4PWNA

Crystal structure of active wnk1 kinase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
274
structure length
245
Chain Sequence
KAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDFKEEAEMLKGLQHPNIVRFYDSWESTCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase WNK1
publication title Chloride Sensing by WNK1 Involves Inhibition of Autophosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 70
structure length 245
sequence length 274
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4pwnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4pwnA01
2R5TA 2PE2A 2ZDUA 2ACXA 4ZAUA 4O7TA 2BFXA 2V62A 3WARA 3PVWA 3D7ZA 3ZLXA 4WNOA 5J9YA 4FE2A 3PA5A 5KBRA 4FEVA 3EN6A 2VTIA 2WXVA 5CF5A 4U81A 3CD3A 4O7SA 1JBPE 2F7XE 4AF3A 5HLPA 1YRPA 4FSUA 4D2VA 2OXDA 5I9WA 3HMMA 2ZDTA 4JLCA 3VS6A 1V1KA 3U55A 2BIYA 5EQEA 2H96A 3D0EA 3DQWA 2O2UA 5KMMA 3TN8A 4MYGA 4BYJA 4ZSAA 1YHVA 2C30A 3V5JA 4XH6A 1OVEA 5EW3A 1R78A 2E9VA 1G3NA 2W1IA 2X8IA 4IAIA 4BB4A 3K5UA 3D4QA 4BDIA 1WBVA 3LFBA 3SG8A 1OIRA 4R3CA 5F1ZA 2UZLA 5F94A 1B39A 3Q4TA 4FVPA 2BAJA 4QMZA 4WG5A 1X8BA 2XZSA 5CEPA 4F65A 1KE6A 4UMRA 3FZSA 1YXUA 5HE0A 4ACDA 3KRLA 4MXXA 3U6JA 2JKKA 5K4JA 2ITZA 3DZQA 5C27A 3RK7A 4N6YA 4EOOA 4ZY4A 3OFMA 3CTJA 4GG7A 4XG8A 1G5SA 3R8LA 4CVAA 1YXXA 4RG0A 4BI0A 1H00A 4XG2A 4JAIA 4X7QA 3TWJA 4ACHA 4R1VA 4QO9A 3HX4A 3QXPA 4TW9A 4CCBA 2WTWA 3AGMA 4B0GA 4DTBA 4FV4A 2GCDA 4HPUE 2I1MA 2XEYA 3HEGA 3LFAA 2HCKA 3ELJA 4MNFA 4V0GB 2HENA 4IX5A 5D11A 2VWWA 4YTHA 2ITQA 4C33A 3TTJA 4QP8A 1JNKA 3QRKA 1VYWA 3CQEA 4FNWA 1OUKA 4S30A 3LCSA 2B1PA 4X6RA 3R30A 2RG5A 1GZOA 5E90A 3A7GA 4GU9A 4FSYA 3R21A 5J5TA 1ZMVA 1UU8A 2W4KA 3EN9A 1ATPE 1ZYJA 3LHJA 4M14A 4UBAA 2PL0A 3KXGA 2XRUA 2UZOA 2XNOA 3PP0A 3VVHA 3S1HA 2IWIA 4Q9SA 4U9AA 5FBNC 2PVYA 4QD6A 3FMEA 2W1ZA 2G2HA 4C4GA 4QTEA 1SMHA 5C8NA 3ZXTA 5CS6A 1B6CB 3KRRA 5IA4A 3NVKI 2O3PA 3OEZA 5K4IA 3UZPA 3W55A 3MI9A 2WKMA 2WEVA 4IEBA 4UMPA 3KKVA 1S9IA 4I0RA 1VR2A 4RJ5A 5CALA 3KCFA 2IZTA 4APCA 5A6NA 3I0QA 2CN5A 3TNWA 4PDSA 4EH7A 5HVJA 4H3PA 1M7QA 1NVRA 2J51A 2V5QA 2OXXA 1GY3A 3PG1A 4FSZA 4ZTRA 1BYGA 2VTAA 4GSBA 3HYHA 2R3JA 3BI6A 4IH8A 2GFSA 5CI6A 3GC8A 2JFMA 2VGOA 2HY81 3ZC6A 4E5AX 4AW0A 3P79A 5CNNA 3WF6A 3EJ1A 3LCOA 4KWPA 5AV3A 3QCXA 3U4WA 4D5KA 1T46A 3UQCA 4LFIA 4EOQA 2XK3A 3SOAA 4IM0A 3Q4UA 1XBCA 4IANA 3ORMA 3GGFA 5AV0A 2WU7A 3OUNB 5AV2A 4MF0A 4APPA 2XMYA 4QTAA 2WQNA 5F4NA 2PVNA 3D2KA 2H6DA 4IWPA 3GCSA 4RA5A 3ZO4A 5KMLA 2XNMA 1H4LA 5L8LA 3D94A 2IVUA 2VO7A 3ALNA 5E8TA 2WMAA 4LMUA 2IPXA 3MIYA 3Q32A 4G9CA 4GCJA 4AA4A 4M0YA 4ALWA 1PMVA 4CFFA 3D5UA 2X6DA 2XM8A 4XOZA 4LUDA 5AR3A 4QYGA 2C6TA 3E7VA 4YJQA 4A07A 1PF8A 3R1NA 2VO3A 1ZYDA 3GEQA 4R3RA 4FI1A 2YIWA 2FO0A 3IDPA 4LQMA 4TYEA 4L67A 5KHWA 4FK6A 4RMZA 3QA8A 4YSJA 2F9GA 4QRCA 4FMQA 5ANEA 4D0WA 4AZWA 3Q6UA 1JKTA 4BR3A 3I81A 4NJ3A 3ZSIA 3RM7A 2FSLX 3V3VA 2CSNA 3FMLA 5A3XA 3LLTA 5HNIX 3KY2A 2XH5A 4RX7A 3UO5A 1G8AA 2WMRA 3GP0A 2IW6A 5FXQA 2YCFA 3RAHA 3SRVA 4EK4A 1H27A 3IW7A 5CU2A 4FV2A 4AW1A 4DITA 4IWQA 3KVWA 3QLFA 4LRJA 2GS2A 4C36A 5DYJA 2WTDA 4FIJA 4RWJA 3ORKA 4NCTA 4EQUA 3FI8A 3FKNA 2VWVA 3A7FA 3L8PA 1MRVA 3ZONA 4O91A 4R3PA 3PVGA 2R7IA 3QRTA 2Z7RA 2A27A 5J1VA 5IA5A 3TKUA 3VW6A 3FBVA 4I5PA 3R8ZA 1I09A 2GHGA 4J8MA 4Y72A 4XLVA 1SNXA 4MTAA 3R1QA 1OKYA 5K9IA 5JT2A 4RIOA 3VUTA 2HYYA 2CGVA 3AGLA 3WE8A 2UVXA 3JPVA 3L8XA 4YHFA 3OCSA 5E8VA 3R1YA 3NNWA 3LCDA 3NS9A 3NUUA 4O2PA 3ZLYA 5EYCA 3GU6A 4S32A 3DKGA 5M08A 2RKUA 2CPKE 2W7XA 1VJYA 3H10A 1NW1A 4U79A 3IECA 2GNGA 2CDZA 1PRYA 4BDJA 1FINA 2VWIA 2XYNA 4X2GA 4M68A 1WFCA 5B2LA 2DS1A 2GNHA 3GXLA 2YABA 5ETIA 5E8UA 3R9NA 2X4ZA 4PMSA 5CX9A 1M17A 3BEGA 5L6WL 5DT0A 3R7GA 1P2AA 3PPKA 4GG5A 4IAYA 4DH1A 2XNGA 4QP4A 2QOLA 3P23A 4J95A 4R7BA 3RAIA 4RIWA 1OL1A 3GU8A 4EH8A 4ZTQA 2GQSA 4PV0A 3H0YA 2NO3A 3E8EA 3G33A 4DINA 4IE9A 5C01A 2Z7QA 3GCVA 4MXZA 4U5JA 2PVMA 3R8VA 3W8LA 1S9JA 2PYWA 5AR5A 4IZYA 2VWUA 2WQBA 4EHEA 4HYIA 1H26A 4JG7A 5IQBA 4L00A 4AZTA 2R64A 3C0GA 3OVVA 3FLNC 2RG6A 4LUEA 3RAWA 3UTOA 3QD0A 4TKSA 4F0FA 3LE6A 4FZ6A 4RT7A 3DJ6A 4TRLA 4BCQA 4BGQA 5LMAA 3PWDA 4AN3A 4KKEA 4FG9A 2C6DA 4ANBA 4EK5A 1BI8A 2UZEA 4E5BA 4RQVA 3TNIA 3DXPA 2PMLX 4A9UA 2UZDA 3F6XA 3DAEA 4USEA 4U40A 2VAGA 2AC5A 4CKRA 4XV9A 3VQUA 4JDKA 3DBQA 4HVGA 4RQKA 5CSXA 3VUMA 1H8FA 3E63A 3PIZA 5CXHA 4IADA 4R7HA 4PTCA 4TWOA 4OT5A 3BKBA 5HCYA 4AZVA 1ZZLA 3NIZA 5I5ZA 5LJJA 4F6SA 2UW3A 4JRVA 2ZM1A 4DH7A 4XUFA 3V8WA 4S34A 2WTCA 5HG8A 2J0KA 4MHAA 4YGAA 3UO4A 3AG9A 1Q97A 3DTWA 5JFWA 3BYMA 3WBLA 2FSTX 3L9MA 3TG1A 5GZAA 4NZWB 3KMUA 4BDDA 3MY1A 3FLQA 4KS7A 3ZLWA 5TOZA 5J9ZA 4GK4A 2BAKA 2YIXA 3NUPA 2XBJA 3FMJA 1GIJA 2WIPA 2BPMA 3MIAA 4I94A 2R3RA 2A2AA 4HCTA 4N0SA 3ORIA 2QC6A 4IZ7A 4CFUA 2ZJWA 1E9HA 4ZZOA 4TYHA 3SA0A 3E62A 5AP5A 3DLSA 2YIYA 4BDBA 2YWVA 4AN2A 5BVEA 2ITTA 4RZWA 4NM5A 4KSQA 3NNVA 4OR5A 1OL6A 1Y8GA 1J7UA 2C68A 4FYOA 4E6QA 3MESA 4JJRA 5J79A 2GPHA 3HRCA 3WZEA 5IQFA 4D4SA 3MBLA 4O82A 2QD9A 1H0WA 4KBKA 1YHSA 4LGHA 3PJ2A 4NM7A 4AW5A 2EVAA 3R7YA 3LXKA 4BHZA 4UMQA 5IKWA 1OMWA 4NKSA 1UU3A 3R0TA 5M4CA 2KTYA 5CU0A 