3BLRA

Crystal structure of human cdk9/cyclint1 in complex with flavopiridol
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
320
structure length
300
Chain Sequence
SVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Cell division protein kinase 9
publication title The structure of P-TEFb (CDK9/cyclin T1), its complex with flavopiridol and regulation by phosphorylation
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 300
sequence length 320
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3blrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3blrA01
4O27B 4RGJA 4GFMA 3JVRA 3MIAA 3AC3A 3EKNA 3GNIB 2UZDA 3CTJA 5FM3A 5EW8A 3PE1A 3ROYA 1BI7A 3VRYA 2ZM4A 4LOQA 5FXRA 4E6DA 1UWHA 3TEIA 1R1WA 3EYGA 3GT8A 2YZAA 4FNZA 4HVGA 5CU0A 4ZJJA 4PPCA 3LM5A 5FWKK 2Z02A 2WO6A 2W99B 4CV9A 3DQXA 4G31A 1F3MC 4NT4A 5EG3A 4D9TA 5HIEA 5KMNA 2QD9A 3C1XA 3F5XA 1UKIA 2R7IA 2IZTA 5FGKA 2R4BA 3DU8A 4R6VA 4DEHA 4CG9A 3UNKA 4D4YA 4GEOA 3ZMMA 1YXVA 3OT3A 3DAEA 2UW9A 2C6KA 2OO8X 3TJDA 5AM6A 3JPVA 4MK0A 1ZY4A 2RG6A 4D5KA 3W2SA 2C0IA 3KKVA 1CKJA 5DBXA 3G15A 2GHGA 4CQEA 4QYEA 4ERKA 3QWKA 1PMEA 1YI6A 2VWXA 3U6JA 4F0IA 2C5XA 3Q5ZA 4S2ZA 5F20A 4RQKA 4IAKA 1XBBA 3UPZA 4EK6A 5LMKA 3GB2A 5DT0A 4E7WA 4ZZNA 3ZDUA 4YZDA 3COMA 2ESMA 5AADA 3D7TB 2C5YA 3T9TA 1OITA 2QKWB 3E3PA 4X3FB 4DEDA 2A4LA 3Q6UA 1KOBA 1RE8A 1TVOA 3NWWA 3H9RA 2V7OA 4L9IA 4YJUA 4BCJA 2OIBA 1KSWA 5A3XA 2CGVA 4OTQA 4LL0A 1WBNA 3FQHA 4QP1A 3FV8A 5DEYA 2WEIA 4AXAA 4FT7A 5JZNA 5I9XA 2BRHA 5E8ZA 4D9UA 3F3WA 4YUQA 3LHJA 2OXDA 3O8UA 4OTHA 3PXYA 5ETCA 3VNTA 5GZ8A 3C50A 3H9FA 4QD6A 1BYGA 3EFJA 2HK5A 3C9WA 3L8VA 4AQCA 4ZS0A 5DT4A 2E9VA 4ZIMA 2W1HA 4PMTA 4FNWA 1Q8UA 1YOLA 1YDTE 3RBWA 2VO6A 4P5QA 5AUZA 3FI8A 1V0OA 2A0CX 4F9AA 2RFEA 3TUCA 3HMMA 2Z7QA 3DPKA 4O1OA 4XG6A 2ONLC 4C33A 3ZXTA 4A4XA 4QMOA 3KMUA 2EXCX 5EQPA 3DKCA 5LMAA 5T68A 4KRDA 3UZPA 3F69A 4ORKA 2UZNA 4D4RA 2PE0A 5EK7A 3EQPA 4AGCA 4F99A 3MJ1A 2GQGA 4TNBA 3GI3A 3FLZA 5LCKA 2PUPA 2Y4IC 1FVVA 3G33A 4GT4A 3QKKA 1H28A 1MP8A 4JBQA 2C6OA 3WOWA 4E73A 2ZMDA 4IM2A 3RPVA 4OLIA 5A4LA 4U8ZA 2I0VA 2UZVA 3QRTA 3PRIA 3DOGA 4RVLA 2WTVA 2GS7A 4YLLA 3AMYA 3EQRA 2ETRA 1OUKA 3IDCA 4MXXA 3EMGA 4QMUA 3DTWA 5EQYA 2WIHA 1ZYJA 3DNEA 3R9DA 1DAYA 5EYKA 5KO1A 4H36A 2CLQA 3PA3A 5M56A 2C3JA 2YM5A 5CYIA 4GW8A 4DG0E 3TNWA 4WG4A 4MAOA 1E1XA 1B38A 2R3HA 3R01A 4YBJA 4A4LA 4C02A 5E90A 2R0IA 3AOXA 3GC0A 5AAGA 3D7TA 4X3FA 4KBKA 4QP2A 3UMWA 3WBLA 2VNYA 4AT4A 2ITUA 3C5UA 5IG1A 3BWFA 4V0GB 4FSYA 2HOGA 2PVFA 4F1TA 3HA8A 3AC4A 3I0OA 2I0HA 3Q2MA 5I5ZA 3R21A 3F61A 3VUTA 4G2FA 3HYHA 3BV2A 1ZRZA 5J79A 2R3GA 4U9AA 4BVUA 4XG3A 4HCUA 2NP8A 3GC8A 2JIIA 4DH5A 4MXAA 3UOJA 3NYVA 2OF4A 5LARA 4HYHA 3MH0A 3RGFA 1H01A 1Y8YA 4QQTA 1RQQA 2UZOA 4I1ZA 3ZXZA 5HNGA 4X6RA 4FKWA 4HGLA 4YJRA 2XKEA 3NW6A 4HJOA 4UXQA 2LGCA 3MESA 5CF5A 3RPYA 4L67A 2I0YA 2AUHA 3QD0A 4XG7A 4XS2A 4AF3A 5J9LA 1UWJA 2YA9A 5J7HA 3BYOA 4JI9A 5J5TA 3Q6WA 3QCQA 4XYFA 3PA4A 3ZUVA 1E1VA 2VO7A 3TUDA 3G2FA 1ZMVA 4BC6A 4Q5HA 3NW5A 3IDBA 4F7SA 1ZARA 2YM3A 2QLUA 3FXZA 3PXZA 3JR1A 4EZ3A 2OIDA 5ETAA 3QTQA 4D4SA 4JX3A 3EL8A 2CKOA 4KS8A 3EQIA 1SM2A 4QYFA 2W1DA 3T8OA 4IFCA 3MPAA 3SLSA 4KIPA 2PE2A 3EWHA 3FHIA 4A9SA 2XYUA 4FG9A 3U51A 1K3AA 3UGCA 4APPA 4E3CA 4FG7A 2X8DA 4Y85A 2VRXA 4GK2A 4LV5A 2I7QA 3VUDA 2HW7A 3SC1A 2XIKA 3B2TA 3DCVA 2YISA 3O0GA 3B8RA 4FL3A 3UG1A 4E4LA 5AEPA 3AC8A 2OIQA 3ZBFA 1LPUA 2X2KA 5AR8A 2J7TA 4M14A 4GIIA 2E9OA 4AN2A 2EXMA 5DG5A 1QPEA 4CFXA 4ANMA 3BLRA 4EK5A 2WTIA 2E9NA 3OW3A 3PFQA 4NTSA 4UBAA 2WQNA 4V0GA 4JDJA 2F7EE 4AOIA 3EZRA 3R1SA 1VYWA 4MNFA 3GU7A 4FYOA 4R1YA 2VAGA 4RSSA 2QO7A 5A4CA 4UWYA 4G3DA 4O21A 4JG6A 1H08A 3RKBA 1H00A 5KZIA 4MD8E 1GJOA 3NS9A 4EYJA 5KE0A 2G1TA 5I9ZA 3R9RA 3SXRA 1XJDA 2J0JA 4IB1A 2DWBA 1XBCA 3QLFA 4RJ3A 4ANLA 4ZLYA 1YXTA 4RIWB 2XNOA 3QA0A 5JGBA 3VS0A 4BDDA 3HV5A 5M4CA 2QONA 2J2IB 3KREA 4BGHA 3CIKA 3GCQA 4O7YA 5JT2A 2I40A 2RIOA 3ANRA 4IX5A 3R1NA 3ZONA 3UZRA 3OW4A 4YP8A 1XR1A 5CI6A 4EORA 4E5AX 3HRFA 3IW8A 4GU9A 3VRZA 3LLTA 4EQMA 4V04A 4IDTA 2XH5A 1OGUA 2R3RA 2YAAA 4F1OA 1GZOA 2R3LA 5FP5A 1PHKA 3TXOA 3MBLA 2YAKA 3PZEA 4EUUA 3EN4A 3HV6A 3GFEA 4J8MA 4B0GA 1PXPA 3PY0A 1WBSA 3NPCA 3ORXA 3QRJA 4HCTA 5I9UA 3UVQA 5AV4A 2EB2A 2VTRA 4DA5A 4BWKA 3GFWA 2CMWA 4XG2A 2I0EA 4FEQA 4CZYB 4EOIA 1JBPE 4FICA 1WFCA 4G3FA 4YO4A 5F1ZA 4JAIA 4Y95A 3GC7A 4KA3A 3ZRMA 4E6CA 1R0PA 1DS5A 1YVJA 2XB7A 5L2SA 4ENXA 1JQHA 2QCSA 4A7CA 3QC4A 3R2YA 2XS0A 4A06A 3JXWA 2P4IA 3QYZA 4FEVA 3GU6A 1SYKA 3SVVA 3C13A 4FV5A 4K9YA 1M17A 3DBDA 3OD6X 2H34A 4HYSA 4WO5A 3ZLYA 3FDNA 4XNEA 3FKOA 4ID7A 4I0TA 2P2HA 3RHKA 3R1QA 4TYIA 4DGLC 5CEMA 4P4CA 3T9IA 4FKSA 4E4XA 3ZO1A 2PZIA 5C1QB 5K5NA 3LCOA 5IQAA 5HG5A 4XCUA 2JDTA 2W06A 4KIOA 5HVYA 5AP0A 5AX9A 2YWVA 4EKLA 2VV9A 2Q0NA 5HLPA 3ZLWA 1BI8A 1ZLTA 3CQWA 3DJ7A 3DQWA 3FEGA 2BMCA 4CMUA 3N9XA 3N4TA 4WNPA 3UYTA 3VUKA 3LCSA 1Y57A 3ORMA 2QU6A 4A07A 3IGGA 3TACA 5JGDA 4IAYA 2O2UA 4GSBA 5TO8A 3MYGA 5GIOE 5ACKA 3PJ8A 4XP0A 2JIVA 2YACA 3LFFA 1KV1A 3OG7A 4RIWA 4AZWA 4BCIA 3LIJA 1BMKA 1IEPA 4C36A 3CKXA 4ZSEA 3VS5A 4PQNA 1QMZA 