4PWNA

Crystal structure of active wnk1 kinase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
274
structure length
245
Chain Sequence
KAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDFKEEAEMLKGLQHPNIVRFYDSWESTCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase WNK1
publication title Chloride Sensing by WNK1 Involves Inhibition of Autophosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 70
structure length 245
sequence length 274
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4pwnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4pwnA01
4K6ZA 3VBWA 2UZOA 2WB8A 1URWA 2ZV8A 4C4JA 2J0LA 1OMWA 4G6LA 3DAJA 4G3GA 5DR2A 4BWPA 4O2PA 4XOZA 1DS5A 1YXUA 3QC9A 1PMUA 3CPBA 5AJQA 1J7IA 5BVKA 5M07A 4LQMA 1B39A 5AP3A 4KAOA 3ET7A 3EL7A 1P4FA 1YOJA 3PRIA 4GJ3A 2QOFA 4XV2A 1ZLTA 5AR2A 5M56A 1W0XC 2WO6A 1FOTA 3DA6A 4L53A 5L2TA 3I0QA 3PY3A 1P14A 4OBOA 3GOKA 4A7CA 4IE9A 4FOCA 5H8BA 4ZSLA 2IZSA 5HU3A 4CTBA 3MTLA 4PV0A 3D2IA 2IWIA 3H9RA 5EYMA 3VVHA 4YJRA 4C2WA 1WFCA 3CEKA 4KKHA 1IR3A 1B6CB 2W96B 5CU3A 5K0XA 3WE8A 3V8SA 3R7UA 2ITUA 1LP4A 3F7ZA 3BBTB 4QMLA 1OM1A 3QUDA 3BHHA 4L3PA 3EQHA 2X7OA 1YXTA 4QMNA 2C4GA 4EQCA 4RC3A 5GZ9A 3HL7A 3C50A 3PJ2A 5DBXA 4GUBA 1JWHA 4F4PA 4FSZA 3PWYA 4OTFA 5D7AA 4EL9A 2J7TA 3S2PA 2YISA 4IB3A 4G2FA 5IQCA 3RVGA 3NLBA 4NSTA 3PE2A 4CT1A 4U7ZA 2WMQA 2XIZA 4WT6A 5L3AA 4KABA 4ZTRA 4QYYA 5B2MA 4GK4A 2VO3A 2P55A 4X2NA 5L6OA 3HECA 2DYLA 4NU1A 4YPDA 5HNBA 4C2VA 4MF0A 4IBMA 2GNFA 3TTIA 4WG5A 5AUUA 3SG8A 1R1WA 4PL3A 2IG7A 1ZYDA 2P3GX 4GU9A 3EN7A 3QD2B 1Q3DA 2JDTA 2BUJA 3PJ8A 2BVAA 4QYHA 3D15A 2BAKA 3OXTA 4GIIA 3VQUA 2YDKA 2WFYA 5BVDA 1IEPA 5L8KA 4YR8A 3AOXA 4OLIA 3SHEA 2W1GA 3C4ZA 5CSVA 2X9FA 5AUXA 2HWOA 3MFUA 4MYGA 4O0TA 3LKMA 3LVPA 3HRBA 3UP7A 3COHA 4PDYA 2QG5A 3ZZEA 3EWHA 5J7HA 4O84A 1SNUA 5FD2A 1YOLA 1OKZA 3BLQA 4K8AA 1Q8YA 1VZOA 3AT2A 3AGLA 3SRVB 3TV4A 4F6SA 5I5ZA 3DFCB 3F3VA 4DH1A 3QGYA 3QQLA 4HVHA 5DRDA 3ZEWA 4IAYA 1YXXA 1YI6A 3PVWA 5HTIA 2ZB0A 2OFUA 4M0YA 2G15A 2Z60A 4I6BA 2BPMA 2X6DA 3BE2A 5FXSA 5HG9A 3C0IA 3HEGA 1Q8WA 4LL0A 4J98A 5HCZA 4C0TA 4ZLZA 3VULA 3LFBA 3DLZA 5AUWA 4HGLA 3FMHA 3B8RA 3C4FA 4FG8A 4AWIA 3ZSGA 1U5RA 4TWNA 3IS5A 2W4OA 1ND4A 3DBFA 4ZTHA 2HZNA 2YABA 3E8CA 3Q5IA 2QOKA 4FKQA 3FSKA 5ANJA 4ALUA 4KUJA 1KOBA 4XUFA 3OUKA 2W99B 2BRMA 4MEDA 2PSQA 3ORNA 2PVRA 4U6RA 3UDBA 3CXWA 4EK4A 5LXMA 5A4EA 5BMSA 2J0IA 2QO9A 1H0WA 3NAXA 3LXLA 3SX9A 1PYEA 1CMKE 3NUNA 1G8AA 1OL5A 3FKNA 4HPUE 2X7FA 4CLJA 1YVJA 4FF8A 2C6DA 3DZOA 3ZO4A 2UVXA 4BDHA 3HMNA 3MIAA 5JRQA 3Q6WA 3TV6A 2WIPA 2QC6A 2UZNA 2YN8A 4E6DA 3PIZA 1MQBA 3PZHA 2A0CX 5HBHA 3FHRA 4O38A 2UZWE 3ZSIA 2PUPA 3G33A 4FKJA 4ACDA 5TE0A 3BU6A 4IFGA 2V62A 4I0SA 4IMYA 3VW6A 1OUKA 3U55A 4I41A 1PHKA 3NYVA 2W05A 4FT3A 4WNKA 5C01A 4M15A 2XYUA 2ERKA 4FEQA 4NM3A 1J7UA 2I0EA 2B9FA 3LJ0A 4A4OA 5AIKA 5D9HA 1UWHA 3W1FA 4FTQA 5LWMA 1QMZA 2J5FA 3R6XA 4M67A 4R7HA 4BWKA 2JC6A 4O0UA 4F99A 3QRTA 2HZ4A 3TCPA 2NRYA 4Y73A 2PHKA 2Z7SA 4JNWA 2W1DA 3CCNA 3IDCA 4GFMA 4MNFA 3QBNA 4IB5A 4FSYA 5KHWA 5EHLA 1JLUE 2XNMA 3CQUA 2CKPA 1OUYA 2UW9A 3T3UA 5DOSA 3MV5A 4W9WA 5AP0A 3VS5A 4AOJA 2FYSA 4AOTA 3WILA 3EQDA 3IK3A 4PP9A 4DAWA 5KMKA 2BROA 2YCSA 4XV3A 5FG8A 5JFXA 3MS9A 5GIOE 4RWKA 2OO8X 3BE9A 2WTJA 4AT5A 1W98A 4U3YA 3Q04A 3VRZA 2AYPA 3PLSA 2H96A 3KRXA 3MWUA 4R5YA 1NVQA 3ROCA 4DITA 4N0SA 3SVVA 1V1KA 3QZGA 1KE9A 3JY9A 4FKSA 5FEQA 3KXGA 2PTKA 3E92A 3WBLA 5HI2A 3OW4A 2ZVAA 2QOQA 4E3CA 4IDVA 4WSYA 2LAVA 5LARA 3VN9A 4ENYA 3V5QA 1OB3A 2XNOA 2GMXA 3RAKA 4NFNA 2IW6A 5ANGA 5KBQA 3IO7A 2R64A 3FQEA 4FGRA 5E8SA 4WRGA 3RHKA 4CZTA 5KMNA 2GNLA 2WMSA 3NSZA 3R28A 5H8GA 4YJNA 4E4NA 3FMNA 2C5NA 2O64A 4B7TA 4ANNA 2H9VA 4WA9A 5K3YA 3OWJA 4ASZA 3FY0A 2VU3A 3MB6A 3LFDA 3FYKX 2OF2A 4QPAA 4ACCA 4YJQA 4AU8A 4F9AA 3GC9A 3SW7A 2CGUA 5IEVA 4ZSGA 3WYYA 3NEWA 2C6MA 1TKIA 3K5UA 4H3BA 4K77A 4RIXA 4IWQA 4FSMA 5AV0A 2ZV9A 3R0TA 4IANA 4XP3A 3ZSHA 4DBNA 2YZAA 2IZUA 1XBAA 3UYTA 3QUPA 3UPXA 4FIJA 3CR0A 4L3LA 3WOWA 5IG1A 5KUPA 5AP1A 4BI2A 3A8WA 3GOPA 4I6FA 3R1QA 4ARKA 3RNIA 5A4LA 5IA4A 3PY0A 4GH2A 2EXMA 3A4PA 2J4ZA 4UWYA 4GIHA 3OC1A 4NIFA 3S1HA 2BMCA 3C1XA 2CPKE 4GS6A 4HVIA 2YIXA 3F5XA 3A60A 2PE2A 5HHWA 3H4JA 3VBXA 5KKRB 5D7VA 3HMOA 3UE4A 4YGAA 3TT0A 3DS6A 3R73A 2VWBA 5A6OA 2C3IB 1BI7A 3NIEA 4EH9A 2CGVA 3QQGA 4MNEB 3PXZA 3H9FA 4PL4A 5CX9A 2F57A 3ZXTA 4CEGA 3QRIA 3Q9XA 4IB0A 4HYUA 5JFVA 4ANLA 4O86A 4A4LA 4NM0A 4NM7A 4F7JA 5C26A 4ZLYA 1UA2A 2ONLC 4ERKA 2UZBA 4XBUA 3BLRA 4FX3A 2PMIA 4IQ6A 3A7IA 2JKQA 2XYNA 1WBVA 2BFXA 2XS0A 3E8EA 5AA9A 2W1EA 4YSJA 4YURA 4ANMA 1DI9A 3FAAA 2VTQA 4XG7A 4XP2A 3BHVA 4U8ZA 5C4KA 3W10A 4DEHA 4IAAA 5LVOA 3FLQA 2VX1A 4YNEA 3A61A 5GJGA 4CYIA 5CAQA 3IONA 4FG9A 3W2SA 3AT3A 2H8HA 2XBJA 4C3FA 4EZ7A 4ZTNA 5IDNA 2OXDA 5AP4A 4O1PA 2F9GA 3CQWA 4GYIA 4CKJA 4BCMA 5JGDA 4L00A 4QQCA 3DAEA 4K9YA 4XG8A 1OKYA 2XNBA 1KUTA 2XM8A 4TWPA 2ZB1A 2VWYA 3IW4A 1PXMA 4IWOA 2CNUA 4UXLA 4KKEA 4DFBA 2C0TA 3DB6A 5DI1A 3TNIA 3F7WA 4OT5A 2R3LA 3IOKA 4YZNA 1L8TA 5EFQA 2JKMA 3BLHA 5JEBA 1FGIA 4RGJA 4IVDA 1PXNA 3UOLA 4L9IA 4XV9A 3I6WA 4IJPA 