4BCJA

Structure of cdk9 in complex with cyclin t and a 2-amino-4-heteroaryl- pyrimidine inhibitor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
321
structure length
309
Chain Sequence
DSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/cell cycle
molecule keywords CYCLIN-DEPENDENT KINASE 9
publication title Comparative Structural and Functional Studies of 4-(Thiazol- 5-Yl)-2-(Phenylamino)Pyrimidine-5-Carbonitrile Cdk9 Inhibitors Suggest the Basis for Isotype Selectivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 309
sequence length 321
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bcjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bcjA01
2XK4A 3IKAA 4FZ6A 3BE2A 3WBLA 4CKRA 4E4MA 3C4XA 3QA8A 3CXWA 5C26A 2J0KA 4FIFA 4IXPA 1REKA 4FNZA 4YJNA 5CNNA 2BKKA 3GCVA 2XNOA 4H36A 4FOCA 2F4JA 2VTJA 4U80A 4BVUA 5F4NA 5JT2A 1UU9A 1NW1A 3VJOA 2R3GA 1OZ1A 2VRXA 3MIAA 1ND4A 3DK3A 4A9UA 4LGHA 3N4VA 2OZOA 4M0ZA 4QMSA 4C3FA 5A4CA 3EIDA 3FYKX 4NUSA 4CQEA 4Y46A 1Y6AA 4IH8A 2FB8A 2FVDA 4RJ3A 1JAMA 4HZRA 4TNDA 2C68A 4BHZA 2VNWA 3O2MA 3VRZA 4K0YA 4RJ4A 3NCGA 3MY0A 4TXCA 3Q4ZA 2OO8X 3HRFA 3QD4A 5ANDA 4A7CA 5EOBA 4ALWA 4C4JA 4YNOA 4O7RA 2ZMCA 5AP3A 4G17A 2YJRA 2V55A 4Y72A 3NW6A 4JBOA 4LUDA 5AV3A 4IM2A 5KO1A 5CI7A 1PY5A 1PMNA 4FTLA 4DEAA 5H9BA 4RGJA 3QD0A 5L6WL 1Q61A 2YA9A 1FOTA 3AG9A 3TDVA 2QOBA 3SLSA 3LKMA 2OGVA 4RG0A 3LCSA 5BVWA 4WA9A 4TRLA 4C61A 1JVPP 5GNKA 3LFDA 1A9UA 1I09A 3COHA 4S2ZA 2ITVA 2GHMA 4G1WA 3A4PA 4TWNA 1CSNA 5L6PA 2CNVA 3QL8A 4EH7A 4GT4A 2V7OA 3DFCB 4IAYA 5FWKK 4FV7A 4RIOA 4Z7GA 4BCIA 1B39A 5L8JA 1A48A 3D0EA 4F6UA 2Y9QA 3KN5A 1K2PA 3CTHA 3ID6C 3SX9A 4BCJA 4BYJA 2OG8A 2YIWA 1F3MC 4FGBA 4JLCA 5CANA 1OPKA 4XS2A 5CVFA 1VYZA 2XIZA 3LVPA 2R3RA 2FH9A 1YOMA 4DT9A 2QU5A 5JQ8A 2ETMA 2X2LA 3GU8A 4PY1A 3UC4A 3PA4A 3WZDA 1XQZA 5LARA 4MXCA 3JY0A 3MVJA 4V05A 4C33A 4LG4A 4QYHA 5B2LA 2FSTX 2XKCA 5F1ZA 1FVRA 2B9IA 4IJ9A 4QNAA 3LMHA 2O5KA 3LM5A 4YZNA 4G6LA 2XCKA 2HYYA 5CSVA 4XHKB 2PZ5A 3LFEA 