3BLRA

Crystal structure of human cdk9/cyclint1 in complex with flavopiridol
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
320
structure length
300
Chain Sequence
SVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein kinase 9
publication title The structure of P-TEFb (CDK9/cyclin T1), its complex with flavopiridol and regulation by phosphorylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 86
structure length 300
sequence length 320
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3blrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3blrA01
3UMWA 3ZDUA 4FT7A 3KXGA 4DAWA 1F3MC 3VJNA 4F9CA 4LL5A 5CAVA 3N4UA 4QO9A 2JLDA 3KQ7A 5BVOA 2YCRA 3RCJA 4KNBA 4EOIA 5EYCA 4GT3A 1B39A 4D9UA 3QXPA 4BF2A 2WU6A 5JQ5A 3DOGA 4ALWA 3UC4A 3DKGA 3SAYA 4CGAA 1PMNA 3IPHA 3DNEA 3TT0A 3FC2A 5GINE 3O23A 3ZLYA 3VUKA 2UZOA 4QMXA 4JDIA 3GB2A 3R8ZA 3UO5A 3EFKA 2UVZA 4YJTA 1TVOA 3VHEA 3CQUA 1J1BA 3F5GA 2BRBA 4E1ZA 3TWJA 2QKRA 1YHWA 3ROYA 5EHOA 4IVCA 4NM5A 2JIUA 4P7EA 4UZDA 5CSWA 3V5WA 4OBQA 3KY2A 2WO6A 5JZNA 5E8ZA 3BQRA 2C5XA 3HZTA 4W8EA 4C2WA 2R7IA 2UV2A 5HICA 3C51A 3ZM4A 3I6WA 3H30A 5FM2A 5HX6A 1BI8A 4TWNA 5E9EA 5TT7A 3F66A 5M09A 5C03A 3RZBA 5EQYA 3QQJA 4Z9LA 3MV5A 4PUZA 3BEAA 5I3OA 2HZIA 3NR9A 2X7GA 3W8QA 5AV4A 1PRYA 1M52A 1GJOA 4HVIA 4EKLA 2XB7A 1KE7A 3FDNA 4RJ7A 4RJ3A 2F4JA 3NEWA 4V0GA 1XH9A 1O6YA 2UW6A 3NNXA 2E9VA 4BTKA 4CLJA 2VWBA 3R73A 3WZEA 3Q2JA 4EZ5A 1BI7A 1Q8WA 3FSKA 3SRVA 5ANGA 5EW3A 4FICA 3EKKA 1BYGA 5J95A 5H8EA 3UOLA 2Z02A 2QLUA 2W1FA 4JQEA 3G0EA 4ZSLA 5KMMA 3HECA 5FP6A 4B7TA 4IB3A 3QBNA 2YIWA 3VBWA 2ZM4A 2ITWA 4Y5HA 4BCKA 3G0FA 4QP7A 2VWXA 1PXJA 4AFJA 3PXFA 1JKKA 4U40A 5HX8A 2PE1A 3DCVA 3UOKA 4BDKA 5EYKA 3FI2A 5AA8A 3GBZA 3P0MA 1REKA 3RMFA 4K11A 5CQWA 2XNEA 3ENHA 2PUUA 5CSHA 4C3PA 4YJUA 3PPZA 2BAQA 3E8NA 4TPTA 1PY5A 1YXSA 2O5KA 5BX0A 3LMGA 4J99A 5AAGA 5FQDC 4G2FA 3PIXA 3SG8A 1OKWA 4O0VA 4ZSEA 2R3LA 5B7VA 4DH3A 4JBPA 4UN0C 1H01A 3TJDA 1OBGA 3R7VA 3ODYX 4XX9A 3MN3A 2VTIA 1JSVA 1KE8A 2RSVA 5GJGA 1WFCA 2YM5A 4YZNA 3VWAA 5B0XA 5IQCA 3C4CA 5CYIA 3B2TA 1ZYLA 1FPUA 2P0CA 3KMWA 4DTBA 5E91A 5IQFA 4MNFA 4C38A 2FVDA 3R7GA 3BU3A 3F7ZA 4IC8A 3QL8A 3H9RA 5K0XA 4YHTA 4ERKA 2V62A 4DG0E 4HPUE 4XP2A 4IAYA 4H3PA 4JT3A 5E4HA 4EYMA 3L8PA 4H1JA 1H8FA 3DT1A 2R9SA 2PVHA 4QOXA 4N6ZA 3E93A 2C68A 2YCSA 2W5AA 5AR8A 3OWPA 2A1AB 4ASEA 3C13A 3MBLA 4FVPA 5IDNA 3QQUA 2WTJA 1JPAA 4XG6A 2VTNA 4EL9A 2VX3A 2HELA 3CJFA 3PPJA 4BY9E 1A9UA 4RQKA 5EI6A 4QYEA 4RIWA 4ZTSA 3HNGA 4YSJA 4L8MA 3EH9A 4HZSA 3ZRMA 4ZOGA 4C59A 5A9UA 3PDTA 5BMMA 3ANRA 3MJ1A 3NUPA 1PXIA 4WT6A 3DU8A 5M07A 5D1JA 5E8SA 2C6MA 4K0YA 5A4QA 4AQCA 2PPQA 2QU6A 3HRFA 3RPYA 4O7RA 2UVXA 1J1CA 5AAEA 4Y83A 3ZUVA 1F5QA 4DFNA 3QGWA 1Q61A 4GK4A 4YPSA 3U6HA 4YHJA 2Z7RA 5L6WL 4ANMA 4CNHA 3IW4A 3DDPA 3WYYA 4C36A 4UY9A 5CF4A 1H26A 3NAYA 5L8KA 2EUFB 3PXQA 4GIHA 4E6DA 3GOKA 2QG5A 4C4FA 3WYXA 3GQLA 2BUJA 2RG6A 1Q8TA 3OXTA 5H9BA 5C4KA 5E8YA 3LOKA 3MIAA 2PZ5A 4FV9A 2WTVA 4QMWA 4XP3A 4ZY5A 3W2CA 4D28A 4KD1A 2BPMA 4FC0A 3ERKA 3AGLA 3QUPA 2C3IB 1E1XA 3QYWA 4L53A 4FK3A 4M69B 4TKSA 3VAPA 4BCHA 4FKOA 4KS8A 4Z7HA 4YJOA 4FIHA 4F6SA 5IEYA 3E3PA 3C0HA 4DFBA 2VTRA 2J5FA 4AA5A 5IUHA 3BCEA 3DBQA 2I0YA 3GXLA 3IDCA 3JXWA 4X0MA 3AD5A 3GC7A 3RALA 3TZ9A 4X2KA 4Z7GA 4BKZA 3FV8A 3D7TB 2XKFA 4MHAA 2CGVA 3BGZA 3TN8A 4BDJA 4R7HA 3W2QA 3GEQA 2EXCX 2F57A 4BKJA 1Q8UA 4HCUA 5DNRA 5HTBA 2PUPA 3BHHA 2YABA 5AP0A 5FTOA 5IA5A 3RI1A 4OTWA 4AGCA 4D1ZA 3FBVA 4IH8A 2UZNA 4LL0A 1ERKA 4FMQA 4C61A 5HO8A 3QTXA 1JWHA 4LRMA 3W16A 4F99A 5TOZA 3KC3A 5CF6A 1H25A 2QOLA 4APCA 5D11A 2IVUA 3I4BA 2FSMX 4HNIA 4PDYA 3QCQA 1GIJA 4KB8A 4Y95A 4CT2A 3QCSA 3VHKA 5HIBA 2PVNA 4WNOA 3RTPA 4EK5A 2C0OA 2CCIA 1E1VA 2W17A 3PY3A 4NKAA 5DHJA 1JKTA 1Y8YA 4WSYA 1ZMVA 3DZQA 2C6KA 3GC8A 4X6RA 5L2WA 2YDKA 3TV6A 5LWNA 3LCDA 1ZLTA 4M15A 1J3HA 2VO6A 3KFAA 3LFFA 4XG7A 4AW0A 3RZFA 3FZPA 2WMBA 3EQHA 4WBOA 1PYXA 3A8XA 1OUKA 3NNWA 5HD7A 4LUEA 1GIHA 5C8KA 2FSOX 1OPJA 2YCQA 3ZCLA 5KMIA 4IAIA 5EQPA 2PMIA 3CGFA 4K1BA 1WVWA 2FB8A 5M4UA 2OK1A 2WIHA 3M42A 5KBQA 1IR3A 4XV1A 2VN9A 5I9UA 2WOTA 3UVRA 3ETAA 4JAIA 1TQPA 3MB6A 4O91A 4L43A 4QP2A 4ERWA 1FGKA 4MXZA 4FKSA 4W9WA 2G2IA 3CSVA 1XBAA 5C9CA 4D58A 1Q41A 3E8EA 4IM2A 2ZOQA 4HGSA 4DLJA 4EHGA 2EB3A 4QYYA 2B0QA 1OVEA 1HCLA 1KV1A 2WTCA 1G8AA 3L9NA 3ZSGA 4E6CA 4QMYA 4QMPA 3RINA 3EQDA 3WF7A 4EWHA 2XA4A 3Q96A 4RIYB 2ITZA 2C3LA 2HY0A 4QTCA 5BVEA 3WZJA 4G1WA 4ALVA 2VX0A 4FIJA 1FINA 3OCBA 1OKYA 5LMBA 1NW1A 1VEBA 5C4LA 4NYEA 4G16A 4UWCA 2WB8A 1XR1A 5TE0A 4W4XA 2QHNA 1H4LA 2CGUA 3COHA 4NZWB 5LVOA 3EZVA 5EM7A 4E5WA 3DFAA 3R7OA 4C33A 4DGOA 5EDPA 2XF0A 2EU9A 3ZOSA 4CZUA 5BYZA 3PP1A 2H34A 3Q9YA 4FEQA 2VWWA 4NW6A 3FQEA 4S32A 3OXIA 3PSDA 4FNWA 3NUYA 3C4ZA 2P55A 4CYJA 3MIYA 5HORA 3D7ZA 4EJNA 4U0IA 5DYJA 1CKPA 1QPDA 3ZYAA 4LGHA 2FSTX 4C4EA 4CFFA 1H1PA 3GCSA 1SNXA 3D9VA 4YO6A 3MFRA 2VGOA 4CKIA 3EKNA 4KSQA 5BUJA 2BDWA 3IS5A 5GJFA 3MW1A 5K4IA 1WBVA 4M97A 5C27A 3OS3A 2VTSA 3ET7A 2Z7QA 2UW7A 5K5XA 3JUHA 4CMOA 2VNYA 5JMSA 5GZAA 3DTCA 4J96A 1Q97A 4ZMFA 3H10A 4OW8A 3A7JA 2YFXA 3HMMA 