3CTJA 1YW2A 2WOUA 4IVBA 5HLPA 4A9SA 4IACA 5CEOA 3C0GA 4PY1A 4Q9SA 4GT5A 2DS1A 4L44A 3NYNA 5DH3A 3RM7A 4YZCA 5KO1A 3C4WA 2I0HA 5LVNA 2G1TA 3CKXA 3LPBA 4JI9A 2CKOA 4YLKA 4YC3A 4HVSA 2EXCX 4G9CA 4OR5A 2XNGA 3QC4A 2F49A 2C5YA 3EYHA 3C4CA 3ZRKA 4BIDA 3PXRA 3ZLWA 2Y6OA 2R3PA 2VWVA 2CHLA 2QKWB 4EH4A 5E8WA 4BDGA 5DPVA 2GHLA 4G1WA 4MBLA 4JLCA 5EQEA 2YITA 4FV1A 2H6DA 2W1IA 3GP0A 1PY5A 4FKRA 2R4BA 2VTTA 3H9OA 4NUSA 3CTHA 4MXAA 5FP6A 2YWVA 2B9HA 3ZYAA 1OIRA 4QNAA 3R7EA 1OITA 3CD8A 3LFAA 3R2BA 5CQWA 4L52A 4AW2A 4PDSA 3KMMA 4WD5A 5EW8A 3VUDA 3ZU7A 4DHFA 2X6EA 3HKOA 2C6LA 4FUXA 3IKAA 2WPAA 2XKCA 5ACKA 4OAVB 4BKYA 2YIRA 3B8QA 3PDTA 1PMEA 4MWHA 4Y83A 4HYSA 5KE0A 4FZDB 3MYGA 2AC3A 3QQJA 3NUAA 1R78A 4HOKA 1IA9A 3QA8A 4D2RA 4QMZA 5A4CA 5CEIA 1PJKA 3SKCA 2HAKA 4JDJA 4WBOA 4LOOA 4WSQA 4UALA 4G5PA 4BBEA 3UNZA 3AC8A 2HIWA 2CNVA 2PWLA 5AP7A 5CWZA 4FR4A 3C0HA 4JXFA 5ITAA 2WU7A 1E1VA 3AC1A 3OWKA 3D94A 4X21A 3KXXA 3VNTA 3D14A 2XNEA 3H30A 4G3DA 4B8MA 1UWJA 4FV4A 3DXPA 4IWPA 5KHXA 3O8UA 3RWPA 4APCA 4FT9A 3HV4A 2XMYA 4KBAA 2GHGA 2XIXA 3RAIA 3MN3A 5LOHA 2QOHA 5AP2A 5BYLA 2E9VA 4FZ6A 3I0OA 2PZ5A 3RPOA 3JS2A 5I9VA 1JQHA 3Q2MA 2RL5A 4GVAA 3BWFA 4ACHA 2ZDTA 5EI2A 3DQWA 3SRVA 1QL6A 1WBNA 4L3JA 3IW8A 2JFLA 3DTWA 3AGMA 3LFEA 4G3FA 4XHKB 3HV5A 4NL0A 4XV1A 3HAMA 1CKJA 5E8XA 2UW7A 3R2YA 4CLIA 4RC4A 4I21A 3U6JA 3PUPA 2C47A 3Q4UA 2QD9A 3IDPA 3OWPA 3QZFA 2R3QA 4GUEA 5JMSA 2OLCA 2WMBA 3VUTA 1V0OA 4XG9A 4YLLA 3ATSA 4U5JA 3OHTA 3O2MA 2W9FB 2BRGA 5GINE 3FMDA 4PPAA 2Z7LA 5JQ8A 2B7AA 4HCTA 1WAKA 3DNDA 4JBPA 3ZTXA 5J5TA 4D1XA 3IGGA 3QKKA 3UVQA 4XEYA 5D12A 1W83A 3DY7A 5A14A 4OAUC 4JBVA 5IEYA 4LGGA 3ZH8A 1PW2A 3DFAA 5BVEA 1RJBA 1DAYA 4TT7A 4ACMA 3UPZA 3QLGA 4B6LA 4FUYA 4PF4A 1QPEA 4OBPA 4OTDA 4NCTA 4NH1A 1Z57A 3UOKA 3V5PA 1BKXA 3NW5A 1PXJA 3GXLA 3DT1A 3QLFA 4B99A 4GFGA 3BU5A 4RBLA 4KSQA 2JKKA 5JGBA 3UZTA 2QOCA 5L6PA 5JH6A 2WOTA 3PPKA 3Q4CA 3TNPC 1W7HA 3OT8A 4YJSA 3V5WA 4EQMA 5AAGA 5FXQA 5A46A 1TQMA 1XH8A 4FKVA 3V6RA 5HNGA 4MAOA 4FV5A 2CDZA 3HRCA 3MSSA 3NRMA 4J1RA 1OI9A 2W1HA 4UY9A 5K5NA 3O8TA 2C6IA 3AG9A 3E63A 2B53A 4AW0A 5FTGA 1OZ1A 4DEEA 5L2QA 5CXZA 1B38A 4ASXA 3E64A 4BKJA 1H01A 4PUZA 5HE3A 3TZ8A 5CALA 4TNDA 1VR2A 4A9TA 3R7OA 5HGIA 5T3QA 2J9MA 5JGAA 4O7RA 4ZTSA 3H0ZA 5E1EA 5HESA 4F0FA 4QTEA 1KE8A 2CGWA 4FKLA 5CZHA 4WUAA 2VNWA 4KKGA 2QOLA 5J79A 3FKOA 1YHSA 3LCOA 5IEXA 3SA0A 3AD6A 4HCUA 4IZ5A 4EOJA 3DK3A 4E6QA 3ZBXA 4UMPA 1MRUA 4O7NA 4FE2A 4XMOA 2C3KA 2QONA 4AUAA 2R3OA 4C8BA 3L8PA 3QTRA 4FIGA 4C34A 5K4IA 2QNJA 3R9DA 4EEVA 2PZIA 4AGUA 4FNZA 2NO3A 4I5MA 3NW7A 4FSRA 2YIQA 2ZJWA 4IW0A 3RALA 4D4RA 4LG4A 3RKBA 4DCEA 2ZYBA 1URCA 3WZKA 4ITIA 1SZMA 2AC5A 3Q9WA 3GC0A 1UU9A 3HX4A 3KRJA 4RFZA 3UQCA 4FV6A 3G90X 2QCSA 5DEYA 2GNJA 4EZ5A 5KMIA 2NRUA 3AC3A 4I94A 4O0RA 3JR1A 5HBJA 2WTVA 4FTTA 3TKUA 4UMRA 5HE0A 2F7ZE 5JN2A 5L8LA 5B0XA 2BAQA 3SXRA 4A06A 2CNQA 2J2IB 3Q9YA 3UIXA 4PWNA 3WYXA 2OIQA 3GC7A 2W06A 3R1NA 4FG7A 3PSCA 4MXXA 5IISA 3LFSA 2HENA 3PVBA 4MXZA 2RSVA 3ZLYA 4BTJA 5HLNA 4DGOA 4J8MA 5JZJA 1L3RE 5CU4A 3ANRA 5HVKA 3GQIA 1CM8A 4GW8A 4CKRA 3PPJA 4B0GA 2VWXA 3DJ7A 4GK2A 2P33A 2GPHA 4JBOA 5CEMA 3FQHA 4U0IA 4XYFA 1SVEA 3UC3A 4GMYA 4D2WA 4EZ3A 4I93A 1QPDA 2OXXA 3LJ2A 5DVRA 4DFZE 4BDFA 1XH9A 2BHEA 3BGQA 3GC8A 1ZYLA 1M17A 4QMWA 2Q83A 3VBYA 2VO0A 3R7VA 1FVRA 3DAKA 2XH5A 3A8XA 2YLFA 2DQ7X 4EOPA 2RG5A 2FSTX 3HZTA 4PRJA 4FZFB 2YCFA 5CU2A 4TYHA 4PX6A 2UW0A 4FTJA 4YTFA 3I6UA 2PL0A 4APPA 4DEAA 5CI6A 2YAKA 4I24A 3R22A 3PJCA 2OKRA 2B9IA 4L67A 3BEGA 3VS2A 3ZC6A 3ZDIA 4Y72A 3UGCA 3IW7A 2BFYA 3BBWA 2PVYA 3D7TA 1NY3A 3EN4A 2XEYA 3Q2JA 2PZYA 3ZCLA 4ZEGA 3FPQA 4RJ3A 4MH7A 1ZRZA 4EQUA 4RJ5A 4CQEA 2EWAA 3FI3A 3NIZA 1YI4A 1PXOA 3DDPA 2JIIA 2WAJA 3PSBA 4TYEA 3HP2A 4II5A 4U3ZA 4RIYA 4O82A 1SVHA 3HVCA 3C9WA 3TIYA 4DFLA 3F3ZA 4PP7A 2ITXA 2OJJA 3FXXA 3NCZA 4G17A 3L1SA 3R1SA 4DGLC 3WI6A 4F09A 4AG8A 3G9LX 3KN5A 4I5CA 4EH3A 4H1JA 3QRJA 4RZWA 2FVDA 3V51A 3TI1A 3FLNC 3FLSA 5GJDA 4V04A 2YWPA 1OGUA 2QHMA 4BZNA 4ONAA 3TZ7A 3NUYA 4IXPA 4LRJA 2JDVA 3EN6A 2Y8OA 4C4GA 2VTMA 4IC7A 2P0CA 4BYJA 2X9EA 2GNGA 3RHXA 3RNYA 3D83A 3A7GA 3NYXA 3PA3A 5M55A 4CV8A 4V01A 3Q96A 5CAPA 5CF6A 5LCKA 4C36A 3KXHA 2E2BA 2OW3A 1U59A 3LLAA 4A07A 4TN6A 2JAVA 3PE1A 4U44A 1GZOA 4U40A 5HG8A 2O3PA 4H1MA 4FT0A 4R6VA 5J5SA 4AW5A 4GT3A 4U41A 4XH6A 2JDOA 3BYUA 4RVMA 5HOAA 1FMKA 4EH2A 3WZUA 4YU2A 2O65A 3FLWA 5A54A 3GGFA 4L8MA 3KXNA 4FEUA 3PLAE 3UOHA 4JAIA 3II5A 4IZAA 4XG6A 1OIQA 1Q61A 3CJFA 5F95A 4EJ7A 1CKIA 1W82A 1ZZLA 2BDWA 2I0VA 3DZQA 2XJ1A 4GU6A 4RG0A 4CFWA 4K2RA 2FO0A 3KRWA 3WZJA 5BUIA 4YPSA 4E7WA 4I5PA 2XK8A 1LR4A 3QXOA 2J0JA 1OL2A 3FLZA 1GZ8A 1LEZA 3GCSA 3RWQA 2VV9A 3MBLA 3FMLA 5HO6A 4ZP5A 5KBRA 4ITHA 1GIJA 1UVRA 5DFPA 3QZIA 2QR7A 3G2FA 2BRHA 3QKLA 3BELA 4FMQA 1JVPP 3ZLSA 1PMNA 1R3CA 3OD6X 2IW8A 4UXQA 2C6TA 3W2OA 5HVJA 1ZMVA 2KTYA 5E90A 5TOZA 4AT4A 3R21A 4DFNA 1YWVA 3LMHA 3WARA 5EK7A 1J7LA 4W8EA 2FUMA 2BZKB 3EKKA 3I7CA 4FL1A 4IX6A 5F4NA 3QYWA 5E91A 2P4IA 4YJUA 4EOIA 3P7AA 3ANQA 1H00A 2B55A 4RJ4A 4ZJVA 2BCJA 5KNJA 3O23A 4OGRA 4UB7A 3FZRA 3FL5A 5E4HA 5CXHA 3R01A 4PDOA 