2W5HA

Human nek2 kinase apo
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
277
structure length
265
Chain Sequence
SRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSHRDLKPANVFLDGKQNVKLGDFGLARHDTSFAKAFVGTPYYMSPEQMNSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE NEK2
publication title Insights Into the Conformational Variability and Regulation of Human Nek2 Kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 265
sequence length 277
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2w5hA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2w5hA01
4ZTHA 2VTOA 3PJCA 2QHMA 3COKA 3PXKA 4EOPA 5CYIA 4BCPA 4EWQA 2OJ9A 3KEXA 5AP2A 4O84A 4JIKA 2XIRA 3IW5A 4FTIA 3R02A 1RE8A 1H1SA 5E92A 2E9NA 3EB0A 3FYJX 4CFFA 1NVRA 5CT0A 3I6WA 4K6ZA 4DC2A 3NEWA 2UZEA 1KOBA 4R1YA 3DDPA 3HMMA 4Y72A 2I40A 5HCZA 4QMMA 3TTIA 2G2FA 1XHAA 2XK8A 5FDXA 3EQIA 3BBTB 3QTZA 2W1FA 4C34A 4ASXA 1GZKA 3MB6A 3OW4A 5DEYA 3RJCA 3PXYA 3II5A 4G6OA 1OL2A 3PFQA 1M7NA 5J9ZA 2GHMA 3KMMA 2IPXA 5CI6A 1YOJA 5J79A 1XBAA 4EK3A 4UWYA 1OI9A 3UOJA 3HUCA 4QTBA 4DEAA 3F9NA 2GNHA 5KCVA 4ZMEA 2G9XA 4YC3A 3VRYA 4I41A 5A9UA 2CGVA 3VS5A 2XMYA 1OPKA 1OKWA 2YACA 4EQMA 1OL7A 3CCNA 4XLVA 1OECA 3RK7A 4NCTC 2VTPA 2J0KA 4YJVA 5AWMA 1Q8ZA 3I7CA 4CG9A 3FXZA 3HMOA 4IB5A 1VYWA 3AT3A 2HW7A 3EQPA 4FZDB 2BKKA 5FEDA 4ZXTA 4WRSA 5KBRA 2J0LA 3GCUA 2UZOA 4S34A 4FKWA 4PDSA 5CEPA 4FIFA 3GOKA 2ERZE 2Z7LA 4QMPA 5DOSA 2ZB0A 4FL1A 4FVPA 4FSNA 4ZZNA 5AR5A 5M55A 3T3VA 4RA4A 2CNVA 4NU1A 3U55A 4IVBA 3TKUA 4D28A 4IMYA 2EWAA 4PPAA 3ZYAA 4A9RA 1KV2A 3MH1A 3L9PA 4USDA 4O22A 1ZY5A 4UXLA 3LJ2A 4A9SA 4FT5A 3JPVA 1L8TA 3GFWA 3KRWA 1FVRA 4IW0A 4FSYA 2CGXA 3TV4A 1G8SA 3KMUA 4FZAB 2RFNA 3I5NA 3UO4A 4DTKA 3PWYA 1MUOA 3V04A 3V01A 2YERA 1YXXA 3IW7A 2WTIA 4JDHA 4XG7A 5E90A 3TZ9A 1JKTA 4MCVA 3OUKA 5ANDA 4O7WA 2BRNA 3UMXA 3VF8A 4UBAA 2WTJA 2ITOA 5CY3A 2YHVA 1V0PA 2UZWE 3BU3A 4EBVA 4O0XA 4YTCA 3ODYX 3HUBA 4JXFA 3D7TA 2VO6A 3VVHA 2WU7A 4NZWB 3PUPA 4C2WA 5I3RA 4W4XA 5HO6A 3MIYA 2VGPA 4L7FA 4O82A 1JSVA 4MYGA 2W05A 1YHSA 3BQCA 4LOOA 5G1XA 4EH5A 2VTQA 1LPUA 4YR8A 3MI9A 2BROA 3HYHA 5LVNA 2B54A 4XP3A 2G15A 4RMZA 4GG5A 1FBNA 1Y57A 4M67A 1MRVA 4WNOA 4AZFA 4WNPA 3PA5A 3FL5A 2FSLX 2X1NA 4AOIA 5KKRB 1V0BA 4II5A 1LP4A 2UZLA 4YBJA 1E1XA 3BI6A 2VAGA 3ZMMA 4FKJA 5HU3A 4IVDA 3LZBA 4GS6A 3PJ3A 4BN1A 3QKMA 4J97A 1Q5KA 3HV3A 4QQJA 3KY2A 4YSMA 4G5JA 5DT3A 3UOHA 2BRMA 5LVOA 1URWA 3WF6A 2YWVA 3R8ZA 1WBPA 4DEBA 4IM2A 2VUWA 4J53A 2IW6A 3P4KA 2C4GA 3ERKA 4E6DA 4F99A 5H8EA 5AV4A 4G3CA 4NSTA 2PVFA 3FLSA 5LARA 4QTEA 2W4JA 2CDZA 5C1QB 2GNFA 1A9UA 3FQEA 3UG1A 4CV8A 2W5HA 3LFDA 4F6WA 5HQ0A 5AV3A 3FMLA 2JITA 2JFMA 4EH9A 3GQIA 4JVGA 4W9WA 2CSNA 3HAMA 3QD0A 1S9IA 3G0EA 4XHKB 4CKJA 1LEWA 2HZNA 3I0QA 4FNXA 4YC6A 4ZSJA 3F3UA 3CPCA 1OL6A 2XVDA 3FLZA 4FVQA 4ENYA 1EH4A 4IVAA 4U45A 1WZYA 2WOUA 4ZLZA 3QZHA 3AMAA 3DBQA 3QALE 3U9NA 3TM0A 3UDBA 1OZ1A 1RDQE 1P2AA 4I4EA 5FTOA 4J8MA 2Z2WA 3I6UA 5CU4A 4A9UA 3ZC6A 3CGFA 5FWKK 4AZEA 3KXMA 4AT5A 5JZJA 3COMA 1BX6A 3DKCA 5E7RA 4E93A 2FYSA 2GQGA 3RVGA 5J87A 4U81A 3ITZA 3LQ8A 3MIAA 2XB7A 4RFMA 5DG5A 5CF5A 5LMKC 4J7BA 4FV1A 3R8VA 3EQRA 4G3EA 5AP6A 4BZDA 2BALA 2OZAB 5HCYA 3ORNA 3ALOA 2R3NA 2Z7QA 4FNYA 2F49A 4GIHA 4AP7A 5JMSA 3MBLA 3R63A 4LGDA 4E4MA 3A7IA 3BHTA 3K3IA 1WAKA 1TVOA 2XBAA 1O6LA 2YCRA 3LM5A 1PY5A 1MQBA 2X81A 3DQXA 5JGDA 2PUIA 3F88A 5L2QA 3R04A 3BBWA 3CTJA 4XMOA 1XBCA 3A2CA 2VZ6A 3PE1A 2I0YA 4ANMA 3QFVA 4IJ9A 4DITA 5J5TA 4ZOGA 4N57A 4BICA 3VS7A 4AGCA 3NMUF 3KQ7A 5BUEA 5BVNA 1PXOA 3LLTA 1MQ4A 4PPBA 3TNHA 3NS9A 5ETFA 2V55A 2WHBA 1R78A 2BCJA 3E8EA 5AUXA 4DHFA 4YJNA 2F7ZE 3OW3A 3DKOA 3DBCA 3NNUA 4KUJA 3ZLYA 4O21A 2BHEA 4R3CA 4QMOA 3LFAA 5AP1A 3UO6A 3HMIA 1XH8A 3VJOA 2QO7A 5IH6A 3LCTA 4I5PA 3R8LA 5BVEA 2J9MA 2BTRA 4IIRA 2G2IA 5EDRA 4C58A 3DU8A 1KV1A 3DZQA 3KL8A 4D55A 3IW6A 2WO6A 3QQHA 2JLDA 2ITPA 4G6NA 3ZH8A 4AZSA 3IDPA 5FUTA 3TNQB 3ODZX 2WZJA 4RIXA 1YDTE 4YTIA 4AF3A 2IZSA 2W17A 4FVRA 3ZEWA 3GEQA 1NVQA 3TUDA 4O7VA 3OXIA 3PLSA 1W83A 2JC6A 3PPZA 4KS7A 3RMFA 3KRLA 3UQGA 3WILA 2VX1A 3ZSHA 2C6TA 4O6LA 5KMKA 3HX4A 3DS6A 1W0XC 1OITA 3HP5A 2YIQA 4G3GA 4M15A 4CXAA 3BCEA 4MX9A 5F95A 2YM5A 1H8FA 3NCGA 4I6HA 3HZTA 4ALVA 2HZ4A 2VN9A 1ND4A 3ZHPC 4DINA 4F0FA 1XQZA 1U54A 3GGFA 4L7SA 4EQCA 1M2QA 2R3HA 4GG7A 3P7AA 5T3QA 2ZDUA 3ORTA 2C6LA 4MWIA 5L2SA 3P86A 2QOHA 3OROA 1YDSE 4UMTA 2XZSA 3L9MA 4F4PA 4O86A 1OVEA 4UMRA 5CENA 4O83A 2RGPA 2UV2A 3HNGA 2H9VA 5C27A 4ZS0A 3Q2JA 1SVHA 2OH0E 1NA7A 5IA2A 5M4FA 3AC4A 2XBJA 4U6RA 3C4ZA 2W96B 5KZIA 3A60A 3KREA 4DAWA 4F9AA 5C8KA 3WF5A 3SAYA 2C6MA 3QD3A 2QG5A 2OK1A 1LR4A 4FI1A 1YXUA 3F82A 3I1AA 2YM7A 5CEIA 5JT2A 2PMOX 4FT9A 4LGHA 4PMSA 2ESMA 1Y91A 2QOBA 5A3XA 1AD5A 3O0GA 4OTHA 3GT8A 4RSSA 5BMSA 4C61A 4IC8A 5AUYA 2VTNA 4LI5A 5IKWA 5M4CA 2G01A 2YISA 3C7QA 3NGAA 4C0TA 2CLXA 1YVJA 4TNDA 4BCJA 5AUVA 4HPUE 4F63A 2F9GA 4AX8A 3DY7A 1YQJA 2YDIA 4XYFA 3U4WA 4UALA 1H28A 3ETAA 3MDYA 5I4NA 5IF1A 5FXQA 2GS6A 4A9YA 4MXOA 2J2IB 4L00A 4F9CA 4ASDA 4R5SA 1PXPA 2OJFE 4FE2A 2FVDA 4JBVA 4PMMA 5ANIA 3G9LX 5FG8A 2YABA 2BDFA 2Y9QA 