1U54B 5A3XA 4F1OA 4I22A 4YR8A 2SRCA 2WMQA 4IAAA 2R3GA 4FYOA 4I21A 4IFCA 2C3KA 2GS2A 2WGJA 3E7VA 3MH2A 4I41A 2YISA 3DB8A 4IAFA 4IEBA 1ZYCA 4X21A 4ENYA 4W8DA 1PXPA 2G9XA 4QQJA 4E20A 3LHJA 2BRHA 4MBIA 2QQ7A 3D5WA 4MBJA 2WTWA 3QC4A 5DG5A 2GMXA 4KRCA 4BKYA 2FA2A 2OH0E 1PKDA 2PZPA 3MI9A 3KREA 4UYAA 3NRMA 5CLPA 2XZSA 4BDEA 1YKRA 3FLSA 3I7CA 3V51A 3FLNC 5ETCA 5DT4A 3ZXTA 4OUCA 2F9GA 3TNHA 4BDDA 3PTGA 4W4YA 5I0BA 4IX5A 4M69A 4PP7A 1OM1A 4TYJA 3QA0A 4WRGA 4S33A 4DTAA 3ZMMA 3WF8A 5KMOA 2AUHA 3UBDA 4BBEA 1H1QA 2IG7A 3PIYA 2OLCA 1IA9A 3DPKA 4EK4A 3TNWA 5EDRA 2W1ZA 1J7LA 3LXKA 3LLTA 1APME 2EWAA 3VS5A 3LFDA 2GQGA 3PIZA 5GIOE 4GYIA 3P08A 3FHIA 2CDZA 2YWPA 2YZAA 3D7TA 3FY2A 2OXDA 4JG6A 4ORKA 4FTQA 4FTJA 3QD0A 4OTHA 2OIDA 4MXAA 4HVHA 4FTLA 4NUSA 5GZ9A 3FI4A 4L42A 4ZSGA 4E4NA 1BX6A 2JD5A 4BIBA 3UYSA 3P23A 4KABA 4QMSA 3SHEA 3BLQA 4M8TA 2C1AA 4N57A 3V5JA 5CU3A 2IZTA 4CFWA 4YO4A 5AP4A 4BDCA 4BBFA 4CFVA 4FKQA 3F2AA 3NW5A 2YM8A 3D0EA 5FDPA 3DTWA 1PXKA 3RVGA 4D2RA 2RGPA 2UW0A 5HNGA 4XCUA 3OUKA 3BGQA 4AX8A 2W06A 2WXVA 2I0EA 4M12A 4B4LA 3FMHA 3LXLA 1RDQE 4IM0A 4JL9A 3EB0A 5HU9A 4C2VA 4QD6A 2Y0AA 2R0IA 2OJIA 2ESMA 3ZLWA 5DI1A 1WZYA 3NUUA 3OCGA 2NNWB 5HVYA 1ZMUA 4M13A 4WOVA 4GFOA 5K9IA 2E9PA 4JDHA 4DEEA 3R9HA 1KE6A 2QU5A 3QA8A 5HO6A 5KKRC 5L4QA 4A07A 3MWUA 2PE2A 3UE4A 4PDPA 5E8UA 4S31A 3Q4ZA 4ONAA 4KBAA 3LFNA 1YWNA 1CM8A 1T46A 2ETKA 5H8GA 3KU2A 5AP5A 2BDJA 3WZUA 2XJ1A 3MTFA 4EH9A 3F6XA 4RIYA 4BI1A 3ORKA 5C26A 3DQXA 3FLZA 5JGAA 4GT5A 4YHFA 3NIZA 2PK9A 4XG2A 4YC6A 4JRVA 3MA3A 5HE0A 5AUUA 5HNBA 4ZEGA 4C8BA 3A60A 1AGWA 3RM7A 3ZO1A 2XNPA 3F5PA 2ETMA 2OW3A 1YXTA 3HV7A 5IU2A 3ZFYA 2W5HA 1SYKA 2OU7A 3LXNA 3KXHA 3NLBA 4EHVA 2PWLA 4NJDA 3QHRA 4FX3A 4M67A 3GNIB 5CI7A 3KXZA 3DJ5A 1W98A 3PWDA 3LZBA 4XJ0A 1KSWA 3IDBA 3MVMA 4ZP5A 1OIRA 2HAKA 2XK6A 1ZZ2A 5D10A 3SQQA 4HYUA 5FXQA 1KUTA 3FEGA 1UU8A 1V0PA 4LV8A 3VS1A 5CF5A 4KSPA 2W4JA 1PF8A 3L1SA 1PXOA 2GHMA 2QO9A 3AC3A 4IAZA 5J9YA 4YBKA 3C5IA 3V5PA 1XBCA 3II5A 3ULIA 2REIA 3MA6A 1ZRZA 4IMYA 4O2PA 4BR3A 1PMVA 2B52A 3MH1A 3THBA 3TNIA 2IPXA 1U54A 3QZFA 2GDOA 4CMUA 3OBGA 5IKWA 1PXMA 2CPKE 2BZKB 2GHGA 2ZM3A 3C4EA 3QZIA 4O6LA 3PJ1A 1XH4A 3HKOA 4L45A 4AT5A 3NSZA 5J9ZA 2EVAA 3CY2A 1YWVA 2VTOA 3DGKA 1XWSA 3OF0A 4GU6A 3UNJA 3ZDIA 4CG8A 4HCTA 5B2KA 2W1EA 3DAEA 2NRUA 2KTYA 4E26A 4CV9A 3SXRA 4EOQA 3BX5A 4L52A 3UODA 3FMDA 4AG8A 4D2VA 2VGPA 5M51A 4XH6A 1DM2A 2VTTA 3TJCA 5HKMA 2XS0A 1O6KA 4Z3VA 3PXZA 3ZHPC 5FXRA 4EH8A 1NY3A 2BVAA 2CNVA 2XYNA 5A4EA 1H1SA 4L3LA 5CVGA 3COKA 5EK7A 4H36A 2ERKA 3IDPA 4FEXA 4II5A 5EM5A 1H0VA 4N70A 3HMIA 2H96A 1OUYA 1Y91A 4MH7A 2R3QA 5DA3A 1ZY5A 4QPSA 3MGYA 3W2RA 4UMQA 4A9TA 3FL4A 4G6NA 2UZDA 1YWRA 4JX7A 2W9ZB 1IAHA 3WE4A 2ZV8A 3ACKA 4F0FA 5EW8A 4H3BA 4GVAA 5CXZA 4U7ZA 3FWQA 1MQ4A 2Q0NA 1NXKA 2O0UA 2YLFA 3O7LD 3FMKA 4XRLA 4OTDA 1YHVA 2F2CB 5HIDA 3PUPA 5BQ0A 3WF9A 3PYYA 2WAJA 3TV7A 2XK4A 4ZAUA 4XV2A 4YJNA 2Y7JA 4CTCA 1P4OA 1R0EA 3HDNA 5F1ZA 4HW7A 2QD9A 4GT4A 1B6CB 4P2KA 1YW2A 4FODA 4F1MA 2FUMA 4PTCA 5HCZA 5E8XA 2R3HA 5EHLA 4EK6A 4E4MA 5EKNA 4TYIA 5IMXA 4AF3A 5CSXA 2NPQA 3R7IA 1U46A 4V05A 3DLZA 5BPYA 1YDRE 3FZTA 4NM0A 4BDGA 5ICPA 3QUEA 4K6ZA 5FTQA 3V01A 4IX6A 3ZLXA 5M06A 3ZM9A 3AD4A 3BYVA 3G5DA 3U9NA 3UVPA 3QU0A 4FTAA 2OZAB 3PZEA 2C6LA 2QNJA 4IVAA 4K77A 4PPCA 1BLXA 3PP0A 4JQ8A 4NT4A 1BL6A 5KMLA 2X4FA 4NM3A 1FVRA 4PMMA 1UV5A 2PVRA 5LVPA 3HUCA 3R71A 3NWWA 1PJKA 5AM7A 4L3JA 5FTGA 3EQPA 4U8ZA 3D5XA 4YC3A 1NVRA 1WVXA 2X7FA 1XH7A 5EYMA 3MS9A 3ZUTA 4BHZA 3SA0A 1R78A 2R3MA 3D2KA 4N4SA 4P4CA 4KUJA 3KRRA 3ENMA 4EONA 3E7OA 4D4SA 4M3QA 1Z57A 4HJOA 1URWA 3I6UA 4U6RA 5EOBA 2HW7A 5DRDA 4IJ9A 2VWZA 4FEWA 4A4OA 2WMRA 2CKPA 4IWQA 1PW2A 3QZGA 4F9BA 3T9IA 4PV0A 5E1EA 2WMTA 3U4WA 3UNZA 2PUIA 3T8OA 2X39A 3RPVA 4AZFA 4GH2A 5DMZA 3ZH8A 3KVXA 4NJ3A 2ZM1A 3CPCA 5EW9A 2GPHA 4DEDA 3OEZA 2R3JA 5LMKC 3QAME 4CT1A 4FSZA 4CFNA 2Z7SA 4XG9A 1MRVA 2W4OA 4C57A 5LQFA 4BTMA 4Y8DA 3F61A 2ZJWA 3R9OA 4NIFB 1RJBA 1W82A 1Y6BA 4HGEA 1IA8A 3VBXA 4YMJA 4X3FC 4DC2A 5I5ZA 2B4SB 5JH6A 3HVCA 3VF8A 3V6RA 3KXXA 3R21A 4WSQA 3RHXA 1Q8ZA 2JKKA 4I6FA 5CQUA 3TI1A 3HL7A 2VO7A 5IQBA 5K0KA 3L9MA 4WG5A 3G2FA 3BE9A 2Z60A 2VUWA 4YJRA 2ZV9A 3TNPC 4M0ZA 2GNFA 3NX8A 4RLLA 2C3JA 3L8XA 4DFUA 1ATPE 4FL2A 3HYHA 3JVRA 4R3CA 3EYGA 1SNUA 2QODA 1PMUA 3CD3A 3O2MA 1OECA 3L9PA 1ZOEA 3IO7A 3RNIA 5CSVA 5F4NA 3TV4A 3MTLA 5A14A 4E4XA 1PHKA 4RRVA 1V0BA 3C4WA 3UQFA 3P79A 4YJPA 4G31A 4LGDA 1H24A 4EUTA 3FY0A 4F9WA 4BDHA 2H6DA 4D2WA 4PPAA 2JDTA 3WILA 5CS6A 5FD2A 1DI9A 2GCDA 4O1OA 4RFMA 4R7BA 4DN5A 4IVBA 1H0WA 2UUEA 5A4LA 2QLQA 2X9FA 3LCSA 5TKDA 4B8MA 4EORA 2IJMA 4FL1A 3WF6A 4H05A 4GK3A 2J4ZA 3POOA 1OBDA 2YHVA 2GNJA 2LGCA 2XNOA 2JDSA 3GP0A 4O7YA 3R00A 4XLVA 4O0RA 4L3PA 3IGGA 5CTPA 3DXNA 3NAXA 4MK0A 4CQEA 4TRLA 4ASDA 3K3IA 2B54A 1ZXEA 3MPAA 2BHHA 4YPDA 5DEYA 5HE3A 5M53A 3H4JA 3LMIA 5KHXA 3BWJA 4I23A 4GMYA 5L2TA 4ZTLA 1OB3A 2XBAA 3BEGA 3MPTA 4FNYA 3ATSA 3K2LA 4U9AA 4BZOA 1YOMA 3KRXA 4FKLA 3BZ3A 1XH8A 4KIOA 2XIRA 4LM5A 3CBLA 3FYKX 3E88A 4XLIA 4YNOA 4JNWA 5AUWA 3R9DA 4AFEA 5LCKA 5CAPA 5KUPA 4WHZA 4RJ8A 4F0GA 