZV8A 4KBCA 2WMSA 5AUWA 3GU7A 3UIBA 2UZBA 5IKWA 3DZQA 5CX9A 1WBSA 3BE9A 2UZVA 5AAGA 4YNEA 1ZYDA 4IVCA 2A1AB 4GL9A 4PF4A 1O6KA 3WZEA 2CHLA 3LFEA 4BCJA 5BUEA 3ZXTA 4FEVA 3O2MA 4P5QA 4D2PA 3TV4A 2B55A 5KHXA 5KZIA 3VBYA 4FIEA 4FTLA 5HG7A 2BKZA 3GEQA 3I0QA 5HX8A 4YJPA 4G17A 4QOXA 4C36A 2JIIA 2EXEA 1I44A 2X9EA 5AR5A 1ZZ2A 3MB7A 2JDSA 4QMXA 3GCVA 4FICA 5HD7A 1H24A 2CCHA 2OJGA 3T3UA 5AP5A 2ZV2A 4YC6A 5AR3A 3QZGA 3BQRA 3R8LA 4B0GA 1PRYA 1FMOE 4LOPA 3KRLA 2B9HA 3D0EA 3I6WA 3O8UA 3PVWA 3REPA 3PUPA 4DH7A 1JSVA 2XIKA 4FVRA 4XJ0A 5BQ0A 3MSSA 2VWWA 4O6LA 1URWA 3ZC6A 4QYYA 3FY2A 4DFYA 4QMVA 4YBKA 1JSUA 5BPYA 5JGAA 2PMOX 3PY0A 1O6LA 4RIXA 4CRLA 3L8XA 4L42A 3RZBA 3HA6A 2VAGA 4DC2A 2R7IA 4XP0A 3O96A 3OCBA 5J1VA 2CPKE 5BVEA 2B52A 3NYNA 4IEBA 2X4ZA 4BFMA 4NKSA 4FZDB 3HLLA 5JGBA 3C4EA 3O7LD 1ZMVA 3R71A 4I4FA 1TQIA 2ZYBA 1YI6A 4LRMA 5LVLA 4AZWA 4F9WA 2HY0A 3O51A 4NM0A 3V5TA 4UN0C 1OBGA 4RJ3A 4O81A 2C69A 2VX0A 2R4BA 2C30A 3ODYX 2PVRA 4KIPA 2F49A 2R3IA 3HDMA 4MXOA 4D9TA 4PNKA 3FMDA 4GJ3A 1J91A 4JQEA 3I0OA 3IW5A 3QUPA 2ZM3A 4W8EA 4P7EA 2QOKA 4CV8A 5LVPA 2C6TA 2VN9A 3LFAA 4EUTA 3QX4A 2VWIA 3QTSA 5ANDA 5A14A 4IQ6A 4IB3A 2GNIA 3JUHA 3R1SA 1P5EA 1LR4A 5AUYA 5LARA 2QOOA 5CNOA 1WVYA 4FVPA 5I9VA 5FDPA 5IEYA 5AP0A 2ZOQA 2A27A 3ZUUA 4HGSA 1YQJA 2JBOA 4Z55A 5EW8A 3S1HA 2PZIA 1VZOA 2VTTA 3LMGA 4QMWA 4ZLZA 4CLJA 2P2IA 2ETKA 4NWMA 5AV3A 5EM6A 4JAIA 3QXPA 3MPTA 4EH8A 2GS7A 3R28A 5I3OA 4C38A 3PY1A 3MVJA 3RPYA 1XH9A 2XJ0A 3F2AA 4FSWA 4HPTE 3MS9A 4FA2A 5HTBA 4PV0A 3AD5A 2H9VA 3D7TA 3QTRA 1GZKA 4XG6A 3GU4A 2GFSA 5EDRA 3VWAA 5BVDA 3CGOA 4QP8A 1DM2A 4NFMA 5H8EA 5FDXA 4EUUA 3DBEA 2P0CA 4P90A 1PYEA 2XNOA 5GJFA 4RVTA 3ZM4A 3F5UA 2OH0E 3QA0A 5AIKA 2XKFA 5J87A 4L00A 2HXQA 4BBMA 5CYIA 4BDCA 1Q3DA 3ZO3A 4J96A 3TKIA 3P1AA 4O1OA 3LFQA 4YBJA 4FKJA 2JIVA 3C51A 3CR0A 5JEBA 1UVRA 2ZB0A 4CKJA 2A4LA 3FLYA 3K3JA 3K3IA 4ZY5A 1Y6AA 4AXAA 4D2RA 3LMIA 3FLNC 4ZTQA 2QKRA 3UPZA 4ZS0A 3WZJA 4BWPA 4NJDA 5K9IA 1FMKA 4ALUA 5AV0A 1QMZA 3BCEA 1H28A 3MVLA 3U9NA 4EK6A 3FI2A 3PY3A 4FTTA 4GJ2A 2LAVA 2VTMA 1MUOA 4JIAA 3C5IA 2QR8A 4F63A 4A4OA 2CGUA 3HRFA 3IGOA 3VS5A 5E4HA 4F1MA 2WMAA 4DH5A 2XIYA 5DHJA 1NXKA 3OW3A 4TL0A 5CQWA 4N4SA 2QOBA 4YJQA 4CFVA 5IG1A 4FNYA 4X3JA 2GHLA 4ZSJA 5FM3A 5AV4A 4RIWA 1PXOA 5D10A 3OCGA 4H3PA 1FVVA 1NY3A 4JDJA 3P7BA 4TKSA 3OWJA 4R7BA 2Y4PA 5EI8A 3EZRA 3D9VA 2CKPA 3R7VA 4GKHA 5K0KA 1V0PA 2ERKA 2B9IA 4FVQA 4BDFA 2CKEA 4FGBA 4ITHA 4WRGA 3WBLA 3QTQA 2ITZA 4BTMA 4R78A 3TI1A 4DEIA 1W82A 5JSMA 2QO7A 3PZEA 3SRVA 1YXUA 2E2BA 2GPHA 3C13A 3BBWA 3UO6A 3VBTA 3VS3A 3R02A 4D5KA 3HVCA 4F7SA 4I6QA 5CEOA 4BZOA 5J5TA 5M4UA 3M11A 5JQ8A 5DBXA 2YIRA 5A6OA 1ZARA 5DRDA 4E6CA 4HVGA 4WA9A 2R3GA 4H1JA 3PPZA 4IM3A 2FB8A 5DRBA 2CGWA 3R0TA 5FM2A 4EL9A 4FZ6A 3COKA 3TZ7A 4HGTA 4BN1A 5BVWA 5KHWA 4UZHA 2LGCA 4V04A 1YXTA 3W2RA 2OICA 2HWOA 4BDIA 4BHZA 3UQFA 4BL1A 2Y0AA 4C61A 3OW4A 4PDYA 3FMHA 3WZUA 3KMWA 2G01A 4FEQA 4U97A 5I9ZA 2J4ZA 3RM6A 2BDWA 3ELJA 4JT3A 3HX4A 2WEVA 3ZEWA 4PTGA 4UMUA 1OBDA 3HV3A 1KV1A 3DGKA 3OUNB 2F2UA 4EONA 4XLIA 4MXAA 1V0BA 5CALA 3RGFA 4ZXTA 5KMKA 4X2JA 1XR1A 2G2HA 3H9RA 4TW9A 2BALA 5B7VA 4ZOGA 5K4JA 5EKOA 3A61A 4USEA 2F7ZE 2YM4A 4BCHA 5I9XA 3H10A 4NH1A 4C2WA 2IZTA 2ZMDA 4YTIA 5DPVA 5ANEA 3MY1A 2XK9A 3Q04A 3UQGA 4UBAA 5F94A 4P4CA 2SRCA 1UKIA 2BVAA 4PL4A 2ONLA 4YUQA 4QMPA 3A8WA 3R22A 2WXVA 5IQIA 3HMPA 4M69B 4O2ZA 3VHEA 4BYIA 1KSWA 3QCXA 3MN3A 2YAKA 5FTOA 4H05A 3V8TA 4GT3A 4KRDA 5HCZA 4E20A 3RAWA 2XKEA 3SXSA 3HUCA 3I79A 3LHJA 2WD1A 4IWDA 3G6HA 4CEGA 4H58A 5GJDA 4A9YA 2YACA 4FSYA 4JDKA 4OTIA 5DEYA 3U6JA 1I09A 4RVKA 4RQVA 4AX8A 1JSTA 2C3JA 2F2CB 2C5YA 5DR6A 3SOAA 4RA4A 4U0IA 2YAAA 3PDTA 1M7NA 4JIKA 4M14A 2UVXA 5E1SA 3PYYA 2WMUA 1ZYSA 3RPSA 4RFZA 3ULZA 1CMKE 