1OKYA 3RAWA 5ACBC 2X7FA 3FZSA 5M4FA 3FUPA 3NYNA 2QLQA 4FTQA 5HLWA 4I41A 4BI1A 5CAUA 4AP7A 4PMMA 4U6RA 1A9UA 1JLUE 3MVHA 3F5PA 5L8JA 3UIMA 4WUAA 4AZVA 4C37A 2XNPA 3E88A 1PF8A 1Q99A 3QA8A 4BF2A 2OGVA 3A8XA 3LFCA 4FTCA 2R5TA 3HMPA 4O0XA 4PL3A 4O7RA 5I9YA 2HELA 4TN6A 3DTCA 1MRYA 2EVAA 3BCEA 4TY1A 3G9LX 5D1JA 4F0GA 3DDQA 4MD9E 1IR3A 4IJPA 4WNMA 2CHLA 4FKQA 1OPLA 3MS9A 4U42A 5EM7A 2HXLA 2GTMA 4D0XA 3ZRLA 2WTDA 4UALA 3KRWA 5IA5A 3FL4A 3TZ7A 5BVNA 2QOIA 3R8UA 5HGIA 4XOZA 4C2WA 4B99A 1GZKA 3Q9YA 5FD2A 5M06A 5HE2A 3IPHA 2C6LA 3L8SA 4ZZMA 2XK4A 4FIJA 5CSWA 1Y8GA 3ZHPC 4FV3A 2X0GA 4GYGA 4O91A 4TZRA 3NDMA 1SNXA 4E1ZA 4CRLA 3NUXA 4AE9A 3FMJA 4FV6A 3V3VA 5HO7A 4KWPA 3QUDA 4U80A 5KUPA 4QOXA 2WEVA 4LV8A 3R8LA 3ZDIA 4BZDA 5B2MA 3LFQA 4JNWA 4E5BA 4UN0C 1O6YA 2QOQA 4TW9A 3PG1A 2WQMA 3AC5A 1DI9A 3NRMA 5H8BA 4AN3A 3O71A 4ZY5A 2C47A 1OIQA 1CM8A 2J0KA 3EN6A 4BCOA 2AC3A 3KXGA 4XG9A 2BDFA 5BVDA 1BL7A 4RJ6A 4MD7E 4EOQA 3VBQA 5IF1A 3C4ZA 4HYUA 3DGKA 3LJ2A 4MXOA 3PIYA 5DA3A 2UZTA 3SX9A 2XNBA 4QMYA 3FC1X 4F6SA 3KQ7A 2WOUA 1YQJA 4YJQA 1HOWA 4DBNA 3VS2A 1NA7A 4K8AA 5LOHA 5GJGA 4GKIA 3GXLA 4AW5A 4C59A 1I44A 2X2LA 4PMPA 2C5NA 4QP9A 5FQDC 2F49A 2R64A 3BU5A 5JQ8A 3TJCA 5CI7A 1R78A 5KX8A 4BCPA 3PIXA 4FUYA 4BI2A 4CG8A 3EFKA 4YBKA 3CBLA 5KMKA 3QXOA 3NMUF 3TG1A 2GDOA 4AGDA 1XH5A 2PHKA 2C1BA 2UUEA 3NIZA 4BCHA 4O7NA 3S0OA 4MXCA 5BYYA 4LMNA 4IACA 5HLNA 4QP6A 2CPKE 4MNEB 3HX4A 3FWQA 4J99A 2OF2A 3KXMA 3QD4A 3DFCB 2FB8A 3TIZA 2QO9A 3F9NA 4B9DA 2IW6A 4DEIA 5H8EA 3QYWA 4QRCA 1NY3A 4EJ7A 2Y4PA 4AACA 2B7AA 4TYEA 5BVOA 5K5XA 4I6FA 3Q53A 4UYAA 5E8TA 2GFSA 3PJ2A 4JDIA 3WILA 4FTLA 1SMHA 4G6OA 5D41A 5AR7A 2QOOA 3EQDA 2CKEA 3ELJA 2VTIA 5JFWA 3WYYA 4G3GA 3VS6A 3W2RA 4OGRA 1PXJA 3P4KA 4PPAA 4CFVA 3B8QA 3NAYA 3P86A 4JL9A 5JGAA 4CZTA 3TUBA 4JQ7A 4L44A 4MKCA 4X3JA 2W1IA 1CKIA 4X2GA 3ZSGA 4WNOA 5HQ0A 3V5WA 5D7AA 3V51A 2Y4IB 3LCKA 4PL4A 5DMZA 3G0FA 3O8TA 4JAJA 3JYAA 1P5EA 5J9ZA 3UIXA 4YO6A 1PKGA 2C1AA 4FT5A 4IBMA 5J5SA 5FXQA 2WTKC 1G5SA 1YXUA 2FSMX 3BYUA 5GNKA 1FGKA 4CFMA 1H1RA 4L3JA 3RWQA 2YFXA 4FTTA 4MQ2A 5IMXA 3R2BA 3KVXA 2YERA 3CJFA 4R1VA 3V8SA 3ANQA 3ENHA 2YDKA 5KKRC 4DTBA 4GG7A 2WOTA 3QGYA 1G8SA 5C4LA 5CTPA 3GU5A 4PF4A 4DEEA 4DCAA 4ZTRA 2CGXA 2ZB1A 5CU4A 2PVKA 4Q9SA 3HDMA 4QMZA 2Z8CA 4HGEA 4FEUA 4DLJA 3WIGA 1YI3A 3E8DA 4JVGA 4QTDA 5AUYA 4ZSLA 1CDKA 3Q9ZA 4NCTA 5HNBA 4ZJIA 4F9BA 5FEEA 5L2TA 3KN6A 3R9NA 3HMOA 5E1EA 4FT0A 5EDRA 1YHWA 3E64A 4MNEA 3ZBXA 4ANOA 3C5IA 4IX6A 4WD5A 3SXSA 4DFLA 4HGTA 4BWPA 1UU7A 4M84A 4CGAA 2HZIA 3RWPA 4FYNA 4XOYA 4YSJA 4C4GA 2PUNA 2BDWA 1ZYLA 3HDNA 4EOLA 3HVCA 1ZMWA 3FI4A 3KK9A 4O96A 4AN9A 2W1GA 2UW0A 4L00A 4YTHA 1W7HA 5E8VA 4I5HA 2ZYBA 3ZC5A 4EYMA 4ZTMA 3BYSA 3NX8A 1YXSA 3L8XA 4FE2A 3MI9A 3MWUA 4DT9A 2ONLA 4FKTA 2ZM3A 3LQ8A 4FKGA 4A9RA 5FEQA 5CF8A 4DAWA 3OEZA 4ARKA 5HI2A 2AYPA 3NYOA 3IG7A 1QL6A 4G1WA 3MY0A 4L42A 1A48A 2X8EA 4GVAA 3PPJA 3TCPA 4UMPA 4M13A 5I0BA 3ACJA 3P79A 4BBMA 3FMDA 3I79A 3LFSA 2ITNA 3CGFA 2CKPA 3UODA 3ENMA 3R7IA 2V5QA 2W5BA 3DK7A 4YJOA 3C0GA 3HA6A 2X8IA 4RA5A 3KXHA 4D2PA 4FOCA 3NNWA 1YW2A 3IQ7A 2NO3A 4FIIA 4YJVA 5EI8A 4E8AA 3TKIA 2HWOA 5JMSA 4DG3E 2UW6A 2UV2A 2VWUA 4O0RA 3FBVA 2Y8OA 4RT7A 3V6RA 3PSCA 4ITJA 4HVSA 4TL0A 5IUHA 4FA2A 4NM7A 2XM8A 4IFGA 4BCKA 2JDRA 2DYLA 3AT3A 3R7OA 4QMXA 1BLXA 5AAEA 4LI5A 3OCBA 1H25A 2YDIA 3HZTA 3PXRA 4ZMFA 4KD1A 3NUPA 3ZM9A 2CN5A 3OEFX 5IKWA 2C4GA 2UZBA 3A4OX 3A2CA 3RJCA 2BILB 2FSLX 3GCUA 4KINA 5LWNA 5BUIA 4MBJA 2R3QA 2UZLA 3DZOA 5IQBA 2XK6A 5FG8A 3A7IA 3QU0A 3CPCA 2A19B 3N51A 2J0MB 3D5UA 4XV3A 3EFLA 3FI3A 5E9EA 2OXYA 3L9NA 4QP3A 3QHWA 1OL7A 5IQCA 2YIWA 4YHJA 2VTHA 4L6QA 4E4MA 3VVHA 1YKRA 2O5KA 3MN3A 3COIA 4FSNA 2JKOA 4S33A 5TE0A 4GYIA 4ASEA 4WSYA 1EH4A 4AW1A 2Q83A 2PZPA 3E5AA 4MXZA 1J1BA 2P2IA 2JKMA 3GOPA 5HVJA 1Q8ZA 5ANJA 2VTPA 4FNXA 2Q0BA 4QMPA 3PDTA 3KVWA 2VO0A 3ZYAA 3TNIA 4WG3A 3RPOA 4FEXA 4BB4A 2C5OA 1AGWA 4G6NA 4GU6A 4D2VA 5HTIA 1RDQE 2XZSA 3R30A 2X4ZA 2HCKA 4JIKA 3O96A 3BLHA 3W33A 2RG5A 3LE6A 3SD0A 2ACXA 3QKMA 1IAJA 3FHRA 2G2HA 5BNJA 2H9VA 4AGUA 2VGPA 3EKKA 1GNGA 4FSZA 2W1EA 4NUSA 4JDKA 4DYMA 3D0EA 3L8PA 3TIYA 4ANNA 4C4FA 5JRQA 4QMNA 3QCSA 2YCSA 3V8TA 2X7GA 1Z57A 2YEXA 3CQEA 4RX9A 4OAVB 2CNUA 3VBXA 2IJMA 1U4DA 1JWHA 1STCE 4L3LA 3E93A 3ERKA 3VUGA 1XHAA 4OTRA 2YIQA 1NT2A 1R0EA 3R9OA 4NSTA 3KCFA 3VBYA 3C7QA 3G90X 2YLEA 4C3FA 1V0PA 3DKGA 4XV9A 2ITVA 4YNEA 5LVLA 4FTKA 3ULIA 3CQUA 5I4NA 4J71A 1PXNA 1M7NA 5M55A 2OJ9A 1S9JA 2KTYA 3JUHA 3P5KA 4ZXTA 3QFVA 3FAAA 5L8KA 4RC4A 3FZTA 1WAKA 4QMSA 2J5FA 3GENA 2EWAA 1A06A 2IZRA 5HG7A 3ROCA 4USEA 4ASDA 3AC1A 3LFEA 3MSSA 4KSQA 1Q24A 4YHTA 4G34A 3PPZA 4O7WA 4EKKA 2W0JA 4B6LA 3WI6A 1TKIA 4AAAA 4CTBA 2OG8A 4XP3A 4DEAA 4W9XA 3H3CA 4F64A 1HCLA 4YZCA 2QOBA 4C4EA 3TL8A 3GVUA 4D1SA 4XJ0A 1UNLA 4KB8A 3OXTA 4EQUA 3R02A 1PMVA 4WBBB 4C58A 5E8SA 4YHFA 4PDPA 4BBFA 4CKIA 4NWMA 5DYJA 4IB5A 2QOCA 3WF8A 4JR3A 5F95A 2X4FA 2RKUA 4MXYA 3ORKA 4F63A 1M14A 4UMRA 1SVHA 4NKAA 5AP3A 5B2KA 4LRMA 3ZO2A 2UZEA 2C5VA 4UMUA 5CF6A 1K9AA 4IWQA 5IQIA 2XKFA 3IK3A 4RVTA 1Y91A 4EH4A 1H07A 3BYVA 4D28A 3U9CA 4L45A 