1XBBA 3EFWA 3UG2A 4JAJA 4QP4A 4G3DA 4RWKA 5DH3A 3W18A 3WBLA 3ZZEA 4FTKA 4UXLA 4EEVA 1BKXA 3OWKA 5EG3A 4BCIA 1SVGA 3Q2MA 4RJ6A 5DIAA 4AOIA 5AP1A 4ZZMA 3VIDA 4D0WA 4ZSJA 3LQ3A 3GU4A 1XO2B 4OTQA 2J7TA 3CR0A 3DK3A 1P4FA 3RAKA 2JITA 4K9YA 3CE3A 2Y4IB 2ONLA 3MY5A 4EQMA 3TKIA 5M57A 2FSLX 2DQ7X 3QYZA 4IIRA 2J0JA 2YM4A 1Q99A 3I7BA 3MH0A 1GZNA 3FL5A 3MVHA 4FVRA 3HA8A 4RQVA 4Y85A 3RM6A 4EOOA 5HVKA 2IW9A 2JKMA 2ZMDA 3NIEA 5I9WA 2OZAA 3HV4A 1KV2A 3OBJA 4I5CA 4OT5A 3VUMA 4DEHA 5HO7A 3AT3A 3U4UA 4FIEA 4CCUA 3NYVA 4FKPA 5JN2A 5AUZA 4F7LA 5AV3A 3SW7A 3VQUA 2WZJA 4G9CA 3BU5A 3DBEA 2IW6A 3ZZWA 4QQTA 3BELA 3B8RA 1B38A 4C3FA 5DE2A 4NWMA 3QUDA 3PJCA 3TKHA 5KZ0A 5IDPA 4WD5A 2FGIA 3BE2A 3RK7A 3AC5A 3CIKA 3D5VA 5M08A 3AC2A 4F9AA 1R39A 4JJRA 4JX3A 5HE1A 2UW8A 3R83A 1NVQA 4YTHA 4ITIA 3OZ6A 3F5UA 4R3PA 5ETAA 4MAOA 5CU0A 3A7FA 2XVDA 2XKEA 3VRYA 2WHBA 3BHUA 2XM8A 2JDRA 4MXCA 4AA4A 3S3IA 3K5UA 2B7AA 1YDTE 1H27A 1UNLA 3NW7A 3O17A 4X2GA 5FEQA 4PL5A 1HCKA 3KF4A 3HV6A 3ZU7A 2BTSA 5D9HA 2BZJA 2HY81 4J8NA 5EM8A 4FOBA 4P5QA 2PSQA 3A4OX 1ZWSA 2I40A 2ACXA 4TN6A 5DFPA 1UVRA 3KRWA 5CEPA 5L6PA 4CG9A 4FTTA 1OPKA 1JLUE 2PVMA 3EN7A 4XOYA 3LQ5A 3OT3A 3PPKA 2QOHA 3OT8A 5AAFA 4NIFA 5E1SA 3NVMB 3OC1A 3TZ8A 3KCKA 1DAYA 3BI6A 3W2PA 4OAUC 1EH4A 4FSWA 4C3RA 2NP8A 5K5NA 3HV3A 4O7WA 3OG7A 3LFSA 2QONA 3QQKA 2WD1A 3W2OA 4MQ2A 3LJ0A 4G34A 4KBKA 2ITPA 2RFNA 4ZTMA 1URCA 1R1WA 1FGIA 1H07A 2XCKA 1OPLA 3BIZA 3I79A 4PDOA 3MSSA 4FUYA 3BRBA 2YA9A 3ID6C 3V04A 4O0XA 4TY1A 3W1FA 1TQMA 4FKRA 4U79A 5DN3A 3OTVA 3AMAA 3GCVA 3P1AA 2PVLA 1FBNA 2E2BA 2WNTA 4ITHA 2G2FA 4AZVA 3EL8A 3K5VA 2HW6A 4KRDA 5HNIX 4A9RA 2RFSA 5FUTA 1LEWA 3C5UA 3EN4A 2BAJA 2YM6A 2Z8CA 3SOCA 3A99A 2HXLA 4U3ZA 3GCUA 2OWBA 4PL4A 4J52A 4XHKB 3VULA 5JFSA 4D1XA 3S0OA 4MXXA 4R78A 4QP6A 3EFJA 4PWNA 5KMNA 2R4BA 4QP1A 5HHWA 1G8SA 4ACGA 4RFZA 5F94A 3F2RA 1WBSA 2VAGA 4QMMA 5ANIA 4FNXA 4GU9A 2I1MA 4J7BA 3PXKA 4CRSA 4IZ5A 3GU7A 3S1HA 1LP4A 3PA3A 5AIRA 2C5OA 4BBMA 4F7SA 3C50A 3FUPA 2XIXA 2GU8A 4DG2E 2BKKA 2F7XE 3HV5A 2VTQA 2FH9A 3O50A 5HI2A 5CF8A 4MYGA 2O64A 1JOWB 1ZOHA 2RF9A 3HX4A 5FBOA 3EQGA 1Q3WA 3W2SA 3U6IA 4I5PA 1U5QA 2GFCA 4LQMA 3NYOA 3O0GA 4FSTA 1PKGA 3UIMA 3ZRLA 4D1SA 5CAOA 4QPMA 4TYHB 3ALOA 5J5SA 2E9NA 3GC0A 2WEIA 3W8LA 1AQ1A 5EYDA 1SVHA 4USEA 5GHVA 4FZAB 1ZAOA 4JDJA 5FBNC 2XEZA 2PY3A 2UZBA 3D5UA 2QR8A 4G3EA 4FSYA 2QVSE 4UMPA 2PVYA 4FEUA 2C0TA 4OR5A 4PNIA 2A19B 4QQCA 4BVUA 5KBRA 2PL0A 3QCYA 5CVFA 1XHAA 4L01A 4C34A 3A8WA 1PXNA 5DGZA 4D0XA 3UP2A 2XM9A 4JXFA 3UC3A 5HBJA 1QMZA 3NUNA 4G17A 2GS7A 2I6LA 1O6LA 2GSFA 3U51A 2X6EA 2ETRA 3KB7A 4HYIA 1XH5A 3HGKA 3MY0A 4FSUA 5JK3A 5J1VA 2R5TA 5CZIA 2G01A 3FKNA 4CRLA 2PUNA 2PVFA 2X6DA 5CNOA 5J9LA 4R5SA 2F7ZE 1JVPP 4NFMA 4MXYA 2QOBA 4OTPA 4QTEA 5B2LA 1YI4A 3F7WA 1UU9A 2HIWA 3C4FA 3LFAA 4LRJA 3ATTA 1RW8A 3QGYA 2BZHB 3O8TA 1KOAA 4O38A 2XRWA 4CMTA 4MD8E 3UNKA 5LVNA 4EOJA 2V0DA 3PA4A 5HZNA 4B99A 2EB2A 3OW4A 4FT0A 4F63A 5JZJA 4EHZA 2C69A 4L9IA 3R1SA 4HNFA 5IF1A 1GZKA 3QRJA 3QKMA 2XNGA 2UW3A 4TNBA 3R7UA 3UGCA 1UKHA 1QCFA 4R1YA 4OTFA 4KKEA 3VW6A 2BAKA 4AXAA 4IBMA 3ZSIA 2GNLA 4YSMA 3A62A 2X2KA 1YRPA 2PHKA 4QQ5A 2GFSA 2DUVA 3NNUA 4QNYA 4RC4A 3PRFA 2ITOA 3P4KA 5CXHA 1UU7A 3V8SA 2WKMA 1ZYJA 4MQ1A 2C5YA 5HESA 3DQWA 1SM2A 3E63A 3FXWA 4DH5A 4YBJA 3V6SA 3EYHA 5H2UA 3RK5A 4EWQA 5KCVA 2VZ6A 4ZLOA 4LOPA 3ZO3A 4AZSA 3UOHA 3LM5A 3UVQA 4IZYA 2UZEA 2BRGA 4IZ7A 4E3CA 2QURA 3F5XA 2Z7LA 4DFXE 3VW8A 2ZDUA 4FF8A 4TL0A 4YZ9A 4FTCA 3RAHA 5J79A 3MFUA 3GVUA 2W0JA 3MDYA 3HMOA 3MPMA 3N51A 4JIKA 4EHEA 2GNGA 3R2YA 3HAVA 2HWOA 3UZRA 4ZIMA 3KRLA 2QR7A 4GKHA 1FVTA 5HLWA 1P5EA 3F3VA 5CU6A 4L00A 5FM3A 3GU6A 3H9FA 1IAJA 1CSNA 4RPVA 5AX9A 4YP8A 4LYNA 4EK3A 4FV5A 1ZY4A 2RIOA 1IASA 2XYUA 4U43A 2X2MA 3UPZA 4X3JA 3G6HA 4MVFA 4CFMA 3R6XA 3QCXA 4JLCA 2C47A 3HDMA 2F7EE 2J50A 1G3NA 3FKOA 4BTFA 5A4TA 3QRTA 5LARA 4D2TA 3CY3A 1OIYA 5IQHA 2OBJA 4RT7A 4B6LA 5IPJA 5T68A 3KA0A 3W10A 1A48A 4XYFA 3FMLA 4DT8A 1I09A 3VQHA 4UMTA 4D4YA 4GJ3A 2O2UA 3AC1A 4F0IA 4LFIA 1OL5A 5IA3A 3GFWA 4I93A 3EOCA 3KEXA 3AC4A 4F1TA 2WQMA 2O65A 4QMNA 5J7BA 4C02A 5IA0A 3DXPA 2O63A 3R8VA 3EJ1A 2W7XA 3EN9A 1YOLA 5M44A 2Q0BA 4B0GA 4X3FB 3OHTA 1W84A 3OCSA 4HYSA 4CZYB 3I60A 2IN6A 3Q53A 4QMOA 3QWKA 4WUAA 3LE6A 3VN9A 2YM3A 2YM7A 5AP2A 2G15A 3GGFA 5GZ8A 3F88A 3FMMA 5CASA 4TXCA 4JBOA 3E8DA 4GV1A 2AYPA 3BYMA 3OOGA 5DR6A 5FG8A 3ORTA 3BLHA 3QKKA 4PMTA 4UALA 5AM6A 3LM0A 1REJA 4TYHA 1GAGA 3F3TA 3ZSHA 2WU7A 4XP0A 2CN8A 2J9MA 3UO6A 3RAWA 3BU6A 4QTDA 1F0QA 5HLPA 3PG3A 5E92A 4DEAA 2KULA 1Q3DA 3BYOA 5EI8A 4FL3A 4NCTA 4I20A 4IWOA 4DGGA 3CP9A 3R30A 5JFWA 5BUEA 4FK6A 2RL5A 4PDSA 5M55A 4I5HA 3TTIA 2J51A 2GNIA 3QRUA 5IQEA 5IEVA 1J91A 5AUXA 3DJ7A 4D4RA 2FYSA 3CCNA 4UYNA 4LMUA 4LOQA 2OJGA 3TIYA 4AP7A 2OIBA 4QP8A 3QTUA 4OBPA 4A9SA 4CLIA 5JRQA 2OKRA 2VO3A 2HZ0A 1YDSE 1SZMA 2BZIB 1X8BA 4BGHA 2PE0A 2QOOA 5KMKA 4DTKA 1M14A 4X2NA 1XKKA 3V5QA 2CKOA 5FEEA 2PZRA 4FV7A 4OTRA 4EJ7A 2R3KA 3NCGA 4C4HA 2I7QA 1ZMWA 5IQIA 4J97A 1MRUA 3EFLA 3CTHA 4RC2A 3LFEA 3QWJA 5K4JA 4HVSA 3PE1A 4E7WA 5BVNA 5CAUA 3LVPA 1SMHA 2J5EA 2UW4A 3AG9A 