5B2MA 2F7XE 2DWBA 3QA0A 2YCFA 1Z5MA 3OWPA 3PIZA 5DEWA 2YDKA 3CJFA 2J0MB 2OLCA 1V0OA 3BU5A 4DGGA 4F7SA 4AGDA 5AJQA 1UWHA 4I0RA 2EXCX 3AXWA 4DE4A 4ZTSA 2JIIA 3EKKA 3KRJA 2W9ZB 4E5WA 4ZZOA 3FLQA 3QBNA 2CMWA 1K2PA 4I94A 3GUBA 4MD8E 3OFMA 3SRVB 3GU4A 3JYAA 4M84A 1OUYA 3KCFA 4PDPA 3BZ3A 2ZOQA 3QCSA 5AV2A 5IMXA 4BIEA 4O7NA 3WYYA 4EZ3A 2ONLA 4DA5A 3M2WA 3DFCB 3FC1X 4RX7A 4MXAA 2QOIA 2XYUA 2XNGA 3AMYA 3GB2A 4L8MA 5BVFA 2W1GA 3FZ1A 5CXHA 2ZMDA 4F7JA 5DMZA 2OXDA 4L45A 2QLUA 3CQWA 1JBPE 3EYGA 1YHWA 3HLLA 4IAIA 5HG8A 3Q4CA 3WF9A 5I5ZA 2V5QA 1FQ1B 2J0IA 2OGVA 3EN4A 3NUNA 2W06A 3OBJA 2AC3A 4AA5A 5A46A 3LCOA 1M7QA 1WVXA 3KN6A 4ENXA 3FEGA 2HWOA 1Y8YA 4DH8A 2RKUA 2CKPA 3MH2A 4EK5A 2X7GA 3D2KA 4LFIA 3S95A 2BFXA 2Y7JA 5CLPA 3SG9A 3F69A 3C9WA 5M51A 2I1MA 1WVYA 2JKOA 1SMHA 4JQ7A 2UW5A 3MH3A 1XH6A 3V8TA 4YLKA 1PKDA 4AFJA 3P0MA 3QX2A 4NM5A 4YJQA 3H0ZA 2XJ0A 4L46A 3GXLA 4CZTA 5IU2A 3DT1A 1PJKA 3I81A 2QKRA 2GNGA 1XWSA 4JX7A 1PXJA 3R7GA 4BFMA 3U4UA 4S33A 1P14A 2A1AB 4I0SA 5CQWA 3SKCA 2O8YA 4FT7A 5KUPA 3FZOA 4DF3A 4RC2A 4D5KA 3HDMA 4H3BA 2CN8A 5TR6A 5HCXA 3MVLA 5IQEA 4KBKA 4O7RA 4OBOA 2YCSA 4DEHA 4XP2A 2OZOA 4OTIA 5E8TA 4DBXA 3UNJA 1HCKA 4H3QA 4G1WA 5EKOA 4DH3A 4IAZA 2YJRA 3IDBA 3BQRA 3VC4A 4JJRA 3QQUA 3EJ1A 3DA6A 3L9NA 4BKZA 3FHRA 4MBJA 5EKNA 3PXRA 3FE3A 1H4LA 3W33A 1TQMA 2C6OA 1APME 3BWJA 2A27A 2R9SA 3R8PA 3KRRA 2J90A 4FKLA 2J5EA 3KCKA 3QGYA 1OMWA 5C9CA 5M53A 3JR1A 4QP7A 2CHLA 5D11A 3FQHA 5CEOA 5EYDA 3TTJA 3DJ7A 1WVWA 5HNGA 3W2CA 2ZM3A 5CU0A 5CVHA 3ACJA 3Q2MA 3CC6A 4RVKA 4BI1A 4IWPA 4FUYA 5I9XA 1CM8A 3EFKA 1RW8A 4QMVA 5ICPA 1HCLA 2WFYA 2WMXA 3VQHA 3BIZA 4GCJA 3COIA 2FSMX 4JQEA 4ZSGA 4GFGA 4IX6A 5H2UA 1CKJA 4DFLA 5IH5A 3UPZA 3UC3A 2C68A 4XP0A 4YTHA 4RQKA 3FJQE 4QPAA 3SDJA 2WOTA 2PHKA 5E8SA 3D2IA 3RCDA 4C37A 4EQUA 1A06A 4EHVA 4CVAA 5DI1A 4BWPA 2C0TA 4PWNA 4G3FA 3DAEA 3TWJA 4YJTA 3QQKA 4K2RA 2C0OA 1J91A 1Q61A 3ZSIA 2PVMA 4BGQA 4I20A 1STCE 3R28A 4ERWA 5EQPA 2YCQA 5JH6A 4ACCA 3F61A 1XH4A 3O8PA 2GMXA 5AADA 4FEUA 4O1PA 3QXOA 4AW0A 3C4EA 3KVWA 4CQEA 4FA2A 3PRFA 4ZAUA 4KKGA 4XUFA 3ZU7A 4I22A 1LEZA 2P4IA 5ANJA 2ITZA 2OSCA 4F6SA 3MJ2A 4WRGA 3LFFA 3MB7A 1UV5A 4JL9A 3R6XA 5JFXA 3LIJA 3IONA 3I60A 1BL7A 5T6KA 5ETIA 3V8WA 4U42A 5IQHA 4R78A 3DNDA 4UMPA 2QOKA 3UTOA 2GDOA 2OU7A 4LM5A 5ACKA 4AE9A 4IEBA 5AR4A 4FIHA 2WEIA 5CSVA 1K9AA 3HRBA 4EORA 4YPSA 4J98A 4RZWA 2X4FA 3SRVA 3EMGA 3W1FA 4EJNA 5CZIA 4YJUA 1IRKA 4UY9A 4EUUA 3MYGA 3EYHA 5KNJA 4D5HA 4I6FA 3BV3A 2VWIA 3KXGA 4M97A 4ID7A 3ZUVA 4NJ3A 2QOFA 1WBVA 2C1AA 2BUJA 2ETMA 2QOCA 4W4WA 5EI8A 4Q9ZA 2E9UA 5C4LA 4X21A 4LQMA 3IK3A 3W2SA 2C69A 4R7HA 5LJJA 3NUXA 3VF9A 5L3AA 4FV6A 4U7ZA 4X2FA 4GW8A 3H4JA 3IKAA 3OCBA 5E9EA 4D4YA 2UZVA 4EHGA 4EOMA 3WIGA 2JEDA 4BCKA 2G2HA 2PY3A 2Y0AA 4XNEA 3W55A 3SLSA 5FRIA 3ZXTA 4QQTA 3V6RA 1F0QA 3UG2A 4K33A 3VBWA 4R5YA 2XNNA 4UB7A 1JVPP 4L9IA 4O0TA 2GCDA 2WMAA 5K0XA 2XIXA 4IZYA 4GEOA 4J52A 5K3YA 4BTJA 3COHA 3FI2A 3H30A 4X6RA 3R22A 5DT0A 3B2WA 1W82A 3SHEA 2QODA 4CGAA 1XKKA 1ZOGA 2EXEA 1KE8A 1PF8A 3DCVA 5AAEA 2WMTA 3SV0A 2O3PA 4YZMA 1FGIA 4EKKA 3SQQA 2X8DA 4RQVA 2OIBA 5L2IA 2IZUA 3B2TA 2BZJA 4ASEA 4NW5A 3NYXA 5AP7A 3PDTA 5IQFA 3KULB 3OEZA 3VUDA 4B8MA 4RJ4A 2W0JA 1XBBA 2UVYA 4KRCA 4YHFA 4QP1A 1BI7A 2BAJA 2PVLA 3Q53A 4PTGA 5HG7A 4MF0A 4C4HA 4DH1A 2PVHA 4C35A 1JNKA 3EFJA 3GU8A 4G5PA 4XG9A 2HXQA 4R7IA 3OD6X 3DBEA 4RJ8A 4CQGA 4CV9A 5JKGA 5F4NA 3ZRKA 4QD6A 2X6DA 3GBZA 2CNUA 3CXWA 3MESA 4HYIA 4ZSLA 4CG8A 5CEQA 4YO4A 5AM7A 4BCGA 5BYLA 3QAME 4QO9A 3EQBA 4IACA 3LXPA 4BKYA 3HP2A 4IDTA 4YPDA 3LCSA 4BI2A 4L43A 3PXQA 5AMNA 4IZ5A 5TT7A 4U8ZA 3LXKA 3HGKA 3QUPA 3BU6A 4NJDA 4K18A 1J3HA 4YNEA 5HX8A 3QQJA 2YLEA 2CKQA 3KB7A 4BCOA 1XO2B 3AT2A 4XRLA 1OIYA 4M8TA 5B2KA 1URCA 2GPHA 2WTKC 1IG1A 5HESA 3D7ZA 2QNJA 5M09A 2PTKA 3N51A 4JI9A 4DGMA 2C3IB 4I92A 5KE0A 2QU6A 4JBQA 2OO8X 3PWDA 1G5SA 2PK9A 3KXNA 4TY1A 5FLFA 2BRGA 4YUQA 4OAUC 4W4VA 2JKMA 2DS1A 3RM6A 4EH3A 3HVCA 2F4JA 2VTHA 3MTFA 3PA4A 3GU5A 4G6LA 4QYEA 5EH0A 4PQNA 4QTCA 4DFZE 4OBQA 3RPOA 2NRUA 3CTQA 3ZFYA 4CTBA 2PE0A 4KS8A 3NW7A 2R3PA 4CLJA 3K5UA 3OXZA 4OW8A 1V1KA 2XA4A 4GKIA 3VULA 4TPTA 4MEDA 4FTAA 3OVVA 4Z16A 3NW5A 3CEKA 5M08A 4I6QA 5CI7A 3H9OA 4BDIA 3FC2A 3RZFA 5C8NA 2O5KA 3KA0A 4ITIA 1U59A 2VWXA 4YJRA 4PX6A 3RAHA 1IAJA 1I44A 4Y8DA 4MK0A 5J5SA 3ATSA 4JBOA 5IUHA 3AG9A 5DVRA 4U9AA 3DFAA 4BBMA 2A19B 1KUTA 1XH7A 4LL5A 4I93A 4PP9A 3A7GA 4LUEA 2WMWA 3HDNA 1Q3DA 2O2UA 3A8WA 5BVKA 4OTFA 4CEGA 4DCEA 3RPVA 3E7OA 1FOTA 4R7BA 4ZJIA 5EHLA 4D0WA 2JDVA 1I09A 5KO1A 3ORPA 4RT7A 4AZVA 2WNTA 4UZHA 3VAPA 4IWDA 3TKIA 3RPSA 4H05A 5CAPA 5KMOA 1Q99A 4DBNA 2FSOX 1SVGA 2GSFA 3A62A 5DFPA 3R9DA 3C1XA 3WZUA 4FBXA 4FZ6A 4JAIA 5LQFA 2XK6A 5I9WA 4OTQA 4TN6A 4XOZA 2W1HA 3ZFMA 4CFXA 2H34A 3RAKA 5IUGA 5FBOA 4ZIMA 3HV5A 2VTIA 3VIDA 4KKEA 5BUIA 5HX6A 3LLAA 3ZEPA 4NUSA 3OOMA 4FL3A 4GT5A 4IAAA 1ZZLA 3SW7A 2WQOA 4FTNA 3E3PA 4EZ7A 5DNRA 2ITUA 3LKMA 3FV8A 4RX5A 1W7HA 4C3FA 5DR9A 1H08A 1S9JA 1XH9A 3EL7A 3PY1A 2XUUA 3KFAA 4X3JA 5LVLA 4O0YA 4FKOA 4JG6A 3VS0A 5DA3A 3AC5A 5IG1A 3D5UA 2BIYA 4FKQA 1BKXA 3P9JA 3ULIA 5JQ5A 