2W5HA

Human nek2 kinase apo
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
277
structure length
265
Chain Sequence
b'SRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSHRDLKPANVFLDGKQNVKLGDFGLARHDTSFAKAFVGTPYYMSPEQMNSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE NEK2
publication title Insights Into the Conformational Variability and Regulation of Human Nek2 Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 265
sequence length 277
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2w5hA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2w5hA01
3QC9A 2WMBA 2OWBA 1PXPA 1KV1A 2PVFA 3BHYA 4MX9A 4P90A 5HBHA 3SXSA 3ZMMA 4EC9A 3JPVA 4XG4A 2UW8A 2YCFA 3FLQA 2A27A 3EJ1A 5E91A 1YWRA 3VS2A 1A06A 2YACA 3E3PA 4CFFA 5M09A 3GENA 2PVMA 3TKUA 4BHZA 4O22A 2UUEA 2V0DA 4CV8A 4JG6A 4FV5A 1PMVA 5EHLA 2BAJA 4N70A 3FQSA 4FTRA 1OM1A 2WHBA 3TEIA 3NW5A 1MRUA 4F09A 3ZM9A 1GIHA 3R7EA 4NFMA 3TNWA 3QGWA 4U3YA 2X81A 5C26A 3A7GA 4X3JA 2VO3A 5AUUA 1CM8A 1GIJA 3GU7A 3Q2JA 1FOTA 3EQPA 4YZNA 1WVWA 4TYHB 4U97A 5KKRB 3F2AA 4DINA 5CAOA 3COHA 5CF8A 4QP3A 1ATPE 3ZS5A 3BHUA 3NYVA 2OJJA 4OUCA 2BDFA 3QAME 4U8ZA 3EFWA 4BCKA 3RAHA 1B6CB 2J4ZA 4FT3A 4BKJA 3QQLA 4EH2A 3NWWA 2Z02A 1QL6A 3NUYA 3W55A 4O81A 3MB6A 3DNEA 4G3CA 3MB7A 3WF5A 2PMOX 4RC4A 3BYVA 3OMVA 2YZAA 3IOPA 2GNLA 4I4FA 4EBVA 2BRNA 2DUVA 3DTCA 3MDYA 2A19B 3FI3A 3EQDA 4M13A 5F95A 5LVPA 2CDZA 3UVRA 1PRYA 3TJDA 1JSUA 1J7LA 3PIYA 4ID7A 2CNUA 2EB2A 3QWKA 2E9UA 1WBWA 4DH7A 4EOIA 2VWIA 3O50A 3O96A 3FYJX 4EH3A 4HW7A 2XK4A 1NY3A 2GPHA 5BMSA 3GU4A 3FLWA 2XBAA 4OAVB 4TNBA 4F64A 3ZRKA 5D12A 3R8ZA 4PL4A 4D1XA 3VN9A 2CN8A 4ZP5A 3DXPA 2PZYA 5CSHA 3WZEA 3B2WA 4JBOA 3ZRLA 1F0QA 3CD3A 4D1ZA 3TNHA 3DK3A 3QYWA 4KBAA 2YFXA 3PRIA 3C4ZA 1W0XC 1TQMA 4YPDA 3P5KA 3TM0A 1XH4A 3DBEA 4AS0A 5EQPA 3EN4A 4BCOA 2YAKA 4E7WA 2ITZA 4F1TA 1PMNA 1H1RA 1WFCA 4FC0A 3WIKA 3BGQA 4FUXA 2FGIA 3QTWA 5IG1A 4FYNA 2WTDA 4O0RA 1KWPA 4BZOA 3DQXA 2E9OA 4C37A 3OP5A 4U80A 3VS1A 4IX3A 3R00A 3SKCA 4X7QA 3PP0A 4U7ZA 5T3QA 2BRBA 3F3UA 4PMTA 3Q4ZA 3HMOA 2EXMA 4DFUA 2QU5A 4QYFA 4XUFA 5CSVA 1ZMVA 3O8PA 4FTMA 4IXPA 4XP3A 1BYGA 3EFJA 1Q61A 3QHRA 4WG3A 2WU7A 2O0UA 2B4SB 3ZRMA 4DAWA 5BVKA 4CQGA 2CNVA 3DFCB 1JAMA 5CEPA 5FXQA 4TPTA 2CGVA 4ITHA 3FUPA 4GUBA 3KK8A 4IW0A 2DWBA 2ITQA 2V7AA 2X9EA 4O38A 3CGOA 3AC8A 3LXPA 5CZIA 3FHIA 4EL9A 5HE0A 3KRLA 3KXNA 3R2BA 1PXMA 3DCVA 2GQRA 3MSSA 2IVSA 4YNOA 2QCSA 3PG3A 4BGQA 5ANGA 3OUKA 2IW9A 4PY1A 3NNUA 2XNGA 4EKLA 4M69B 3PSDA 2VTAA 2XKDA 3FZRA 2YCSA 4G6NA 4BI0A 4BCPA 4XV2A 4O6LA 4Q5EA 4E5BA 4FL2A 3C0GA 4GIIA 3EH9A 3Q5ZA 4BCNA 5F9EA 4FEXA 4JNWA 4L01A 4S33A 5KUPA 3R2YA 2R3MA 2XIKA 2C6EA 5J95A 5BVWA 2W99B 4MAOA 5ETFA 4KKHA 5JMSA 2OW3A 3HV4A 3MH2A 1P2AA 3PXFA 2WTCA 3K5VA 5AWMA 3NLBA 2ZDTA 4PPAA 3CQWA 2BAQA 3FE3A 2R3KA 4U40A 1IG1A 4FEWA 1U59A 3ENMA 4J8MA 2V7OA 2B55A 2WZJA 3PE2A 2G2HA 3DAEA 3NCGA 3ORKA 4O0XA 5AMNA 3TI1A 4DEEA 4E6QA 4GSBA 3WF6A 5BUIA 2BFXA 3P7CA 2GDOA 3A61A 4FSQA 4O96A 3BX5A 5HTBA 3HAMA 4O82A 1CKIA 5IF1A 1YDRE 1JKLA 4CZTA 3ZCLA 1P4FA 4AE9A 4P5ZA 5E8XA 1BL6A 3RWPA 3V01A 4V05A 4G16A 4UXQA 1A9UA 2W4JA 4E20A 2XA4A 1OL2A 3OXTA 4XV3A 2H9VA 1IAHA 1GNGA 4GFGA 3DT1A 2ITTA 3Q9XA 4OTHA 4ANBA 5KMKA 2G2FA 4CCUA 4MBIA 5DG5A 3VRZA 3SHEA 1P14A 2CGUA 3S4QA 3IQ7A 4KKGA 4ZJVA 4UX9A 2WTKB 2PZPA 4G2FA 1M2PA 2VWYA 2C4GA 4V0GA 3M42A 3ZSGA 4RIOA 5C01A 4M15A 1OPLA 2ITUA 3CJFA 4GW8A 4J95A 1WBVA 5M56A 4C3PA 3LQ5A 4MTAA 4R7BA 4O21A 2X1NA 1Q8UA 2Y4IB 2OGVA 3R01A 4RRVA 3F66A 5FGKA 2B9HA 5AUWA 2XEZA 4C57A 4DITA 4I24A 3BHVA 4HPTE 2HIWA 3EN6A 4FV8A 5GZ8A 1UWHA 2WB8A 4D2VA 3KULA 4M66A 5FP6A 3VUMA 2C0OA 3ZTXA 2Z7LA 1R0PA 4MVFA 1REKA 3IGOA 2ZM4A 4BDKA 5L8LA 4FIGA 4QMSA 4WNPA 5IUHA 1NT2A 2SRCA 4CCBA 2UZEA 3U87A 4BIDA 3NDMA 5ANDA 4G3GA 4NW5A 3BV3A 3QA0A 5AEPA 2W5BA 4GT5A 3C4CA 2VTTA 5IU2A 3E92A 1K3AA 3HA8A 5KMLA 3UOHA 4YZMA 4AA5A 3K5UA 4AW2A 3OOMA 5BNJA 5B0XA 2W9ZB 3QZHA 3SOAA 3FSKA 1YXSA 5AR4A 4RJ6A 4BWXA 4OAUC 3WZUA 4EUTA 5K5XA 2P33A 4GS6A 4IX5A 4AXAA 2BHHA 5AV2A 4QMNA 3OUNB 1MRVA 2IW8A 1O9UA 5DRBA 3T9IA 4OTPA 1H01A 1I09A 3A7JA 4FKIA 1OKYA 4FEUA 3UDBA 2YIRA 3ORTA 1Q4LA 3Q53A 4IE9A 5HCYA 5GZ9A 2PY3A 3BV2A 3RWQA 4NM5A 1CTPE 2OBJA 3P1AA 5CVFA 3AT2A 2BIYA 3EQRA 4FI1A 4J98A 3TZ9A 1Y8GA 3R7IA 4XLIA 5JRSA 2R3HA 2FYSA 2VO7A 4JRNA 4B7TA 1M7NA 1ZOHA 3O0GA 4ZK5A 3TJCA 3I81A 4QOXA 4QYGA 5BVFA 3V5TA 4I4EA 1SNXA 3H3CA 4MK0A 5H2UA 3RPRA 5DNRA 4O7TA 1XH9A 2JIUA 3LHJA 4C38A 4L3JA 4BDJA 4CZUA 5M07A 3BIZA 4GVJA 1H1WA 4S2ZA 5HGIA 4BDIA 2ITWA 4O2PA 5HG9A 2W0JA 3C13A 1ZXEA 2BCJA 4ALWA 4DGNA 4EK4A 3F2RA 5LMAA 2WQMA 1M14A 5JFXA 5KX8A 3F3VA 1J1CA 1TVOA 2VTMA 3TZ8A 4AW0A 5CSPA 2XS0A 4PTEA 2P3GX 3W2QA 2QOCA 3AOXA 2RFSA 1XH5A 5AAGA 1NVQA 4AUAA 2QO9A 4M8TA 3L9PA 1PKGA 3NW7A 5FWKK 1OKWA 4F9AA 2XK7A 3WIGA 2O8YA 3AG9A 3RPSA 2YJSA 3F7WA 4LI5A 4N6YA 4D2WA 2JLDA 4RA4A 3D7TA 2C6TA 4O0YA 4CFNA 5IH4A 3EFKA 2DQ7X 1NXKA 3MPAA 3PE1A 2ONLC 3LCKA 4CTCA 3TIYA 5TO8A 3RK5A 4FODA 4YHJA 4LMUA 5JGDA 4IFCA 2XNNA 3AD4A 5IH6A 4UMQA 2G15A 3D5VA 3U6HA 3DBCA 5HD4A 4PV0A 1PHKA 4TWOA 4DYMA 4L44A 2WELA 