4KKHA 2BDFA 4RX5A 4CZTA 4USDA 5L2IA 2OI4X 2ZV7A 3DBCA 3PFQA 2C1BA 2CMWA 1MQBA 2JDVA 1UNGA 4QT1A 3DBFA 4FBXA 2BKZA 4IX3A 3FI8A 4MWIA 4YTFA 2I0HA 3OW3A 3QTRA 5AX3A 1Q62A 4K2RA 3QALE 4CTBA 3SXFA 2VTLA 3EHAA 3CD8A 4J53A 3FQSA 3DJ6A 5LWMA 4GUEA 2WFYA 2QC6A 4GCJA 3IQ7A 4KWPA 3TUCA 4RC3A 4V04A 3FZSA 3K3JA 3PVUA 3QTWA 4F7NA 4USFA 4YU2A 4RIOA 4EH6A 2CLQA 4FNZA 2ZB1A 4MCVA 3UQCA 2W1DA 4EH7A 3UTOA 4FTMA 5AUVA 3R8UA 5I9ZA 4EBVA 4O81A 3R04A 4FV1A 4G3FA 4MEDA 2WTKC 4GG5A 2C6IA 2XH5A 5DWRA 1G5SA 3LFQA 4DGNA 1S9IA 3SC1A 1P14A 4QMUA 1WBWA 4D2PA 4ZLYA 3R2BA 5CZHA 2XIKA 2XRUA 1JBPE 4PNKA 2C5NA 3C9WA 5CANA 4RX9A 2IZRA 2QKWB 2UZLA 4FKGA 4K8AA 4U42A 3QQGA 4BDIA 3OD6X 4ANBA 4BIEA 2QO2A 4C0TA 3QLGA 4YNEA 4IHPA 2J0KA 4I94A 5EOLA 4CXAA 4L7FA 1STCE 3I81A 4FTRA 4ZZOA 4FSNA 4GK2A 2AC5A 4W4WA 3POZA 4HGLA 2OH4A 3KF7A 4DEIA 4FA2A 4NSTA 5F9EA 4O6EA 5AR7A 1KE5A 4EK8A 3C0IA 4GJ2A 2X8IA 4A4LA 3OMVA 1UA2A 4BFMA 4BDBA 1YXVA 5KZIA 1DS5A 3UZTA 5JKGA 4RMZA 3CTQA 4LUDA 4ZTRA 4OTGA 3PSCA 3QTZA 4YJSA 5DR2A 5M4CA 2R3PA 4S2ZA 2JFMA 4XOZA 2HOGA 3HA6A 4ZTNA 3SRVB 3CKWA 2VWUA 3SXSA 1IEPA 2H9VA 3NUSA 4XG4A 4QMQA 1ZZLA 3Q32A 4N6YA 4D9TA 2OICA 5I3RA 3ZEPA 3QF9A 4WG3A 2OF4A 3ODZX 4XBRA 3OCTA 2BRMA 4RGJA 4O0WA 3RAIA 4DF3A 4FV8A 4LV5A 3NMUF 4BYIA 1U5RA 3DZOA 4N0SA 5TR6A 4M84A 4JIAA 4U80A 4YTIA 1JKLA 2BILB 2YJRA 2ZV2A 3LAUA 4DEBA 1YI6A 2XK3A 3HP2A 3NVKI 2E9UA 4JOAA 4FT3A 2B9HA 3NZ0A 5FEDA 5BUIA 3G15A 3H0ZA 4GRBA 3S4QA 5JSMA 4U81A 3P86A 4U97A 4L46A 5BYYA 4CVAA 2HWPA 2RG5A 3FZRA 3ORZA 4RVTA 2GHLA 1L8TA 3VBTA 3I5ZA 3PY0A 1UWHA 5CU2A 4FZ7A 4PMSA 4ASXA 4FIFA 4U45A 4ACHA 4F4PA 3EZRA 3P78A 2JEDA 2JAVA 3DNDA 5M56A 4LG4A 5F95A 4WO5A 2BTRA 3HRCA 5DOSA 3VBYA 1K2PA 5E8TA 2EXMA 4X6QC 3P7BA 3PJ3A 4FKWA 4MXOA 2JC6A 4HOKA 4NU1A 1PYEA 4RIXB 4ZTQA 4I6QA 4ZSAA 4I0RA 3BBWA 5T6KA 1QPEA 2ITVA 4C4GA 1M2RA 1ZYDA 1LR4A 2Y6OA 3D94A 3TNQB 5I9YA 2R7BA 4FTNA 4HVGA 3ZTXA 3ITZA 4EI4A 4Q2AA 4DFYA 5DBXA 4EOLA 2YIYA 5AFVA 3TDVA 3PJ2A 4W9XA 2PVJA 4FYNA 4BHNA 2XCHA 3GCPA 1OI9A 5BVKA 2VWYA 4O2ZA 3F9NA 3A7IA 4GEOA 4AZTA 3OWLA 5JRSA 2Y4PA 2YDJA 2IVSA 1OKZA 4FTOA 4GUBA 5AJQA 1CMKE 1PMEA 4CKJA 4EZ3A 3UDBA 4ACMA 1FVVA 4ACDA 5H8BA 3LJ2A 3TM0A 4GS6A 4QMLA 2DYLA 2OG8A 2P2IA 3L8VA 5BYLA 1W83A 3CPBA 3ELJA 2WOUA 5DR9A 5EM6A 3ORXA 4ZJVA 2ITNA 2W4KA 2QOCA 2GTMA 3AOXA 3QD2B 3R1YA 4G6OA 2WEVA 2YIXA 4CFUA 4P5ZA 4WNMA 4D5HA 2W96B 1SVEA 4IXPA 3TL8A 5CI6A 4WRSA 2W9FB 2V7AA 1YQJA 5AR3A 3IOPA 4FIGA 1WMKA 2W05A 3M2WA 5KX8A 4OAVB 3ZBXA 4DLIA 2I0VA 4J95A 4TNDA 4KBCA 5FLFA 3O8UA 3Q9XA 3ZLSA 4BYJA 4IACA 3DY7A 3K54A 2WQBA 1KE9A 3D83A 4RFYA 2OFVA 2JDOA 2NRYA 3BYSA 3H0YA 2IVTA 4J98A 3VNTA 5L8LA 3DXQA 2VRXA 4IB5A 4JR7A 2PULA 2V5QA 2OFUA 1V0OA 2PZIA 2P33A 4GSBA 4JBQA 3IW8A 2QOFA 2BCJA 4X2FA 5DRBA 4ZJJA 5L3AA 4NKSA 4PTGA 1K3AA 5L2QA 3MVLA 4X2JA 3R28A 1Q4LA 4QMVA 4AW1A 2OZOA 3CKXA 3OWJA 4WG4A 1VZOA 2CLXA 5BVFA 3P5KA 3DLSA 3KN6A 2OXXA 4NTTA 5G6VA 5FP5A 3VUDA 2XKDA 4QP3A 1RQQA 4BWKA 4Y46A 5HCYA 2OGVA 1JSUA 2W99B 4AAAA 1WBNA 4PQNA 1BL7A 4X7QA 3KN5A 4Y73A 4IDTA 3ZONA 4BC6A 4M0YA 2W1HA 4GFMA 5ANEA 2XEYA 5HIEA 3FYJX 3LXPA 3SG9A 3QHWA 2CJMA 2XK8A 3JYAA 4EH2A 3EQCA 4UZHA 4AA0A 3UG1A 4YLLA 2X7OA 4CEGA 5IUGA 5L2SA 4O27B 4BB4A 4IFGA 3A4PA 1A06A 4FUXA 1M17A 4UMRA 1ZOGA 4MX9A 3BV2A 3EQBA 2BMCA 4V01A 3VS0A 2C6EA 3BYUA 3EQIA 3OOMA 3ZO4A 3LCKA 5I9XA 5J7HA 4I3ZA 4KS7A 4YUQA 3DKCA 1E9HA 3OROA 5ACKA 2JFLA 4BCFA 2BRNA 1MRYA 2XBJA 3OEFX 4IE9A 4XRJA 4DH1A 4O0YA 3D2IA 2UZTA 4CCBA 2QOKA 5LXMA 4BCJA 3BV3A 2DS1A 2WTIA 3EL7A 4FKIA 3KCFA 4AN3A 1W0XC 3VS2A 2WPAA 4GYGA 2P3GX 2X8DA 2H8HA 3Q4CA 5CVHA 3PG1A 3VRZA 3H9OA 4MF1A 4LOOA 4AW2A 1CKJA 3Q9WA 4IW0A 5JT2A 3SGCA 3RP9A 4U3YA 5CEQA 3U54A 4L44A 5IMEA 5KE0A 3GU8A 1H1RA 5IH5A 3V5TA 4DGMA 4FKJA 5D7AA 3PVWA 1GY3A 4F9YA 4MD7E 4U44A 4IX4A 2VTMA 4AGWA 1P2AA 3FC1X 3MYGA 5CT7A 2PTKA 4J8MA 3W32A 4ZJIA 3FJQE 3CEKA 3T3VA 3ZFMA 3U9CA 4MKCA 5LVMA 5I9VA 3N4TA 4PX6A 3ULZA 3OP5A 2JGZA 2B1PA 2CN5A 3LMHA 5AWMA 4EOPA 4C35A 5A46A 3QQLA 3LKMA 3CS9A 2C5VA 2VD5A 3IOKA 2J0IA 4FT9A 4G5JA 3MY1A 4M68A 4LGGA 4R7IA 5DLSA 3NGAA 3TZMA 5IISA 3VUGA 3QD4A 3WZKA 4DH7A 4E8AA 5F20A 4BCNA 5I4NA 4RIXA 3UJGA 2G1TA 4FV3A 2XJ0A 4ANLA 2UVYA 3P9JA 4PTEA 3TEIA 3OVVA 1UWJA 3EWHA 4E5AX 4FG8A 3SKCA 5A6NA 2YERA 3JY0A 5BVWA 1XJDA 2PZYA 2VV9A 3FHRA 4HCVA 3QZHA 3RNYA 4RX8A 3S95A 3V8WA 3KULB 4BDFA 5AV1A 3Q60A 5ITAA 2ERZE 4C37A 2J90A 1VR2A 4C4IA 3IECA 3NS9A 5C01A 4DYMA 4R77A 5IEXA 5L6OA 4OBOA 2OSCA 5AMNA 3QFVA 4EQUA 4WNPA 3DDQA 3VS3A 4ENXA 3DB6A 4PMPA 3A2CA 3DAKA 3UQGA 4Z16A 2OO8X 4FV6A 2WMXA 1YI3A 4I92A 4O83A 1RE8A 4IAKA 3VS7A 5LOHA 2J2IB 5L8JA 4I0TA 4ITJA 3SD0A 1ZYSA 2CNQA 2OJJA 4MNEB 4O7TA 2XK9A 5ANDA 4BCOA 3KMUA 2V7OA 2YLEA 4C4JA 5EKOA 4KIQA 4ARKA 4YZMA 5E7RA 3R1NA 4JQ7A 1GOLA 3FSFA 4D2SA 3QTSA 3R8LA 4BCMA 5LJJA 3EIDA 5E8VA 3F3UA 4JVGA 2LAVA 2OXYA 2BFYA 1H28A 2WMUA 3RPOA 2B9JA 2O8YA 4DHFA 1YXXA 4FG7A 4AGUA 2Q83A 4QRCA 1R3CA 4L68A 3WIKA 5T3QA 4BCQA 3F82A 3CLYA 4J71A 5KKRB 4DA5A 1OL6A 3AGMA 3BWFA 3O51A 1U4DA 4IJPA 4DT9A 4O0SA 4AT3A 4I6HA 2W5BA 4AN2A 3DA6A 5D41A 1XH6A 3R01A 4LRKA 4EH5A 