1PXPA 4XP3A 5D41A 1Q97A 2Y7JA 5L2SA 2C68A 2FH9A 3ET7A 2RFSA 4D4YA 4U42A 4IIRA 4DT9A 3FPMA 1U54B 4FKGA 3EYHA 3WIKA 3PJCA 2QOQA 5B2MA 3CJGA 3VQUA 2OJFE 4MX9A 4I92A 5E1EA 2C6DA 4EHVA 4AN3A 4E4LA 1MRVA 1RQQA 4RGJA 4QPAA 1GZ8A 1STCE 3FYKX 5GHVA 3EOCA 4RA5A 4C3RA 4IBMA 4ERWA 2BTRA 2BFYA 2O3PA 5DIAA 5KX8A 1R78A 1HOWA 2PK9A 2PPQA 1PMNA 1Y8YA 4ACCA 1DAYA 2UW4A 5AFVA 3NW6A 3RNIA 3UZTA 2BTSA 3F69A 1P14A 4BKYA 1URCA 3L9NA 3NUXA 3DNEA 5G1XA 3EJ1A 3LFDA 4RPVA 1Q4LA 2BAQA 4L3PA 3HKOA 4LG4A 4MD7E 4U79A 4U3ZA 2WQOA 2ITOA 4EI4A 1JKLA 3AC3A 3ZMMA 4FSNA 5DWRA 4S2ZA 5CVFA 5IH6A 2B9JA 3NRMA 4FGRA 4AE9A 2BZJA 4A4XA 3CTHA 2VWBA 4G5PA 4IC8A 5HVYA 3TG1A 1OECA 3CD8A 2RL5A 4I6HA 3CPCA 5ANIA 4E5AX 3FZ1A 2WGJA 3QU0A 3BWFA 3BWJA 4TWNA 5AP1A 3WARA 2IZRA 4F7JA 1JKSA 4LGGA 4BCMA 3FKLA 1JNKA 2X2MA 2HXLA 2I6LA 3PFQA 3W1FA 4BCQA 4C4FA 5AWMA 3EQHA 4ZZNA 2B1PA 5J9ZA 3ZSGA 3G0FA 1OL6A 3DU8A 2J2IB 4IXPA 2ITUA 1OPJA 3MESA 4WUNA 4ENXA 5IA4A 3TNHA 1QCFA 1JVPP 3AQVA 3G9NA 2W06A 2HENA 4M67A 2A0CX 2YFXA 2XNNA 3DBQA 4DN5A 2VNYA 3RWPA 1XQZA 4ZS4A 4J98A 4NIFB 2GTNA 4PTCA 5H2UA 4W9XA 2YCQA 4QMYA 2JD5A 4M7IA 4U45A 3TKUA 3WF8A 2R0IA 4FODA 2HAKA 5HG8A 4QQJA 3F7WA 3AMAA 4KA3A 5FTQA 2HIWA 3PSBA 2WMBA 3NNVA 2YZLA 2CLQA 3R00A 3CP9A 4EH6A 3ZDIA 1OVEA 4FL2A 1LUFA 5AIRA 3DK7A 3FE3A 4IB1A 4TNDA 1OKYA 1WBVA 4BIDA 4YR8A 3FUPA 4CZYB 3PLSA 5CU3A 4C4HA 3TUCA 4O7YA 4ZAUA 3RKBA 3F9NA 4CV9A 5T6KA 1BKXA 4ANOA 1OKZA 1Q8ZA 3ACJA 4U9AA 4V0GA 4EOLA 3U6HA 3POZA 5AP6A 3ZDUA 3H0ZA 4J71A 4LQMA 5HNGA 3RCJA 4B6LA 3HGKA 5IMXA 1WFCA 4FTUA 2ZB1A 4DBNA 3PP1A 2AYPA 4XV3A 2RFNA 3GB2A 2XCKA 2HCKA 3LQ5A 3ZHPC 5J9LA 4XNEA 2QODA 3R30A 3NYXA 1T46A 3GCUA 3LJ2A 4FIFA 4Z9LA 4CCBA 5HGIA 1WMKA 3HAVA 4CKRA 2ZM4A 5FEQA 5B2KA 5A4TA 5AUXA 2O8YA 4ZSLA 4NU1A 5ANGA 4UY9A 4KIKB 4CGAA 4G3EA 3QRJA 1RE8A 4MQ2A 2CSNA 3FZRA 3I4BA 3A4PA 4FI1A 3IW7A 3T9IA 2O65A 4DTBA 3MFUA 2VWVA 3E92A 4BYJA 2VTQA 4EHZA 1PF8A 4TN6A 4JRNA 3SAYA 4YZDA 1OPKA 5CEKA 4R77A 2G1TA 2ITXA 3LFNA 5DT4A 4GK4A 4NCTA 3DBCA 3LMHA 2XJ2A 3WF7A 4QO9A 5IH5A 3SVVA 2ZM1A 3C0GA 2PUNA 4J1RA 3VS1A 3C5UA 2OSCA 3OT3A 4D28A 3HEGA 3ORZA 3ZRMA 3BYOA 3DK3A 3Q6UA 4OTQA 4U8ZA 3EQCA 1XBAA 3QYWA 3SLSA 2XK7A 3QQHA 4O0YA 3M2WA 4QYFA 4AZVA 4IC7A 5IA2A 4QNAA 3GUBA 4XX9A 3W2CA 4O82A 4ANMA 3QD3A 3WZDA 1W98A 1WZYA 4G6NA 5KMIA 2JDRA 2JDOA 2OF4A 4I5MA 4LGDA 4GRBA 5HCXA 4BKJA 3NUSA 4MXXA 4WT6A 3FSKA 5A3XA 4LMUA 1MQBA 5GIOE 2OBJA 2QO2A 2XH5A 3OMVA 1QPEA 3OZ6A 5DFPA 4BI2A 4XS2A 2P55A 3E5AA 4IX6A 4FSZA 4USDA 5HG5A 2IVVA 2B0QA 3C50A 3U8WA 2IN6A 1CKJA 4M68A 2BDFA 4MBJA 4I5PA 3U55A 1RW8A 2QHNA 4JR7A 4QMMA 3DOGA 4YLJA 2C3IB 4E73A 4YJTA 2OFVA 1ZYCA 3R01A 4PDOA 3VBXA 2HW6A 2DYLA 2JBPA 4IFGA 2G2IA 3EMGA 3SKCA 5BYYA 4TY1A 1PXJA 1T45A 1K2PA 4NYEA 4USFA 4DGMA 4K8AA 2XNPA 2ZVAA 4BI0A 3KL8A 2BZHB 3HMNA 4MCVA 5CNNA 2OJIA 3HYHA 4BF2A 4EOSA 2HZIA 1J7LA 4O7WA 5IQHA 4I5HA 4K0YA 2ITNA 3C4WA 3S3IA 3R7GA 3EH9A 2X8EA 5E9EA 4JQ7A 3R8ZA 4AW2A 3UG1A 2YCSA 3PWYA 5AAFA 4BKZA 4EWQA 3GXLA 2YHVA 4C37A 4EK8A 3F3ZA 3OHTA 3QTUA 5HIBA 2J50A 2XM9A 4Z7HA 3EFKA 4OTFA 5HBHA 4JG8A 1OUYA 2GNHA 3GQIA 4TWOA 3KMUA 4WD5A 3UOHA 3ZUTA 2NP8A 3MH3A 3MB6A 4B8MA 1L3RE 3E63A 2WTWA 4PWNA 4O0WA 1VEBA 4JR3A 3MFRA 2PVFA 2F9GA 4Z3VA 2YIQA 4E8AA 1A48A 3RNYA 4CMUA 5M55A 4RC3A 4O0VA 5IUHA 4NM3A 3DAKA 4G9RA 4D2SA 2QCSA 2VTJA 3OXTA 3D94A 5HLPA 4XYFA 4JX7A 4XV1A 1SZMA 4ASDA 2UW6A 2YM5A 5FRIA 2PVKA 3MVMA 3MWUA 4UB7A 1H0VA 2Z7LA 4X21A 4D55A 4GUEA 3O7LB 2J0LA 3GU5A 4FV1A 1ERKA 2JIUA 5LWMA 3P4KA 3W10A 4QQ5A 5AR2A 3CE3A 1G8AA 4I1ZA 3LXNA 5AV1A 4GV1A 4L45A 4WO5A 5L6OA 4QT1A 4BDKA 1U5QA 3PPKA 5F95A 4HVHA 5KMJA 3MI9A 3PJ3A 2CNQA 4FX3A 3PVUA 4IE9A 4J95A 2GS6A 5KBRA 2VWZA 2YJRA 3UVPA 5AUVA 1LEWA 5JQ5A 3QTIA 4DGNA 4FEUA 4ENYA 4DFUA 