2ITVA 3OT3A 3B2WA 1CTPE 3DDQA 3GQLA 4CRLA 4OUCA 3MFSA 1URCA 4JQ7A 2W05A 2YDIA 3PVUA 5IH5A 3C0HA 5H3QA 1G8SA 3F2AA 1BL7A 1GIHA 3BCEA 2CHLA 1Q8YA 3CLYA 3UOJA 1Q5KA 2E9NA 4LL5A 4EI4A 4YLKA 3UQGA 3BU6A 5IA1A 4ASZA 4GFMA 4PDYA 3MGYA 5M4FA 2VD5A 5A14A 5D12A 3AC2A 3P0MA 3W32A 2ONLA 3A7JA 3CR0A 2WMVA 2X9EA 3HVCA 3MH2A 3VS2A 2W1GA 5DRBA 2UW0A 2VNYA 2UZBA 3Q3BA 4C4JA 1SZMA 4D9TA 3V8SA 3KK8A 4ZTSA 3E64A 1FBNA 3PDTA 3WI6A 4M0ZA 3BGPA 4QNAA 4XEYA 3A8XA 3ZU7A 4KS8A 3QCYA 3BBWA 5BVFA 3DJ7A 1RW8A 4YPSA 3O51A 4XLIA 2OK1A 1Q8ZA 2B55A 3I7BA 4YBKA 5EDQA 5KKRB 1E1XA 4U80A 5GJDA 3R73A 4UB7A 4TNDA 3UODA 4DEHA 4F1TA 3BV3A 3AD4A 3IS5A 3P7CA 4K1BA 3WZDA 4DGGA 2QHMA 3SRVB 2VTRA 5M09A 3UOLA 5D9HA 3OXZA 1PKGA 5TO8A 3RP9A 4GVAA 2EXCX 4JDIA 4RIYA 3WF8A 4RJ3A 1KUTA 4QTCA 3QX4A 3ZLSA 4FT5A 3UC3A 3VBQA 2I0YA 2ETMA 1ZZ2A 2G9XA 2UW6A 3DNEA 3FJQE 4L46A 2GHLA 3Q5IA 2WELA 3W2RA 4C61A 3DOGA 5FXRA 4GU6A 3H9FA 3BPRA 3F5PA 1TVOA 2X2MA 3EB0A 4FEQA 5ANOA 4K11A 3NUAA 5IF1A 4O38A 4IHPA 5IH6A 5DR6A 4CCUA 1V0OA 2EXEA 4V04A 3FXZA 2G2IA 4RLLA 2OSCA 4UMUA 3ALOA 3NW6A 2QR7A 3TZMA 3CP9A 3NGAA 5DGZA 3EQBA 5BYLA 2YAKA 3PXQA 3BIZA 4KRDA 2FUMA 4PPAA 4I22A 4M67A 4L43A 5LVNA 2QO2A 3NVMB 4CV9A 3DV3A 5GHVA 3OOMA 4BYIA 3I0OA 2BZHB 2QHNA 2FA2A 3C4FA 1XH4A 1P14A 2JGZA 3LPBA 4G3GA 3VN9A 4BTKA 2KULA 2ZB1A 2HXLA 4E6CA 3VUIA 2HW6A 4U42A 2ITYA 4FTMA 4UXQA 4MEDA 2IZRA 5HBHA 4IC8A 4BL1A 2OBJA 4CNHA 4EYMA 3KULA 3VS0A 5GZ8A 4HZRA 3L9PA 4BGHA 3NYXA 4RIWB 4DFBA 2UVZA 3TJCA 4G16A 3CD8A 4ERKA 2PZRA 4MWHA 5M51A 3TM0A 4EZ3A 2OLCA 3P4KA 5FEQA 3FDNA 4L3JA 5GJFA 4X21A 3R9DA 3QLGA 4XX9A 3DZOA 2Z60A 4ASXA 4GEOA 2CKOA 3KB7A 2PU8A 2F57A 4OBPA 1AGWA 5JFVA 2UZUE 2XNEA 3V8TA 1H25A 5FD2A 1F5QA 4F0IA 3GT8A 5D7AA 4AWIA 3ZM9A 4C4IA 2EUFB 3D7TA 4RWKA 3FL5A 4PDPA 3AC8A 4FF8A 1RJBA 4QP9A 5KMIA 2QG5A 2VX1A 3PA4A 4YJPA 3T3UA 4BKJA 3F82A 4IWOA 1OECA 3BYSA 3DXNA 4FKTA 2UV2A 4FKOA 3FE3A 1IA9A 4O7YA 3ORZA 4Q5EA 3FPMA 5F95A 4BDAA 4F9WA 3DCVA 2UZWE 3BYVA 4FOCA 4PNKA 3ZM4A 4LI5A 4BCHA 5LXMA 1U54A 3QC4A 3NUSA 1TKIA 1O6LA 5C03A 3DKOA 3HECA 4PPCA 1NVQA 5ANDA 5GZ9A 5BYZA 1R0PA 4PQNA 4AU8A 2YA9A 2PZPA 3PUPA 2XKFA 5A4TA 2C1AA 2C5XA 3G90X 4XNEA 2GHMA 4MKCA 4YLJA 4FV9A 4ITHA 4GYGA 4YZNA 5E8XA 3VNTA 2J0IA 3E8CA 1L8TA 2Z7LA 5B7VA 4J96A 5FGKA 4QPMA 1PXMA 4G5PA 3ZSGA 5C4KA 1W84A 5JZNA 4RA4A 2YIQA 3SDJA 4EOMA 4Y83A 2WQMA 1J91A 3C4CA 4A4XA 1LPUA 2VTNA 5CSPA 4C37A 3EHAA 4ZY6A 4RFYA 3SOCA 2VWYA 4HVHA 5LWMA 3BZ3A 4C8BA 1H08A 4AFEA 3S3IA 3ZFYA 4FT0A 3DLZA 2V7AA 3C13A 3MA6A 5KMNA 5JGAA 3OCGA 4Y73A 3EL7A 5AP7A 3ORXA 2XP2A 3HV3A 4FKQA 3FLZA 4D28A 1OB3A 3VS1A 2P2IA 4BCKA 3HRBA 1FGKA 3V51A 3W16A 4BCOA 4FNYA 4H1JA 4S31A 3L1SA 3NR9A 3V6RA 4I0SA 4YTIA 4CD0A 4W8DA 2NP8A 3DAJA 4LG4A 4P4CA 3SX9A 3ZZWA 3SW7A 3D14A 4RFZA 3QA0A 4YJUA 1J1CA 3OW3A 4K33A 4P7EA 2CLQA 3DAKA 3F69A 3W1FA 4DH5A 1VYZA 2RIOA 5J1WA 2PMNX 3HGKA 4D1SA 2C4GA 4D0XA 3II5A 3O8PA 5TR6A 5AM6A 5AWMA 1JQHA 2IN6A 4OAVB 2Y6OA 4XMOA 2JC6A 2GNIA 5DRDA 4UEUA 3TEIA 3QAME 3WF5A 4AGDA 1ZOHA 3QQUA 4J99A 5CQUA 3L9NA 4BWKA 4Q5HA 3QQHA 5FBOA 5BUJA 4U44A 3IW4A 1KOBA 4HCVA 3ZBFA 2GTMA 2XB7A 3IDCA 4DC2A 4EHZA 1IR3A 3V5TA 3QKLA 4HYSA 2R3NA 4QMWA 4TWNA 3LOKA 3ZOSA 5EI8A 5CAPA 3RZBA 1J3HA 2WOUA 3GFWA 3FAAA 4FZFB 4IW0A 2BAQA 3SV0A 4TWCA 5DT3A 2JKMA 4E3CA 4EUTA 5CYIA 3RPRA 3CS9A 3UNJA 3BLQA 4JIAA 3RCDA 4CT1A 5JMSA 4I41A 1WVYA 4FV7A 3V5WA 3T3VA 4R77A 3ITZA 3AT4A 3R00A 2JD5A 4DFNA 3A60A 4A7CA 1RDQE 3OF0A 1M2RA 3FLSA 2BHEA 3BHHA 4B8MA 5BQ0A 3ATTA 2CN8A 5L2SA 1W7HA 1W82A 4F7LA 5ETCA 3G2FA 3U9NA 2UUEA 4LV5A 3DK7A 3P7AA 2ITUA 2VO0A 3ZMMA 2GTNA 2VRXA 3E3PA 2BRNA 2OG8A 3QX2A 4RVLA 3FZOA 3RAKA 5IQIA 4HGTA 2O63A 3E8DA 3Q9WA 4BIBA 2F49A 3KMWA 4QMSA 2WB8A 3R28A 4NM0A 4EOSA 3FC2A 2QU6A 2XKEA 3VBXA 4DEEA 2ITWA 3ACKA 4BZNA 4HVIA 4FIGA 1L3RE 2QOHA 5EH0A 4P5QA 5I9XA 2PUPA 3PIXA 4ACGA 4NW5A 2VTPA 3LM5A 5C8MA 4BVUA 4BICA 1AD5A 4KIKA 4Z55A 1UWHA 4MX9A 1FVTA 4XP3A 4HGEA 4FTTA 4JG6A 3S2PA 2YZLA 4BY9E 3POOA 4CRSA 4LRMA 4GYIA 4DEAA 1WBPA 5M06A 2ONLC 2YM4A 3EQCA 1FQ1B 5HBEA 4X3JA 4JG8A 5CVFA 2Y0AA 3QWKA 3RZFA 2XNPA 4D2RA 2Q0NA 4ALUA 4JX3A 4DT9A 4E6DA 4FK3A 5K3YA 3FXXA 1UV5A 5AP0A 4DG0E 4KIQA 1JKLA 2XJ1A 3BU5A 4RVTA 3O50A 3D2IA 2E9UA 3FZRA 4B9DA 4I24A 4LOOA 5KCVA 3VBVA 5DR2A 3WOWA 3O8TA 3TL8A 4QPSA 2Y8OA 2GNFA 3EZVA 5DOSA 2DUVA 4UZHA 4Q9ZA 4ZP5A 5JZJA 2JFLA 5IMXA 1CMKE 4DT8A 4Z7GA 3HP5A 3A4PA 4LMNA 5IMEA 3D7TB 1IAJA 5CU4A 4BCIA 2YLFA 4B8LA 3HDNA 4O0RA 3LMGA 3TJDA 4A9RA 4L3PA 4ZS4A 3UG1A 2F2CB 1JKSA 3LQ8A 3WYXA 3OUKA 3CPBA 5LOHA 2NRYA 4UX9A 4AGUA 4BCJA 4L01A 2XKCA 1H1WA 2YCQA 3IONA 4QT1A 3RNYA 3F2RA 4RJ7A 3OROA 4O7VA 3MTFA 3Q6WA 4DGMA 2EXMA 3QUDA 3CC6A 3QTXA 5DFPA 4XRJA 1FGIA 5FDXA 3T9TA 2F2UA 2C6LA 4GFGA 4C57A 4I23A 3EQHA 4KBAA 3KRXA 1U54B 4KINA 5JQ8A 3TDWA 4WUAA 5A54A 3U8WA 4DLJA 4F99A 2RGPA 2OKRA 3GB2A 5A6OA 1ND4A 3SD0A 4D2SA 5AP2A 4BFMA 4DH8A 5JEBA 2BTSA 4IAAA 4GVJA 1UU9A 2J90A 3FL4A 4FG7A 4HVDA 1RQQA 4K18A 5LWNA 2WMUA 4Z3VA 4FTOA 2XUUA 5KMKA 1BL6A 4QYEA 3TKHA 3IKAA 3Q4CA 4CG8A 3FHRA 4FV5A 4E1ZA 3OW4A 3I60A 3KXZA 3AQVA 2C0TA 4ZTLA 3NUXA 2R3HA 1WZYA 