4PWNA

Crystal structure of active wnk1 kinase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
274
structure length
245
Chain Sequence
KAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDFKEEAEMLKGLQHPNIVRFYDSWESTCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase WNK1
publication title Chloride Sensing by WNK1 Involves Inhibition of Autophosphorylation.
pubmed doi rcsb
source organism Homo sapiens
total genus 70
structure length 245
sequence length 274
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4pwnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4pwnA01
2WZJA 4FOCA 4J8NA 4S34A 5JGAA 4RFYA 5E7RA 5CEPA 2EU9A 2QCSA 2YLEA 2VRXA 3OWLA 5E8ZA 2XIRA 4OTHA 4U8ZA 4AOIA 4UXLA 4J71A 1Q99A 5T68A 3MH2A 3KGAA 5FWKK 4X21A 4D0WA 4N57A 4IAYA 4R3CA 1IA9A 3MS9A 4U80A 1NA7A 2WFYA 3S3IA 2C5OA 4CRLA 4EHEA 4F0GA 1ZAOA 5FTGA 4LOPA 4R78A 3A60A 4FTLA 5F4NA 4UYNA 4PTEA 2UV2A 2HENA 3GU5A 2JIVA 2WTJA 3O23A 3VS5A 3DBEA 4HW7A 2JDVA 3KVWA 5GNKA 1K2PA 4KINA 5HG8A 2RFNA 4RX5A 5L8LA 3FC1X 4RSSA 3AC2A 3GU6A 5L6PA 3ZFYA 2W5HA 4X3FA 4BCPA 3ZTXA 4IM2A 2WNTA 3BHHA 4YP8A 5IA0A 5CF8A 2QOHA 4K18A 1XWSA 4RIYA 4N6YA 4FVPA 2VWWA 4FZFB 4BI0A 3TACA 3EN6A 3MFTA 3F3VA 3LCOA 4QQCA 2YAKA 4FC0A 1L3RE 2I7QA 3LCKA 4J53A 4XYFA 5CS6A 5FP6A 4PX6A 3O71A 3C4WA 3HA6A 4FKOA 2C6KA 4FV8A 5CAUA 5M4UA 3C4ZA 4PDOA 4YURA 3SLSA 4WHZA 2OH0E 3LE6A 4OTGA 4UMQA 5ANGA 4I92A 3W32A 3D7ZA 1H0VA 2BZHB 4YNOA 5JZNA 3NDMA 4U40A 1XHAA 3QTWA 3V04A 4FOBA 4KBKA 4AOTA 1TQMA 3WE8A 3EFLA 2QNJA 4NJDA 2EB3A 2IW9A 1DAWA 4YTFA 1Q8ZA 3A4PA 3HECA 4DLJA 1GZKA 3OEZA 4IWPA 1OIQA 4FZDB 3CY3A 3FMJA 4G3CA 4J1RA 4J96A 5CALA 2XM9A 2Z7RA 1XKKA 4C2VA 2PL0A 4MXYA 3HAVA 2A0CX 3VBQA 5HX6A 4CFXA 2ZV9A 2RIOA 3FZPA 5FD2A 4O91A 3TDVA 2X8EA 3TWJA 1PXJA 3BELA 3BI6A 4NEUA 4XRLA 5CI6A 5F20A 4FZ7A 4GT4A 4ITJA 3PRIA 2V5QA 4QTDA 4YJQA 3F5UA 3TTIA 3UNKA 5CI7A 3V5WA 3WZJA 3VS6A 4U3YA 3LCSA 3LFCA 4PV0A 3LMIA 3BEGA 3P7BA 3FMLA 4BKJA 5DR2A 4EOMA 2ITQA 3GFEA 1PJKA 2PHKA 3VC4A 4IAIA 4QYGA 2BVAA 2OXXA 2YJRA 3VW8A 2W7XA 4RIWB 4ZTMA 5L2SA 1HOWA 1K3AA 3TNPC 4AXAA 2R3IA 4DFXE 1G8AA 4FSNA 2VWUA 3Q9WA 4XCUA 3BYUA 5H8GA 2HY81 3MTLA 4YC3A 3QGYA 2BFYA 2OFUA 4EH8A 3LXKA 1CSNA 5JGDA 4C0TA 3W10A 4L53A 4QMVA 4BZDA 5DEYA 2PVHA 3UOHA 4AZSA 3I0OA 4JL9A 4JAIA 3QZGA 3MWUA 3HGKA 3R7GA 2OICA 3COIA 2BZKB 4QMXA 2CLXA 5CEIA 4K6ZA 4BGQA 3MVMA 4AN9A 3OUNB 3DDPA 5GINE 5H8EA 1WBPA 5H2UA 1H4LA 4G2FA 5HD4A 2VUWA 3FZTA 2ERZE 4A4XA 2WQBA 3R1YA 4B8MA 4DT9A 1YHVA 1YHSA 4BC6A 5L6OA 1FMOE 1SZMA 2UW4A 5HBHA 1H1SA 3DK3A 4IWQA 4ZTNA 4DFLA 4U3ZA 4RG0A 2R3OA 4HZRA 3WIKA 3BYSA 2W06A 1Y57A 4YU2A 4WBOA 4DFBA 4IAFA 1LR4A 4HVIA 2BAJA 2UVYA 1HCLA 1W84A 3VAPA 4PPAA 3TG1A 5CU6A 4F7NA 1SYKA 1OIUA 3RNIA 4E6DA 1O6KA 2DQ7X 3LLAA 3VVHA 4FUYA 3ZRLA 2IVUA 1UU8A 3E7OA 2JKKA 5HQ0A 2JAMA 4OBPA 4WSYA 5BVKA 4RQVA 4WNOA 4ANOA 5KBRA 4NZWB 3IQ7A 4ZTSA 2ZYBA 4HCUA 3BGQA 4HVGA 3WZKA 4O84A 3SHEA 4MBIA 5AEPA 3QD3A 3GU8A 4O0SA 1KOAA 2BROA 3Q60A 4FEQA 4FX3A 3I60A 4AA0A 4FV6A 2VX1A 2PZ5A 3AXWA 4U5JA 3NMUF 2PWLA 2QU6A 2C6LA 2YZAA 4L01A 4Z9LA 1GAGA 2PZYA 3W2CA 1GIIA 4L42A 3ZXTA 4BDAA 5KMIA 4FNXA 4U41A 4XG3A 4FTCA 3RZFA 3DB6A 5TKDA 3ZCLA 4EJNA 5F95A 4AF3A 4DEDA 3FLWA 5AUYA 2BRHA 2C3LA 2PMNX 1DM2A 2R5TA 3K5VA 3PDTA 5JT2A 2VD5A 4MAOA 3EQRA 3FQHA 1PMVA 1MUOA 4O0WA 4I20A 3RALA 5HD7A 4LL5A 3ZZEA 4BHZA 3VF9A 4BYIA 5HI2A 4FVQA 3KXNA 4G5JA 2XK8A 3OCSA 5AADA 2PMIA 4EK6A 3JYAA 5CU2A 3LLTA 3DJ5A 5D1JA 3RMFA 5J95A 4U0IA 2X2MA 3MI9A 3RHKA 4ANBA 2R9SA 3VJOA 3K5UA 4I3ZA 2PUNA 3DXNA 3LFEA 2YM4A 4CVAA 5JZJA 3ZEPA 2Z02A 2G9XA 5HE1A 4UZDA 4G1WA 3R7EA 5HIBA 5IA4A 3VQUA 3NCGA 4XH6A 4BDFA 2X39A 3EMGA 4JNWA 3TJDA 3RAWA 3KXHA 4XV9A 4YBJA 3DGKA 4U79A 1BUHA 4JG7A 1E1XA 4C61A 3MY1A 5CQWA 4C3RA 5JRQA 3W1FA 2I1MA 4CT2A 3UG2A 4QMPA 4EH5A 4RLKA 1IA8A 3FXXA 5AR5A 1Q97A 4G3DA 4PQNA 4N70A 4XOYA 5A6NA 3NWWA 2GSFA 3D14A 2J0IA 4FV9A 5L2QA 5IKWA 1ZYLA 3RPSA 1YQJA 4H36A 4NSTA 3FZSA 5IDNA 2OI4X 3BHVA 3PYYA 3ACJA 3Q4TA 5T3QA 5DOSA 3IKAA 1J1CA 4XG6A 2Z60A 3FMKA 3ORTA 4YLLA 2XIZA 3HDMA 2B9FA 1KE6A 3R71A 3QD2B 3ZDUA 5HIEA 1W7HA 3MB6A 4FL2A 3WILA 3MH1A 4GU9A 4FT7A 3PIZA 5FUTA 3A62A 4V04A 3TJCA 1YWRA 4NM7A 4IIRA 5AA9A 3LFSA 3RPOA 2VTQA 3R2BA 4F1MA 3NRMA 3KRJA 3QQLA 5HICA 4YZ9A 4EYMA 2C6EA 3VN9A 3HMNA 3NVKI 2R64A 4QP7A 5EOLA 4A9SA 3NNXA 1OMWA 4UXQA 4DFZE 5KMNA 5AFVA 5JH6A 3VUKA 4YZBA 4J8MA 4A07A 2HWPA 4F6UA 5GJGA 3LMHA 2OO8X 4NM5A 4UB7A 5KBQA 4CMTA 1TVOA 5CENA 4F7JA 3MA3A 4JOAA 4WG4A 4PY1A 4C4HA 3ERKA 1QPDA 4G6LA 4DG2E 3A8WA 3FJQE 3HV7A 5EKNA 5LMKA 4FEVA 4NFMA 5I0BA 1R0PA 5I9YA 4EOOA 2ZB0A 4PWNA 5M4FA 3OF0A 5EHYA 2YM3A 3NUXA 2YERA 3MDYA 1IR3A 3TCPA 3UQGA 5IISA 2PY3A 3HRCA 5J87A 5FEDA 2DWBA 1Y6BA 2QQ7A 3PRFA 5I9XA 3GFWA 3ORXA 4FK3A 4S2ZA 3SC1A 5FBOA 4E4MA 3ZUVA 1PYXA 2JFMA 5CEMA 4I0TA 3PVBA 4D1SA 1OGUA 3DJ7A 4C37A 2H6DA 3U9NA 2F7EE 4LRKA 3D5XA 5B2KA 2FO0A 4WRGA 2QOFA 4UMTA 3CCNA 1PW2A 3NEWA 5EW9A 4ZTHA 3EQBA 3G2FA 4RIWA 4EQUA 2ZDUA 1Q62A 4G3EA 4O1OA 2B52A 2GNHA 3MYGA 5HE3A 3O7LB 4WIHA 5AV0A 3PLAE 2ZJWA 3CQUA 3FLYA 3VBXA 5IEYA 3G0FA 2J2IB 3HV3A 