3P7CA 3WF5A 1WVYA 2XBAA 5CQUA 4YMJA 2YCRA 3AD5A 3R83A 4G9RA 4H39A 1WBVA 2W9ZB 2FVDA 3BEGA 5FDXA 3KY2A 3D5VA 2V55A 1OKZA 4FZ6A 3ZSIA 2FA2A 3HMNA 1FINA 4EI4A 3R00A 3UDBA 3MFUA 2BRNA 3ZH8A 4BCNA 4LYNA 2QODA 2R3JA 5HORA 4O81A 4O7TA 1Y6BA 5HBEA 5IEXA 4FC0A 3Q52A 3VAPA 5A54A 4R5SA 3QTIA 2PVNA 2H6DA 5L2QA 3TN8A 5AIKA 2WQBA 5EOLA 3OUKA 1ZY5A 2BTRA 2W1ZA 3TDWA 3ZZWA 3IDPA 2BALA 3UO4A 2GCDA 4JG8A 4OT6A 2R2PA 3V5LA 3DZQA 4D4VA 3CEKA 5EI2A 5C8MA 2QI8A 5GZ9A 4I4FA 2C0OA 4X2KA 4D1ZA 2A27A 2VTJA 3AMBA 3GCVA 4ASXA 4D2TA 4DGMA 4U45A 2HENA 4IZYA 2QVSE 3LLAA 2YM4A 4G5JA 4HZSA 1OIRA 1KE9A 4E6AA 4DHFA 1M52A 5B2LA 4OTGA 3CCNA 3H0ZA 5C4KA 3COHA 3POOA 1SVGA 3FI2A 3CSVA 4JX7A 2R7BA 4UXLA 4FKRA 5JRSA 4MH7A 3RK9A 4BIEA 3GC9A 3MPMA 4EH8A 5CXZA 4F9YA 3HP5A 5DR6A 1FBNA 4F7NA 4LQMA 2QU5A 4UWCA 4Z7HA 4G16A 5JN2A 2P0CA 5KBRA 3Q3BA 2WMBA 5K9IA 4Y46A 5M07A 1Q61A 3RNYA 2UW3A 3VS3A 3LCDA 5H3QA 4C57A 3AC2A 4CNHA 3QTSA 4UX9A 3GCSA 3G5DA 2CN8A 1YWVA 4I22A 4YC3A 2OXXA 4ZP5A 4F0FA 4ZJVA 3W8LA 2C68A 3UOHA 5AIRA 4GVJA 5HZNA 2VTNA 1W8CA 4IE9A 2O63A 3PJCA 1Z9XA 4QT1A 3OCSA 4PL5A 2RFSA 4LUEA 5DEWA 4FVPA 5IDNA 5BVWA 5AAFA 1QPDA 1VR2A 4OBQA 4R7BA 2B9HA 3AMAA 2NRYA 4B4LA 5J9YA 1OBDA 1JNKA 3FZOA 3P78A 2ZVAA 2QOHA 4HPTE 3D9VA 3DDPA 2WFYA 4FKLA 5IA4A 1FVTA 4DE4A 4DTAA 4LG4A 3WE4A 4EH3A 3A7JA 5F94A 2F9GA 5EYMA 3F7ZA 3QTZA 4I0RA 1ND4A 2YCFA 5LMBA 3DXPA 4ZSJA 5HO8A 5M51A 4QQ5A 4O6EA 4BCFA 1UU9A 3D15A 2IO6A 2WQOA 3PVWA 1ZYDA 3VO3A 4EOJA 4CLIA 2BVAA 3EQHA 2E2BA 2WQEA 4FTJA 3PE2A 3VBWA 5CAVA 3EB0A 2GNLA 4Q2AA 5IEVA 3OWKA 2IWIA 4YNOA 3KRLA 5EKNA 2OWBA 2PVYA 3OY1A 2XIYA 3O2MA 2RSVA 2WTKB 4Y5HA 1JSTA 2SRCA 4LL5A 1GIHA 3DA6A 4MX9A 4JLCA 3TDVA 2OZOA 2F57A 1MRVA 1ZOGA 3ZEPA 4K6ZA 1R3CA 4O22A 4OR5A 5CS6A 3THBA 2WNTA 4WHZA 4QMVA 1ERKA 1OL1A 4L3PA 3BWJA 4EOOA 3BE9A 5C01A 3ZFXA 5K4IA 2IG7A 4WT6A 1GIJA 2E9UA 4XLVA 3A7HA 3UNZA 3FLSA 4NTTA 2KULA 2C6MA 2BHEA 2Z7LA 3EFWA 5C8NA 1WVXA 2YJSA 3RPRA 3F2NA 4ALVA 3I0QA 1P4FA 2VTTA 2C69A 4PUZA 3PXKA 5IH6A 4GKHA 1KE8A 3LW0A 4H3PA 2WMTA 2W1CA 3BLQA 3E7VA 3E8EA 1BL6A 3GEQA 4FUXA 4G6LA 1WMKA 3SG8A 2P3GX 5GHVA 4FGBA 4U81A 3RNIA 1RJBA 3NSZA 4YGAA 3R7EA 4K0YA 4IADA 4OTFA 5L2IA 4WBOA 5CAOA 1KE7A 4BR3A 4TWOA 3VHKA 3IGOA 3MFRA 5A14A 5HBHA 3F3ZA 3BHUA 1U59A 2OW3A 2VTAA 3QCYA 2QHMA 1LP4A 2IZSA 3NIEA 3ZFYA 4L53A 5KHWA 3C0IA 3VHEA 2EXEA 2PE1A 4O0UA 2C0TA 2GNFA 1LEZA 3QX2A 5I9WA 5BMSA 4KKEA 3HLLA 3MVLA 4FEWA 2BAKA 4UB7A 3HUBA 4TYHB 4EH7A 5CNOA 2OU7A 4J7BA 4J95A 1PXKA 4AZTA 5KMLA 2VN9A 2QQ7A 4W4VA 4XLIA 5H8GA 5ANGA 3FMEA 3UPXA 4FV1A 4AW2A 4DFZE 2HY81 3FLQA 3FSKA 2JFMA 3MTFA 4NU1A 5AR3A 2WTJA 4I5PA 2F7ZE 2JGZA 3IOPA 2OZAB 2UVXA 4P90A 5E8WA 4AX8A 3OCTA 1H1SA 4JG7A 4CMOA 5K0XA 3OP5A 1J7UA 2JKQA 3OF0A 4NJ3A 4YZNA 5L2WA 2FUMA 2JAVA 5HG9A 1PRYA 4IB3A 2VWYA 4WRSA 4B7TA 1IA8A 3VJOA 3OZ6A 4AA5A 5CF4A 5CEKA 2EU9A 4CXAA 3BGZA 3QHRA 4UY9A 1GIIA 3DB6A 5M08A 2PZRA 3LFBA 4GMYA 4KBCA 3GGFA 3TI1A 5AJQA 5LMKC 1SNUA 5JZJA 4Z3VA 3LMIA 1R39A 2XNNA 2C3LA 3QXPA 4AZFA 2JDOA 4HZRA 1KOAA 4ZSAA 4X2JA 5HBJA 4FSTA 4D2WA 3NCGA 4IEBA 4O0VA 2ITYA 2XRUA 4IJ9A 4OUCA 4E20A 3V5PA 3AD6A 5FBNC 4AG8A 5CEPA 1Q8WA 2F7XE 4CTCA 2YLFA 3IW5A 2BFYA 4BDEA 4ZY6A 1OIYA 5JH6A 2O0UA 3QQFA 2JDVA 3UBDA 4IC7A 4DEBA 1IA9A 3HGKA 3FMHA 4N6YA 4JR7A 4EL9A 2V0DA 5JSMA 3BU3A 4J8NA 2YITA 1P14A 3WYXA 2WAJA 4WOVA 3PZHA 2ZJWA 1GAGA 3PSDA 3UVPA 3W1FA 3R7VA 3R1YA 1O6KA 2QNJA 5BVKA 4CV8A 4RA4A 3VIDA 1W84A 2B9FA 2W9FB 2XF0A 3G0EA 3OBJA 4WRGA 5JFSA 5EM8A 3HRBA 5HX8A 4NL0A 3LZBA 2F2CB 3R28A 3ITZA 4I0SA 3TNPC 4DF3A 4BFMA 4DFYA 3AGLA 2V62A 2C3KA 5IQDA 3KMMA 3KRRA 4JXFA 4RWKA 5AR4A 3NVMB 3VF8A 3LFDA 3F3UA 4PV0A 5DR9A 4TYHA 4LMUA 4D5HA 5ITAA 5J8IA 2G2IA 5A4TA 2QR7A 2J0LA 4N0SA 2YHVA 5HIBA 3RAKA 3S3IA 5ETFA 5GIPE 3NAXA 5CXHA 3I6WA 2BZKB 4QPMA 4EK4A 3KN5A 4FZDB 2OZAA 3DKOA 3IS5A 2VX1A 3NYXA 4BTKA 5T6KA 2XCKA 5FTOA 3IONA 1ZZLA 3FMNA 4QMMA 4BICA 5EYCA 4GUBA 4FTIA 4LFIA 3SG9A 4K1BA 1DI8A 2UW5A 1OVEA 4TKSA 4BDAA 4L52A 5FM2A 3NNXA 5AV3A 4II5A 4ACGA 2OH0E 3MH2A 3DT1A 3BV3A 3VS4A 4FKJA 4H3BA 5EYDA 4C61A 5AP1A 3D2IA 3LMGA 4AA4A 4FSMA 3FY0A 3CTQA 3EZVA 4HNIA 4OTIA 4XEYA 2BRGA 4LOOA 5FLFA 1PW2A 3MA6A 4J98A 2J6MA 2PK9A 4GRBA 3KGAA 4N4SA 5TOZA 2IVTA 1JKLA 3PG3A 4WUNA 3SV0A 5JFVA 2VNWA 4M0YA 5DGZA 4MWHA 3UQCA 2OSCA 4XRLA 4JQ8A 5ANIA 4DH8A 3ATTA 4GH2A 2C6TA 1YDRE 1WBWA 4ZEGA 1U54B 2OK1A 3T3UA 3VN9A 4JDHA 4BI0A 4C3PA 5LJJA 4ZLZA 3DBEA 4IAIA 4I94A 5EQEA 2HZNA 3H30A 4I6QA 3AT2A 4QMWA 3QD3A 3W18A 1M7QA 4AWIA 3OCGA 3I7CA 3QQGA 1VJYA 4FSUA 5JFXA 4X2FA 4AA0A 2V7AA 2ITTA 1G8AA 1BKXA 2WU7A 1VYZA 3CE3A 4EBVA 2JD5A 3OUNB 3GU8A 2GMXA 4I6BA 2XMYA 2ZDUA 5E1SA 4LRKA 2W5AA 3BI6A 1B39A 3H4JA 4RIXB 2A2AA 5D7VA 4TRLA 2PVLA 4FL2A 4QNYA 4QO9A 3GBZA 2J5EA 3K2LA 2HZ0A 4ACHA 3U55A 3K3JA 1WVWA 4ITHA 3EN7A 5E92A 4RZVA 1TQMA 4GG5A 4GCJA 1W98A 3W2OA 2WXVA 4BGGA 4FF8A 3DAJA 3HV3A 4CMTA 3RCJA 4MBLA 4W4WA 4O2ZA 3ORZA 4Y5QA 5AR2A 3DB8A 3R7UA 3WARA 4XX9A 5BUJA 1J1CA 4IIRA 2PULA 5AMNA 3AT4A 3KXXA 3CKWA 1Z5MA 5KZ0A 3FQEA 1PXOA 4DH3A 3QTRA 4EWHA 2ITOA 1GOLA 4PY1A 2IVSA 3QQUA 3ULZA 2UZUE 3DBQA 5CVHA 1KWPA 