5CSPA 4YGAA 2YAKA 3MB7A 3WZDA 2YACA 2JKQA 2RKUA 3G6GA 2BR1A 4AUAA 4D55A 5AADA 1IG1A 4EH4A 4TWPA 3R7EA 3AMYA 4TW9A 4NTSA 2OIQA 3I1AA 2ONLC 2NO3A 4RA4A 5HOAA 2QCSA 4IZAA 4RVLA 3NUXA 4ZS4A 4GG7A 5KHWA 1QPCA 3WIGA 5HLNA 5J8IA 3OFMA 5AEPA 2W1IA 5ETIA 5CNNA 2JKOA 3DBDA 1WAKA 2ZB0A 4O21A 3VS6A 2UW5A 3PXYA 4H1MA 3C7QA 4IWPA 4MWHA 3A7HA 1JQHA 3BKBA 4RG0A 3U6JA 1BUHA 3HUBA 3ORNA 4F6UA 4AT4A 4FZFB 4EC8A 2VWVA 2C6TA 2B9FA 1OGUA 1OZ1A 3EN5A 4BI0A 4ASZA 2CKQA 3BHTA 1MUOA 3SX9A 3LW0A 4LI5A 4BCGA 5GJDA 2YJSA 1Z9XA 2QOQA 3S2PA 4BI2A 5DPVA 3JR1A 4F08A 4DCEA 1Z5MA 4BGGA 2VTAA 4QYGA 4IWDA 3FPQA 4KINA 4O7LA 2VTHA 3C4XA 3PA5A 3FMEA 3P7CA 3FMNA 2YAAA 4ZY6A 3FZ1A 3LPBA 3DKOA 4IB0A 3DS6A 2BIYA 1JKSA 3G90X 4HPTE 4S30A 2E9OA 2ITUA 3BHYA 2C6OA 1OIQA 5J5TA 3FMJA 3OY3A 3KKVA 3R7YA 3W55A 4DFZE 2C4GA 3ZFXA 4YJVA 5FGKA 2IZSA 3S00A 4UXQA 5EH0A 3KVWA 4IQ6A 1ND4A 3FKLA 2ZDTA 1BMKA 4TT7A 3FXXA 3RWQA 3NYNA 2ZMCA 4O96A 2VO0A 5HVJA 4G6LA 3LCOA 2XNMA 2WTKB 1UKIA 4NFNA 2V55A 2C30A 3VJOA 2YCFA 2X1NA 3ACJA 4A9UA 4F64A 2IWIA 2R64A 4IC7A 4O7ZA 4HZRA 2VTPA 3P7AA 3E3BX 2QI8A 1JAMA 2WQEA 4DBXA 3L9LA 1OMWA 2RFEA 1IRKA 5H3QA 1H1WA 4P90A 5C8NA 4QMTA 2QO7A 3KMMA 4UBAA 5IA2A 3JS2A 4IADA 3UYTA 1W8CA 3O7LB 4XNEA 3VS4A 2W1GA 3B2WA 3PVGA 5IQDA 2DWBA 4Y5QA 3DKFA 1WVYA 3VVHA 5CEOA 2FO0A 2XJ2A 3CC6A 4O22A 3DAJA 3N4VA 4DCAA 5DT3A 2HXQA 3QKLA 5AR2A 4JRNA 3O8PA 4CV8A 2PYWA 4C58A 1OL7A 3L8SA 4Q9ZA 2R3IA 4LMNA 3FLYA 3KULA 4MD9E 5CU4A 2Y9QA 1U59A 4YZDA 1LUFA 2C6DA 4IDVA 3I0QA 4QPAA 3F3WA 4AU8A 3IKAA 4I6BA 5JFVA 4FGRA 2JBOA 3ORLA 3Q3BA 1OL1A 4FTUA 4FZ6A 4PF4A 4UV0A 4M14A 4R8QA 2WMVA 1DAWA 4BZNA 3M1SA 3E8CA 4FOCA 5AV2A 1AD5A 4FKUA 4O7VA 4G3GA 4RWJA 4M66A 2BHEA 4U41A 3RK9A 3AXWA 2JAMA 4R5YA 5HG9A 4FKVA 5TF9A 4I0SA 4UEUA 3ZBFA 3V8TA 5HU3A 4O7NA 3BHVA 3E92A 4O7SA 4FI1A 5HG8A 1NA7A 3GQIA 3R02A 5DT0A 3NNVA 2F49A 4F09A 4RWIA 2WMSA 4CD0A 2IZUA 5FRIA 4FEVA 3U55A 5HD4A 1VJYA 3SV0A 4MNEA 2UZUE 4W4VA 4EC9A 2R3RA 3DK7A 4DH8A 4FKTA 3VUTA 5KO1A 3O96A 4FIIA 4DGLC 1GNGA 1UNHA 3WI6A 3HLLA 2CCHA 3TDWA 4A9YA 3N9XA 1PXLA 4BZDA 4CKRA 2A2AA 5C8MA 5HG7A 2GQRA 5JGBA 2CSNA 4EOMA 1CKIA 3Q04A 3FLQA 1QPJA 3AQVA 1YXUA 4CFXA 3UMXA 3VUHA 1Q8YA 3SDJA 2XKCA 5EFQA 4UX9A 4Y72A 3CQWA 2WMAA 3BLRA 3QX2A 4GIIA 4HYHA 2J0LA 3VF9A 4A7CA 4ANSA 4F7JA 5HE2A 4XEYA 1KWPA 1YOJA 1VYWA 3GCQA 5AP3A 5CALA 2CHLA 1M2PA 3G33A 1KOBA 4J1RA 3LFBA 2HYYA 2PMNX 3E87A 1M7QA 2GNHA 4TZRA 1WCCA 3JY9A 5CT0A 3PVBA 4ZTHA 5CENA 3R63A 4AS0A 4WNKA 4QYFA 4RBLA 4CSVA 4XV3A 2Y6MA 3PLSA 4I24A 3ZXZA 2OJ9A 4NL0A 5ANOA 5CX9A 3RGFA 2A4LA 5AIKA 2Y4IC 3KK9A 3KXNA 4QYHA 4TTHB 1K9AA 1JSTA 4ZS0A 3EQFA 5AR5A 4NM7A 4F6WA 3PWYA 2AC3A 3GU5A 2YN8A 2XUUA 5CY3A 2PU8A 2WELA 4R3RA 3A61A 3QRIA 4UB7A 4ANNA 1Q24A 2ITTA 1UU3A 4BWPA 4YJQA 3PSBA 2PMLX 3W33A 1V1KA 2JIVA 1TKIA 3AC8A 4RWLA 3U87A 4DFLA 4QTBA 5HTCA 2CNUA 3HP5A 3LFCA 3ZC6A 2YEXA 3JVSA 3V3VA 3SLSA 4D5KA 2X0GA 2J0MB 3F2NA 1NVSA 4R6VA 3RJCA 2R0UA 3QTQA 4KIKB 4WA9A 3TZ7A 3WOWA 4BWXA 3T9TA 4L6QA 3HMNA 3R9RA 4UWBA 3ZUUA 3PJ8A 4FR4A 3COIA 2B53A 4WIHA 4FV4A 4ACCA 3TG1A 3GT8A 2PMOX 3R9NA 3UIBA 3RWPA 4MBLA 5KMJA 3MFTA 1QL6A 2XP2A 3CGOA 3COMA 3EMGA 5FXSA 3SOAA 3IONA 1Y57A 3MJ2A 4DITA 3VBQA 4E73A 5CAQA 2WIPA 3F69A 5FWKK 5IUIA 4DINA 3FXZA 4OLIA 5CEIA 4PPBA 4XUFA 2R3NA 2WMWA 3DK6A 4FTIA 4AN9A 2XNNA 3EQRA 2BFXA 5CEMA 4BDAA 5BMSA 5IQGA 4K18A 4H39A 4S34A 2ITXA 3GI3A 4RJ4A 4ZXTA 2HCKA 5DEWA 3WARA 4F65A 4NEUA 3VBVA 2JBPA 4ZY4A 3MESA 4GFGA 4G5PA 4RJ5A 4AZEA 2YIQA 2RFDA 1FMKA 4JG8A 4L67A 4UMUA 4BGQA 1WBPA 3O71A 5TO8A 4EBWA 1T45A 3QRKA 1H08A 3SW4A 4ZLZA 5A4CA 3OTUA 4DEGA 2HZ4A 4EUUA 4RA5A 4WKQA 3C0GA 3UP7A 5BNJA 3VO3A 2VX1A 2YDIA 4E6QA 2VU3A 5G1XA 5D12A 1Y8GA 2F2UA 4BCPA 1J7UA 3GC9A 4AOJA 4DE4A 1FMOE 2YITA 2VNWA 3TUBA 4E6AA 4OGRA 2R2PA 3E64A 3HEGA 5ACBC 4AE9A 3AT2A 4KIPA 4IM3A 5AUTA 3WF5A 1VYZA 3LQ8A 3RHKA 5E90A 4AACA 2HZNA 4NW5A 4FGBA 5HBEA 5HEZA 4YC8A 1YVJA 3CTJA 2JIIA 2P2HA 3NYXA 4XS2A 3GUBA 5IA4A 5GNKA 5AA9A 4FZDB 4EZ7A 4GL9A 3NCZA 2X2LA 4ID7A 2BIKB 1M7NA 4EYJA 3OUNB 3U8WA 4ZK5A 4BIDA 5IA1A 2ZYBA 3PY1A 5EHYA 3FI3A 4HVDA 2PVKA 2X8EA 2IO6A 4XBUA 4JS8A 4L7SA 4PL3A 4KAOA 2GQSA 3LLAA 3OXZA 5LVLA 5AV0A 4A4XA 3TIZA 3ALNA 4CQGA 2O3PA 5ANKA 5HBHA 5EQEA 3QX4A 3IGOA 3MH3A 3NPCA 3VC4A 4ALUA 4B8LA 3RPRA 1Y6AA 2X4ZA 4BN1A 4FSRA 5B2MA 4YLKA 3UIXA 4AW5A 4CYIA 4RLKA 4GVJA 4DBNA 5HGIA 3QXOA 3UOJA 2XIZA 3DFCB 5IH6A 4YLJA 4O82A 3B8QA 3QQFA 1I44A 4M7IA 4QP9A 1LPUA 3VUIA 2YIRA 1GZOA 4C7TA 1FOTA 4I1ZA 4NH1A 3ZC5A 2ITQA 4FV0A 4AGDA 4QMZA 2WQNA 3RCDA 5E8WA 3BQCA 4ZZNA 2IW8A 1MP8A 5JFXA 3F3ZA 5IH4A 2V22A 2YZLA 3KGAA 2Z2WA 1H00A 2B55A 3Q4TA 3MVJA 3Q52A 4WBBB 5AUYA 3RKBA 5HQ0A 1M2QA 4QNAA 1ZARA 3QD3A 1OITA 4JDKA 5AR4A 4A06A 1LEZA 4WUNA 4IB1A 5ANJA 4F70A 2OF2A 4NCTC 3NDMA 4O0UA 1OKVA 3H3CA 3T3UA 3UIUA 5A54A 3GOPA 2BALA 2WQOA 3ORMA 4D4VA 5FDXA 5IQAA 4JG7A 4U5JA 3QLFA 3PXRA 4FT5A 3LCTA 3D4QA 2XIYA 3IG7A 2VTJA 5EDQA 3QQHA 3NW6A 4RVKA 3CQEA 1OL2A 5AP7A 2W1CA 3R8PA 4B9DA 4V0GB 3AD6A 3UO4A 3FZOA 2J6MA 3REPA 2G2HA 3Q6WA 2OJFE 4XG8A 1S9JA 3AT4A 3CXWA 5HCXA 2R3FA 4RVMA 4PP9A 5GIPE 4R1VA 2QOIA 