4V0GB 5EKOA 5IKWA 5TO8A 2VWUA 3BRBA 3DJ5A 3OT3A 4L45A 4ALVA 4AOIA 2C1BA 3F2NA 3LCDA 4W9XA 5L2IA 4ZAUA 3ZFYA 3VS1A 3ENHA 4MHAA 4I92A 3VF9A 4D55A 4EK6A 4BICA 2NNWB 3VBVA 3EFJA 3FL4A 4WBBB 4RIWB 5HO7A 5B7VA 2QVSE 2JBPA 4ZXTA 4X2KA 2R3NA 2OBJA 1UNHA 4QTCA 4BIBA 2BR1A 1H4LA 3PVGA 3MB7A 3P9JA 2OJ9A 2VX3A 4RX8A 1V0BA 3OY1A 4XJ0A 5HIBA 4AZSA 4BCKA 3HA8A 5ICPA 3TUBA 2FSLX 3CBLA 4QRCA 2OXYA 3BKBA 3UTOA 3QQUA 4GL9A 3BHYA 3U51A 3QZHA 3TZ9A 3EFWA 4TY1A 4KIKB 3DXNA 4P2KA 4WHZA 5E8TA 4L42A 4FEVA 4F64A 2WQBA 3SQQA 1XQZA 5LJJA 2CKQA 4IC8A 4PDPA 5TT7A 5HO8A 1H1PA 4GFOA 4EWHA 4TWOA 4EBWA 3FE3A 3C5UA 4M8TA 4PPBA 5IMXA 2ETRA 2R3MA 2W17A 4FV7A 3WF7A 2QKRA 3EQCA 5LMKA 2W9ZB 4G6NA 4YZDA 3L9MA 1IG1A 4FTRA 5GNKA 4ZY6A 4X7QA 4BI1A 1XWSA 4C37A 4DG0E 2PMLX 3A7HA 3DKFA 3KVXA 4IWDA 2VTPA 2Y4IC 5LVMA 1UU3A 3HDNA 2R3HA 4U97A 3KRLA 4ZTLA 3K3JA 3TXOA 3ZBFA 1M52A 2WNTA 5E9EA 4CFXA 3Q52A 3LXPA 2PE1A 4C62A 2IVUA 4EH5A 3TDWA 3ERKA 5IMEA 4R1YA 4FK3A 2BKZA 3EQIA 4D0WA 4L7FA 4TYIA 3JVRA 3FC2A 4IAKA 1DAWA 1PXIA 4NKAA 2YM3A 4H58A 4EUTA 1H1SA 2HOGA 3SD0A 3HV7A 4X2GA 4F7LA 1FBNA 4OW8A 1GIHA 4DTAA 4EOSA 2GS7A 3D9VA 3EQBA 3LFNA 4NJDA 4G5JA 3KULB 2PVFA 4QMOA 4YC8A 3ZFMA 3F88A 3BQCA 4JBQA 4FTOA 4F0IA 2XK9A 4O21A 3A4OX 5AADA 5AA8A 4QMPA 1E9HA 4MQ1A 5AAFA 4NKSA 3UO6A 3E88A 4RWIA 1YRPA 4YBKA 4UMUA 2OIDA 2OU7A 5AM6A 2RG6A 3PWDA 5J95A 2EUFB 3PG1A 4D4YA 4JQEA 3IECA 4BDKA 5BNJA 1JNKA 4FOBA 5BMMA 1I44A 4CCUA 4HJOA 3MVMA 3SW4A 3UNKA 2B1PA 2ITQA 4EH8A 2OH4A 4JOAA 4LI5A 3OCTA 4F1OA 1U54B 3VJOA 3CGFA 5AR3A 4BDDA 1H25A 3KN6A 2DWBA 4QMQA 1O6LA 5M09A 4O27B 1H27A 4F9CA 3MVJA 1XKKA 3EQPA 5M4FA 5TF9A 2ZDUA 4BDEA 1J1CA 2ETKA 4R78A 3PIXA 5L2WA 4XCUA 2X39A 5FEEA 5LVPA 4DFUA 3L9LA 2NP8A 4JDKA 3TNQB 5LVLA 3V5TA 4GEOA 2R3FA 3QTQA 4MWIA 3HDMA 5T6KA 3R8MA 3RPSA 2HZIA 2PZRA 3R9OA 4C38A 4I20A 4FIFA 4EYMA 4I0TA 3SLSA 4F65A 4FEWA 4NCTC 3TWJA 2WIHA 2XEZA 2XVDA 3K2LA 3MPAA 2ZM3A 2VWIA 4O7LA 4YJPA 2J90A 3O96A 5KCVA 3SDJA 3V8TA 2X2MA 3U9CA 3F5GA 5CU6A 4EBVA 1Y6AA 4U42A 3ORMA 5KZ0A 2WMXA 3B2WA 5ETCA 2WTKC 3EHAA 5L4QA 1YXSA 2BZJA 4KS8A 1J1BA 1BL7A 2G2IA 2BAJA 3CKWA 3NX8A 4L43A 4IAFA 4RJ7A 5AM7A 3RPVA 1H26A 4U81A 5DHJA 3L8XA 3R8UA 1F3MC 1MRYA 4L7SA 4GVJA 4QP6A 1A06A 3RPYA 1O9UA 2GNIA 4JG7A 1KE6A 3P7BA 1H1WA 3FKLA 4RFYA 5B2LA 2A27A 2HY81 2XIYA 4D4SA 5JT2A 1IRKA 2ZM1A 3A62A 3JY0A 4MBJA 4ZMEA 2V7OA 2X8EA 3ZUTA 3BYMA 4C4IA 2JIVA 5D1JA 4X3FC 3P23A 3KGAA 4O1OA 1V0PA 4BTFA 3R04A 3VUKA 1KV1A 4DFYA 3M11A 4BI0A 4FK6A 3OMVA 5FTQA 4CZYB 3R00A 4KSPA 4BCOA 3KK8A 2YEXA 3FI2A 2HXLA 2G2FA 1GZKA 2XZSA 5EW9A 2OFVA 3ZDUA 3PA4A 2PE0A 1TQIA 3ZS5A 4EHZA 4TL0A 3LE6A 4EHEA 3QKMA 4RX7A 4F1TA 3KRRA 3DQXA 5E8UA 4ANSA 2B4SB 1DI8A 1JPAA 2YHVA 3ZFXA 1UKIA 2XK6A 4FVRA 4F7SA 2LGCA 1OBDA 3ACJA 2VO7A 1Z9XA 2FB8A 1Y91A 4EOLA 5AEPA 3NW6A 3NVKI 1VEBA 3RAHA 4CFUA 4EC9A 4FYNA 5LWNA 3CS9A 3U6HA 3AC4A 3QCQA 1UU7A 2A1AB 3NVMB 3EZVA 4N4SA 2ITVA 1AQ1A 3OCGA 3ZO1A 2W1CA 4FV0A 3R7GA 5AUTA 4G31A 4D2TA 4CRSA 4FKTA 4TYGA 2XRWA 3HV3A 4WOVA 5HD4A 1JOWB 2ITNA 3QTZA 3KF7A 4Z16A 4AE9A 4H3PA 4BHNA 4GKIA 3BGPA 1WBPA 2YM4A 4A9UA 2YACA 3Q60A 3TNWA 3VS4A 2PVMA 4EOMA 4NZWB 3D5VA 4OTGA 3WF6A 2PVNA 4D0XA 4CZUA 4M0ZA 4AA5A 4DH8A 3QWJA 2HW7A 3VQHA 3VUIA 2QU5A 4BCGA 3VS7A 5IH4A 3MESA 4FTNA 3LFFA 3MY0A 3LW0A 3KQ7A 1XR1A 1XHAA 2X1NA 3VC4A 3VBTA 5FEDA 3L8SA 3GU4A 5CAUA 2Z02A 4FV2A 3FY2A 3KB7A 4FVQA 5BVNA 5H2UA 4TYJA 3BX5A 3GU7A 5I4NA 1G8SA 5CNOA 1PF8A 3KMUA 5HE2A 3DBCA 4FKIA 2CSNA 3GT8A 3SV0A 4GKHA 3MJ2A 1ZMUA 2VGPA 4CG9A 1A48A 4I4EA 4Y85A 4YJVA 5JK3A 5EOBA 3MW1A 1UKHA 2BHHA 3R83A 3ZM9A 4B8LA 4O7YA 2ERZE 4O0SA 3GEQA 5CYIA 4AE6A 3P08A 2W1FA 5FBOA 2UW5A 1Q8UA 5AR5A 2G2HA 5E1SA 4E4XA 4GV1A 3CP9A 4YUQA 4ZSJA 5BX0A 1WCCA 5HIDA 3R9HA 2QR8A 2X8IA 4FKPA 4CRLA 2WTCA 2YERA 4QMYA 2XK4A 5K9IA 1KV2A 4LMNA 3E7VA 1XH6A 3EIDA 5CASA 3QTWA 4O0WA 4AZTA 2V7AA 3Q4ZA 4BDAA 4IZ7A 3A99A 4C02A 4MD9E 3VS3A 3GCPA 1STCE 5CAVA 1QPCA 3KK9A 3NPCA 3W2CA 3SAYA 3QHWA 4ORKA 4DH5A 3R8ZA 4D4VA 4BC6A 4C58A 2YM5A 3TUDA 4RA4A 3TDVA 5AV2A 5J7BA 4EONA 1FVVA 2GTMA 5IH6A 1Q8ZA 2X4FA 4JX7A 4R3PA 4Y8DA 5C8MA 3SOAA 4LOPA 2KULA 4N57A 4CKIA 3R8VA 3CE3A 4PQNA 5DT0A 4DGNA 4O7TA 4AN9A 2R2PA 4R5SA 4BBFA 4O0VA 5JFSA 4GG5A 4KD1A 4MK0A 2OG8A 4RIWA 1IA8A 5IQBA 3QTSA 4CQGA 3KY2A 4C61A 4F9WA 5HCYA 3FI8A 2B0QA 2UVYA 3CGOA 3UODA 2PMOX 5CS6A 4RVLA 4JIAA 3MH2A 4X2JA 3DXQA 1JSVA 1JKLA 3CJGA 3NYOA 5ETIA 1YDTE 2XK3A 3MFTA 1SM2A 2IO6A 4KIKA 4QQJA 2YAAA 3BIZA 4BHZA 1OIUA 3ZMMA 2WQOA 3H0YA 3A7JA 4P4CA 3F3WA 1HCLA 4AA0A 4LUDA 5FWKK 4ZZOA 2YM6A 2H34A 2WQEA 4YHJA 5FTOA 4LL5A 2VGOA 1FMOE 4K18A 4O0XA 3QYZA 4D58A 5DMZA 5EKNA 5I9YA 5M44A 4BCFA 4C4FA 4N6ZA 3DV3A 4YTCA 1WVXA 4P5QA 3EQFA 1RW8A 2BIKB 3OCBA 1ZY4A 4GJ2A 5HE1A 2XJ2A 3F66A 1YDSE 3P86A 3BPRA 2OGVA 5DR6A 3MA6A 3K5VA 4IADA 4WUNA 4QP7A 4FZ7A 4JDHA 4KWPA 4Z55A 4D2SA 2GU8A 4EYJA 1O6YA 4H39A 3GCVA 5HX6A 1GZNA 1Q8TA 3W2PA 4EHGA 1FINA 5M53A 2GQSA 3T9IA 3ZRMA 5A4TA 2HELA 2VWZA 2O2UA 3QX4A 4ACGA 3C4EA 4YO4A 1ZOEA 4BYIA 4XBRA 3AMAA 3LQ8A 5JFWA 3G0EA 1PKDA 1K9AA 4AP7A 2VTOA 4AFEA 4AS0A 4JDIA 4D2PA 2EB2A 3R9NA 