4UXQA 2PE1A 4OBPA 3T9IA 2PUPA 5JRSA 4O7YA 4APCA 5C01A 3TT0A 5CT7A 3FSKA 3I79A 1J7UA 4ANOA 4HGLA 3ZBFA 4OUCA 2OF4A 3NRMA 3P1AA 3FBVA 3KULA 4XOYA 3WZDA 4OTDA 3DLZA 2ZYBA 2UW6A 3I0OA 1JOWB 1JQHA 2X7FA 3UIMA 4E7WA 2WQBA 3GC0A 4H36A 5IISA 1SZMA 3TUCA 3Q96A 4RIXB 4TYIA 3RK5A 2XP2A 4N70A 5IEXA 2RG5A 4U44A 2VTTA 4AZWA 2WPAA 3C13A 2W99B 5L6WL 2P0CA 2R3RA 3ZSGA 3ZZEA 4D1ZA 1ZYJA 3QU0A 1SNXA 4K0YA 3QGWA 5BMMA 2OXXA 4EYMA 3N4UA 1ERKA 3ORXA 5KKRC 3CD8A 3LE6A 4AFEA 2NPQA 4JG8A 3GCVA 3L1SA 3C0HA 3ET7A 3FZSA 3Q52A 4ZK5A 5EYCA 5IDNA 1U54B 3V5PA 3QZGA 4GL9A 4Z9LA 3R9NA 4AAAA 4DFXE 3GI3A 2IO6A 5FP6A 4ALUA 3SOAA 5FP5A 2WMRA 4FKUA 5CASA 2XJ1A 5EM5A 3DB6A 3VUIA 5E8YA 1R3CA 1MRYA 3BHVA 5FEQA 4O27B 3OT3A 2GTNA 3KC3A 5BYYA 3R30A 4FV8A 2BAQA 4FG7A 4RGJA 3V8SA 3UC4A 2YZLA 3L8SA 3F3TA 4TYGA 4D9UA 4R1VA 1FGKA 4FSRA 3LFSA 3PJ8A 1G8AA 5E8VA 3RAWA 4WSYA 3BWFA 4AQCA 4DGNA 5HLWA 2VX3A 4AN3A 5AIKA 3LXNA 5J95A 3VBQA 4FF8A 4X6QC 5D41A 1H0VA 1Q3WA 4QMLA 3TJDA 3PVBA 3TZMA 4LRJA 3OTVA 5J7BA 2RIOA 4QTAA 5CSPA 3UZRA 3VW6A 4FTRA 1CSNA 4FG8A 4WOVA 3BEGA 3C0GA 4B0GA 4JBPA 5FQDC 3RWQA 1OGUA 2R3FA 4MXCA 2XCKA 3FXWA 3Q6WA 2HZIA 3L8PA 2JIUA 3UMWA 3KXXA 4WT6A 3UYTA 4RRVA 2VTLA 4MF1A 4F64A 4NK9A 4MKCA 5LVPA 4GK3A 3DBFA 5K5XA 3AGLA 2GS2A 4C36A 5A4EA 2UW8A 4E6AA 5L4QA 2ETRA 1ZZ2A 4A06A 4V01A 5HE2A 4YZDA 2WIPA 3F2NA 3ATTA 2YIRA 3GCSA 4FTLA 4FOBA 4O0SA 3KVXA 3REPA 5EOBA 4G3DA 4JRNA 4QMQA 4UN0C 2WU6A 4FSZA 4CTCA 4LGGA 3VUHA 2PE2A 5IH4A 4HPTE 4RWLA 3DBDA 5FGKA 2VGOA 3A8XA 3D4QA 3MW1A 3OC1A 3R9OA 4AXAA 4B6LA 4CD0A 5CX9A 4P5ZA 3R83A 3WF8A 1IA9A 3QRIA 4WHZA 2WD1A 3LMGA 3MY1A 2EB3A 3U51A 4ACGA 4EOSA 3Q9YA 4J71A 1GNGA 2C6IA 3JS2A 3A7HA 4V05A 1T45A 2PMLX 3VUMA 2HOGA 2IW8A 3CTHA 5AAFA 5E91A 3GFEA 4EH2A 2UVZA 5EYKA 5HNBA 5HG9A 5HVYA 2JDTA 5LXMA 4YP8A 2OF2A 5DPVA 3ZUTA 4IH8A 4WKQA 4NKAA 4Z3VA 5IEVA 3F3WA 4J96A 4USFA 4I6BA 4BF2A 4RVMA 3NNXA 5H8BA 4BTKA 5L6OA 4FKGA 5D7VA 3LFEA 4E5AX 2AC5A 1KSWA 2R3LA 4KBAA 1WCCA 4BTFA 4WG3A 2WTVA 5JSMA 2F2UA 2PZPA 5M4UA 1B39A 1JSTA 4YU2A 2DUVA 4V0GB 2JDRA 1OKZA 5BQ0A 1QCFA 1Q97A 1OB3A 3R71A 4U5JA 3UIBA 5HLPA 5EM8A 2GFSA 3F66A 3IO7A 3RWPA 3SW4A 5EM7A 2CNQA 5D9HA 4B9DA 2A4LA 2VTMA 1ZYDA 2RFDA 2R4BA 4RFZA 4IDVA 2KULA 2VWYA 3QD2B 3N4VA 3FHIA 3W10A 3O51A 1OUKA 3EWHA 4OT6A 4CRSA 1R0PA 2XK7A 5AUWA 4EK6A 2H8HA 3E3BX 4D4SA 2OJJA 4RWIA 2YIWA 3T3UA 3OWJA 2WGJA 2QLQA 3IG7A 3SA0A 2IG7A 2HXLA 4WUAA 4HGSA 3UP7A 5CAUA 1Q24A 4GUEA 4C7TA 3ZONA 2CCIA 3V5JA 2XIKA 4IB1A 3FUPA 4IX3A 2R7IA 3NCZA 1DM2A 4CZYB 2F2CB 2CKOA 4ONAA 2YIXA 2C3LA 3VBVA 4DH5A 4WG5A 2XEYA 5C8MA 4G2FA 1NW1A 2XYNA 4ZTQA 2W5AA 3E7VA 4QYHA 4EOIA 2ZM1A 3NUPA 3DXNA 2CKEA 4FT0A 1YOMA 4L6QA 3TKHA 1PMNA 2UVXA 1ZMUA 3G2FA 3C4CA 3HV6A 3RM7A 3VS4A 3BLRA 4PNIA 4D2SA 4KINA 4P5QA 1CDKA 3L9LA 4I24A 3OY3A 4NM7A 4PUZA 4XG4A 1YWRA 3W18A 2X9FA 4CNHA 5JGBA 3NNVA 3BGQA 4E20A 4R77A 1JSUA 3G90X 3P23A 3ZS5A 1GZ8A 4BYJA 3RHXA 3E87A 4LRKA 3DJ6A 1H1PA 2HENA 2VWWA 3TEIA 2UZDA 2VRXA 4O0RA 3IW8A 5LWMA 3QZIA 3GCQA 5C4KA 2WMSA 3FMKA 4WSQA 1PXNA 4LOPA 1JAMA 2R3MA 3PPKA 3PG3A 4FTKA 4CFVA 2X2KA 4C02A 2WAJA 4ZMFA 5BVOA 4FV2A 3NAYA 5JK3A 4NL0A 3OWKA 4ANQA 2YM3A 3E88A 5CANA 3FXXA 3PVUA 4RIOA 3O71A 1Q41A 5FTQA 3MSSA 1SM2A 4B8LA 4Z7HA 3P7BA 3R7VA 1X8BA 4JAJA 2I6LA 4FIIA 1JKKA 3QQFA 4XS2A 3U6IA 4KAOA 3BPRA 3GU6A 3KXHA 4USEA 2IVSA 3LMHA 3LM0A 4W9XA 3MVMA 2V22A 3GU7A 4AE6A 4O81A 3FZTA 4X7QA 3TNWA 4FIJA 2X8EA 2BFYA 4B7TA 4FSWA 4F1OA 5DRDA 1PMVA 2PZ5A 3GC9A 2Z7RA 3MN3A 3QQGA 4L3JA 1Q8YA 1ZLTA 4G17A 4AN9A 3B8QA 4BDFA 4BGGA 4EK8A 4JQ8A 4F1MA 3K5VA 4XG8A 4F7LA 3BLHA 5CSXA 5AUUA 5M57A 4GFOA 5HBEA 4KA3A 3PP0A 3LJ0A 4CMTA 2XNBA 3RINA 4X2JA 3DK7A 5EW8A 4DFYA 3MPMA 3VQUA 4QT1A 1O6YA 4EC8A 3AOXA 5IA1A 3FZPA 5TKDA 1WBNA 4HVDA 1IA8A 2UZTA 4HCTA 4JOAA 3QA8A 3R1SA 5IQCA 2R3KA 3AD4A 3JVRA 3H9RA 3G33A 1REJA 5ITAA 1XJDA 2ZDTA 4IB3A 4BDDA 5IA0A 4AOJA 3UYSA 2B7AA 3EQCA 2V7OA 4UEUA 3IOPA 3E93A 4JR7A 3O17A 4GK4A 1UU7A 2Y6OA 4RG0A 3FMEA 5ANGA 3D14A 3ZLXA 2B52A 1UNHA 2UW0A 4PPCA 5HTCA 3BYOA 4K9YA 1GZOA 3EL8A 3OXTA 1KE6A 2QI8A 2VWVA 3D0EA 4RLKA 4YLLA 3NR9A 1DI8A 1U4DA 2BAKA 2VTSA 3F6XA 3WBLA 3MV5A 2J4ZA 5GZAA 4BDGA 2X2LA 2XKEA 3BX5A 4HNFA 2YITA 4KD1A 4V0GA 2FB8A 2QCSA 1YRPA 2PL0A 3R73A 4M66A 1OBGA 4A4XA 3MY5A 5IA3A 4WNMA 3R01A 3WI6A 3F3VA 4DTAA 5HD4A 4LOQA 2CJMA 3DAJA 3NPCA 4FSUA 5LWNA 2AYPA 5AAGA 3PJ1A 5LMKA 4A4OA 2PZIA 2W1ZA 3POZA 2FGIA 1GIIA 4FEVA 2RF9A 4FKVA 1PMUA 2BDJA 3VBTA 2LGCA 4C3PA 3UJGA 3H3CA 5FM2A 3S1HA 3EFLA 3PY0A 3UIXA 1QPDA 3BEAA 3EHAA 3MVHA 4CCUA 4IQ6A 5ACBC 3NW6A 3RZBA 5JN2A 2ITVA 2BR1A 5FXRA 5J1WA 4P7EA 3VS6A 3LFCA 3D5WA 3QRTA 5DRBA 3LMIA 3PY3A 2Y4IB 5KMMA 4O7SA 3KRXA 4FIGA 4DGLC 4OAVB 2V0DA 3BRBA 5GJFA 3M42A 5AEPA 3ELJA 3UVRA 2OIQA 4MAOA 4Q5EA 3ZUUA 4PP7A 1YXTA 2YA9A 4MBIA 1H1RA 3KU2A 4YBKA 2QOOA 4DGOA 4NW6A 4EH8A 4RA5A 3RCJA 3DDQA 2YM4A 4CZUA 3TJCA 3BYVA 2YZAA 3UQFA 4BDHA 2QOLA 4FIEA 1WBWA 2QR7A 3PLAE 3IOKA 3MVJA 1W98A 2R64A 3FKOA 3QHWA 3ZOSA 5JFSA 1RQQA 4L3PA 2C1BA 4D9TA 4AS0A 4YZBA 1SYKA 2G1TA 5CVGA 5KMLA 2W9FB 4FEQA 3OP5A 4TW9A 4EOLA 3AQVA 1P4FA 4A7CA 5LMAA 4BWXA 