4ZLYA 5JK3A 1URCA 4YO6A 2WTKC 1P4FA 2BDFA 4YR8A 2R3HA 4XBUA 4ZAUA 4HOKA 3F5GA 4L7FA 3R1SA 4DGNA 3DXQA 3FPMA 4LM5A 2WAJA 3DLSA 3DT1A 3IONA 3BWFA 3ENHA 2XKCA 4D0XA 1M2PA 4MCVA 3U87A 2WEIA 4CKIA 1GOLA 1JNKA 4BGGA 3NAXA 4CV8A 3QX4A 3HZTA 2JFLA 4M0YA 4ZJJA 4Q5EA 1W98A 3D2IA 4RX9A 4NIFB 5EM7A 5J7HA 4JDJA 4EK3A 1Z9XA 1OKYA 3Q53A 4O7VA 3F9NA 4J99A 2QC6A 2BTRA 4BTMA 4IX6A 4W4WA 3PA3A 2E9PA 4BBEA 4N0SA 4XV3A 4AE9A 3HMPA 3I81A 5ANKA 3ZONA 3FE3A 3V3VA 1NVSA 1DI8A 2I40A 3D2KA 5C9CA 1IRKA 5KCVA 2ONLA 4MTAA 3CY2A 2CGUA 5AR8A 5M56A 1KV1A 2WQMA 3QA0A 2ITVA 2X8DA 5CU3A 4P4CA 5M51A 3LXPA 3N4TA 1LP4A 3ZH8A 4EOJA 1BX6A 2PVFA 5BYLA 3ODZX 2QLUA 4ZS4A 1UWJA 5A14A 4W4YA 4MVFA 3W2QA 5I4NA 4QQJA 5KZ0A 3U9CA 5I9WA 2QR8A 3L9NA 4EKLA 3LFBA 1LEZA 3VS1A 1Q61A 3DK7A 4FIJA 4K33A 3C4CA 5EM5A 5TOZA 5JQ5A 2NRUA 1IG1A 3O8PA 2ESMA 3QRTA 4QP4A 4BCNA 3WIGA 5HTCA 4IH8A 5K5XA 3PVGA 5AIKA 2P55A 1H28A 4FSYA 5DE2A 2YLFA 3QGWA 4RA4A 4FTOA 4NCTA 4KD1A 2J50A 1V1KA 4F9BA 3H30A 2IZUA 3CQWA 3GQLA 2PUUA 2ZM3A 3Q32A 3ITZA 3P23A 5DGZA 3WF7A 1H01A 4Y73A 4RA5A 1R1WA 2IN6A 2Y4PA 5FP5A 3GCSA 2GHGA 3FMMA 3R7UA 4BGHA 4EC9A 1ZARA 4MNEB 5DA3A 2WMSA 4G5PA 2PVRA 3R8ZA 1PXOA 3I6UA 4N4SA 4CZYB 4CG9A 4UMPA 4F0IA 4OTFA 3FYKX 3FQEA 3GI3A 3Q2MA 4Y8DA 2R2PA 4RJ3A 5DR6A 1ZYJA 5LVMA 4DCAA 3RM6A 3V8SA 2CMWA 3LJ0A 2QLQA 3NNUA 4PRJA 4QPMA 3CE3A 2HZIA 1A06A 4MHAA 5HBEA 3IW6A 3TTJA 3TZ7A 3Q9XA 4S30A 3ET7A 2PE2A 4JR3A 5FXRA 3RTPA 5TF9A 1PY5A 3I7BA 4M8TA 4AT3A 4D28A 2CKPA 4KB8A 3E88A 4MXXA 4D5KA 4IVBA 2WXVA 3TV6A 1Y6AA 4O27B 4QMSA 4YC6A 2WIPA 4GCJA 1L8TA 5E1SA 3DZOA 1H1PA 4OR5A 2UVXA 4FTIA 3V5JA 3C4FA 4GS6A 4XG2A 1G5SA 3TNWA 2CCHA 3DTWA 2F49A 2A19B 2Q0NA 4ANQA 3SV0A 2PPQA 1VYWA 2FGIA 3EQCA 3RPRA 1BKXA 3FMEA 5H8BA 3FZOA 4M14A 3C1XA 3CTQA 3VBYA 4Q9ZA 5IMXA 3GU4A 2W1DA 3KFAA 1BMKA 1OUKA 2GNFA 3HRFA 2IJMA 3WI6A 5LOHA 4RFZA 2YN8A 3WF8A 5AUWA 3NS9A 2ITYA 5CNNA 4YJRA 2XIKA 3R30A 4U44A 4DH8A 2NNWB 3C4XA 4RLLA 4BB4A 4LMNA 5CTPA 1TKIA 3O17A 3AC3A 4JI9A 4OLIA 5KNJA 1JKTA 4GU6A 2VTTA 4DH7A 4OBQA 2EUFB 3KC3A 4HGSA 5IQAA 2UW7A 1FGIA 3RKBA 4AT5A 1YXUA 2WOTA 1IAHA 1MQ4A 2Y6MA 4NUSA 1REKA 5EI2A 1PXKA 4D2TA 5AV3A 2HW7A 3MFRA 4YJNA 5K0KA 4O6LA 3OCGA 4FKWA 3D5WA 2E9OA 2R3LA 1XH6A 4YZNA 3VUIA 4JQEA 3SG9A 2BFXA 2WMVA 5ETFA 2V7AA 5BYZA 1ZYCA 2CGWA 2F57A 3AMBA 5EYKA 3UDBA 5BX0A 5KMLA 2XJ1A 5LXMA 4DYMA 1Y91A 2VX3A 4AW5A 1MRUA 3NZ0A 5IU2A 5C8MA 2PVKA 4ZMEA 1I09A 3AGMA 2R3FA 3DOGA 1XQZA 4FSRA 2YZLA 5FEEA 1OPKA 1OB3A 1OIRA 1KE8A 2YCFA 2OWBA 2Z2WA 3QU0A 1VJYA 3Q3BA 3QYZA 5C01A 3VBTA 4C57A 3S95A 2CKQA 4FG7A 2BDWA 4I5HA 4C4JA 2W9ZB 4MD7E 3F3ZA 3JVRA 4PUZA 5CYIA 4GMYA 4NFNA 2I6LA 1YDSE 4IC7A 5DEWA 3A2CA 1OIYA 4GVJA 2QG7A 2G15A 3QD0A 4FTTA 1Z5MA 3W55A 2QHNA 2ZMDA 1TQIA 3R22A 4M15A 4CMUA 3PXZA 4EZ7A 2PMLX 1UNHA 4U6RA 4FSZA 5L2WA 1JKSA 4GUEA 4F7LA 4OTPA 4DTBA 4FG9A 2PVNA 3HKOA 5CAVA 3OXZA 3BE2A 3F69A 5EG3A 1U5RA 2WMRA 5D10A 4X6QC 3K54A 4MX9A 4NIFA 5KHXA 3IW7A 3KXXA 4QQ5A 4LRMA 3PZHA 4G6NA 5GZ9A 4GK3A 4L7SA 3NYOA 2PMOX 3R02A 3OEFX 2CHLA 4QP9A 4MF0A 5CSHA 4TTHB 4J7BA 4N6ZA 4CNHA 4BKYA 3COHA 2O2UA 1M7QA 2W99B 1YOMA 2C0IA 2G2HA 4PNIA 4QYYA 2B1PA 4CTBA 2A1AB 3GGFA 1XR1A 1PMUA 3P1AA 2R3RA 3KA0A 4H3PA 4JG6A 4FV3A 4IMYA 2OKRA 5BUJA 4RJ6A 5L4QA 4XV1A 2VWIA 3KEXA 3NW7A 5A4EA 3G9NA 2PULA 4HYHA 2XKDA 2VTPA 3PWDA 4HJOA 3DKCA 1YI4A 4ALUA 3B8RA 3ZLSA 2QOCA 2RKUA 3PA4A 4GH2A 4F9CA 2QOQA 2JEDA 5LVPA 2XB7A 4RPVA 4FUXA 5J5SA 5AP0A 1YDTE 2QONA 1CDKA 3ZO1A 4DAWA 3U54A 3P0MA 3G0EA 4Y5QA 4EEVA 2JIUA 1VYZA 3DB8A 4XJ0A 4D1XA 3KMUA 2JDTA 5J1VA 4J98A 2F2CB 4F9WA 3MBLA 3P79A 3TXOA 3FY2A 5HLWA 4X7QA 3LQ5A 5IUHA 3P5KA 2W96B 4Y83A 4BDKA 3RZBA 2BRGA 3ULZA 4DGLC 4AA5A 4RJ7A 3M2WA 4IWOA 1OPJA 2YIQA 4E5AX 4EOLA 5FM3A 4CFWA 4IVDA 3ELJA 3ZLWA 1BL6A 2YEXA 4E5WA 2WTVA 4WG3A 5GJDA 1PF8A 3MVLA 1H0WA 2NP8A 3OT8A 1FQ1B 3FI8A 3DCVA 2R4BA 2R3KA 5JRSA 3KL8A 2WHBA 4G3FA 4MNEA 5EHOA 4AFEA 3Q4UA 3JXWA 3Q5IA 4ASDA 4KUJA 2ERKA 3OXTA 3VUTA 5HX8A 4Z7GA 4D9TA 4EUTA 3TNQB 4FIIA 1ZOHA 5A4TA 3DY7A 4TRLA 4B0GA 2XK4A 4FKQA 5BVNA 4D2VA 4NW6A 2GTMA 4ITIA 2YAAA 3RP9A 2J90A 3NNWA 5EYMA 2IW8A 4A7CA 4BTJA 5IZFA 3TI1A 5DMZA 2VWBA 5M55A 4JX3A 2VTAA 2X0GA 1GZNA 4AA4A 3DAKA 2UZBA 4WNPA 3V51A 3LFQA 4HVHA 4NWMA 3TEIA 4ERWA 1RDQE 3LHJA 4O1PA 2B54A 3TT0A 4GW8A 4MWHA 1Q8UA 2R3JA 4RWKA 3V8WA 5HCYA 3G9LX 2B9IA 3EFWA 5DT4A 2OXDA 3OG7A 3PP1A 3K3IA 3VHKA 3LKMA 2BRNA 4L46A 4APCA 4AZFA 3EN7A 3FL4A 3QXPA 1OM1A 5K4JA 5KUPA 2EXEA 4RX7A 1V0BA 2ACXA 2XNGA 1YRPA 3M11A 4UMRA 4YJPA 4GJ2A 5L2IA 4WG5A 3TKUA 3DK6A 2GS2A 3FWQA 4IVCA 3PA5A 5ETCA 3IW5A 4DEGA 5G1XA 3DKGA 3A7IA 3EL7A 3VS2A 5A6OA 4HGEA 5LMBA 2V0DA 4G34A 4FKTA 3QZHA 1Q3DA 4WSQA 4BCJA 4D1ZA 2Y0AA 4QMLA 2X2KA 4TZRA 1H1QA 2JAVA 1B38A 4FYNA 4D2SA 4F0FA 4ASEA 3FSKA 4A9TA 2X4ZA 5HE2A 4RQKA 4MBLA 1M14A 2ZDTA 5BNJA 5KMJA 4BWPA 3AMYA 1QPEA 3EQIA 4MYGA 3BBTB 4GEOA 4QMOA 5TO8A 4ACMA 4EOSA 4Z55A 3ALNA 2IZRA 4F08A 3DQXA 4FV1A 4RX8A 1PKGA 1T46A 1YW2A 3LJ2A 1J7UA 2CKEA 4JBVA 3R63A 3WZEA 4DCEA 5DRDA 1AD5A 1WVYA 2VV9A 3KF4A 1FINA 4GK4A 4ID7A 3TNIA 3MVJA 4IDVA 3V5PA 4K11A 3ZDIA 4EKKA 1XH8A 4M97A 