4RSSA 4C57A 5DN3A 3KULA 3RPRA 4JG6A 5CSPA 1K2PA 4PNIA 1PXPA 3VS0A 1H08A 3WZEA 3SXFA 2W1ZA 3G9NA 3ROYA 3HLLA 2ZMCA 2F2CB 4DFXE 4TXCA 4FICA 3R7IA 4BCNA 2RKUA 5C8KA 4JR3A 4ZIMA 4FIEA 4UYNA 3MFRA 4BCIA 2X8DA 3LJ1A 3ZUUA 4B4LA 2GTNA 4X6RA 4CFMA 2I40A 1OVEA 2ITOA 1QPJA 3PYYA 4E5AX 2C5XA 3ULZA 3KXMA 4BL1A 3OTVA 2WU6A 2PMNX 2F4JA 4EHVA 4L68A 4YLJA 4XRLA 5L2SA 2C3JA 5M51A 3CY2A 4DE4A 3BHTA 1U54A 3LIJA 4JIKA 5CTPA 2R3IA 3MDYA 4LGHA 1UU8A 4RWJA 5L8JA 4GRBA 1OPJA 4EI4A 4N6YA 4FL2A 3RCJA 4OTPA 5HEZA 5K0KA 4OTHA 1U46A 4ASDA 1PMVA 1BYGA 2JGZA 3CSVA 3E93A 3BHUA 4JG8A 2X0GA 5CEQA 3V3VA 3UP2A 5CNNA 4UZHA 1J3HA 4IJ9A 2XIRA 3W2RA 3F69A 2WTIA 2NPQA 1REKA 4QMSA 5BVWA 4C59A 5A3XA 4CV9A 3EFKA 2YDJA 1XO2B 4IAZA 4AACA 4EJNA 4F7NA 4NYEA 3DKOA 2OI4X 3LZBA 1YOMA 4F63A 4S32A 5M4UA 4X3JA 4PTCA 3QA0A 4JR7A 3HA6A 4DGMA 2WEVA 2C6KA 3W33A 2PUIA 3A2CA 4BBMA 2BKKA 5EQYA 3W2QA 4HZSA 4M3QA 2C6EA 1R0EA 1GIIA 5EOLA 4C4EA 2WQMA 4BDJA 4HYHA 2R9SA 4CFVA 3UIMA 4RRVA 3DK7A 1IASA 3DPKA 3V6SA 1WBSA 1Q41A 1RQQA 4FYOA 3BGZA 3VS6A 4C35A 5JQ5A 2ITZA 5B2KA 3QXPA 4QQTA 5IDPA 5J8IA 2HZ0A 3U8WA 3HMMA 3S00A 5CLPA 4ZY4A 4XLVA 3D5XA 5AX3A 2IJMA 3COIA 3H3CA 3HV6A 4C3PA 1KSWA 2WEIA 4I0RA 3QHRA 4Q5EA 3W8LA 1OKVA 2QLQA 1BLXA 2YCQA 2QLUA 2O0UA 4NT4A 3KCFA 2BZIB 2CN5A 5D41A 5I9UA 1E1XA 3COMA 3HMIA 3BZ3A 4YHTA 4Z7HA 4NTSA 4QO9A 2ZAZA 4EC8A 4IHPA 5C8NA 4CNHA 3FI4A 4LRMA 4MQ2A 3GFEA 3FPMA 1GAGA 2P2HA 5DR9A 3P78A 4U79A 3RK7A 1Q97A 3PP1A 4E8AA 1YDRE 2IPXA 1H28A 3NDMA 3QAME 4KS7A 2IZRA 2HWPA 3O7LB 3KA0A 3FYJX 1J91A 2XKEA 3B2TA 3F3TA 2ONLA 3MH3A 4LRKA 2OK1A 3SC1A 5IF1A 4D9TA 4TRLA 2HK5A 4FSUA 2XP2A 2Z7RA 3DKGA 5FLFA 5FXRA 1BUHA 3FDNA 5I9XA 4F9YA 4AGCA 4LMUA 4TNBA 2XK7A 4KNBA 4RIOA 5L6WL 5AUZA 5IQHA 3AQVA 4BZOA 4J99A 2YIYA 3NAYA 4AZEA 2UUEA 3L9NA 2VAGA 5HORA 2PVHA 2UVZA 1ZYCA 4BTKA 4AA4A 5HTCA 3AD4A 4FBXA 3EH9A 2GQRA 2BIYA 2R5TA 4MNEA 4FTAA 1CDKA 3BYOA 4WNMA 2WMAA 3PVUA 4MD7E 1ZXEA 1PRYA 2E9NA 3RM6A 3U9NA 4Y95A 3JUHA 4HGSA 2BRBA 1UV5A 2O8YA 4JAJA 3THBA 1BI8A 2J50A 4FVPA 2QO7A 4NTTA 5E8YA 4QP1A 5F1ZA 3KEXA 2R3RA 4FA2A 1WBWA 1SNXA 1P4OA 5FDXA 4Y46A 5J1VA 2I0YA 4RPVA 4E1ZA 4DC2A 3ORZA 3W8QA 3RBWA 1Q3WA 1U5QA 3NWWA 3LMIA 2F7XE 5DT3A 3ORPA 4IEBA 3H10A 5CQUA 2QQ7A 3VJNA 3VAPA 4E73A 2W5BA 5KMJA 1H1RA 5HNIX 4CCBA 1EH4A 2BZHB 4HNFA 4QTAA 4RX5A 5HICA 4UN0C 4XP0A 1PXLA 3EKNA 4PMTA 4KA3A 3VHKA 1Y8GA 2IVSA 3EL8A 3OCSA 5K5XA 1OIYA 5C9CA 4FEXA 3OOGA 3TJDA 3C51A 5KZIA 3RTPA 5IA0A 4RVTA 5E8VA 3AMBA 1WVYA 5AIRA 4ANQA 4BCPA 5IZFA 4HCVA 4YSMA 4QT1A 2EVAA 1PKGA 5IUIA 4F70A 1YXVA 3F5PA 3ZEPA 3QTXA 3UOJA 3RK5A 2EU9A 2VRXA 3MA3A 3QUEA 2YIWA 2XA4A 3L9PA 5HG5A 4LGDA 1YHVA 5TR6A 4I22A 3UMXA 4AZWA 1GOLA 3NUPA 4BVUA 5KMMA 3REPA 3GU6A 3QD0A 3E87A 5A4QA 5FRIA 5ANDA 1BMKA 1O6KA 4U80A 1F0QA 3GNIB 4IIRA 1BX6A 4X2FA 2QURA 3PP0A 2WMWA 1ZAOA 1ZWSA 2IVTA 2VWWA 4EOOA 3PTGA 2VTNA 4LOQA 3E3PA 4E6CA 4GCJA 4A9RA 2QODA 4JVGA 3N4TA 4BRXA 3Q53A 4FKGA 3FMMA 1KOAA 3P1AA 3UMWA 2BALA 5CZIA 5BPYA 5I9ZA 3E7OA 3DOGA 4FNWA 4I23A 4D5KA 5HD7A 5JRSA 5KMLA 4B9DA 4M84A 4DLJA 3DGKA 2RFNA 2WMUA 3VHEA 2PVJA 5CSXA 1RE8A 4IX5A 3Q32A 1VYZA 5CEPA 2OJFE 5J9ZA 3KU2A 1NA7A 2V22A 2XUUA 5HCXA 3SGCA 3BWJA 2PYWA 3VIDA 2QHNA 2RFDA 2SRCA 2QU6A 2REIA 1MP8A 3R02A 4P5ZA 3I7BA 5E7RA 3GB2A 3TKHA 3FJQE 2YM7A 3JYAA 3N51A 1I09A 4YJTA 3S4QA 1XH4A 4KIOA 5AP6A 4DG2E 4XRJA 3TKIA 1OL6A 4BZDA 3LQ5A 3QL8A 3BEAA 2UW6A 3R1YA 3F6XA 2Y9QA 3RAWA 1TQPA 5AUVA 3KREA 4C4HA 3MGYA 1XJDA 2UZEA 3LQ3A 3NNXA 5D11A 5IA5A 3V5LA 2JBOA 3E62A 4MF1A 3OUNB 3VW8A 1Q5KA 4J53A 3LM5A 3FMKA 3PJ1A 5CVFA 3GU8A 5BVOA 3F9NA 3UQFA 3FLYA 1X8BA 2UZDA 4XG4A 4QQ5A 4A9YA 3V01A 2Y4IB 4O7SA 1VYWA 2W4JA 3FV8A 1XBCA 4O0YA 4QPSA 4R3RA 3MH1A 3MI9A 3CPCA 4OBQA 1KWPA 4TWCA 4YC6A 2JKOA 2XF0A 3A7FA 2QI8A 3ORLA 5HLWA 4ZTQA 5HTBA 4YTHA 4ZJIA 2OJGA 4FGBA 2O5KA 4XG3A 4UX9A 3QCYA 1Q62A 3BU3A 4M68A 5I9WA 2XKDA 4BDCA 2YFXA 3CY3A 1LPUA 2FH9A 3FZPA 4PTGA 3LCTA 4QPMA 3OEFX 4WNPA 4QMTA 5A9UA 3NMUF 4BDBA 4XS2A 4F6UA 2OSCA 2VTAA 2PK9A 1R39A 4KIPA 3PXYA 3G5DA 5HKMA 3VUGA 3W55A 1DM2A 3QFVA 5DA3A 3F2AA 3GENA 4AZFA 3IDBA 3FMJA 3C7QA 4Z3VA 4BR3A 2OZAB 2CLQA 2ZMDA 4LM5A 5CF8A 5EDRA 4BCQA 5FM3A 1M2QA 4BWXA 4ENXA 4ERWA 3GCUA 3K54A 5EG3A 2BRNA 2VTHA 3VUMA 2JITA 3P7CA 3GUBA 5FQDC 2CCIA 3DBEA 3FMEA 4WO5A 2FSOX 1SYKA 4GG7A 4QMUA 3PY1A 3QX2A 5CF4A 1T45A 4KINA 5J1WA 2ZOQA 2UV2A 2X2LA 5AUYA 5M4CA 3TM0A 2X7GA 2XRUA 3GCQA 4QD6A 5IQEA 2WTWA 3MVHA 3PSDA 5H8EA 2UW4A 3IW6A 4PMPA 3I81A 4IX3A 3UVPA 4H36A 1H24A 2XNPA 3NGAA 4HW7A 3OXIA 2J51A 4GK3A 2I6LA 3TJCA 4EOKA 4M69B 4RWLA 2A2AA 3P0MA 4FV9A 3RI1A 4BB4A 4R7BA 1OL1A 4DA5A 4I6QA 3ZZWA 3MTFA 3TL8A 4USFA 2ETMA 4LUEA 1P2AA 4E5WA 4M7IA 4JRVA 2A4LA 1R0PA 4FNXA 1M2PA 4IH8A 3ZOSA 2CKEA 4BF2A 3FQSA 4ZTMA 3D7ZA 3MY5A 5F9EA 3EN9A 3LCSA 4OTIA 2JD5A 2R3KA 4YZ9A 4DT8A 4QP4A 2PZPA 5I0BA 5FP5A 3ZONA 1KE7A 5LMAA 1NVSA 2BTRA 2RF9A 3ZRLA 1M2RA 2C0OA 3MJ1A 3MFSA 5AFVA 3UYSA 2OZOA 3EZRA 2RIOA 1UNLA 3LFQA 4NJ3A 5DGZA 3ZXZA 3IGOA 4W4WA 4BCHA 4EORA 3FZTA 3Q6UA 3P4KA 4BIEA 4D9UA 5EM8A 4H05A 2WTKB 2Y6MA 2ITWA 4FKWA 2R7BA 4G3CA 3U4WA 3ELJA 3UQGA 