4GFMA 2VWBA 4M0YA 3ZLWA 1E1VA 3I7BA 4CCBA 1VEBA 4H3PA 2ERKA 3F2AA 2IVUA 4FEXA 4ANSA 4YO6A 4OLIA 4BDCA 3WIKA 4DEGA 5DHJA 3OY1A 2GHGA 3BGZA 3O8TA 2EVAA 1MP8A 4TTHB 2ZV9A 4EK4A 4EOJA 5J1VA 1L3RE 1QPJA 4M13A 3O2MA 3FI4A 4HYSA 1OKYA 4P2KA 1UWJA 4LG4A 4XCUA 4G34A 5CS6A 5GNKA 4BL1A 1O9UA 1WBOA 3QC4A 5HORA 3E62A 4DYMA 2GHLA 1RJBA 5EQYA 4E6QA 3C0IA 3WZKA 3A61A 4EL9A 3QRKA 4PV0A 1W8CA 3EN7A 4J95A 4EHZA 4KIPA 5AIRA 3C4XA 2OFUA 1PKGA 2BTSA 3UZPA 3W2RA 4C4JA 3R1QA 4RIYB 5CSHA 2DYLA 2GQSA 4KKHA 3QTWA 5CU6A 3ZRLA 4EH7A 4LV8A 3DTCA 3RI1A 2R3JA 5CSWA 3MGYA 1R1WA 3B8RA 3QCYA 4BDAA 4D58A 4DG3E 4H58A 4QP3A 5JFVA 1OBDA 5C26A 5G6VA 2WQMA 4HCUA 4HW7A 3FSFA 2YM6A 4FT3A 4IX5A 5AA9A 3P7CA 2WELA 5AP5A 2B53A 1Y8GA 2WMBA 3LFBA 2BZIB 1UVRA 3KN5A 2QG7A 5A6OA 4BR3A 4F0GA 1GJOA 1DAYA 1VR2A 5EW3A 2VTRA 3LJ1A 4C62A 2CLQA 4GSBA 1U46A 5TE0A 4GU6A 4IAYA 3IS5A 4EBWA 4ZSAA 3R7EA 5EQEA 2GQRA 3DKFA 3Q3BA 2OH4A 4HYHA 4P90A 5EG3A 3EN9A 1Z57A 3SVVA 4O91A 2XKFA 3QRJA 3FWQA 4U40A 4FTOA 4PF4A 3GQLA 3Q9XA 3SX9A 1CKIA 2PSQA 5AUTA 3EN6A 2JBPA 4EHEA 4BKJA 4QRCA 1Q62A 2ZMCA 4O96A 5FBNC 4WA9A 5AV0A 3WYXA 3KK8A 4EUTA 2BZHB 4XH6A 3O50A 3EIDA 2OIDA 4TNBA 4ALWA 2QHNA 2YAKA 5E8XA 4GT4A 4DG2E 1BI8A 5CEKA 1TQIA 5IA5A 1T46A 1GOLA 2WEVA 5J7HA 2C3JA 4I3ZA 3OZ6A 4KIKA 4CMOA 2VV9A 5HTBA 4IANA 2QKWB 4HZSA 4AT3A 3SG8A 5TF9A 5JQ8A 2X2MA 3HL7A 4RIWB 2WTDA 3DLSA 5DGZA 5I0BA 3PJ2A 3ZM4A 3OF0A 4X3FB 5JRQA 3QXPA 4QNAA 5AA8A 3G9NA 3QC9A 2ZB1A 2GU8A 2W1DA 3Q04A 3R2BA 2PVRA 4XRJA 5CALA 2RFEA 5JEBA 2YWPA 3PYYA 4FKPA 4RX8A 4X2KA 4BDEA 1A48A 4L52A 5CAOA 4TYHB 2Q83A 4RZVA 5EK7A 4TRLA 2PU8A 4QQCA 3LAUA 3EQDA 3QCQA 1H0WA 4FKIA 4IBMA 4J8NA 3NUUA 2FSTX 5D1JA 4JX3A 5DYJA 3LXLA 1OKVA 2NNWB 3L8XA 3QX4A 4EH6A 5CEMA 4ITJA 2QO2A 4ACDA 4BWKA 2UZNA 3F7ZA 4JG7A 4UMUA 1YOLA 5LOHA 4EOKA 2I7QA 2J50A 3WF7A 3G15A 2HWPA 3U6HA 2JKKA 5EM6A 2IWIA 1ZYCA 4BYIA 4TXCA 3F7WA 5K9IA 3TDVA 1TQPA 4NKSA 2CN5A 3WZEA 3EFWA 3FLWA 3Q9ZA 4QMZA 4Q5HA 5AR3A 3IW4A 1F3MC 4IE9A 3AC8A 3ANRA 3TZ8A 3A7JA 1M14A 1M52A 2C47A 2V62A 3HMPA 3QCXA 4RJ3A 4TWCA 5I9UA 4EOOA 1KWPA 4J99A 4ZLOA 5BX0A 2B4SB 4N6YA 2SRCA 4IJPA 4OR5A 1ZAOA 2X8IA 2R3IA 2VO3A 4JDIA 3NLBA 3D15A 5IPJA 3MH0A 3RP9A 2JFLA 4CFNA 3ANQA 4FUXA 4JNWA 4HGTA 4MD7E 3LQ5A 1FINA 4UV0A 4YC8A 5AFVA 2IZRA 4DFBA 2V7AA 2YFXA 4NM0A 2YDJA 5GZ8A 4D2WA 4ORKA 1CMKE 3BE2A 4LMNA 2R3QA 3MJ1A 3MS9A 2JD5A 1FMKA 2B9FA 5BVWA 3UBDA 3WARA 4DT8A 3HMNA 2Y6MA 5BUJA 1WFCA 2HY0A 2WKMA 4NT4A 3VS3A 4R3RA 5FD2A 4NFMA 4RIYA 3K54A 2ZV8A 3AGMA 2EU9A 4IAKA 4YHJA 3BYUA 2B9JA 2PYWA 2C6DA 2BRBA 4EEVA 2W4OA 2FO0A 2J0JA 3BHHA 5J8IA 3NIZA 2BVAA 2QU5A 3IGGA 5BPYA 5I9ZA 4QP4A 3UIUA 2XNPA 3DPKA 2EUFB 3OEFX 4ASZA 4K1BA 4ACHA 5HNIX 4XX9A 4WNKA 2C5OA 1OIRA 3W16A 3KF7A 4ACMA 4HVGA 2IW9A 4KB8A 4ZTMA 4GK2A 4R8QA 4L68A 4FKTA 5M56A 1ZYLA 2YJSA 4JLCA 2PWLA 4FSTA 5HVJA 1ZYSA 2AUHA 1ZXEA 3NUSA 2B1PA 4FTUA 4O0WA 4BDKA 3C51A 3EN5A 3TIZA 4G9RA 4LMUA 3DB8A 4JT3A 2ITTA 4X2GA 4TYJA 4BTMA 2IN6A 1OL1A 4HYUA 4K11A 3V5TA 3O7LB 3QQLA 4C2VA 4UX9A 1UKIA 1DAWA 4ERKA 3DK3A 3ORMA 4M7IA 4D2PA 1ATPE 4DEIA 3NDMA 3UOLA 4WBOA 2C5NA 3ORKA 3PSCA 3RNIA 4PNKA 2UW3A 4F6UA 3W8LA 5JFWA 2A0CX 3UPXA 2C30A 4QP9A 2I0EA 3ALNA 4K77A 4LYNA 2X9EA 5ETCA 3P79A 2XNMA 1GIJA 4FTTA 4IFCA 3WZJA 4DEDA 4DH7A 2JBOA 5EHOA 3PIXA 3ROCA 3R0TA 4NEUA 4BZOA 4ZJJA 2ITQA 3CJGA 2P2IA 4JS8A 5I3OA 5IMEA 2VD5A 4L44A 4EH4A 3ZBXA 5EW9A 4N4SA 4V04A 4RIWA 4NYEA 2FA2A 1NVSA 2OI4X 3FMMA 3M1SA 3PXFA 4KSPA 4X3FA 2HELA 3T8OA 4AT4A 1KE7A 4D4RA 5KMIA 1R39A 3FPMA 4B4LA 1H1WA 2R0UA 3BKBA 3KKVA 3TACA 4O7ZA 3E5AA 4RC3A 2C5XA 5ETAA 3TV6A 2VX0A 3R2YA 2H96A 1QPCA 3Q32A 4QOXA 3LFQA 4C4EA 3NYOA 4TYHA 3MPAA 3QTXA 4RVTA 3HA8A 4DEEA 4IM0A 4BBEA 1B6CB 4IM3A 4AG8A 1PYXA 4KRDA 3LOKA 2QQ7A 2E9VA 3HA6A 4IWQA 5CU2A 2XIYA 3BHYA 4EZ5A 5DR2A 3LPBA 2H6DA 4FNWA 2YLFA 3DGKA 2WB8A 3MFSA 5AUZA 5F94A 1IASA 2YEXA 4FV4A 4AACA 4CFUA 4MHAA 5L6PA 3EQFA 5GJDA 3MFRA 4XG3A 5EI6A 4BBFA 3WOWA 5IEYA 4BGHA 2PVNA 3Q9WA 4JRVA 1FMOE 3FDNA 4M12A 3NWWA 4UYNA 2HCKA 3QD4A 1KOAA 4UYAA 3QKKA 5CZHA 2BIKB 5EOLA 3VWAA 2HZ0A 4XV1A 2GS7A 3FAAA 3HRCA 3OMVA 3ZO1A 5L8LA 4MBLA 4BCNA 3KMWA 5DE2A 4U43A 4GJ3A 1H27A 3GNIB 4HGEA 3ZRMA 4AA4A 4BY9E 5HE0A 3NVMB 3DK6A 1YI3A 2PVJA 3FMJA 2Y4PA 4ARKA 3SXRA 4UZDA 3U6JA 4QYYA 4BC6A 4E4LA 3BGPA 3UE4A 3ZDUA 5CF6A 2Z8CA 1ZRZA 4F7NA 2QR8A 3AC3A 4IHPA 4U80A 5T68A 5TOZA 4AU8A 4F08A 4BRXA 4XG6A 4PDOA 3PE2A 2Y8OA 3E8DA 1VYZA 3EKNA 3V5QA 3VUGA 4E8AA 3F5XA 3QUDA 3PXZA 4YJOA 1J1CA 4PL4A 4N0SA 3VS2A 2O64A 3FMNA 1H00A 2JGZA 4GMYA 4BVUA 5EI2A 5IUIA 3AMBA 4GH2A 2JAVA 3N9XA 1XR1A 2HIWA 3UVPA 3W2OA 1J1BA 2BILB 3HEGA 3MA3A 5F20A 3UGCA 3G6HA 4G9CA 5HHWA 1YI4A 5I9YA 2I0VA 2ACXA 1OIQA 1Y6AA 5F9EA 1BYGA 1K3AA 3SXFA 3FMHA 4HVIA 3ZO4A 3ZFXA 5E1EA 3MY0A 3QTUA 5HU9A 1LUFA 3FI3A 2GTMA 1H25A 5DN3A 4FTJA 3DZOA 4NWMA 4YURA 3DXPA 2X4ZA 3KK9A 4QMNA 4LUDA 3A7FA 1YWVA 3RAIA 4AN2A 3TNIA 5LVMA 3TI1A 5AV1A 4KWPA 4OTPA 4ZP5A 4KIQA 5HE3A 4GVAA 3N4TA 3FKNA 4OT5A 4AW2A 4ZY5A 2FUMA 3GVUA 2GNIA 2DQ7X 2QURA 3MTLA 4I0TA 2HYYA 4QP6A 4RC4A 1BUHA 3G6GA 4QYGA 4S32A 3VRZA 5K4IA 3DQWA 5K5NA 