5I3RA 4IQ6A 3ZRKA 2BIKB 4J52A 4F9WA 2OI4X 3ZEWA 1YI4A 2GNGA 2HIWA 4AE6A 2G01A 4K33A 3F6XA 3SXFA 4H05A 2VX0A 4O6LA 1ZYCA 2WMXA 3MIYA 1JSVA 5FTQA 3KK8A 1M2PA 3VS1A 2PZ5A 3LQ5A 4O7ZA 2CCHA 3QALE 2OJIA 2ITXA 4V05A 5AV2A 1TQIA 3A62A 3P7BA 2XK9A 1U54A 3T3VA 3H10A 5HCZA 4DH7A 5EOBA 3MVJA 3BELA 2NNWB 4BDHA 3OOGA 5M44A 2W05A 2OJGA 3MH3A 3O17A 4XBUA 1F0QA 4ZSGA 1QPJA 1NW1A 4U5JA 2PVHA 4FIEA 4QQJA 1GZNA 1UU3A 2G2FA 2H96A 4O0SA 4ZTNA 5AP5A 3D5XA 3FSFA 3R7GA 4OBOA 3BQCA 3MA3A 3A60A 4R3PA 4QYYA 5L8LA 3OHTA 5LCJA 5IA0A 2QG5A 4RIXA 3UP2A 3FPQA 2VU3A 3MDYA 4UEUA 3FMLA 1B6CB 4OT5A 4FODA 4FI1A 4FZ7A 1ZOHA 4L7FA 3LJ1A 5H9BA 4DLIA 1CSNA 3NLBA 3Q2JA 5AWMA 4QMLA 1F5QA 5ETIA 3VQUA 4RJ4A 5FP6A 3WIKA 4EC9A 4LGGA 2GU8A 4C38A 3O7LB 2G15A 3ID6C 4RFYA 3ZLXA 3MFTA 1IAHA 4R3RA 4KRCA 3LXNA 2LAVA 2XK3A 3KRJA 4ANBA 5M4UA 4O86A 4W4XA 3F88A 2XNEA 4YURA 4BDFA 2PVJA 1H1PA 2R3NA 4FZAB 5C8KA 4BBEA 3NEWA 3C4FA 2HXQA 4MHAA 5CWZA 2WU6A 2C3IB 3A7GA 4UWBA 4AFJA 1OIUA 3QCXA 1KUTA 4R5YA 3TT0A 2O64A 1AQ1A 5HIDA 1Q97A 2QC6A 3R8MA 3ZUUA 4TT7A 3PY3A 3ACKA 4B8MA 3OTVA 5KMJA 3BHVA 4EZ7A 3EYHA 4EHEA 4KAOA 2W4OA 1W82A 2VWBA 4NM5A 4Y73A 4AFEA 2B53A 4M69B 5KMIA 2PUUA 5CVFA 5HTCA 2J4ZA 2W4KA 3P0MA 4PP9A 4QP8A 3UC3A 3R73A 1PKDA 5HCYA 4ZLOA 4FSQA 3CS9A 3IO7A 3I81A 3QBNA 4FV2A 5AP7A 5T3QA 4PDYA 4MCVA 3MPTA 5CEOA 3KA0A 4U0IA 1OZ1A 1XBAA 4IZAA 3EIDA 4IM3A 4L7SA 3C4EA 3P7AA 5KBQA 3E87A 3UOKA 3VBTA 3HAMA 4ACMA 3II5A 1H4LA 3IW6A 4DFXE 3D14A 3UO6A 4O7LA 2PMNX 5HO6A 5C27A 5DN3A 1U5RA 3LJ0A 3JY9A 5EKOA 4J97A 4MQ1A 4EOPA 2FGIA 1OMWA 2QURA 4FOBA 2BIYA 1WZYA 2IZUA 3RM6A 3RTPA 4WA9A 5HE0A 4FL1A 4JIAA 4EOSA 2YM7A 2IPXA 5EHYA 5CX9A 3N4VA 3LFAA 4ONAA 3DK3A 1FVRA 1XO2B 4FSWA 3P08A 2Z2WA 4H58A 4E6QA 3POZA 3UVRA 4C7TA 5M57A 5C03A 3L9PA 1L8TA 3D2KA 3VF9A 1J91A 5GJDA 4IXPA 3UTOA 4CSVA 3BEAA 3VBVA 4C8BA 4FKPA 1CTPE 3NUAA 3GU4A 4FKUA 4FT3A 1YDSE 3QX4A 2PU8A 4BZOA 2PMOX 3EQGA 3KXZA 3ZU7A 4ZTSA 3ORIA 4D1XA 2C6DA 2VZ6A 2CLXA 5IDPA 3W55A 1YWNA 4X21A 5IH4A 4RWJA 4GL9A 3QLGA 3KXNA 3TV6A 5BUEA 3KF4A 1KE6A 3E8CA 4BDBA 5HESA 3QUPA 4ZZOA 1URCA 3BQRA 4JS8A 5L6WL 3GQIA 3HECA 2IVVA 3K5VA 3CTHA 3U87A 3MH1A 2O65A 2Z7SA 3REPA 3W2PA 2HW6A 5G6VA 4DINA 1XH9A 4USDA 3HRCA 1LUFA 4IMYA 1YOJA 4M69A 5DFPA 3LXLA 3U9NA 5J7BA 3BBTB 1W0XC 1UV5A 4K11A 4AOJA 3QRIA 3UO5A 5CANA 5IQEA 3AXWA 4AZEA 2YDJA 3ZUTA 3QD2B 3QRKA 5E8XA 4AW0A 2W1FA 3U6HA 3SRVB 3E3BX 4OTDA 4GT5A 4JRNA 3L9LA 3C0HA 2EUFB 3FMKA 3W32A 5IEYA 2BAJA 3A7FA 2CKQA 4S31A 3UQFA 3QL8A 4EH5A 3V04A 3I60A 1XH8A 2WIPA 2ZAZA 5IA2A 2J90A 3TTIA 4PDOA 5CASA 3VWAA 4EBWA 4Z16A 1ZZ2A 3R63A 4IWPA 5CNNA 5BMMA 2BZHB 2J51A 5KMMA 5ANOA 3PJ1A 4M0ZA 3Q96A 4KIKB 4CLJA 1VEBA 2XIZA 1S9IA 4LUDA 4TWPA 5LXMA 4EH9A 1ATPE 4PDSA 1UVRA 3TV4A 2X6EA 2ITWA 5EW9A 1J7IA 3TTJA 3S00A 2XP2A 3ODZX 1APME 3KB7A 5CSVA 2CCIA 4E4NA 2JITA 4U44A 2ITPA 3VUMA 2X6DA 3UNJA 3HKOA 1L3RE 5FEDA 2PVRA 5CAPA 4UYNA 1PXLA 4XP2A 4AS0A 4LM5A 1OPKA 4RX7A 1PJKA 2ITQA 4GFGA 4YJNA 3R8VA 4IH8A 3F7WA 4U97A 3M1SA 3SAYA 3HV7A 5D9HA 4F9CA 3F3TA 5AA9A 3I5ZA 2JFLA 4FV4A 4RJ8A 2YM6A 2YIXA 4N70A 2R3FA 1MQBA 2G9XA 5HCXA 5AUTA 3SA0A 3V6SA 4ALWA 1TQPA 1BUHA 2P33A 3KMWA 4QPSA 4YR8A 4FK6A 3BIZA 3QZIA 4P2KA 4EHGA 2ZMCA 5DI1A 4CCUA 2PY3A 4EOKA 2BCJA 5HEZA 4W9WA 4BCGA 3CY2A 3P9JA 4QYHA 5GINE 4OTPA 5BYLA 3NVKI 3A61A 2W4JA 3FYKX 1Q8TA 5C9CA 3SRVA 5IPJA 4EHZA 3TKUA 2JIUA 4UMTA 3H9OA 2GQRA 5AP4A 2O3PA 3FKLA 5KHXA 1OB3A 2GS2A 5IH5A 1H0VA 1E9HA 3K54A 4FMQA 3RZFA 4C4HA 3QAME 1PYEA 4XH6A 2F4JA 4NM0A 4RPVA 5EFQA 4L68A 3CGOA 3PTGA 4L01A 2R3IA 3DY7A 4DCEA 3DJ5A 2PVMA 3QQHA 4KIKA 1OKWA 3LXKA 4QMQA 4KABA 4X7QA 2HYYA 2CGUA 3SOCA 4FIFA 4B8LA 3Q9WA 2VTQA 3LKMA 4PTEA 3E8NA 3GCPA 2BR1A 4CZUA 4WG5A 3GOKA 5TKDA 1O9UA 4HW7A 5F4NA 4G5PA 2QO2A 2Y6OA 2W96B 5IUIA 4F08A 5BQ0A 1QPCA 1JVPP 4JT3A 5J1WA 1UKHA 2WTCA 5AP2A 4BWXA 3SHEA 2C6IA 4RJ7A 4GV1A 4NCTC 2BKKA 2QOFA 4NW6A 5DR2A 4IHPA 3RAHA 3HL7A 4EUTA 4XUFA 2OFUA 4MBIA 4RRVA 1P4OA 3LOKA 3PY1A 5EM6A 3ZM4A 5M09A 1SZMA 4PWNA 1OI9A 4R78A 3CY3A 3CXWA 5H2UA 3MY5A 2PZYA 3KCKA 5CZHA 3MW1A 2OJFE 5BYZA 4CFFA 1FQ1B 3KC3A 4TYGA 1YHSA 4YJPA 1PXIA 2CSNA 2PTKA 3R8PA 2JDSA 2WMVA 4FG8A 3HP2A 2YIYA 4EEVA 2OKRA 4BDKA 4CFUA 2HAKA 4FTRA 4MVFA 4PPBA 3CP9A 2YWPA 3R8ZA 3S4QA 4F7LA 4ITIA 3VULA 1WBOA 2UVZA 3ZFMA 2XYNA 3EN5A 4G3CA 2BPMA 4N57A 1I09A 5JKGA 5KMOA 1XH7A 3FLNC 3PVBA 4I6HA 2IVUA 2BRBA 4ZS4A 4TNDA 4YZ9A 2ERKA 3GP0A 5CVGA 3WF7A 2WMSA 3ODYX 4RQVA 4X2NA 2OLCA 2ETKA 3OWPA 4FTUA 5DH3A 1PY5A 3BHYA 2QHNA 2X7OA 3JVSA 3ZZEA 4BN1A 3R22A 3RP9A 3M2WA 3G9NA 3NW7A 3ORPA 2C6EA 4WIHA 3IW4A 3W8QA 2RF9A 2FYSA 4U79A 3UG2A 1IRKA 3FL5A 1H8FA 3PP0A 3TZ9A 4J96A 1LR4A 4FR4A 2EB3A 3PP1A 5EM5A 2B1PA 3BGPA 1JKTA 3S2PA 3PRFA 4GJ3A 4U40A 3VUIA 1H1QA 5TF9A 5J1VA 3NNVA 2Y6MA 3EH9A 3NUSA 4RX5A 4UZDA 2CNQA 1OL2A 4A9UA 4IANA 4EH2A 3CJGA 4IWOA 5AR5A 5CAQA 3HNGA 5JEBA 4R3CA 4IM0A 5D11A 3TWJA 2VWVA 4YPDA 4AZSA 1Q41A 5CSXA 4U7ZA 5DNRA 3V8WA 5HVKA 3ET7A 5HE3A 5D12A 3O7LD 3E7OA 5A4QA 3L1SA 2FSOX 1YRPA 4HOKA 5I3OA 4O82A 2B55A 3QC9A 3IOKA 4BHNA 4H1MA 2XK8A 1GY3A 3PSBA 4PP7A 4BDGA 3EOCA 4AUAA 4FBXA 