5ETAA 1NVSA 3QQJA 4IDTA 3FZTA 2GNGA 3W32A 4A06A 2FSTX 1MP8A 2PVLA 3I5NA 1YHVA 2C3IB 1Q8WA 4CLIA 5J9LA 4FL3A 4IVBA 2QOIA 4EEVA 5IQHA 5FBOA 4GKIA 3G9LX 2Y9QA 3HP2A 4AA4A 5GZAA 4UEUA 5JFSA 3LKMA 3D0EA 4FZDB 5AA9A 2W1DA 3OT8A 2PHKA 5KKRC 2YLFA 4IX6A 5HNIX 3U54A 5C8MA 5A54A 5EH0A 4Z7GA 4BYIA 3QD3A 4OTDA 2B53A 1ZZLA 3FV8A 4DN5A 3VAPA 2W5HA 5IUIA 5FXRA 5CTPA 5A4LA 3V5PA 3R1QA 4CXAA 4DH1A 4I22A 5B7VA 1J3HA 3KFAA 4BC6A 2CKQA 4QP2A 4QMWA 5E1SA 1GZKA 3O51A 3UBDA 4RFMA 2XRWA 5GHVA 1OVEA 2OFVA 2UW7A 4U9AA 5HQ0A 3CS9A 2Z7QA 4GK4A 4GVAA 4KNBA 2W1IA 4PDYA 3R0TA 4L8MA 3FMNA 2BZKB 1VYZA 4D4YA 5L6OA 3COMA 4IZYA 1XBAA 4LUDA 3NAYA 4O7LA 1V0PA 2OU7A 3ITZA 5CU3A 5DH3A 3GC0A 4AW5A 5JT2A 1ND4A 1H0WA 3O23A 3ZDIA 4JR3A 3VRYA 3RMFA 4D0WA 4KWPA 3EIDA 4D2TA 3KGAA 3K2LA 5CU6A 3DGKA 4L6QA 2C5OA 3JY9A 5CEQA 4MKCA 5F1ZA 4IB1A 5HOAA 3H9OA 5HTCA 4LM5A 3UNZA 3VQUA 3QLFA 3MH3A 4MWIA 4EKKA 4CYJA 5DVRA 3PWYA 4RC3A 3E64A 4CLJA 4JRVA 1OECA 2ZM3A 3FAAA 1H1SA 2WFYA 2XM9A 3JVSA 4FYOA 3RPYA 3PJ8A 3S00A 4EH4A 3UOJA 4AN9A 4KA3A 1JKTA 3PA3A 2GU8A 5IA2A 3CEKA 4DEBA 1Z9XA 4BGGA 2J0IA 2JKKA 1R78A 3LXLA 4F70A 4RIXA 3U8WA 5FM2A 4TL0A 1OKVA 1JQHA 3GEQA 3QYZA 3KXHA 4RWJA 2W5AA 4R3CA 4WBBB 3MFSA 5DEWA 2IPXA 2X4FA 3KKVA 1J1BA 5CNOA 4RC2A 2RKUA 3EKNA 5CT7A 3F5XA 4IM3A 1Z5MA 1XHAA 4ZMEA 3WZKA 5C27A 5L3AA 4KIPA 1WBNA 4M0YA 4Z16A 5JK3A 4BR3A 4RWLA 2F7XE 3TUBA 4O6EA 5AV1A 3FMHA 3NRMA 3SRVA 3ORIA 3UMWA 2QHNA 4PL5A 3LFQA 4QMMA 3WZDA 3PRFA 4ZZNA 5HO7A 3VBWA 2VU3A 5AR8A 3CR0A 3OCBA 1JBPE 3K54A 2B9IA 2OSCA 4CQEA 3FQEA 3UVPA 3BYMA 4O7VA 2V55A 2Y7JA 4CFWA 4MXXA 1ERKA 3L8XA 5AAEA 3S1HA 3S95A 3DDQA 4LOOA 2WMTA 4AZWA 5I3RA 3KVXA 3RKBA 5M4IA 2HWPA 4FZAB 5HCZA 5AFVA 3OBJA 5LVMA 4F4PA 3AGLA 1UVRA 4IIRA 2RFDA 5G6VA 2XYNA 2W17A 1JNKA 4FA2A 3G9NA 1FMKA 4BCIA 3UTOA 3KA0A 2X9FA 3P0MA 3R28A 4A9UA 3FXWA 5EDPA 4PMPA 1UU9A 4QP1A 4RT7A 4V0GB 5DT3A 2B0QA 4FGBA 4FKOA 3HX4A 4IFGA 4RWIA 3ZLXA 4HZRA 4LV5A 3VC4A 4ASXA 5FTOA 4UN0C 4ZY4A 5DEYA 3MWUA 4FL1A 3CLYA 3QX2A 4AGUA 5CSXA 2VO0A 5EHYA 5CSWA 1YQJA 5J1WA 5CT0A 3ZONA 3PG1A 1I44A 4W8EA 4YJNA 2G9XA 2UZBA 3HDMA 3ODYX 3Q6UA 2RFNA 2XBJA 3QCXA 3RJCA 3KULB 3OVVA 3W10A 1NVRA 4E4XA 3WYYA 4Y95A 2NRYA 3FSFA 2OG8A 3EN9A 3LAUA 2R3PA 4BCJA 4DCAA 4BCQA 4D2PA 2C5YA 4FV1A 4GFMA 4KBCA 5FTQA 2VTPA 4ZTRA 4AP7A 3Q9YA 4AQCA 4CG8A 1XBCA 2H6DA 3VS3A 2IZTA 3C4FA 3VHEA 5CEMA 2JGZA 2OIBA 2JIVA 5L2SA 4GRBA 2ITOA 3F61A 3LFNA 4Q9ZA 3NUSA 3LCTA 2VTJA 3MYGA 2OKRA 3Q4TA 1PYEA 1V1KA 3AC3A 4RX7A 4Y5QA 3ZLWA 3QCSA 3RVGA 4FSUA 4ZZMA 3GU5A 5HU9A 3WE8A 3FY0A 3P4KA 3FI8A 3DS6A 3OS3A 1WCCA 3KC3A 3RNIA 5ANKA 4X2FA 5BQ0A 3AD6A 4IADA 5AM7A 3D94A 3F82A 4OBPA 4QNYA 5BMMA 2WMAA 4HGTA 5CZHA 5C4KA 4L9IA 4FT7A 3A7FA 4M7IA 4MF1A 2WTKC 1G3NA 3RK9A 4EORA 2PPQA 4I93A 5K0XA 3RTPA 2EUFB 2J0KA 3OD6X 3FPMA 3OT3A 4FKQA 3ROCA 5E8YA 4PWNA 3ZLYA 3PVWA 4GT3A 1O6LA 1YI3A 5EYDA 3PXKA 4F63A 1KV2A 1GOLA 4BY9E 4IAZA 5FDPA 3R8MA 4GYGA 2HXQA 4C36A 4LRJA 4FE2A 1Y91A 4YTFA 2WTWA 3F3WA 5EYMA 5M4CA 3LFFA 1Q3DA 3G33A 2BALA 1OGUA 4Y83A 4C4IA 4F0IA 2OZOA 4J99A 2WTJA 5D41A 3ZUVA 3ORLA 4E6AA 3G0FA 3L8SA 4E4MA 3PA5A 4K6ZA 1SZMA 2R0UA 4TWPA 2JDRA 3P23A 3EL7A 3R02A 3QKKA 4FKJA 4BZNA 2R3QA 2QG5A 3KXXA 3OTVA 4CT1A 4EI4A 3RI1A 4O86A 3TG1A 4I3ZA 5TT7A 2ITVA 3I79A 3T3UA 4FBXA 4DFBA 3ATSA 3GOPA 4OR5A 4CKJA 4FOCA 5DR2A 3DKGA 3GCQA 4QMQA 4ERWA 3EMGA 2QOOA 3D7TB 4H36A 3GCVA 3E3BX 3MY5A 3V5QA 5HE1A 3VUKA 4NH1A 3WF9A 5B2LA 1MUOA 5DR9A 5GJDA 4A4LA 3UYSA 4UV0A 4GV1A 3HMIA 3IOKA 4G6OA 3TUDA 1JKKA 5A4QA 2J6MA 2R0IA 3SXFA 2OJ9A 1UNGA 1IR3A 3G5DA 1H28A 3FZPA 4L52A 4GL9A 4L00A 4IACA 3EN5A 5D11A 4AT4A 4EH9A 4O0TA 5L6PA 4HNIA 2JDTA 5IPJA 5AIKA 4BRXA 2WMXA 3UE4A 3DLSA 4WD5A 3KK9A 5AP5A 2ZB0A 5IISA 4YSMA 3R8LA 5EOLA 2VX1A 4J96A 3PWDA 2J0MB 3F88A 1VEBA 1ZYJA 2CGWA 3QGYA 5HO8A 4W4VA 4KABA 2R3IA 2IZSA 2XUUA 2CMWA 4RMZA 3V6RA 2O63A 3C0IA 5HG8A 5KHXA 5M08A 3FEGA 3QD2B 3R7YA 1XWSA 3HL7A 4NK9A 3RPOA 4ZJIA 1IEPA 2DS1A 1UNHA 2PE0A 4XH6A 2A0CX 5J79A 4W9WA 3F6XA 3ZZWA 3D5UA 2WMQA 5FP5A 3QRJA 1WBTA 3CQEA 4FVQA 4QRCA 4RWKA 4EK8A 4JX3A 4QP4A 3I6WA 4PDOA 3GC7A 4FTTA 5AV4A 5IA3A 3ZSIA 2IZRA 3Q60A 4O1OA 5FEEA 4G6LA 3EB0A 1WZYA 5D1JA 5L8KA 4KSQA 1IASA 4G17A 3PY1A 1U4DA 3ZU7A 3UVQA 5AAFA 4U5JA 2YEXA 4ZTHA 3NAXA 3WF7A 1QPJA 3KB7A 2BUJA 5L6WL 3QTSA 4EOMA 5T6KA 3R7VA 5C03A 3R9DA 4BCMA 3A7HA 4XEYA 2X8IA 2BTRA 3DAJA 3EWHA 2R3JA 2J5EA 3DB8A 3GVUA 4FV3A 3PFQA 3FZ1A 2WAJA 4HNFA 4PMMA 5AX3A 2B1PA 1ZARA 3DDPA 3CQUA 5EW9A 5BUEA 1VYWA 2YM4A 4BIBA 4DH5A 4XG2A 3C50A 4C61A 3V04A 3QQGA 2QI8A 3LLAA 4BBEA 4A9TA 4C7TA 3MVJA 5LWNA 4RIXB 4YZ9A 2UW3A 4YJSA 4QQTA 1UV5A 5I9VA 2QR8A 4YURA 2X6EA 2PUPA 1FVVA 2CCHA 3HECA 3IW4A 4U45A 3IG7A 3GP0A 4AWIA 3Q32A 5ANEA 5FD2A 3THBA 4DGOA 4I6QA 2JKQA 4CNHA 5IDPA 4UYAA 3QXPA 2EB3A 4FT9A 2G2IA 4XV1A 4PP7A 4FSZA 1P4OA 3SRVB 3COIA 3GCUA 2C3KA 4B8LA 2ZMDA 3LQ8A 4BCHA 4NZWB 2WXVA 4WA9A 3Q96A 5B2KA 4X0MA 1ZOEA 3F3TA 4GH2A 5HHWA 5BX0A 5DE2A 4BICA 2C3JA 3LCSA 4TZRA 3C4EA 4JBQA 2F49A 3VUDA 4C59A 2YCRA 4Q5HA 3L8PA 4XBRA 3ZM4A 2PYWA 1YOJA 4MQ1A 2UW0A 4NEUA 4S32A 2UVZA 3ZZEA 2IN6A 3QBNA 