3C1XA 4E4LA 3TUDA 1NT2A 4KA3A 3FPMA 3D14A 1J7IA 3HMPA 4C62A 1L3RE 4H58A 3FAAA 2CGWA 5LCJA 3ORPA 5J1WA 3PLAE 2HK5A 3RPSA 4G9RA 1WBTA 3SVVA 3V5LA 2X9EA 5J87A 4K33A 4RZVA 3GENA 3MFSA 4O1PA 2EXEA 3LIJA 5HTIA 2ITYA 3BGPA 4IANA 4Q5EA 5LMKA 3PE2A 4KIKA 4EOSA 2UZWE 3R0TA 3FLWA 1GZ8A 4KKGA 3FE3A 4RSSA 3UPXA 5BVDA 2X81A 3ZS5A 4JI9A 3HAMA 2R3OA 4BICA 1O9UA 4OT6A 3IW5A 3JPVA 4TWOA 3M11A 3G9LX 2VWIA 3R1QA 4RX7A 4X3FA 4NK9A 3NUAA 4RZWA 3ZRKA 4AWIA 3ROCA 3QC9A 3ANQA 3GFEA 5IZFA 4ZMEA 3RBWA 3Q4UA 3Q9ZA 4OTIA 1WBOA 3E62A 4O84A 3QTIA 3KRJA 4BTJA 5HG5A 4TYGA 4EKKA 4EOKA 4O0TA 4YURA 2IVVA 2XK7A 5KNJA 4AE6A 1FQ1B 3G51A 5CEKA 4BRXA 4FV2A 4G3CA 5EI2A 4I4FA 3DV3A 2P4IA 5A6OA 1HOWA 4YZBA 3IK3A 4E5BA 1R0PA 2HENA 3TACA 1XQZA 3Q6UA 4PRJA 4EQCA 2YWVA 3G9NA 4AOTA 1W7HA 3R8MA 3IW7A 3OY1A 2ZVAA 4JR3A 4FSQA 4ANQA 4JBVA 4QTAA 4FVQA 4I4EA 3ORIA 3ZEWA 2CGXA 5DVRA 3KL8A 5M4FA 4PY1A 2XMYA 3IW6A 2UZVA 2QG7A 4O86A 2CKEA 4ANOA 2WTDA 4APPA 4AZWA 5JQ8A 5M4IA 4GKIA 4FSMA 3WE8A 3UZPA 3BBTB 1CDKA 1CTPE 2ZAZA 3KXMA 1DI8A 2B9IA 2A27A 3I0OA 3HRBA 3PRIA 1TQIA 1YHSA 3BPRA 3Q5IA 4YZCA 4GW8A 4XMOA 4BL1A 3PZHA 1GIIA 4HGTA 4MF0A 3A7GA 4UWYA 4RIWB 4XG3A 4YTCA 1JNKA 5ETFA 2UW9A 4Z55A 3FQHA 5K3YA 4IVDA 5C1QB 5JEBA 4FE2A 2GTNA 3TCPA 2Y8OA 5IG1A 3TXOA 3ZO2A 4XV9A 3AMBA 3TKUA 4TYEA 4MTAA 3D15A 1OIUA 4DG3E 3CJGA 2GS6A 2A0CX 3R22A 5JGDA 3I5NA 4TWCA 4Q9SA 2BROA 3LJ1A 2XNBA 4FG9A 4I5MA 5D7VA 5LMAA 3TTJA 2QHMA 3EN6A 4EH3A 4Q5HA 4E93A 1Q5KA 5AP6A 5CWZA 4H3QA 3Q5ZA 3KK8A 3E5AA 2C0IA
chains in the Genus database with same CATH superfamily
2XAOA 3UMWA 3ZDUA 3NFGB 4FT7A 3KXGA 4DAWA 1F3MC 3VJNA 4F9CA 4LL5A 5CAVA 3N4UA 4QO9A 2JLDA 3KQ7A 5BVOA 2YCRA 3RCJA 4KNBA 4EOIA 5EYCA 4GT3A 1B39A 4D9UA 3QXPA 4BF2A 2WU6A 5JQ5A 3DOGA 4ALWA 3UC4A 3DKGA 3SAYA 4CGAA 1PMNA 3IPHA 3DNEA 3TT0A 3FC2A 5GINE 3O23A 3ZLYA 3VUKA 2UZOA 4QMXA 4JDIA 3GB2A 3R8ZA 3UO5A 3EFKA 2UVZA 4YJTA 3W0OA 1TVOA 3VHEA 3CQUA 1J1BA 3F5GA 2BRBA 4E1ZA 3TWJA 2QKRA 1YHWA 3ROYA 5EHOA 4IVCA 4NM5A 2JIUA 4P7EA 4UZDA 5CSWA 3V5WA 4OBQA 3KY2A 2WO6A 5JZNA 5E8ZA 3BQRA 2C5XA 3HZTA 4W8EA 4C2WA 2R7IA 2UV2A 5HICA 3C51A 3ZM4A 3I6WA 3H30A 5FM2A 5HX6A 1BI8A 4TWNA 5E9EA 5TT7A 3F66A 5M09A 5C03A 3RZBA 5EQYA 3QQJA 4Z9LA 3MV5A 4PUZA 3BEAA 5I3OA 2HZIA 3NR9A 2X7GA 3W8QA 5AV4A 1PRYA 1M52A 1GJOA 4HVIA 4EKLA 2XB7A 1KE7A 3FDNA 4RJ7A 4RJ3A 2F4JA 3NEWA 4V0GA 1XH9A 1O6YA 2UW6A 3NNXA 2E9VA 4BTKA 4CLJA 2VWBA 3R73A 3WZEA 3Q2JA 3W0RA 4EZ5A 1BI7A 1Q8WA 3FSKA 3SRVA 5ANGA 5EW3A 4FICA 3EKKA 1BYGA 5J95A 5H8EA 3UOLA 2Z02A 2QLUA 2W1FA 4JQEA 3G0EA 4ZSLA 5KMMA 3HECA 5FP6A 4B7TA 4IB3A 3VONA 3QBNA 2YIWA 3VBWA 2ZM4A 2ITWA 4Y5HA 4BCKA 3G0FA 4QP7A 2VWXA 1PXJA 4AFJA 3PXFA 4AXDA 1JKKA 4U40A 5HX8A 2PE1A 3DCVA 3UOKA 4BDKA 5EYKA 3FI2A 5AA8A 3GBZA 3P0MA 1REKA 3RMFA 4K11A 5CQWA 2XNEA 3ENHA 2PUUA 5CSHA 4C3PA 4YJUA 3PPZA 2BAQA 3E8NA 4TPTA 1PY5A 1YXSA 2O5KA 5BX0A 3LMGA 4J99A 5AAGA 5FQDC 4G2FA 3PIXA 3SG8A 1OKWA 4O0VA 4ZSEA 2R3LA 5B7VA 4DH3A 4JBPA 4UN0C 1H01A 3TJDA 1OBGA 4DHIB 3R7VA 3ODYX 4XX9A 3MN3A 2VTIA 1JSVA 1KE8A 2RSVA 5GJGA 1WFCA 2YM5A 4YZNA 3VWAA 5B0XA 5IQCA 3C4CA 5CYIA 3B2TA 1ZYLA 1FPUA 2P0CA 3KMWA 4DTBA 5E91A 5IQFA 4MNFA 4C38A 2FVDA 3R7GA 3BU3A 3F7ZA 4IC8A 3QL8A 3H9RA 5K0XA 4YHTA 4ERKA 2V62A 4DG0E 4HPUE 4XP2A 4IAYA 4H3PA 4JT3A 5E4HA 4EYMA 3L8PA 4H1JA 1H8FA 3DT1A 2R9SA 2PVHA 4QOXA 4N6ZA 3E93A 2C68A 2YCSA 2W5AA 5AR8A 1ST0A 3OWPA 2A1AB 4ASEA 3C13A 3MBLA 4FVPA 5IDNA 3QQUA 2WTJA 1JPAA 4XG6A 3W0PA 2VTNA 4EL9A 2VX3A 2HELA 3CJFA 3PPJA 4BY9E 1A9UA 4RQKA 5EI6A 4QYEA 4RIWA 4ZTSA 3HNGA 4YSJA 4L8MA 3EH9A 4HZSA 3ZRMA 4ZOGA 4C59A 5A9UA 3PDTA 5BMMA 3ANRA 3MJ1A 3NUPA 1PXIA 4WT6A 3DU8A 5M07A 5D1JA 5E8SA 2C6MA 4K0YA 5A4QA 4AQCA 2PPQA 2QU6A 3HRFA 3RPYA 4O7RA 2UVXA 1J1CA 5AAEA 4Y83A 3ZUVA 1F5QA 4DFNA 3QGWA 1Q61A 4GK4A 4YPSA 3U6HA 4YHJA 2Z7RA 5L6WL 4ANMA 4CNHA 3IW4A 3DDPA 3WYYA 4C36A 4UY9A 5CF4A 1H26A 3NAYA 5L8KA 2EUFB 3PXQA 4GIHA 4E6DA 3GOKA 2QG5A 4C4FA 3WYXA 3GQLA 2BUJA 2RG6A 1Q8TA 3OXTA 5H9BA 5C4KA 5E8YA 3LOKA 3MIAA 2PZ5A 4FV9A 2WTVA 4QMWA 4XP3A 4ZY5A 3W2CA 4D28A 4KD1A 2BPMA 4FC0A 3ERKA 3AGLA 3QUPA 2C3IB 1E1XA 3QYWA 4L53A 4FK3A 4M69B 4TKSA 3VAPA 4BCHA 4FKOA 4KS8A 4Z7HA 4YJOA 4FIHA 4F6SA 5IEYA 3E3PA 3C0HA 4DFBA 2VTRA 2J5FA 4AA5A 5IUHA 3BCEA 3DBQA 2I0YA 3GXLA 3IDCA 3JXWA 4X0MA 3AD5A 3GC7A 3RALA 3TZ9A 4X2KA 2X0OA 4Z7GA 4BKZA 3FV8A 3D7TB 2XKFA 4MHAA 2CGVA 3BGZA 3TN8A 4BDJA 4R7HA 3W2QA 3GEQA 2EXCX 2F57A 4BKJA 1Q8UA 4HCUA 5DNRA 5HTBA 2PUPA 3BHHA 2YABA 5AP0A 5FTOA 5IA5A 3RI1A 4OTWA 4AGCA 4D1ZA 3FBVA 4IH8A 2UZNA 4LL0A 1ERKA 4FMQA 4C61A 5HO8A 3QTXA 1JWHA 4LRMA 3W16A 4F99A 5TOZA 3KC3A 5CF6A 1H25A 2QOLA 4APCA 5D11A 2IVUA 3I4BA 2FSMX 4HNIA 4PDYA 3QCQA 1GIJA 4KB8A 4Y95A 4CT2A 3QCSA 4O4DA 5HIBA 2PVNA 4WNOA 3RTPA 3VHKA 4EK5A 2C0OA 2CCIA 1E1VA 2W17A 3PY3A 4NKAA 5DHJA 1JKTA 1Y8YA 4WSYA 1ZMVA 3DZQA 2C6KA 3GC8A 4X6RA 5L2WA 2YDKA 3TV6A 5LWNA 3LCDA 1ZLTA 4M15A 1J3HA 2VO6A 3KFAA 3LFFA 4XG7A 4AW0A 3RZFA 3FZPA 2WMBA 3EQHA 4WBOA 1PYXA 3A8XA 1OUKA 3NNWA 5HD7A 4LUEA 1GIHA 5C8KA 2FSOX 1OPJA 2YCQA 3ZCLA 5KMIA 2ZFYA 4IAIA 5EQPA 2PMIA 3CGFA 4K1BA 1WVWA 