4I24A 2Y7JA 5HICA 2X9FA 4M3QA 5JQ5A 2AC5A 2GSFA 3DKFA 3EQBA 3BHTA 4BZNA 3UC4A 3RPSA 1H1WA 4NW5A 5HHWA 2QOKA 5A9UA 3PXQA 1CMKE 5DIAA 4HYIA 4ANSA 3EL7A 3OXIA 4GK3A 5E8YA 5CSPA 4UV0A 4CKRA 2GNJA 4GUEA 3AGMA 3BX5A 3QTWA 3SKCA 1YOMA 3RHXA 4IAZA 3RM7A 4S34A 4GS6A 2PMIA 4R7HA 5TT7A 2VTSA 2J50A 5KNJA 4F6WA 3E62A 3S95A 4M97A 3UIBA 4IAAA 1AD5A 1Q62A 4Y72A 4FTOA 4W8DA 3RCDA 3UMXA 4BKYA 5A46A 1M2QA 4JOAA 4MYGA 5IZFA 2WTWA 2OICA 4TWNA 3V5JA 3OT8A 4ACCA 5L6PA 3FJQE 5IU2A 4FT9A 1NVQA 4M67A 4HVIA 3LFNA 4BYIA 5HNIX 4S32A 5L6OA 5KKRB 2FH9A 2HZ4A 4M8TA 3FQSA 4Y8DA 3TV7A 4IAFA 4A9TA 4NZWB 1H26A 2QOLA 2XJ2A 3OC1A 3PUPA 4NFMA 3W16A 3ZCLA 5LWMA 2V22A 3UZTA 4O7SA 2XKDA 2O8YA 5B7VA 2ETMA 4RVMA 4QP4A 5AFVA 4FKIA 1WBPA 5EDQA 4CT2A 2XVDA 1H27A 3NGAA 3U4WA 1PXMA 2HWPA 3ETAA 4HNFA 5CU3A 2VO3A 2XNGA 2ITZA 3OY3A 4PRJA 5HU3A 4MF1A 1OM1A 2WMUA 2YIRA 1UA2A 2GNIA 3SQQA 4G9CA 3TKHA 3ZC6A 2GHLA 4YTCA 4I23A 3F66A 4M66A 4IB0A 4RMZA 5DRBA 3G6GA 3EHAA 2BFXA 3F3VA 3WZKA 4QTBA 3MTLA 4M12A 3V01A 5IMEA 5KCVA 3ORNA 3ZOSA 3QTXA 4KUJA 2PPQA 5C26A 4DGNA 5IUGA 3NUUA 4OW8A 4M15A 3CPBA 3PVUA 2IN6A 4XHKB 4DC2A 1JKSA 4F4PA 4JRVA 5CEIA 1OL6A 2JEDA 3AG9A 2Z7RA 4GJ2A 5EW3A 2X39A 4ANQA 2FSTX 2ZB0A 4DEGA 3DJ6A 2BROA 4CYIA 5IQGA 4IZ5A 4QYGA 2B54A 4TPTA 2Y9QA 3KULB 4PTGA 4YJSA 3OS3A 2R3KA 5G1XA 2XIRA 2W7XA 3RI1A 2UW4A 3OBGA 5IQFA 2ZDTA 3ZTXA 2IW8A 4Q9ZA 4WNKA 4C3RA 3U6IA 3V5TA 2VUWA 4O2PA 4RX8A 4DTKA 4HVHA 1Q4LA 3U8WA 4F09A 2UW8A 2VTLA 1URWA 3QKLA 3SOAA 3WF6A 4NEUA 4EK3A 4FKVA 2GQSA 5CT0A 5A4EA 3MFSA 2X9EA 4NIFB 4CRSA 5LVPA 3O23A 2JC6A 1YXXA 5CALA 2H8HA 3G51A 3WF9A 3PYYA 3UOLA 3UIUA 4CKJA 3KRXA 2WMRA 4HVDA 4C0TA 3NUNA 5ANDA 1Q8YA 3OOMA 5HKMA 4FTNA 5CEQA 5A6OA 4IVDA 4ZK5A 5AV0A 4U41A 4QQCA 3QWJA 2X2MA 3MGYA 3P23A 2XJ1A 3PJ3A 4I21A 1T45A 5DT3A 3RALA 3N4UA 1YHVA 2GHMA 3F5UA 4QTEA 5CT7A 3Q5IA 4LOPA 2VTOA 3VC4A 3QUEA 5HG8A 5BVEA 4S30A 5IA1A 2WB8A 4ZTQA 3DK6A 2R3MA 3DFAA 3P1AA 4LGDA 3R0TA 5BX0A 3FZRA 4ZTLA 2NPQA 3KF7A 3A99A 1FPUA 2WMQA 3NNUA 3GUBA 3QZGA 4IZ7A 3HV4A 4R8QA 2HY0A 4A9YA 1XKKA 5CSHA 5L4QA 4W4YA 2DQ7X 3A8WA 1OBGA 3LAUA 5HTBA 3COKA 1LEWA 4JBPA 1Q3DA 3PLSA 4FV9A 3K5UA 4R77A 2VGOA 3QQKA 3VUHA 2WMAA 4FIHA 3KU2A 1UNGA 3UP7A 4RC3A 4EONA 4YLKA 4E26A 4DFBA 1O6LA 2BRMA 2BZJA 2J0IA 4EOMA 2DS1A 5ICPA 3C4CA 3V5QA 4DFUA 3VW6A 3FC2A 5DOSA 2YABA 4I20A 5FTGA 2VX3A 2RFDA 2ZM1A 4RFZA 3BU6A 3HAVA 1SVEA 2B52A 2R9SA 5FRIA 3F5GA 3Q4TA 3KULA 1DAWA 3BBWA 3CC6A 4UMQA 4M7IA 5IISA 5M53A 2PYWA 3G6HA 4EHVA 2B0QA 3M11A 3FY2A 5AUXA 3FE3A 3SGCA 4Y83A 3SW4A 1XQZA 1KV2A 3FMMA 3VJNA 3DBFA 3R6XA 4FKOA 3E92A 1NVRA 5DLSA 4H3QA 4D2SA 3OMVA 4X3FC 4NYEA 4RIOA 4NFNA 4NIFA 3D5WA 4IDVA 4FNYA 4E93A 2OFVA 4NKSA 4TXCA 4ACDA 1XH4A 3EJ1A 1X8BA 3QGWA 2JBPA 2NRUA 1JSUA 5BPYA 4YC6A 4BKJA 4BKZA 4ERWA 5GZAA 2JKKA 3WZUA 4BTMA 2GTNA 3Q32A 2JLDA 4IWDA 4KKGA 4O1PA 4PMSA 4C62A 2BUJA 3EQFA 4RVKA 4TYJA 4U3YA 3ZO3A 4BGQA 4QTCA 5J95A 3BRBA 2QKRA 2E9PA 5E4HA 1REKA 3BHHA 4OTWA 5CLPA 5ANKA 2RL5A 4NJDA 4XMOA 3Q4ZA 4L46A 4ZMEA 3ORTA 4WKQA 5CENA 3FLYA 5JK3A 3AD4A 2VWWA 4RLLA 4FTMA 4EH6A 2UVYA 5HD4A 4MEDA 1XH6A 2GS6A 5EI6A 5L3AA 2RGPA 4J53A 3FXXA 3IECA 3IKAA 3OVVA 4YPSA 5CY3A 3RINA 3WZDA 4E5WA 1DM2A 5AUVA 4CT1A 5LVOA 3NUYA 4EK8A 3ALOA 3QTUA 4XBRA 4KIQA 4NM3A 3QRUA 3A4PA 4QMTA 5FDPA 3DNDA 4RWIA 5A6NA 1OECA 4D58A 4D55A 2A1AB 3NCZA 4I5CA 1P2AA 5FBOA 2GPHA 2J9MA 5B0XA 3ATSA 4G3EA 4QPAA 4CFWA 4APCA 3MB6A 1KE5A 3ZLSA 4OAUC 3O50A 3MV5A 4EQCA 4C34A 2X1NA 2PWLA 3TNHA 1PMUA 3FLWA 4HGSA 4O83A 4HPUE 1YWRA 2FO0A 1GZ8A 1Q3WA 4CFNA 3D94A 2RFNA 2QG7A 4OBPA 2OJJA 1QCFA 2X81A 2XNMA 4I4EA 4X0MA 4D0WA 4I93A 4EC8A 3PIZA 3EQCA 3FZ1A 2WHBA 4RLKA 4Z7GA 3ALNA 1UNHA 2XEYA 4FVRA 3BPRA 2BAQA 5DWRA 2CJMA 1ZWSA 5D10A 2BKZA 3W10A 4RFMA 3U4UA 4BTJA 3DXQA 3ZO4A 2BZIB 2XBJA 3D4QA 3DS6A 2XM9A 4J1RA 3HUCA 4RJ5A 3BZ3A 3W2CA 2BHHA 2YJRA 3PXFA 1FGIA 5ANEA 5HX6A 5AUWA 4YTIA 4BYJA 2PMLX 2WKMA 3F2RA 4YU2A 3LVPA 4NK9A 5BVFA 3ZS5A 5FXSA 3QQJA 3L9MA 4ZAUA 5LVMA 4EZ5A 3R71A 5F9EA 3HEGA 3I5NA 2CGWA 2UZWE 1JKKA 5AX3A 3RAIA 1ZYSA 3MY1A 3OWLA 4C35A 4Z9LA 1PMNA 1REJA 4L43A 4AU8A 2R3PA 5K0KA 4FZFB 4Z55A 4O0YA 1BX6A 3MB7A 4JBVA 3UJGA 4MWIA 1OKVA 4F6UA 2R3OA 2Y0AA 5J87A 3FPMA 3CR0A 4RG0A 2PL0A 3KEXA 1RW8A 3UYSA 4FIGA 4QP7A 5AV1A 3I6UA 1JPAA 2OH4A 4ALUA 4C4JA 2ERZE 2OBJA 3MJ2A 5IA3A 4AOTA 4ENYA 4BIBA 4GFOA 3JY0A 4FV7A 4W8EA 3WZJA 3OWJA 4CYJA 4PNIA 3BE2A 4BRXA 4U43A 1J7LA 2PUIA 2BTSA 1ZMUA 5CZIA 3C4WA 5E8UA 4AT5A 4BDIA 3D7ZA 3FZPA 5EHOA 2JAMA 4ZY4A 1U5QA 4P5ZA 3F82A 3K3IA 2ZV9A 1V0BA 1CKPA 5TR6A 4YZBA 2IW9A 1K2PA 4V01A 4UZHA 5AA8A 2PSQA 2VWIA 3HMIA 4YC8A 5M4IA 4BL1A 4DG2E 4XV1A 4G17A 1IASA 4QNAA 4D2RA 4DGOA 4KSPA 4RBLA 4F65A 3DV3A 3SW7A 2CNVA 5DVRA 3RK7A 3I4BA 4O0WA 1G3NA 4RWLA 3VW8A 3OTUA 2Z60A 3C51A 3FYJX 2GNHA 3TZ8A 3PWDA 2W5HA 1M2RA 4TTHB 1OPJA 3RMFA 4HCVA 4PTCA 2YZLA 3GQLA 4KBAA 5I9VA 4I92A 1V1KA 3EN9A 4YLJA 4CCBA 2B4SB 4MF0A 3Q04A 2VD5A 4GT3A 4ZOGA 1ZOEA 4YJTA 4A4OA 5EHLA 4ASZA 4K2RA 5FUTA 3OFMA 3Q4UA 4BCQA 4IX4A 2ZV7A 3LPBA 3DBCA 4YTFA 3TNQB 2C30A 4FTAA 3AQVA 4XG8A 5CU2A 4YSMA 4FVQA 4JQEA 2WZJA 1PYXA 