3TCPA 4GIIA 2XM8A 5LCKA 4E3CA 2PZRA 1UNLA 3CR0A 3QUEA 3R8UA 4Z7GA 1Q8UA 5CNNA 4AW5A 3KXZA 2ONLC 1P4OA 4BCMA 3S00A 3FKLA 4FX3A 4QMYA 4BIBA 4FGBA 3DJ5A 5FDPA 2W7XA 5CVFA 4M68A 3R00A 4U3YA 4NFNA 4ZTRA 2XCHA 1J7LA 2W5BA 3JY9A 3DAKA 3OBGA 3NX8A 3OCSA 1IEPA 4L42A 1P5EA 3U8WA 3V5LA 4MNEB 5CWZA 4C4GA 4D1XA 5LMBA 1PW2A 3TNPC 3QLFA 5D12A 4RJ5A 2P2HA 2ZAZA 4NM3A 3TN8A 4QMXA 1AGWA 3AT4A 4I1ZA 4FNZA 5M4IA 3ZDIA 1OIUA 1Q4LA 4FYOA 4XBUA 3TG1A 4EI4A 2PVKA 3OT8A 1DI9A 4BZNA 3UQCA 3AD5A 4DTBA 4HOKA 4XV3A 4Z55A 2X6EA 3RBWA 3LFNA 4MXZA 3UP2A 2A2AA 2CGWA 3BHUA 3JY0A 4CSVA 1H26A 2CGUA 5HGIA 4Y95A 3EQHA 3FLNC 5A4CA 4C59A 5J9LA 2VU3A 2ETKA 1U5RA 3VW8A 3EZVA 3CY2A 5DLSA 2R5TA 3Q5ZA 5HIBA 3E63A 3QTIA 4FV7A 4H39A 1Q8TA 5L2TA 2REIA 4AUAA 4W8DA 4IB0A 3E92A 3R1YA 4FSMA 5AR2A 5F1ZA 4F65A 4YGAA 4KIOA 5DH3A 3AD6A 4BCQA 4QP8A 2CCHA 3A99A 3FY2A 3FL4A 4H1MA 1YKRA 3EQGA 4GU9A 3VBXA 4BI0A 2WQEA 5CF4A 2P3GX 4M0ZA 3CS9A 2XK3A 3A4OX 4IADA 3ACKA 4M69B 3ZO2A 2C5VA 3FLYA 2W1EA 4NCTA 3ID6C 4PL5A 5IQDA 4OTGA 3GP0A 4FTQA 1SNUA 1PXMA 5BYZA 4ZTNA 5EDPA 1ZMVA 4BCFA 2XS0A 1CTPE 3TDWA 1KE9A 2QOQA 3VO3A 2XIZA 2RG6A 3CE3A 4FTCA 4AA0A 5A54A 4C38A 2GNJA 5HLNA 3QTQA 2VWZA 3Q4TA 4FV3A 4RJ6A 4FSQA 5ANKA 3VS1A 3C4FA 3ZO3A 1GY3A 5H9BA 4YJSA 4RVLA 5CQUA 4RX9A 3PVGA 4L67A 3S2PA 3R8MA 3P5KA 4EKLA 4MQ2A 2XK4A 4CFWA 5CXZA 4ZSEA 2XRUA 3IDCA 5JZNA 4HVSA 2B9HA 4D4VA 4TKSA 2EB2A 4FMQA 5AX9A 4HVHA 5E1SA 1WMKA 3NUAA 3SGCA 2P55A 5IQGA 4IVCA 3POOA 1YXSA 1ZARA 3NSZA 3TV7A 2IVTA 2J5FA 3PZHA 3PA3A 3IQ7A 4QMUA 4BHNA 3ORIA 2B55A 1QPEA 3OOGA 5HD7A 2OW3A 3R7YA 4FL2A 4QNYA 3L8VA 3VHEA 4QPSA 4PMTA 3C4WA 5HVKA 3V5WA 2JIVA 1UU3A 5AR8A 3PVWA 3LW0A 5IQIA 2J51A 3CPBA 4GJ2A 4X2NA 3U9CA 3PTGA 1PMEA 5FXSA 4BDJA 4BHZA 2FH9A 5IDPA 3UO5A 1IAHA 1JKLA 2J6MA 2X39A 3LHJA 5E8ZA 4WIHA 3K3JA 3QLGA 1NXKA 4IFGA 4D2RA 4GYGA 4E6CA 2KTYA 2PUUA 4TZRA 3AC2A 2JDOA 5TO8A 2OKRA 5H3QA 3H10A 3RKBA 5J9YA 5I9VA 3LCKA 4DT9A 4DFNA 2VNWA 2PPQA 5AR7A 2R7BA 2VNYA 1Q8WA 3H9FA 4FG9A 4F9YA 4YMJA 2OXYA 3OUNB 4MTAA 1YWNA 4FKSA 3V51A 3HV4A 3C5IA 2JKQA 5B2LA 3RHKA 3HV7A 3FMDA 4FC0A 2Q0BA 2X0GA 4NIFB 4C3RA 3MPTA 4YLJA 4APPA 3F3ZA 5C03A 4E1ZA 4I4FA 4EJ7A 1W84A 4Q9SA 4F9BA 2W4KA 4ITHA 4Y83A 5EHYA 1XH5A 3S0OA 1FPUA 1DS5A 4GRBA 3EOCA 4E4XA 4FGRA 2WTWA 4RJ7A 5AM6A 1OPLA 2UW9A 3PSBA 4XBRA 4MNEA 4PDYA 2ITNA 4Y85A 1GIHA 2XNOA 5HIDA 5E4HA 3MWUA 5D7AA 2OFVA 3ZC5A 3ZM9A 4YNOA 4WUNA 4M14A 4JDJA 1YI6A 3ORLA 1B38A 1QL6A 3Q4ZA 1JWHA 5A4QA 2B0QA 3F5PA 4X0MA 3Q5IA 4R3PA 4MD9E 3S3IA 3SC1A 1E9HA 3UNZA 4ZS4A 2ITYA 4I5CA 2Q0NA 3G0FA 3QRUA 3OTUA 4S2ZA 4U3ZA 3H0YA 2XKDA 4XV2A 5GJGA 2OZAA 5DR6A 5HKMA 3UVQA 3V6SA 2R0IA 1HOWA 4C4IA 4FR4A 2XJ2A 4FICA 5HI2A 3HAVA 4HNIA 3KF4A 3SOCA 3RGFA 4MXYA 3CLYA 2O65A 3D5VA 3U87A 2W1CA 5CAVA 3FQSA 4YSJA 4FV9A 2EXMA 5H8GA 1PHKA 3NNWA 3O8UA 5HIEA 3ROYA 4CFMA 4DFUA 5AP3A 4R6VA 4M3QA 4Q2AA 3SXSA 3QHRA 3MFTA 3W32A 2Y4IC 1MRUA 4KIKB 4FK3A 4S31A 5DT4A 4ZTLA 3P78A 2JDSA 2P33A 3QKLA 4MH7A 4QTDA 5HBJA 3D5XA 4XLIA 1PRYA 3BLQA 4QMSA 4ZY4A 2WIHA 3E64A 4M69A 1SVEA 5HICA 4BCHA 4PL3A 3ZTXA 2IVVA 2HK5A 4WBBB 1JLUE 3R7IA 4HCVA 5FM3A 4K8AA 2XNEA 4BB4A 4RWKA 4DLIA 4O38A 1QMZA 3RPYA 5A6NA 3BYSA 3GC8A 3O23A 3PP1A 4G16A 3CBLA 2VO7A 4CLIA 3ENMA 3ZLSA 5HZNA 4FODA 4MNFA 3NIEA 3CY3A 4XJ0A 4CKRA 5HO7A 4IXPA 5IQAA 1YW2A 2W1IA 2YIYA 1M2RA 4C57A 4DCAA 4C4FA 2RL5A 2ITXA 4KSQA 4MXXA 4YJPA 3RPRA 4YHTA 4GVJA 1Z9XA 5HE1A 4PMPA 2WMUA 3KGAA 4RWJA 4QYFA 3VUTA 5GZ9A 2VTAA 4O7TA 3RK9A 2R2PA 1ZY4A 2OWBA 5AX3A 4BCIA 3QYWA 1ZOEA 4IC7A 4MQ1A 4TWNA 2OG8A 3Q60A 1IR3A 4L01A 1BMKA 2Z02A 1ZWSA 1UU8A 4NTTA 2E9PA 5B0XA 3QWJA 3F5GA 1NY3A 4RBLA 4CYJA 5HG5A 4HZRA 4O6EA 4KNBA 3T9TA 4CMUA 3UODA 4FZ7A 4I5MA 4W8EA 2OBJA 2XF0A 3C5UA 3OG7A 3CQEA 3IGOA 4YZNA 5GHVA 4AOTA 4E73A 4ZJVA 5A4TA 5M44A 3JUHA 3MA6A 3DKGA 3LCDA 3ULZA 3GCPA 2RSVA 3D94A 3MFUA 3FI8A 4FTMA 3PZEA 3FZRA 2QONA 5B7VA 4O0VA 5GIPE 2O63A 2IZTA 2ZV2A 4O2PA 4E26A 4TYEA 2Z60A 4D2TA 4FOCA 3G5DA 3E8NA 2HW6A 3CSVA 1H24A 1OM1A 1PXKA 3CKWA 3DV3A 4EOQA 3WE8A 1OPJA 1VZOA 4MVFA 1KE5A 3QF9A 4LV5A 4PRJA 4WD5A 1PXIA 4JR3A 4AGUA 4FZFB 3JVSA 4GV1A 5K4JA 5KMJA 4IWOA 3Q4UA 1BLXA 4NH1A 5D10A 2I0HA 1ZOHA 3GENA 4PY1A 2Z7SA 4C8BA 3NZ0A 5DIAA 3I5ZA 4CRLA 4CYIA 4B99A 5L8KA 1F5QA 2NP8A 4FK6A 4NIFA 4CT1A 5KX8A 2C0IA 3IECA 1AQ1A 1GZNA 1Y6BA 2ZM4A 3BELA 3GOPA 3P08A 4JDKA 3RALA 1G3NA 4BDBA 3D9VA 4OTWA 4TT7A 4CKIA 4NTSA 5HBHA 3UNKA 4F70A 5IZFA 4UWCA 4GYIA 4BIDA 4XV9A 1OL5A 1JPAA 2PMIA 4I5HA 2C6KA 2J7TA 4ZY6A 3RTPA 1REKA 3TIYA 1YDRE 1WBSA 4DG0E 3QYZA 3K2LA 1NT2A 4E5BA 1ZMWA 3E8CA 3NYNA 3TUBA 2UZUE 4D2VA 2VWUA 3IPHA 3FYKX 3HRFA 5E8WA 3PIYA 4IX4A 3HKOA 4W4YA 2BRHA 1VJYA 2ZV7A 5HO8A 4DLJA 2F57A 2ITWA 5JGAA 2BPMA 2QD9A 3NYVA 1CKPA 2BZKB 3LQ3A 3PG1A 3R1NA 2BDWA 3AC1A 3F2RA 3QTSA 2PMNX 2IJMA 2WMQA 1GAGA 2PVYA 3CIKA 2BKZA 5EDQA 4WG4A 2X7OA 2OJGA 3NUYA 3PRIA 4YZCA 4X3FC 3R7UA 3WE4A 1FVTA 4G31A 4PTEA 4QMWA 4ZEGA 4ANBA 3R9RA 2VO0A 5KZ0A 5FEEA 4ZLYA 2OJIA 4AW1A 2HAKA 2R3GA 5HTIA 3OCGA 3VNTA 3V3VA 1WBTA 4IAFA 2QC6A 3HECA 4ANNA 2YM8A 2WXVA 5EFQA 4Y5HA 4U97A 4UWBA 4YTFA 3TL8A 5IA4A 3CP9A 