2W4JA 2W4OA 3GCSA 4DTAA 3IW6A 4DEAA 4EYMA 3EKKA 3O8TA 4G3CA 2W7XA 2R3QA 4YSJA 4O7VA 3LKMA 4X2GA 3TEIA 5E91A 2HK5A 1AGWA 4LRJA 5I9UA 3PA5A 3FLWA 1V0OA 3N51A 4EOIA 4EQCA 4G1WA 5E8ZA 4PL3A 4W4VA 4OBOA 2R3HA 4Q5EA 3E8NA 4L3JA 2WQNA 1M7QA 2W5BA 4MXCA 4S31A 5KMMA 1H26A 4YZNA 2J0MB 3UNZA 4ANLA 1OUKA 5IA1A 4EH9A 2BHHA 2PVHA 2C0IA 2OJJA 2X6DA 2Z2WA 5J7HA 1YI3A 4EKKA 5CASA 2YCFA 3DPKA 3W16A 4RJ7A 4FV7A 3DCVA 4QTEA 5AAEA 4GK3A 4C2VA 5EG3A 4M0YA 5A4QA 3OXIA 5EI2A 1J7IA 4QMTA 2J0JA 3NAYA 2VX1A 5LVNA 1G3NA 1KV2A 4FTMA 4GFMA 3RCDA 4GU9A 2RG6A 5LCJA 2I0EA 2FSOX 2C4GA 4NEUA 5EDQA 1QPCA 3O23A 3V8SA 3HECA 3VJOA 3VN9A 2W9FB 5HD4A 5IQEA 5M51A 2QU6A 5IQDA 4QP2A 3VUDA 4B9DA 5LMAA 3A62A 4BDBA 5CT0A 3C4XA 3DKFA 4N0SA 4YPSA 1JPAA 4O7ZA 5E8VA 4D2WA 2X6EA 4GT4A 1H07A 4DCAA 4UWCA 1BLXA 2W1IA 3MFTA 3VUMA 3QRKA 3SQQA 4N6YA 5M4IA 5H8GA 2C0OA 3T9TA 5T3QA 1XBCA 3ZRLA 1Y8GA 3AC4A 1ZY4A 2WMVA 2P4IA 3QFVA 4X6QC 4F7NA 4CFUA 3OF0A 4FG8A 3ZRKA 4HZRA 1KOBA 4HW7A 3W2OA 2XRUA 4A7CA 3NS9A 4I24A 4J7BA 3KULA 3AT4A 2VTHA 3BEGA 3NUYA 2ERZE 2PVLA 3JY0A 2BRHA 2VTAA 5EM5A 4F6UA 3UYTA 3BGZA 4FV3A 3ZO4A 1OM1A 5C26A 5LMKC 1PXMA 2PVYA 4O2PA 5DA3A 2IW8A 4O0UA 3KN6A 1W83A 5EDPA 3VS7A 4R7IA 1UNLA 5KCVA 4FTOA 3ZCLA 3OXZA 3PG1A 4FZFB 3GQLA 5EK7A 4D1ZA 4RX5A 1XH6A 1B6CB 1IEPA 3E3PA 2Y4IC 4K6ZA 4TT7A 3MTLA 3NYOA 4HOKA 4ASZA 1H1SA 5AUTA 2RSVA 5A54A 1U4DA 2QOLA 5GIPE 3VO3A 3EWHA 2XEYA 3K2LA 3U9CA 4ZP5A 1PMVA 1OL7A 2RF9A 3BIZA 3EQPA 1XH7A 3E7VA 1YXXA 3QRIA 4LM5A 3MIYA 3W18A 4O7RA 5DYJA 2XNBA 3BHYA 4MVFA 5DOSA 2CN5A 4C62A 3P23A 3I6UA 1ZY5A 4M13A 1U46A 1DI8A 4KINA 4DFZE 3ODZX 4R1YA 1X8BA 3BHVA 3OVVA 3QA8A 5M09A 1RDQE 3CCNA 4J99A 2E9NA 3Q4ZA 4YJUA 3IOPA 2GNJA 2H6DA 2P2HA 2WMRA 4MD8E 3HDNA 4DG2E 4OBQA 4JJRA 1YXSA 5JFVA 5K4IA 2BAJA 3VF8A 1OIRA 4YZCA 4CMTA 4QD6A 3Q32A 2IW6A 4AOTA 4UYAA 3ERKA 2EWAA 3HV6A 5FG8A 4KABA 4FTKA 4BZNA 3MDYA 4EORA 2WQBA 5JFXA 4CG9A 3FL4A 5AP7A 4M97A 4C57A 2VNWA 2UW7A 2PVNA 1FBNA 5CXHA 2GHGA 3MYGA 4AGCA 4EH2A 5CAPA 4AA5A 3HAMA 2BR1A 2JC6A 3AC1A 4E5BA 3QRTA 1BI7A 3R63A 4FKLA 3R2BA 3WYYA 5D7AA 3Q9WA 4PY1A 5J95A 2E9UA 2OWBA 2PZ5A 4OTRA 3TJDA 5CZHA 5CSPA 3ZLYA 2PUIA 2XBJA 3D4QA 5E8XA 3OCTA 3FZOA 5TE0A 4KKHA 3WZKA 3PRIA 3TZMA 3EN5A 2IG7A 3VBQA 4CQEA 3U4UA 1SMHA 1UU8A 3QQKA 3DJ5A 3VUHA 2B7AA 2YLEA 4C4EA 4KKEA 4ALWA 3VIDA 3NCZA 3C4CA 5HTCA 1F0QA 4U40A 3UG2A 4G16A 3UO5A 5KNJA 3F5PA 4BCOA 4Q9ZA 4D1XA 4IW0A 5CZIA 2B4SB 3ENHA 3P79A 1OGUA 5BX0A 4EJNA 4RSSA 1Q41A 3LXPA 3DY7A 4RIYB 3ALNA 2BILB 1TKIA 4X2FA 3II5A 4UXLA 3GOPA 4RWLA 4DH8A 3DBFA 5BVFA 3DQWA 5L4QA 4I22A 2CKOA 2Z60A 4FIIA 3CBLA 4XG2A 2OZOA 2WMQA 4YJNA 4Z7GA 5CVGA 5KMLA 3OUKA 1QPJA 1XBBA 3EQBA 4PQNA 4NL0A 1Q62A 5CEMA 2X39A 3IPHA 3KEXA 4BDDA 2WMTA 3TN8A 5AEPA 1FQ1B 5CEIA 4O38A 2CLXA 4OTWA 3EN4A 4RJ6A 2JAVA 5G6VA 1IAJA 3BHHA 2YCRA 3COMA 3AD4A 3EFWA 3GU6A 3QKMA 4FE2A 1R3CA 1ZMUA 2GSFA 2OFUA 2OJ9A 2C6OA 3P9JA 2KTYA 3NIEA 3HRCA 1M2RA 3CS9A 3MVHA 3SG9A 3ETAA 4ID7A 3F2RA 5HNBA 3RHXA 4FG7A 2BUJA 2YWPA 3F5GA 3FXWA 4MAOA 4C4GA 2F57A 4F70A 3ZOSA 3N4VA 3V01A 1ZOEA 3GC7A 1NVQA 3ROCA 2WOTA 3FZPA 5EI6A 3FEGA 3HMOA 4CYIA 4ZMFA 2W1EA 4FC0A 5IA3A 4NM7A 4QP4A 4C3FA 3RZFA 2UW3A 1H1PA 4L52A 4BDHA 2XA4A 4BBEA 4ZTLA 4DBXA 4J53A 4BGQA 3R9RA 2OG8A 5JKGA 4V05A 2W5AA 3RWQA 4EHEA 2JAMA 2Y8OA 3OP5A 5JZJA 2X81A 3Q3BA 4YJRA 5ETIA 2OIDA 4WUAA 4O0TA 4OT6A 3Q2JA 3RPOA 4CZTA 4XEYA 3HMMA 4WNKA 4X3FC 3Q53A 3Q4CA 3KCFA 2FSMX 2ITPA 2RG5A 4QPMA 4Y46A 5CI7A 5HO8A 3Q4UA 2GNLA 3CJFA 3CIKA 3K5VA 4KAOA 4L01A 4MNEA 1BUHA 4BGGA 4QP9A 2EU9A 3CQWA 3R2YA 4D4RA 5D11A 4L67A 4QP6A 1FVTA 4BDJA 5HTIA 2WKMA 4AACA 4JXFA 3UIXA 4DCEA 4AW1A 1VJYA 4K9YA 3QL8A 2OLCA 2J0IA 3H9FA 3R04A 2Q0NA 4GW8A 5CAUA 2JKOA 2JKMA 4C7TA 1MRYA 3QQUA 3ZSIA 3R7EA 4XG4A 