2XUUA 4H1JA 4CEGA 3DAKA 4BY9E 3DLSA 1T46A 1U46A 4IW0A 3WZEA 4RIYB 3O51A 4IC8A 4U3ZA 4O7VA 5IQHA 1NXKA 1FOTA 4JBOA 3TM0A 3PWYA 4FX3A 2ZV8A 5GJFA 2XK7A 4N6ZA 2UW7A 4LRJA 4TWCA 2XIXA 2DUVA 2I1MA 3RVGA 5HE1A 3UQGA 2B9IA 4WSQA 4JJRA 4DFNA 3Q4CA 3WE8A 1FMKA 4GK4A 1H0WA 3DLZA 2YM8A 3QF9A 3ORLA 2WD1A 3BKBA 4O0TA 4IVAA 1OUYA 4IVBA 4L8MA 5AM7A 3VS7A 4K18A 3U54A 3VQHA 1J3HA 4DITA 3CD3A 4F7JA 2QR8A 4MTAA 3R04A 5K4JA 4KKHA 4XG4A 5K3YA 5HOAA 1MRUA 3PPKA 3NR9A 2YCQA 3FXWA 4RZWA 2CDZA 1WCCA 1HCKA 4IX3A 2I6LA 3ZSHA 4BTFA 3LCTA 4DT8A 2B9JA 2WMWA 3CLYA 5CQWA 5DHJA 4BDCA 4DN5A 4EJNA 4USFA 4DBXA 3D83A 4EWQA 4P7EA 5DRDA 2WELA 3KL8A 3QQLA 3OROA 1H24A 4I3ZA 1FMOE 3E63A 2XKCA 5AP6A 4X6QC 2VWZA 4CD0A 3M42A 4YZMA 4AGWA 4PNKA 4AT3A 4BDJA 4FV8A 5HD7A 2R0UA 4PX6A 4RC2A 3O8PA 4FK3A 4IVCA 1UU8A 1ZAOA 3IW7A 2REIA 3B2WA 3QZFA 3CD8A 3H0YA 2XCHA 3LMHA 3FKNA 3RK5A 2ZOQA 2XRWA 4QTAA 2ZV2A 5EDPA 3NZ0A 4M68A 4XV2A 3R7YA 3QZHA 4KNBA 2BDJA 4CQGA 1IG1A 3PA5A 4KS7A 2WPAA 2XA4A 4RIYA 5E7RA 5EH0A 3Q60A 4C4IA 5HU9A 5LVNA 3BYMA 1JOWB 3SDJA 3RZBA 3F2AA 4O38A 2YN8A 3LXPA 3OXZA 4XRJA 4CVAA 4FV0A 4ZTHA 3JS2A 3Q9XA 3S1HA 4BIDA 2XJ0A 1XWSA 3DXNA 1MUOA 2VTMA 2WGJA 3LQ3A 1W83A 3R9HA 1OL5A 1Q5KA 3I7BA 2JBOA 2P55A 2XEZA 4BCMA 4DH1A 5LQFA 4O84A 4GIHA 4R7IA 3LM0A 2F2UA 3W2QA 1WBTA 1NVSA 1Y6AA 3KFAA 5DPVA 4FGRA 4NH1A 4LGHA 5E91A 3TZMA 4Q5EA 2GFCA 3I1AA 4K77A 5CU6A 1MQ4A 3MVMA 1ZXEA 4C2VA 3C4XA 4F1MA 3BGQA 5DE2A 4DGGA 3PVGA 3PLAE 5AUUA 4I5MA 2W17A 4FSRA 1JAMA 3UE4A 4F70A 1VZOA 4BHZA
chains in the Genus database with same CATH superfamily
4O27B 4RGJA 4GFMA 3JVRA 3MIAA 3AC3A 3EKNA 3GNIB 2UZDA 3CTJA 5FM3A 5EW8A 3PE1A 3ROYA 1BI7A 3VRYA 2ZM4A 4LOQA 5FXRA 3KIOC 4E6DA 1UWHA 3TEIA 1R1WA 3EYGA 3GT8A 2YZAA 4FNZA 4HVGA 5CU0A 4ZJJA 4PPCA 3LM5A 5FWKK 2Z02A 2WO6A 2W99B 4CV9A 3DQXA 4G31A 1F3MC 4NT4A 5EG3A 4D9TA 5HIEA 5KMNA 2QD9A 3C1XA 3F5XA 1UKIA 2R7IA 2IZTA 5FGKA 2R4BA 3DU8A 4R6VA 4DEHA 4CG9A 3UNKA 4D4YA 4GEOA 3ZMMA 1YXVA 3OT3A 3DAEA 2X0PA 2UW9A 2C6KA 2OO8X 3TJDA 5AM6A 3JPVA 4MK0A 1ZY4A 2RG6A 4D5KA 3W2SA 2C0IA 3KKVA 1CKJA 5DBXA 3G15A 2GHGA 4CQEA 4QYEA 4ERKA 3QWKA 1PMEA 1YI6A 2VWXA 3U6JA 4F0IA 2C5XA 3Q5ZA 4S2ZA 5F20A 4RQKA 4IAKA 1XBBA 3UPZA 4EK6A 5LMKA 3GB2A 5DT0A 4E7WA 4ZZNA 3ZDUA 4YZDA 3COMA 2ESMA 5AADA 3D7TB 2C5YA 3T9TA 1OITA 2QKWB 3E3PA 4X3FB 4DEDA 2A4LA 3Q6UA 1KOBA 1RE8A 1TVOA 3NWWA 3H9RA 2V7OA 4L9IA 4YJUA 4BCJA 2OIBA 3W0OA 1KSWA 5A3XA 2CGVA 4OTQA 4LL0A 1WBNA 3FQHA 4QP1A 3FV8A 5DEYA 2WEIA 4AXAA 4FT7A 5JZNA 5I9XA 2BRHA 5E8ZA 4D9UA 3F3WA 4YUQA 3BL7A 3LHJA 2OXDA 3O8UA 4OTHA 3PXYA 5ETCA 3VNTA 5GZ8A 3C50A 3H9FA 4QD6A 1BYGA 3EFJA 2HK5A 3C9WA 3L8VA 4AQCA 4ZS0A 5DT4A 2E9VA 4ZIMA 2W1HA 4PMTA 4FNWA 1Q8UA 1YOLA 1YDTE 3RBWA 2VO6A 4P5QA 5AUZA 3FI8A 1V0OA 2A0CX 4F9AA 2RFEA 3TUCA 3HMMA 2Z7QA 3DPKA 4O1OA 4XG6A 2ONLC 4C33A 3ZXTA 4A4XA 4QMOA 3KMUA 2EXCX 5EQPA 3DKCA 5LMAA 5T68A 4KRDA 3UZPA 3F69A 4ORKA 2UZNA 4D4RA 2PE0A 5EK7A 3EQPA 4AGCA 4F99A 3MJ1A 2GQGA 4TNBA 3GI3A 3FLZA 5LCKA 2PUPA 2Y4IC 1FVVA 3G33A 3NFFB 4GT4A 3QKKA 2NYAA 1H28A 1MP8A 4JBQA 2C6OA 3WOWA 4E73A 2ZMDA 4IM2A 3RPVA 4OLIA 5A4LA 4U8ZA 2I0VA 2UZVA 3QRTA 3PRIA 3DOGA 4RVLA 2WTVA 2GS7A 4YLLA 3AMYA 3EQRA 2ETRA 1OUKA 3IDCA 4MXXA 3EMGA 4QMUA 3DTWA 5EQYA 2WIHA 1ZYJA 3DNEA 3R9DA 1DAYA 5EYKA 5KO1A 4H36A 2CLQA 3PA3A 5M56A 2C3JA 2YM5A 5CYIA 4GW8A 4DG0E 3TNWA 4WG4A 4MAOA 1E1XA 1B38A 2R3HA 3R01A 4YBJA 4A4LA 4C02A 5E90A 2R0IA 3AOXA 3GC0A 5AAGA 3D7TA 4X3FA 4KBKA 4QP2A 3UMWA 2X0QA 3WBLA 2VNYA 4AT4A 2ITUA 3C5UA 5IG1A 3BWFA 4V0GB 4FSYA 2HOGA 2PVFA 4F1TA 3HA8A 3AC4A 3I0OA 2I0HA 3Q2MA 5I5ZA 3R21A 3F61A 3VUTA 4G2FA 3HYHA 3BV2A 1ZRZA 5J79A 2R3GA 4U9AA 4BVUA 4XG3A 4HCUA 2NP8A 3GC8A 2JIIA 4DH5A 4MXAA 3UOJA 3NYVA 2OF4A 5LARA 4HYHA 3MH0A 3RGFA 1H01A 1Y8YA 4QQTA 1RQQA 2UZOA 4I1ZA 3ZXZA 5HNGA 4X6RA 4FKWA 4HGLA 4YJRA 2XKEA 3NW6A 4HJOA 4UXQA 2LGCA 3MESA 5CF5A 3RPYA 4L67A 2I0YA 2AUHA 3QD0A 4XG7A 4XS2A 4AF3A 5J9LA 1UWJA 2YA9A 5J7HA 3BYOA 4JI9A 5J5TA 3Q6WA 3QCQA 4XYFA 3PA4A 3ZUVA 1E1VA 2VO7A 3TUDA 3G2FA 1ZMVA 4BC6A 4Q5HA 3NW5A 3IDBA 4F7SA 1ZARA 2YM3A 2QLUA 3FXZA 3PXZA 3JR1A 4EZ3A 2OIDA 5ETAA 3QTQA 4D4SA 4JX3A 3EL8A 2CKOA 4KS8A 3EQIA 1SM2A 4QYFA 2W1DA 3T8OA 4IFCA 3MPAA 3SLSA 4KIPA 2PE2A 3EWHA 3FHIA 4A9SA 2XYUA 4FG9A 3U51A 1K3AA 3UGCA 4APPA 4E3CA 4FG7A 2X8DA 4Y85A 2VRXA 4GK2A 4LV5A 2I7QA 3VUDA 2HW7A 3SC1A 2XIKA 3B2TA 3DCVA 2YISA 3O0GA 3B8RA 4FL3A 3UG1A 4E4LA 5AEPA 3AC8A 2OIQA 3ZBFA 1LPUA 2X2KA 5AR8A 2J7TA 4M14A 4GIIA 2E9OA 4AN2A 2EXMA 5DG5A 1QPEA 4CFXA 4ANMA 3BLRA 4EK5A 2WTIA 2E9NA 3OW3A 3PFQA 4NTSA 4UBAA 2WQNA 4V0GA 2X0OA 2F7EE 4JDJA 4AOIA 4DHIB 3EZRA 3R1SA 1VYWA 4MNFA 3GU7A 4FYOA 4R1YA 2VAGA 4RSSA 2QO7A 5A4CA 4UWYA 4G3DA 4O21A 4JG6A 1H08A 3RKBA 1H00A 5KZIA 4MD8E 1GJOA 3NS9A 4EYJA 5KE0A 2G1TA 5I9ZA 3R9RA 3SXRA 1XJDA 2J0JA 4IB1A 2DWBA 1XBCA 3QLFA 4RJ3A 4ANLA 4ZLYA 1YXTA 4RIWB 2XARA 2XNOA 3QA0A 5JGBA 3VS0A 4BDDA 3HV5A 5M4CA 2QONA 2J2IB 3KREA 4BGHA 3CIKA 3GCQA 4O7YA 5JT2A 2I40A 2RIOA 3ANRA 4IX5A 3R1NA 3ZONA 3UZRA 3OW4A 4YP8A 1XR1A 5CI6A 4EORA 4E5AX 3HRFA 3IW8A 4GU9A 3VRZA 3LLTA 4EQMA 4V04A 4IDTA 