4K9YA 4IVCA 3QGYA 4WNPA 4FODA 5FUTA 5BUEA 1Q99A 2Y9QA 5E8SA 2IVVA 3FXWA 4C34A 3R7OA 4DN5A 4F6WA 3F7WA 4FIIA 2J4ZA 1TQIA 4FKSA 3EQRA 3MY5A 4NT4A 3VS4A 1Q8UA 4YC8A 4J53A 3R7IA 4A9SA 4D2TA 3QQKA 4MXAA 4JQEA 3CY2A 4ARKA 4BRXA 4ZLYA 2R2PA 2YJSA 3ORPA 5AAFA 3DXQA 3M42A 4EZ7A 1PY5A 2VWBA 3OCBA 5J8IA 1KE9A 4EOKA 4C35A 4MK0A 4B7TA 4O7RA 4FV3A 5HO7A 1CKPA 3GU7A 3EYGA 4WA9A 2XM9A 4IZ5A 3CKXA 3FZ1A 2C0OA 3I1AA 4YNOA 5EHOA 5B0XA 5HKMA 3NEWA 1XBBA 4BC6A 2VTSA 3HV5A 4PMPA 1Y6AA 3KXHA 3KXNA 5HG9A 4F1MA 3KRJA 2XBAA 1Y8YA 3ZBXA 5BVOA 3EN7A 3LKMA 1JKKA 1KV1A 3BX5A 3IW8A 5EI6A 5LCKA 1QPDA 3GC7A 4TZRA 5HIEA 3GCQA 4GW8A 4R1YA 3C4WA 2GDOA 2GSFA 5E8ZA 3WE4A 4YZMA 1Q41A 3OC1A 4FR4A 5BUIA 2X0GA 2X7FA 3S00A 5D41A 2F4JA 4BCMA 4NL0A 3IO7A 4MBLA 4FKWA 2ZM4A 3P9JA 4RX9A 4FSMA 2WOTA 4ZSEA 3PG3A 3CBLA 4K2RA 4UYAA 4FOBA 5FM2A 4EH5A 3ZO1A 4O7NA 3DK6A 2R3FA 4BDKA 2PWLA 4FBXA 4IDTA 5B2MA 3EQDA 3GCUA 2PY3A 4PL5A 3TACA 5LQFA 1OI9A 2R9SA 4I5HA 3QUEA 4DEGA 4KSPA 5IA0A 3QU0A 4C59A 1XBAA 4ZLOA 1ZYCA 3LMHA 4OBOA 3BBTB 4AT4A 4ZTNA 3BQRA 5BX0A 1CKJA 5IG1A 1A48A 2R3IA 3DKCA 3MJ1A 4NK9A 2JDOA 4HGLA 4XV3A 5CQWA 5LVMA 3C4EA 3R04A 4M66A 4CKJA 3PPJA 4Z16A 5HG7A 4XOYA 3H30A 3HUBA 4YJOA 2CLXA 3KRWA 4WD5A 5EYDA 1M2QA 5AX3A 4OGRA 5KZ0A 3UNZA 4ORKA 4QTBA 3NMUF 2OFUA 3GQIA 4EJNA 3TIYA 3R9RA 3OXIA 4LL0A 4MD7E 3RGFA 4QQCA 5GIPE 4JI9A 2W17A 3DFAA 4X2JA 3KVXA 3BQCA 1PW2A 2O65A 5EHLA 1MP8A 5M57A 4OTHA 1BX6A 5H8EA 3HMOA 4D5HA 3TUDA 2I0VA 2WMBA 2ZVAA 2X2LA 3SXSA 4ZK5A 3MN3A 1FVVA 3KREA 2CGWA 5HO6A 3G9NA 3TZ7A 1HCKA 3AD6A 5HBJA 4E7WA 1GZ8A 3QCQA 3LZBA 4XBUA 2BTRA 5IUGA 1XH5A 2W5BA 3H0ZA 3PY0A 1NT2A 3A99A 3U6HA 3GOKA 5FDPA 1A9UA 4QMVA 5ETFA 4ZIMA 3O7LB 4R5YA 4TT7A 5EM7A 4KIKB 2I7QA 3ODYX 4IM3A 3CCNA 3FQHA 3MFRA 3OCTA 5AR7A 5JFXA 1PXNA 4RC2A 4DGOA 4GT4A 4UYNA 4AAAA 3MH3A 2X7OA 3PXKA 2P3GX 3UOHA 4QQTA 4MF1A 4QMTA 4AE6A 3HRFA 3WF7A 5AUUA 4ZJVA 3COMA 5CTPA 4BZOA 4QQ5A 1ZYLA 5JN2A 5HNGA 4C2VA 1PXOA 4WG4A 5HTCA 2C3IB 3EOCA 3N51A 1LUFA 3ATSA 4O1PA 4I4FA 5B2KA 2VTHA 3IPHA 2E2BA 2ZV9A 1ZWSA 2QKWB 4Y95A 4EOJA 4FUYA 4DEDA 2QVSE 4J97A 4GT5A 3PLAE 2R4BA 1VZOA 2XVDA 3G6GA 2FH9A 3DT1A 4J71A 3QKMA 4D1XA 5HOAA 2ZMDA 3RWQA 4AZEA 4KB8A 3UBDA 4BBEA 2YERA 4E73A 3HMPA 3RVGA 4F7NA 3MJ2A 3P7BA 1V0PA 4DFLA 4RFMA 4HVSA 4XP0A 2C0IA 3BU3A 4E4LA 3GC0A 4IX3A 4FNXA 4LRKA 5T68A 5FP5A 4CLJA 3A4OX 1J1BA 4ASDA 2YCSA 4IDVA 4JS8A 1Q3DA 4GIHA 3ROYA 4F64A 3VRZA 5IQEA 3TNQB 3ID6C 4EJ7A 4FSQA 3G6HA 1FPUA 3LQ5A 4M13A 1Z57A 4FKGA 5HD7A 1WBTA 4YJNA 4W9XA 2R3QA 1SVGA 2G15A 1UNGA 2J9MA 4ENYA 3VS3A 4D58A 2Y4PA 3FUPA 3FKOA 5L6PA 1GJOA 4N70A 5AFVA 5AR8A 4OBQA 3KF7A 4YSMA 3DGKA 2I0HA 2PVLA 5IUIA 2C5YA 4FC0A 5IQDA 4DLIA 4OW8A 3AC3A 5AM7A 4GJ3A 5FQDC 3ZTXA 4FICA 4C3FA 4RC4A 2Y6MA 4OT6A 3QUPA 1QMZA 3BELA 4EHVA 4FTRA 4KAOA 3NDMA 5H8GA 4EH4A 4DYMA 3FEGA 3OP5A 2CNVA 3LW0A 4UWBA 4EZ5A 4CFVA 4C4FA 4C7TA 3DU8A 3L9LA 3IQ7A 4HGSA 1YDTE 3ODZX 4I6HA 4IACA 4XJ0A 3HL7A 2IW8A 3R9OA 2PPQA 3E3BX 4MXCA 4L9IA 2BCJA 1XJDA 2BALA 5CF4A 3QKKA 1DI8A 2HWOA 2BDFA 4MBJA 3MPMA 4USDA 3UIUA 3V5QA 2Y7JA 3JS2A 3MYGA 1ERKA 4F63A 3HAMA 3HKOA 5BVWA 5ICPA 3SW4A 1Y91A 3R2YA 3RKBA 1ZARA 1W8CA 4ZY5A 4L6QA 3FI4A 1PKDA 1UVRA 3KN5A 3NZ0A 1DI9A 3DBCA 3QRUA 4RSSA 4YP8A 5L2QA 3R7VA 5JRSA 1GZNA 5M53A 5IA2A 4ZOGA 4R6VA 5TE0A 3RM6A 5BVNA 3OZ6A 3VJOA 3PFQA 5KNJA 4S2ZA 5EG3A 4IQ6A 4E4MA 4HNIA 4I5MA 5ACKA 3ZXZA 5IISA 5E7RA 5F20A 3UP2A 4JDHA 3S0OA 3BYUA 4A9YA 4U43A 4L52A 5AV1A 4C3PA 1V0BA 1ZOEA 2WD1A 3R1SA 3QZGA 4U6RA 4U97A 5AUYA 4DAWA 5DPVA 5JRQA 2UZTA 4IIRA 4XV1A 2WIHA 4FZAB 1BMKA 4QP6A 3TV4A 4O86A 2P33A 1WBSA 1GIIA 5I4NA 1FMOE 4HZSA 2J5FA 5L3AA 4TL0A 3SVVA 4CTCA 3W2QA 5M4IA 5JFSA 4YMJA 4AOIA 2XIKA 3TV7A 3ETAA 4ANLA 1JWHA 3NLBA 3PXFA 4LM5A 5EYMA 4BCFA 3BE2A 4G1WA 4HCUA 1YOMA 4PY1A 4AN9A 2C5NA 3E93A 4M3QA 4TPTA 4CZYB 1UNLA 3MB7A 3IW6A 3IDBA 4GL9A 1Q4LA 3T8OA 1ZLTA 3VBWA 4ITIA 3UQFA 5EM5A 5DMZA 5IQAA 2BRHA 5FXSA 2IJMA 2C3KA 2XIRA 4JXFA 2YM5A 3ZS5A 4EWHA 5I9VA 4B4LA 3W18A 4Y5QA 5K5XA 2W1HA 4FVQA 2XJ2A 3NUNA 4PX6A 3GC9A 2C5VA 2IVSA 3PJ1A 3ZDUA 4YO6A 2BRMA 3DPKA 3CTQA 2GMXA 4BIDA 3RHKA 1W0XC 4TNBA 3UIXA 3F88A 1URWA 4EH9A 3EL8A 5EHYA 4W4WA 2PUNA 2QR8A 1OPKA 3Q9YA 4YJSA 2YITA 4XG9A 4CLIA 4CMTA 4GUBA 3EH9A 1HOWA 2RFEA 4F7SA 2J0LA 1J7LA 2CJMA 2PVHA 5K5NA 5CXZA 2JIUA 2QNJA 5HHWA 2PZ5A 3DBEA 3TUBA 1ZYSA 3QD3A 3C4ZA 2ITNA 4AFJA 5AV4A 3ANQA 2XCHA 2W1CA 2EB3A 4I6FA 5HLWA 2GS6A 5IZFA 2OICA 4FL2A 3UNKA 4IB3A 4AE9A 4YHTA 5DIAA 5HU3A 3JY9A 5EW9A 2OF4A 3KGAA 5AA8A 4JIKA 4NM3A 3I6WA 4KNBA 3QD4A 5IQHA 3WILA 2C6KA 3RNIA 3C5UA 3ORLA 2XK8A 3EQFA 2CKQA 5AAGA 3ZRKA 4O81A 1K3AA 2XIYA 2AUHA 1TQPA 4F9AA 5FRIA 4FTUA 5LMKA 2UZNA 2JEDA 5FWKK 2XNNA 4ZEGA 1OUYA 2XIZA 3TV6A 5AUTA 3RPYA 4J8NA 4G2FA 2JKOA 5BMSA 1OKWA 2BUJA 2YDKA 5J9LA 4G34A 5AUVA 3PLSA 5L6OA 2IZSA 4KABA 3PY1A 4NWMA 2JIVA 4DBNA 3UO6A 4C02A 5DEYA 1GZKA 2VGPA 2ZAZA 3PZEA 1H0VA 4ZJJA 4RIXA 5DE2A 1KE5A 3GFEA 4PPBA 3V5PA 4QMMA 4W9WA 2RSVA 5EM8A 3F3VA 2RFDA 3BGQA 3LFSA 3V5LA 4E26A 3KFAA 4ERWA 3E7OA 5L4QA 3R63A 4C0TA 4CFNA 3IOKA 2GQRA 4ZSLA 3TTIA 4DEBA 3FQSA 4I0TA 4NIFA 