5E1EA 4TN6A 2YDKA 3BYOA 4JBOA 3RBWA 2PUIA 3BQRA 3VRZA 4XLVA 1NVRA 5HU9A 5IQHA 2WKMA 4WD5A 1ZWSA 3GVUA 4IQ6A 4EZ5A 2G1TA 4OTDA 3NAYA 5I9VA 3AD6A 2VNYA 1JSUA 5AX9A 3H10A 3HLLA 3PG3A 1A48A 3DPKA 3F2NA 3N51A 2UUEA 5CASA 5J9LA 4OAUC 5CVFA 2J0MB 1R78A 4FTKA 2GS6A 2IO6A 4P5QA 2YM5A 4KA3A 4RJ4A 3W2PA 4FSTA 4U7ZA 4AGWA 4D5HA 1W0XC 1PXPA 4OTQA 3A99A 1XJDA 4PMPA 3HV5A 4D4VA 3UVRA 2XJ0A 3GU7A 5M08A 3NIZA 3KXMA 2J5EA 3NUSA 4FL3A 3UE4A 5IUGA 5DLSA 4MH7A 4EK8A 4L45A 4FKUA 3D7TB 1GY3A 1SVEA 1H26A 3L8VA 1ZXEA 4RVMA 3FKOA 5BQ0A 5J9ZA 1VR2A 1GZOA 4EONA 3D83A 4IX5A 5IH5A 2QU5A 4DITA 1OUYA 3UC3A 3PY1A 2XCHA 4FL1A 3ZRMA 3EB0A 4DBNA 3FHRA 3VULA 4EYJA 3P7AA 1ZOGA 4Y46A 2BDJA 3KQ7A 5CAQA 3GCQA 5DPVA 5HESA 4ZTLA 4TW9A 3UODA 5KHWA 2WTIA 4NM3A 3CS9A 3I4BA 4FT3A 1XO2B 4G9CA 3CBLA 4MWIA 1IEPA 4WOVA 2GQSA 4B9DA 3PSDA 2BR1A 3ORKA 2JDRA 2A4LA 3TV4A 1APME 1UKHA 2XA4A 1OL2A 4L9IA 2F7XE 1IASA 4WUNA 3FLZA 4DFNA 2C5NA 2J0LA 4IJ9A 5IA5A 3ZC5A 4J95A 4ZJIA 2UZUE 4M0ZA 4X3FC 3BHYA 2QODA 4PTGA 3RCDA 3UJGA 5I9ZA 3D4QA 4TYJA 3AT2A 2RFEA 2QD9A 4KSPA 5IEVA 2H96A 2ZMCA 5A54A 2EB2A 1ZMVA 3LFFA 5HG7A 4YHTA 1PXIA 3JUHA 3N9XA 3O7LD 2B0QA 3FY0A 4WT6A 4C58A 2LAVA 3S2PA 3QQHA 2OZAB 4I24A 2P33A 4MXOA 3ZSHA 5AUXA 3VUMA 5HO8A 2V7OA 2VTIA 1RW8A 4PMMA 2BRMA 4WA9A 2I0EA 4C59A 4I94A 5BVFA 5HZNA 1JAMA 5JGBA 1E9HA 2X2LA 4M68A 1GIHA 5DI1A 3OS3A 4FR4A 3G33A 4RJ5A 3TN8A 4BICA 4EOPA 4F1TA 3P08A 3L9PA 2VO3A 4FKPA 1PMEA 3U55A 3AGLA 3L8PA 4Q9SA 3FKNA 2F2UA 3DNDA 4QMZA 5J79A 3DDQA 2WMXA 4L67A 5D9HA 5EK7A 2YIRA 4BIBA 4RBLA 4EHGA 3AG9A 5ITAA 4EK4A 4R5YA 5I3OA 5C8NA 5FG8A 5IA2A 3QWKA 4PMTA 3QX2A 4R7HA 4ZSEA 1QMZA 3PUPA 5CNOA 4YJVA 5EKOA 3F3TA 5EDPA 3UNJA 4BCKA 2ITOA 3MH0A 4NKAA 1H25A 4E5BA 2CGXA 3FI3A 2WTWA 2QOIA 3GUBA 2B9HA 2OH4A 4QNYA 2XNMA 3QF9A 3QTUA 5CVGA 5ANIA 3BLQA 3COKA 2LGCA 5BYYA 1W8CA 3LJ1A 2AUHA 2WD1A 4BI1A 4CZUA 3BLHA 1WVWA 3ROCA 4O6EA 4X2NA 3JR1A 4FF8A 1ZY4A 2X1NA 3E93A 3QQKA 3GC9A 4IFGA 3PY3A 1YKRA 3SW4A 3FMHA 1DS5A 4E4LA 4L44A 4F70A 3ORLA 2JD5A 3V5TA 2WOUA 3Q9YA 4CV9A 3G5DA 4JRNA 5LWNA 3ZO4A 3D0EA 4IB1A 3LXNA 3UZPA 3TIZA 2VTJA 5AP1A 1YXXA 3KMMA 3ZEWA 3H9RA 4QP6A 4HCVA 4ZY4A 2XK3A 3IOPA 4J97A 4FEUA 4E26A 4RWJA 4WBBB 3RPVA 5CAOA 4KIPA 4A4LA 3UC4A 2C6IA 2W0JA 2R3MA 3QUEA 3M1SA 2XZSA 4O0XA 2C5XA 3OOGA 1K9AA 5C26A 2PE1A 3KK9A 3LM0A 4YNEA 5E8YA 5JFWA 4IAKA 3VBVA 3W18A 4RGJA 3CD8A 3HUBA 1Q4LA 1V0PA 4BKZA 2A27A 5HG5A 2XKEA 2FSOX 2OIDA 3R1QA 3WYYA 2UW9A 4O2ZA 4DH5A 3SA0A 1ZRZA 2XM8A 4IC8A 2WIHA 4X6RA 3BQCA 4LQMA 4ZSGA 1ZMUA 3G6GA 4PL5A 2V62A 4UN0C 4I6FA 4KKEA 4OT5A 4EWHA 4LOOA 4O7YA 2PVJA 4F9YA 3EZRA 5GIPE 5I3RA 5FM2A 2OG8A 3DZQA 3FLNC 2KTYA 3FUPA 3ZZWA 4O81A 5M09A 3GOKA 4TYEA 3KY2A 5E8TA 5LVNA 2FUMA 1GNGA 3CGOA 4AN3A 4ZZMA 2WQOA 5CSWA 4ALWA 4EHVA 4L43A 2VTRA 3WBLA 2Z7SA 1XH5A 1S9JA 4QMTA 2XK7A 2VAGA 1PKDA 4RZWA 2BMCA 5KE0A 4KS8A 1U46A 1YOLA 5EDRA 3SKCA 4EZ3A 4XP3A 2VWXA 2QO2A 4R8QA 3MY0A 2I0VA 3HDNA 4O0UA 3OFMA 5EI8A 3T8OA 4C3PA 1YXSA 3HNGA 4YPDA 2FSMX 4NTTA 3D7TA 3IPHA 3OTVA 3QYWA 2GMXA 4E6AA 5BUEA 4UWCA 3UQCA 3UQFA 2OJGA 4FTQA 2WO6A 4DH3A 2E9UA 2OF2A 3C4EA 3FHIA 4AGCA 1OL5A 2RFSA 4IZYA 4AGUA 2HWOA 3Q9ZA 5EM8A 2NPQA 4R3PA 3A7JA 4M69B 3ZO2A 4G9RA 4GYGA 3DBQA 3HMIA 4J52A 4AWIA 3ORMA 3W2OA 3RHXA 2VWYA 3ZO3A 3SVVA 3KU2A 4EH3A 1SNUA 4H1MA 4H3BA 4XLIA 1F3MC 4EBVA 3I0QA 4ZK5A 4ZSJA 5HNIX 4QTEA 3MV5A 3R73A 4H3QA 1WCCA 3LCDA 5CEQA 3IDBA 4QPSA 3BYVA 4X2FA 5CZHA 3VBWA 3EQDA 3R04A 3UZRA 5D7VA 2VU3A 3KXGA 4NH1A 3WOWA 3O8TA 5HNBA 3VUHA 4ENYA 3VS7A 5E91A 1P5EA 3BV3A 2R3QA 4W4XA 5KZIA 4BDBA 4FE2A 4O83A 2BPMA 4FIGA 2Y9QA 4UMUA 2WMTA 3ULIA 1X8BA 2O64A 4L68A 4FNYA 5DH3A 3FLQA 4BDEA 1BI8A 2CPKE 2XUUA 3DKOA 2CCIA 4MBJA 4O7NA 4U42A 3R2YA 5J8IA 2XEYA 5TE0A 4BZNA 2BAQA 4HGLA 4ORKA 4GSBA 4JT3A 3SX9A 3R9NA 1PHKA 4BN1A 3V6SA 4YUQA 3OW4A 5EM6A 3E3PA 2P4IA 4QP1A 4QPAA 2J0KA 4HGTA 2EXCX 5LCJA 5EYDA 2OFVA 2R0UA 2Y4IC 3KN6A 3T9TA 3BHTA 3DFAA 2PYWA 2GTNA 3PVWA 5FQDC 2OIBA 5FXSA 3F3UA 4QTAA 5DT3A 4CKJA 3UZTA 2PTKA 4OT6A 4G17A 5M44A 2OZAA 3KREA 3DV3A 5HG9A 5DBXA 2XVDA 3L9MA 4FYOA 4MEDA 2HOGA 3MJ2A 4RVTA 3WF6A 4BWKA 4QMQA 3BE9A 3NUPA 3D94A 2R3GA 5FRIA 2JDOA 5IQIA 4LGGA 2OK1A 3PP0A 3PPKA 4W9WA 4FV7A 2J9MA 4JX7A 4KWPA 2C6TA 3H3CA 3JPVA 5AWMA 4BCIA 2ITZA 3RAHA 3I79A 3ZBXA 2IVSA 4AS0A 4TNDA 3QHRA 4NU1A 3KRXA 1PMNA 5AM7A 4CGAA 3QUPA 2OF4A 3MPTA 4K2RA 5CSXA 3ODYX 5B0XA 2WU7A 2YWPA 4M66A 3ZBFA 1FVVA 4TYHB 4F65A 1H1RA 4AFJA 1MRYA 4O2PA 5IUIA 3ZYAA 3MESA 3ACKA 4CKRA 3DAJA 4OGRA 3OWKA 2ETMA 4TWCA 1R0EA 5IEXA 3JS2A 3Q04A 1YXTA 2WTCA 2C1AA 2XBJA 3EWHA 1JPAA 2C1BA 2IZTA 4M12A 4P5ZA 2QO7A 4IWDA 3SRVB 5IA1A 3PG1A 5EQPA 5LMKC 5IQBA 4E6QA 3ALOA 4D2PA 4BI2A 5ACKA 5DYJA 4IDTA 4X3JA 5CXHA 2IPXA 4WUAA 2XS0A 4JAJA 4AGDA 4UWBA 2W05A 2QR7A 3DBDA 3FI4A 3O0GA 1QL6A 1KV2A 4MQ1A 4XG8A 2BIKB 4CQGA 4QP2A 4E73A 3G15A 4NL0A 4ZSLA 4PP7A 4G16A 3E62A 3PJCA 2WGJA 3PIYA 4I0SA 4IAAA 4IB3A 4RJ8A 2E9VA 4YPSA 3QC4A 4XHKB 4AZTA 4ZZNA 4O7RA 4FICA 5CQUA 2HZ4A 3LIJA 4D55A 2XNBA 2Z7LA 5HTIA 3FI2A 4UEUA 3TKIA 3C50A 3QTQA 3Q6UA 3R9DA 2YITA 4ACCA 4B99A 3MJ1A 4DGOA 2XEZA 4FV4A 