5A4LA 3VUKA 5CTPA 4ANLA 3ORZA 4LL0A 2E2BA 2PUNA 3BYMA 4KABA 4EONA 4TWPA 3DOGA 3CGOA 3UZTA 5M07A 2UW4A 1BL6A 4FV0A 4YZ9A 2YAAA 3A4PA 5HEZA 3QZFA 3F5UA 4F1TA 1R0EA 4U79A 4MWHA 4PTCA 5KHWA 3W2QA 5ANEA 4LRMA 2CPKE 1O6KA 4Y5QA 3VBYA 4XEYA 2ZJWA 4P4CA 4O2ZA 4Y46A 1UKHA 3NAXA 3BV2A 3O7LD 3PPJA 3TXOA 3DTWA 2BHHA 4OGRA 2QO9A 5E8UA 4GT3A 3ZXZA 3C50A 2ZVAA 2XEZA 3G51A 4FKRA 2C3KA 4L53A 4RPVA 4FEWA 4DN5A 4C33A 2VTJA 4QMTA 4RLLA 5AP4A 4F09A 2B9IA 3BE9A 3LVPA 5LCJA 2GNLA 4ZZMA 4AZTA 4EYJA 4TL0A 3EZRA 3GC7A 4AWIA 3QWKA 2UUEA 5ANOA 4GUBA 3OHTA 4A9TA 3Q6UA 4TWOA 5A14A 1H1QA 3D83A 1FVVA 3RNYA 4L3LA 3ZCLA 1UU9A 2UW7A 5DWRA 3VHKA 1UA2A 3TZ7A 4RFYA 2NO3A 5HOAA 5KBQA 3R9HA 3D7TB 3R21A 3VN9A 4F0IA 3M11A 5K0KA 3UOKA 3W2PA 4O0UA 4A07A 3ENHA 2PZYA 4F9WA 3I4BA 4GKHA 4A4LA 4AGWA 5L8JA 2XRWA 5L2WA 1PXLA 3CKXA 4S30A 2C5YA 2BMCA 4QQ5A 3VJNA 4N6ZA 4UMQA 4CT2A 5M06A 4H1JA 4O7LA 5KMNA 2XK9A 4Y73A 4U0IA 2XM9A 2WQNA 4QP2A 2E9OA 2RFSA 4FV5A 2OICA 4JIAA 2O0UA 5CF8A 1H07A 3FPQA 5KHXA 3OS3A 1M17A 3EH9A 3OWLA 4EWHA 5FTGA 4XG2A 3ZZWA 5IQBA 2HY81 1YXVA 4FYNA 4IZ7A 4D1SA 4E4NA 3NVKI 2QVSE 2XH5A 3QL8A 1M2PA 1JKSA 3R7OA 2C6EA 2PULA 5GINE 3DNEA 1PYEA 2UZBA 2WTKB 5AP0A 3SD0A 5CAQA 1TKIA 3S4QA 3CQUA 4O1OA 3DXQA 4D0XA 1YHVA 4EC9A 1J7IA 2R3OA 3OCTA 5DBXA 2LAVA 4HJOA 2NRYA 1UNGA 2WMVA 2XKCA 3FY0A 3QTRA 5EYMA 4QPMA 3O96A 4IZAA 2WTCA 4I21A 4J1RA 3PSDA 4OTRA 3THBA 2YN8A 2JAMA 4I23A 4KBCA 3W8QA 5BVDA 3JXWA 5BNJA 5GIOE 4WO5A 5CNOA 2F7EE 1U5QA 2GFCA 1H01A 5CU3A 3CD3A 4U41A 3U54A
chains in the Genus database with same CATH superfamily
4ZTHA 2VTOA 3PJCA 2QHMA 3COKA 3PXKA 4EOPA 5CYIA 4BCPA 4EWQA 2OJ9A 3KEXA 5AP2A 4O84A 4JIKA 2XIRA 3IW5A 4FTIA 3R02A 1RE8A 1H1SA 5E92A 2E9NA 3EB0A 3FYJX 4CFFA 1NVRA 5CT0A 3I6WA 4K6ZA 4DC2A 3NEWA 2UZEA 1KOBA 4R1YA 3DDPA 3HMMA 4Y72A 2I40A 5HCZA 4QMMA 3TTIA 2G2FA 1XHAA 2XK8A 5FDXA 3EQIA 3BBTB 3QTZA 2W1FA 4C34A 4ASXA 1GZKA 3MB6A 3OW4A 5DEYA 3RJCA 3PXYA 3II5A 4G6OA 1OL2A 3PFQA 1M7NA 5J9ZA 2GHMA 3KMMA 2IPXA 5CI6A 1YOJA 5J79A 1XBAA 4EK3A 4UWYA 1OI9A 3UOJA 3HUCA 4QTBA 4DEAA 3F9NA 2GNHA 5KCVA 4ZMEA 2G9XA 4YC3A 3VRYA 4I41A 5A9UA 2CGVA 3VS5A 2XMYA 1OPKA 1OKWA 2YACA 4EQMA 1OL7A 3CCNA 4XLVA 1OECA 3RK7A 4NCTC 2VTPA 2J0KA 4YJVA 5AWMA 1Q8ZA 3I7CA 3W0RA 4CG9A 3FXZA 3HMOA 4IB5A 1VYWA 3AT3A 2HW7A 3EQPA 4FZDB 2BKKA 5FEDA 4ZXTA 4WRSA 5KBRA 2J0LA 3GCUA 2UZOA 4S34A 4FKWA 4PDSA 5CEPA 4FIFA 3GOKA 2ERZE 2Z7LA 4QMPA 5DOSA 2ZB0A 4FL1A 4FVPA 4FSNA 4ZZNA 5AR5A 5M55A 3T3VA 4RA4A 2CNVA 4NU1A 3U55A 4IVBA 3TKUA 4D28A 4IMYA 2EWAA 4PPAA 3ZYAA 4A9RA 1KV2A 3MH1A 3L9PA 4USDA 4O22A 1ZY5A 4UXLA 3LJ2A 4A9SA 4FT5A 3JPVA 1L8TA 3GFWA 3KRWA 1FVRA 4IW0A 4FSYA 3W0MA 2CGXA 3TV4A 1G8SA 3KMUA 4FZAB 2RFNA 3I5NA 3UO4A 4DTKA 3PWYA 1MUOA 3V04A 3V01A 2YERA 1YXXA 3IW7A 2WTIA 4JDHA 4XG7A 5E90A 3TZ9A 1JKTA 4MCVA 3OUKA 5ANDA 4O7WA 2BRNA 3UMXA 3VF8A 4UBAA 2WTJA 2ITOA 5CY3A 2YHVA 1V0PA 2UZWE 3BU3A 4EBVA 4O0XA 4YTCA 3ODYX 3HUBA 4JXFA 3D7TA 2VO6A 3VVHA 2WU7A 4NZWB 3PUPA 4C2WA 5I3RA 4W4XA 5HO6A 3MIYA 2VGPA 4L7FA 4O82A 1JSVA 4MYGA 2W05A 1YHSA 3BQCA 4LOOA 5G1XA 4EH5A 2VTQA 1LPUA 4YR8A 3MI9A 2BROA 3HYHA 5LVNA 2B54A 4XP3A 2G15A 4RMZA 4GG5A 1FBNA 1Y57A 4M67A 3AKJA 1MRVA 4WNOA 4AZFA 4WNPA 3PA5A 3FL5A 2FSLX 2X1NA 4AOIA 5KKRB 1V0BA 4II5A 1LP4A 2UZLA 4YBJA 1E1XA 3BI6A 2VAGA 3ZMMA 4FKJA 5HU3A 4IVDA 3LZBA 4GS6A 3PJ3A 4BN1A 3QKMA 4J97A 1Q5KA 3HV3A 4QQJA 3KY2A 4YSMA 4G5JA 5DT3A 3UOHA 2BRMA 5LVOA 1URWA 3WF6A 2YWVA 3R8ZA 1WBPA 4DEBA 4IM2A 2VUWA 4J53A 2IW6A 3P4KA 2C4GA 3ERKA 4E6DA 4F99A 5H8EA 5AV4A 4G3CA 4NSTA 2PVFA 3FLSA 5LARA 4QTEA 2W4JA 2CDZA 5C1QB 2GNFA 1A9UA 3FQEA 3UG1A 4CV8A 2W5HA 3LFDA 4F6WA 3W0NA 5HQ0A 5AV3A 3FMLA 2JITA 2JFMA 4EH9A 3GQIA 4JVGA 4W9WA 2CSNA 3HAMA 3QD0A 1S9IA 3G0EA 4XHKB 4CKJA 1LEWA 2HZNA 3I0QA 4FNXA 4YC6A 4ZSJA 3F3UA 3CPCA 1OL6A 2XVDA 3FLZA 4FVQA 4ENYA 1EH4A 4IVAA 4U45A 1WZYA 2WOUA 4ZLZA 3QZHA 3AMAA 3DBQA 3QALE 3U9NA 3TM0A 3UDBA 1OZ1A 1RDQE 1P2AA 4I4EA 5FTOA 4J8MA 2Z2WA 3I6UA 5CU4A 4A9UA 3ZC6A 3CGFA 5FWKK 4F78A 4AZEA 3KXMA 4AT5A 5JZJA 3COMA 1BX6A 3DKCA 5E7RA 4E93A 2FYSA 2GQGA 3RVGA 5J87A 4U81A 3ITZA 3LQ8A 3MIAA 2XB7A 4RFMA 5DG5A 5CF5A 5LMKC 4J7BA 4FV1A 3R8VA 3EQRA 4G3EA 5AP6A 4BZDA 2BALA 2OZAB 4QDEA 5HCYA 3ORNA 3ALOA 2R3NA 2Z7QA 4FNYA 2F49A 4GIHA 4AP7A 5JMSA 3MBLA 3R63A 4LGDA 4E4MA 3A7IA 3BHTA 3K3IA 1WAKA 1TVOA 2XBAA 1O6LA 2YCRA 3LM5A 1PY5A 1MQBA 2X81A 3DQXA 5JGDA 2PUIA 3F88A 5L2QA 3R04A 3BBWA 3CTJA 4XMOA 3TYKA 1XBCA 3A2CA 2VZ6A 3PE1A 2I0YA 4ANMA 3QFVA 4IJ9A 4DITA 5J5TA 4ZOGA 4N57A 4BICA 3VS7A 4AGCA 1TFFA 3NMUF 3KQ7A 5BUEA 5BVNA 1PXOA 3LLTA 1MQ4A 4PPBA 3TNHA 3NS9A 5ETFA 1W2FA 2V55A 2WHBA 1R78A 2BCJA 3E8EA 5AUXA 4DHFA 4YJNA 2F7ZE 3OW3A 3DKOA 3DBCA 3NNUA 4KUJA 3ZLYA 1ST4A 4O21A 1VLRA 2BHEA 4R3CA 4QMOA 3LFAA 5AP1A 3UO6A 3HMIA 1XH8A 3VJOA 2QO7A 5IH6A 3LCTA 4I5PA 3R8LA 5BVEA 2XANA 2J9MA 2BTRA 4IIRA 2G2IA 5EDRA 4C58A 3DU8A 1KV1A 3DZQA 3KL8A 4D55A 3IW6A 2WO6A 3QQHA 2JLDA 2ITPA 4G6NA 3ZH8A 4AZSA 3IDPA 5FUTA 3TNQB 3ODZX 2WZJA 4RIXA 1YDTE 4YTIA 4AF3A 2IZSA 2W17A 4FVRA 3ZEWA 3GEQA 1NVQA 3TUDA 4O7VA 3OXIA 3PLSA 1W83A 2JC6A 3PPZA 