4EKKA 3OOMA 4EOQA 3BV2A 4O7VA 3E3BX 3IG7A 2BILB 4USDA 3LXNA 4FNYA 2V0DA 3ORTA 4FV8A 4O2ZA 4RMZA 5M08A 4BKZA 5CEKA 3KMWA 2J5EA 4FSQA 2R3JA 1LEWA 4DH3A 2CLXA 1A9UA 2P2IA 5H3QA 4AF3A 5IQDA 4YP8A 5C1QB 2YCRA 2XM9A 3E8DA 3DLSA 3EN5A 4EH6A 4OUCA 2PU8A 3G51A 4DG3E 2I1MA 4W4VA 3U6IA 4IVCA 4DEGA 4X3FB 2C6OA 3AXWA 4ZS4A 5AWMA 4TW9A 4WNOA 3D2KA 5A6NA 4EK8A 4BN1A 2PPQA 2UZTA 2BTSA 4MXOA 2J0MB 2OF4A 4FKOA 4WKQA 1YQJA 2IVVA 3PXFA 4MX9A 5CY3A 5FM2A 3T3VA 3V8WA 4DN5A 2I7QA 4ZZMA 2OH0E 2QOOA 4M12A 4CFFA 3I1AA 1T46A 3IQ7A 5CT0A 1YHWA 2WKMA 3LM0A 3O8PA 3S95A 1OKWA 1QCFA 2C1AA 3KCKA 3TZMA 1NT2A 2BDJA 3E8NA 3PXQA 3RZBA 3FUPA 4E93A 4YMJA 3PPZA 3TV7A 5DLSA 3W16A 3BV3A 5EH0A 2E9UA 2HW6A 3CC6A 4MVFA 2F7EE 5E8ZA 3RP9A 4UWBA 4D2VA 3PG3A 1OL7A 4IM2A 4F9BA 4CTCA 4J97A 3DDQA 4YTIA 4OTWA 3G15A 4FIHA 4ZLOA 3GI3A 3PJ3A 2W0JA 2WXVA 4XX9A 5ACBC 2PVLA 4V05A 4AN3A 3CD3A 4W8DA 3O71A 1G3NA 3O51A 4KIQA 3TACA 4CGAA 1H8FA 3FC1X 4R7IA 1VJYA 2JIUA 4JRNA 4RC2A 4WIHA 3AC2A 5HVYA 5IA3A 3VWAA 4I6HA 1APME 5EYCA 3RMFA 3VF8A 4YZBA 3FXZA 4AFJA 4ZZNA 5J87A 1NVRA 3HUBA 3RZFA 2C0IA 4IAIA 2PULA 5ETAA 3FEGA 1GY3A 2F2UA 4A4XA 4K0YA 4O81A 3U87A 3ZO3A 3DU8A 4NK9A 4CSVA 1XH5A 2XCKA 4LV5A 4RLLA 4EKLA 3QQHA 4ZK5A 4EK5A 2Y0AA 4S34A 2JFMA 2FSMX 4UMTA 1WVWA 1JAMA 3OZ6A 4G6OA 3OTUA 4ZY5A 3MIYA 4EH7A 3FSFA 4OT6A 3RK9A 4UMQA 1OPLA 3NNUA 3V04A 4UZDA 3VRYA 3U54A 5C4LA 1ZOGA 3KC3A 4Y5HA 2PUUA 2UW3A 4UYAA 4TYHB 3ZHPC 3NR9A 4FT5A 3WE4A 5DNRA 4J8NA 2ZM4A 4DEDA 5IA2A 2XB7A 3MPMA 3MY1A 1WZYA 3D4QA 3RCDA 4MD8E 2HXQA 4YZMA 3PZEA 3G6GA 4RX9A 3D7TB 3TIZA 2XIKA 1U4DA 4PMSA 3LLTA 3PXKA 1JSTA 3TUCA 3UJGA 2IW9A 1GJOA 2Q0NA 1HOWA 3QRUA 4FSWA 5LCJA 5EDPA 5IQFA 5CVHA 2UZLA 2IN6A 4RVKA 3GQLA 4J7BA 1F5QA 4CMUA 5JZNA 5AR4A 4RIYB 5IQIA 2R3GA 2VTIA 3AMYA 3UO4A 3N4VA 3OXZA 4J71A 3UO5A 5HQ0A 4QTDA 1ZYJA 3TEIA 3EOCA 3OS3A 4NM5A 4ANBA 5IPJA 5G1XA 5J9LA 1PXKA 4Q2AA 4N70A 3DBDA 1SMHA 5AAEA 3C4XA 1FPUA 2RFSA 3FWQA 3HNGA 3OP5A 3BCEA 5DEWA 3SOCA 5CANA 5KKRC 4IB1A 2Y4PA 1YI3A 4RJ6A 4UBAA 3R7YA 3D0EA 2GS2A 3IW5A 4M97A 3FZSA 1YKRA 2O63A 3ZO2A 2PUNA 1ZZ2A 2ITTA 5DT4A 4GSBA 2PY3A 4CD0A 3PIYA 4F6WA 4QMXA 5JKGA 3QRKA 4FI1A 5AV4A 4E6AA 5CSWA 1ATPE 3QWKA 4R77A 4QYGA 3UZRA 3MH0A 3WZDA 3LOKA 2CMWA 3KFAA 5FUTA 2OIBA 3WF9A 3WIGA 4BFMA 4JJRA 3ZLXA 4QOXA 3WF8A 4F1MA 3KXZA 5FBNC 5AX9A 4QMMA 3F2RA 2J0KA 3R9RA 2VO6A 3AD5A 4IVAA 4P7EA 4Z7GA 4FIIA 4ID7A 2VNYA 4X6QC 4JL9A 4FL3A 5DIAA 1REJA 4O7WA 4NW5A 5ANIA 1ZMWA 5F20A 3UG2A 5CSHA 2G01A 1K3AA 2VD5A 2WMRA 3ZUVA 3MVLA 3DBQA 2V5QA 3KL8A 4PL5A 4C7TA 4G9RA 4E5BA 3ODYX 3OVVA 5IU2A 4V0GA 1W84A 2J6MA 1HCKA 5IA1A 2A19B 3QU0A 3SXSA 3BI6A 4ZOGA 4O22A 1M14A 3N4UA 5ANKA 3NCGA 4DYMA 2JDRA 4TPTA 3I79A 3OY3A 1OECA 2WTDA 1SVGA 2VTRA 3P5KA 4AZVA 3CIKA 5HU9A 3UVRA 4XG2A 3UBDA 4FTUA 5HX8A 4XLIA 2B54A 4LV8A 5DWRA 2VUWA 2WD1A 4FKUA 2GFSA 5HZNA 4FSNA 2W5HA 3UC4A 1AD5A 4FC0A 2X2KA 3ENMA 3QCXA 4M14A 3DKCA 4S31A 4U43A 3O17A 5HG7A 3S3IA 3JXWA 3F5UA 3GFWA 4L46A 4YHFA 2QOIA 3ID6C 3LFCA 4D28A 2CGXA 2R7IA 3ACKA 5J9YA 4NEUA 3EB0A 4FV3A 4TKSA 4EK3A 1ZARA 3NUUA 3ORIA 4CFNA 2EXEA 3EQRA 2ESMA 3M42A 3ORKA 4K1BA 4CYJA 4DINA 2XJ0A 4DTBA 3D5UA 3EJ1A 4R8QA 1CKPA 1XH7A 5LQFA 2OJIA 2PVKA 5EHOA 4PNKA 1GNGA 4UV0A 5AP5A 4AT3A 2JAMA 2JLDA 4RJ8A 4J95A 2XNNA 5AV1A 3ITZA 4E4LA 2GS6A 4UWCA 4HGEA 1OPKA 3LMGA 5D10A 3AT4A 4EWQA 1Q24A 1MUOA 4E20A 3OEZA 3VUHA 4K11A 5K4JA 4E4MA 3ZM4A 2DUVA 1IAJA 2UW8A 3QD4A 2EB3A 3OBGA 4KRDA 2OZAA 4AGDA 4MXCA 4CT2A 3IPHA 4FODA 2C30A 3BQRA 3EQGA 3GVUA 5BVFA 1BL6A 4AGWA 4G16A 4FSTA 2E9OA 4KB8A 5AV3A 2YZLA 3NUSA 2W4KA 4P90A 2Q0BA 2HYYA 3R30A 4D1SA 4UEUA 3DCVA 3CLYA 1P5EA 3DB8A 3DTCA 2ITYA 3OROA 4S33A 4FTCA 4W4YA 4OTQA 5EHYA 2JDSA 2RGPA 1FVTA 3TTJA 5ANEA 2B9JA 3I60A 3U4UA 3ETAA 4DBXA 3WIKA 5IQAA 1WBTA 3E5AA 2WQNA 4G34A 4RLKA 4CMTA 5DYJA 3W32A 5CAOA 2WELA 3I5NA 5AMNA 3TNHA 5G6VA 3VO3A 4LFIA 4M69A 3OWLA 1Z5MA 4QMVA 4AAAA 3PFQA 4Y5QA 2XBAA 1AGWA 3ALOA 2FA2A 3D5WA 4RFMA 1KE5A 4I4FA 3ULIA 3NNVA 4KBKA 4JX3A 3RGFA 5JSMA 3PA5A 3KVWA 3DJ6A 3JPVA 4FTMA 4KRCA 5IH5A 2W5AA 2BDFA 2Z2WA 4JQ8A 3TG1A 1G5SA 3P79A 4S2ZA 3V5JA 3HGKA 1ERKA 4FTKA 1WMKA 4YBJA 3C13A 3M1SA 4O91A 3BYVA 5FDPA 2ITPA 1Q4LA 2WGJA 4ITJA 4BGHA 4BY9E 3G6HA 5F94A 3ORXA 5GJFA 3LHJA 4WRSA 2Y7JA 4DF3A 3O7LD 4BGGA 3HAVA 5LMKC 3N9XA 5H9BA 4O7ZA 5I3OA 3CTQA 3QD3A 4X0MA 1M7QA 4XOYA 4FTIA 3G0FA 3AC5A 4QP9A 4O83A 2Z8CA 1JSUA 1S9JA 2GSFA 3GBZA 3HMPA 4J52A 4L01A 4MCVA 4R3CA 4F08A 2WHBA 3S0OA 4YJOA 4DTKA 5CF5A 5KMOA 2OWBA 3OG7A 4CVAA 3UIBA 3UZPA 5BQ0A 1S9IA 4DCAA 2GCDA 4BGQA 2CJMA 5M06A 4D1ZA 4IDTA 3NZ0A 4WG3A 2WMTA 4HNIA 4YNOA 3QTIA 4U45A 4IX4A 4Q5HA 5IUHA 4X3FA 2R0IA 3K3IA 4KBCA 4AX8A 2G9XA 2WZJA 1H1QA 3UNJA 5GZAA 2C3LA 2VTLA 2YA9A 3NS9A 3ODZX 3T9TA 4DH7A 2VX0A 4DLIA 4AN2A 4CG8A 2GDOA 5M4IA 4HGTA 4JS8A 4HVGA 2HY0A 3UIUA 1FGKA 4GT4A 4CXAA 2QO2A 3VBQA 4BCJA 5CI7A 1FQ1B 4I3ZA 1M7NA 3QQFA 2R0UA 3ATTA 3C5IA 4ZMFA 3FZ1A 1MQ4A 4QYFA 5AR8A 3RINA 1Y6BA 1UNGA 4L6QA 5AR7A 5HBEA 4ZS0A 4I1ZA 3HP5A 3COKA 3OW3A 5CVGA 5EYKA 3OBJA 4G3EA 3FXWA 3T8OA 5EM6A 2C5OA 5C03A 3R63A 5BUJA 3O0GA 2B52A 1OBGA 4IM3A 