2PZIA 4JXFA 4BF2A 2UZOA 3FAAA 4C36A 3FDNA 4JDIA 3U6IA 3LAUA 5AJQA 5CSVA 2O65A 3RINA 2VTHA 5GIOE 1CM8A 4GJ3A 4C4EA 2XYUA 4ZOGA 3RK7A 5G6VA 2UZEA 3V5LA 2CJMA 3B2WA 4II5A 2BZIB 1UU9A 3LXLA 3TV7A 4YSMA 5HIDA 3SW7A 5B2MA 5H3QA 4DA5A 2AC3A 4TYIA 4KBAA 3OBJA 4JRVA 4GIIA 4LV8A 3RPYA 3F7ZA 2XK9A 2XIYA 4RZVA 4AU8A 3RGFA 3EQGA 4OTRA 2XNNA 3FXWA 4LV5A 4ZLZA 4YZMA 4DG0E 5AUUA 5BUIA 5EW3A 3LFAA 3TKHA 4FEWA 4FSUA 3GP0A 5L2TA 3EH9A 5IH6A 4EBWA 3QTZA 5DWRA 4Q5HA 3RM7A 1U54B 5CAPA 5BVEA 3C5UA 3GT8A 5CVHA 3QFVA 5FEQA 5IQDA 2X6DA 4IM3A 4FODA 2GFSA 3IK3A 3NX8A 3Q6WA 3FL5A 3LZBA 4HCTA 4BDDA 4K1BA 2OSCA 3ANRA 4R6VA 2Z8CA 4U9AA 4PNKA 3A7GA 4ZY5A 4CFUA 5KKRC 5K3YA 3ORNA 3NW6A 4QD6A 1Q8TA 2R3NA 4Q2AA 3EFJA 3OBGA 5K9IA 3R1NA 3KK8A 5J9YA 4KIKB 4U43A 3QLGA 2VTLA 3DLZA 4HNFA 4BDIA 5C8KA 3FZ1A 4CFFA 5BVDA 3HYHA 1WBSA 4JIAA 4P7EA 3OWPA 4ARKA 3KXZA 5CT0A 2ONLC 4YO4A 5CEOA 2C3KA 3PZEA 4MXAA 4FMQA 3OVVA 5D11A 4GT5A 4H05A 4RC2A 1CKPA 5KMOA 2IG7A 3IW4A 3THBA 2ETKA 3CTJA 3N4UA 1ZYDA 3UO6A 4RFMA 1OL6A 2FSTX 3C0IA 1ERKA 2XH5A 3FYJX 5C4KA 4H39A 2YFXA 5IPJA 4R7BA 2QHMA 3FZRA 3NGAA 3Q52A 5E8WA 5C03A 4M69A 2AC5A 3EIDA 2J4ZA 3OMVA 4RIOA 4ZY6A 3BX5A 1ATPE 1H8FA 3WYXA 4GIHA 2C0TA 3PVUA 2C5VA 3COMA 1OKVA 1VEBA 4YTIA 3K2LA 3L8XA 5AR3A 2CKOA 4PMSA 4DC2A 4I22A 3TNHA 5JSMA 3NUUA 3R8PA 4FT9A 4F4PA 2YCQA 3C5IA 3VO3A 3UPZA 4BCQA 5AV1A 4DEIA 3AQVA 3AC5A 4BZOA 1U4DA 2C69A 2YHVA 5BMSA 4GKIA 2PZPA 4A9YA 4Z16A 5K5NA 4O7WA 2WEVA 3IW8A 5CLPA 4MXCA 5J5TA 1UNGA 2FB8A 4W8DA 4CLJA 4BDCA 4FVRA 4C4FA 4TL0A 1F0QA 3PXKA 3W33A 3QKLA 4UY9A 4DINA 2BAKA 3LFNA 3M42A 2EXMA 5F1ZA 5HCZA 1WBWA 4CT1A 3SD0A 1OITA 5E8XA 4DTKA 1J1BA 4M13A 4LL0A 2ITWA 4UBAA 2UW6A 4C62A 5A46A 5AA8A 1PXNA 3DTCA 4BDGA 4ZSAA 3QLFA 5AM6A 2GHMA 4JS8A 1XH7A 4B8LA 5AAFA 4F64A 5CF6A 2UZTA 4GFOA 4TXCA 1R3CA 3NYVA 2XNPA 1OVEA 2C0OA 3TZ8A 4O86A 4AQCA 4EK5A 4CZTA 3LPBA 4KIOA 4DEBA 2WQNA 4YZDA 2GHLA 2IVTA 3VHEA 2J0JA 4HYIA 4CFNA 2QOOA 2J51A 2VWVA 4EQMA 3ZM9A 2YCSA 2QOLA 2G01A 1OL7A 2YDJA 2H34A 1YOJA 3I7CA 4JQ8A 4AP7A 3F5XA 4NJ3A 4OBOA 4M3QA 2RL5A 4XUFA 1H00A 2O3PA 3E92A 4C34A 3QCYA 4HNIA 1UU7A 2X4FA 5JEBA 5LJJA 3QBNA 4TYHA 4B6LA 3VQHA 4C2WA 1OBDA 5I5ZA 2KULA 3OW3A 2X9FA 5HGIA 3VWAA 3W16A 2B55A 3ZS5A 3UVPA 4BIEA 4ZTRA 1RJBA 4BDJA 2B7AA 2ZV2A 3O8UA 3SRVA 3PWYA 3G6HA 4FTNA 1KE5A 4HYUA 2OW3A 4AW1A 4B7TA 1ND4A 4D2WA 5HORA 4XP0A 2CNUA 1FOTA 4AW0A 4DTAA 4L8MA 3BPRA 4CFVA 3HAMA 2VNWA 5LVOA 3D5UA 2ZM1A 5IMEA 3GB2A 4BRXA 3EOCA 1BYGA 4IX4A 3UO4A 3W8LA 3GCPA 4AZWA 4C4IA 4PL3A 3C13A 3R8UA 4E3CA 3ZFMA 4I21A 4DLIA 3E8CA 4I93A 4RIXB 1SVHA 3HVCA 5JFXA 3H9FA 4O82A 5L3AA 2PZRA 4WO5A 5GZ8A 3CR0A 5EQEA 4BR3A 3MB7A 4I6BA 4KRCA 2V55A 3PXFA 4MK0A 3KRLA 4I1ZA 5F94A 3ZRKA 2YIYA 4LFIA 4E1ZA 2PVLA 1JVPP 3UVQA 1Q41A 5J7BA 3IG7A 5IH4A 3LQ3A 5EH0A 1JSTA 4XRJA 2Q83A 4YMJA 4LOQA 4IVAA 5M07A 2YABA 2W9FB 4BCOA 2HIWA 2BHEA 4ANNA 4MNFA 3GC7A 4FTMA 2WTKB 5CU0A 5FDPA 3EFKA 4FV2A 3E5AA 3VUGA 3EQPA 3MSSA 4A06A 4DG3E 3MW1A 3PFQA 3VIDA 2CNVA 1OECA 3EJ1A 3VRYA 5CXZA 4FV5A 3BEAA 5AP5A 5DFPA 5T6KA 3U6JA 1FVTA 1U59A 4FTUA 4Y85A 2H8HA 3BWJA 2QKWB 4YZCA 3AC8A 4KKGA 3UBDA 4M7IA 3U6HA 1U54A 4FSMA 4AG8A 5CZIA 4QT1A 5M57A 4F6WA 4FTJA 2C47A 5CX9A 3KB7A 3NIEA 4ANMA 1M17A 4DGMA 2OU7A 3VNTA 3QCQA 4AE6A 2W4JA 4KKHA 3S1HA 4FGBA 3V8TA 4FEXA 5ANEA 2P2IA 5B2LA 3D9VA 2WMBA 5KMKA 3SXSA 4FSWA 4QMMA 4ERKA 3CC6A 1WBOA 2J6MA 1Q5KA 4MKCA 5GZAA 3GENA 1B39A 3WF5A 3NVMB 4GG7A 3DFCB 5LMAA 4I0RA 3KMWA 1FPUA 4EH4A 4KIKA 3EQHA 3QC9A 4EH9A 5CSPA 3S00A 2Y4IB 3GCUA 3U8WA 4QP8A 5ACBC 2GQGA 4BCGA 5KX8A 3CEKA 3P86A 5E90A 3NUAA 5BMMA 2YDIA 3F3WA 3QKMA 2ITUA 1FMKA 4I5MA 2ITTA 4EOQA 3ETAA 4DEHA 4IHPA 4QMUA 3VS4A 4F99A 4ZS0A 4YHFA 3TIYA 3MPAA 4RC3A 5A9UA 1SVGA 1YHWA 3D15A 3MH3A 3DNEA 4CCUA 3QKKA 5HVJA 4DGGA 3JY9A 2UW0A 3ZLXA 1OKZA 3DA6A 3L1SA 4XX9A 5BVWA 5JKGA 2X7OA 3UOKA 3GNIB 4R1YA 5A4LA 3QTSA 4FIFA 5DHJA 4IXPA 3ZMMA 4ZIMA 3T3VA 3HV6A 4OW8A 4O7ZA 3KULB 4K9YA 5E92A 3F82A 3VJNA 4O22A 1MP8A 3QQUA 5DNRA 3PLSA 4D9UA 4AAAA 2W1FA 4YSJA 4TT7A 4M84A 4XBRA 1XBBA 3ATSA 2QURA 5IG1A 3EYGA 2CN8A 3OCBA 4XEYA 1PXMA 3GXLA 4FK6A 4TWOA 2GNLA 4LMUA 2RG6A 2WMWA 3QL8A 4BL1A 3QALE 1V0OA 3GBZA 5HEZA 2R3PA 2VN9A 3E3BX 5ETIA 3FSFA 3LMGA 2C5YA 2GCDA 4ANLA 1WAKA 5M4IA 4QRCA 2XMYA 3BKBA 3EL8A 4BBMA 3WE4A 4IB5A 4UALA 5M53A 2JIIA 2YCRA 3HMMA 3KF7A 3C0GA 3E8NA 3H0YA 2CNQA 2SRCA 3AOXA 3EN9A 4L3PA 5FTOA 5LCKA 3HV4A 5AUTA 2WELA 5IDPA 5C1QB 1FGKA 3PJ1A 3QCXA 5C27A 5KO1A 3AC4A 2JKOA 2XIXA 2VGOA 3BU3A 3II5A 1OBGA 2XF0A 3QRUA 2P0CA 4IZAA 5M4CA 2C3JA 4WKQA 4U45A 3ID6C 1JSVA 2Q0BA 2ZOQA 3QQFA 4U81A 5FDXA 4LRJA 3NCZA 3U4WA 2JITA 3W8QA 4IJPA 4ANSA 3O50A 2REIA 5HO7A 3S4QA 4BCHA 3FEGA 2JKQA 2CDZA 4DFYA 2W1CA 2VO6A 4BVUA 3R8LA 2YM7A 4E7WA 1Y8YA 4GVAA 3E8DA 4LUDA 2CLQA 1E1VA 2RG5A 4R77A 3PE1A 4XG9A 3EQFA 2PU8A 2HZNA 1S9IA 2Y6OA 4H1JA 1J7LA 5HKMA 5AAGA 3NW5A 1XBAA 1KE7A 3BBWA 3GC8A 3E7VA 5E4HA 1Q8YA 4FKGA 4GFMA 4D4SA 5IA3A 3P9JA 4U97A 2VO0A 4A4OA 2YISA 4CXAA 4F7SA 4G31A 4H58A 4I23A 3ZSIA 4O0TA 5FGKA 2HZ0A 3SXRA 3Q2JA 5KKRB 3MTFA 3SOCA 2R7IA 2R0IA 2QG5A 3FC2A 3I5NA 4YBKA 3TZ9A 