2BTSA 4CTBA 3BGZA 1G5SA 3PXYA 4QQCA 4RIWA 4JL9A 4IJ9A 3GCSA 4LMNA 1PY5A 4FNWA 1MQBA 2XK8A 2R7BA 1KE7A 1T45A 4EWQA 1YI4A 1KSWA 2HYYA 2X7GA 3QTRA 2GQSA 4IAYA 3NUNA 2PMNX 2JDSA 4AX8A 3GQLA 4O0WA 2B7AA 4CKRA 2CKOA 4GG7A 3MH0A 5EQEA 4IVDA 3D15A 1BL7A 5A3XA 4CVAA 3GFEA 2XM8A 3D9VA 4OTFA 3MVMA 4FZ6A 4QMYA 4XG3A 5HD7A 5LCKA 3ULZA 2RG5A 5CWZA 1R1WA 3OCTA 1DM2A 4DFZE 4EHVA 3VJOA 4F65A 2RSVA 3LJ2A 3GC8A 4IAAA 5LQFA 4OBQA 2B52A 4BDDA 2WQBA 5HZNA 2OK1A 3R8UA 3DOGA 5C8KA 3OTUA 4F9YA 4QTEA 5H8EA 3LMIA 1M2QA 3C7QA 3ORNA 3FMKA 3GUBA 2RL5A 2P4IA 3UC3A 3OWLA 1H25A 4OTRA 2PUNA 4H58A 4CGAA 2C5NA 5HI2A 4DTBA 3C5IA 2PVYA 5FTGA 4E26A 4WO5A 3R9NA 4YJOA 4DGLC 3A8WA 2JD5A 3CXWA 4HCUA 1DI8A 4IAKA 4U42A 1FPUA 4XNEA 4ZSEA 3A60A 4AZFA 1PW2A 4E8AA 2AUHA 3PIXA 4QP9A 1ZRZA 2XEYA 1E9HA 4CMOA 2BZJA 3WBLA 3SAYA 4Q2AA 3CY3A 2QO2A 4U6RA 5AP7A 3VS0A 4TTHB 3QZIA 3SXRA 4V01A 4S34A 4FEQA 2RFEA 3NGAA 2EXEA 2WU6A 1APME 4NM7A 5KMMA 3UP2A 3REPA 3UOLA 4JBVA 5E8SA 5HVJA 3VJNA 4JAIA 4FGRA 2J5FA 4X2GA 5HO6A 2QOQA 1MQ4A 5HE3A 4YLKA 5FUTA 1PXIA 2XKEA 4K2RA 3PY0A 5AR7A 3ZEWA 5HG7A 5ACBC 1W82A 4RSSA 4YHFA 4BL1A 2ESMA 3A62A 3PP1A 2ETRA 4CRLA 4DFXE 3LFSA 2BZIB 2BKKA 4X3FA 3NSZA 3RPVA 5AUVA 2OXXA 4J1RA 4MQ2A 5T68A 4E93A 5ITAA 4H39A 1K2PA 2FSMX 2NP8A 5CAQA 2EVAA 4L7SA 2PVNA 3UPXA 4NL0A 5IQIA 1J91A 4NU1A 2PZRA 4F7LA 4YTCA 5JEBA 4OLIA 3NYOA 4RQKA 1IRKA 1W84A 4YBKA 5HTIA 5CVGA 1BLXA 3R9HA 2ZMCA 3W33A 2WO6A 4BBFA 3HUBA 2IZUA 4JT3A 1FBNA 1KE6A 3NVMB 5F20A 2PZ5A 5AADA 1SVGA 1XH7A 3KMWA 3VF9A 2C1AA 2QKRA 4C4FA 2HZ0A 4WNOA 5L4QA 1V0OA 2WMUA 3MIYA 4JQ7A 4WRSA 4I5PA 1OL6A 3DY7A 1SYKA 1CSNA 1ZMUA 3HKOA 3LE6A 5JGBA 3SW7A 4RJ3A 3OY1A 4O91A 5GIPE 5ANJA 4ACGA 1UU7A 2C6OA 4NKSA 4UALA 1U46A 2JAMA 2UW4A 1OUKA 4IBMA 5AP2A 3VUIA 5K4IA 3SG8A 3GCPA 3LM5A 4NIFA 4EZ7A 3E87A 3L9MA 5ANOA 1OITA 5A4TA 4NCTA 3UQGA 3FKOA 4WKQA 3W18A 3HP5A 1CKPA 1GIIA 4DCEA 3OEZA 3I1AA 4EH6A 1Q5KA 4I20A 3BYOA 3DPKA 3EQIA 3QTUA 2UZTA 4EWHA 1H07A 3NNXA 4QMTA 2GNIA 3ANRA 3VBVA 3MN3A 2CGXA 4OT6A 4WIHA 3UOKA 4X2NA 4D4RA 4FK6A 4ZIMA 1S9JA 4D55A 4EH5A 3VO3A 4LOPA 4FTLA 5CI7A 5CQUA 1LEWA 1AGWA 3AC5A 3MS9A 4I6BA 5E8ZA 5HX6A 4A9RA 2AYPA 5L2WA 2J7TA 1VJYA 2JIIA 4BTMA 2FA2A 4O1PA 3QALE 4DGMA 4QYEA 4E6CA 2BRGA 2IJMA 4ANQA 3GC9A 4FZ7A 4TW9A 5DN3A 5KCVA 3C1XA 1TQIA 5LJJA 5J5SA 4HVSA 5FM3A 3AC2A 4EOPA 2YM6A 5CY3A 2G01A 3EOCA 2X7FA 3AD5A 1H26A 4BBMA 5TE0A 1HOWA 3SOCA 2BRHA 4BDEA 4MD7E 5KO1A 2JDOA 1SVEA 4FNZA 2PZIA 3CTQA 3G6GA 3QUDA 5H3QA 3KN6A 3R7OA 4AN3A 4RA5A 4ERKA 4YR8A 2HZIA 1H08A 3BCEA 3QLGA 2VTOA 3L9LA 1F5QA 5I9ZA 5GINE 4UXLA 4AZTA 2WEVA 2VX0A 5EW3A 5CENA 4FKUA 4B9DA 4GU9A 2B9FA 3U9CA 3NUXA 3TUCA 3C4WA 4FTCA 3WOWA 4DFYA 1IA9A 2ETKA 1UNLA 2QONA 5IQDA 2WGJA 3A2CA 4BTKA 4K1BA 2AC3A 4DBXA 3MY1A 3NEWA 4IC8A 5CYIA 4S30A 4EOOA 5K4JA 3GNIB 3PSCA 3ZO4A 3OOGA 4LQMA 4D9UA 1CMKE 2F57A 5J1VA 4MBJA 2YJRA 3IKAA 2C6IA 3F5GA 4M67A 1O6KA 4X6QC 3AQVA 2PK9A 4Z9LA 4YO4A 2JDVA 2XNPA 4DA5A 4M3QA 1S9IA 3RAWA 4IDVA 5HICA 3DKCA 4C2VA 4XLVA 4LGDA 5EKOA 4EK6A 1YXXA 5LXMA 4ZS4A 4XMOA 3OC1A 3W16A 2BILB 5A46A 1AQ1A 1ZMWA 4TT7A 5CANA 4JIAA 5J8IA 5KZIA 3TXOA 4AG8A 4R5SA 5KMIA 3FMMA 4ZTNA 4FG8A 3W8QA 3OZ6A 5EK7A 4LL0A 4Z3VA 4ZSJA 4XOYA 4IM0A 4HZSA 2YWVA 3KCKA 4NSTA 4CYIA 4D4SA 3HMNA 3BEGA 4G5JA 2WTVA 4IMYA 3MH1A 3PPKA 4MCVA 3UIBA 1X8BA 2VNWA 3BGPA 1UWJA 4K77A 5BYLA 1OPJA 3DK6A 1OL5A 4DBNA 4JR7A 4F1OA 5ACKA 5AA8A 4FEVA 4JI9A 4BB4A 2B54A 3CTHA 3FDNA 5TR6A 4UMRA 3MGYA 3MY0A 3CCNA 4I0RA 4TYJA 2HAKA 4BDGA 4F08A 4K11A 3NX8A 1BI8A 4KIOA 4XYFA 2R7IA 4WT6A 2W06A 5ETCA 2BPMA 3CGFA 4ZXTA 2VTIA 1KE9A 4WSQA 4QNAA 3U51A 4I5HA 3FMJA 1XJDA 1YHSA 3V51A 3UZPA 2QQ7A 2VGPA 1RW8A 3OFMA 4RIWB 2HOGA 3EQBA 1A48A 3BE2A 3PJ2A 5I9WA 3C0HA 5EG3A 4UBAA 5H9BA 4USEA 4BKZA 3U4WA 4J97A 5HESA 4QP6A 4J53A 4BYJA 5KE0A 3HAVA 1FGIA 4A7CA 4WNKA 3UG2A 4DEGA 4NM0A 5TF9A 4FKVA 2V5QA 4ANLA 1PXOA 3OY3A 2QD9A 2I7QA 2XMYA 5C9CA 3ID6C 3QXOA 4GCJA 3MTFA 2F2CB 3GI3A 3TACA 4TRLA 3LFEA 2W1CA 4QYYA 4BTJA 2FSLX 1SNUA 1OL1A 2UZVA 3GFWA 4KD1A 3Q9ZA 4C34A 5F4NA 5CEKA 4LGGA 4K0YA 5CLPA 3M1SA 3GB2A 4BIEA 4I1ZA 3QUPA 4I94A 2YAAA 2CLXA 3R1NA 3ATTA 4D58A 3OW4A 3VS5A 3BQCA 5CU0A 2X0GA 1Q99A 5G1XA 1LUFA 1KUTA 4GT4A 2YM5A 5DFPA 1PXJA 3BQRA 3TTJA 3ENHA 3LZBA 5BVDA 3OXIA 3W2SA 4O0SA 5FBNC 3D2IA 4ZLOA 5M06A 4IWQA 3NIEA 4CMUA 3TV6A 3L9NA 3DTWA 4X6RA 4BDFA 2WTIA 3RP9A 4O7YA 3QRTA 4FX3A 5HIEA 3O2MA 4R7IA 3Q4CA 4N4SA 1Q8YA 3NMUF 3EQFA 3R6XA 4ZSAA 1BX6A 3VWAA 3S0OA 1JSTA 5HE2A 2H8HA 3IPHA 5JGAA 2E9PA 3SQQA 4EQCA 4HGSA 2ZDUA 2VV9A 3G0EA 4F0FA 1OB3A 5DPVA 5IDNA 3F69A 3PVUA 4B4LA 5CQWA 3LM0A 2WIHA 4U81A 3JXWA 3QTQA 2R3GA 3DNDA 3KRWA 3P9JA 4FKSA 4M0ZA 4X21A 2PVHA 3E8CA 3PA4A 4C2WA 2YA9A 4IZ5A 5E8UA 4DGGA 3HRFA 4F99A 5AUYA 2RGPA 4BDBA 4CEGA 3DAKA 2O3PA 3RM6A 5CAVA 5HLNA 2ONLA 3GOKA 3RALA 3DV3A 2W4OA 2I0VA 4YJPA 4ZTMA 2XZSA 3ERKA 2W1HA 5IZFA 3O17A 4X3FB 5LMKA 2BHEA 2CNQA 1XBBA 4L7FA 2XIZA 3B2TA 2UVXA 4C4HA 1RE8A 1XQZA 2LGCA 4E3CA 2HK5A 3MVHA 4OW8A 4DEAA 2PSQA 5EW8A 4AZVA 1U5RA 4EHGA 2XNOA 1FINA 5L8JA 5HVKA 3C4XA 1YXTA 3G2FA 4FV0A 4W4XA 5A4CA 3TDVA 3JYAA 