4E4MA 4ZTHA 1GZOA 2Z8CA 3A2CA 4UMTA 2C1BA 3DXNA 4DYMA 4QYHA 4G34A 2VGPA 2VTNA 4H36A 1SVHA 3Q52A 4FTQA 3RINA 5I5ZA 2BDJA 3ZZWA 3MGYA 4U43A 4HVDA 2UZLA 4KS7A 4X3FB 3VBWA 3WYXA 5EYDA 4GK2A 4J52A 2NNWB 2O64A 3PXKA 3VS2A 2ZV9A 5C4KA 5LWNA 3FXXA 3NNWA 4FV2A 2NO3A 3CTJA 4I5CA 4EZ5A 4EHGA 4X6RA 4AU8A 3EQIA 3EQGA 3P7CA 3DK6A 3NW5A 4L9IA 5IA5A 2IZSA 2XCHA 2XRWA 1K9AA 4FF8A 3T8OA 4FK3A 1GY3A 4O84A 1GIIA 3H9OA 4YZ9A 4CNHA 3MTFA 5TF9A 5AJQA 2XK3A 3LCTA 4DLJA 1YHVA 3A4OX 1MQ4A 2KULA 3ORPA 3D5XA 4FT5A 3W33A 5DI1A 4BHNA 2WPAA 3R73A 3NPCA 2XM8A 4D9UA 2XBAA 1JBPE 3V6RA 2V5QA 4M3QA 1LEZA 3C1XA 5EQPA 1PXLA 4FZAB 2O5KA 1BL6A 3ORTA 4RFYA 3N4TA 5LOHA 5EQEA 5M56A 4RVMA 3AMBA 2C6MA 4CFMA 4DT8A 1KE5A 1FOTA 3CKXA 3TTJA 3CY3A 5J7BA 5HCYA 3LVPA 4UX9A 4YHFA 4FTNA 3EN7A 4PL5A 3BLQA 2HZ4A 3A7JA 3AXWA 5E92A 2WEIA 4KKGA 4NK9A 4DTKA 4W4WA 2UZNA 3I81A 4DLIA 5ETAA 3QLGA 1IA8A 4DITA 2UV2A 2X8DA 4CTCA 4BCFA 2P33A 4FKIA 1F5QA 5FWKK 2C5XA 2PY3A 3IQ7A 2YWVA 1QPDA 3I60A 2XKDA 4LL5A 3QWKA 3ZM9A 3NEWA 4ITIA 3PZHA 3TXOA 4ANBA 4EK4A 2XEZA 3RPRA 4E6AA 4YTFA 4X7QA 2W1HA 5DGZA 1ZRZA 5DG5A 4ZTNA 4F09A 4AW5A 2W9ZB 4RX7A 5IPJA 3VAPA 3KXXA 3LJ1A 3OT8A 4FYOA 4AGUA 1PMUA 3I5NA 4XG3A 4IX4A 4ZZMA 3RTPA 3SOCA 5M07A 3UP7A 4CZUA 2PVJA 3FQHA 5TOZA 1ZYLA 4FNWA 3QALE 5LCKA 5EFQA 1UWJA 2OF2A 4G3GA 3PSCA 1Q99A 3GCPA 2ITYA 3GNIB 1BL7A 3PIXA 5CAOA 3FLQA 2YISA 4TNBA 3IECA 4UWBA 2WTIA 2X2LA 3UMWA 2OK1A 2UZEA 4NUSA 3HZTA 2PSQA 1Q8TA 5JGDA 5F9EA 5FXQA 2I7QA 3DA6A 3UODA 5HBJA 3D14A 2XS0A 2C6IA 2IVUA 2OU7A 4FOCA 4OTPA 4TYHB 4CSVA 3LCDA 4R8QA 5CAVA 1G8SA 4NM5A 3Q60A 3DQXA 3DKGA 2J6MA 2UW8A 3RP9A 4LOQA 3IK3A 4EWHA 5FUTA 3GBZA 4D2TA 5LVMA 3CGFA 2R0UA 3FSFA 2VU3A 3EYGA 2EUFB 4O0RA 5CY3A 4AA4A 2NRUA 2YEXA 3A8XA 4G3FA 4E26A 1EH4A 4Q9SA 3UIMA 2W1CA 1YOLA 2FO0A 3E64A 3NUPA 2IWIA 3FL5A 3ZBXA 3UQCA 4GFOA 4BIEA 4DH1A 2VRXA 5J79A 3KU2A 1ZOHA 4GFGA 3BLRA 1PY5A 3NX8A 2JFLA 3AGLA 5CS6A 4OUCA 4BCIA 3HP2A 4MXZA 3RM7A 3V04A 3O71A 5I4NA 2YM3A 4J8MA 3VC4A 2IPXA 4XH6A 1H1RA 2BIYA 3PXFA 3HV4A 5JMSA 4RZWA 4A07A 4OAVB 3ANQA 2Z7QA 3FWQA 5AUZA 4DFLA 1PKDA 2PMIA 2YLFA 4FIJA 5HEZA 3PE2A 4KRCA 3RHKA 4BICA 3MJ2A 3KXHA 3QCQA 3VF9A 3E87A 4U44A 4BTKA 3WIGA 4WBOA 4BR3A 3DAEA 4JLCA 4X2KA 4ZJIA 4FSTA 3V6SA 4QTAA 1ZZLA 4XG7A 3QF9A 4B99A 4IZ7A 4FKQA 3WILA 3UOJA 3HV5A 2WZJA 2PZYA 3LJ0A 4FIHA 1IG1A 5K3YA 1GOLA 5CENA 4RRVA 4TWPA 3QD2B 4R3PA 4D0XA 3MIAA 3BZ3A 3A7GA 1NW1A 3NMUF 4PP9A 4C35A 1OMWA 5ANOA 2XZSA 4YGAA 5HHWA 2BMCA 4I94A 3EFLA 4MWHA 1WCCA 3W2SA 1CKPA 3MY5A 2V7AA 3CQUA 3ATSA 3BYSA 1KWPA 1OL5A 4M12A 5GZ8A 3GCQA 2XNEA 5M4CA 1OZ1A 5L3AA 4UV0A 1Y57A 2H8HA 3FLZA 4RIXB 4A9SA 3FMKA 4F6SA 3QKKA 4C4JA 3CC6A 4C4IA 5HKMA 2XK8A 3GOKA 3W32A 4C58A 3VUGA 2A2AA 3L9MA 2PE0A 1YWRA 4ZLOA 3NVMB 3OG7A 5AR4A 4W9WA 2DS1A 3I7CA 4OR5A 4RX9A 5AX3A 2OW3A 1APME 5M06A 1CSNA 2J0KA 3ZEPA 5HU3A 5LVOA 1NVSA 1H27A 3ZLWA 2HYYA 1FGIA 4RX8A 2XK6A 4IVAA 4IZ5A 3OS3A 3HUBA 3RMFA 3ZZEA 3QZFA 3SC1A 3VUTA 4LMNA 3UNKA 5A4EA 3LFBA 1REKA 3LAUA 4LV5A 3BRBA 3R7OA 3SV0A 2PMLX 1L8TA 5D7VA 2QD9A 3BU6A 4ZJJA 3L8SA 4AT4A 3M42A 4LGHA 3PJ8A 5BVNA 4WKQA 2NPQA 1OKVA 2QQ7A 3HRBA 5DR2A 1UU7A 1BX6A 2JLDA 5AP2A 3V5PA 2CGXA 1IR3A 1NA7A 1J1BA 3TNIA 3E8EA 1WBNA 1KE7A 4JOAA 5KBQA 1JKKA 1WAKA 4F9CA 4LL0A 4YSMA 3IONA 3OY3A 4BI1A 4FNXA 2VTRA 2C5NA 1XKKA 3FDNA 4FSQA 4IZYA 2XNGA 3DFCB 5T68A 4EOOA 4IX5A 4PMSA 3RPVA 1GIHA 4QMQA 5M4FA 3AC2A 4F0IA 2WAJA 5IQGA 3TKHA 4IVDA 2F7XE 2Y9QA 1WVWA 2QLUA 2VTIA 3R1QA 4TZRA 2J5EA 4GU6A 2XNMA 3BQCA 3OFMA 2GFCA 3COIA 4FTRA 5JH6A 4HCTA 1Q61A 5HESA 4MH7A 3UVQA 4DH3A 4IAYA 4HZSA 3EKNA 5M53A 3FC2A 2QOCA 3O0GA 5HG9A 4ACDA 3NNUA 4G9CA 3SHEA 2YA9A 5HLWA 1MRUA 1PMEA 3DS6A 4PX6A 3FMJA 4DINA 3FLSA 1Q24A 3KRJA 3UTOA 5AA8A 4FNZA 3AGMA 4IACA 