5CWZA 3L9LA 3IGOA 5E8SA 2PVYA 4GRBA 4S33A 2JLDA 1ZLTA 5D41A 5CANA 3QUDA 3UOLA 1O9UA 4AUAA 1UVRA 1H07A 3DU8A 2GU8A 4O96A 5HVYA 2WU6A 4IEBA 2PSQA 4RIXA 1YXVA 3ZSGA 3I5ZA 4NT4A 5AIRA 5ANDA 1WBNA 3CXWA 3IECA 2UZNA 4O7LA 3HEGA 3R9HA 5TT7A 1UNLA 4O0VA 2YIWA 2OBJA 2XK6A 3KCFA 4P2KA 5ETAA 3R83A 4AZEA 3R8VA 2NO3A 4NYEA 4GG5A 2BUJA 4YJOA 3K3JA 2B53A 3KN5A 5AP2A 2Y8OA 5EOBA 1Q8WA 2FH9A 3QCSA 3L8SA 4ONAA 4TNBA 3V6RA 5E8VA 3OXIA 4CRSA 1ZZ2A 2ETRA 4RC4A 5IF1A 1MQBA 4YHJA 1YWNA 3RJCA 3H0ZA 3V5QA 4C7TA 3ZLYA 4EORA 4USFA 2QKRA 3POZA 5KMMA 3C51A 3OZ6A 4X2KA 5EI6A 4BTKA 4FT5A 4KIQA 4CYJA 4CQEA 2V22A 4B4LA 1JBPE 1ZY5A 4EL9A 1FVRA 1YI6A 4FKSA 4UX9A 2OIQA 2ZV8A 5FTQA 1M2QA 3ROYA 2C6DA 3PIXA 3FMDA 3KRWA 4C35A 1JKKA 3DXPA 3LM5A 4G6OA 5E8UA 3EN5A 2C3IB 4JBPA 5JFSA 3S0OA 5HO6A 3UOJA 3NNVA 3D5VA 4YGAA 3QZIA 4AZVA 4X2JA 4ASZA 1H27A 3ORZA 4RT7A 1BI7A 1UWHA 5HVKA 4PTCA 4JQ7A 1DAYA 2EWAA 3GC0A 4FTRA 3SDJA 5DR9A 4RMZA 2Z7QA 2QI8A 3FKLA 4JR7A 2F4JA 1AQ1A 3BGPA 1PXLA 3W2SA 4MF1A 4YC8A 3A7HA 1HCKA 4K8AA 4AACA 4JVGA 2VZ6A 2ITXA 3MIYA 5DRBA 5E9EA 3WZUA 1ZZLA 5HU3A 5HHWA 3CGFA 3AD5A 5HLPA 3CJGA 3CKXA 4FV0A 4BFMA 3OCTA 3R7YA 4C02A 4AW2A 2GQRA 2OJIA 2GNGA 3F88A 4OAVB 4CEGA 3R7OA 4FZ6A 3O96A 4UYAA 4NW5A 5DVRA 5CEKA 2DYLA 1JQHA 3FMNA 3RK5A 4IAZA 3TM0A 4ZJVA 5AP7A 4FKLA 4ZLOA 1BL7A 3MA6A 2XP2A 4XG4A 4ZTQA 2Y7JA 2C6MA 4YLKA 4M67A 2HW6A 1RE8A 1SMHA 2HXLA 2DS1A 1G3NA 1P4OA 2X7GA 4MQ2A 2XYNA 4I6QA 4CCBA 2GNJA 3PXYA 5AUVA 4CYIA 5ANJA 5DT0A 3VS3A 1UU3A 4F9AA 1H1WA 4QMWA 3E64A 4BYJA 2BKZA 3OD6X 3OUKA 2OJ9A 4HPTE 1W83A 3KULA 3UP2A 1REJA 5CF4A 3QRKA 3BCEA 3SXFA 4FGRA 2BRBA 3NYNA 5A4CA 4BCMA 1Q3WA 4DT8A 2GNIA 1UV5A 3MVHA 2RGPA 3NPCA 4MXZA 2ZVAA 5CT7A 3T9IA 4EH7A 5HBJA 1G8SA 4NKSA 1URWA 1EH4A 2XNOA 4ENXA 4CSVA 5BVOA 3W2RA 3SQQA 3ATTA 1O6YA 2W1EA 4C3FA 3DS6A 1W82A 3LFDA 1WBTA 3RCJA 3CLYA 1NW1A 3QA8A 2FYSA 3PSCA 3RWQA 2XCKA 4KBCA 4QO9A 3FXZA 4PPCA 1YWVA 2O8YA 3DQWA 3QRJA 4XOZA 2VTOA 4LUEA 1TQPA 2HELA 3MPMA 2UW8A 4D4YA 1P2AA 4EWQA 4F1OA 3BU5A 3VW6A 4HVSA 5AV4A 2XRWA 4Y95A 4CD0A 4EOIA 4QMNA 4HZSA 3DJ6A 3ZHPC 4GFGA 1UKIA 3OWJA 2EVAA 3QTIA 4IB0A 5I9UA 3WF9A 3PSBA 3P78A 3RAKA 2JDSA 3G51A 4AX8A 3BGZA 4KAOA 4E93A 4BY9E 5AAEA 3Q5ZA 4IE9A 3SG8A 4O7SA 3IO7A 2QOBA 3B2TA 1PYEA 4EH2A 3PJ3A 3CPCA 3MFSA 2W5BA 4DEAA 5AP4A 1JOWB 1CKIA 1H08A 3R00A 4QTBA 4GK2A 5HNGA 3R9OA 4IANA 4DE4A 4PDSA 2X9EA 5EDQA 4ACGA 4XMOA 1A9UA 3TUCA 3NR9A 3Q96A 3AD4A 3BHUA 3UYSA 4BDHA 4GKHA 4S32A 2BIYA 3F6XA 3IDPA 2HYYA 2VTNA 3B8QA 2J7TA 3PXRA 4YLJA 1AGWA 2UW3A 4ZEGA 3CD3A 4ACDA 4S31A 1F5QA 4E4NA 3NUYA 3REPA 4EQCA 2IVVA 1KWPA 4FSQA 5LQFA 2XNEA 1ZOEA 1FBNA 4E8AA 2OZOA 3LOKA 3QQJA 5JN2A 5JMSA 3U4UA 4JLCA 4KSQA 5HTBA 2YM8A 4W9XA 3RWPA 2XKFA 3OTUA 5EYCA 1UA2A 4QOXA 3UYTA 2HCKA 3Q4CA 4D58A 4EUUA 4AN2A 3N4VA 5AMNA 1OPLA 2WMAA 2GFCA 3FBVA 4L52A 2OJFE 4OTWA 3FPQA 4CFMA 2C30A 4IW0A 3UIBA 2YACA 3P7CA 3QTXA 3G90X 1I44A 3R01A 4HYSA 4ITHA 3ZM4A 2G2IA 4FI1A 1MRVA 5CU4A 3HP2A 4JJRA 3LCTA 4IX3A 4JIKA 3CTHA 1KE9A 3LVPA 3QAME 1LUFA 3DKFA 3ZC6A 2C6OA 1QPJA 2UW5A 4HPUE 1B6CB 2OGVA 2HY0A 3HMOA 3I6WA 3KVXA 3R7IA 4AT4A 1O6LA 3IOKA 3OROA 4KRDA 2VTSA 4IACA 4K0YA 2UVZA 2ITNA 4FNZA 3CSVA 3NLBA 3ORIA 4NTSA 2F9GA 4FZAB 4TKSA 4NM0A 5IQCA 3KCKA 5EFQA 4CLIA 3QWJA 4PDYA 4L3LA 5D12A 3ANQA 4JDKA 5EQYA 3H9OA 4LI5A 5L8KA 2C4GA 3TUDA 4P90A 1J91A 4L3JA 4NK9A 3MFUA 3EHAA 2IWIA 4IFCA 3IDCA 2UZWE 3ZUTA 2A2AA 3OP5A 4MD9E 2UZDA 2O0UA 2BZJA 4Z3VA 2XBAA 2W4OA 3SAYA 5BPYA 3GOPA 3EZVA 1LPUA 3OY1A 5M06A 3UGCA 4BHNA 5D7AA 4FG8A 4C33A 3BZ3A 4IZ5A 3HRBA 1JLUE 5F9EA 2YJSA 3UNZA 5J1WA 3JVSA 2PK9A 2RSVA 3T3UA 4O0RA 4A9RA 2FSLX 3QXOA 3E63A 3FQSA 2NRYA 4Y5HA 4V0GB 3POOA 2QO9A 3ZU7A 5AR2A 3EKNA 2WMUA 3A61A 3BU6A 1M7NA 4I5CA 3AC1A 1Y8GA 3C9WA 4L00A 3RVGA 4Y72A 2VGPA 1CTPE 4RVKA 1VZOA 2W1HA 2PE0A 2HAKA 4GT3A 4UZHA 1J7IA 3CP9A 3F66A 2GPHA 1OZ1A 4TWPA 4XS2A 3O51A 4X2GA 4EI4A 2F7ZE 1QCFA 3BIZA 3EN4A 3NSZA 2BALA 4O7TA 3OHTA 3V01A 4Z7HA 2WB8A 1JKLA 1LEWA 2CSNA 4FKIA 4USDA 5HCXA 5IQFA 3R6XA 5AV2A 4GYIA 3C7QA 4C4GA 1SM2A 3HP5A 3RAIA 4KABA 4OUCA 4E4XA 3FV8A 4IBMA 2RF9A 4WRSA 5IQGA 1ZYSA 3E8EA 4W4VA 4BWXA 5K0XA 4CG8A 1XH4A 5LWMA 2ZAZA 4FTAA 2HXQA 4RWLA 3O2MA 3HA8A 3ZUUA 4CMOA 4X3FB 1OI9A 2YA9A 4EH6A 5AP6A 5HOAA 5K4IA 2R7BA 2HK5A 2XJ2A 3R8MA 4ZXTA 1WFCA 5AR4A 5L6WL 2ZM4A 2G2FA 1KOBA 2QVSE 4TPTA 4FA2A 4RIYB 4YTHA 3A7FA 2W17A 3SOAA 4E20A 5GJFA 5JQ8A 2PVMA 4QNAA 2JKMA 4AOJA 3MY5A 1J3HA 4KNBA 4FT0A 4A9UA 2C68A 5TR6A 1CMKE 2P3GX 3PXQA 4YJUA 2UZVA 4D2RA 2BHHA 1KSWA 3CJFA 2VTMA 2JGZA 4G3GA 2IW6A 4ACHA 3TDWA 3OOMA 4QYFA 2JC6A 4DHFA 3SGCA 2E2BA 5HLNA 4O0YA 3HX4A 2O5KA 4UV0A 3R28A 4ZZOA 2WPAA 2E9NA 3UPXA 3LQ8A 4GUBA 3R21A 4XV2A 4W8EA 4LGHA 4LG4A 3PY0A 2B4SB 3U51A 3VUDA 4YJSA 4APPA 5C4LA 1M52A 2AYPA 2QOKA 3MN3A 4RVLA 5EHLA 3H4JA 4ALVA 1WMKA 2ZB1A 3A8XA 4XP2A 2YIXA 2VWZA 2XRUA 3AMAA 4PP9A 5L8JA 4GL9A 3WARA 4BBFA 3ZOSA 4RRVA 3BV2A 4FIHA 2WTDA 3KKVA 3P4KA 1PRYA 4CTCA 3F7WA 2P2HA 2W1ZA 3ENMA 4NCTC 3A4OX 4O21A 3QD4A 2IZSA 4X0MA 1STCE 4V01A 3PPJA 2BILB 4WNKA 4PPBA 4I6HA 1YI3A 2WMQA 4QP3A 3UO5A 1GJOA 4BTFA 4FKJA 