2FB8A 5M4UA 2OK1A 2WIHA 3M42A 5KBQA 1IR3A 4XV1A 2VN9A 5I9UA 2WOTA 3UVRA 1G8KA 3ETAA 4JAIA 1TQPA 3MB6A 4O91A 4L43A 4QP2A 4ERWA 1FGKA 4MXZA 4FKSA 4W9WA 2G2IA 3CSVA 1XBAA 5C9CA 4D58A 1Q41A 3E8EA 4IM2A 2ZOQA 4HGSA 4DLJA 4EHGA 2EB3A 4QYYA 2B0QA 1OVEA 1HCLA 1KV1A 2WTCA 1G8AA 3L9NA 3ZSGA 4E6CA 4QMYA 4QMPA 3RINA 3EQDA 3WF7A 4EWHA 2XA4A 3Q96A 4RIYB 2ITZA 2C3LA 2HY0A 4QTCA 5BVEA 3WZJA 4F78A 4G1WA 4ALVA 2VX0A 4FIJA 1FINA 3OCBA 1OKYA 5LMBA 1NW1A 1VEBA 5C4LA 4NYEA 4G16A 4UWCA 2WB8A 1XR1A 5TE0A 4W4XA 2QHNA 1H4LA 2CGUA 3COHA 4NZWB 5LVOA 3EZVA 5EM7A 4E5WA 3DFAA 3R7OA 4C33A 4DGOA 5EDPA 2XF0A 2EU9A 3ZOSA 4CZUA 5BYZA 3PP1A 2H34A 3Q9YA 4FEQA 2VWWA 4NW6A 3FQEA 4S32A 3OXIA 3PSDA 4FNWA 3NUYA 3C4ZA 2P55A 4CYJA 3MIYA 5HORA 3D7ZA 4EJNA 4U0IA 5DYJA 1CKPA 1QPDA 3ZYAA 4LGHA 2FSTX 4C4EA 4CFFA 1H1PA 3GCSA 1SNXA 3D9VA 4YO6A 3MFRA 2VGOA 4AXFA 4CKIA 4AXCA 3EKNA 4KSQA 5BUJA 2BDWA 3IS5A 5GJFA 3MW1A 5K4IA 1VLRA 1WBVA 4M97A 5C27A 3OS3A 2VTSA 3ET7A 2Z7QA 2UW7A 5K5XA 3JUHA 4CMOA 2VNYA 5JMSA 5GZAA 3DTCA 4J96A 1Q97A 4ZMFA 3H10A 4OW8A 3A7JA 2YFXA 3HMMA 1U54B 5A3XA 4F1OA 4I22A 4YR8A 2SRCA 2WMQA 4IAAA 2R3GA 4FYOA 4I21A 4IFCA 2C3KA 2GS2A 2WGJA 3E7VA 3MH2A 4I41A 2YISA 3DB8A 4IAFA 4IEBA 1ZYCA 4X21A 4ENYA 4W8DA 1PXPA 2G9XA 4QQJA 4E20A 3LHJA 2BRHA 4MBIA 2QQ7A 3D5WA 4MBJA 2WTWA 3QC4A 5DG5A 2GMXA 4KRCA 4BKYA 2FA2A 2OH0E 1PKDA 2PZPA 3MI9A 3KREA 4UYAA 3NRMA 5CLPA 2XZSA 4BDEA 1YKRA 3FLSA 3I7CA 3V51A 3FLNC 5ETCA 5DT4A 3ZXTA 4OUCA 2F9GA 3TNHA 4BDDA 3PTGA 4W4YA 5I0BA 4IX5A 4M69A 4PP7A 1OM1A 4TYJA 3QA0A 4WRGA 4S33A 4DTAA 3ZMMA 3WF8A 3RM6A 2AUHA 5KMOA 3UBDA 4BBEA 1H1QA 2IG7A 3PIYA 2OLCA 1IA9A 3DPKA 4EK4A 3TNWA 5EDRA 2W1ZA 1J7LA 3LXKA 3LLTA 1APME 2EWAA 3VS5A 3LFDA 2GQGA 3PIZA 5GIOE 4GYIA 3P08A 3FHIA 2CDZA 2YWPA 2YZAA 3D7TA 3FY2A 2OXDA 3W0QA 4JG6A 4ORKA 4FTQA 4FTJA 3QD0A 4OTHA 2OIDA 4MXAA 4HVHA 4FTLA 4NUSA 5GZ9A 3FI4A 4L42A 4ZSGA 4E4NA 1BX6A 2JD5A 4BIBA 3UYSA 3P23A 4KABA 4QMSA 3SHEA 3BLQA 4M8TA 2C1AA 4N57A 3V5JA 5CU3A 2IZTA 4CFWA 4YO4A 5AP4A 4BDCA 4BBFA 4CFVA 4FKQA 3F2AA 3NW5A 2YM8A 3D0EA 5FDPA 3DTWA 1PXKA 3RVGA 4D2RA 2RGPA 2UW0A 5HNGA 4XCUA 3OUKA 3BGQA 4AX8A 2W06A 2WXVA 2I0EA 4M12A 4B4LA 3FMHA 3LXLA 1RDQE 4IM0A 4JL9A 3EB0A 5HU9A 4C2VA 4QD6A 2Y0AA 2R0IA 2OJIA 2ESMA 3ZLWA 5DI1A 1WZYA 3NUUA 3OCGA 2NNWB 5HVYA 1ZMUA 4M13A 4WOVA 4GFOA 5K9IA 2E9PA 4JDHA 4DEEA 3R9HA 1KE6A 2QU5A 3QA8A 5HO6A 5KKRC 5L4QA 4A07A 3MWUA 2PE2A 3UE4A 4PDPA 5E8UA 4S31A 3Q4ZA 4ONAA 4KBAA 3LFNA 1YWNA 1CM8A 1T46A 2ETKA 5H8GA 3KU2A 5AP5A 2BDJA 3WZUA 2XJ1A 3MTFA 4EH9A 3F6XA 4RIYA 4BI1A 3ORKA 5C26A 3DQXA 3FLZA 5JGAA 4GT5A 4YHFA 3NIZA 2PK9A 4XG2A 4YC6A 4JRVA 3MA3A 5HE0A 5AUUA 5HNBA 4ZEGA 4C8BA 3A60A 1AGWA 3RM7A 3ZO1A 2XNPA 3F5PA 2ETMA 2OW3A 1YXTA 3HV7A 5IU2A 3ZFYA 2W5HA 1SYKA 2OU7A 3LXNA 3KXHA 3NLBA 4EHVA 2PWLA 4NJDA 3QHRA 4FX3A 4M67A 3GNIB 5CI7A 3KXZA 3DJ5A 1W98A 3PWDA 3LZBA 4XJ0A 1KSWA 3IDBA 3MVMA 4ZP5A 1OIRA 2HAKA 2XK6A 1ZZ2A 5D10A 3SQQA 4HYUA 5FXQA 1KUTA 3FEGA 1UU8A 1V0PA 4LV8A 3VS1A 5CF5A 4KSPA 2W4JA 1PF8A 3L1SA 1PXOA 2GHMA 2QO9A 3AC3A 4IAZA 5J9YA 4YBKA 3C5IA 3V5PA 1XBCA 3II5A 3ULIA 2REIA 3MA6A 1ZRZA 4IMYA 4O2PA 4BR3A 1PMVA 2B52A 3MH1A 3THBA 3TNIA 2IPXA 1U54A 3QZFA 2GDOA 4CMUA 3OBGA 5IKWA 1PXMA 2CPKE 2BZKB 2GHGA 2ZM3A 3C4EA 3QZIA 4O6LA 3PJ1A 1XH4A 3HKOA 4L45A 4AT5A 3NSZA 5J9ZA 2EVAA 3CY2A 1YWVA 2VTOA 3DGKA 1XWSA 3OF0A 4GU6A 3UNJA 3ZDIA 4CG8A 4HCTA 5B2KA 2W1EA 3DAEA 2NRUA 2KTYA 4E26A 4CV9A 3SXRA 4EOQA 3BX5A 4L52A 3UODA 3FMDA 4AG8A 4D2VA 2VGPA 5M51A 4XH6A 1DM2A 2VTTA 3TJCA 5HKMA 2XS0A 1O6KA 4Z3VA 3PXZA 3ZHPC 5FXRA 4EH8A 1NY3A 2BVAA 2CNVA 2XYNA 5A4EA 1H1SA 4L3LA 5CVGA 2A98A 3COKA 5EK7A 4H36A 2ERKA 3IDPA 4FEXA 4II5A 5EM5A 1H0VA 4N70A 3HMIA 2H96A 1OUYA 1Y91A 4MH7A 2R3QA 5DA3A 1ZY5A 4QPSA 3MGYA 3W2RA 4UMQA 4A9TA 3NFFB 3FL4A 4G6NA 2UZDA 1YWRA 4JX7A 2W9ZB 1IAHA 3WE4A 2ZV8A 3ACKA 4F0FA 5EW8A 4H3BA 4GVAA 5CXZA 4U7ZA 3FWQA 4QDEA 1MQ4A 2Q0NA 1NXKA 2O0UA 2YLFA 3O7LD 3FMKA 4XRLA 4OTDA 1YHVA 2F2CB 5HIDA 3PUPA 5BQ0A 3WF9A 3PYYA 2WAJA 3TV7A 2AQXA 2XK4A 4ZAUA 4XV2A 4YJNA 2Y7JA 4CTCA 1P4OA 1R0EA 3HDNA 5F1ZA 4HW7A 2QD9A 4GT4A 1B6CB 4P2KA 1YW2A 4FODA 4F1MA 2FUMA 4PTCA 5HCZA 5E8XA 2R3HA 4DDIA 5EHLA 4EK6A 4E4MA 5EKNA 4TYIA 5IMXA 4AF3A 5CSXA 2NPQA 3R7IA 1U46A 4V05A 3DLZA 5BPYA 1YDRE 3FZTA 4NM0A 4BDGA 5ICPA 3QUEA 4K6ZA 5FTQA 3V01A 4IX6A 3ZLXA 5M06A 3ZM9A 3AD4A 3BYVA 3G5DA 3U9NA 3UVPA 3QU0A 4FTAA 2OZAB 3PZEA 2C6LA 2QNJA 4IVAA 4K77A 4PPCA 1BLXA 3PP0A 4JQ8A 4NT4A 1BL6A 5KMLA 2X4FA 4NM3A 1FVRA 4PMMA 1UV5A 2PVRA 2IEWA 2X0QA 5LVPA 3HUCA 3R71A 3NWWA 1PJKA 5AM7A 4L3JA 5FTGA 3EQPA 4U8ZA 3D5XA 4YC3A 1NVRA 1WVXA 2X7FA 1XH7A 5EYMA 3MS9A 3ZUTA 4BHZA 3SA0A 3TMOA 1R78A 2R3MA 3D2KA 4N4SA 4P4CA 4KUJA 3KRRA 3ENMA 4EONA 3E7OA 4D4SA 4M3QA 1Z57A 4HJOA 1URWA 3I6UA 4U6RA 5EOBA 2HW7A 5DRDA 4IJ9A 2VWZA 4FEWA 4A4OA 2WMRA 2CKPA 4IWQA 1PW2A 3QZGA 4F9BA 3T9IA 4PV0A 5E1EA 2WMTA 3U4WA 3UNZA 2PUIA 3T8OA 2X39A 3RPVA 4AZFA 4GH2A 5DMZA 3ZH8A 3KVXA 4NJ3A 2ZM1A 3CPCA 5EW9A 2GPHA 4DEDA 3OEZA 2R3JA 5LMKC 3QAME 4CT1A 4FSZA 4CFNA 2Z7SA 4XG9A 1MRVA 2W4OA 4C57A 5LQFA 4BTMA 4Y8DA 3F61A 2ZJWA 