4KS7A 3RMFA 3KRLA 3UQGA 3WILA 2VX1A 3ZSHA 2C6TA 4O6LA 5KMKA 3HX4A 3DS6A 1W0XC 1OITA 3HP5A 2YIQA 4G3GA 4M15A 4CXAA 3BCEA 4MX9A 5F95A 2YM5A 1H8FA 3NCGA 4I6HA 3HZTA 4ALVA 2HZ4A 2VN9A 1ND4A 3ZHPC 4DINA 4F0FA 1XQZA 1U54A 3GGFA 4L7SA 4EQCA 1M2QA 2R3HA 4GG7A 3P7AA 5T3QA 2ZDUA 3ORTA 2C6LA 4MWIA 5L2SA 3P86A 2QOHA 3OROA 1YDSE 4UMTA 2XZSA 3L9MA 4F4PA 4O86A 1OVEA 4UMRA 5CENA 4O83A 2RGPA 2UV2A 3HNGA 2H9VA 5C27A 4ZS0A 3Q2JA 1SVHA 2OH0E 1NA7A 5IA2A 5M4FA 3AC4A 2XBJA 4U6RA 3C4ZA 2W96B 3UDSA 5KZIA 3A60A 3KREA 4DAWA 4F9AA 5C8KA 3WF5A 3SAYA 2C6MA 3QD3A 2QG5A 2OK1A 1LR4A 4FI1A 1YXUA 3F82A 3I1AA 2YM7A 5CEIA 5JT2A 2PMOX 4FT9A 4LGHA 4PMSA 2ESMA 1Y91A 2QOBA 5A3XA 1AD5A 3O0GA 4OTHA 3GT8A 4RSSA 5BMSA 3NFGB 4C61A 4IC8A 5AUYA 2VTNA 4LI5A 5IKWA 5M4CA 2G01A 2YISA 3C7QA 3NGAA 4C0TA 2CLXA 1YVJA 4TNDA 4BCJA 5AUVA 4HPUE 4F63A 2F9GA 4AX8A 3DY7A 1YQJA 2YDIA 4XYFA 3U4WA 4UALA 1H28A 3ETAA 3MDYA 5I4NA 5IF1A 5FXQA 2GS6A 4A9YA 4MXOA 2J2IB 4L00A 4F9CA 4ASDA 4R5SA 1PXPA 2OJFE 4FE2A 2FVDA 4JBVA 4PMMA 5ANIA 3G9LX 5FG8A 2YABA 2BDFA 2Y9QA 5B2MA 4JMQA 2F7XE 2DWBA 3QA0A 2YCFA 1Z5MA 3OWPA 3PIZA 5DEWA 2YDKA 3CJFA 2J0MB 2OLCA 1V0OA 3BU5A 4DGGA 4F7SA 4AGDA 5AJQA 1UWHA 4I0RA 2EXCX 3AXWA 4DE4A 4ZTSA 2JIIA 3EKKA 3KRJA 2W9ZB 4E5WA 4ZZOA 3FLQA 3QBNA 2CMWA 1K2PA 4I94A 3GUBA 4MD8E 3OFMA 3SRVB 3GU4A 3JYAA 4M84A 1OUYA 3KCFA 4PDPA 3BZ3A 2ZOQA 3QCSA 5AV2A 5IMXA 4BIEA 4O7NA 3WYYA 4EZ3A 2ONLA 4DA5A 3M2WA 3DFCB 3FC1X 1W2DA 4RX7A 4MXAA 2QOIA 2XYUA 2XNGA 3AMYA 3GB2A 4L8MA 5BVFA 2W1GA 3FZ1A 5CXHA 2ZMDA 4F7JA 5DMZA 2OXDA 4L45A 2QLUA 3CQWA 1JBPE 3EYGA 1YHWA 3HLLA 4IAIA 5HG8A 3Q4CA 3WF9A 5I5ZA 2V5QA 1FQ1B 2J0IA 2OGVA 3EN4A 3NUNA 2W06A 3OBJA 2AC3A 4AA5A 5A46A 3LCOA 1M7QA 1WVXA 3KN6A 4ENXA 3FEGA 2HWOA 1Y8YA 4DH8A 2RKUA 2CKPA 3MH2A 4EK5A 2X7GA 3D2KA 4LFIA 3S95A 2BFXA 2Y7JA 5CLPA 3SG9A 3F69A 3C9WA 5M51A 2I1MA 1WVYA 2JKOA 1SMHA 4JQ7A 2UW5A 3MH3A 1XH6A 3V8TA 4YLKA 1PKDA 4AFJA 3P0MA 3QX2A 4NM5A 4YJQA 3H0ZA 2XJ0A 2X0OA 4L46A 3GXLA 4CZTA 5IU2A 3DT1A 1PJKA 3I81A 2QKRA 2GNGA 1XWSA 4JX7A 1PXJA 3R7GA 4BFMA 3U4UA 4S33A 1P14A 2A1AB 4I0SA 5CQWA 3SKCA 2O8YA 4FT7A 5KUPA 3FZOA 4DF3A 4RC2A 4D5KA 3HDMA 4H3BA 2CN8A 5TR6A 5HCXA 3MVLA 5IQEA 4KBKA 4O7RA 4OBOA 2YCSA 4DEHA 4XP2A 2OZOA 4OTIA 5E8TA 4DBXA 3UNJA 1HCKA 4H3QA 4G1WA 5EKOA 2XAMA 4DH3A 4IAZA 2YJRA 3IDBA 3BQRA 3VC4A 4JJRA 3QQUA 3EJ1A 3DA6A 3L9NA 4BKZA 3FHRA 4MBJA 5EKNA 3PXRA 3FE3A 1H4LA 3W33A 1TQMA 2C6OA 1APME 3BWJA 2A27A 2R9SA 3R8PA 3KRRA 2J90A 4FKLA 2J5EA 3KCKA 1G8KA 3QGYA 1OMWA 5C9CA 5M53A 3JR1A 4QP7A 2CHLA 5D11A 3FQHA 5CEOA 5EYDA 3TTJA 3DJ7A 1WVWA 5HNGA 3W2CA 2ZM3A 5CU0A 5CVHA 3ACJA 3Q2MA 3CC6A 4RVKA 4BI1A 4IWPA 4FUYA 5I9XA 1CM8A 3EFKA 1RW8A 4QMVA 5ICPA 1HCLA 2WFYA 3PFYA 2WMXA 3VQHA 3BIZA 4GCJA 3COIA 2FSMX 4JQEA 4ZSGA 4GFGA 4IX6A 5H2UA 1CKJA 4DFLA 5IH5A 3UPZA 3UC3A 2C68A 4XP0A 4YTHA 4RQKA 3FJQE 4QPAA 3SDJA 2WOTA 2IF8A 2PHKA 5E8SA 3D2IA 3RCDA 4C37A 4EQUA 1A06A 3KIOC 4EHVA 4CVAA 5DI1A 4BWPA 2C0TA 4PWNA 4G3FA 3DAEA 3TWJA 4YJTA 3QQKA 4K2RA 2C0OA 1J91A 1Q61A 3ZSIA 2PVMA 4BGQA 4I20A 1STCE 3R28A 4ERWA 5EQPA 2YCQA 5JH6A 4ACCA 3F61A 1XH4A 3O8PA 2GMXA 5AADA 4FEUA 4O1PA 3QXOA 4AW0A 3C4EA 3KVWA 4CQEA 4FA2A 3PRFA 4ZAUA 4KKGA 4XUFA 3ZU7A 4I22A 1LEZA 2P4IA 5ANJA 2ITZA 2XAOA 2OSCA 4F6SA 3MJ2A 4WRGA 3LFFA 3MB7A 1UV5A 4JL9A 3R6XA 5JFXA 3LIJA 3IONA 3I60A 1BL7A 5T6KA 5ETIA 3V8WA 4U42A 5IQHA 4R78A 3DNDA 4UMPA 2QOKA 3UTOA 2GDOA 2OU7A 4LM5A 5ACKA 4AE9A 4IEBA 5AR4A 4FIHA 2WEIA 5CSVA 1K9AA 3HRBA 4EORA 4YPSA 4J98A 4RZWA 2X4FA 3SRVA 3EMGA 3W1FA 4EJNA 5CZIA 4YJUA 1IRKA 4UY9A 4EUUA 3MYGA 3EYHA 5KNJA 4D5HA 4I6FA 3BV3A 2VWIA 3KXGA 4M97A 4ID7A 3ZUVA 4NJ3A 2QOFA 1WBVA 2C1AA 2BUJA 2ETMA 2QOCA 4W4WA 5EI8A 4Q9ZA 2E9UA 5C4LA 4X21A 4LQMA 3IK3A 3W2SA 2C69A 4R7HA 5LJJA 3NUXA 3BL7A 3VF9A 5L3AA 4FV6A 4U7ZA 4X2FA 4GW8A 3H4JA 3IKAA 3OCBA 5E9EA 4D4YA 2UZVA 4EHGA 4EOMA 3WIGA 2JEDA 4BCKA 2G2HA 2PY3A 2Y0AA 4XNEA 3W55A 3SLSA 5FRIA 4O4CA 3ZXTA 4QQTA 3V6RA 1F0QA 3UG2A 4K33A 3VBWA 4R5YA 2XNNA 4UB7A 1JVPP 4L9IA 4O0TA 2GCDA 2WMAA 5K0XA 2XIXA 4IZYA 4GEOA 4J52A 5K3YA 4BTJA 3COHA 3FI2A 3H30A 4X6RA 3R22A 5DT0A 3B2WA 1W82A 3SHEA 2QODA 4CGAA 1XKKA 1ZOGA 2EXEA 1KE8A 1PF8A 3DCVA 5AAEA 2WMTA 3SV0A 2O3PA 1ST0A 4YZMA 1FGIA 4EKKA 3SQQA 2X8DA 4RQVA 2OIBA 5L2IA 2IZUA 3B2TA 2BZJA 4ASEA 4NW5A 3NYXA 5AP7A 3PDTA 5IQFA 3KULB 3OEZA 3VUDA 4B8MA 4RJ4A 2W0JA 1XBBA 2UVYA 4KRCA 4YHFA 4QP1A 1BI7A 2BAJA 2PVLA 3Q53A 4PTGA 5HG7A 4MF0A 4C4HA 4DH1A 2PVHA 4C35A 3UDTA 1JNKA 3EFJA 3GU8A 4G5PA 4XG9A 2HXQA 4R7IA 3OD6X 3DBEA 4RJ8A 4CQGA 4CV9A 5JKGA 5F4NA 3ZRKA 4QD6A 2X6DA 3GBZA 2CNUA 3CXWA 3MESA 4HYIA 4ZSLA 4CG8A 5CEQA 4YO4A 5AM7A 4BCGA 5BYLA 3QAME 4QO9A 3EQBA 4IACA 3LXPA 4BKYA 3HP2A 4IDTA 4YPDA 3LCSA 4BI2A 4L43A 3PXQA 5AMNA 4IZ5A 5TT7A 4U8ZA 3LXKA 3HGKA 3QUPA 3BU6A 4NJDA 4K18A 1J3HA 4YNEA 5HX8A 3QQJA 2YLEA 2CKQA 3KB7A 4BCOA 1XO2B 3AT2A 4XRLA 1OIYA 4M8TA 5B2KA 1URCA 2GPHA 2WTKC 1IG1A 5HESA 3D7ZA 2QNJA 5M09A 2PTKA 3N51A 4JI9A 4DGMA 2C3IB 4I92A 5KE0A 2QU6A 4JBQA 2OO8X 3PWDA 1G5SA 2PK9A 3KXNA 4TY1A 5FLFA 2BRGA 4YUQA 4OAUC 4W4VA 2JKMA 2DS1A 3RM6A 4EH3A 1XMLA 3HVCA 