3SG9A 2AUHA 1Y8YA 3FBVA 3IOPA 4NFMA 4RA5A 4YO6A 4LYNA 2IZTA 4IFCA 4ZJJA 4MTAA 3RJCA 5IUGA 4TTHB 2GNHA 5EW3A 4NW6A 2YLEA 2XKFA 1WBOA 4R1VA 5GHVA 3I5ZA 4J96A 2VTJA 4FTLA 4MXYA 4JT3A 4O96A 1RDQE 4ALWA 3EMGA 5C27A 4PPCA 3NUXA 4O6EA 4S30A 4ASEA 5GIPE 4QNYA 2YJRA 3Q5ZA 3QTUA 4U9AA 4OTRA 3R8PA 4IZYA 1JKSA 5EM7A 2C69A 3KKVA 5TKDA 3NNWA 2JEDA 2OICA 4JQ7A 1LUFA 4K33A 4M13A 4HPTE 3F3UA 5CT7A 4FT7A 4RZVA 5EI6A 2X4ZA 4NWMA 3GU5A 4ANOA 3HUCA 4TZRA 3HYHA 5HIEA 2HCKA 3JVSA 4HZRA 3Q4TA 1CSNA 1NXKA 4AQCA 4FZAB 4RQVA 4Q9ZA 5BYYA 3HRFA 4RIXB 4ZSEA 2ZV7A 1CTPE 4QYEA 5EI8A 3TN8A 2YDIA 5LMBA 1ZY5A 1JBPE 4QP3A 4E26A 3F82A 1W8CA 1JKTA 4PMMA 1IAHA 4PTEA 3LAUA 3PRFA 2GQGA 3QGWA 3FHIA 3EYGA 5DE2A 2Z7QA 3POOA 4DT9A 3CQEA 1XBBA 4DGGA 3L8VA 4AW1A 4QP8A 4AXAA 4EUUA 4WG4A 3LCKA 4NIFB 3QCSA 4F0GA 5KX8A 1MRVA 5M57A 5FGKA 2QOBA 3POZA 3R71A 4DEBA 4RQKA 3WF5A 4D5HA 3QQKA 2E9PA 2QG7A 2VZ6A 5EQPA 1JKKA 5E92A 2W7XA 1NW1A 3R8LA 2ZV2A 3Q3BA 4H3QA 5EYDA 4O6LA 1H0VA 1TVOA 1YWRA 2GFCA 4Z9LA 3ALNA 3DNEA 3EFLA 4BDIA 5T68A 1Q99A 3MPTA 2WMVA 2C68A 4XNEA 4QP2A 3ZC5A 3UG1A 2YJSA 5I3RA 4RT7A 3W18A 2RFEA 5GZ8A 4BTMA 2VTSA 2CN8A 5DG5A 2VN9A 3KF4A 5CENA 5IQGA 1ZOHA 3LXKA 2GHMA 3OF0A 2X81A 3FZOA 2V55A 4DEIA 5ETFA 1PYXA 3QF9A 5EDQA 4HVDA 3O50A 3OFMA 1YWNA 3I4BA 2FGIA 4GYGA 4MBIA 4IM0A 4QTBA 5ANOA 2CCHA 2UZVA 3DK6A 3M2WA 2C5VA 4MKCA 3QALE 1ZYSA 1Y57A 3BYSA 5BYZA 4M66A 4HYIA 5DRBA 2ACXA 5EM5A 4C3RA 5BUEA 1H07A 3Q9ZA 3F61A 4CMOA 4I5HA 4W4XA 2YM8A 4ZSAA 4C33A 5CU0A 4USEA 2XCHA 2UZUE
chains in the Genus database with same CATH superfamily
4K6ZA 3VBWA 2UZOA 2WB8A 1URWA 2ZV8A 4C4JA 2J0LA 1OMWA 4G6LA 3DAJA 4G3GA 5DR2A 4BWPA 4O2PA 4XOZA 1DS5A 1YXUA 2XAOA 3QC9A 1PMUA 3CPBA 5AJQA 1J7IA 5BVKA 5M07A 4LQMA 1B39A 5AP3A 4KAOA 3ET7A 3EL7A 1P4FA 1YOJA 3PRIA 4GJ3A 2QOFA 4XV2A 1ZLTA 5AR2A 5M56A 1W0XC 2WO6A 1FOTA 3DA6A 4L53A 5L2TA 3I0QA 3PY3A 1P14A 4OBOA 3GOKA 4A7CA 4IE9A 4FOCA 5H8BA 4ZSLA 2IZSA 5HU3A 4CTBA 3MTLA 4PV0A 3D2IA 2IWIA 3H9RA 5EYMA 3VVHA 4YJRA 4C2WA 1WFCA 3CEKA 4KKHA 1IR3A 1B6CB 2W96B 5CU3A 5K0XA 3WE8A 3V8SA 3R7UA 2ITUA 1LP4A 3F7ZA 3BBTB 4QMLA 1OM1A 3QUDA 3BHHA 4L3PA 3EQHA 2X7OA 1YXTA 4QMNA 2C4GA 4EQCA 4RC3A 5GZ9A 3HL7A 3C50A 3PJ2A 5DBXA 4GUBA 1JWHA 4F4PA 4FSZA 3PWYA 4OTFA 5D7AA 4EL9A 2J7TA 3S2PA 2YISA 4IB3A 4G2FA 5IQCA 3RVGA 3NLBA 4NSTA 3PE2A 4CT1A 4U7ZA 2WMQA 2XIZA 4WT6A 5L3AA 4KABA 4ZTRA 4QYYA 5B2MA 4GK4A 2VO3A 2P55A 4X2NA 5L6OA 3HECA 2DYLA 4NU1A 4YPDA 5HNBA 4C2VA 4MF0A 4IBMA 2GNFA 3TTIA 3BLAA 4WG5A 5AUUA 3PFYA 3SG8A 1R1WA 4PL3A 2IG7A 1ZYDA 2P3GX 4GU9A 3EN7A 3QD2B 1Q3DA 2JDTA 2BUJA 3PJ8A 2BVAA 4QYHA 3D15A 2BAKA 3OXTA 4GIIA 3VQUA 2YDKA 2WFYA 5BVDA 1IEPA 5L8KA 4YR8A 3AOXA 4OLIA 3SHEA 2W1GA 3C4ZA 5CSVA 2X9FA 5AUXA 2HWOA 3MFUA 4MYGA 4O0TA 3LKMA 3LVPA 3HRBA 3UP7A 3COHA 4PDYA 2QG5A 3ZZEA 3EWHA 5J7HA 4O84A 1SNUA 5FD2A 1YOLA 1OKZA 3BLQA 4K8AA 1Q8YA 1VZOA 3AT2A 3AGLA 3SRVB 3TV4A 4F6SA 5I5ZA 3DFCB 3F3VA 4DH1A 3QGYA 3QQLA 4HVHA 5DRDA 3ZEWA 4IAYA 1YXXA 1YI6A 3PVWA 5HTIA 2ZB0A 2OFUA 4M0YA 2G15A 2Z60A 4I6BA 2BPMA 2X6DA 3BE2A 5FXSA 5HG9A 3C0IA 3HEGA 1Q8WA 4LL0A 4J98A 5HCZA 4C0TA 4ZLZA 3VULA 3LFBA 3DLZA 5AUWA 4HGLA 3FMHA 3B8RA 3C4FA 4FG8A 4AWIA 3ZSGA 1U5RA 4TWNA 3IS5A 2W4OA 1ND4A 3DBFA 4ZTHA 2HZNA 2YABA 3E8CA 3Q5IA 2QOKA 4FKQA 3FSKA 5ANJA 4ALUA 4KUJA 1KOBA 4XUFA 3OUKA 2W99B 2BRMA 4MEDA 2PSQA 3ORNA 2PVRA 4U6RA 3UDBA 3CXWA 4EK4A 5LXMA 5A4EA 5BMSA 2J0IA 2QO9A 1H0WA 3NAXA 3LXLA 3SX9A 1PYEA 1CMKE 3NUNA 1G8AA 1OL5A 3FKNA 4HPUE 2X7FA 4CLJA 1YVJA 4FF8A 2C6DA 3DZOA 3ZO4A 2UVXA 4BDHA 3HMNA 3MIAA 5JRQA 3Q6WA 3TV6A 2WIPA 2QC6A 2UZNA 2YN8A 4E6DA 3PIZA 1MQBA 3PZHA 2A0CX 5HBHA 3FHRA 4O38A 2UZWE 3ZSIA 2PUPA 3G33A 4FKJA 4ACDA 5TE0A 3BU6A 4LV7A 4IFGA 2V62A 4I0SA 4IMYA 3VW6A 1OUKA 3U55A 4I41A 1PHKA 3NYVA 2W05A 4FT3A 4WNKA 5C01A 4M15A 2XYUA 2ERKA 4FEQA 4NM3A 1W2FA 1J7UA 2I0EA 2B9FA 3LJ0A 4A4OA 5AIKA 5D9HA 1UWHA 3W1FA 4FTQA 5LWMA 1QMZA 2J5FA 3R6XA 4M67A 4R7HA 4BWKA 2JC6A 4O0UA 4F99A 3QRTA 2HZ4A 3TCPA 2NRYA 4Y73A 2PHKA 2Z7SA 4JNWA 2W1DA 3CCNA 3IDCA 4GFMA 4MNFA 3QBNA 4IB5A 4FSYA 5KHWA 5EHLA 1JLUE 2XNMA 3CQUA 2CKPA 1OUYA 2UW9A 3T3UA 5DOSA 3MV5A 4W9WA 5AP0A 3VS5A 4AOJA 2FYSA 4AOTA 3WILA 3EQDA 3IK3A 4PP9A 4DAWA 5KMKA 2BROA 2YCSA 4XV3A 5FG8A 5JFXA 3MS9A 5GIOE 4RWKA 2OO8X 3BE9A 2WTJA 4AT5A 1W98A 4U3YA 3Q04A 3VRZA 2AYPA 3PLSA 2H96A 3KRXA 3MWUA 4R5YA 1NVQA 3ROCA 4DITA 4N0SA 3SVVA 1V1KA 3QZGA 1KE9A 3JY9A 4FKSA 5FEQA 3KXGA 2PTKA 3E92A 3WBLA 5HI2A 3OW4A 2ZVAA 2QOQA 4E3CA 4IDVA 4WSYA 2LAVA 5LARA 3VN9A 4ENYA 2XANA 3V5QA 1OB3A 2XNOA 2GMXA 3RAKA 4NFNA 2IW6A 5ANGA 5KBQA 3IO7A 2R64A 3FQEA 4FGRA 5E8SA 4WRGA 3RHKA 4CZTA 5KMNA 2GNLA 2WMSA 3NSZA 3R28A 5H8GA 4YJNA 4E4NA 3FMNA 2C5NA 2O64A 4B7TA 4ANNA 2H9VA 4WA9A 5K3YA 3OWJA 4ASZA 2A98A 3FY0A 2VU3A 4AXEA 3MB6A 3LFDA 3FYKX 2OF2A 4QPAA 4ACCA 4YJQA 4AU8A 4F9AA 3GC9A 3SW7A 2CGUA 5IEVA 4ZSGA 3WYYA 3NEWA 2C6MA 1TKIA 3K5UA 4H3BA 4K77A 4RIXA 4IWQA 4FSMA 5AV0A 2ZV9A 3R0TA 4IANA 4XP3A 3ZSHA 4DBNA 2YZAA 2IZUA 1XBAA 3UYTA 3PUFC 3QUPA 3UPXA 4FIJA 3CR0A 4L3LA 3WOWA 5IG1A 5KUPA 5AP1A 4BI2A 3A8WA 3GOPA 4I6FA 3R1QA 4ARKA 