2VN9A 4GT3A 3QHWA 5CZHA 3ZRMA 2IG7A 3ULIA 4QP3A 3ZSHA 2H8HA 3L8SA 5FLFA 1OGUA 2E9OA 3TXOA 3N4TA 3ZUTA 3I4BA 1CM8A 3CY3A 3FKLA 3UVPA 3LFQA 4KIPA 1BI7A 4RVMA 4E5WA 4ZLZA 3HAVA 4YNEA 1LR4A 3SG9A 2QQ7A 4BWPA 1NA7A 4EHGA 3UVQA 4CFMA 4D4RA 4WSYA 3LMIA 1PYXA 3R7UA 4O7WA 1T45A 4FTQA 2JDTA 4FGBA 4IVBA 2GNLA 4RC3A 2YLEA 3W2OA 3BRBA 3C0IA 4C38A 2C5OA 4DGNA 4FT7A 2CNUA 4YZBA 5IU2A 3LFCA 2WHBA 4TYGA 3V6SA 2YISA 4BCNA 4N6ZA 4JBPA 2EWAA 3F2NA 4M8TA 4CFWA 1XR1A 4XG4A 3MVJA 3QCSA 3HZTA 3F7ZA 4MD9E 4EOPA 3O71A 4E93A 2UW8A 5E91A 1Q8WA 2XEZA 5CVGA 2PHKA 2HY0A 5H2UA 1MRUA 3DK3A 4YZ9A 2JLDA 4YURA 4G6LA 5I9YA 3MS9A 4F08A 4FKVA 3FLYA 2JKQA 3F9NA 3MA3A 5D10A 4CMOA 3QYZA 5E92A 2YWPA 3AT3A 3ET7A 1SYKA 2WMSA 4UWCA 3Q2JA 1YHWA 4AA0A 4BIEA 5HE3A 3GUBA 1DS5A 4FUXA 2IW9A 4ZZNA 3SXRA 5CANA 3MY0A 3EKKA 3UPXA 2Y4IC 3QFVA 4UXLA 4ACCA 4PP9A 5JK3A 3C50A 2C47A 4NJDA 4RBLA 3UE4A 5HORA 4NTTA 2QOCA 4TYHB 4UALA 3FSKA 3QQLA 3GI3A 4AZFA 3N4VA 5JKGA 3F61A 3P08A 2J2IB 4UZDA 1E1VA 5HU9A 2VV9A 4AOTA 1GAGA 4QMYA 3SAYA 2OGVA 4CFXA 5DH3A 5M55A 2XS0A 3K3JA 3Q53A 4WG3A 3MTLA 3ORTA 3VQHA 4G6OA 2YHVA 3FMMA 1UWJA 4YLLA 4FKPA 3ZZEA 3QF9A 2W5AA 4FX3A 4K8AA 5AIKA 3ZH8A 5AA9A 5CAUA 2OZAA 4MQ2A 4I92A 5DT4A 2F7EE 2B7AA 3KN6A 3P5KA 4UWYA 3LAUA 3B2TA 3UMXA 5J95A 1O6YA 3OTVA 1LP4A 4KKGA 4QMUA 4FEWA 3LQ3A 5C26A 3F3ZA 4LYNA 5HIDA 1H01A 4JR7A 3FZTA 3KCKA 4FSTA 4G17A 5CEOA 3Q9XA 4FTJA 4MD8E 1YDRE 3LXPA 1YOLA 2QODA 3PYYA 4II5A 3ZDIA 4D4VA 4P90A 4PTGA 4RWLA 5AP6A 4W4VA 1GNGA 3QYWA 2ITXA 5FM3A 1XQZA 4F7JA 2FVDA 2R3LA 3TNPC 1UA2A 4LGGA 3PRFA 3KXMA 4W8EA 2HELA 2DYLA 2JIIA 4YZDA 4AGCA 4EOIA 3M1SA 1PYEA 3NCGA 3BLRA 2CCIA 4GJ2A 5CY3A 4BN1A 3KK9A 5CF6A 4FEXA 3Q96A 3PWYA 4FTKA 2B0QA 3JY0A 2CNQA 5J87A 1REKA 4PRJA 4DFYA 5CASA 1JSUA 5L2TA 1IG1A 4FV6A 3QZHA 2ZV2A 4JR3A 2XA4A 1KOAA 2XRWA 4IB1A 2SRCA 4NFMA 4YHJA 4NYEA 5J5SA 1ZOGA 3KU2A 4X3FA 3ZFMA 4EBWA 5A9UA 3EQPA 2WGJA 2QURA 5FEEA 1XKKA 2VU3A 3QWJA 3CXWA 4IM2A 2YZAA 4CG9A 3UIMA 5HLNA 3JR1A 2VNWA 4F9BA 3I5ZA 4TYIA 3NPCA 4QQJA 4QYHA 3Q04A 3EIDA 4NW6A 5TT7A 5HTBA 4IFGA 3Q4ZA 3W10A 3W2SA 4I20A 4L42A 4BBMA 2VTOA 3MPAA 4PWNA 4RIYB 1QPEA 4U8ZA 4PP7A 4BTJA 2O5KA 3O7LD 3OY3A 2JITA 2HXQA 3QGWA 4L45A 4EL9A 4FEUA 3Q9ZA 5AADA 2JAMA 2VZ6A 4IWDA 4U45A 1WAKA 2JBPA 5CSHA 1OPLA 5J7BA 2BKKA 2W5HA 2F7ZE 2OO8X 2VTQA 2W96B 3H4JA 5JQ5A 3FLWA 1J7IA 2C6IA 5CNOA 2X81A 3R71A 5M56A 3WZKA 3PPZA 4YPDA 2WPAA 1Q24A 2WQEA 3C1XA 1KWPA 2ZOQA 1DAWA 3G9LX 3PIYA 4DH3A 5BYYA 3LJ0A 3IW5A 4IXPA 3EWHA 1YWRA 4JDJA 4A9TA 4MWIA 1OKVA 4K6ZA 3FWQA 3C7QA 3TDVA 4PNIA 3V01A 2BDWA 3NWWA 2ERZE 5FTQA 2WO6A 4F09A 2OFVA 2YM7A 2VTMA 2R0IA 2X39A 3R02A 5AP3A 4XHKB 5J7HA 3RWPA 1Q3WA 2ZV8A 1R1WA 2ESMA 4MBIA 4O6EA 4ZTHA 4RIXB 4HYHA 5ANGA 5G6VA 2IZUA 3EKNA 3R6XA 2A19B 4WBOA 3W8QA 1FMKA 3KULB 3PRIA 4TXCA 5IEXA 1P4FA 2YM6A 2OJFE 2WNTA 3GCPA 3OMVA 1YXSA 3FZPA 3QC9A 3LVPA 3UG2A 1SVHA 3B8QA 5A4CA 3IG7A 3SQQA 4AUAA 4FYNA 3C5IA 1OIUA 4OTIA 4NIFB 3TUCA 2X8EA 2BMCA 4FL1A 4V01A 5ITAA 2R3MA 2CCHA 4XG7A 1PHKA 5ANKA 4KKHA 5CU3A 3MVMA 2EB2A 4KD1A 5HVYA 3UGCA 4X0MA 2BZJA 3QHRA 4E20A 1OPJA 1YWNA 3MH0A 3P1AA 5HESA 2GQGA 4AZSA 4I3ZA 1U46A 5AJQA 2OH4A 3VBTA 1M52A 4FZDB 3KQ7A 3C9WA 4BDGA 5HZNA 3NW7A 2GNJA 4O0TA 4M84A 1Z5MA 4WSQA 4YJRA 4EC8A 3CGOA 4ID7A 3AOXA 1PXKA 4M15A 1YOJA 2W1DA 2YM8A 1WVXA 3MWUA 3HA8A 3NAYA 4O22A 5I3OA 2ERKA 4IX4A 4O1OA 2V22A 2OW3A 3LJ2A 4O27B 4DF3A 5EKNA 1UNHA 4G3CA 3QQGA 3RPVA 2X7GA 2UW7A 4H05A 1JVPP 2A0CX 2OWBA 4WT6A 5LMKC 4O83A 4L8MA 1R0EA 3UYSA 1FVRA 1W83A 1PXPA 5LVOA 3EFKA 3CGFA 4DFZE 5DR9A 5JSMA 2OIDA 4ZXTA 4FKJA 3OBGA 1QPCA 3DA6A 1I44A 2QOQA 3PY3A 3PXYA 4QP1A 4U41A 1K9AA 3OXTA 4W4XA 2O0UA 3S4QA 4BKYA 4PTEA 3U54A 5A46A 1H28A 3GOPA 5CEQA 4KA3A 4H58A 3AMBA 5CI7A 4BGGA 2B9FA 4XYFA 5CU6A 4IB5A 1HCLA 3FMNA 4AX8A 4BHNA 3HA6A 3K5VA 5BVDA 3DNDA 3R01A 4F0GA 5FP6A 2WAJA 4XS2A 5CT0A 2FB8A 2R3OA 4FKIA 5HG5A 3UZRA 2RL5A 2PUIA 2XF0A 1ZY5A 3F3WA 1BUHA 2W06A 3ROCA 3WZJA 3COKA 1OIQA 5TKDA 2YEXA 1JAMA 4QP2A 4CZTA 2QOKA 1JPAA 4FKLA 4IBMA 3WYYA 3VIDA 2Z8CA 2WTKB 4DHFA 3OWPA 2OZAB 3QBNA 2W1FA 5AAEA 3G0EA 4XG3A 3EN4A 2OXYA 5E8WA 3E5AA 4D55A 1P5EA 4JRNA 4XRLA 5E9EA 5AP4A 4AA5A 3D15A 3TCPA 4G3FA 5JH6A 2X6EA 1SVEA 3C4XA 3WIKA 4E4XA 4I93A 4PL3A 2FSMX 4BZDA 2BZKB 2Q0BA 4NSTA 4AGWA 5DLSA 3POZA 1WCCA 3LLAA 2PE1A 1KE7A 2PK9A 3ZUVA 4GS6A 4IFCA 4WRSA 4YJTA 4M12A 4UY9A 2W4JA 3ZHPC 3VJNA 1CKIA 2ZMCA 3H9OA 4XP2A 3VUGA 4TYJA 4ZSJA 2WEIA 3TZ9A 1XHAA 2OJJA 4CGAA 5IPJA 2HWPA 2I6LA 2R7BA 1NXKA 4WKQA 4RX8A 4JOAA 4MXYA 2IVTA 3FYJX 4JBQA 2HOGA 4ANNA 3FQEA 1P4OA 1WBNA 5HTIA 4O0XA 1UKHA 3BLHA 3VULA 4AS0A 3Q52A 5EI2A 3ZEWA 2J5EA 3UMWA 1IASA 3E92A 4FSWA 3U51A 5F9EA 3ZO3A 2ETRA 4U3YA 3CE3A 3ERKA 1PMNA 3EFLA 3FHIA 4WRGA 3PXZA 4ZMEA 4ENXA 2ZV7A 3DJ5A 5EQYA 1ZMUA 4X3FB 2PTKA 5CSVA 3T9IA 5E4HA 3D5WA 5KHXA 3RPSA 4CEGA 4O7LA 2RFNA 3FV8A 4ZS0A 1OKZA 4L68A 3JVSA 4FTLA 4XG6A 3QTUA 1BLXA 3K2LA 2R3PA 2QOOA 4D2PA 5CAVA 3UPZA 2XNBA 1JLUE 3EFJA 4DTKA 4W4YA 1A06A 4H1MA 3BWFA 4ZMFA 4NKAA 2BRGA 5JGBA 3V04A 1TQMA 4EORA 4IZAA 4YO4A 5L8KA 5M44A 4R78A 3HV4A 4DGLC 3BHVA 2WTKC 4L7SA 