1FINA 4OLIA 3TWJA 5TT7A 2F7EE 3F2NA 4XP2A 3R7YA 1Q8UA 3N9XA 3AOXA 3E8DA 1S9IA 3IO7A 4IJ9A 3OC1A 4EQMA 4F0FA 2G9XA 2WTVA 4HYUA 3DV3A 3E88A 3Q9ZA 4O7TA 3NYVA 4FV0A 3Q5ZA 1IASA 4HVSA 3FQEA 3RJCA 4EQUA 4MBLA 3BELA 4UMPA 3PG3A 4OBPA 2FSLX 4RJ8A 4EOQA 2RGPA 4XBRA 3UDBA 5EM8A 3EQFA 3ITZA 4Y95A 2G2FA 4U7ZA 4L7SA 4JAJA 4PPBA 4WSYA 2UUEA 3FMMA 2R3OA 2VO3A 4O0XA 4CRSA 2F4JA 3EB0A 3K54A 4I93A 4ITJA 4YJOA 4HYHA 3HNGA 4RIWB 4K33A 4EK5A 5HE1A 3V5LA 4YO6A 2BCJA 1P2AA 2BRNA 2VWUA 4BDAA 2B9FA 2YERA 2W4KA 2VO0A 2YM8A 3WE8A 4CT1A 4JQ8A 4QMOA 4YHJA 4DFNA 1E1VA 2VZ6A 3MH1A 2OGVA 3OROA 4IAZA 5CTPA 4CFNA 5CSHA 5FEEA 4JRVA 3SRVB 4ASXA 5H3QA 5CF5A 2Z7SA 2QG7A 5M08A 2WMWA 4ZY4A 4EZ7A 5I9YA 1ZYJA 2JITA 4GIHA 3F3VA 3SXFA 4DGLC 5C8KA 4EH7A 4NZWB 1S9JA 4M15A 4S33A 5E8SA 4AT3A 3OOGA 3QQFA 4LFIA 4XG9A 3FZTA 3GU8A 2R3NA 4QRCA 2ONLC 2PU8A 5EW3A 2W1FA 2GCDA 3KB7A 4I23A 3QTWA 3PA4A 4KSQA 5HO6A 3ZONA 4B4LA 2UZOA 1UA2A 5HICA 5C4LA 3WF6A 4CCUA 4MD9E 2ESMA 1RJBA 2QR7A 4KBAA 3MPMA 4RLLA 5FP5A 4GVAA 3LLTA 2FA2A 1SNUA 3ORMA 5H8BA 3UMXA 4L7FA 3DDPA 3KMMA 3L9PA 2WMXA 3OWLA 3F6XA 4M0ZA 5AMNA 3A7IA 3MJ1A 4JBQA 2Q0BA 4EBVA 2UZUE 4HNIA 4I3ZA
chains in the Genus database with same CATH superfamily
4CQGA 1JAMA 4PTEA 2AC5A 2XIXA 5GNKA 2EXCX 3LOKA 4NKAA 3BI6A 4HGEA 3KGAA 3CSVA 1F3MC 5C8NA 3W0MA 3BV2A 3ACKA 5FGKA 4BWKA 4O1PA 3KFAA 4K77A 5B2LA 1E9HA 4C02A 5HE3A 4ZMEA 1JKTA 1PW2A 3SXRA 3U51A 4F99A 3QQLA 4ZLYA 3EQRA 2IO6A 3JVSA 2WB8A 5IMEA 5GJGA 5ACKA 1A06A 3PXQA 3VULA 4BCNA 1XWSA 2YJSA 4AOJA 1XH4A 3C4FA 4IWQA 3PSDA 4FMQA 1PYXA 2WTKC 4X0MA 5E90A 4AZEA 1AQ1A 1YKRA 2VV9A 4GCJA 3ANRA 5DT0A 3G15A 4GEOA 4ZK5A 3RK5A 5I0BA 3FI3A 3PLAE 5JN2A 2XK4A 3OTVA 5CWZA 4M69A 4AAYA 3TIZA 4I0RA 1YWNA 4G6LA 4S34A 5HORA 4TYEA 3TZ8A 1ZAOA 4XMOA 1IA9A 2JFMA 4BIBA 2GNFA 2AUHA 1BI8A 3NNXA 3MH2A 3BX5A 3FKNA 2PZPA 4HGLA 2BRBA 3IOKA 3KVXA 4P5ZA 1WBTA 4QP3A 2CNVA 3EZVA 3NVKI 5IEVA 2UVYA 3JS2A 2X8IA 5HVKA 4ZZOA 5BYZA 3PXZA 3W55A 2WTKB 5FBOA 3KC3A 3FY0A 4I41A 5HU9A 4AZFA 1CDKA 3BEAA 4E3CA 2C3KA 4F65A 1PXNA 2R7BA 1ST4A 2JDTA 3QCSA 5EHOA 3SW7A 1H01A 3PIYA 4APCA 5CF4A 4IB0A 4UMQA 5AADA 2WU6A 3F3WA 3VS0A 1U54A 2CMWA 3D2IA 2PE2A 5BVKA 4AOIA 4V01A 5ICPA 3D7ZA 4MXYA 4ONAA 3DTCA 4RWIA 2BIKB 1OB3A 2OH4A 1VR2A 3COHA 4RMZA 2ETMA 3PE1A 4XV2A 1W84A 5CSVA 5L2WA 1H00A 2Z02A 5CAQA 3O5AA 5F4NA 2W5HA 2RIOA 2Y6OA 4O91A 4FUYA 5CLPA 3VS4A 1CM8A 1OI9A 2QO9A 3EN9A 4E7WA 3POOA 2X0GA 4XRJA 5HX6A 2VGOA 5IH4A 2V7OA 3TV7A 4O27B 4Z16A 4FKRA 4R1VA 5HQ0A 4S32A 3C9WA 4AN2A 3QCYA 5J9YA 3CTQA 3RK7A 3E7OA 3RBWA 4ZJVA 4MHAA 5ANKA 2VWYA 3ATTA 3DJ7A 3Q6WA 3E93A 1H8FA 1XO2B 4PDSA 2R3FA 4RC2A 4L3LA 5IEXA 4LI5A 2QURA 2YABA 5HOAA 2O2UA 2WQMA 4AT5A 3ZYAA 3VJNA 3TUBA 4U81A 4EYJA 1FPUA 3TDWA 4IM0A 2EB2A 5C01A 4E6QA 1BMKA 5CANA 4PPAA 3JY9A 3F7ZA 2PULA 4GG7A 2YN8A 4EH4A 4U80A 3DXQA 2C47A 3QGWA 4WG4A 2YDKA 5KO1A 3ZH8A 3IDCA 3TDVA 4E6DA 3O17A 2UVZA 4RC4A 5DH3A 2YITA 4F9YA 5HE2A 3NGAA 4K11A 4BCPA 3Q4TA 4FT9A 3LCKA 3Q2MA 3QC9A 2ITWA 2REIA 2W1DA 3R9NA 4N6ZA 3QC4A 3THBA 5DN3A 4FBXA 1TQMA 4JG6A 3ZBFA 4EOKA 4C0TA 3MFSA 3KXZA 2Y4IB 3F61A 2XIRA 3GC9A 3R21A 4FKVA 4OT5A 1OL2A 2QG5A 3UC3A 3F5XA 4XG8A 4I6LA 3A99A 4GYIA 5CI6A 3EFJA 4AP7A 5L6PA 4NIFA 4GVJA 1YDSE 3G33A 4V0GB 5BUJA 4F1OA 4FYNA 1UNHA 2CKQA 3Q5IA 5IU2A 4LOOA 2IVSA 4DE4A 2W05A 2QI8A 3NDMA 3W0SA 3QD0A 3ENMA 3KF4A 4NW5A 1UU3A 4HYIA 4DFXE 4HNFA 4QP1A 4NCTC 1M2PA 4I0SA 3FV8A 4OTGA 4K1BA 4UEUA 2C3LA 2BROA 2X2KA 3KK8A 3ULIA 4BTJA 5A4CA 3LCSA 2VD5A 2BRGA 3UYSA 4AQCA 4D4VA 1JOWB 4U5JA 4RWKA 2RFEA 4AN9A 1OL1A 4AS0A 4DA5A 3ZO1A 4F6WA 4GT5A 2XF0A 5CU4A 5EQYA 5BMSA 3G51A 1DS5A 5GZ9A 2C1AA 2GQGA 3HA8A 4OGRA 4ACGA 3WF5A 3R1NA 4XOYA 2XYUA 3AT2A 2UZWE 3CEKA 4RFMA 4WHZA 4CD0A 3EN6A 4TPTA 