3MIAA 3MGYA 4JDHA 1Q24A 4R7IA 1NY3A 2BCJA 2J5FA 3QTRA 4I4FA 5LVLA 3KRRA 1WZYA 2X81A 4OTIA 3CIKA 1XBCA 4QYHA 4EOKA 2RFDA 3BLRA 4PDPA 2CN5A 3PJ8A 3GEQA 4FIEA 1NXKA 4RWIA 3VF8A 4QQTA 3F5PA 3CKWA 4I4EA 1ZMWA 3TL8A 3R7VA 5CF5A 4JG8A 4R1VA 3QRIA 1NT2A 5IQEA 3PE2A 3QQGA 3TZMA 3UG1A 4I5PA 4O38A 1JWHA 2B9JA 3HUCA 4I41A 3EKKA 4PL4A 3RK9A 1OL1A 1QPCA 4F09A 4V05A 4ZMFA 3UIUA 3UIXA 2X8IA 3HL7A 5FLFA 4F63A 1T45A 3PJ2A 4QYEA 1IAJA 1BLXA 3ZFXA 4DEEA 5JFVA 5DG5A 2I0YA 2OXYA 3R9RA 4DBXA 4FNWA 2GS7A 3PPZA 2YM6A 2WQEA 3FLSA 3JY0A 4UWYA 2FA2A 1YVJA 1U5QA 1NVQA 2YWVA 3EYHA 5AX3A 3F2RA 2X7FA 3LW0A 4DH1A 3UMXA 2VX0A 4LGDA 1Z57A 5ANOA 1H24A 3PTGA 2OJJA 3ORPA 3QZFA 3F61A 4IADA 2X6EA 5AUZA 1YDRE 1SNXA 3CQEA 3NYXA 1RQQA 4YTCA 2W4KA 4GV1A 1CKJA 3R0TA 4WNMA 5ICPA 4TWNA 3TUBA 3OT3A 5DIAA 4D4RA 3DBCA 2ITPA 5EW8A 4KS7A 5FXQA 3DAEA 4JBQA 3VS0A 3DBFA 4K77A 4DFUA 5HE0A 4BIDA 1WBVA 3Q4ZA 4R3RA 4XG7A 5GHVA 3UTOA 4TYGA 3BYMA 3IS5A 3E87A 2BTSA 2JBPA 3UMWA 4MD8E 4QMYA 2ZV7A 4PF4A 3GCVA 5AP3A 3RNYA 3I1AA 4USEA 3OC1A 4E6CA 5A3XA 4DN5A 2W1GA 1GIJA 4YJTA 4LYNA 5DN3A 3C0HA 3WZDA 2OLCA 2W5AA 4R5SA 4ZP5A 4DF3A 5AR7A 3QHWA 3AT3A 3NUNA 4QTCA 2H9VA 4FKVA 2O63A 4EHZA 2CGVA 4XNEA 4EJ7A 1KUTA 1OKWA 4IM0A 5H9BA 1WVXA 5FBNC 4BCFA 1M2RA 1R39A 3UIMA 4HVDA 5A4QA 2GDOA 3UP7A 5CY3A 4TY1A 3ZXZA 2BKKA 3BRBA 3AT4A 1P14A 1DI9A 4L6QA 2JBOA 2I0HA 3GQIA 4V0GA 4ASXA 2FVDA 4FKRA 1GZ8A 2UZLA 3RI1A 4IZ7A 1XH9A 2W1IA 4EC8A 2VO7A 4C8BA 3F2AA 3IGGA 5B7VA 2PUPA 4C38A 5LARA 4F6SA 4FBXA 3OY3A 2DUVA 3CPBA
chains in the Genus database with same CATH superfamily
2WZJA 4FOCA 4J8NA 3P5JC 4S34A 5JGAA 4RFYA 5E7RA 5CEPA 2EU9A 2QCSA 2YLEA 2VRXA 3OWLA 5E8ZA 2XIRA 4OTHA 4U8ZA 4AOIA 4UXLA 4J71A 1Q99A 5T68A 3MH2A 3KGAA 1W2FA 4X21A 5FWKK 4D0WA 4N57A 4IAYA 4R3CA 1IA9A 3MS9A 4U80A 1NA7A 2WFYA 3S3IA 2C5OA 4CRLA 4EHEA 4F0GA 1ZAOA 5FTGA 4LOPA 4R78A 3A60A 4FTLA 5F4NA 4UYNA 4PTEA 2UV2A 2HENA 3GU5A 2JIVA 2WTJA 3O23A 3VS5A 3DBEA 4HW7A 2JDVA 3KVWA 5GNKA 1K2PA 4KINA 5HG8A 2RFNA 4RX5A 5L8LA 3FC1X 4RSSA 3AC2A 3GU6A 5L6PA 3ZFYA 2W5HA 4X3FA 4BCPA 4QDEA 3ZTXA 4IM2A 2WNTA 3BHHA 4YP8A 5IA0A 5CF8A 2QOHA 4K18A 1XWSA 4RIYA 4N6YA 3O5AA 4FVPA 2VWWA 4FZFB 4BI0A 3TACA 3EN6A 3MFTA 3F3VA 3LCOA 4QQCA 2YAKA 4FC0A 3AKLA 1L3RE 2I7QA 3LCKA 4J53A 4XYFA 5CS6A 5FP6A 4PX6A 3O71A 3C4WA 3HA6A 4FKOA 2C6KA 4FV8A 5CAUA 5M4UA 3C4ZA 4PDOA 4YURA 3SLSA 4WHZA 2OH0E 3LE6A 4OTGA 4UMQA 5ANGA 4I92A 3W32A 3D7ZA 1H0VA 2BZHB 4YNOA 5JZNA 3NDMA 4U40A 1XHAA 3QTWA 4DHJA 3V04A 4FOBA 4KBKA 4AOTA 1TQMA 3WE8A 3EFLA 2QNJA 4NJDA 2EB3A 2IW9A 1DAWA 4YTFA 1Q8ZA 3A4PA 3HECA 4DLJA 1GZKA 3OEZA 4IWPA 1OIQA 4FZDB 3CY3A 3FMJA 4G3CA 4J1RA 4J96A 5CALA 2XM9A 2Z7RA 1XKKA 4C2VA 2PL0A 4MXYA 3HAVA 2A0CX 3VBQA 5HX6A 4CFXA 2ZV9A 2RIOA 3FZPA 5FD2A 4O91A 3TDVA 2X8EA 3TWJA 1PXJA 3BELA 3BI6A 4NEUA 4XRLA 5CI6A 5F20A 4FZ7A 4GT4A 4ITJA 3PRIA 2V5QA 4QTDA 4YJQA 3F5UA 3TTIA 3UNKA 5CI7A 3V5WA 3WZJA 3VS6A 4U3YA 3LCSA 3LFCA 4PV0A 3LMIA 3BEGA 3P7BA 3FMLA 4BKJA 5DR2A 4EOMA 2ITQA 3GFEA 1PJKA 2PHKA 3VC4A 4IAIA 4QYGA 2BVAA 2OXXA 4F78A 2YJRA 3VW8A 2W7XA 4RIWB 4ZTMA 5L2SA 1HOWA 1K3AA 3TNPC 4AXAA 2R3IA 4DFXE 1G8AA 4FSNA 2VWUA 3Q9WA 4XCUA 3BYUA 5H8GA 2HY81 3MTLA 4YC3A 3QGYA 2BFYA 2OFUA 4EH8A 3LXKA 1CSNA 5JGDA 4C0TA 3W10A 4L53A 4QMVA 4BZDA 5DEYA 2PVHA 3UOHA 4AZSA 3I0OA 4JL9A 4JAIA 3QZGA 3MWUA 3HGKA 3R7GA 2OICA 3COIA 2BZKB 4QMXA 2CLXA 5CEIA 4K6ZA 4BGQA 3MVMA 4AN9A 3OUNB 3DDPA 5GINE 5H8EA 1WBPA 5H2UA 1H4LA 4G2FA 5HD4A 2VUWA 3FZTA 2ERZE 4A4XA 2WQBA 3R1YA 4B8MA 4DT9A 1YHVA 1YHSA 4BC6A 5L6OA 1FMOE 1SZMA 2UW4A 5HBHA 1H1SA 3DK3A 4IWQA 4ZTNA 4DFLA 4U3ZA 4RG0A 2R3OA 4HZRA 3WIKA 3BYSA 2W06A 1Y57A 4YU2A 4WBOA 4DFBA 4IAFA 1LR4A 4HVIA 2BAJA 2UVYA 1HCLA 1W84A 3VAPA 4PPAA 3TG1A 5CU6A 4F7NA 1SYKA 1OIUA 3RNIA 4E6DA 1O6KA 2DQ7X 3LLAA 3VVHA 4FUYA 3ZRLA 2IVUA 1UU8A 3E7OA 2JKKA 5HQ0A 2JAMA 4OBPA 4WSYA 5BVKA 4RQVA 4WNOA 4ANOA 5KBRA 4NZWB 3IQ7A 4ZTSA 2ZYBA 4HCUA 3BGQA 4HVGA 3WZKA 4O84A 3SHEA 4MBIA 5AEPA 3QD3A 3GU8A 4O0SA 1KOAA 2BROA 3Q60A 4FEQA 4FX3A 3I60A 4AA0A 4FV6A 2VX1A 2PZ5A 3AXWA 4U5JA 3NMUF 2PWLA 2QU6A 2C6LA 2YZAA 4L01A 4Z9LA 1GAGA 2PZYA 3W2CA 1GIIA 4L42A 3ZXTA 4BDAA 5KMIA 4FNXA 4U41A 4XG3A 4FTCA 3RZFA 3DB6A 5TKDA 3ZCLA 4EJNA 5F95A 4AF3A 4DEDA 3FLWA 5AUYA 2BRHA 2C3LA 2PMNX 1DM2A 2R5TA 1ST4A 3K5VA 3PDTA 5JT2A 2VD5A 4MAOA 3EQRA 3FQHA 1PMVA 1MUOA 4O0WA 4I20A 3RALA 5HD7A 4LL5A 3ZZEA 4BHZA 3VF9A 4BYIA 5HI2A 4FVQA 3KXNA 4G5JA 2XK8A 3OCSA 5AADA 2PMIA 4EK6A 3JYAA 5CU2A 3LLTA 3DJ5A 5D1JA 3RMFA 5J95A 4U0IA 2X2MA 3MI9A 3RHKA 4ANBA 2R9SA 3VJOA 3K5UA 4I3ZA 2PUNA 3DXNA 3LFEA 2YM4A 4CVAA 5JZJA 3ZEPA 2Z02A 2G9XA 5HE1A 4UZDA 4G1WA 3R7EA 5HIBA 5IA4A 3W0SA 3VQUA 3NCGA 4XH6A 4BDFA 2X39A 3EMGA 4JNWA 3TJDA 3RAWA 3KXHA 4XV9A 4YBJA 3DGKA 4U79A 1BUHA 4JG7A 1E1XA 4C61A 3MY1A 5CQWA 4C3RA 5JRQA 3W1FA 2I1MA 4CT2A 3UG2A 4QMPA 4EH5A 4RLKA 1IA8A 3FXXA 5AR5A 1Q97A 4G3DA 4PQNA 4N70A 4XOYA 5A6NA 3NWWA 2GSFA 3D14A 2J0IA 4FV9A 5L2QA 5IKWA 1ZYLA 3RPSA 1YQJA 4H36A 4NSTA 3FZSA 5IDNA 2OI4X 3BHVA 3PYYA 3ACJA 3Q4TA 5T3QA 5DOSA 3IKAA 1J1CA 4XG6A 2Z60A 3FMKA 3ORTA 4YLLA 2XIZA 3HDMA 2B9FA 