4I6QA 2XKDA 3WIGA 3RHXA 4D2WA 2HZ4A 5KBQA 4WBBB 4QMQA 3KC3A 1WBOA 4G5JA 4GRBA 2CKPA 2BDJA 5ACBC 4G3EA 5GNKA 1XO2B 5CEKA 2HZIA 4AQCA 3AMYA 2VTTA 2CGXA 3A8WA 4FIFA 3DFCB 2V7OA 3EQGA 5E8YA 4AP7A 3QQJA 4HPTE 4AT5A 4QP7A 3UOKA 4EKKA 3A62A 1W98A 2PVFA 3OBJA 4BCPA 2ZM3A 4AXAA 2HZNA 4GUEA 3SLSA 3PSCA 4H36A 4QYYA 3VF9A 4C2WA 2J50A 4F1OA 1Y57A 2WFYA 5HE2A 1YXVA 3QTIA 2B4SB 2E9PA 4RGJA 4PMMA 1PXLA 3KEXA 3OOGA 4RJ6A 4J7BA 5AUZA 4EOLA 4YUQA 3HMNA 1RE8A 2WMWA 2WZJA 4IX6A 2JDRA 4S33A 4R8QA 4Y46A 4EK3A 2XIXA 3C51A 3DB6A 3ACJA 3DQXA 4G6NA 3VHKA 3MPTA 1JOWB 3CIKA 3GVUA 3R22A 5DN3A 1K2PA 3UDBA 1VEBA 3ZCLA 3NW5A 2GS7A 4YTFA 1XH6A 4IJ9A 4BDCA 3A2CA 4H39A 2LGCA 5C4LA 3MB6A 3HP2A 2WMQA 4V05A 4WO5A 4X2NA 4X3FC 2H34A 4BBFA 3FPQA 4BDEA 4PDOA 4C3RA 4JQ8A 2YIRA 4I21A 4M7IA 3ENHA 5HO8A 3TNHA 4FSRA 4MNEA 4CSVA 4G9RA 4KBCA 3NIEA 4O6LA 3DKFA 3BHYA 3AXWA 3IOPA 3QXOA 4IJPA 3IGOA 3D5VA 5LVPA 1KV2A 2HIWA 5DBXA 4EUUA 1YI3A 4FSNA 2QI8A 3TIZA 2BKZA 5FEDA 2UW4A 5G1XA 5L8JA 2VX0A 5I9ZA 4L44A 3VO3A 4Z7HA 2VO6A 3PJCA 4CT2A 5KMOA 1XH8A 3UIBA 2W9ZB 2WTVA 1F0QA 5DNRA 3Q60A 2JAVA 2FGIA 4EYJA 4WIHA 4JL9A 2YCRA 3OWLA 3MSSA 3RPOA 3A7IA 5EYKA 3PE2A 4QYFA 3DY7A 1ZMWA 4DA5A 2GFCA 3ENMA 3FY0A 4FIHA 4FTCA 3A7HA 5AMNA 2R0UA 3SKCA 1Q62A 1IAHA 3NNXA 3O2MA 3Q2MA 3WZUA 4C58A 5HX8A 4IMYA 4U7ZA 4I1ZA 1ZY4A 3M11A 4MXOA 4NTSA 3P78A 2QO9A 1SM2A 5EM6A 5FTGA 4U0IA 5K0XA 4AG8A 2J6MA 4CV8A 1QPJA 3U6IA 4YBJA 5LMBA 4CKIA 2B53A 1XH7A 1H1SA 2OU7A 2YJRA 4FV8A 4X2FA 3NYNA 4J1RA 1LEWA 3QTWA 4ZJIA 3TT0A 3U4UA 3VHEA 4F4PA 3AC4A 2C1BA 4A4OA 3CEKA 4MAOA 4RVKA 4WOVA 3RCJA 5CSWA 3OD6X 5HI2A 1YW2A 2B9JA 2PZYA 3WF9A 5A4QA 2JBOA 2REIA 3AMAA 4HOKA 4BDHA 3TZ8A 1DAYA 3F3UA 3VUDA 3F5XA 3EQIA 2X8DA 4GV1A 4IAKA 1AQ1A 4IVAA 4FZ7A 2UW9A 2DWBA 4HNFA 5DI1A 5DWRA 5I9UA 4BKZA 2A4LA 5A4LA 3LXNA 2JDVA 2OIQA 4FG8A 4BI2A 3ANRA 4C4HA 3E88A 2PMOX 2UW5A 5EW8A 4YR8A 3BHTA 3VUHA 2B9HA 3PJ3A 5HD4A 2B54A 3COHA 4DCEA 5GIOE 4PMTA 2P0CA 4QPAA 2P2HA 5C9CA 3VS5A 3LCTA 4EQMA 4UN0C 4EH3A 3E8NA 3QZFA 5TF9A 2V0DA 4GIIA 3QZIA 4FV0A 2DQ7X 1REJA 2QCSA 3PA3A 4I6BA 4O7ZA 3RJCA 4O0UA 4YJVA 5JGDA 4AT3A 2FSOX 2XK7A 3OWJA 3O17A 3FMKA 4K77A 4RZVA 4ANQA 3I5NA 3AC5A 3QRJA 2LAVA 3R8MA 3MFTA 4FL3A 4ANMA 3N4UA 2QOBA 3W2CA 4LV8A 1PXJA 4JBVA 3R8PA 4RLKA 5CVHA 4M69A 2J0MB 4A06A 5ANJA 2HW7A 4L7FA 3GBZA 4R7IA 4XBRA 5L2IA 4F70A 3LM0A 2C6OA 4GFOA 4BDFA 1O6KA 3NSZA 4LOQA 3K54A 5E1SA 2QKRA 4PF4A 1NVSA 4XV2A 5KUPA 5AR2A 2O64A 3QTSA 1DM2A 2H9VA 4HYUA 4EC9A 2GU8A 2C3LA 1PJKA 4J52A 2PULA 3VRYA 3VW8A 2RF9A 4FTIA 4NUSA 2CMWA 3CPCA 4DG3E 3I7CA 2BZIB 2VUWA 5HCXA 3AD5A 5T3QA 5HQ0A 4IAZA 3BE9A 2CGUA 4GMYA 2OZOA 2QU5A 4EH6A 5EQPA 1YXTA 2P55A 3ORNA 5AUWA 5CAQA 3E87A 3MVLA 3QRIA 3UJGA 3DDPA 3FMHA 3H9RA 4OTPA 1B38A 1WVWA 3NYVA 3P86A 1JSTA 3NYOA 5C8KA 4WHZA 3HV6A 2WTJA 3HLLA 5EOLA 4E6AA 5AUXA 4L53A 2PE0A 3MW1A 3DTCA 1CDKA 2BR1A 3OHTA 4UV0A 4Z9LA 2WTIA 4E8AA 2PMIA 4AOJA 3DS6A 3DBDA 5CWZA 4RJ4A 3D5XA 5HICA 3LFEA 4NFNA 5HIBA 3KA0A 1U5QA 5EOBA 3EFWA 4ACMA 1Q8TA 3F3TA 2W0JA 1MQ4A 4MH7A 2HAKA 3LJ1A 1MUOA 3VAPA 1OM1A 3FC1X 4WNMA 2VWXA 2WMXA 3IGGA 1OITA 5A4EA 3I79A 2W99B 3CQUA 4ANSA 1R39A 2QG7A 3THBA 3S95A 1F3MC 3BGZA 3GENA 2YAAA 1ZAOA 1GOLA 5T6KA 3QTZA 4GKHA 2NPQA 2YN8A 2ITPA 3A61A 4OLIA 3RBWA 3OEFX 3FMDA 4HW7A 1OBGA 4ITJA 3SC1A 3FSFA 3U87A 1PMUA 2OF2A 1NY3A 3QL8A 4I4EA 4M97A 2QLQA 2OJIA 1MQBA 4ZZMA 4KUJA 4GH2A 3LFNA 3R8UA 4YC3A 1UKIA 4B6LA 3G15A 3OG7A 4CQEA 5EKOA 5IDNA 5IH4A 1QCFA 4FNZA 2W1EA 4EWQA 4OTQA 4N4SA 4QMPA 4YZCA 3UZTA 1PMEA 3M2WA 4R5SA 4FT3A 5KZIA 3JVRA 3JYAA 4CMUA 2Y4IB 4FTNA 4C62A 2BRBA 1OL2A 4F6UA 5AX9A 3EMGA 4MNEB 2V55A 3O23A 2HZ0A 5AIRA 4CQGA 4O84A 2W4OA 4TY1A 3BHUA 3VC4A 3HMIA 2XJ0A 4QNYA 4DEIA 5CEIA 3OS3A 4BF2A 1Z9XA 1BKXA 1YWVA 5BPYA 5IQCA 4EKLA 3SXFA 3VWAA 4BTMA 1IEPA 3EN5A 4BTFA 5BNJA 5IEYA 4QMXA 4D9UA 4IC7A 4FIEA 3W2PA 1ZRZA 3NCZA 3D9VA 3DB8A 5DA3A 5LCJA 3CJFA 3KMMA 3LFDA 2BVAA 3KL8A 3ZC5A 3ZRLA 4FA2A 1YVJA 1M14A 4J98A 2XK6A 3G51A 3GU5A 5HNBA 4EEVA 1XWSA 1FOTA 2J7TA 3NRMA 2C69A 4X2KA 4CZUA 4YTCA 5HVKA 2QO7A 5CF8A 5HCZA 5AP1A 2AYPA 2C6EA 3R7EA 4F9CA 3QALE 4GK3A 4X6QC 5H9BA 5HX6A 4B99A 3I6UA 4O96A 1Q61A 3PTGA 4ZSGA 3RMFA 5KKRC 3L8VA 3W33A 5I3RA 3F5UA 4D4YA 5DG5A 4USFA 2XCKA 3NAXA 4O0SA 5M07A 3RALA 4EONA 5KMJA 3CKWA 1QL6A 3QTRA 4EK8A 4CYJA 5GINE 4BCGA 1UU7A 3ULZA 4DE4A 3CSVA 2ZYBA 2I0EA 3MV5A 4OTGA 4JVGA 4CYIA 3MFUA 5IQGA 3GU4A 4QMLA 4QMOA 1OZ1A 4NCTC 5AR4A 3TKIA 5CENA 1YKRA 3H3CA 2BFYA 1YI6A 3RTPA 3LXLA 3MH1A 2VX3A 4EH2A 3OT8A 1STCE 3MVHA 2C6MA 4FKUA 1M2PA 3KXXA 4RPVA 2Q83A 4CTBA 4Y5HA 2X9FA 3R9HA 3VUKA 1YI4A 5CLPA 4D1ZA 1OIYA 4F9YA 4ONAA 1PXIA 2VTJA 2G2FA 5D7VA 4FT9A 4EQCA 3BEAA 3O96A 4NH1A 2Z2WA 4LGDA 3COIA 4L3LA 5GJGA 3ZYAA 2X2KA 2X4FA 1H1QA 2ETKA 2ITOA 5DVRA 5C1QB 4H3QA 4V0GA 2I40A 5ETAA 3SGCA 3SHEA 4FVRA 3RK5A 3QQFA 5EFQA 5HE1A 3NUYA 2YM3A 2BHHA 2G01A 3K3IA 3FI3A 2ZB0A 3U9CA 5BVKA 5IUHA 3PP1A 4G3DA 1WBWA 5I0BA 3RI1A 4ASEA 2QOFA 4IB0A 3R2BA 4FGRA 4MVFA 3KF4A 3B8RA 2P4IA 4RRVA 4OTDA 2J0JA 3VF8A 2O8YA 1Y6BA 3OWKA 2W9FB 3PE1A 4Y8DA 4M69B 3MDYA 4JBOA 4DTAA 2XK4A 2Z02A 