3O7LB 3NS9A 4MHAA 3JR1A 1QCFA 3I6UA 4YJVA 5DBXA 2WQEA 3NR9A 2YIYA 3BU6A 4I92A 1WAKA 4IJPA 4ACMA 1URWA 2PUUA 5E8WA 5CEOA 4BGHA 1OIUA 4APCA 1R0EA 4WNMA 3UO5A 1QMZA 3AC1A 4EYMA 3PTGA 4XG8A 3KXMA 4GJ2A 4ASDA 3FL4A 4XV9A 4ZTSA 2DYLA 5JQ8A 3KMMA 4QMUA 3SV0A 2YN8A 4D5HA 1V0BA 3BBTB 2A1AB 2OXYA 3RGFA 3VBXA 4GK3A 4F1MA 2ZV9A 1HCLA 3FLYA 4UY9A 2PUIA 5K3YA 2CJMA 2LAVA 1XKKA 2I0YA 4NIFB 5ICPA 2GCDA 3NNWA 3QA8A 3DBQA 4XP0A 3QQFA 5AP0A 5AR5A 2BRMA 1AD5A 5DA3A 4TYEA 3VBYA 3SX9A 3L1SA 4FOBA 4FVRA 1WBOA 3FXZA 1HCKA 1YWVA 4JG7A 1KE5A 2C6LA 2HY0A 4C62A 1ZAOA 1OIRA 2OICA 2QURA 1SVHA 2GSFA 2WIPA 1MRYA 5HCXA 4OT5A 1PJKA 4ASEA 4FTKA 4XHKB 2C0IA 4YTHA 2OIDA 4D9TA 2PVJA 3ANQA 1DAYA 2BVAA 4GKHA 4EC8A 3QRIA 3CJGA 3KEXA 3W2RA 4C4JA 4MD8E 2VUWA 1IAJA 4H3BA 5AUZA 2YDIA 5D9HA 4K8AA 4PNKA 3ZFMA 3UPZA 4G34A 2QG7A 4WUNA 4FIJA 4YLLA 4QD6A 3UYTA 3WILA 1E1XA 1JLUE 5JN2A 1H1QA 3BYUA 5C1QB 3AT3A 4DEDA 4CV9A 4PPCA 3ROYA 4EZ5A 3K3JA 5HKMA 5IA0A 2YIQA 1U54A 2C3LA 3KXGA 4RJ7A 3F5PA 4ZSLA 5IA5A 3SDJA 1M17A 5EOBA 2KTYA 4ZLZA 5CAPA 2GHMA 2F9GA 2REIA 3BBWA 3NUPA 3P7AA 2CLQA 4BN1A 4S31A 4UWYA 1SM2A 3RM7A 3OWJA 2QOHA 4D2RA 4HYUA 2C6DA 1G8SA 2GTMA 3E62A 2WMWA 3PZEA 5LVOA 4C02A 5IQAA 1WBPA 5IQBA 2Q83A 3MPMA 4FV9A 4YNEA 3V8TA 2YM7A 3FWQA 2Y4IC 5AR3A 3R22A 4USFA 2IVTA 3TCPA 4ZEGA 2X2KA 4B99A 3NZ0A 4FKGA 4DH3A 3VUHA 2Y6MA 4YJRA 4JLCA 2C69A 4NM3A 3F3ZA 4HCVA 3HDNA 4RJ5A 2HZNA 5I9YA 5JQ5A 5M57A 2YIXA 3OXZA 2B9JA 4NUSA 2W4KA 2VN9A 3T9TA 4FNYA 4F6UA 4OTQA 3GU8A 5CX9A 2EU9A 5I4NA 2O2UA 3R7GA 4QTBA 3MBLA 4AW1A 3OWPA 4W9XA 1OI9A 3AMAA 4OTGA 3MFRA 2XB7A 4L3LA 2GS2A 2UZLA 2XJ2A 3DJ6A 3HVCA 2FO0A 3Q52A 5BYYA 2VWUA 3FI2A 3PPJA 5HLWA 4IVAA 4DHFA 2JFMA 4PUZA 3O71A 4G9RA 5CI6A 1YDSE 1KOAA 3FY2A 4NFNA 4QP7A 4EOQA 5J7HA 5J5TA 1OBGA 1JKSA 3PVBA 2FUMA 3F2NA 3G15A 4ASZA 3QC4A 4E4LA 2R3LA 2W1ZA 4IZ7A 3JY0A 3Q04A 3BU3A 4IAFA 4M84A 3W2CA 4EQUA 4MXAA 3QKMA 4BI1A 5A6NA 4YUQA 3QWJA 4EUUA 3LFDA 4RLKA 3CSVA 2OZAA 3V8SA 4XG7A 3A7IA 3VQHA 3CC6A 4KS7A 3H10A 4N57A 1PMEA 1YHWA 4EOSA 3E7VA 4FIIA 3II5A 4LOQA 2QOFA 5IEVA 4DT9A 3VS6A 3EQCA 1YI6A 4KKEA 2QR7A 2C6MA 4H3QA 3KF7A 2BMCA 3BLQA 3GGFA 4YBJA 3OG7A 3ACJA 2WMRA 4EH8A 2YZLA 4O7ZA 5EQYA 3HZTA 5M53A 5L2QA 3G90X 4F0GA 1VZOA 2VWVA 3MVLA 3DKOA 4RJ8A 2OH0E 3FKNA 4YJUA 3W1FA 2XP2A 3N4VA 5EI8A 3OEFX 4TWCA 4YC6A 4H3PA 4E4NA 3EKKA 5AP6A 3LOKA 3QF9A 4YJTA 4QYHA 4I0SA 4EH7A 4PF4A 5E1EA 1M2RA 2ITYA 1PXNA 4YZCA 2YISA 4F9WA 3UO4A 2C6KA 2GFSA 3OWKA 1TKIA 1R39A 1VR2A 2GFCA 4YTIA 1REJA 2UV2A 3MW1A 4YJQA 4YLJA 3VHKA 5DYJA 2F7EE 1YDTE 3FHRA 3NPCA 3QRUA 4QPMA 3A4OX 2XCKA 4DG0E 3DB6A 4B8MA 1STCE 4EK5A 2Y6OA 4ZOGA 5CF4A 3CBLA 4XRLA 4EONA 5AUTA 3HRCA 3R04A 2CKPA 5A4EA 3IGGA 3CKWA 4RX9A 4DEHA 1Y6BA 5EI2A 2OJFE 3Q4UA 4IWOA 3LW0A 2XK9A 3DJ5A 1BI7A 3V6SA 4D1SA 5BPYA 3LFBA 4ZMFA 2AC5A 2IWIA 2R3OA 2BIKB 4TWNA 1WVXA 2XVDA 2QLUA 5DR6A 3SD0A 3UMXA 3KL8A 3C9WA 3R1SA 4FSRA 4P7EA 3ZO1A 3MV5A 3PJ3A 4LV8A 1CKJA 2X2MA 4C3RA 2YHVA 2RF9A 3FLSA 2OJIA 4OBOA 3KMUA 3T3VA 3BI6A 4IHPA 5LWMA 5E92A 4U44A 3TDWA 4F7JA 1DAWA 3W2PA 4AGDA 3ALNA 4YZBA 3TV4A 3ZUUA 4IB5A 5LMBA 3ETAA 4C4GA 1M7QA 1OIQA 4DC2A 3LCOA 3QD0A 2WEIA 4FK3A 3TZMA 4ORKA 3ORMA 5J87A 5BUJA 4XP2A 2E2BA 4IANA 2GHLA 2H96A 2IVVA 5JFVA 3PXZA 4AGCA 5E8VA 3QFVA 5JZJA 3EN7A 3ZH8A 4ANOA 1OMWA 1Q97A 3OROA 4D5KA 3H30A 2HZ4A 3I7CA 4OTIA 5I0BA 2I1MA 1F3MC 4UWBA 5CXHA 4ARKA 4EHZA 2OFUA 4FG9A 2QVSE 3EL8A 3H4JA 2C68A 4AE6A 3PPZA 5A14A 1FGKA 2GS7A 2V22A 4HYSA 2C30A 4L46A 4LFIA 4Y8DA 3TNPC 1KOBA 4G5PA 4CD0A 3IS5A 5EDQA 3ORPA 4ACDA 2Z7SA 5JZNA 1Q3WA 2I0EA 5I9XA 4H05A 1H27A 2I6LA 4TXCA 3PJ1A 3MJ1A 3EQHA 3I7BA 3SG9A 1H4LA 3A4PA 3IK3A 3KRXA 3UGCA 5KZ0A 3PYYA 4J71A 5HG5A 3CTJA 3HMPA 2OO8X 4AGWA 5FDXA 2WMSA 3DU8A 3F9NA 2HW7A 3D4QA 3TT0A 4QTDA 3FMDA 3HUCA 4PP9A 3KQ7A 1DI9A 4R77A 1K9AA 4YGAA 2Y0AA 3JS2A 1XH6A 2GQGA 3FI4A 4ACCA 1GZOA 4JX7A 3SA0A 5LCJA 4X3FC 4MYGA 2JBPA 2FSOX 4FKRA 4JXFA 1LPUA 2GS6A 4EYJA 3GU6A 3ORZA 3LLTA 4E1ZA 5IQFA 2Z60A 4ZY5A 2FVDA 2UZNA 3FQHA 4IEBA 4FTUA 1J7UA 4FV4A 4FTJA 2O5KA 4YC8A 5B2MA 4H1MA 1B38A 4RIYA 4AT5A 1QPCA 3FPQA 4RPVA 3QTZA 2YM3A 3LMHA 1FMOE 1H8FA 2C5XA 1PMUA 3PSBA 4B0GA 2W9FB 3UQCA 4DG3E 3E88A 3NNVA 4I6HA 1JWHA 3VBTA 1UU3A 3OCSA 5HIBA 3R8PA 3UG1A 4EZ3A 4ZLYA 5I5ZA 2QOLA 2PE1A 1UKHA 2W05A 5L2IA 1U54B 4BVUA 3R63A 4ENYA 2OJGA 4OGRA 4HVHA 4GMYA 5FEQA 4HJOA 4W4WA 4BI2A 4YMJA 2PL0A 2R4BA 4IB0A 4W8DA 4GEOA 4G1WA 3RINA 2I40A 1ZYCA 3QTIA 4RG0A 5FRIA 3RHXA 3MI9A 3QL8A 2IG7A 1YRPA 2BZHB 4I41A 3GQIA 4NCTC 3TKIA 3QD4A 5EM5A 3R9OA 4WUAA 3AGMA 1NW1A 3EYHA 2PE2A 4HCTA 1GAGA 2QKWB 1DS5A 3HRBA 3NW6A 3ZUTA 4IWPA 4TNDA 5CALA 5IQGA 2ZV8A 4QMVA 5KMOA 2NPQA 4FSWA 4J8NA 4Y5HA 2OXDA 3KRJA 3CKXA 1OPKA 2VNYA 1JSVA 4A4OA 4MXYA 3Q5IA 2WPAA 3O8UA 3D83A 4DEIA 1YWNA 4C0TA 2VO6A 1T46A 3FXXA 4GU6A 5IMEA 4RZWA 3BWFA 4ONAA 3A99A 2VTLA 2I0HA 2HELA 1ZZ2A 4AAAA 3I5ZA 3BKBA 4UMTA 3P78A 4IAIA 5CEIA 3LPBA 3PXRA 3DXQA 5IMXA 4NWMA 3S3IA 3HV7A 2F7ZE 2XIYA 5CXZA 3WYXA 3PIZA 3EYGA 2JEDA 5AP4A 4B6LA 5CASA 1UA2A 4D2SA 2BDJA 3K3IA 4RVLA 4FICA 2A4LA 1P5EA 4KS8A 4RFZA 4RVKA 4FSMA 2CPKE 4RBLA 4LGHA 