2UZDA 4A9RA 1FGKA 5IZFA 5A4LA 3DFAA 3P86A 2QNJA 3FXZA 3ZTXA 3TM0A 3ORNA 2X7GA 5EYMA 1J1CA 2X9FA 5IQAA 4PMPA 2C6KA 4G31A 3EQDA 1TQPA 3V3VA 4FKUA 4AFEA 3OD6X 4KIKA 5DVRA 4CKIA 5LXMA 4BDEA 5LMBA 4F64A 3FI4A 2X7FA 1CTPE 4YTHA 4ASEA 4BY9E 4QTCA 3RAIA 3Q9YA 4M84A 1YDTE 5AX9A 2XJ1A 2X0QA 3L9LA 3NFFB 1YOJA 2AEGA 3BPRA 2OZAB 3ZU7A 3AC5A 2HW7A 2W1ZA 1YI4A 2GQSA 4QQCA 4UYNA 5BNJA 2WELA 4IANA 3UDSA 3NAXA 1ATPE 3TNQB 4KB8A 2C0TA 4NFNA 4ZSGA 4EOJA 5D1JA 4KIOA 5K5NA 3LIJA 5EHYA 5ITAA 5LQFA 4WG5A 3LFSA 3GVUA 2WTDA 3H4JA 3LFFA 2H34A 3S0OA 3GGFA 4OTDA 3DB6A 1OIQA 3MH0A 3SDJA 2PE1A 5C27A 4BZDA 4QQTA 4DEDA 1J3HA 3QYZA 5CEPA 4YMJA 4EH3A 3RVGA 5HZNA 4KUJA 4K18A 2XKCA 3VONA 2XIZA 4II5A 4BCGA 3TNPC 4FL1A 3PRFA 3ZLSA 4O6EA 4TYGA 4WSQA 2JEDA 4FG9A 4AXFA 2GS2A 1HCLA 3FJQE 3UIUA 4GYGA 4WOVA 4FZ7A 1JLUE 5J8IA 3KKVA 2YZAA 1ZXEA 3PWDA 2C6EA 4WNPA 4FV9A 3B2WA 4L8MA 1PKGA 3OY1A 3LXKA 3E62A 5HIEA 3O8PA 4RVLA 4FV4A 2OIQA 2R3JA 3QRUA 1YHWA 4JVGA 1KUTA 1KE6A 3O50A 3ORIA 4FTCA 3QD4A 4YJSA 4ZY6A 4AF3A 4ANNA 1R1WA 2FVDA 3DB8A 4YHTA 4APPA 4KWPA 3RAHA 2XALA 2ZJWA 3C7QA 3A7FA 4R3RA 4W4XA 4YPDA 2R3PA 2QHMA 3QZIA 3ROYA 5JFSA 4YURA 3R9OA 1XH8A 3BU3A 3ZLXA 4GH2A 5HI2A 1H1WA 5A46A 3QTXA 4FKOA 2QOFA 2FUMA 3D83A 5GZAA 4O86A 4JNWA 2UW5A 3ORXA 4L43A 3BYVA 4PDPA 4Q5HA 3MV5A 4XUFA 5ANJA 3AD6A 1UNGA 4KIQA 4IAIA 3TT0A 3NUUA 4BRXA 2VUWA 4NSTA 2DUVA 5KMOA 3KXMA 2WIPA 3P5KA 1JWHA 3G9LX 3D5WA 4UZDA 4D4SA 2O63A 3R8UA 2XVDA 4XOZA 4C59A 4F9AA 4P2KA 5FQDC 5L2QA 4Y5QA 4C34A 2EB3A 3PXRA 3VRYA 4PPCA 3TNWA 4PRJA 4OTHA 2FYSA 5IQCA 1H4LA 3CD3A 5DR9A 1IRKA 2WO6A 4QTDA 5EYCA 4O4CA 2OI4X 2UZTA 2ZMCA 4ZTRA 5B0XA 4MK0A 4YZBA 3IW4A 4H39A 2QONA 3ORKA 1CKIA 3OBGA 5D9HA 4ZEGA 5JT2A 1SVEA 2CCIA 2HOGA 2PZRA 3CPBA 1YWVA 2YIYA 3OEZA 4ACHA 5HO7A 4FEXA 3I1AA 3AG9A 1PXIA 5TR6A 2R9SA 4R7HA 2WFYA 4O21A 4X2NA 4L46A 5EOLA 3WOWA 4IAFA 1ZLTA 4JBPA 2IJMA 3LPBA 5K5XA 2DWBA 2R3MA 3TACA 2VTLA 4D0WA 3CLYA 1Z9XA 1W8CA 4IB5A 4ANSA 2XP2A 4TWCA 3G5DA 3KRWA 2BHEA 3WE4A 3ZXZA 3ZUVA 4U6RA 4F9BA 5AR7A 3KK9A 5A6NA 1JQHA 5EHLA 4F0GA 1P4FA 4IADA 4O4DA 4NT4A 3GC0A 4RWJA 4AAAA 5JFWA 4TYJA 4IDTA 2VTSA 4O83A 4Y85A 2V0DA 3QBNA 2BAKA 3GT8A 1KE9A 3NSZA 3PJ1A 1Z57A 4MYGA 2R2PA 4TYIA 3PIZA 2QKWB 1Q8WA 1R0PA 2R3LA 2ZDTA 1O6YA 1P4OA 3H30A 4L53A 4A9TA 4A06A 5HNIX 3VVHA 3QKLA 4AW0A 4O0SA 4YZMA 3LW0A 2I40A 3UZRA 3K5UA 2V62A 2GQRA 3KVWA 1MP8A 3QGYA 3HP5A 2XUUA 4I0TA 2J5FA 3TIYA 4JL9A 3CQEA 4O4FA 1ZMWA 1VYZA 3A60A 1HCKA 3KCKA 2J7TA 4IDVA 4PP7A 4RZVA 4I21A 2CGVA 5L8KA 3F82A 1Z5MA 4A4LA 4PMTA 3Q96A 2UW9A 4QMUA 3UVRA 3G2FA 3FPQA 5IDPA 3TYKA 2QOIA 3LZBA 2HZNA 2VX3A 3TTIA 3AKJA 3LLAA 3FMNA 3W8QA 4IJPA 4GKIA 3BYUA 5LJJA 3F3TA 4QMZA 3TUDA 4QMLA 3JVRA 1YW2A 1H25A 5DNRA 4E5WA 3QHWA 3PPJA 2PL0A 4HPUE 3CY2A 3DZOA 4YJVA 3UP2A 4FEWA 3CXWA 4EJ7A 4D2VA 3Q9XA 4WRSA 1YVJA 3S95A 5AP4A 4ZTSA 3UBDA 2E9OA 4YLLA 3DTWA 3KULB 5CT7A 1M2QA 5CU6A 3FQSA 5IF1A 4UALA 3KRXA 2EXMA 2C6LA 5CVHA 4MTAA 4LV8A 5HBEA 3PP0A 3QZHA 4NJ3A 2CDZA 3NR9A 2BZIB 3RI1A 1R39A 3W8LA 4EEVA 3IKAA 4ZSAA 1WBPA 2YDJA 3AC8A 4MNFA 4FT3A 3ZS5A 4EC9A 3SG8A 4O22A 3R6XA 4A9UA 4DEHA 3EL7A 3GENA 4R6VA 4D5HA 3BHUA 5IQBA 2C5OA 2GNGA 3H0YA 2I0VA 3R8VA 2VO6A 2QLQA 4K2RA 4DEBA 2WU7A 4B7TA 1GJOA 1YXVA 3S4QA 3NUAA 4G5JA 4G6OA 4EOMA 4QPSA 1REJA 1U59A 4FTAA 4J8NA 2ZDUA 3NCGA 2X4FA 3UOKA 5EKNA 2FGIA 3C4ZA 3MA6A 4ZTMA 1SNXA 3PTGA 4LYNA 5CU2A 3B8RA 3QX2A 2J51A 4JDIA 3VS6A 4KD1A 2PHKA 3QXOA 1G5SA 4IAAA 1GZNA 3A7HA 3V51A 4W8DA 1YOMA 2WIHA 4Y83A 3DKOA 3NWWA 1TVOA 4FOBA 5AM7A 5A9UA 1OIYA 4GSBA 3EHAA 4NW6A 5KMNA 1W0XC 1XJDA 1LP4A 5M44A 2A19B 4DGOA 5BYLA 3FKOA 2RKUA 4IVBA 4CFXA 5L2TA 3TZ9A 3F66A 5E8TA 2EVAA 3F3UA 4XLVA 4E4XA 3ORLA 3P7AA 3QTZA 4F1TA 3QWJA 4D58A 5LMKA 5JK3A 5I3RA 3I7BA 2IZUA 