1KE6A 3R71A 3QD2B 3ZDUA 5HIEA 1W7HA 3MB6A 4FL2A 3WILA 3MH1A 4GU9A 4FT7A 3PIZA 5FUTA 3A62A 4V04A 3TJCA 1YWRA 4NM7A 4IIRA 5AA9A 3LFSA 3RPOA 2VTQA 3R2BA 4F1MA 3NRMA 3KRJA 3QQLA 5HICA 4YZ9A 4EYMA 2C6EA 3VN9A 3HMNA 3NVKI 2R64A 4QP7A 5EOLA 4A9SA 3NNXA 1OMWA 4UXQA 4DFZE 5KMNA 5AFVA 5JH6A 3VUKA 4YZBA 4J8MA 2XARA 4A07A 2HWPA 4F6UA 5GJGA 3LMHA 2OO8X 4NM5A 4UB7A 5KBQA 4CMTA 1TVOA 5CENA 4F7JA 3MA3A 4JOAA 4WG4A 4PY1A 3W0MA 4C4HA 3ERKA 1QPDA 4G6LA 4DG2E 3A8WA 3FJQE 3HV7A 5EKNA 5LMKA 4FEVA 4NFMA 5I0BA 1R0PA 5I9YA 4EOOA 2ZB0A 4PWNA 5M4FA 3OF0A 5EHYA 2YM3A 3NUXA 2YERA 3MDYA 1IR3A 3TCPA 3UQGA 5IISA 2PY3A 3HRCA 5J87A 5FEDA 2DWBA 1Y6BA 2QQ7A 3PRFA 5I9XA 3GFWA 3ORXA 4FK3A 4S2ZA 3SC1A 5FBOA 4E4MA 3ZUVA 1PYXA 2JFMA 5CEMA 4I0TA 3PVBA 4D1SA 1OGUA 3DJ7A 4C37A 2H6DA 3U9NA 2F7EE 4LRKA 3D5XA 5B2KA 2FO0A 4WRGA 2QOFA 4UMTA 3CCNA 1PW2A 3NEWA 5EW9A 4ZTHA 3EQBA 3G2FA 4RIWA 4EQUA 2ZDUA 1Q62A 4G3EA 4O1OA 2B52A 2GNHA 3MYGA 5HE3A 3O7LB 4WIHA 4O4FA 5AV0A 3PLAE 2ZJWA 3CQUA 3FLYA 3VBXA 5IEYA 3G0FA 2J2IB 3HV3A 4ZLYA 5JK3A 1URCA 4YO6A 2WTKC 1P4FA 2BDFA 4YR8A 2R3HA 4XBUA 4ZAUA 4HOKA 3F5GA 4L7FA 3R1SA 4DGNA 3DXQA 3FPMA 4LM5A 2WAJA 3DLSA 3DT1A 3IONA 3BWFA 3ENHA 2XKCA 4D0XA 1M2PA 4MCVA 3U87A 2WEIA 4CKIA 1GOLA 1JNKA 4BGGA 3NAXA 4CV8A 3QX4A 3HZTA 2JFLA 4M0YA 4ZJJA 4Q5EA 1W98A 3D2IA 4RX9A 4NIFB 5EM7A 5J7HA 4JDJA 4EK3A 1Z9XA 1OKYA 3Q53A 4O7VA 3F9NA 4J99A 2QC6A 2BTRA 4BTMA 4IX6A 4W4WA 3PA3A 2E9PA 4BBEA 4N0SA 4XV3A 4AE9A 3HMPA 3I81A 4AXEA 5ANKA 3ZONA 3FE3A 3V3VA 1NVSA 1DI8A 2I40A 3D2KA 5C9CA 1IRKA 5KCVA 2ONLA 4MTAA 3CY2A 2CGUA 5AR8A 5M56A 1KV1A 4FJVA 2WQMA 3QA0A 2ITVA 2X8DA 5CU3A 4P4CA 5M51A 3LXPA 3N4TA 1LP4A 3ZH8A 4EOJA 1BX6A 2PVFA 5BYLA 3ODZX 2QLUA 4ZS4A 1UWJA 5A14A 4W4YA 4MVFA 3W2QA 5I4NA 4QQJA 5KZ0A 3U9CA 5I9WA 2QR8A 3L9NA 4EKLA 3LFBA 1LEZA 3VS1A 1Q61A 3DK7A 4FIJA 4K33A 3C4CA 5EM5A 5TOZA 5JQ5A 3TYKA 2NRUA 1IG1A 3O8PA 2ESMA 3QRTA 4QP4A 4BCNA 3WIGA 5HTCA 4IH8A 5K5XA 3PVGA 5AIKA 2P55A 1H28A 4FSYA 5DE2A 2YLFA 3QGWA 4RA4A 1XMMA 4FTOA 4NCTA 4KD1A 2J50A 1V1KA 4F9BA 3H30A 2IZUA 3CQWA 3GQLA 2PUUA 2ZM3A 3Q32A 3ITZA 3P23A 5DGZA 3WF7A 1H01A 4Y73A 4RA5A 1R1WA 2IN6A 2Y4PA 5FP5A 3GCSA 2GHGA 3FMMA 3R7UA 4BGHA 4EC9A 1ZARA 4MNEB 5DA3A 2WMSA 4G5PA 2PVRA 3R8ZA 1PXOA 3I6UA 4N4SA 4CZYB 4CG9A 4UMPA 4F0IA 4OTFA 3PUFC 3FYKX 3FQEA 3GI3A 3Q2MA 4Y8DA 2R2PA 4RJ3A 5DR6A 1ZYJA 5LVMA 4DCAA 3RM6A 3V8SA 2CMWA 3LJ0A 2QLQA 3NNUA 4PRJA 4QPMA 3CE3A 2HZIA 1A06A 4MHAA 5HBEA 3IW6A 3TTJA 3TZ7A 1VLRA 3Q9XA 4S30A 3ET7A 2PE2A 4JR3A 5FXRA 3RTPA 5TF9A 1PY5A 3I7BA 4M8TA 4AT3A 4D28A 2CKPA 4KB8A 3E88A 4MXXA 4D5KA 4IVBA 2WXVA 3TV6A 1Y6AA 4O27B 4QMSA 4YC6A 2WIPA 4GCJA 1L8TA 5E1SA 3DZOA 1H1PA 4OR5A 2UVXA 4FTIA 3V5JA 3C4FA 4GS6A 4XG2A 1G5SA 3TNWA 2CCHA 3DTWA 2F49A 2A19B 2Q0NA 4ANQA 3SV0A 2PPQA 1VYWA 2FGIA 3EQCA 3RPRA 1BKXA 3FMEA 5H8BA 3FZOA 4M14A 3C1XA 3CTQA 3VBYA 4Q9ZA 5IMXA 3GU4A 2W1DA 3KFAA 1BMKA 1OUKA 2GNFA 3HRFA 2IJMA 3WI6A 5LOHA 4RFZA 2YN8A 3WF8A 5AUWA 3NS9A 2ITYA 5CNNA 4YJRA 2XIKA 3R30A 4U44A 4DH8A 2NNWB 3C4XA 4RLLA 4BB4A 4LMNA 5CTPA 1TKIA 3O17A 3AC3A 4JI9A 4OLIA 5KNJA 1JKTA 4GU6A 2VTTA 4DH7A 4OBQA 2EUFB 3KC3A 4HGSA 5IQAA 2UW7A 1FGIA 3RKBA 4AT5A 1YXUA 2WOTA 1IAHA 1MQ4A 2Y6MA 4NUSA 1REKA 5EI2A 1PXKA 4D2TA 5AV3A 2HW7A 3MFRA 4YJNA 5K0KA 4O6LA 3OCGA 4FKWA 3D5WA 2E9OA 2R3LA 1XH6A 4YZNA 3VUIA 4JQEA 3SG9A 2BFXA 2WMVA 5ETFA 2V7AA 5BYZA 1ZYCA 2CGWA 2F57A 3AMBA 5EYKA 3UDBA 5BX0A 5KMLA 2XJ1A 5LXMA 4DYMA 1Y91A 2VX3A 4AW5A 1MRUA 3NZ0A 5IU2A 5C8MA 2PVKA 4ZMEA 1I09A 3AGMA 2R3FA 3DOGA 1XQZA 4FSRA 2YZLA 5FEEA 1OPKA 1OB3A 1OIRA 1KE8A 2YCFA 2OWBA 2Z2WA 3QU0A 1VJYA 3Q3BA 3QYZA 5C01A 3VBTA 4C57A 3S95A 2CKQA 4FG7A 2BDWA 4I5HA 4C4JA 2W9ZB 4MD7E 3F3ZA 3JVRA 4PUZA 5CYIA 4GMYA 4NFNA 2I6LA 1YDSE 4IC7A 5DEWA 3A2CA 1OIYA 4GVJA 2QG7A 2G15A 3QD0A 4FTTA 1Z5MA 3W55A 2QHNA 2ZMDA 1TQIA 3R22A 4M15A 4CMUA 3PXZA 4EZ7A 2PMLX 1UNHA 4U6RA 4FSZA 5L2WA 1JKSA 4GUEA 4F7LA 4OTPA 4DTBA 4FG9A 2PVNA 3HKOA 5CAVA 3OXZA 3BE2A 3F69A 2AEGA 5EG3A 1U5RA 2WMRA 5D10A 4X6QC 3K54A 4MX9A 4NIFA 5KHXA 3IW7A 3KXXA 4QQ5A 4LRMA 3PZHA 4G6NA 5GZ9A 4GK3A 4L7SA 3NYOA 2PMOX 3R02A 3OEFX 2CHLA 4QP9A 4MF0A 5CSHA 4TTHB 4J7BA 4N6ZA 4CNHA 4BKYA 3COHA 2O2UA 1M7QA 2W99B 1YOMA 2C0IA 2G2HA 4PNIA 4QYYA 2B1PA 4CTBA 2A1AB 3GGFA 1XR1A 1PMUA 3P1AA 2R3RA 3KA0A 4H3PA 4JG6A 4FV3A 4IMYA 2OKRA 5BUJA 4RJ6A 5L4QA 4XV1A 2VWIA 3KEXA 3NW7A 5A4EA 3G9NA 2PULA 4HYHA 2XKDA 2VTPA 3PWDA 4HJOA 3DKCA 4DHIB 1YI4A 4ALUA 3B8RA 4O4DA 3ZLSA 2QOCA 2RKUA 3PA4A 4GH2A 4F9CA 2QOQA 2JEDA 5LVPA 2XB7A 4RPVA 4FUXA 2ZFYA 5J5SA 5AP0A 1YDTE 2QONA 1CDKA 3ZO1A 4DAWA 3U54A 3P0MA 3G0EA 4Y5QA 4EEVA 2JIUA 1VYZA 3DB8A 4XJ0A 4D1XA 3KMUA 2JDTA 5J1VA 4J98A 2F2CB 4F9WA 3MBLA 3P79A 3TXOA 3W0PA 3FY2A 5HLWA 4X7QA 3LQ5A 5IUHA 3P5KA 2W96B 4Y83A 4BDKA 3RZBA 2BRGA 3ULZA 4DGLC 4AA5A 4RJ7A 3M2WA 4IWOA 1OPJA 2YIQA 4E5AX 4EOLA 5FM3A 4CFWA 4IVDA 3ELJA 3ZLWA 1BL6A 2YEXA 4E5WA 2WTVA 4WG3A 5GJDA 1PF8A 3MVLA 1H0WA 2NP8A 3OT8A 1FQ1B 3FI8A 3DCVA 2R4BA 2R3KA 5JRSA 3KL8A 2WHBA 4G3FA 4MNEA 5EHOA 3AKJA 4AFEA 3Q4UA 3JXWA 3Q5IA 4ASDA 4KUJA 2ERKA 3OXTA 3VUTA 5HX8A 4Z7GA 4D9TA 