3ULIA 2X6DA 4JOAA 5HU3A 5IQCA 3S2PA 3Q3BA 2Z7RA 4I5CA 3VS7A 5HBJA 3COKA 3DLZA 2BFYA 3DZQA 4QTCA 3ZXTA 2UZDA 3FC1X 4BDAA 4DFNA 5M51A 3AMYA 3FBVA 4U43A 3PUPA 2OZAB 2R3RA 2VTQA 4M97A 5DT0A 4XCUA 1SMHA 3D14A 4KBKA 5HBEA 4YSJA 4E5WA 2Z2WA 3W2OA 4FR4A 5IQEA 5ANIA 1LEZA 5EHOA 3RCJA 4IM2A 2QODA 3LIJA 5FEDA 4ANSA 3H0YA 2WQOA 3GBZA 4K33A 4G3EA 3LJ1A 5M44A 4QT1A 4Q9SA 3E8DA 4IVCA 3VIDA 4RGJA 5IA1A 3FC2A 2NO3A 3I60A 3CIKA 1CDKA 3QQKA 3WE4A 4PPBA 2Q0NA 3PJCA 2A2AA 2OF2A 2OIQA 4OTWA 3ZHPC 3G6HA 3D5XA 2JKMA 5AP1A 4AOJA 4CZYB 4PRJA 4MNEA 4QP8A 4DTAA 5CU4A 3OBGA 3TWJA 4HYHA 2QC6A 4G3FA 5D7AA 3CPCA 1OBDA 2PU8A 3HA6A 3V5LA 3Q9WA 3WI6A 2F2UA 4FV2A 4JQEA 2UZOA 5J9ZA 4R3PA 4ALVA 2QHMA 1XO2B 4C33A 3QCYA 3U6IA 4O27B 2WOTA 4DTKA 4HPUE 2ZAZA 4YZDA 5ETIA 4O83A 4EHEA 1PF8A 2ZOQA 4WHZA 3DA6A 3DK7A 2ZVAA 3U6JA 4IQ6A 5D10A 5E8TA 4F9BA 5K9IA 3OF0A 1QPEA 4PTCA 5CNNA 1J7IA 3G51A 2GMXA 3C51A 4FSTA 5FXSA 4IH8A 2C0TA 5A6OA 5J9YA 3CPBA 2CCIA 5DIAA 3ZO3A 5TKDA 3V5JA 4DE4A 4FT0A 3ELJA 3LCDA 4MNFA 4A07A 1YW2A 3QZGA 5GNKA 5AUXA 4LL5A 5CVHA 4QPAA 4II5A 2GHGA 2Y8OA 2X8DA 3UQFA 4EOLA 3BPRA 1KE8A 3OHTA 2VWZA 3LJ0A 1YOLA 1H0VA 2JFLA 3PVGA 3WF8A 3QTXA 1OUYA 4BDCA 4WG5A 3V8WA 3TKHA 3PLAE 3FMLA 1PXKA 4CFVA 1ZOGA 2OH4A 4ACHA 4I0TA 1GZNA 1L3RE 1U5QA 2W1FA 3B8QA 4NKAA 3BU5A 4XG6A 5HORA 5BVNA 1W83A 2PVKA 4FKLA 4X2JA 2XKFA 3E63A 3ET7A 4L67A 2W7XA 1H24A 3ZYAA 3H9RA 4C58A 4HGLA 3UZTA 4FKWA 3ACKA 3EFLA 3FKLA 3L8VA 4U0IA 2Z8CA 4LRKA 3UIMA 2P55A 2XCHA 4F7SA 2FB8A 3TL8A 3BYSA 4JJRA 4USDA 3LXNA 2BAKA 3JVRA 5EFQA 4FV6A 3EHAA 3E8NA 5C8NA 3BELA 4QMPA 2EWAA 4MEDA 3R73A 1BMKA 4C4EA 2C47A 1ZYDA 3EZVA 4I5MA 4EQMA 3R7UA 4L42A 2ITNA 4KIKA 2JKOA 4LRMA 5I3OA 3RK7A 2CN5A 5AP3A 5L2TA 5DGZA 2XF0A 5IKWA 3SLSA 4O7RA 4EK3A 5CF6A 2W96B 4WG4A 5HX8A 2WKMA 2PULA 2ITPA 4FTNA 3QCQA 4NT4A 5DHJA 5EM8A 3O7LD 4R5YA 4E6DA 5E90A 3P7BA 4RLLA 4AFEA 3VS4A 4IZAA 1UKIA 1OIYA 4ANMA 4AZEA 2CHLA 4BKYA 5EDRA 2XH5A 4L45A 4KSPA 2QU6A 3HMMA 4E73A 3FJQE 2YDKA 4R78A 2Q0BA 3ZBXA 5EM7A 2XIRA 2J0LA 4FNXA 4ANNA 3I4BA 5EKNA 3QZFA 3TTIA 4M68A 4RFYA 5E4HA 3JUHA 1PKDA 4N6ZA 2GNFA 1GY3A 2QNJA 5FLFA 2R3NA 3BE9A 3FLNC 3RZFA 3ZFYA 1PYXA 4BF2A 2YERA 4QQ5A 4RVTA 4TYGA 3DZOA 2HENA 4KINA 1JOWB 1NA7A 4MH7A 4C8BA 3DXNA 4YPSA 1XR1A 3RAKA 5LARA 4O2ZA 3N51A 4PDSA 5LMKC 2VTHA 4X2KA 3P86A 5M55A 4HOKA 2JC6A 4CFMA 5H8GA 3TZ7A 4KRDA 3RCDA 3W8LA 4O0VA 4ZAUA 4D4VA 3O8TA 4CG9A 5DT4A 2EXCX 4DF3A 3B8RA 3KY2A 1YOMA 3D7ZA 3E8EA 3GT8A 3NUUA 4RIYB 4ZTLA 5HNGA 3LFCA 3HV6A 5J7BA 5LVLA 5DI1A 4PTGA 3N4TA 3POZA 4QMZA 3Q2MA 4F6SA 3PDTA 4DH8A 4EOKA 3FMEA 1OL7A 1H00A 2YM8A 2J0JA 3FZSA 2XRUA 1ZY4A 4JDIA 5H8BA 3AXWA 4ZZOA 4FTOA 3CY2A 4DLIA 3LVPA 5IEXA 4FKTA 4BWKA 2ZV2A 4GFOA 4M12A 2IVUA 2QOKA 1B39A 2VTNA 2PTKA 3I0OA 4IB3A 3E93A 3PLSA 4BHNA 3CD8A 5EI6A 2QOBA 3VULA 2C5VA 4BTFA 3ODZX 4J7BA 5AV3A 3WZJA 5IUGA 4QMLA 4NJ3A 3QUEA 4GYIA 3PXQA 2R9SA 5AM6A 3RAIA 3GXLA 4WSYA 3MFUA 2CKEA 2YLEA 4R8QA 3VW8A 3ZEPA 3KREA 4FG7A 3FZOA 4WOVA 2HWOA 1W98A 2NRUA 5IA4A 5JFWA 5A9UA 2IO6A 3RNYA 5JSMA 2YABA 4L3PA 3Q6WA 4F6WA 4K18A 3SVVA 1Y6AA 4IC7A 5KBRA 3BLHA 5E7RA 1WVYA 2VAGA 4ENXA 3KN5A 3MIAA 3ZC6A 2ETMA 4K9YA 1UU8A 4BWPA 1ZWSA 4HVGA 4JIKA 3ZBFA 4XRJA 2PMLX 2OI4X 3EZRA 3HLLA 4XOZA 2UW5A 3PY3A 4R3RA 3RZBA 2JITA 3ZSHA 4DG2E 3MFTA 4CRSA 4UB7A 2HCKA 2BR1A 4ITIA 5DRDA 4BDHA 4FTIA 2YDJA 4FSYA 2YITA 4EBWA 1L8TA 4O7NA 5AR2A 4KIQA 4ZY6A 2X4ZA 4NTTA 2VWWA 2VTRA 1WMKA 3ALOA 4MF0A 5AIRA 3UNKA 5AJQA 5BVEA 4GJ3A 2VGOA 4TYHA 1ZYSA 2VWXA 4TN6A 4AA0A 4UMPA 5HNBA 2NNWB 2J9MA 3IDPA 3N9XA 5JH6A 4AACA 2O65A 2VTSA 4FUYA 5EYKA 3VBQA 4LUEA 4AZSA 3DBDA 3KCFA 3UODA 2WNTA 4YO6A 3BWJA 4QPSA 5HLPA 1URCA 3QX4A 4RQVA 1YXVA 2XIXA 4GG5A 5AX9A 3AC4A 4YU2A 3KVWA 4TY1A 2VRXA 3FLZA 2XKCA 3QQUA 2ZV7A 4ZSGA 4R7HA 1EH4A 3HV3A 2WMVA 4R1VA 5DOSA 5AV0A 4CMTA 3SGCA 1OKZA 2UZWE 2GNHA 4NYEA 4AOTA 3SC1A 4BCFA 2QLQA 3M2WA 2ZJWA 4C35A 4PX6A 3CE3A 3HEGA 2W1EA 4JDJA 4DT8A 2VWBA 4GUEA 4L53A 3BRBA 2UW6A 2X7OA 4XS2A 5CS6A 1O6YA 3VF8A 4AT3A 3E7OA 3RBWA 1RJBA 1W7HA 4WBOA 4G9CA 4JVGA 4XG9A 4A9YA 3V5WA 2PMIA 3NYNA 5BYZA 3WARA 5GIOE 4QQJA 3HNGA 4BZDA 3NCZA 3VUGA 4MNEB 4RVMA 4ZJJA 3LQ3A 2HXLA 4UZDA 4KUJA 4FKPA 4KAOA 3RHKA 5EYCA 4L43A 2OLCA 5DMZA 5C4LA 1M52A 2ZYBA 3TN8A 2WQNA 4MXCA 4YP8A 4L68A 5DWRA 4UZHA 4Z55A 3IONA 4IX4A 3UC4A 2XNBA 2PVRA 2X39A 3R21A 3R9RA 3BZ3A 1ZYLA 3IW8A 3POOA 5M4FA 3R8VA 2C1BA 5D7VA 1YKRA 3BLRA 4WRGA 4EOJA 4HVIA 1R3CA 3ZFXA 2XK6A 4FZFB 3DQWA 5HIDA 3UZRA 1GJOA 2IW6A 4NJDA 1G8AA 4GK2A 4AN2A 2J2IB 2CSNA 3MA6A 1TQPA 4Y72A 3NVKI 4Y73A 4O84A 4YC3A 2F4JA 4O7WA 2J90A 2KULA 3KRRA 4U79A 4JDHA 3IW5A 4EJNA 3UIXA 3DKFA 3SW4A 2HW6A 1Z57A 3R71A 3R1YA 3DBFA 4FF8A 5I9UA 3P79A 4N0SA 2GNJA 3H9FA 2UVYA 4V04A 2YCQA 4CFXA 1QPDA 2XNEA 4XX9A 3VW6A 1ZY5A 2G1TA 1Q41A 2BROA 3HYHA 5CU2A 3V3VA 3ORXA 4Y85A 3TNIA 4BFMA 4MWHA 4PNIA 3PZHA 3FL5A 2RG6A 2Y4PA 1Q8TA 4JDKA 4MD9E 4NTSA 4D0XA 5CAUA 4FIFA 4QO9A 4I21A 4CT2A 3FYKX 3IDBA 4J52A 1Q62A 3ZC5A 3LFAA 4JBPA 1W8CA 1RQQA 1PXLA 3U4UA 1JPAA 2P2HA 4PL3A 5LVNA 2H34A 2WD1A 4O0UA 1E1VA 2VD5A 3E5AA 1Y57A 1LP4A 4RJ4A 5KMNA 2P2IA 