3E8CA 3HMIA 4AGWA 1NT2A 5FTGA 1GIJA 2ACXA 4RT7A 3OWKA 4ZIMA 2IVTA 3DXPA 3V5JA 5IQFA 2VTOA 3KY2A 2X7OA 3KRRA 4HVIA 5F20A 4IH8A 3UOLA 2JKQA 4QMNA 4DEEA 2I1MA 3D5VA 3R1YA 4TXCA 1YDRE 4RJ4A 3BKBA 3GI3A 4NTTA 2R5TA 3QUEA 2VO7A 4FKSA 3B8QA 3BLHA 5HE0A 1GAGA 3U54A 5FLFA 2BFXA 3DLSA 2G15A 5ETCA 3AMYA 3SA0A 1XH5A 5JRQA 3OCSA 3JR1A 1PJKA 2YM6A 3SW4A 3UGCA 3KXGA 3T3VA 3EIDA 4YU2A 4ZSEA 4G2FA 4AZTA 3LQ8A 4HYSA 4I6FA 4QTBA 3L1SA 4FR4A 5DT3A 3NW7A 4YP8A 4RBLA 3TCPA 3WI6A 5AV2A 3JPVA 1PXKA 3VRZA 1ZOGA 4RG0A 4FT0A 5KUPA 2H96A 4F4PA 2JDVA 4IHPA 4BBFA 2BPMA 4ERKA 5L6WL 5FBNC 3OWPA 4GS6A 1XMLA 4YNOA 3JXWA 2ITQA 3PVGA 5EW9A 2OIBA 3D7TB 3ZFXA 3R8PA 3OOMA 2B54A 3KN5A 5ETFA 4JBOA 5BUIA 2ETRA 3ZO2A 4FV5A 1NVRA 2XB7A 3P08A 4MEDA 3U6IA 4BJJB 2JGZA 2WNTA 4CT2A 2R3RA 3KQ7A 4DFBA 3ZC5A 3N4UA 1DAWA 2WOUA 3UC4A 5FXSA 4RIYA 3W0NA 5CSXA 4HCVA 2WTCA 4XBUA 4DGGA 3UJGA 2UW0A 1UKHA 4Y5HA 1M52A 1M14A 4M66A 4JX3A 4Q2AA 3R8MA 3U87A 4DAWA 1V1KA 3OTUA 5JRSA 3OBJA 4RLKA 1BYGA 4FT7A 4H3QA 2O0UA 5E7RA 3V5QA 3FHIA 1E1XA 4UXQA 3TV6A 3VUKA 3ZFMA 3MA3A 4ANQA 4CXAA 2GHMA 3NLBA 4R5YA 4WBBB 4XRLA 4YC8A 2OZAA 5IUIA 1A9UA 3TL8A 4BTFA 3NIZA 3BL9A 3DDQA 4IWPA 5TO8A 1B39A 3G6GA 3FMEA 4O7LA 3ZFYA 2GMXA 4ALVA 3FC1X 4JDHA 5HVJA 4MBIA 1QL6A 1Y6BA 4CTBA 4GG5A 3G90X 1VYWA 2HWPA 5EYKA 4N70A 2YM7A 4DHFA 4ORKA 4QMSA 2NRYA 1ND4A 4CFWA 3P78A 1UV5A 3LE6A 3MBLA 3UNJA 5J5SA 3BV3A 2J9MA 4AG8A 4RQKA 4MNEB 3QQJA 5CEQA 1KOAA 1O9UA 4WG3A 4TTHB 5I9WA 5L8JA 4FV6A 4O7SA 4GUBA 4XCUA 4DF3A 4FTIA 1J7UA 1OIUA 4YTCA 2ZV7A 2GU8A 2W96B 2YIXA 4DEGA 3PXYA 2W99B 4C8BA 2PUPA 4NTSA 5C1QB 2YDIA 3OEFX 4EZ3A 5DE2A 4TRLA 5L2IA 5F1ZA 5M57A 2P3GX 1IAHA 1PHKA 5AP3A 2PUUA 5AA9A 5FP6A 1OITA 4FKTA 2YIWA 4F08A 2PYWA 2VTPA 5EOBA 4LUDA 4S30A 4IWOA 4UWYA 3LCOA 4WNOA 4CYJA 2CNUA 3P0MA 2QVSE 1DI9A 4FSUA 4OW8A 4AA0A 2PMNX 4EH5A 3BGPA 4JI9A 3FHRA 2ITTA 3TJCA 4CG8A 2PWLA 4QYEA 2OKRA 4Y73A 3BE2A 3BYMA 4RJ5A 5C9CA 5JZNA 1Q5KA 2XYNA 2HY81 3DT1A 3GFEA 3EL8A 4JBVA 3S2PA 5KKRC 2XARA 2R3KA 3NZ0A 4MKCA 1XHAA 4EBWA 3BGQA 2AC3A 2PVMA 4O96A 5FXRA 4E4NA 5KZ0A 5AM6A 2RFDA 2V55A 3HL7A 3PVBA 3W2PA 3QAME 4I20A 5IUGA 4MQ1A 4QNYA 4MWIA 2C5VA 4FSRA 4FUXA 4C33A 3VNTA 5HLNA 5CSWA 4ARKA 4R5SA 5IDNA 3DKCA 4IZAA 3MPAA 5KE0A 4WIHA 2GTMA 4BVUA 2I0HA 3G0EA 2E9PA 3LFCA 4X3FA 4LRKA 4U3YA 3UPXA 4BGHA 2IW9A 5E8WA 2ZAZA 5CF6A 3R9DA 3H3CA 3WF9A 4F7LA 3DJ6A 4JS8A 4KNBA 4QP7A 4C3PA 4BCKA 5IISA 4DG3E 3ALOA 3GFWA 4GIIA 4YC3A 5DMZA 4U41A 5CQUA 3CKWA 4I6BA 5GINE 2PTKA 5KKRB 1OKWA 4EOPA 4PNIA 1Q3WA 5DLSA 4PUZA 3VW6A 5CXZA 1LPUA 4CFFA 2WQEA 5CF8A 5E8UA 3DNDA 4PMMA 1WVXA 2JKKA 3QLFA 3VHKA 3DAJA 3E3BX 1H0WA 2E9VA 3W2QA 4OAUC 3LXLA 4G3DA 4KBKA 4KS8A 5ACBC 2R64A 3KF7A 3V8WA 1M17A 2CN8A 1SM2A 3MW1A 4FK6A 1SYKA 4YLKA 2Q83A 3LQ3A 3FMLA 3C0HA 4H1MA 3FAAA 3FZSA 5FEDA 5J1WA 3KREA 2BZKB 2XMYA 4IM2A 2W0JA 4IAKA 4Y72A 3GP0A 4AUAA 4H3BA 3VW8A 4FTJA 3IGGA 5C8MA 2OXXA 3R7UA 4IMYA 5L8LA 3VQHA 3IG7A 3AT3A 3FYJX 3KXNA 3BBTB 4Y8DA 5K0XA 4FV8A 3IDBA 2FSTX 2ITVA 3MY0A 4B8LA 2WTJA 3DBDA 4KSPA 1Q8YA 3RALA 4EKLA 3VUIA 3QHRA 3L8VA 3UZPA 4FJVA 1WBWA 2B53A 3C0IA 4CMOA 3R83A 4EC8A 4W4YA 3HV7A 3NFGB 4CLIA 2GDOA 1WBOA 5IA0A 3GC8A 3RK9A 3D5UA 4M8TA 3ZSHA 4AFJA 4AE6A 4BB4A 3QQGA 4WNMA 4DHIB 5AR8A 5CU0A 2HZ0A 5E8YA 4HCUA 3FBVA 3I5ZA 5DEWA 5EH0A 2VWXA 3BHTA 4RIOA 3ID6C 2QC6A 1UWHA 3F88A 4GMYA 3SGCA 4L44A 3KA0A 2V22A 1B38A 4XV9A 3D15A 4MF1A 1U5RA 4AWIA 3R7IA 1YHSA 4E93A 1W7HA 2CJMA 3B2TA 1R0EA 1K3AA 2OXYA 2Z7RA 2WHBA 1ZWSA 3LM0A 2HELA 3M1SA 4FSMA 4BDGA 3L8PA 1SVGA 3LM5A 4J97A 1Y91A 3PA3A 2BKKA 3FI8A 2OXDA 1AD5A 4XHKB 1H08A 5AUUA 4FKPA 2DQ7X 2X1NA 5EM7A 3SD0A 4YO4A 3IS5A 3BU5A 5BMMA 4R3CA 1OPLA 2OO8X 3D2KA 3IW8A 3SX9A 4ACMA 4HJOA 2QU5A 4I4EA 4BC6A 4DG0E 4FL3A 4D1SA 4E1ZA 