3OTUA 5M4UA 3CTHA 5HEZA 4K0YA 4FV1A 2R3GA 4I5CA 3UVRA 2QONA 3LIJA 1OBDA 3ZO2A 2BROA 1JSVA 4JT3A 2UVYA 1CSNA 4TWPA 4XCUA 1MRYA 3IK3A 5BMMA 3CJGA 3PZHA 2XYUA 5ANIA 1OL7A 2OIBA 3O0GA 4IVDA 4JX7A 1SNUA 3OY1A 1U59A 3TI1A 4OAUC 1H07A 3PSDA 2XK9A 5CEMA 4QOXA 2UZVA 2R3KA 2NRUA 5DEWA 2OH0E 3ZFXA 3D83A 1H1RA 3F66A 4P5ZA 3PJ8A 2EU9A 4WNKA 4PUZA 1EH4A 4QTDA 4GKIA 4WUNA 3G5DA 4Q2AA 1U5RA 3HUCA 4RX5A 1ZXEA 4ZTMA 3RINA 3EZRA 3QTQA 4KIOA 4N57A 3FY2A 4GK2A 4Y85A 2NNWB 2BIKB 2C3JA 4KRCA 4U3ZA 4MQ1A 2AC3A 2YDJA 5FG8A 1IA8A 4NU1A 3UYTA 1XH9A 4DFXE 3Q5ZA 4MCVA 5K0KA 1WMKA 4O2ZA 1IRKA 4O0VA 3HNGA 1R3CA 4EK6A 3CQWA 4CXAA 5KO1A 2JDSA 4PL4A 2FYSA 2X1NA 3F5GA 3ZEPA 1H24A 2IO6A 2PVJA 1OL5A 2QLUA 2PSQA 2PUUA 2Z7SA 3NNUA 3PSBA 4H3BA 4RWIA 4JNWA 4YC6A 1U4DA 5H8BA 3HDMA 2RFSA 4DG2E 3JXWA 3FI2A 4FKRA 4UMTA 4TTHB 2OJGA 3DBFA 3REPA 3UC4A 3HV7A 4BWXA 2HK5A 4DBXA 5KE0A 5D1JA 5EK7A 4P2KA 4ALVA 5IEVA 5HGIA 5IDPA 4DFUA 1KE8A 3N9XA 4RJ8A 4YU2A 4IAFA 1M7NA 3EYHA 2G1TA 2QOIA 2WMTA 4O21A 4DCAA 5E1EA 4O0YA 1O9UA 4G31A 3ZUUA 5LARA 1LEZA 3LCKA 4EBVA 3JUHA 5CZIA 2CKEA 3BYOA 3GNIB 2B9IA 3BV2A 4O0WA 3NX8A 4HJOA 5EDPA 4E4NA 4JAJA 4OTWA 4AACA 1APME 2PZIA 2OJ9A 3VBYA 4TN6A 5DHJA 3LFFA 4C4EA 3PXRA 3PVBA 5EDRA 5L2WA 2VTLA 4QMNA 3QD2B 3G0FA 3UP7A 2B52A 1H1PA 3O8UA 4OTFA 2YFXA 4AW2A 3BWJA 3R83A 4LOPA 3VS7A 2A1AB 5CAOA 5CT7A 3FYKX 2WQOA 2VWZA 5LVLA 1YQJA 4NEUA 5FTOA 3AT2A 2OI4X 4BI1A 2PVRA 5AEPA 5KX8A 3RK9A 4ANOA 1KSWA 2PVKA 4OTRA 1YDSE 2YACA 2WU6A 4A4LA 5IA3A 3AC1A 4FTAA 2BILB
chains in the Genus database with same CATH superfamily
2R5TA 2PE2A 2ZDUA 2ACXA 4ZAUA 4O7TA 2BFXA 2V62A 3WARA 3PVWA 3D7ZA 3ZLXA 4WNOA 5J9YA 4FE2A 3PA5A 5KBRA 4FEVA 3EN6A 2VTIA 2WXVA 5CF5A 4U81A 3CD3A 4O7SA 1JBPE 2F7XE 4AF3A 5HLPA 1YRPA 4FSUA 4D2VA 2OXDA 5I9WA 3HMMA 2ZDTA 4JLCA 3VS6A 1V1KA 3U55A 2BIYA 3UDSA 5EQEA 2H96A 3D0EA 3DQWA 2O2UA 5KMMA 3TN8A 4MYGA 4BYJA 4ZSAA 1YHVA 2C30A 3V5JA 4XH6A 1OVEA 5EW3A 1R78A 2E9VA 1G3NA 2W1IA 2X8IA 4IAIA 4BB4A 3K5UA 3D4QA 4BDIA 1WBVA 3LFBA 3SG8A 1OIRA 4R3CA 5F1ZA 2UZLA 5F94A 1B39A 3Q4TA 4FVPA 4AQKA 2BAJA 4QMZA 4WG5A 1X8BA 2XZSA 5CEPA 4F65A 4LDTA 1KE6A 4UMRA 3FZSA 1YXUA 5HE0A 4ACDA 3KRLA 4MXXA 3U6JA 2JKKA 5K4JA 2ITZA 3DZQA 5C27A 3RK7A 4N6YA 4EOOA 4ZY4A 3OFMA 3CTJA 4GG7A 4XG8A 1G5SA 3R8LA 4CVAA 1YXXA 4RG0A 4BI0A 1H00A 4XG2A 4JAIA 4X7QA 3TWJA 4ACHA 4R1VA 4QO9A 3HX4A 3QXPA 4TW9A 4CCBA 2WTWA 3AGMA 4B0GA 4DTBA 4FV4A 2GCDA 4HPUE 2I1MA 2XEYA 3HEGA 3LFAA 2HCKA 3ELJA 4MNFA 4V0GB 2HENA 4IX5A 5D11A 2VWWA 4YTHA 2ITQA 4C33A 3TTJA 4QP8A 1JNKA 3QRKA 1VYWA 3CQEA 4FNWA 1OUKA 4S30A 3LCSA 2B1PA 4X6RA 3R30A 2RG5A 1GZOA 5E90A 3A7GA 4GU9A 4FSYA 3R21A 5J5TA 1ZMVA 1UU8A 2W4KA 3EN9A 1ATPE 1ZYJA 3LHJA 4M14A 4UBAA 2PL0A 3KXGA 2XRUA 2UZOA 2XNOA 3PP0A 3VVHA 3S1HA 2IWIA 4Q9SA 4U9AA 4DDIA 5FBNC 2PVYA 4QD6A 3FMEA 2W1ZA 2G2HA 4C4GA 4QTEA 1SMHA 5C8NA 3ZXTA 5CS6A 1B6CB 3KRRA 5IA4A 3NVKI 2O3PA 3OEZA 5K4IA 3UZPA 3W55A 3MI9A 2WKMA 2WEVA 4IEBA 4UMPA 3KKVA 1S9IA 4I0RA 1VR2A 4RJ5A 5CALA 3KCFA 2IZTA 4APCA 5A6NA 3I0QA 2CN5A 3TNWA 4PDSA 4EH7A 5HVJA 4H3PA 1M7QA 1NVRA 2J51A 2V5QA 2OXXA 1GY3A 3PG1A 4FSZA 4ZTRA 1BYGA 2VTAA 4GSBA 3HYHA 2R3JA 3BI6A 4IH8A 2GFSA 5CI6A 3GC8A 2JFMA 2VGOA 2HY81 3ZC6A 4E5AX 4AW0A 3P79A 5CNNA 3WF6A 3EJ1A 3LCOA 3AKLA 4KWPA 5AV3A 3QCXA 3U4WA 4D5KA 1T46A 3UQCA 4LFIA 4EOQA 2XK3A 3SOAA 4IM0A 3Q4UA 1XBCA 4IANA 3ORMA 3GGFA 5AV0A 2WU7A 3OUNB 5AV2A 4MF0A 4APPA 2XMYA 4QTAA 2WQNA 5F4NA 2PVNA 3D2KA 2H6DA 4IWPA 3GCSA 4RA5A 3ZO4A 5KMLA 2XNMA 1H4LA 5L8LA 3D94A 2IVUA 2VO7A 3ALNA 5E8TA 2WMAA 4LMUA 2IPXA 3MIYA 3Q32A 4G9CA 4GCJA 4AA4A 4M0YA 4ALWA 1PMVA 4CFFA 3D5UA 2X6DA 2XM8A 4XOZA 4LUDA 5AR3A 4QYGA 2C6TA 3E7VA 4O4DA 4YJQA 4A07A 1PF8A 3R1NA 2VO3A 1ZYDA 3GEQA 4R3RA 4FI1A 2YIWA 2FO0A 3IDPA 4LQMA 4TYEA 4L67A 5KHWA 4FK6A 4RMZA 3QA8A 4YSJA 2F9GA 4QRCA 4FMQA 5ANEA 4D0WA 4AZWA 3Q6UA 1JKTA 4BR3A 3I81A 4NJ3A 3ZSIA 3RM7A 2FSLX 3V3VA 2CSNA 3FMLA 5A3XA 3LLTA 5HNIX 3KY2A 2XH5A 4RX7A 3UO5A 1G8AA 2WMRA 3GP0A 2IW6A 5FXQA 2YCFA 3RAHA 3SRVA 4EK4A 1H27A 3IW7A 5CU2A 4FV2A 4AW1A 4DITA 4IWQA 3KVWA 3QLFA 4LRJA 2GS2A 4C36A 5DYJA 2WTDA 4FIJA 4RWJA 3ORKA 4NCTA 4EQUA 3FI8A 3FKNA 2VWVA 3A7FA 3L8PA 1MRVA 3ZONA 4O91A 4R3PA 3PVGA 2R7IA 3QRTA 2Z7RA 2A27A 5J1VA 5IA5A 3TKUA 3VW6A 3FBVA 4I5PA 3R8ZA 1I09A 2GHGA 4J8MA 4Y72A 4XLVA 1SNXA 4MTAA 3R1QA 1OKYA 5K9IA 5JT2A 3NFFB 4RIOA 3VUTA 2HYYA 2CGVA 3AGLA 3WE8A 2UVXA 3JPVA 3L8XA 4YHFA 3OCSA 5E8VA 3R1YA 3NNWA 3LCDA 3NS9A 3NUUA 4O2PA 3ZLYA 5EYCA 3GU6A 4S32A 3DKGA 5M08A 2RKUA 2CPKE 2W7XA 1VJYA 3H10A 1NW1A 4U79A 3IECA 2GNGA 2CDZA 1PRYA 4BDJA 1FINA 2VWIA 2XYNA 4X2GA 4M68A 1WFCA 5B2LA 2DS1A 2GNHA 3GXLA 2YABA 5ETIA 5E8UA 3R9NA 2X4ZA 4PMSA 5CX9A 1M17A 3BEGA 5L6WL 5DT0A 3R7GA 1ST0A 1P2AA 3PPKA 4GG5A 4IAYA 4DH1A 2XNGA 4QP4A 2QOLA 3P23A 4J95A 4R7BA 3RAIA 4RIWA 1OL1A 3GU8A 4EH8A 4ZTQA 2GQSA 4PV0A 3H0YA 2NO3A 3E8EA 3G33A 4DINA 4IE9A 5C01A 2Z7QA 3GCVA 4MXZA 4U5JA 2PVMA 3R8VA 3W8LA 1S9JA 2PYWA 5AR5A 4IZYA 2VWUA 2WQBA 4EHEA 4HYIA 1H26A 4JG7A 5IQBA 4L00A 4AZTA 2R64A 3C0GA 3OVVA 3FLNC 2RG6A 4LUEA 3RAWA 3UTOA 3QD0A 4TKSA 4F0FA 3LE6A 