4F9CA 3QU0A 2HY81 4DLJA 4E5AX 4AF3A 3BEAA 3HGKA 3NUAA 1XH8A 3DFAA 3C5UA 4FMQA 4I23A 4M69A 4I6FA 4FT5A 3R83A 3LXKA 2ZM1A 1LR4A 4NW6A 4ALUA 2ERKA 1OZ1A 5KHWA 5KMJA 4AU8A 4A9SA 4MXZA 2R64A 4AOIA 5CF5A 5M4UA 5GJGA 3NYXA 4G3DA 3UP7A 2VX3A 2YIWA 4UYNA 4UMUA 4KIKB 4JS8A 2X2LA 4APPA 1H1PA 2J50A 3IO7A 4FIHA 3HV5A 3U9NA 4PMSA 4Y46A 4CKIA 2BDWA 5KNJA 5E9EA 1FVTA 4JAJA 3MJ2A 3UIUA 1ZLTA 3D5WA 2XJ0A 4P4CA 5KBQA 4FVPA 3ZO2A 4IWDA 5F94A 4FTAA 4CFUA 3TNQB 4FV7A 1Q8ZA 3MTLA 4YHTA 4F7NA 3P08A 4UWCA 4GIHA 5K5NA 2E9VA 5EM6A 2GTNA 4O7SA 5DLSA 4ITJA 2X8EA 5JKGA 5FG8A 2ITXA 2ACXA 3IW6A 4U41A 2XK3A 4RX8A 5LOHA 2R5TA 2JBOA 1YXUA 3ZDUA 4P5QA 3H0ZA 4QTAA 3ZLSA 4XBUA 4R1YA 4XJ0A 3QRKA 2O64A 3IW7A 2BKZA 4JQ8A 4MBLA 1BUHA 4U3ZA 4ZTQA 4FSNA 4BCGA 4DFLA 1YVJA 3CP9A 3BHHA 3KXZA 4KRCA 4EJ7A 2PWLA 3AT4A 2ERZE 2UW9A 3MPTA 1FVRA 3R30A 4MXOA 1RDQE 4C3FA 4HYIA 4RZVA 2R2PA 3AMBA 2J51A 4QMXA 3KF4A 3A8XA 3TV7A 4PDPA 1GZ8A 2FH9A 4A4XA 5GJFA 3LMGA 4H1JA 4D28A 1WBSA 3M11A 4G31A 3UNJA 3VVHA 3ZXZA 3NIZA 1Q24A 4JG8A 1IA8A 4R6VA 3IDCA 5HVYA 3TIZA 1JVPP 4FIEA 4RX5A 2VZ6A 5JRQA 1FQ1B 3MA3A 4Z7HA 2P0CA 3KU2A 4KB8A 5TOZA 3ZOSA 2UZUE 3BHTA 3VUTA 4HGEA 3OCGA 1Y8YA 5FQDC 3UJGA 5BVOA 2R3FA 4W4YA 2JAVA 4LG4A 4QMOA 4AFJA 2XJ1A 2XYUA 2QO7A 2V62A 2E9NA 2W1GA 4PQNA 3OW3A 3EQGA 4TYIA 2XNMA 4FTQA 5K0KA 3T8OA 3UO6A 3F7ZA 3I0QA 2RIOA 2WOUA 2YWPA 4P2KA 2OF4A 3QKLA 5IEYA 4CSVA 2ZB1A 4TKSA 5IH5A 4ZS0A 3MESA 3VNTA 4M14A 3DJ7A 3QQHA 5HEZA 4HVDA 3D2KA 1BKXA 3F5UA 4LYNA 3N4UA 3U55A 3QHWA 3IECA
chains in the Genus database with same CATH superfamily
3QC9A 2WMBA 2OWBA 1PXPA 1KV1A 2PVFA 3BHYA 4MX9A 4P90A 5HBHA 3SXSA 3ZMMA 4EC9A 3JPVA 4XG4A 2UW8A 2YCFA 3FLQA 2A27A 3EJ1A 5E91A 1YWRA 3VS2A 1A06A 2YACA 3E3PA 4CFFA 5M09A 3GENA 2PVMA 3TKUA 4BHZA 4O22A 2UUEA 2V0DA 4CV8A 4JG6A 4FV5A 1PMVA 5EHLA 2BAJA 4N70A 3FQSA 4FTRA 1OM1A 2WHBA 3TEIA 3NW5A 1MRUA 4F09A 3ZM9A 1GIHA 3R7EA 4NFMA 3TNWA 3QGWA 4U3YA 2X81A 5C26A 3A7GA 4X3JA 2VO3A 5AUUA 1CM8A 1GIJA 3GU7A 3Q2JA 1FOTA 3EQPA 4YZNA 1WVWA 4TYHB 4U97A 5KKRB 3F2AA 4DINA 5CAOA 3COHA 5CF8A 4QP3A 1ATPE 3ZS5A 3BHUA 3NYVA 2OJJA 4OUCA 2BDFA 3QAME 4U8ZA 3EFWA 4BCKA 3RAHA 1B6CB 2J4ZA 4FT3A 4BKJA 3QQLA 4EH2A 3NWWA 2Z02A 1QL6A 3NUYA 3W55A 4O81A 4AXDA 3MB6A 3DNEA 4G3CA 3MB7A 3WF5A 2PMOX 4RC4A 3BYVA 3OMVA 2YZAA 1W2FA 3IOPA 2GNLA 4I4FA 4EBVA 2BRNA 2DUVA 3DTCA 3MDYA 2A19B 3FI3A 3EQDA 4M13A 5F95A 5LVPA 4AXEA 2CDZA 3UVRA 1PRYA 3TJDA 1JSUA 1J7LA 3PIYA 4ID7A 2CNUA 2EB2A 3QWKA 2E9UA 1WBWA 4DH7A 4EOIA 2VWIA 3O50A 3O96A 3FYJX 4EH3A 4HW7A 2XK4A 1NY3A 2GPHA 5BMSA 3GU4A 1ST4A 3FLWA 2XBAA 4OAVB 4TNBA 4F64A 3ZRKA 5D12A 3R8ZA 4PL4A 4D1XA 3VN9A 2CN8A 4ZP5A 3DXPA 2PZYA 5CSHA 3WZEA 3B2WA 4JBOA 3ZRLA 1F0QA 3CD3A 4D1ZA 3TNHA 3DK3A 3QYWA 4KBAA 2YFXA 3PRIA 3C4ZA 1W0XC 1TQMA 4YPDA 3P5KA 3TM0A 1XH4A 3DBEA 4AS0A 5EQPA 3EN4A 4BCOA 2YAKA 3UDTA 4E7WA 2ITZA 4F1TA 1PMNA 1H1RA 1WFCA 4FC0A 3WIKA 3BGQA 4FUXA 2FGIA 3QTWA 3BLAA 5IG1A 4FYNA 2WTDA 4O0RA 1KWPA 4BZOA 3DQXA 2E9OA 4C37A 3OP5A 4U80A 3VS1A 4IX3A 3R00A 3SKCA 4X7QA 3PP0A 4U7ZA 3W0NA 5T3QA 2BRBA 3F3UA 4PMTA 3Q4ZA 3HMOA 2EXMA 4DFUA 2QU5A 4QYFA 4XUFA 5CSVA 1ZMVA 3O8PA 4FTMA 4IXPA 4XP3A 1BYGA 3EFJA 1Q61A 3QHRA 4WG3A 2WU7A 2O0UA 2B4SB 3ZRMA 4DAWA 5BVKA 4CQGA 2CNVA 3DFCB 1JAMA 5CEPA 5FXQA 4TPTA 2CGVA 4ITHA 3FUPA 4GUBA 3KK8A 4IW0A 2DWBA 2ITQA 2V7AA 2X9EA 4O38A 3CGOA 3AC8A 3LXPA 5CZIA 3FHIA 4EL9A 5HE0A 3KRLA 3KXNA 3R2BA 1PXMA 3DCVA 2GQRA 3MSSA 2IVSA 4YNOA 2QCSA 3PG3A 4BGQA 5ANGA 1W2CA 3OUKA 2IW9A 4PY1A 3NNUA 2XNGA 4EKLA 4AXCA 4M69B 3PSDA 2VTAA 2XKDA 3FZRA 2YCSA 4G6NA 4BI0A 4BCPA 4XV2A 4O6LA 4Q5EA 4E5BA 4FL2A 4O4BB 3C0GA 4GIIA 3EH9A 3Q5ZA 4BCNA 5F9EA 4FEXA 4JNWA 4L01A 4S33A 5KUPA 3R2YA 2R3MA 2XIKA 2C6EA 5J95A 5BVWA 2W99B 4MAOA 5ETFA 4KKHA 5JMSA 2OW3A 3HV4A 3MH2A 1P2AA 3PXFA 2WTCA 3K5VA 5AWMA 3NLBA 2ZDTA 4PPAA 3CQWA 2BAQA 3FE3A 2R3KA 4U40A 1IG1A 4FEWA 1U59A 3ENMA 4J8MA 2V7OA 2B55A 2WZJA 3PE2A 2G2HA 3DAEA 3NCGA 3ORKA 4O0XA 5AMNA 3TI1A 4DEEA 4E6QA 4GSBA 3WF6A 5BUIA 2BFXA 3P7CA 2GDOA 3A61A 4FSQA 4O96A 3BX5A 5HTBA 3HAMA 4O82A 1CKIA 5IF1A 1YDRE 1JKLA 4CZTA 3ZCLA 1P4FA 4AE9A 4P5ZA 5E8XA 1BL6A 3RWPA 4FJVA 3V01A 4V05A 4G16A 4UXQA 1A9UA 2W4JA 4E20A 2XA4A 1OL2A 3OXTA 4XV3A 2H9VA 1IAHA 1GNGA 4GFGA 3DT1A 2ITTA 3Q9XA 4OTHA 4ANBA 5KMKA 2G2FA 4CCUA 4MBIA 5DG5A 3VRZA 3SHEA 1P14A 2CGUA 3S4QA 3IQ7A 4KKGA 4ZJVA 4UX9A 2WTKB 2PZPA 4G2FA 1M2PA 2VWYA 2C4GA 4V0GA 3M42A 3ZSGA 4RIOA 5C01A 4M15A 1OPLA 2ITUA 3CJFA 4GW8A 4J95A 1WBVA 5M56A 4C3PA 3LQ5A 4MTAA 4R7BA 4O21A 2X1NA 1Q8UA 2Y4IB 2OGVA 3R01A 4RRVA 3F66A 5FGKA 2B9HA 5AUWA 2XEZA 4C57A 4DITA 4I24A 3BHVA 4HPTE 2HIWA 3EN6A 4FV8A 5GZ8A 1UWHA 2WB8A 4D2VA 3KULA 4M66A 5FP6A 3VUMA 2C0OA 3ZTXA 2Z7LA 1R0PA 4MVFA 1REKA 3IGOA 2ZM4A 4BDKA 5L8LA 4FIGA 4QMSA 4WNPA 5IUHA 1NT2A 2SRCA 4CCBA 2UZEA 3U87A 4BIDA 3NDMA 5ANDA 4G3GA 4NW5A 3BV3A 3QA0A 1TFFA 5AEPA 2W5BA 4GT5A 3C4CA 2VTTA 5IU2A 3E92A 1K3AA 3HA8A 5KMLA 3UOHA 4YZMA 4AA5A 3K5UA 4AW2A 3OOMA 5BNJA 5B0XA 2W9ZB 3QZHA 3SOAA 3FSKA 1YXSA 5AR4A 4RJ6A 4BWXA 4OAUC 3WZUA 4EUTA 5K5XA 2P33A 4GS6A 4IX5A 4AXAA 2BHHA 5AV2A 4QMNA 