2XH5A 1OGUA 2R3RA 2YAAA 4F1OA 1GZOA 4F78A 2R3LA 5FP5A 1PHKA 3TXOA 3MBLA 2YAKA 3PZEA 4EUUA 3EN4A 3HV6A 3GFEA 4J8MA 4B0GA 1PXPA 3PY0A 1WBSA 3NPCA 3ORXA 3QRJA 4HCTA 5I9UA 3UVQA 5AV4A 2EB2A 2VTRA 4DA5A 4BWKA 3GFWA 2CMWA 4XG2A 2I0EA 4FEQA 4CZYB 4EOIA 1JBPE 4FICA 1WFCA 4G3FA 4YO4A 5F1ZA 4JAIA 4Y95A 3GC7A 4KA3A 3ZRMA 4E6CA 1R0PA 1DS5A 1YVJA 2XB7A 5L2SA 4ENXA 1JQHA 2QCSA 4A7CA 1VLRA 3QC4A 3R2YA 4DHZA 2XS0A 4A06A 3JXWA 2P4IA 3QYZA 4FEVA 3GU6A 1SYKA 3SVVA 3C13A 4FV5A 4K9YA 1M17A 3DBDA 3OD6X 2H34A 4HYSA 4WO5A 3ZLYA 3FDNA 4XNEA 3FKOA 4ID7A 4I0TA 2P2HA 3RHKA 3R1QA 4TYIA 4DGLC 5CEMA 4P4CA 3T9IA 4FKSA 4AXDA 4E4XA 3ZO1A 2PZIA 5C1QB 5K5NA 3LCOA 5IQAA 5HG5A 4XCUA 2JDTA 2W06A 4KIOA 5HVYA 5AP0A 5AX9A 2YWVA 4EKLA 2VV9A 2Q0NA 5HLPA 3ZLWA 1BI8A 1OGYA 1ZLTA 3CQWA 3DJ7A 3DQWA 3FEGA 2BMCA 4CMUA 3N9XA 3N4TA 4WNPA 3UYTA 3VUKA 3LCSA 1Y57A 3ORMA 2QU6A 4A07A 3IGGA 3TACA 5A46A 5JGDA 4IAYA 2O2UA 4GSBA 3AKJA 5TO8A 3MYGA 5GIOE 5ACKA 3PJ8A 4XP0A 2JIVA 2YACA 3LFFA 1KV1A 3OG7A 4RIWA 4AZWA 4BCIA 3LIJA 1BMKA 1IEPA 4C36A 3CKXA 4ZSEA 3VS5A 4PQNA 1QMZA 1OKYA 3RAWA 5ACBC 2X7FA 3FZSA 5M4FA 3FUPA 3NYNA 2QLQA 4FTQA 5HLWA 4I41A 4BI1A 5CAUA 4AP7A 4PMMA 4U6RA 1A9UA 1JLUE 3MVHA 3F5PA 5L8JA 3UIMA 4WUAA 4AZVA 4C37A 2XNPA 3E88A 4MUQA 1PF8A 1Q99A 3QA8A 4BF2A 2OGVA 3A8XA 3LFCA 4FTCA 2R5TA 3HMPA 4O0XA 4PL3A 4O7RA 5I9YA 2HELA 4TN6A 3DTCA 1MRYA 2EVAA 3BCEA 4TY1A 3G9LX 5D1JA 4F0GA 3DDQA 4MD9E 1IR3A 4IJPA 4WNMA 2CHLA 4FKQA 1OPLA 3MS9A 4U42A 5EM7A 2HXLA 2GTMA 4D0XA 3ZRLA 2WTDA 4UALA 4AXEA 3KRWA 5IA5A 3FL4A 3TZ7A 5BVNA 2QOIA 3R8UA 5HGIA 4XOZA 4C2WA 4JMQA 4B99A 1GZKA 3Q9YA 5FD2A 5M06A 5HE2A 3IPHA 2C6LA 3L8SA 4ZZMA 2XK4A 4FIJA 5CSWA 1Y8GA 3ZHPC 4FV3A 2X0GA 4GYGA 4O91A 4TZRA 3NDMA 1SNXA 4E1ZA 4CRLA 3NUXA 4AE9A 3FMJA 4FV6A 3V3VA 5HO7A 4KWPA 3QUDA 4U80A 5KUPA 4QOXA 2WEVA 4LV8A 3R8LA 3ZDIA 4BZDA 5B2MA 3LFQA 4JNWA 4E5BA 4UN0C 1O6YA 2QOQA 4TW9A 3PG1A 2WQMA 3AC5A 1DI9A 3NRMA 5H8BA 4AN3A 3O71A 4ZY5A 2C47A 1OIQA 1CM8A 2J0KA 3EN6A 4BCOA 2AC3A 3KXGA 4XG9A 2BDFA 5BVDA 1BL7A 4RJ6A 4MD7E 4EOQA 3VBQA 5IF1A 3C4ZA 4HYUA 3DGKA 2A98A 3LJ2A 3PIYA 4MXOA 2UZTA 5DA3A 3SX9A 4QEBA 2XNBA 4QMYA 3FC1X 4F6SA 3KQ7A 2WOUA 1YQJA 4YJQA 1HOWA 4DBNA 3VS2A 1NA7A 4K8AA 5LOHA 5GJGA 4GKIA 3GXLA 4AW5A 4C59A 1I44A 2X2LA 4PMPA 2C5NA 4QP9A 5FQDC 2F49A 2R64A 3BU5A 5JQ8A 3TJCA 5CI7A 1R78A 5KX8A 4BCPA 3PIXA 4FUYA 4BI2A 4CG8A 3EFKA 3NFGB 4YBKA 3CBLA 5KMKA 3QXOA 3NMUF 3TG1A 2GDOA 4AGDA 1XH5A 2PHKA 2C1BA 2UUEA 3NIZA 4BCHA 4O7NA 3S0OA 4MXCA 5BYYA 4LMNA 4IACA 5HLNA 4QP6A 2CPKE 4MNEB 3HX4A 3FWQA 4J99A 2OF2A 3KXMA 3QD4A 3DFCB 2FB8A 3TIZA 2QO9A 3F9NA 4B9DA 2IW6A 4DEIA 5H8EA 3QYWA 2AQXA 1NY3A 4QRCA 4EJ7A 2Y4PA 4AACA 2B7AA 4TYEA 5BVOA 5K5XA 4I6FA 3Q53A 4UYAA 5E8TA 2GFSA 3PJ2A 4JDIA 3WILA 4FTLA 1SMHA 4G6OA 5D41A 5AR7A 2QOOA 3EQDA 2CKEA 3ELJA 2VTIA 5JFWA 3WYYA 4G3GA 3VS6A 3W2RA 4OGRA 1PXJA 3P4KA 4PPAA 4CFVA 3B8QA 3NAYA 3P86A 4JL9A 5JGAA 4CZTA 3TUBA 4JQ7A 4L44A 4MKCA 4X3JA 2W1IA 1CKIA 4X2GA 3ZSGA 4WNOA 5HQ0A 3V5WA 5D7AA 3V51A 2Y4IB 3LCKA 4PL4A 5DMZA 3G0FA 3O8TA 4JAJA 3JYAA 1P5EA 5J9ZA 3UIXA 4YO6A 1PKGA 2C1AA 4FT5A 4IBMA 5J5SA 5FXQA 2WTKC 1G5SA 1YXUA 2FSMX 3BYUA 5GNKA 1FGKA 4CFMA 1H1RA 4L3JA 3RWQA 2YFXA 4FTTA 4MQ2A 5IMXA 3R2BA 3KVXA 2YERA 3CJFA 4R1VA 3V8SA 3ANQA 3ENHA 2YDKA 5KKRC 4DTBA 4GG7A 2WOTA 3QGYA 1G8SA 5C4LA 5CTPA 3GU5A 4PF4A 4DEEA 4DCAA 4ZTRA 2CGXA 2ZB1A 5CU4A 2PVKA 4Q9SA 3HDMA 4QMZA 2Z8CA 4HGEA 4FEUA 4DLJA 3WIGA 1YI3A 3E8DA 4JVGA 4QTDA 5AUYA 4ZSLA 1CDKA 3Q9ZA 4NCTA 5HNBA 4ZJIA 4F9BA 5FEEA 5L2TA 3KN6A 3R9NA 3HMOA 5E1EA 4FT0A 5EDRA 1YHWA 3E64A 4MNEA 3ZBXA 4ANOA 3C5IA 4IX6A 4WD5A 3SXSA 4DFLA 4HGTA 4BWPA 1UU7A 4M84A 4CGAA 2HZIA 3RWPA 4FYNA 4XOYA 4YSJA 4C4GA 2PUNA 2BDWA 1ZYLA 3HDNA 4EOLA 3HVCA 1ZMWA 3FI4A 3KK9A 4O96A 4AN9A 2W1GA 2UW0A 4L00A 4YTHA 1W7HA 5E8VA 4I5HA 2ZYBA 3ZC5A 4EYMA 4ZTMA 3BYSA 3NX8A 1YXSA 3L8XA 4FE2A 3MI9A 3MWUA 4DT9A 2ONLA 4FKTA 2ZM3A 3LQ8A 4FKGA 4A9RA 5FEQA 5CF8A 4DAWA 3OEZA 4ARKA 5HI2A 2AYPA 3NYOA 3IG7A 1QL6A 4G1WA 3MY0A 4L42A 1A48A 2X8EA 4GVAA 3PPJA 3TCPA 4UMPA 4M13A 5I0BA 3ACJA 3P79A 4BBMA 3FMDA 3I79A 3LFSA 2ITNA 3CGFA 2CKPA 3UODA 3ENMA 3R7IA 2V5QA 2W5BA 3DK7A 4YJOA 3C0GA 3HA6A 2X8IA 4FRFA 3KXHA 4RA5A 4D2PA 4FOCA 3NNWA 1YW2A 3IQ7A 2NO3A 4FIIA 4YJVA 5EI8A 4E8AA 3TKIA 2HWOA 5JMSA 4DG3E 2UW6A 1W2CA 2UV2A 2VWUA 3FBVA 2Y8OA 4O0RA 4RT7A 3PSCA 4ITJA 3V6RA 4HVSA 4TL0A 5IUHA 4FA2A 4NM7A 2XM8A 4IFGA 4BCKA 2JDRA 2DYLA 3AT3A 3R7OA 4QMXA 1BLXA 5AAEA 4LI5A 3OCBA 1H25A 2YDIA 3HZTA 3PXRA 4ZMFA 4KD1A 3NUPA 3ZM9A 2CN5A 3OEFX 5IKWA 2C4GA 2UZBA 3A4OX 3A2CA 3RJCA 2BILB 2FSLX 3GCUA 4KINA 5LWNA 5BUIA 4MBJA 2R3QA 2UZLA 3DZOA 5IQBA 2XK6A 5FG8A 3A7IA 4AQKA 3QU0A 3CPCA 2A19B 3N51A 2J0MB 3D5UA 4XV3A 3EFLA 3FI3A 5E9EA 2OXYA 3L9NA 4QP3A 3QHWA 1OL7A 5IQCA 2YIWA 4YHJA 2VTHA 4L6QA 4E4MA 3VVHA 1YKRA 2O5KA 3MN3A 3COIA 4FSNA 2JKOA 4S33A 5TE0A 4GYIA 4ASEA 4WSYA 1EH4A 4AW1A 2Q83A 2PZPA 3E5AA 4MXZA 1J1BA 2P2IA 2JKMA 3GOPA 5HVJA 1Q8ZA 5ANJA 2VTPA 4FNXA 2Q0BA 4QMPA 3PDTA 3KVWA 2VO0A 3ZYAA 3TNIA 4WG3A 3RPOA 4FEXA 4BB4A 2C5OA 1AGWA 4G6NA 4GU6A 4D2VA 5HTIA 1RDQE 2XZSA 