3JYAA 5HIDA 5C03A 3U4WA 3S00A 4AGDA 5FD2A 4FIGA 4TYHA 1YRPA 3RAKA 3V5WA 4CVAA 2XAOA 3UE4A 4AZSA 5D12A 1FVRA 5H9BA 4N57A 1H1QA 2Y6MA 4QDVA 3PJ2A 4LUEA 4IX3A 4UMRA 2J90A 2W17A 3IDPA 4FKWA 4IFCA 4L68A 4QYGA 3UO4A 4EK3A 2I0YA 4MF0A 3DLZA 4L6QA 2QOHA 1UU9A 2BRMA 3QUDA 2W1GA 4BWXA 4JG7A 3NUNA 5TKDA 3R9HA 5BVOA 1GNGA 4O7NA 3VBVA 1KE8A 2ZV8A 4KBCA 2WMSA 5AUWA 3GU7A 3UIBA 2UZBA 5IKWA 3DZQA 5CX9A 1WBSA 3BE9A 2UZVA 5AAGA 4YNEA 1ZYDA 4IVCA 2A1AB 4GL9A 4PF4A 1O6KA 3WZEA 2X0OA 2CHLA 3LFEA 4BCJA 5BUEA 3ZXTA 4FEVA 3O2MA 4P5QA 4D2PA 3TV4A 2B55A 5KHXA 5KZIA 3VBYA 4FIEA 4FTLA 5HG7A 3P5JC 2BKZA 3GEQA 3I0QA 5HX8A 4YJPA 4G17A 4QOXA 4C36A 2JIIA 2EXEA 1I44A 2X9EA 5AR5A 1ZZ2A 3MB7A 2JDSA 4QMXA 3GCVA 4FICA 5HD7A 1H24A 2CCHA 2OJGA 3T3UA 5AP5A 2ZV2A 4YC6A 5AR3A 3QZGA 3BQRA 3R8LA 4B0GA 1PRYA 1FMOE 4LOPA 3KRLA 2B9HA 3D0EA 3I6WA 3O8UA 3PVWA 3REPA 3PUPA 4DH7A 1JSVA 2XIKA 4FVRA 4XJ0A 5BQ0A 3MSSA 2VWWA 4O6LA 1URWA 3ZC6A 4QYYA 3FY2A 4DFYA 4QMVA 4YBKA 1JSUA 5BPYA 5JGAA 2PMOX 3PY0A 1O6LA 4RIXA 4CRLA 3L8XA 4L42A 3RZBA 1XMMA 4QDEA 3HA6A 2VAGA 4DC2A 2R7IA 4XP0A 3O96A 3OCBA 5J1VA 2CPKE 5BVEA 2B52A 3NYNA 4IEBA 2X4ZA 4BFMA 4NKSA 4FZDB 3HLLA 5JGBA 3C4EA 3O7LD 1ZMVA 3R71A 4I4FA 1TQIA 2ZYBA 1YI6A 4LRMA 5LVLA 4AZWA 4F9WA 2HY0A 3O51A 4NM0A 3V5TA 4UN0C 1OBGA 4RJ3A 4O81A 2C69A 2VX0A 2R4BA 2C30A 3ODYX 4DDIA 2PVRA 4KIPA 2F49A 2R3IA 3HDMA 4MXOA 4D9TA 4PNKA 3FMDA 4GJ3A 1J91A 1TZDA 4JQEA 3I0OA 3IW5A 2A98A 2ZM3A 3QUPA 4P7EA 2QOKA 4W8EA 4CV8A 5LVPA 2C6TA 2VN9A 3LFAA 4EUTA 3QX4A 1OGYA 2VWIA 3QTSA 5ANDA 5A14A 4IQ6A 4IB3A 2GNIA 3JUHA 3R1SA 1P5EA 1LR4A 5AUYA 5LARA 2QOOA 5CNOA 1WVYA 4FVPA 5I9VA 5FDPA 5IEYA 5AP0A 2ZOQA 2A27A 3ZUUA 4HGSA 1YQJA 2JBOA 4Z55A 5EW8A 3S1HA 2PZIA 1VZOA 2VTTA 3LMGA 4QMWA 4ZLZA 4CLJA 2P2IA 2ETKA 4NWMA 5AV3A 5BV3A 5EM6A 4JAIA 3QXPA 3MPTA 4EH8A 2GS7A 3R28A 5I3OA 4C38A 3PY1A 3MVJA 3RPYA 1XH9A 2XJ0A 3F2AA 4FSWA 4HPTE 3MS9A 4FA2A 5HTBA 4PV0A 3AD5A 2H9VA 3D7TA 3QTRA 1GZKA 4XG6A 3GU4A 2GFSA 5EDRA 3VWAA 5BVDA 3CGOA 4QP8A 1DM2A 4NFMA 5H8EA 3UDTA 5FDXA 4EUUA 3DBEA 2P0CA 4P90A 1PYEA 2XNOA 4BJJA 5GJFA 4RVTA 3ZM4A 3F5UA 4MUQA 2OH0E 3QA0A 5AIKA 2XKFA 5J87A 4L00A 2HXQA 4BBMA 4O4EA 5CYIA 4BDCA 1Q3DA 3ZO3A 4J96A 3TKIA 3P1AA 4O1OA 3LFQA 4YBJA 4FKJA 2JIVA 3C51A 3CR0A 5JEBA 1UVRA 2ZB0A 4CKJA 2A4LA 3FLYA 3K3JA 3K3IA 4ZY5A 1Y6AA 4AXAA 4D2RA 3LMIA 3FLNC 4ZTQA 2QKRA 3UPZA 4ZS0A 3WZJA 4BWPA 4NJDA 5K9IA 1FMKA 4ALUA 5AV0A 1QMZA 3BCEA 1H28A 3MVLA 3U9NA 4EK6A 3FI2A 3PY3A 4FTTA 4GJ2A 2LAVA 2VTMA 1MUOA 4JIAA 3C5IA 2QR8A 4F63A 4A4OA 2CGUA 3HRFA 3IGOA 3VS5A 5E4HA 4F1MA 2WMAA 4DH5A 2XIYA 5DHJA 1NXKA 3OW3A 4TL0A 5CQWA 4N4SA 2QOBA 4YJQA 4CFVA 5IG1A 4FNYA 4X3JA 2GHLA 4ZSJA 5FM3A 5AV4A 4RIWA 1PXOA 5D10A 3OCGA 4H3PA 1FVVA 1NY3A 4JDJA 3P7BA 4TKSA 3OWJA 4R7BA 2Y4PA 5EI8A 3EZRA 3D9VA 2CKPA 3R7VA 4GKHA 5K0KA 1V0PA 2ERKA 2B9IA 4FVQA 4BDFA 2CKEA 4FGBA 4ITHA 4WRGA 3WBLA 3QTQA 2ITZA 4BTMA 4R78A 3TI1A 4DEIA 1W82A 5JSMA 2QO7A 3PZEA 3SRVA 1YXUA 2E2BA 2GPHA 3C13A 3BBWA 3UO6A 3VBTA 3VS3A 3R02A 4D5KA 3HVCA 4F7SA 4I6QA 5CEOA 4BZOA 5J5TA 5M4UA 3M11A 5JQ8A 5DBXA 2YIRA 5A6OA 1ZARA 5DRDA 4E6CA 4HVGA 4WA9A 2R3GA 4H1JA 3PPZA 4IM3A 2FB8A 5DRBA 2CGWA 3R0TA 5FM2A 4EL9A 4FZ6A 3COKA 3TZ7A 4HGTA 4BN1A 5BVWA 5KHWA 4UZHA 2LGCA 4V04A 1YXTA 3W2RA 2OICA 2HWOA 4BDIA 4BHZA 3UQFA 4BL1A 2Y0AA 4C61A 3OW4A 4PDYA 3FMHA 4JMQA 3WZUA 3KMWA 2G01A 4FEQA 4U97A 5I9ZA 2J4ZA 3RM6A 4DHJA 2BDWA 3ELJA 4JT3A 3HX4A 2WEVA 3ZEWA 4PTGA 4UMUA 1OBDA 3HV3A 1KV1A 3DGKA 3OUNB 2F2UA 4EONA 4XLIA 4MXAA 1V0BA 5CALA 3RGFA 4ZXTA 5KMKA 4X2JA 1XR1A 2G2HA 3H9RA 4TW9A 3PFYA 2BALA 5B7VA 4ZOGA 5K4JA 5EKOA 3A61A 4USEA 2F7ZE 2YM4A 4BCHA 5I9XA 3H10A 4NH1A 4C2WA 2IZTA 2ZMDA 4YTIA 5DPVA 5ANEA 3MY1A 2XK9A 3Q04A 3UQGA 4UBAA 5F94A 2X0PA 4P4CA