3OUNB 1MRVA 2IW8A 1O9UA 5DRBA 3T9IA 4OTPA 1H01A 1I09A 3A7JA 4FKIA 1OKYA 4FEUA 3UDBA 2YIRA 3ORTA 1Q4LA 3Q53A 4IE9A 5HCYA 5GZ9A 2PY3A 3BV2A 3RWQA 4NM5A 1CTPE 2OBJA 3P1AA 5CVFA 3AT2A 2BIYA 3EQRA 4FI1A 4J98A 3TZ9A 1Y8GA 3R7IA 4XLIA 5JRSA 2R3HA 2FYSA 2VO7A 4JRNA 4B7TA 1M7NA 1ZOHA 3O0GA 4ZK5A 3TJCA 3I81A 4QOXA 4QYGA 5BVFA 3V5TA 4I4EA 1SNXA 3H3CA 4MK0A 5H2UA 3RPRA 5DNRA 4O7TA 1XH9A 2JIUA 3LHJA 4C38A 4L3JA 4BDJA 4CZUA 5M07A 3BIZA 4GVJA 1H1WA 4S2ZA 5HGIA 4BDIA 2ITWA 4O2PA 5HG9A 2W0JA 3C13A 1ZXEA 2BCJA 4ALWA 4DGNA 4EK4A 3F2RA 5LMAA 2WQMA 1M14A 5JFXA 5KX8A 3F3VA 1J1CA 1TVOA 2VTMA 3TZ8A 4AW0A 5CSPA 2XS0A 4PTEA 2P3GX 3W2QA 2QOCA 3AOXA 2RFSA 1XH5A 5AAGA 1NVQA 4AUAA 2QO9A 4M8TA 3L9PA 1PKGA 3NW7A 5FWKK 1OKWA 4F9AA 2XK7A 3WIGA 2O8YA 3AG9A 3RPSA 2YJSA 3F7WA 4LI5A 4N6YA 4D2WA 2JLDA 4RA4A 3D7TA 2C6TA 4O0YA 4CFNA 5IH4A 3EFKA 2DQ7X 1NXKA 3MPAA 3PE1A 4O4DA 2ONLC 3LCKA 4CTCA 3TIYA 5TO8A 3RK5A 4FODA 4YHJA 4LMUA 5JGDA 4IFCA 2XNNA 3AD4A 5IH6A 4UMQA 2G15A 3D5VA 3U6HA 3DBCA 5HD4A 4PV0A 1PHKA 4TWOA 4DYMA 4L44A 2WELA 5ETAA 1NVSA 3QQJA 4IDTA 3FZTA 2GNGA 3W32A 4A06A 2FSTX 1MP8A 2PVLA 3I5NA 1YHVA 2C3IB 1Q8WA 4CLIA 5J9LA 4FL3A 4IVBA 3UDZA 2QOIA 4EEVA 5IQHA 5FBOA 4GKIA 3G9LX 2Y9QA 3HP2A 4AA4A 5GZAA 4UEUA 5JFSA 3LKMA 3D0EA 4FZDB 5AA9A 2W1DA 3OT8A 2PHKA 5KKRC 2YLFA 4IX6A 5HNIX 3U54A 5C8MA 5A54A 5EH0A 4Z7GA 4BYIA 3QD3A 4OTDA 2B53A 1ZZLA 3FV8A 4DN5A 3VAPA 2W5HA 5IUIA 5FXRA 5CTPA 5A4LA 3V5PA 3R1QA 4CXAA 4DH1A 4I22A 5B7VA 1J3HA 3KFAA 4BC6A 2CKQA 4QP2A 4QMWA 5E1SA 1GZKA 3O51A 3UBDA 4RFMA 2XRWA 5GHVA 1OVEA 2OFVA 2UW7A 4U9AA 5HQ0A 3CS9A 2Z7QA 4GK4A 4GVAA 4KNBA 2W1IA 4PDYA 3R0TA 4L8MA 3FMNA 2BZKB 1VYZA 4D4YA 5L6OA 3COMA 4IZYA 1XBAA 4LUDA 3NAYA 4O7LA 1V0PA 2OU7A 3ITZA 5CU3A 5DH3A 3GC0A 4AW5A 5JT2A 1ND4A 1H0WA 3O23A 3ZDIA 4JR3A 3VRYA 3RMFA 4D0WA 4KWPA 3EIDA 4D2TA 3KGAA 3K2LA 5CU6A 3DGKA 4L6QA 2C5OA 3JY9A 5CEQA 4MKCA 5F1ZA 4IB1A 5HOAA 3H9OA 5HTCA 4LM5A 3UNZA 3VQUA 3QLFA 3MH3A 4MWIA 4EKKA 4CYJA 5DVRA 3PWYA 4RC3A 3E64A 4CLJA 1OGYA 4JRVA 1OECA 2ZM3A 3FAAA 1H1SA 2WFYA 2XM9A 3JVSA 4FYOA 3RPYA 3PJ8A 3S00A 4EH4A 3UOJA 4AN9A 4KA3A 1JKTA 3PA3A 2GU8A 5IA2A 3CEKA 4DEBA 1Z9XA 4BGGA 2J0IA 2JKKA 1R78A 3LXLA 4F70A 4RIXA 3U8WA 5FM2A 4TL0A 1OKVA 4AAYA 1JQHA 3GEQA 3AKKA 3QYZA 3KXHA 4RWJA 2W5AA 4R3CA 4WBBB 3MFSA 5DEWA 2IPXA 2X4FA 3KKVA 1J1BA 5CNOA 4RC2A 2RKUA 3EKNA 5CT7A 3F5XA 4IM3A 1Z5MA 1XHAA 4ZMEA 3WZKA 5C27A 5L3AA 4KIPA 1WBNA 4M0YA 4Z16A 5JK3A 4BR3A 4RWLA 2F7XE 3TUBA 4O6EA 5AV1A 3FMHA 3NRMA 3SRVA 3ORIA 3UMWA 2QHNA 4PL5A 3LFQA 4QMMA 3WZDA 3PRFA 4ZZNA 5HO7A 3VBWA 2VU3A 5AR8A 3CR0A 3OCBA 4DHIB 1JBPE 3K54A 2B9IA 2OSCA 4CQEA 3FQEA 3UVPA 3BYMA 4O7VA 2V55A 2Y7JA 4CFWA 4MXXA 1ERKA 3L8XA 5AAEA 3S1HA 3S95A 3DDQA 4LOOA 2WMTA 4AZWA 5I3RA 3TMOA 3KVXA 3RKBA 5M4IA 1ST0A 2HWPA 4FZAB 5HCZA 5AFVA 3OBJA 5LVMA 4F4PA 3AGLA 1UVRA 4IIRA 2RFDA 5G6VA 2XYNA 2W17A 1JNKA 4FA2A 3G9NA 1FMKA 4BCIA 3UTOA 3KA0A 2X9FA 3P0MA 3R28A 4A9UA 3FXWA 5EDPA 4PMPA 1UU9A 4QP1A 4RT7A 4V0GB 5DT3A 2B0QA 4FGBA 4FKOA 3HX4A 4IFGA 4RWIA 3ZLXA 4HZRA 4LV5A 3VC4A 4ASXA 5FTOA 4UN0C 4ZY4A 5DEYA 3MWUA 4FL1A 3CLYA 3QX2A 4AGUA 5CSXA 2VO0A 5EHYA 5CSWA 1YQJA 5J1WA 5CT0A 3ZONA 3PG1A 1I44A 4W8EA 4YJNA 2G9XA 2UZBA 3HDMA 3ODYX 3Q6UA 2RFNA 2XBJA 3QCXA 3RJCA 3KULB 3OVVA 3W10A 1NVRA 4E4XA 3WYYA 4Y95A 2NRYA 3FSFA 2OG8A 3EN9A 3LAUA 2R3PA 4BCJA 4I6LA 4DCAA 4BCQA 4D2PA 2C5YA 4FV1A 4GFMA 4KBCA 5FTQA 2VTPA 4ZTRA 4AP7A 3Q9YA 4AQCA 4CG8A 1XBCA 2H6DA 3VS3A 2IZTA 3C4FA 3VHEA 5CEMA 2JGZA 2OIBA 2JIVA 5L2SA 4GRBA 2ITOA 3F61A 3LFNA 4Q9ZA 3NUSA 3LCTA 2VTJA 3MYGA 2OKRA 3Q4TA 1PYEA 1V1KA 3AC3A 4RX7A 4Y5QA 3ZLWA 3QCSA 3RVGA 4FSUA 4ZZMA 3GU5A 5HU9A 3WE8A 3FY0A 3P4KA 3FI8A 3DS6A 3OS3A 1WCCA 3KC3A 3RNIA 5ANKA 4X2FA 5BQ0A 3AD6A 4IADA 5AM7A 3D94A 3F82A 4OBPA 4QNYA 5BMMA 2WMAA 4HGTA 5CZHA 5C4KA 4L9IA 4FT7A 3A7FA 4M7IA 4MF1A 2WTKC 1G3NA 3RK9A 4EORA 2PPQA 4I93A 5K0XA 3TYKA 3RTPA 2EUFB 2J0KA 3OD6X 3FPMA 3OT3A 4FKQA 3ROCA 5E8YA 4PWNA 3ZLYA 3PVWA 3NFFB 4GT3A 1O6LA 1YI3A 5EYDA 3PXKA 4F63A 1KV2A 1GOLA 4BY9E 4IAZA 5FDPA 3R8MA 4GYGA 2HXQA 4C36A 4LRJA 4FE2A 1Y91A 4YTFA 2WTWA 3F3WA 5EYMA 5M4CA 3LFFA 1Q3DA 3G33A 2BALA 1OGUA 4Y83A 4C4IA 4F0IA 2OZOA 4J99A 2WTJA 5D41A 3ZUVA 3ORLA 4E6AA 3G0FA 3L8SA 4E4MA 3PA5A 4K6ZA 1SZMA 2R0UA 4TWPA 2JDRA 3P23A 3EL7A 3R02A 3QKKA 4FKJA 4BZNA 2R3QA 2QG5A 3KXXA 3OTVA 4CT1A 4EI4A 3RI1A 4O86A 3TG1A 4I3ZA 5TT7A 2ITVA 3I79A 3T3UA 4FBXA 4DFBA 3ATSA 3GOPA 4OR5A 4CKJA 4FOCA 5DR2A 3DKGA 3GCQA 4QMQA 4ERWA 3EMGA 2QOOA 3D7TB 4H36A 3GCVA 3E3BX 3MY5A 3V5QA 5HE1A 3VUKA 4NH1A 3WF9A 5B2LA 1MUOA 5DR9A 5GJDA 4A4LA 3UYSA 4UV0A 4GV1A 3HMIA 3IOKA 4G6OA 3TUDA 1JKKA 5A4QA 2J6MA 2R0IA 3SXFA 2OJ9A 1UNGA 1IR3A 3G5DA 1H28A 3FZPA 4L52A 4GL9A 4L00A 4IACA 3EN5A 5D11A 4AT4A 4EH9A 4O0TA 5L6PA 4HNIA 2JDTA 5IPJA 5AIKA 4BRXA 2WMXA 3UE4A 3DLSA 4WD5A 3KK9A 5AP5A 3O5AA 2ZB0A 5IISA 4YSMA 3R8LA 2IEWA 5EOLA 4O4FA 2VX1A 4J96A 3PWDA 2J0MB 3F88A 1VEBA 1ZYJA 2CGWA 3QGYA 5HO8A 4W4VA 4KABA 2R3IA 2IZSA 2XUUA 2CMWA 4RMZA 3V6RA 2O63A 3C0IA 5HG8A 5KHXA 5M08A 3FEGA 3QD2B 3R7YA 1XWSA 3HL7A 4NK9A 3RPOA 4ZJIA 1IEPA 2DS1A 