3R30A 2X4ZA 2HCKA 4JIKA 3O96A 3BLHA 3W33A 2RG5A 3LE6A 3SD0A 2ACXA 3QKMA 1IAJA 3FHRA 2G2HA 5BNJA 2H9VA 4AGUA 2VGPA 3EKKA 1GNGA 4FSZA 2W1EA 4NUSA 4JDKA 4DYMA 3D0EA 3L8PA 3TIYA 4ANNA 4C4FA 5JRQA 4QMNA 3QCSA 2YCSA 3V8TA 2X7GA 1Z57A 2YEXA 3CQEA 4RX9A 4OAVB 2CNUA 3VBXA 2IJMA 1U4DA 1JWHA 1STCE 4L3LA 3E93A 3ERKA 3VUGA 1XHAA 4OTRA 2YIQA 1NT2A 1R0EA 3R9OA 4NSTA 3KCFA 3VBYA 3C7QA 3G90X 2YLEA 4C3FA 1V0PA 3DKGA 4XV9A 2ITVA 4YNEA 5LVLA 4FTKA 3ULIA 3CQUA 5I4NA 4J71A 1PXNA 1M7NA 4AXFA 5M55A 2OJ9A 1S9JA 2KTYA 3JUHA 3P5KA 4ZXTA 3QFVA 3FAAA 5L8KA 4RC4A 3FZTA 1WAKA 4QMSA 2J5FA 3GENA 2EWAA 1A06A 2IZRA 5HG7A 3ROCA 4USEA 4ASDA 3AC1A 3LFEA 3MSSA 4KSQA 1Q24A 4YHTA 4G34A 3PPZA 4O7WA 4EKKA 2W0JA 4B6LA 3WI6A 1TKIA 4AAAA 4CTBA 2OG8A 4XP3A 4DEAA 4W9XA 3H3CA 4F64A 1HCLA 4YZCA 2QOBA 4C4EA 3TL8A 3GVUA 4D1SA 1G8JA 4XJ0A 1UNLA 4KB8A 3OXTA 4EQUA 3R02A 1PMVA 4WBBB 4C58A 5E8SA 4YHFA 4PDPA 4BBFA 4CKIA 4NWMA 5DYJA 4IB5A 2QOCA 3WF8A 4JR3A 5F95A 2X4FA 2RKUA 4MXYA 3ORKA 4F63A 1M14A 4UMRA 1SVHA 4NKAA 5AP3A 5B2KA 4LRMA 3ZO2A 2UZEA 2C5VA 4UMUA 5CF6A 1K9AA 4IWQA 5IQIA 2XKFA 3IK3A 4RVTA 1Y91A 4EH4A 1H07A 3BYVA 4D28A 3U9CA 4L45A 3P7CA 3WF5A 1WVYA 3UDSA 2XBAA 5CQUA 4YMJA 2YCRA 3AD5A 3R83A 4G9RA 4H39A 1WBVA 2W9ZB 2FVDA 3BEGA 5FDXA 3KY2A 3D5VA 2V55A 1OKZA 4FZ6A 3ZSIA 2FA2A 3HMNA 1FINA 4EI4A 3R00A 3UDBA 3MFUA 2BRNA 3ZH8A 4BCNA 4LYNA 2QODA 2R3JA 5HORA 4O81A 4O7TA 1Y6BA 5HBEA 5IEXA 4FC0A 3Q52A 3VAPA 5A54A 4R5SA 3QTIA 2PVNA 2H6DA 5L2QA 3TN8A 5AIKA 2WQBA 5EOLA 3OUKA 1ZY5A 2BTRA 2W1ZA 3TDWA 3ZZWA 3IDPA 2BALA 3UO4A 2GCDA 3W0SA 4JG8A 4OT6A 2R2PA 3V5LA 3DZQA 4D4VA 3CEKA 5EI2A 5C8MA 2QI8A 5GZ9A 4I4FA 2C0OA 4X2KA 4D1ZA 2A27A 2VTJA 3AMBA 3GCVA 4ASXA 4D2TA 4LV7A 4DGMA 4U45A 2HENA 3TYKA 4IZYA 2QVSE 2XAOA 3LLAA 2YM4A 4G5JA 4HZSA 1OIRA 1KE9A 4E6AA 3P5JC 4DHFA 1M52A 5B2LA 4OTGA 3CCNA 3H0ZA 5C4KA 3COHA 3POOA 1SVGA 3FI2A 3CSVA 4JX7A 2R7BA 4UXLA 4FKRA 5JRSA 4MH7A 3RK9A 4BIEA 3GC9A 3MPMA 4EH8A 5CXZA 4F9YA 3HP5A 5DR6A 1FBNA 4F7NA 4LQMA 2QU5A 4UWCA 4Z7HA 4G16A 5JN2A 2P0CA 5KBRA 3Q3BA 2WMBA 5K9IA 4Y46A 5M07A 1Q61A 3RNYA 2UW3A 3VS3A 3LCDA 5H3QA 4C57A 3AC2A 4CNHA 3QTSA 4UX9A 3GCSA 3G5DA 2CN8A 1YWVA 4I22A 4YC3A 2OXXA 4ZP5A 4F0FA 4ZJVA 3W8LA 2C68A 3UOHA 5AIRA 4GVJA 5HZNA 2VTNA 1W8CA 4IE9A 2O63A 3PJCA 1Z9XA 4QT1A 3OCSA 4PL5A 2RFSA 4LUEA 5DEWA 4FVPA 5IDNA 5BVWA 5AAFA 1QPDA 1VR2A 4OBQA 4R7BA 2B9HA 3AMAA 2NRYA 4B4LA 5J9YA 1OBDA 1JNKA 3FZOA 3P78A 2ZVAA 2QOHA 4HPTE 3D9VA 3DDPA 2WFYA 4FKLA 5IA4A 1FVTA 4DE4A 4DTAA 4LG4A 3WE4A 4EH3A 3A7JA 5F94A 2F9GA 5EYMA 3F7ZA 3QTZA 4I0RA 1ND4A 2YCFA 5LMBA 3DXPA 4ZSJA 5HO8A 5M51A 4QQ5A 4O6EA 4BCFA 1UU9A 3D15A 2IO6A 2WQOA 3PVWA 1ZYDA 3VO3A 4EOJA 4CLIA 2BVAA 3EQHA 2E2BA 2WQEA 4FTJA 3PE2A 3VBWA 5CAVA 3EB0A 2GNLA 4Q2AA 5IEVA 3OWKA 2IWIA 4YNOA 3KRLA 5EKNA 2OWBA 2PVYA 3OY1A 2XIYA 3O2MA 2RSVA 2WTKB 4Y5HA 1JSTA 2SRCA 4LL5A 1GIHA 3DA6A 4MX9A 4JLCA 3TDVA 2OZOA 2F57A 1MRVA 1ZOGA 3ZEPA 4K6ZA 1R3CA 4O22A 4OR5A 5CS6A 3THBA 2WNTA 4WHZA 4QMVA 1ERKA 1OL1A 4L3PA 3BWJA 4EOOA 3BE9A 5C01A 3ZFXA 5K4IA 2IG7A 4LDTA 4WT6A 1GIJA 2E9UA 4XLVA 3A7HA 3UNZA 3FLSA 4NTTA 3W0PA 2KULA 2C6MA 2BHEA 2Z7LA 3EFWA 5C8NA 1WVXA 2YJSA 3RPRA 3F2NA 4ALVA 3I0QA 1P4FA 2VTTA 2C69A 4PUZA 3PXKA 5IH6A 4GKHA 1KE8A 3LW0A 4H3PA 2WMTA 2W1CA 3BLQA 3E7VA 3E8EA 1BL6A 3GEQA 4FUXA 4G6LA 1WMKA 3SG8A 2P3GX 5GHVA 4FGBA 4U81A 3RNIA 1RJBA 3NSZA 4YGAA 3R7EA 4K0YA 4IADA 4OTFA 5L2IA 4WBOA 3PFYA 5CAOA 1KE7A 4BR3A 4TWOA 3VHKA 3IGOA 3MFRA 5A14A 5HBHA 3F3ZA 3BHUA 1U59A 2OW3A 2VTAA 3QCYA 2QHMA 1LP4A 2IZSA 3NIEA 3ZFYA 4L53A 5KHWA 3C0IA 3VHEA 2EXEA 2PE1A 4O0UA 2C0TA 2GNFA 1LEZA 3QX2A 5I9WA 5BMSA 5BV3A 4O4CA 4KKEA 3HLLA 3MVLA 4FEWA 2BAKA 4UB7A 3HUBA 4TYHB 4EH7A 5CNOA 2OU7A 4J7BA 4J95A 1PXKA 4AZTA 5KMLA 2VN9A 2QQ7A 4W4VA 4XLIA 5H8GA 5ANGA 3FMEA 3UPXA 4FV1A 4AW2A 4DFZE 2HY81 3FLQA 3FSKA 2JFMA 3MTFA 4NU1A 5AR3A 2WTJA 4I5PA 2F7ZE 2JGZA 3IOPA 2OZAB 2UVXA 4P90A 5E8WA 4AX8A 3OCTA 1H1SA 4JG7A 4CMOA 5K0XA 3OP5A 1J7UA 2JKQA 3OF0A 4NJ3A 4YZNA 5L2WA 2FUMA 2JAVA 5HG9A 1PRYA 4IB3A 2VWYA 4WRSA 4B7TA 1IA8A 3VJOA 3OZ6A 4AA5A 5CF4A 5CEKA 3W0MA 2EU9A 4CXAA 3BGZA 3QHRA 4UY9A 1GIIA 3DB6A 2ZFYA 5M08A 2PZRA 3LFBA 4GMYA 4KBCA 3GGFA 3TI1A 5AJQA 5LMKC 1SNUA 5JZJA 4Z3VA 3LMIA 2XALA 1R39A 2XNNA 2C3LA 3QXPA 4AZFA 2JDOA 4HZRA 1KOAA 4ZSAA 4X2JA 5HBJA 4FSTA 4D2WA 3NCGA 4IEBA 4O0VA 2ITYA 2XRUA 4IJ9A 4OUCA 4E20A 4I6LA 3V5PA 3AD6A 5FBNC 4AG8A 5CEPA 1Q8WA 2F7XE 4CTCA 2YLFA 3IW5A 2BFYA 4BDEA 4ZY6A 1OIYA 5JH6A 2O0UA 3QQFA 2JDVA 3UBDA 4IC7A 4DEBA 1IA9A 3HGKA 3FMHA 4N6YA 4JR7A 4EL9A 2V0DA 5JSMA 3BU3A 4J8NA 2YITA 1P14A 3WYXA 2WAJA 4WOVA 3PZHA 2ZJWA 1GAGA 3PSDA 3UVPA 3W1FA 3R7VA 3R1YA 1O6KA 2QNJA 5BVKA 4CV8A 4RA4A 3VIDA 1W84A 2B9FA 2W9FB 2XF0A 3G0EA 3OBJA 4WRGA 5JFSA 5EM8A 3HRBA 5HX8A 4NL0A 3LZBA 2F2CB 3R28A 3ITZA 4I0SA 3TNPC 4DF3A 4BFMA 4DFYA 3AGLA 2V62A 2C3KA 5IQDA 3KMMA 3KRRA 4JXFA 4RWKA 5AR4A 3NVMB 3VF8A 3LFDA 3F3UA 4PV0A 5DR9A 4TYHA 4LMUA 4D5HA 5ITAA 5J8IA 2G2IA 5A4TA 2QR7A 2J0LA 4N0SA 2YHVA 5HIBA 3RAKA 3S3IA 5ETFA 5GIPE 3NAXA 5CXHA 3I6WA 2BZKB 4QPMA 4EK4A 3KN5A 4FZDB 2OZAA 3DKOA 3IS5A 2VX1A 3NY