3R9OA 4NIFB 1RJBA 1W82A 1Y6BA 4HGEA 1IA8A 3VBXA 4YMJA 4X3FC 4DC2A 5I5ZA 2B4SB 5JH6A 3HVCA 3VF8A 3V6RA 3KXXA 3R21A 4WSQA 3RHXA 1Q8ZA 2JKKA 4I6FA 5CQUA 3TI1A 3HL7A 2VO7A 5IQBA 5K0KA 3L9MA 4WG5A 3G2FA 3BE9A 2Z60A 2VUWA 4YJRA 2ZV9A 3TNPC 4M0ZA 2GNFA 3NX8A 4RLLA 2C3JA 3L8XA 4DFUA 1ATPE 4FL2A 3HYHA 3JVRA 4R3CA 3UDZA 3EYGA 1SNUA 2QODA 1PMUA 3CD3A 3O2MA 1OECA 3L9PA 1ZOEA 3IO7A 3RNIA 5CSVA 5F4NA 3TV4A 3MTLA 5A14A 4E4XA 1PHKA 4RRVA 1V0BA 3C4WA 3UQFA 3P79A 1W2DA 4YJPA 4G31A 4LGDA 1H24A 4EUTA 3FY0A 4F9WA 4BDHA 2H6DA 4D2WA 4PPAA 2JDTA 3WILA 5CS6A 5FD2A 1DI9A 2GCDA 4O1OA 4RFMA 4R7BA 4DN5A 4IVBA 1H0WA 2UUEA 5A4LA 2QLQA 2X9FA 3LCSA 5TKDA 4B8MA 4EORA 2IJMA 4FL1A 3WF6A 4H05A 4GK3A 2J4ZA 3POOA 1OBDA 4AAYA 2YHVA 2GNJA 2LGCA 2XNOA 2JDSA 3GP0A 4O7YA 3R00A 4XLVA 4O0RA 4L3PA 3IGGA 5CTPA 3DXNA 3NAXA 4MK0A 4CQEA 4TRLA 4ASDA 3K3IA 2B54A 1ZXEA 3MPAA 2BHHA 4YPDA 5DEYA 5HE3A 5M53A 3H4JA 3LMIA 5KHXA 3BWJA 4I23A 4GMYA 5L2TA 4ZTLA 1OB3A 2XBAA 3BEGA 3MPTA 4FNYA 3ATSA 3K2LA 4U9AA 4BZOA 1YOMA 3KRXA 4FKLA 3BZ3A 1XH8A 4KIOA 2XIRA 4LM5A 3CBLA 3FYKX 3E88A 4XLIA 4YNOA 4JNWA 5AUWA 3R9DA 4AFEA 5LCKA 5CAPA 5KUPA 4WHZA 4RJ8A 4F0GA 1TFFA 1XBBA 3EFWA 3UG2A 4JAJA 4QP4A 4FRFA 4G3DA 4RWKA 5DH3A 3W18A 3WBLA 3ZZEA 4FTKA 4UXLA 4EEVA 1BKXA 3OWKA 5EG3A 4BCIA 1SVGA 3Q2MA 4RJ6A 5DIAA 4AOIA 5AP1A 4ZZMA 3VIDA 4D0WA 4ZSJA 3LQ3A 3GU4A 1XO2B 4OTQA 2J7TA 3CR0A 3DK3A 1P4FA 3RAKA 2JITA 4K9YA 3CE3A 2Y4IB 2ONLA 3MY5A 4EQMA 3TKIA 5M57A 2FSLX 2DQ7X 3QYZA 4IIRA 2J0JA 2YM4A 1Q99A 3I7BA 3MH0A 1GZNA 3FL5A 3MVHA 4FVRA 3HA8A 4O4CA 4RQVA 4Y85A 4EOOA 5HVKA 2IW9A 2JKMA 2ZMDA 3NIEA 5I9WA 2OZAA 3HV4A 1KV2A 3OBJA 4I5CA 4OT5A 3VUMA 4DEHA 5HO7A 3AT3A 3U4UA 4FIEA 4CCUA 3NYVA 4FKPA 5JN2A 5AUZA 4F7LA 5AV3A 3SW7A 3VQUA 2WZJA 4G9CA 3BU5A 3DBEA 2IW6A 3ZZWA 4QQTA 3BELA 3B8RA 1B38A 4C3FA 5DE2A 4NWMA 3QUDA 3PJCA 3TKHA 5KZ0A 3KIOC 5IDPA 4WD5A 2FGIA 3BE2A 3RK7A 3AC5A 3CIKA 3D5VA 5M08A 3AC2A 4F9AA 1R39A 4JJRA 4JX3A 5HE1A 2UW8A 3R83A 1NVQA 4YTHA 4ITIA 3OZ6A 3F5UA 4R3PA 5ETAA 4MAOA 5CU0A 3A7FA 2XVDA 2XKEA 3VRYA 2WHBA 3BHUA 2XM8A 2JDRA 4MXCA 4AA4A 3W0NA 3S3IA 3K5UA 2B7AA 1YDTE 1H27A 1UNLA 3NW7A 3O17A 4X2GA 5FEQA 4PL5A 1HCKA 3KF4A 3HV6A 3ZU7A 2BTSA 5D9HA 2BZJA 2HY81 4J8NA 5EM8A 4FOBA 4P5QA 2PSQA 3A4OX 1ZWSA 2I40A 2ACXA 4TN6A 5DFPA 1UVRA 3KRWA 5CEPA 5L6PA 3TYKA 4CG9A 4FTTA 1OPKA 1JLUE 2PVMA 3EN7A 4XOYA 3LQ5A 3OT3A 3PPKA 2QOHA 3OT8A 5AAFA 4NIFA 5E1SA 3NVMB 3OC1A 3TZ8A 3KCKA 1DAYA 3BI6A 3W2PA 4OAUC 1XMLA 1EH4A 4FSWA 4C3RA 2NP8A 5K5NA 3HV3A 4O7WA 3OG7A 3LFSA 2QONA 3QQKA 2WD1A 3W2OA 4MQ2A 3LJ0A 4G34A 4KBKA 2ITPA 2RFNA 4ZTMA 1URCA 1R1WA 1FGIA 1H07A 2XCKA 1OPLA 3BIZA 3I79A 4PDOA 3MSSA 4FUYA 3BRBA 2YA9A 3ID6C 3V04A 4O0XA 4TY1A 3W1FA 1TQMA 4FKRA 4U79A 5DN3A 3OTVA 3AMAA 3GCVA 3P1AA 2PVLA 1FBNA 2E2BA 2WNTA 4ITHA 2G2FA 4AZVA 3EL8A 3K5VA 2HW6A 4KRDA 5HNIX 4A9RA 2RFSA 5FUTA 1LEWA 3C5UA 3EN4A 2BAJA 2YM6A 2Z8CA 3SOCA 3A99A 2HXLA 4U3ZA 3GCUA 2OWBA 4PL4A 4J52A 4XHKB 3VULA 5JFSA 4D1XA 3S0OA 4MXXA 4R78A 4QP6A 3EFJA 4PWNA 5KMNA 2R4BA 4QP1A 5HHWA 1G8SA 4ACGA 4RFZA 5F94A 3F2RA 1WBSA 2VAGA 4QMMA 5ANIA 4FNXA 4GU9A 2I1MA 4J7BA 3PXKA 4CRSA 4IZ5A 3GU7A 3S1HA 1LP4A 3PA3A 5AIRA 2C5OA 4BBMA 4F7SA 3C50A 3FUPA 2XIXA 2GU8A 4DG2E 2BKKA 2F7XE 3HV5A 2VTQA 2FH9A 3O50A 5HI2A 5CF8A 4MYGA 2O64A 1JOWB 1ZOHA 2RF9A 3HX4A 5FBOA 3EQGA 1Q3WA 3W2SA 3U6IA 4I5PA 1U5QA 2GFCA 4LQMA 3NYOA 3O0GA 4FSTA 1PKGA 3UIMA 3ZRLA 4D1SA 5CAOA 4DHZA 4QPMA 4TYHB 3ALOA 5J5SA 2E9NA 3GC0A 2WEIA 3W8LA 1AQ1A 5EYDA 1SVHA 4USEA 5GHVA 4FZAB 1ZAOA 4JDJA 5FBNC 2XEZA 2PY3A 3ML1A 2NYAA 2UZBA 3D5UA 2QR8A 4G3EA 4FSYA 2QVSE 4UMPA 2PVYA 4FEUA 2C0TA 4OR5A 4PNIA 2A19B 4QQCA 4BVUA 5KBRA 2PL0A 3QCYA 5CVFA 1XHAA 4L01A 4C34A 3A8WA 1PXNA 5DGZA 4D0XA 3UP2A 2XM9A 4JXFA 3UC3A 5HBJA 1QMZA 3NUNA 4G17A 2GS7A 2I6LA 1O6LA 2GSFA 3U51A 2X6EA 2ETRA 3KB7A 4HYIA 1XH5A 3HGKA 3MY0A 4FSUA 5JK3A 5J1VA 2R5TA 5CZIA 2G01A 3FKNA 4CRLA 2PUNA 2PVFA 2X6DA 5CNOA 5J9LA 4R5SA 2F7ZE 1JVPP 4NFMA 5JFWA 4MXYA 2QOBA 4OTPA 4QTEA 5B2LA 1YI4A 3F7WA 1UU9A 2HIWA 3C4FA 3LFAA 4LRJA 3ATTA 1RW8A 3QGYA 2BZHB 3O8TA 1KOAA 4O38A 2XRWA 4CMTA 4MD8E 3UNKA 5LVNA 4EOJA 2V0DA 3PA4A 5HZNA 4B99A 2EB2A 3OW4A 4AXEA 4FT0A 4F63A 5JZJA 4EHZA 2C69A 4L9IA 3R1SA 4HNFA 5IF1A 1GZKA 3QRJA 3QKMA 2XNGA 2UW3A 4TNBA 3R7UA 3UGCA 1UKHA 1QCFA 4R1YA 4OTFA 4KKEA 3VW6A 2BAKA 4AXAA 4IBMA 3ZSIA 2GNLA 4YSMA 3A62A 2X2KA 1YRPA 2PHKA 4QQ5A 2GFSA 2DUVA 3NNUA 4QNYA 4RC4A 3PRFA 2ITOA 3P4KA 5CXHA 1UU7A 3V8SA 2WKMA 1ZYJA 4MQ1A 2C5YA 5HESA 3DQWA 1SM2A 3E63A 3FXWA 4DH5A 4YBJA 3V6SA 4AQKA 3EYHA 5H2UA 3RK5A 4EWQA 5KCVA 2VZ6A 4ZLOA 4LOPA 3ZO3A 4AZSA 3UOHA 3LM5A 3UVQA 4IZYA 2UZEA 2BRGA 4IZ7A 4E3CA 2QURA 3F5XA 2Z7LA 4DFXE 3VW8A 2ZDUA 4FF8A 4TL0A 4YZ9A 4FTCA 3RAHA 5J79A 3MFUA 3GVUA 2W0JA 3MDYA 3HMOA 3MPMA 3N51A 4JIKA 4EHEA 2GNGA 3R2YA 3HAVA 2HWOA 3UZRA 4ZIMA 3KRLA 2QR7A 4GKHA 1FVTA 5HLWA 1P5EA 3F3VA 5CU6A 4L00A 5FM3A 3GU6A 3H9FA 1IAJA 1CSNA 4RPVA 5AX9A 4YP8A 4LYNA 4EK3A 4FV5A 2XARA 1ZY4A 2RIOA 1IASA 2XYUA 4U43A 2X2MA 3UPZA 4X3JA 3G6HA 4MVFA 4CFMA 3R6XA 3QCXA 4JLCA 2C47A 3HDMA 2F7EE 2J50A 1G3NA 3FKOA 4BTFA<