4FZ6A 4RT7A 3DJ6A 4TRLA 4BCQA 4BGQA 5LMAA 3PWDA 4AN3A 4KKEA 4FG9A 2C6DA 4ANBA 4EK5A 1BI8A 2UZEA 4E5BA 1TZDA 4RQVA 3TNIA 2PMLX 4A9UA 3DXPA 2UZDA 3F6XA 3DAEA 4USEA 4U40A 2VAGA 2AC5A 4CKRA 4XV9A 3VQUA 4JDKA 3DBQA 4HVGA 4RQKA 5CSXA 3VUMA 1H8FA 3E63A 3PIZA 5CXHA 4IADA 4R7HA 4PTCA 4TWOA 4OT5A 3BKBA 5HCYA 4AZVA 1ZZLA 3NIZA 5I5ZA 5LJJA 4F6SA 2UW3A 4JRVA 2ZM1A 4DH7A 3UDZA 4XUFA 3V8WA 4S34A 2WTCA 5HG8A 2J0KA 4MHAA 4YGAA 3UO4A 3AG9A 1Q97A 3DTWA 5JFWA 1IAHA 3BYMA 3WBLA 2FSTX 3L9MA 3TG1A 5GZAA 4NZWB 3KMUA 4BDDA 3MY1A 3FLQA 4KS7A 3ZLWA 5TOZA 5J9ZA 4GK4A 2BAKA 2YIXA 3NUPA 2XBJA 3FMJA 1GIJA 2WIPA 2BPMA 3MIAA 4I94A 2R3RA 2A2AA 4HCTA 4N0SA 3ORIA 2QC6A 4IZ7A 4CFUA 2ZJWA 1E9HA 4ZZOA 4TYHA 3SA0A 3E62A 5AP5A 3DLSA 3UDTA 2YIYA 4BDBA 2YWVA 4AN2A 5BVEA 2ITTA 4RZWA 4NM5A 4KSQA 3NNVA 4OR5A 1OL6A 1Y8GA 1J7UA 2C68A 4FYOA 4E6QA 3MESA 4JJRA 5J79A 2GPHA 3HRCA 3WZEA 5IQFA 4D4SA 3MBLA 4O82A 2QD9A 1H0WA 4KBKA 1YHSA 4LGHA 3PJ2A 4NM7A 4AW5A 2EVAA 3R7YA 3LXKA 4BHZA 4UMQA 5IKWA 1OMWA 4NKSA 1UU3A 3R0TA 5M4CA 4AXCA 2KTYA 5CU0A 2ITVA 3OT3A 3B2WA 1CTPE 3DDQA 3GQLA 4CRLA 4OUCA 3MFSA 1URCA 4JQ7A 2W05A 2YDIA 3PVUA 5IH5A 3C0HA 5H3QA 1G8SA 3F2AA 1BL7A 1GIHA 3BCEA 1W2DA 2CHLA 1Q8YA 3CLYA 3UOJA 1Q5KA 2E9NA 4LL5A 4EI4A 4YLKA 3UQGA 3BU6A 5IA1A 4ASZA 4GFMA 4PDYA 3MGYA 5M4FA 2VD5A 5A14A 5D12A 3AC2A 3P0MA 3W32A 2ONLA 3A7JA 3CR0A 2WMVA 2X9EA 3HVCA 3MH2A 3VS2A 2AEGA 2W1GA 5DRBA 2UW0A 2VNYA 2UZBA 3Q3BA 4C4JA 1SZMA 4D9TA 3V8SA 3KK8A 4ZTSA 3E64A 1FBNA 3PDTA 3WI6A 4M0ZA 3BGPA 4QNAA 4O4CA 4XEYA 3A8XA 3ZU7A 4KS8A 3QCYA 3BBWA 5BVFA 3DJ7A 1RW8A 4YPSA 3O51A 4XLIA 2OK1A 4DDGA 1Q8ZA 2B55A 3I7BA 4YBKA 5EDQA 5KKRB 1E1XA 4U80A 5GJDA 3R73A 4UB7A 4TNDA 3UODA 4DEHA 4F1TA 3BV3A 3AD4A 3IS5A 3P7CA 4K1BA 3WZDA 4DGGA 2QHMA 3SRVB 2VTRA 5M09A 3UOLA 5D9HA 3OXZA 1PKGA 5TO8A 3RP9A 4GVAA 2EXCX 4JDIA 4RIYA 3WF8A 3AKKA 4RJ3A 1KUTA 4QTCA 3QX4A 3ZLSA 4FT5A 3UC3A 3VBQA 2I0YA 2ETMA 1ZZ2A 2G9XA 2UW6A 3DNEA 3FJQE 4L46A 2GHLA 3Q5IA 2WELA 3W2RA 4C61A 3DOGA 5FXRA 4GU6A 3H9FA 3BPRA 3F5PA 1TVOA 2X2MA 3EB0A 4FEQA 5ANOA 4K11A 3NUAA 5IF1A 4O38A 4IHPA 5IH6A 5DR6A 4CCUA 1V0OA 2EXEA 4V04A 3FXZA 2G2IA 4RLLA 2OSCA 4UMUA 3ALOA 3NW6A 2QR7A 3TZMA 3CP9A 3NGAA 5DGZA 3EQBA 5BYLA 2YAKA 3PXQA 3BIZA 4KRDA 2FUMA 4PPAA 4I22A 4M67A 4L43A 5LVNA 2QO2A 3NVMB 4CV9A 3DV3A 5GHVA 3OOMA 4BYIA 3I0OA 2BZHB 2QHNA 2FA2A 3C4FA 1XH4A 1P14A 2JGZA 3LPBA 4G3GA 3VN9A 4BTKA 2KULA 2ZB1A 3W0MA 2HXLA 4E6CA 3VUIA 2HW6A 4U42A 2ITYA 4FTMA 4UXQA 4MEDA 2IZRA 5HBHA 4IC8A 4BL1A 2OBJA 4CNHA 4EYMA 3KULA 3VS0A 5GZ8A 4HZRA 3L9PA 4BGHA 3NYXA 4RIWB 4DFBA 2UVZA 3TJCA 4G16A 3CD8A 4ERKA 2PZRA 4MWHA 5M51A 2IF8A 3TM0A 4EZ3A 2OLCA 3P4KA 5FEQA 3FDNA 4L3JA 5GJFA 4X21A 3R9DA 3QLGA 2XAMA 4XX9A 3DZOA 2Z60A 4ASXA 4GEOA 2CKOA 3KB7A 2PU8A 2F57A 4OBPA 1AGWA 5JFVA 2UZUE 2XNEA 3V8TA 1H25A 5FD2A 1F5QA 4F0IA 3GT8A 5D7AA 4AWIA 3ZM9A 4C4IA 2EUFB 3D7TA 4RWKA 3FL5A 4PDPA 3AC8A 4FF8A 1RJBA 4QP9A 5KMIA 2QG5A 2VX1A 3PA4A 4YJPA 3T3UA 4BKJA 3F82A 4IWOA 1OECA 3BYSA 3DXNA 4FKTA 2UV2A 4FKOA 3FE3A 1IA9A 4O7YA 3ORZA 4Q5EA 3FPMA 5F95A 4BDAA 4F9WA 3DCVA 2UZWE 3BYVA 4FOCA 4PNKA 3ZM4A 4LI5A 4BCHA 5LXMA 1U54A 3QC4A 3NUSA 1TKIA 1O6LA 5C03A 3DKOA 3HECA 4PPCA 1NVQA 5ANDA 5GZ9A 5BYZA 1R0PA 4PQNA 4AU8A 2YA9A 2PZPA 3PUPA 2XKFA 5A4TA 2C1AA 2C5XA 3G90X 4XNEA 2GHMA 4MKCA 4YLJA 4FV9A 4ITHA 4GYGA 4YZNA 5E8XA 3VNTA 2J0IA 3E8CA 1L8TA 2Z7LA 5B7VA 4J96A 5FGKA 4QPMA 2XAOA 1PXMA 4G5PA 3ZSGA 5C4KA 1W84A 5JZNA 4RA4A 2YIQA 3SDJA 4EOMA 4Y83A 2WQMA 1J91A 3C4CA 4A4XA 1LPUA 2VTNA 5CSPA 4C37A 3EHAA 4ZY6A 4RFYA 3SOCA 2VWYA 4HVHA 5LWMA 3BZ3A 4C8BA 1H08A 4AFEA 3S3IA 3ZFYA 4FT0A 3DLZA 2V7AA 3C13A 3MA6A 5KMNA 5JGAA 3OCGA 4Y73A 3EL7A 5AP7A 3ORXA 2XP2A 3HV3A 4FKQA 3FLZA 4D28A 1OB3A 3VS1A 2P2IA 4BCKA 3HRBA 1FGKA 3V51A 3W16A 4BCOA 4FNYA 4H1JA 4S31A 3L1SA 3NR9A 3V6RA 4I0SA 4YTIA 4CD0A 4W8DA 2NP8A 3DAJA 4LG4A 4P4CA 3SX9A 3ZZWA 3SW7A 3D14A 4RFZA 3QA0A 4YJUA 1J1CA 3OW3A 4K33A 4P7EA 2CLQA 3DAKA 3F69A 3W1FA 4DH5A 1VYZA 2RIOA 5J1WA 2PMNX 3HGKA 4D1SA 2C4GA 4D0XA 3II5A 3O8PA 5TR6A 5AM6A 5AWMA 1JQHA 2IN6A 4OAVB 2Y6OA 4XMOA 2JC6A 2GNIA 5DRDA 4UEUA 3TEIA 3QAME 3WF5A 4AGDA 1ZOHA 3QQUA 4J99A 5CQUA 3L9NA 4BWKA 4Q5HA 3QQHA 5FBOA 5BUJA 4U44A 3IW4A 1KOBA 4HCVA 3ZBFA 2GTMA 2XB7A 3IDCA 4DC2A 4EHZA 1IR3A 3V5TA 3QKLA 4HYSA 2R3NA 4QMWA 4TWNA 3LOKA 3ZOSA 5EI8A 5CAPA 3RZBA 1J3HA 2WOUA 3GFWA 3FAAA 2A98A 4FZFB 4IW0A 2BAQA 3SV0A 4TWCA 5DT3A 2JKMA 4E3CA 4EUTA 5CYIA 3RPRA 3CS9A 3UNJA 3BLQA 4JIAA 3RCDA 4CT1A 5JMSA 4I41A 2NYAA 1WVYA 4FV7A 3V5WA 3T3VA 4R77A 3ITZA 3AT4A 3R00A 2JD5A 4DFNA 3A60A 4A7CA 1RDQE 3OF0A 1M2RA 3FLSA 2BHEA 3BHHA 4B8MA 5BQ0A 3ATTA 2CN8A 5L2SA 1W7HA 1W82A 4F7LA 5ETCA 3G2FA 3U9NA 2UUEA 4LV5A 3DK7A 3P7AA 2ITUA 2VO0A 3ZMMA 2GTNA 2VRXA 3E3PA 2BRNA 2OG8A 3QX2A 4RVLA 4DHZA 3FZOA 3RAKA 5IQIA 4HGTA 2O63A 3E8DA 3Q9WA 4BIBA 2F49A 3KMWA 4QMSA 2WB8A 3R28A 4NM0A 4EOSA 3FC2A 2QU6A 2XKEA 3VBXA 4DEEA 2ITWA 3ACKA 4BZNA 4HVIA 4FIGA 1L3RE 2QOHA 5EH0A 4P5QA 5I9XA 2PUPA 3PIXA 4ACGA 4NW5A 2VTPA 3LM5A 5C8MA 4BVUA 4BICA 1AD5A 4KIKA 4Z55A 1UWHA 1TFFA 4MX9A 1FVTA 4XP3A 4HGEA 4FTTA 4JG6A 3S2PA 