2F4JA 2VTHA 3MTFA 3PA4A 3GU5A 4G6LA 4QYEA 5EH0A 4PQNA 4QTCA 4DFZE 4OBQA 3RPOA 2NRUA 3CTQA 3ZFYA 4CTBA 2PE0A 4KS8A 3NW7A 2R3PA 4CLJA 3K5UA 3OXZA 4OW8A 1V1KA 2XA4A 4GKIA 3VULA 4TPTA 4MEDA 4FTAA 3OVVA 4Z16A 3NW5A 3CEKA 5M08A 4I6QA 5CI7A 3H9OA 4BDIA 3FC2A 3RZFA 5C8NA 2O5KA 3KA0A 4ITIA 1U59A 2VWXA 4YJRA 4PX6A 3RAHA 1IAJA 1I44A 4Y8DA 4MK0A 5J5SA 3ATSA 4JBOA 5IUHA 3AG9A 5DVRA 4U9AA 3DFAA 4BBMA 2A19B 1KUTA 1XH7A 4LL5A 4I93A 4PP9A 3A7GA 4LUEA 2WMWA 3HDNA 1Q3DA 2O2UA 3A8WA 5BVKA 4OTFA 4CEGA 4DCEA 3RPVA 3E7OA 1FOTA 4R7BA 4ZJIA 5EHLA 4D0WA 2JDVA 1I09A 5KO1A 3ORPA 4RT7A 4AZVA 2WNTA 4UZHA 3VAPA 4IWDA 3TKIA 3RPSA 4H05A 5CAPA 5KMOA 1Q99A 4DBNA 2FSOX 1SVGA 2GSFA 3A62A 5DFPA 3R9DA 3C1XA 3WZUA 4FBXA 4FZ6A 4JAIA 5LQFA 2XK6A 5I9WA 4OTQA 4TN6A 4XOZA 2W1HA 3ZFMA 4CFXA 2H34A 3RAKA 5IUGA 5FBOA 4ZIMA 3HV5A 2VTIA 3VIDA 4KKEA 5BUIA 5HX6A 3LLAA 3ZEPA 4NUSA 3OOMA 4FL3A 4GT5A 4IAAA 1ZZLA 3SW7A 3BLAA 2WQOA 4FTNA 3E3PA 4EZ7A 5DNRA 2ITUA 3LKMA 3FV8A 4RX5A 1W7HA 4C3FA 5DR9A 1H08A 1S9JA 1XH9A 3EL7A 3PY1A 2XUUA 3KFAA 4X3JA 5LVLA 4O0YA 4FKOA 4JG6A 3VS0A 5DA3A 3AC5A 5IG1A 3D5UA 2BIYA 4FKQA 1BKXA 3P9JA 3ULIA 5JQ5A 4UXQA 4BJJA 2PE1A 4OBPA 3T9IA 2PUPA 5JRSA 4O7YA 4APCA 5C01A 3TT0A 5CT7A 3FSKA 3I79A 1J7UA 4ANOA 4HGLA 3ZBFA 4OUCA 3AKLA 2OF4A 3NRMA 3P1AA 3FBVA 3KULA 4XOYA 3WZDA 4OTDA 3DLZA 2ZYBA 2UW6A 3I0OA 1JOWB 1JQHA 2X7FA 3UIMA 4E7WA 2WQBA 3GC0A 4H36A 5IISA 1SZMA 3TUCA 3Q96A 4RIXB 4TYIA 3RK5A 2XP2A 4N70A 5IEXA 2RG5A 4U44A 2VTTA 4AZWA 2WPAA 3C13A 2W99B 5L6WL 2P0CA 2R3RA 3ZSGA 3ZZEA 4D1ZA 1ZYJA 3QU0A 1SNXA 4K0YA 3QGWA 5BMMA 2OXXA 4EYMA 3N4UA 1ERKA 3ORXA 5KKRC 3CD8A 3LE6A 4AFEA 2NPQA 4JG8A 3GCVA 3L1SA 3C0HA 3ET7A 3FZSA 3Q52A 4ZK5A 5EYCA 5IDNA 1U54B 3V5PA 3QZGA 4GL9A 4Z9LA 3R9NA 4AAAA 4DFXE 3GI3A 2IO6A 5FP6A 4ALUA 3SOAA 5FP5A 2WMRA 4FKUA 5CASA 2XJ1A 5EM5A 3DB6A 3VUIA 5E8YA 1R3CA 1MRYA 3BHVA 5FEQA 4O27B 3OT3A 2GTNA 3KC3A 4O4FA 5BYYA 3R30A 4FV8A 2BAQA 4FG7A 4RGJA 3V8SA 3UC4A 2YZLA 3L8SA 3F3TA 4TYGA 4D9UA 4R1VA 1FGKA 4FSRA 3LFSA 3PJ8A 1G8AA 5E8VA 3RAWA 4WSYA 3BWFA 4AQCA 4DGNA 5HLWA 2VX3A 4AN3A 4FJVA 4AXCA 5AIKA 3LXNA 5J95A 3VBQA 4FF8A 4X6QC 5D41A 1H0VA 1Q3WA 4QMLA 4AXEA 3TJDA 3PVBA 3TZMA 4LRJA 3OTVA 5J7BA 2RIOA 4QTAA 5CSPA 3UZRA 3VW6A 4FTRA 1CSNA 4FG8A 4WOVA 3BEGA 3C0GA 4B0GA 4JBPA 5FQDC 3RWQA 1OGUA 2R3FA 4MXCA 2XCKA 3FXWA 3Q6WA 2HZIA 3L8PA 2JIUA 3UMWA 3KXXA 4WT6A 3UYTA 4RRVA 2VTLA 4MF1A 4F64A 4NK9A 4MKCA 4AQKA 5LVPA 4GK3A 3DBFA 5K5XA 3AGLA 2GS2A 4C36A 5A4EA 2UW8A 4E6AA 5L4QA 2ETRA 1ZZ2A 4A06A 4V01A 5HE2A 4YZDA 2WIPA 3F2NA 3ATTA 2YIRA 3GCSA 4FTLA 4FOBA 4O0SA 3KVXA 3REPA 5EOBA 4G3DA 4JRNA 4QMQA 4UN0C 2WU6A 4FSZA 4CTCA 4LGGA 3VUHA 2PE2A 5IH4A 4HPTE 4RWLA 3DBDA 5FGKA 2VGOA 3A8XA 3D4QA 3MW1A 3OC1A 3R9OA 4AXAA 4B6LA 4CD0A 5CX9A 4P5ZA 3R83A 3WF8A 1IA9A 3QRIA 4WHZA 2WD1A 3LMGA 3MY1A 2EB3A 3U51A 4ACGA 4EOSA 3Q9YA 4J71A 1GNGA 2C6IA 3JS2A 3A7HA 4V05A 1T45A 2PMLX 3VUMA 2HOGA 2IW8A 3CTHA 5AAFA 5E91A 3GFEA 4EH2A 2UVZA 5EYKA 5HNBA 5HG9A 5HVYA 2JDTA 5LXMA 4YP8A 2OF2A 5DPVA 3ZUTA 4IH8A 4WKQA 4NKAA 4Z3VA 5IEVA 3F3WA 4J96A 4USFA 4I6BA 4BF2A 4RVMA 3NNXA 5H8BA 4BTKA 5L6OA 4FKGA 5D7VA 3LFEA 4E5AX 2AC5A 1KSWA 2R3LA 4KBAA 1WCCA 4BTFA 4WG3A 2WTVA 5JSMA 2F2UA 2PZPA 5M4UA 1B39A 1JSTA 4YU2A 2DUVA 4V0GB 2JDRA 1OKZA 5BQ0A 1QCFA 1Q97A 1OB3A 3R71A 4U5JA 3UIBA 5HLPA 4DDIA 5EM8A 2GFSA 3F66A 3IO7A 3RWPA 3SW4A 5EM7A 2CNQA 5D9HA 4B9DA 2A4LA 2VTMA 1ZYDA 2RFDA 2R4BA 4RFZA 4IDVA 2KULA 2VWYA 3QD2B 3N4VA 3FHIA 3W10A 3O51A 1OUKA 3EWHA 4OT6A 4CRSA 1R0PA 2XK7A 5AUWA 4EK6A 2H8HA 3E3BX 4D4SA 2OJJA 4RWIA 2YIWA 3T3UA 3OWJA 4QDVA 2WGJA 2QLQA 3IG7A 3SA0A 2IG7A 2HXLA 4WUAA 4HGSA 3UP7A 5CAUA 1Q24A 4GUEA 4C7TA 3ZONA 2CCIA 3V5JA 2XIKA 4IB1A 3FUPA 4IX3A 2R7IA 3NCZA 1DM2A 4CZYB 2F2CB 2CKOA 4ONAA 2YIXA 2C3LA 3VBVA 4DHJA 4DH5A 4WG5A 2XEYA 5C8MA 4G2FA 3P5JC 1NW1A 2XYNA 4ZTQA 2W5AA 3E7VA 4QYHA 4EOIA 2ZM1A 3NUPA 3DXNA 2CKEA 4FT0A 1YOMA 4L6QA 3TKHA 1PMNA 2UVXA 1ZMUA 3G2FA 3C4CA 3HV6A 3VONA 3RM7A 3VS4A 3BLRA 4PNIA 4D2SA 4KINA 4P5QA 1CDKA 3L9LA 4I24A 3OY3A 4NM7A 4PUZA 4XG4A 1YWRA 3W18A 2X9FA 4CNHA 5JGBA 3NNVA 3BGQA 4E20A 4R77A 1JSUA 3G90X 3P23A 3ZS5A 1GZ8A 4BYJA 3RHXA 3E87A 4LRKA 3DJ6A 1H1PA 2HENA 2VWWA 3TEIA 2UZDA 2VRXA 4O0RA 3IW8A 5LWMA 3QZIA 3GCQA 5C4KA 2WMSA 3FMKA 4WSQA 1PXNA 4LOPA 1JAMA 2R3MA 3PPKA 3PG3A 4FTKA 4CFVA 2X2KA 4C02A 2WAJA 4ZMFA 5BVOA 4FV2A 3NAYA 5JK3A 4NL0A 3OWKA 4ANQA 2YM3A 3E88A 5CANA 3FXXA 3PVUA 4RIOA 3O71A 1Q41A 5FTQA 3MSSA 1SM2A 4B8LA 4Z7HA 3P7BA 3R7VA 1X8BA 4JAJA 2I6LA 4FIIA 1JKKA 3QQFA 4XS2A 3U6IA 4KAOA 3BPRA 3GU6A 3KXHA 4USEA 2IVSA 3LMHA 3LM0A 4W9XA 3MVMA 2V22A 3GU7A 4AE6A 4O81A 3FZTA 4X7QA 3TNWA 4FIJA 2X8EA 2BFYA 4B7TA 4FSWA 4F1OA 5DRDA 1PMVA 2PZ5A 3GC9A 2Z7RA 3MN3A 3QQGA 4L3JA 1Q8YA 1ZLTA 4G17A 4AN9A 3B8QA 4BDFA 4BGGA 4EK8A 4JQ8A 4F1MA 3K5VA 4XG8A 4F7LA 3BLHA 5CSXA 5AUUA 5M57A 4GFOA 5HBEA 4KA3A 3PP0A 3LJ0A 4CMTA 2XNBA 3RINA 4X2JA 3DK7A 5EW8A 4DFYA 3MPMA 3VQUA 4QT1A 1O6YA 4EC8A 3AOXA 5IA1A 3FZPA 5TKDA 1WBNA 4HVDA 1IA8A 2UZTA 4HCTA 4JOAA 3QA8A 3R1SA 5IQCA 2R3KA 3AD4A 3JVRA 3H9RA 3G33A 1REJA 5ITAA 1XJDA 2ZDTA 4IB3A