1UNHA 2PE0A 4XH6A 2A0CX 5J79A 4W9WA 3F6XA 3ZZWA 3D5UA 2WMQA 5FP5A 3QRJA 1WBTA 3CQEA 4FVQA 4QRCA 4F78A 4RWKA 4EK8A 4JX3A 4QP4A 3I6WA 4PDOA 3GC7A 4FTTA 5AV4A 5IA3A 3ZSIA 2IZRA 3Q60A 4O1OA 5FEEA 4G6LA 3EB0A 1WZYA 5D1JA 5L8KA 1XMMA 4KSQA 1IASA 4G17A 3PY1A 1U4DA 3ZU7A 3UVQA 5AAFA 4DHZA 4U5JA 2YEXA 4ZTHA 3NAXA 3WF7A 1QPJA 3KB7A 2BUJA 5L6WL 3QTSA 4EOMA 5T6KA 3R7VA 5C03A 3R9DA 4BCMA 3A7HA 4XEYA 2X8IA 2BTRA 3DAJA 3EWHA 2R3JA 2J5EA 3DB8A 3GVUA 4FV3A 3PFQA 3FZ1A 2WAJA 4HNFA 4PMMA 5AX3A 2B1PA 1ZARA 3DDPA 3CQUA 5EW9A 5BUEA 1VYWA 2YM4A 4BIBA 4DH5A 4XG2A 3C50A 4C61A 3V04A 3QQGA 2QI8A 3LLAA 4BBEA 4A9TA 4C7TA 3MVJA 5LWNA 4RIXB 4YZ9A 1G8JA 2UW3A 4YJSA 4QQTA 1UV5A 5I9VA 2QR8A 4YURA 2X6EA 2PUPA 1FVVA 2CCHA 3HECA 3IW4A 4U45A 3IG7A 3GP0A 4AWIA 3Q32A 5ANEA 5FD2A 3THBA 4QEBA 4DGOA 4I6QA 2JKQA 4CNHA 5IDPA 4UYAA 3QXPA 2EB3A 4FT9A 2G2IA 4XV1A 4PP7A 4FSZA 1P4OA 3SRVB 3COIA 3GCUA 2C3KA 4B8LA 2ZMDA 3LQ8A 4BCHA 4NZWB 2WXVA 4WA9A 3Q96A 5B2KA 4X0MA 1ZOEA 3F3TA 4GH2A 5HHWA 5BX0A 5DE2A 4BICA 2C3JA 3LCSA 4TZRA 3C4EA 4JBQA 2F49A 3VUDA 4C59A 2YCRA 4Q5HA 3L8PA 4XBRA 3ZM4A 2PYWA 1YOJA 4MQ1A 2UW0A 4NEUA 4S32A 2UVZA 3ZZEA 2IN6A 3QBNA 2BTSA 4CTBA 3BGZA 1G5SA 3PXYA 4QQCA 4RIWA 4JL9A 4IJ9A 3GCSA 4LMNA 1PY5A 4FNWA 1MQBA 2XK8A 2R7BA 1KE7A 1T45A 4EWQA 1YI4A 1KSWA 2HYYA 2X7GA 3QTRA 2GQSA 4IAYA 3NUNA 2PMNX 2JDSA 4AX8A 3GQLA 4O0WA 2B7AA 4CKRA 2CKOA 4GG7A 3MH0A 5EQEA 4IVDA 3D15A 1BL7A 5A3XA 4CVAA 3GFEA 2XM8A 3D9VA 4OTFA 3MVMA 4FZ6A 4QMYA 4XG3A 5HD7A 5LCKA 3ULZA 2RG5A 5CWZA 1R1WA 3OCTA 1DM2A 4DFZE 4EHVA 3VJOA 4F65A 2RSVA 3LJ2A 3GC8A 4IAAA 5LQFA 4OBQA 2B52A 4BDDA 2WQBA 5HZNA 2OK1A 3R8UA 3DOGA 5C8KA 3OTUA 4F9YA 4QTEA 5H8EA 3LMIA 1M2QA 3C7QA 3ORNA 3FMKA 3GUBA 2RL5A 2P4IA 3UC3A 3OWLA 1H25A 4OTRA 2PUNA 4H58A 4CGAA 2C5NA 5HI2A 4DTBA 3C5IA 2PVYA 5FTGA 4E26A 4WO5A 3R9NA 4YJOA 4DGLC 3A8WA 2JD5A 3CXWA 4HCUA 1DI8A 4IAKA 4U42A 1FPUA 4XNEA 4ZSEA 3A60A 4AZFA 1PW2A 4E8AA 2AUHA 3PIXA 4QP9A 1ZRZA 2XEYA 1E9HA 4CMOA 2BZJA 3WBLA 3SAYA 4Q2AA 3CY3A 2QO2A 4U6RA 5AP7A 3VS0A 4TTHB 3QZIA 3SXRA 4V01A 4S34A 4FEQA 2RFEA 3NGAA 2EXEA 2WU6A 1APME 4NM7A 5KMMA 3UP2A 3REPA 3UOLA 4JBVA 5E8SA 5HVJA 3VJNA 4JAIA 4FGRA 2J5FA 4X2GA 5HO6A 2QOQA 1MQ4A 5HE3A 3KIOC 4YLKA 5FUTA 1PXIA 2XKEA 4K2RA 3PY0A 5AR7A 3ZEWA 5HG7A 5ACBC 1W82A 4RSSA 3UDSA 4YHFA 2XANA 4BL1A 2ESMA 3A62A 3PP1A 2ETRA 4CRLA 4DFXE 3LFSA 2BZIB 2BKKA 4X3FA 3NSZA 3RPVA 5AUVA 2OXXA 4J1RA 4MQ2A 5T68A 4E93A 5ITAA 4H39A 3PFYA 1K2PA 2FSMX 2NP8A 5CAQA 2EVAA 4L7SA 2PVNA 3UPXA 4NL0A 5IQIA 1J91A 4NU1A 2PZRA 4F7LA 4YTCA 5JEBA 4OLIA 3NYOA 4RQKA 1IRKA 1W84A 4YBKA 5HTIA 5CVGA 1BLXA 3R9HA 2ZMCA 3W33A 2WO6A 4BBFA 3HUBA 2IZUA 4JT3A 1FBNA 1KE6A 3NVMB 5F20A 2PZ5A 5AADA 1SVGA 1XH7A 3KMWA 3VF9A 2C1AA 2QKRA 4C4FA 2HZ0A 4WNOA 5L4QA 1V0OA 2WMUA 3MIYA 4JQ7A 4WRSA 4I5PA 1OL6A 3DY7A 1SYKA 1CSNA 1ZMUA 3HKOA 3LE6A 5JGBA 3SW7A 4QDEA 4RJ3A 3OY1A 4O91A 5GIPE 2AEGA 5ANJA 4ACGA 1W2DA 1UU7A 2C6OA 4NKSA 4UALA 1U46A 2JAMA 2UW4A 1OUKA 4IBMA 5AP2A 3VUIA 5K4IA 3SG8A 3GCPA 3LM5A 4NIFA 4EZ7A 3E87A 3L9MA 5ANOA 1OITA 5A4TA 4NCTA 3UQGA 3FKOA 4WKQA 3W18A 3HP5A 1CKPA 1GIIA 4DCEA 3OEZA 3I1AA 4EH6A 1Q5KA 4I20A 3BYOA 3DPKA 3EQIA 3QTUA 2UZTA 4EWHA 1H07A 3NNXA 4QMTA 2GNIA 3ANRA 3VBVA 3MN3A 2CGXA 4OT6A 4WIHA 3UOKA 4X2NA 4D4RA 4FK6A 4ZIMA 1S9JA 4D55A 4EH5A 3VO3A 4LOPA 4FTLA 5CI7A 5CQUA 1LEWA 1AGWA 3AC5A 3MS9A 4I6BA 5E8ZA 5HX6A 4A9RA 2AYPA 5L2WA 2J7TA 1VJYA 2JIIA 4BTMA 2FA2A 4O1PA 3QALE 4DGMA 4QYEA 4E6CA 2BRGA 2IJMA 4ANQA 3GC9A 4FZ7A 4TW9A 5DN3A 5KCVA 3C1XA 1TQIA 5LJJA 5J5SA 4HVSA 5FM3A 3AC2A 4EOPA 2YM6A 5CY3A 3BL9A 2G01A 3EOCA 2X7FA 3AD5A 1H26A 4BBMA 1VLRA 5TE0A 1HOWA 3SOCA 2BRHA 4BDEA 4MD7E 5KO1A 2JDOA 1SVEA 4FNZA 2PZIA 3CTQA 3G6GA 3QUDA 5H3QA 3KN6A 3R7OA 4AN3A 4RA5A 4ERKA 4YR8A 2HZIA 1H08A 3BCEA 3QLGA 2VTOA 3L9LA 1F5QA 5I9ZA 5GINE 4UXLA 4AZTA 2WEVA 2VX0A 5EW3A 5CENA 4FKUA 4B9DA 4GU9A 2B9FA 3U9CA 3NUXA 3TUCA 3C4WA 4FTCA 3WOWA 4DFYA 1IA9A 2ETKA 1UNLA 2QONA 3W0SA 4AQKA 2WGJA 3A2CA 4BTKA 4K1BA 2AC3A 4DBXA 3MY1A 3NEWA 4IC8A 5CYIA 4S30A 4EOOA 5K4JA 3GNIB 3PSCA 3ZO4A 3OOGA 4LQMA 4D9UA 1CMKE 2F57A 5J1VA 4MBJA 2YJRA 3IKAA 2C6IA 3F5GA 4M67A 1O6KA 4X6QC 3AQVA 2PK9A 4Z9LA 4YO4A 2JDVA 2XNPA 4DA5A 4M3QA 1S9IA 3RAWA 4IDVA 5HICA 3DKCA 4C2VA 4XLVA 4LGDA 5EKOA 4EK6A 1YXXA 5LXMA 4ZS4A 4XMOA 3OC1A 3W16A 2BILB 5A46A 1AQ1A 1ZMWA 4TT7A 5CANA 4JIAA 5J8IA 5KZIA 3TXOA 4AG8A 4R5SA 5KMIA 3FMMA 4ZTNA 4FG8A 3W8QA 3OZ6A 5EK7A 4LL0A 4Z3VA 4ZSJA 4XOYA 4IM0A 4HZSA 2YWVA 3KCKA 4NSTA 4CYIA 4D4SA 3HMNA 3BEGA 4G5JA 2WTVA 4IMYA 3MH1A 3PPKA 4MCVA 3UIBA 1X8BA 2VNWA 3BGPA 1UWJA 4K77A 5BYLA 1OPJA 3DK6A 1OL5A 4DBNA 4JR7A 4F1OA 5ACKA 5AA8A 4FEVA 4JI9A 4BB4A 2B54A 3CTHA 3FDNA 5TR6A 4UMRA 3MGYA 3MY0A 3CCNA 4I0RA 4TYJA 2HAKA 4BDGA 4F08A 4K11A 3NX8A 1BI8A 4KIOA 4XYFA 2R7IA 4WT6A 2W06A 5ETCA 2BPMA 3CGFA 4ZXTA 2VTIA 1KE9A 4WSQA 4QNAA 3U51A 3PUFC 4I5HA 3FMJA 1XJDA 1YHSA 3V51A 3UZPA 2QQ7A 2VGPA 1RW8A 3OFMA 4RIWB 2HOGA 3EQBA 1A48A 3BE2A 3PJ2A 5I9WA 3C0HA 5EG3A 4UBAA 5H9BA 4USEA 4BKZA 3U4WA 4J97A 5HESA 4QP6A 4J53A 4BYJA 5KE0A 3HAVA 1FGIA 4A7CA 4WNKA 3UG2A 4DEGA 4NM0A 5TF9A