4EUTA 3TNQB 4FIIA 1ZOHA 5A4TA 3DY7A 4TRLA 4B0GA 2XK4A 4FKQA 5BVNA 4D2VA 4NW6A 2GTMA 4ITIA 2YAAA 3RP9A 2J90A 3NNWA 5EYMA 2IW8A 4A7CA 4BTJA 5IZFA 3TI1A 5DMZA 2VWBA 5M55A 4JX3A 2VTAA 2X0GA 1GZNA 4AA4A 3DAKA 2UZBA 4WNPA 3V51A 3LFQA 4HVHA 4NWMA 3TEIA 4ERWA 1RDQE 3LHJA 4O1PA 2B54A 3TT0A 4GW8A 4MWHA 1Q8UA 2R3JA 4RWKA 3V8WA 5HCYA 3G9LX 2B9IA 3EFWA 5DT4A 2OXDA 3OG7A 3PP1A 3K3IA 3VHKA 3LKMA 2BRNA 4L46A 4APCA 4AZFA 3EN7A 3FL4A 3QXPA 1OM1A 5K4JA 5KUPA 2EXEA 4RX7A 1V0BA 2ACXA 2XNGA 1YRPA 3M11A 4UMRA 4YJPA 4GJ2A 5L2IA 4WG5A 3TKUA 3DK6A 2GS2A 3FWQA 4IVCA 2IEWA 3PA5A 4O4CA 3IW5A 5ETCA 5G1XA 4DEGA 3DKGA 3A7IA 3EL7A 3VS2A 5A6OA 4HGEA 5LMBA 2V0DA 4G34A 4FKTA 3QZHA 1Q3DA 4WSQA 4BCJA 4D1ZA 2Y0AA 4QMLA 2X2KA 4DDIA 4TZRA 4AXFA 1H1QA 2JAVA 1B38A 4FYNA 4D2SA 4F0FA 4ASEA 3FSKA 4A9TA 2X4ZA 5HE2A 4RQKA 4MBLA 1M14A 2ZDTA 5BNJA 5KMJA 4BWPA 3AMYA 1QPEA 3EQIA 4MYGA 3BBTB 4GEOA 4QMOA 5TO8A 4ACMA 4EOSA 4Z55A 3ALNA 2IZRA 4F08A 3DQXA 4FV1A 4RX8A 1PKGA 1T46A 1YW2A 3LJ2A 1J7UA 2CKEA 4JBVA 3R63A 3WZEA 4DCEA 5DRDA 1AD5A 1WVYA 2VV9A 3KF4A 1FINA 4GK4A 4ID7A 3TNIA 3MVJA 4IDVA 3V5PA 4K11A 3ZDIA 4EKKA 1XH8A 4M97A 5E1EA 4TN6A 2YDKA 3BYOA 4JBOA 3RBWA 2PUIA 3BQRA 3VRZA 4XLVA 1NVRA 5HU9A 5IQHA 2WKMA 4WD5A 1ZWSA 3GVUA 4IQ6A 4EZ5A 2G1TA 4OTDA 3NAYA 5I9VA 3AD6A 2VNYA 1JSUA 5AX9A 3H10A 3HLLA 3PG3A 1A48A 3DPKA 3F2NA 3N51A 2UUEA 5CASA 5J9LA 4OAUC 5CVFA 2J0MB 1R78A 4FTKA 2GS6A 2IO6A 4P5QA 2YM5A 4KA3A 4RJ4A 3W2PA 4FSTA 4U7ZA 4AGWA 4D5HA 1W0XC 1PXPA 4OTQA 3A99A 1XJDA 4PMPA 3HV5A 4D4VA 3UVRA 2XJ0A 3GU7A 5M08A 3NIZA 3KXMA 2J5EA 3NUSA 4FL3A 3UE4A 5IUGA 5DLSA 4MH7A 4EK8A 4L45A 4FKUA 3D7TB 1GY3A 1SVEA 1H26A 3L8VA 1ZXEA 4RVMA 3FKOA 5BQ0A 5J9ZA 1VR2A 1GZOA 4EONA 3D83A 4IX5A 5IH5A 2QU5A 4DITA 1OUYA 3UC3A 3PY1A 2XCHA 4FL1A 3ZRMA 3EB0A 4DBNA 3FHRA 3VULA 4BJJB 4EYJA 3P7AA 1ZOGA 4Y46A 2BDJA 3KQ7A 5CAQA 3GCQA 5DPVA 5HESA 4ZTLA 4TW9A 3UODA 5KHWA 2WTIA 4NM3A 3CS9A 3I4BA 4FT3A 1XO2B 4G9CA 3CBLA 4MWIA 1IEPA 4WOVA 2GQSA 4B9DA 3PSDA 2BR1A 3ORKA 2JDRA 2A4LA 3TV4A 1APME 1UKHA 2XA4A 1OL2A 4L9IA 2F7XE 1IASA 4WUNA 3FLZA 4DFNA 2C5NA 2J0LA 4IJ9A 5IA5A 4DDGA 3ZC5A 4J95A 4ZJIA 2UZUE 4M0ZA 4X3FC 3BHYA 2QODA 4O4BB 4PTGA 3RCDA 2XANA 3UJGA 5I9ZA 3D4QA 4TYJA 3AT2A 2RFEA 2QD9A 4KSPA 5IEVA 2H96A 2ZMCA 5A54A 2EB2A 1ZMVA 3LFFA 5HG7A 4YHTA 1PXIA 3JUHA 3N9XA 3O7LD 2B0QA 3FY0A 4WT6A 4C58A 2LAVA 3S2PA 3QQHA 2OZAB 4I24A 2P33A 4MXOA 3ZSHA 5AUXA 3VUMA 5HO8A 2V7OA 2VTIA 1RW8A 4PMMA 2BRMA 4WA9A 2I0EA 4C59A 4I94A 5BVFA 5HZNA 1JAMA 5JGBA 1E9HA 2X2LA 4M68A 1GIHA 5DI1A 3OS3A 4FR4A 3G33A 4RJ5A 3TN8A 4BICA 4EOPA 4F1TA 3P08A 3L9PA 2VO3A 4FKPA 1PMEA 3U55A 3AGLA 3L8PA 4Q9SA 3FKNA 2F2UA 3DNDA 4QMZA 5J79A 3DDQA 2WMXA 4L67A 5D9HA 5EK7A 2YIRA 4BIBA 4RBLA 4EHGA 3AG9A 5ITAA 4EK4A 4R5YA 5I3OA 5C8NA 5FG8A 5IA2A 3QWKA 4PMTA 3QX2A 4R7HA 4ZSEA 1QMZA 3PUPA 5CNOA 4YJVA 5EKOA 3F3TA 5EDPA 3UNJA 4BCKA 2ITOA 3MH0A 4NKAA 1H25A 4E5BA 2CGXA 3FI3A 2WTWA 2QOIA 3GUBA 2B9HA 2OH4A 4QNYA 2XNMA 3QF9A 3QTUA 5CVGA 5ANIA 3BLQA 3COKA 2LGCA 5BYYA 1W8CA 3LJ1A 2AUHA 2WD1A 4BI1A 4CZUA 3BLHA 1WVWA 3ROCA 4O6EA 4X2NA 3JR1A 4FF8A 1ZY4A 2X1NA 3E93A 3QQKA 3GC9A 4IFGA 3PY3A 1YKRA 3SW4A 3FMHA 1DS5A 4E4LA 4L44A 4F70A 3ORLA 2JD5A 3V5TA 2WOUA 3Q9YA 4CV9A 3G5DA 4JRNA 5LWNA 3ZO4A 3D0EA 4IB1A 3LXNA 3UZPA 3TIZA 2VTJA 5AP1A 1YXXA 3KMMA 3ZEWA 4MUQA 3W0RA 3H9RA 4QP6A 4HCVA 4ZY4A 2XK3A 3IOPA 4J97A 4FEUA 3UDTA 4E26A 4RWJA 4WBBB 3RPVA 5CAOA 4KIPA 4A4LA 3UC4A 2C6IA 2W0JA 2R3MA 3QUEA 3M1SA 2XZSA 4O0XA 2C5XA 3OOGA 1K9AA 5C26A 2PE1A 3KK9A 3LM0A 4YNEA 5E8YA 5JFWA 4IAKA 3VBVA 3W18A 4RGJA 3CD8A 3HUBA 1Q4LA 1V0PA 4BKZA 2A27A 5HG5A 2XKEA 2FSOX 2OIDA 3R1QA 3WYYA 2UW9A 4O2ZA 4DH5A 3SA0A 1ZRZA 2XM8A 4IC8A 2WIHA 4X6RA 3BQCA 4LQMA 4ZSGA 1ZMUA 3G6GA 4PL5A 2V62A 4UN0C 4I6FA 4KKEA 4OT5A 4EWHA 4LOOA 4O7YA 2PVJA 4F9YA 3EZRA 5GIPE 5I3RA 5FM2A 2OG8A 3DZQA 3FLNC 2KTYA 3FUPA 3ZZWA 4O81A 5M09A 3GOKA 4TYEA 3KY2A 5E8TA 5LVNA 2FUMA 1GNGA 3CGOA 4AN3A 4ZZMA 2WQOA 5CSWA 4ALWA 4EHVA 4L43A 2VTRA 3WBLA 2Z7SA 1XH5A 4I6LA 1S9JA 4QMTA 2XK7A 2VAGA 1PKDA 4RZWA 2BMCA 5KE0A 4KS8A 1U46A 1YOLA 5EDRA 3SKCA 4EZ3A 4XP3A 2VWXA 2QO2A 3W0QA 4R8QA 3MY0A 2I0VA 3HDNA 4O0UA 3OFMA 5EI8A 3T8OA 4C3PA 1YXSA 3HNGA 4YPDA 2FSMX 4NTTA 3D7TA 3IPHA 3OTVA 3QYWA 2GMXA 4E6AA 5BUEA 4UWCA 3UQCA 3UQFA 2OJGA 4FTQA 1TZDA 2WO6A 4DH3A 1G8JA 2E9UA 2OF2A 3C4EA 3FHIA 4AGCA 1OL5A 2RFSA 4IZYA 4AGUA 2HWOA 3Q9ZA 5EM8A 2NPQA 4R3PA 3A7JA 4M69B 3ZO2A 4G9RA 4GYGA 4BJJA 3DBQA 3HMIA 4J52A 4AWIA 3ORMA 3W2OA 3RHXA 2VWYA 3ZO3A 3SVVA 3KU2A 4EH3A 1SNUA 4H1MA 4H3BA 4XLIA 3BLAA 1F3MC 4EBVA 3I0QA 4ZK5A 4ZSJA 5HNIX 4QTEA 3MV5A 3R73A 4H3QA 1WCCA 3LCDA 5CEQA 3IDBA 4QPSA 3BYVA 4X2FA 5CZHA 3VBWA 3EQDA 3R04A 3UZRA 5D7VA 2VU3A 3KXGA 4NH1A 3WOWA 3O8TA 5HNBA 3VUHA 4ENYA 3VS7A 5E91A 1P5EA 3BV3A 2R3QA 4W4XA 5KZIA 4BDBA 4FE2A 4O83A 2BPMA 4FIGA 2Y9QA 4UMUA 2WMTA 3ULIA 1X8BA 2O64A 4L68A 4FNYA 5DH3A 3FLQA 4BDEA 1BI8A 2CPKE 2XUUA 3DKOA 2CCIA 4MBJA 4O7NA 4U42A 3R2YA 5J8IA 2XEYA 4FRFA 5TE0A 2BAQA 4HGLA 4BZNA 4GSBA 4JT3A 3SX9A 3R9NA 4ORKA 1PHKA 4BN1A 3V6SA 4YUQA 3OW4A 5EM6A 3E3PA 2P4IA 4QP1A 4QPAA 2J0KA 4HGTA