2YZLA 4BY9E 3POOA 4CRSA 4LRMA 4GYIA 4DEAA 1WBPA 5M06A 2ONLC 2YM4A 3EQCA 1FQ1B 5HBEA 4X3JA 4JG8A 5CVFA 2Y0AA 3QWKA 3RZFA 2XNPA 1G8KA 4D2RA 2Q0NA 4ALUA 4JX3A 4DT9A 4E6DA 4FK3A 5K3YA 3FXXA 1UV5A 5AP0A 4DG0E 4KIQA 1JKLA 2XJ1A 3BU5A 4RVTA 3O50A 3D2IA 2E9UA 3FZRA 4B9DA 4I24A 4LOOA 5KCVA 3VBVA 5DR2A 3WOWA 3O8TA 3TL8A 4QPSA 2Y8OA 2GNFA 3EZVA 5DOSA 2DUVA 4UZHA 4Q9ZA 4ZP5A 5JZJA 2JFLA 5IMXA 1CMKE 4DT8A 4Z7GA 3HP5A 3A4PA 4LMNA 5IMEA 3D7TB 1IAJA 5CU4A 4BCIA 2YLFA 4B8LA 3HDNA 4O0RA 3LMGA 3TJDA 4A9RA 4L3PA 4ZS4A 3UG1A 2F2CB 1JKSA 3LQ8A 3WYXA 3OUKA 3CPBA 4I6LA 5LOHA 2NRYA 4UX9A 4AGUA 4BCJA 4L01A 2XKCA 1H1WA 2YCQA 3IONA 4QT1A 3RNYA 3F2RA 4RJ7A 3OROA 4O7VA 3MTFA 3Q6WA 4DGMA 2EXMA 3QUDA 3CC6A 3QTXA 5DFPA 4XRJA 1FGIA 5FDXA 3T9TA 2F2UA 2C6LA 4GFGA 4C57A 4I23A 3EQHA 4KBAA 3KRXA 1U54B 4KINA 5JQ8A 3TDWA 4WUAA 5A54A 3U8WA 4DLJA 4F99A 2RGPA 2OKRA 3GB2A 5A6OA 1ND4A 3SD0A 4D2SA 5AP2A 4BFMA 4DH8A 5JEBA 2BTSA 4IAAA 4GVJA 1UU9A 2J90A 3FL4A 4FG7A 4HVDA 1RQQA 4K18A 5LWNA 2WMUA 4Z3VA 4FTOA 2XUUA 5KMKA 1BL6A 4QYEA 3TKHA 3IKAA 3Q4CA 4CG8A 3FHRA 4FV5A 4E1ZA 3OW4A 3I60A 3KXZA 3AQVA 2C0TA 4ZTLA 4AXFA 3NUXA 2R3HA 1WZYA 4K9YA 4IVCA 3QGYA 4WNPA 4FODA 5FUTA 5BUEA 1Q99A 2Y9QA 5E8SA 2IVVA 3FXWA 4C34A 3R7OA 4DN5A 4F6WA 3F7WA 4FIIA 2J4ZA 1TQIA 4FKSA 3EQRA 3MY5A 4NT4A 3VS4A 1Q8UA 4YC8A 4J53A 3R7IA 4A9SA 4D2TA 3QQKA 4MXAA 4JQEA 3CY2A 4ARKA 4BRXA 4ZLYA 2R2PA 2YJSA 3ORPA 5AAFA 3DXQA 3M42A 4EZ7A 1PY5A 2VWBA 3OCBA 5J8IA 1KE9A 4EOKA 4C35A 4MK0A 4B7TA 4O7RA 4FV3A 5HO7A 1CKPA 3GU7A 3EYGA 4WA9A 2XM9A 4IZ5A 3CKXA 3FZ1A 2C0OA 3I1AA 4YNOA 5EHOA 5B0XA 5HKMA 3NEWA 1XBBA 4BC6A 3W0SA 2VTSA 3HV5A 4PMPA 1Y6AA 3KXHA 3KXNA 5HG9A 4F1MA 3KRJA 2XBAA 1Y8YA 3ZBXA 5BVOA 3EN7A 3LKMA 1JKKA 1KV1A 3BX5A 3IW8A 5EI6A 5LCKA 1QPDA 3GC7A 4TZRA 5HIEA 3GCQA 4GW8A 4R1YA 3C4WA 2GDOA 2GSFA 5E8ZA 3WE4A 4YZMA 1Q41A 3OC1A 4FR4A 5BUIA 4FJVA 2X0GA 2X7FA 3S00A 5D41A 2F4JA 4BCMA 4NL0A 3IO7A 4MBLA 4FKWA 2ZM4A 3P9JA 4RX9A 4FSMA 2WOTA 4ZSEA 3PG3A 3CBLA 4K2RA 4UYAA 4FOBA 5FM2A 4EH5A 3ZO1A 4O7NA 3DK6A 2R3FA 4BDKA 2PWLA 4FBXA 4IDTA 5B2MA 3EQDA 3GCUA 2PY3A 4PL5A 3TACA 5LQFA 2IEWA 1OI9A 2R9SA 4I5HA 1OGYA 3QUEA 4DEGA 4KSPA 5IA0A 3QU0A 4C59A 1XBAA 4ZLOA 1ZYCA 3LMHA 4OBOA 3BBTB 4AT4A 4ZTNA 3BQRA 5BX0A 1CKJA 5IG1A 1A48A 2R3IA 3DKCA 3MJ1A 4FRFA 2JDOA 4HGLA 4NK9A 4XV3A 5CQWA 5LVMA 3C4EA 3R04A 4M66A 4CKJA 3PPJA 4Z16A 5HG7A 4XOYA 3H30A 3HUBA 4YJOA 2CLXA 3KRWA 4WD5A 5EYDA 1M2QA 5AX3A 4OGRA 5KZ0A 3UNZA 4ORKA 4QTBA 3NMUF 2OFUA 3GQIA 4DHJA 4EJNA 1XMLA 3TIYA 3R9RA 3OXIA 4LL0A 4MD7E 3RGFA 4QQCA 5GIPE 4JI9A 2W17A 3DFAA 4X2JA 3KVXA 3BQCA 1PW2A 2O65A 5EHLA 1MP8A 5M57A 4OTHA 1BX6A 5H8EA 3HMOA 4D5HA 3TUDA 2I0VA 2WMBA 2ZVAA 2X2LA 3SXSA 4ZK5A 3MN3A 1FVVA 3KREA 2CGWA 5HO6A 3G9NA 3TZ7A 1HCKA 3AD6A 5HBJA 4E7WA 1GZ8A 3QCQA 3LZBA 4O4EA 2BTRA 4XBUA 1XH5A 2W5BA 3H0ZA 3PY0A 1NT2A 3A99A 3U6HA 3GOKA 5FDPA 1A9UA 4QMVA 5ETFA 4ZIMA 3O7LB 4R5YA 4TT7A 5EM7A 4KIKB 2I7QA 3ODYX 4IM3A 3CCNA 3FQHA 3MFRA 3OCTA 5AR7A 5JFXA 1PXNA 4RC2A 4DGOA 4GT4A 4UYNA 4AAAA 3MH3A 2X7OA 3PXKA 2P3GX 3UOHA 4QQTA 4MF1A 4QMTA 4AE6A 3HRFA 3WF7A 5AUUA 4ZJVA 3COMA 5CTPA 4BZOA 4QQ5A 1ZYLA 5JN2A 3O5AA 5HNGA 4C2VA 1PXOA 4WG4A 5HTCA 2C3IB 3EOCA 3N51A 1LUFA 3ATSA 4O1PA 4I4FA 5B2KA 2VTHA 3IPHA 2E2BA 2ZV9A 1ZWSA 2QKWB 4Y95A 4EOJA 4FUYA 4DEDA 2QVSE 4J97A 4GT5A 3PLAE 2R4BA 1VZOA 2XVDA 3G6GA 2FH9A 3DT1A 4J71A 3QKMA 4D1XA 5HOAA 2ZMDA 3RWQA 4AZEA 4KB8A 3UBDA 4BBEA 2YERA 4E73A 3HMPA 3RVGA 4F7NA 3MJ2A 3P7BA 1V0PA 4DFLA 4RFMA 4HVSA 4XP0A 2C0IA 3BU3A 4E4LA 3GC0A 4IX3A 4FNXA 4LRKA 5T68A 5FP5A 4CLJA 3A4OX 1J1BA 4ASDA 2YCSA 4IDVA 4JS8A 1Q3DA 4GIHA 3ROYA 4F64A 3VRZA 5IQEA 3TNQB 3ID6C 4EJ7A 4FSQA 3G6HA 1FPUA 3LQ5A 4M13A 1Z57A 4FKGA 5HD7A 1WBTA 4YJNA 4W9XA 2R3QA 1SVGA 2G15A 1UNGA 2J9MA 4ENYA 3VS3A 4D58A 2Y4PA 3FUPA 3FKOA 2XANA 5L6PA 1GJOA 4N70A 5AFVA 5AR8A 4OBQA 3KF7A 4YSMA 3DGKA 2I0HA 2PVLA 5IUIA 2C5YA 4FC0A 5IQDA 4DLIA 4OW8A 3AC3A 5AM7A 4GJ3A 5FQDC 3ZTXA 4FICA 4C3FA 4RC4A 2Y6MA 4OT6A 3QUPA 1QMZA 3BELA 4EHVA 4FTRA 4KAOA 3NDMA 5H8GA 4EH4A 4DYMA 3FEGA 3OP5A 2CNVA 3LW0A 4UWBA 4EZ5A 4CFVA 4C4FA 4C7TA 3DU8A 3L9LA 3IQ7A 4HGSA 1YDTE 3ODZX 4I6HA 4IACA 4XJ0A 3HL7A 2IW8A 3R9OA 2PPQA 3E3BX 4MXCA 4L9IA 2BCJA 1XJDA 2BALA 5CF4A 3QKKA 1DI8A 2HWOA 2BDFA 4MBJA 3MPMA 4USDA 4QEBA 3UIUA 3V5QA 2Y7JA 3JS2A 3MYGA 1ERKA 4F63A 3HAMA 3HKOA 5BVWA 5ICPA 3SW4A 1Y91A 3R2YA 3RKBA 1ZARA 1W8CA 4ZY5A 4L6QA 3FI4A 1PKDA 1UVRA 3KN5A 3NZ0A 1DI9A 3DBCA 3QRUA 4RSSA 4YP8A 5L2QA 3R7VA 5JRSA 1GZNA 5M53A 5IA2A 4ZOGA 4R6VA 5TE0A 3RM6A 5BVNA 3OZ6A 3VJOA 3PFQA 5KNJA 4S2ZA 5EG3A 4IQ6A 4E4MA 4HNIA 4I5MA 5ACKA 3ZXZA 5IISA 5E7RA 5F20A 3UP2A 4JDHA 3S0OA 3BYUA 4A9YA 4U43A 4L52A 5AV1A 4C3PA 1V0BA 1ZOEA 2WD1A 3R1SA 3QZGA 4U6RA 4U97A 5AUYA 4DAWA 5DPVA 5JRQA 2UZTA 4IIRA 4XV1A 2WIHA 4FZAB 1BMKA 4QP6A 3TV4A 4O86A 2P33A 1WBSA 1GIIA 5I4NA 1FMOE 4HZSA 2J5FA 5L3AA 4TL0A 3SVVA 4CTCA 3W2QA 5M4IA 5JFSA 4YMJA 4AOIA 2XIKA 3TV7A 3ETAA 4ANLA 4MUQA 1JWHA 3NLBA 3PXFA 4LM5A 5EYMA 4BCFA 3BE2A 4G1WA 4HCUA 1YOMA 4PY1A 4AN9A 2C5NA 3E93A 4M3QA 4TPTA 4CZYB 1UNLA 3MB7A 3IW6A 3IDBA 4GL9A 1Q4LA