3RNIA 5A4LA 5IA4A 3PY0A 3W0NA 4GH2A 2EXMA 3A4PA 2J4ZA 4UWYA 4GIHA 3OC1A 4NIFA 3S1HA 2BMCA 3C1XA 2CPKE 4GS6A 4HVIA 2YIXA 3F5XA 3A60A 2PE2A 5HHWA 3H4JA 3VBXA 5KKRB 2X0PA 5D7VA 3HMOA 3UE4A 4YGAA 3TT0A 3DS6A 3R73A 2VWBA 5A6OA 2C3IB 1BI7A 3NIEA 4EH9A 2CGVA 3QQGA 4MNEB 3PXZA 3H9FA 4PL4A 5CX9A 2F57A 3ZXTA 4CEGA 3QRIA 3Q9XA 4IB0A 4HYUA 5JFVA 4ANLA 4O86A 4A4LA 4NM0A 4NM7A 4F7JA 5C26A 4ZLYA 1UA2A 2ONLC 4ERKA 2UZBA 4XBUA 3BLRA 4FX3A 2PMIA 4IQ6A 3A7IA 2JKQA 2XYNA 1WBVA 2BFXA 2XS0A 3E8EA 5AA9A 2W1EA 4YSJA 4YURA 4ANMA 1DI9A 3FAAA 2VTQA 4XG7A 4XP2A 3BHVA 4U8ZA 5C4KA 3W10A 4DEHA 4IAAA 5LVOA 3FLQA 2VX1A 4YNEA 3A61A 5GJGA 4CYIA 5CAQA 3IONA 4FG9A 3W2SA 3AT3A 2H8HA 2XBJA 4C3FA 4EZ7A 4ZTNA 5IDNA 2OXDA 5AP4A 4O1PA 2F9GA 3CQWA 4GYIA 4CKJA 4BCMA 5JGDA 4L00A 4QQCA 3DAEA 4K9YA 4XG8A 1OKYA 2XNBA 2AQXA 1KUTA 2XM8A 4TWPA 2ZB1A 2VWYA 3IW4A 1PXMA 4IWOA 2CNUA 4UXLA 4KKEA 4DFBA 2C0TA 3DB6A 5DI1A 3TNIA 3F7WA 4OT5A 2R3LA 3IOKA 4YZNA 1L8TA 5EFQA 2JKMA 3BLHA 5JEBA 1FGIA 4RGJA 4IVDA 1PXNA 3UOLA 4L9IA 4XV9A 3I6WA 4IJPA 3CTJA 1YW2A 2WOUA 4IVBA 5HLPA 4A9SA 4IACA 5CEOA 3C0GA 4PY1A 4Q9SA 4GT5A 2DS1A 4L44A 3NYNA 5DH3A 3RM7A 4YZCA 5KO1A 3C4WA 2I0HA 5LVNA 2G1TA 3CKXA 3LPBA 4JI9A 2CKOA 4YLKA 4YC3A 4HVSA 2EXCX 4G9CA 4OR5A 2XNGA 3QC4A 2F49A 2C5YA 3EYHA 3C4CA 3ZRKA 4BIDA 3PXRA 3ZLWA 2Y6OA 2R3PA 2VWVA 2CHLA 2QKWB 4EH4A 5E8WA 4BDGA 5DPVA 2GHLA 4G1WA 4MBLA 4JLCA 5EQEA 2YITA 4FV1A 2H6DA 2W1IA 3GP0A 1PY5A 4FKRA 2R4BA 2VTTA 3H9OA 4NUSA 3CTHA 4MXAA 5FP6A 2YWVA 2B9HA 3ZYAA 1OIRA 4QNAA 3R7EA 1OITA 3CD8A 3LFAA 3R2BA 5CQWA 4L52A 4AW2A 4PDSA 3KMMA 4WD5A 5EW8A 3VUDA 3ZU7A 4DHFA 2X6EA 3HKOA 2C6LA 1G8KA 4FUXA 3IKAA 2WPAA 2XKCA 5ACKA 4OAVB 4BKYA 2YIRA 3B8QA 3PDTA 4DHIB 1PMEA 4MWHA 4Y83A 4HYSA 5KE0A 4FZDB 3MYGA 2AC3A 3QQJA 3NUAA 1R78A 4HOKA 1IA9A 3QA8A 4D2RA 4QMZA 5A4CA 5CEIA 1PJKA 3SKCA 2HAKA 4JDJA 4WBOA 4LOOA 4WSQA 4UALA 4G5PA 4BBEA 3UNZA 3AC8A 2HIWA 2CNVA 2PWLA 5AP7A 5CWZA 4FR4A 3C0HA 4JXFA 5ITAA 2WU7A 1E1VA 3AC1A 3OWKA 3D94A 4X21A 3KXXA 3VNTA 4JMQA 3D14A 2XNEA 3H30A 4G3DA 4B8MA 1UWJA 4FV4A 3DXPA 4IWPA 5KHXA 3O8UA 3RWPA 4APCA 4FT9A 3HV4A 2XMYA 4KBAA 2GHGA 2XIXA 3RAIA 3MN3A 5LOHA 2QOHA 5AP2A 5BYLA 2E9VA 4FZ6A 3I0OA 2PZ5A 3RPOA 3JS2A 5I9VA 1JQHA 3Q2MA 2RL5A 4GVAA 3BWFA 4ACHA 2ZDTA 5EI2A 3DQWA 3SRVA 1QL6A 1WBNA 4L3JA 3IW8A 2JFLA 3DTWA 3AGMA 3LFEA 4G3FA 4XHKB 3HV5A 4NL0A 4XV1A 2XAMA 3HAMA 1CKJA 5E8XA 4QDVA 2UW7A 3R2YA 4CLIA 4RC4A 4I21A 3U6JA 3PUPA 2C47A 3Q4UA 2QD9A 3IDPA 3OWPA 3QZFA 2R3QA 4GUEA 5JMSA 2OLCA 2WMBA 3VUTA 1V0OA 4DHZA 4XG9A 4YLLA 3ATSA 4U5JA 3OHTA 3O2MA 2W9FB 2BRGA 5GINE 3FMDA 4PPAA 3P5JC 2Z7LA 5JQ8A 2B7AA 4HCTA 1WAKA 3DNDA 4JBPA 3ZTXA 5J5TA 4D1XA 3IGGA 3QKKA 3UVQA 4XEYA 5D12A 1W83A 3DY7A 5A14A 4OAUC 4JBVA 5IEYA 4LGGA 3ZH8A 1PW2A 3DFAA 5BVEA 1RJBA 1DAYA 4TT7A 4ACMA 3UPZA 3QLGA 4B6LA 4FUYA 4PF4A 1QPEA 4OBPA 4OTDA 4NCTA 4NH1A 1Z57A 3UOKA 3V5PA 1BKXA 3NW5A 1PXJA 3GXLA 3DT1A 3QLFA 4B99A 4GFGA 3BU5A 4RBLA 4KSQA 2JKKA 5JGBA 3UZTA 2QOCA 5L6PA 5JH6A 2WOTA 3PPKA 3Q4CA 3TNPC 1W7HA 3OT8A 4YJSA 3V5WA 4EQMA 5AAGA 5FXQA 5A46A 1TQMA 1XH8A 4FKVA 3V6RA 5HNGA 4QEBA 4MAOA 3O5AA 4FV5A 2CDZA 3HRCA 3MSSA 3NRMA 4J1RA 1OI9A 2W1HA 4UY9A 5K5NA 3O8TA 2C6IA 3AG9A 3E63A 2B53A 4AW0A 5FTGA 1OZ1A 1XMLA 4DEEA 5L2QA 5CXZA 1B38A 4ASXA 3E64A 4BKJA 3ML1A 1H01A 4PUZA 5HE3A 3TZ8A 5CALA 4TNDA 1VR2A 4A9TA 3R7OA 5HGIA 5T3QA 2J9MA 5JGAA 4O7RA 4ZTSA 3H0ZA 5E1EA 5HESA 4F0FA 4QTEA 1KE8A 2CGWA 4FKLA 5CZHA 4WUAA 2VNWA 4KKGA 2QOLA 5J79A 3FKOA 1YHSA 3LCOA 5IEXA 3SA0A 3AD6A 4HCUA 4IZ5A 4EOJA 3DK3A 4E6QA 3ZBXA 4UMPA 1MRUA 4O7NA 4FE2A 4XMOA 2C3KA 2QONA 4AUAA 2R3OA 4C8BA 3L8PA 3QTRA 4FIGA 4C34A 5K4IA 2QNJA 3R9DA 4EEVA 2PZIA 4AGUA 4FNZA 2NO3A 4I5MA 3NW7A 4FSRA 2YIQA 2ZJWA 4IW0A 3RALA 4D4RA 4LG4A 3RKBA 4DCEA 2ZYBA 1URCA 3WZKA 4ITIA 1SZMA 2AC5A 3Q9WA 3GC0A 1UU9A 3HX4A 3KRJA 4RFZA 3UQCA 4FV6A 3G90X 2QCSA 5DEYA 2GNJA 4EZ5A 5KMIA 2NRUA 3AC3A 4I94A 4O0RA 3JR1A 5HBJA 2WTVA 4FTTA 3TKUA 4UMRA 5HE0A 2F7ZE 5JN2A 5L8LA 5B0XA 2BAQA 3SXRA 4A06A 2CNQA 2J2IB 3Q9YA 3UIXA 4PWNA 3WYXA 2OIQA 3GC7A 2W06A 3R1NA 4FG7A 3PSCA 4MXXA 5IISA 3LFSA 2HENA 3PVBA 4MXZA 2RSVA 3ZLYA 4BTJA 5HLNA 4DGOA 4J8MA 4O4DA 5JZJA 1L3RE 5CU4A 3ANRA 5HVKA 3GQIA 1CM8A 4GW8A 4CKRA 3PPJA 4B0GA 2VWXA 3DJ7A 4GK2A 2P33A 2GPHA 4JBOA 5CEMA 3FQHA 4U0IA 4XYFA 1SVEA 3UC3A 4GMYA 4D2WA 4EZ3A 4I93A 1QPDA 2OXXA 3LJ2A 5DVRA 4DFZE 4BDFA 1XH9A 2BHEA 3BGQA 3GC8A 1ZYLA 1M17A 4QMWA 2Q83A 3VBYA 2VO0A 3R7VA 1FVRA 3DAKA 2XH5A 3A8XA 2YLFA 2DQ7X 4EOPA 2RG5A 2FSTX 3HZTA 4PRJA 4FZFB 2YCFA 5CU2A 4TYHA 4PX6A 2UW0A 4FTJA 4YTFA 3I6UA 2PL0A 4APPA 4DEAA 5CI6A 2YAKA 4I24A 3R22A 3PJCA 2OKRA 2B9IA 4L67A 3BEGA 3VS2A 3ZC6A 3ZDIA 4Y72A 3UGCA 3IW7A 2BFYA 3BBWA 2PVYA 3D7TA 1NY3A 3EN4A 2XEYA 3Q2JA 2PZYA 3ZCLA 4ZEGA 3FPQA 4RJ3A 4MH7A 1ZRZA 4EQUA 4RJ5A 4CQEA 2EWAA 3FI3A 3NIZA 1YI4A 1PXOA 3DDPA 2JIIA 2WAJA 3PSBA 4TYEA 3HP2A 4II5A 4U3ZA 4RIYA 4O82A 1SVHA 3HVCA 3C9WA 3TIYA 4DFLA 3F3ZA 4O4EA 4PP7A 2ITXA 2OJJA 3FXXA 3NCZA 4G17A 3L1SA 3R1SA 4DGLC 3WI6A 4F09A 4AG8A 3G9LX 3KN5A 4I5CA 4EH3A 4H1JA 3QRJA 4RZWA 2FVDA 3V51A 3TI1A 3FLNC 3FLSA 5GJDA 4V04A 3AKJA 2YWPA 1OGUA 2QHMA 4BZNA 4ONAA 3TZ7A 3NUYA 4IXPA 4LRJA 2JDVA 3EN6A 2Y8OA 4C4GA 2VTMA 4IC7A 2P0CA 4BYJA 2X9EA 2GNGA 3RHXA 3RNYA 3D83A 3A7GA 3NYXA 3PA3A 5M55A 4CV8A 4V01A 3Q96A 5CAPA 5CF6A 5LCKA 4C36A 3KXHA 2E2BA 2OW3A 1U59A 3LLAA 4A07A 4TN6A 2JAVA 3PE1A 4U44A 1GZOA 4U40A 5HG8A 2O3PA 3NFGB 4H1MA 4FT0A 4R6VA 5J5SA 4AW5A 4GT3A 4U41A 4XH6A 2JDOA 3BYUA 4RVMA 5HOAA 1FMKA 4EH2A 3WZUA 4YU2A 2O65A 3FLWA 5A54A 3GGFA 4L8MA 3KXNA 4FEUA 3PLAE 3UOHA 4JAIA 3II5A 4IZAA 4XG6A 1OIQA 1Q61A 3CJFA 5F95A 4EJ7A 1CKIA 1W82A 1ZZLA 2BDWA 2I0VA 3DZQA 2XJ1A 4GU6A 4RG0A 4CFWA 4K2RA 2FO0A 3KRWA 3WZJA 5BUIA 4YPSA 4E7WA 4I5PA 2XK8A 1LR4A 3QXOA 2J0JA 1OL2A 3FLZA 1GZ8A 1LEZA 3GCSA 3RWQA 2VV9A 3MBLA 3FMLA 5HO6A 4ZP5A 5KBRA 4ITHA 1GIJA 1UVRA 5DFPA 3QZIA 2QR7A 3G2FA 2BRHA 3QKLA 3BELA 4FMQA 1JVPP 3ZLSA 1PMNA 1R3CA 3OD6X 2IW8A 4UXQA 2C6TA 3W2OA 5HVJA 1ZMVA 2KTYA 5E90A 5TOZA 4AT4A 3R21A 4DFNA 1YWVA 3LMHA 3WARA 5EK7A 1J7LA 4W8EA 2FUMA 2BZKB 3BL7A 3EKKA 3I7CA 4FL1A 4IX6A 5F4NA 3QYWA 5E91A 2P4IA 4YJUA 4EOIA 3P7AA 3ANQA 1H00A 2B55A 4RJ4A 4ZJVA 2BCJA 5KNJA 3O23A 4OGRA 4UB7A 3FZRA 3FL5A 5E4HA 5CXHA 3R01A 4PDOA 4V0GB 5EKOA 5IKWA 5TO8A 2VWUA 3BRBA 3DJ5A 3OT3A 4L45A 4ALVA 4AOIA 2C1BA 3F2NA 3LCDA 4W9XA 5L2IA 4ZAUA 3ZFYA 3VS1A 3ENHA 4MHAA 4I92A 3VF9A 4D55A 4EK6A 4BICA 2NNWB 3VBVA 3EFJA 3FL4A 4WBBB 4RIWB 5HO7A 5B7VA 2QVSE 2JBPA 4ZXTA 4X2KA 2R3NA 2OBJA 3UDSA 1UNHA 4QTCA 4BIBA 2BR1A 1H4LA 3PVGA 3MB7A 3P9JA 2OJ9A 2VX3A 4RX8A 1V0BA 3OY1A 4XJ0A 5HIBA 4AZSA 4BCKA 3HA8A 5ICPA 3TUBA 2FSLX 3CBLA 3NFFB 4QRCA 2OXYA 3BKBA 4QDEA 3UTOA 3QQUA 4GL9A 3BHYA 3U51A 3QZHA 3TZ9A 3EFWA 4TY1A 4KIKB 3DXNA 4P2KA 4WHZA 5E8TA 4L42A 4FEVA 4F64A 2WQBA 3SQQA 1XQZA 5LJJA 2CKQA 4IC8A 4PDPA 5TT7A 5HO8A 1H1PA 4GFOA 1TFFA 4EWHA 4TWOA 4EBWA 3FE3A 3C5UA 4M8TA 4PPBA 5IMXA 2ETRA 2R3MA 4I6LA 2W17A 4FV7A 3WF7A 2QKRA 3EQCA 5LMKA 2W9ZB 4G6NA 4YZDA 3L9MA 1IG1A 4FTRA 5GNKA 4ZY6A 4X7QA 4BI1A 1XWSA 4C37A 4DG0E 2PMLX 3A7HA 3DKFA 3KVXA 4IWDA 2VTPA 2Y4IC 2NYAA 5LVMA 1UU3A 3HDNA 2R3HA 4U97A 3KRLA 4ZTLA 3K3JA 3TXOA 3ZBFA 1M52A 2WNTA 5E9EA 4CFXA 3Q52A 3LXPA 2PE1A 4C62A 2IVUA 4AXCA 4EH5A 3TDWA 3ERKA 5IMEA 4R1YA 4FK3A 2BKZA 3EQIA 4D0WA 4L7FA 4TYIA 3JVRA 3FC2A 4IAKA 1DAWA 1PXIA 4NKAA 2YM3A 4H58A 4EUTA 1H1SA 2HOGA 3SD0A 3HV7A 4X2GA 4F7LA 1FBNA 4OW8A 1GIHA 4DTAA 4EOSA 2GS7A 3D9VA 3EQBA 3LFNA 4NJDA 4G5JA 3KULB 2PVFA 4QMOA 4YC8A 3ZFMA 3F88A 3BQCA 4JBQA 4FTOA 4F0IA 2XK9A 4O21A 3A4OX 5AADA 5AA8A 4QMPA 4AAYA 1E9HA 4MQ1A 5AAFA 4NKSA 3UO6A 3E88A 4RWIA 1YRPA 4YBKA 4UMUA 2OIDA 2OU7A 5AM6A 2RG6A 3PWDA 5J95A 2EUFB 3PG1A 4D4YA 4JQEA 3IECA 4BDKA 5BNJA 1JNKA 4FOBA 5BMMA 1I44A 4CCUA 4HJOA 3MVMA 3SW4A 3UNKA 2B1PA 2ITQA 4EH8A 2OH4A 4JOAA 4LI5A 3OCTA 4F1OA 1U54B 3VJOA 4FJVA 4DDGA 3CGFA 5AR3A 4BDDA 1H25A 3KN6A 2DWBA 4QMQA 1O6LA 5M09A 4O4BB 4O27B 1H27A 4F9CA 3MVJA 1XKKA 3EQPA 5M4FA 5TF9A 2ZDUA 4BDEA 1J1CA 2ETKA 4R78A 3PIXA 5L2WA 4XCUA 2X39A 5FEEA 5LVPA 4DFUA 3L9LA 2NP8A 4JDKA 3TNQB 5LVLA 3V5TA 4GEOA 2R3FA 3QTQA 4MWIA 3HDMA 5T6KA 3R8MA 3RPSA 2HZIA 2PZRA 3R9OA 4C38A 4I20A 4FIFA 4EYMA 4I0TA 3SLSA 4F65A 4FEWA 4NCTC 3TWJA 2WIHA 2XEZA 2XVDA 3K2LA 3MPAA 2ZM3A 2VWIA 4O7LA 4YJPA 2J90A 3O96A 5KCVA 3SDJA 3V8TA 2X2MA 3U9CA 3F5GA 5CU6A 4EBVA 1Y6AA 4U42A 3ORMA 5KZ0A 2WMXA 3B2WA 5ETCA 2WTKC 3EHAA 5L4QA 1YXSA 2BZJA 4KS8A 1J1BA 1BL7A 2G2IA 2BAJA 3CKWA 3NX8A 4L43A 4IAFA 4RJ7A 5AM7A 3RPVA 1H26A 4U81A 5DHJA 3L8XA 3R8UA 1F3MC 1MRYA 4L7SA 4GVJA 4QP6A 1A06A 3RPYA 1O9UA 2GNIA 4JG7A 1KE6A 3P7BA 1H1WA 3FKLA 4RFYA 5B2LA 2A27A 2HY81 2XIYA 4D4SA 5JT2A 1IRKA 2ZM1A 3A62A 3JY0A 4MBJA 4ZMEA 2V7OA 2X8EA 3ZUTA 3BYMA 4C4IA 2JIVA 5D1JA 4X3FC 3P23A 3KGAA 4O1OA 1V0PA 4BTFA 3R04A 3VUKA 1KV1A 4DFYA 3M11A 4BI0A 4FK6A 3OMVA 5FTQA 4CZYB 3R00A 4KSPA 4BCOA 3KK8A 2YEXA 3FI2A 2HXLA 2G2FA 1GZKA 2XZSA 5EW9A 2OFVA 3ZDUA 3PA4A 2PE0A 1TQIA 3ZS5A 4EHZA 4TL0A 3LE6A 4EHEA 3QKMA 4RX7A 4F1TA 3KRRA 3DQXA 5E8UA 4ANSA 2B4SB 1DI8A 1JPAA 2YHVA 3ZFXA 1UKIA 2XK6A 4FVRA 4F7SA 2LGCA 1OBDA 3ACJA 2VO7A 1Z9XA 2FB8A 1Y91A 4EOLA 5AEPA 3NW6A 3NVKI 1VEBA 3RAHA 4CFUA 4EC9A 4FYNA 5LWNA 3CS9A 3U6HA 3AC4A 3QCQA 1UU7A 1VLRA 2A1AB 3NVMB 3EZVA 4N4SA 2ITVA 1AQ1A 3OCGA 3ZO1A 2W1CA 4FV0A 3R7GA 5AUTA 4G31A 4D2TA 4CRSA 4FKTA 4TYGA 2XRWA 3HV3A 4WOVA 5HD4A 1JOWB 2ITNA 3QTZA 3KF7A 4Z16A 4AE9A 4H3PA 4BHNA 4GKIA 3BGPA 1WBPA 2YM4A 4A9UA 2YACA 3Q60A 3TNWA 3VS4A 2PVMA 4EOMA 4NZWB 3D5VA 4OTGA 3WF6A 2PVNA 4D0XA 4CZUA 4M0ZA 4AA5A 4DH8A 3QWJA 2HW7A 2ZFYA 3VQHA 3VUIA 2QU5A 4BCGA 3VS7A 5IH4A 3MESA 4FTNA 3LFFA 3MY0A 3LW0A 3KQ7A 1XR1A 1XHAA 2X1NA 3VC4A 3VBTA 5FEDA 3L8SA 3GU4A 5CAUA 2Z02A 4FV2A 3FY2A 3KB7A 4FVQA 5BVNA 5H2UA 4TYJA 3BX5A 3GU7A 5I4NA 1G8SA 5CNOA 1PF8A 3KMUA 5HE2A 3DBCA 4FKIA 2CSNA 3GT8A 3SV0A 4GKHA 3MJ2A 1ZMUA 2VGPA 4CG9A 1A48A 4I4EA 4Y85A 4YJVA 5JK3A 5EOBA 3MW1A 1UKHA 2BHHA 3R83A 3ZM9A 4B8LA 4O7YA 2ERZE 4O0SA 4DDIA 3GEQA 5CYIA 4AE6A 3P08A 2W1FA 5FBOA 2UW5A 1Q8UA 5AR5A 2G2HA 5E1SA 4E4XA 4GV1A 3CP9A 4YUQA 4AXDA 4ZSJA 5BX0A 1WCCA 5HIDA 3R9HA 2QR8A 2X8IA 4FKPA 4CRLA 2WTCA 2YERA 4QMYA 2XK4A 5K9IA 1KV2A 4LMNA 3E7VA 1XH6A 3EIDA 5CASA 3QTWA