4G5JA 3B2TA 4IE9A 1KOAA 3MA6A 4YZBA 4D2PA 3MFUA 3QALE 3UVQA 4UMUA 2O0UA 4X6QC 5L8KA 4H1JA 3Q4UA 4XG4A 5AUZA 5EM7A 3ORKA 2ZAZA 2FSOX 4E6AA 4XG2A 5H8EA 4EH5A 3BYMA 4K33A 4CG9A 1PMVA 4FIGA 4I6BA 4PTGA 1J7UA 5HLPA 5IQAA 3Q5IA 3MDYA 2Y6MA 4X2NA 3W2OA 4RT7A 2HY0A 4PL3A 1G8SA 4IZ7A 4PUZA 4RQVA 2EB3A 1PMUA 4TKSA 4E6DA 3V5JA 1VEBA 5LOHA 5LXMA 5M4FA 4UZHA 3R8LA 5DT3A 3R21A 2YCRA 1XH7A 5GZ9A 1PXPA 3IW4A 4F9YA 2JLDA 3HRBA 4FKVA 3UPZA 5IEXA 4MX9A 4ZTQA 1FBNA 3VF9A 2QCSA 3AMYA 2X8DA 4JAIA 4L7FA 2W4JA 3L9MA 4M69A 3K3JA 4IZ5A 5HNGA 5AADA 5BVNA 4QP4A 4XCUA 5FP6A 5FTOA 2CCIA 1OPLA 3K54A 1ZYDA 3DLSA 3P7CA 3L8XA 4AN3A 4C8BA 2UV2A 4BCHA 4G3FA 2OKRA 2FGIA 4I0RA 3PRFA 1U5RA 4AGCA 4RZWA 4IWOA 3AD5A 5HNBA 3PJ8A 3DAKA 4X3JA 4FSZA 3KULA 3CR0A 4BDFA 3KXNA 5J9LA 5C8NA 3NIEA 3DLZA 1U54A 2HIWA 3GOPA 2PMNX 3MFRA 3PVWA 5CF6A 4GU9A 4CSVA 2QOHA 3TEIA 3TZ9A 1JKSA 4GJ2A 5IQIA 5KKRC 4BTFA 1JOWB 4AA0A 2WQEA 4FNYA 5HE0A 3S1HA 4BWKA 2O8YA 1PKGA 1Y6BA 1XWSA 3BQCA 1PW2A 3FMHA 1XJDA 5DLSA 3VF8A 4CTBA 4C4HA 1H24A 4L01A 5K5XA 5GHVA 2WB8A 4W4WA 5CU3A 4D4YA 3O8TA 1H1QA 3M2WA 3NR9A 2XKFA 2PU8A 2XKEA 3LCOA 5I9WA 3QZGA 2ERZE 3CY2A 2PL0A 3OWLA 3LOKA 3PUPA 3OHTA 3UBDA 3R02A 2W5AA 5I3RA 3PLAE 1PXKA 2NPQA 2XYUA 4OTHA 3QCQA 3R7VA 5TR6A 2YABA 3KEXA 4KBKA 1WBWA 2JDRA 2OXYA 4DH1A 3QC4A 2PY3A 3EJ1A 4AZEA 3IOKA 3VUTA 4FEUA 4F6SA 4OTQA 3BGQA 5GIOE 3CPCA 2RFSA 2XKDA 4YTHA 2ITYA 2PVKA 4HNIA 4ID7A 4DT8A 3FQSA 3QRTA 3LQ5A 4IWDA 4F7SA 4QQCA 4W9WA 4YJPA 3WYXA 4GKHA 3O71A 2EB2A 4IM0A 2WMBA 1E9HA 4U7ZA 2UW9A 3ERKA 4QMOA 4E6CA 4E4XA 3AOXA 4ORKA 2WTDA 1XH5A 4GCJA 3KA0A 3NUXA 3DDPA 5HOAA 3DXQA 4YPDA 3ZLWA 4IC8A 4J53A 4CD0A 3QRJA 3TL8A 5B0XA 4D1SA 3O8PA 4JRVA 4QNYA 1G3NA 3MY5A 4IX4A 5FD2A 3QU0A 2Z7LA 2CKOA 3GT8A 3PSCA 4CMUA 3NWWA 4P5ZA 1Q24A 2OICA 3BWJA 3ZRLA 1FGKA 3ZDIA 1OL1A 3SA0A 2XIYA 2WKMA 3TZMA 2WU6A 3CTJA 3VS2A 3TI1A 1PMEA 4KS7A 4R7BA 1YHVA 3KC3A 3FLYA 2W17A 2JAMA 2OJFE 4GEOA 1K3AA 3ELJA 2WMAA 2A0CX 2B9JA 3FC2A 4XG7A 4GFMA 4B8MA 4DH8A 2QO9A 2UW7A 2YZAA 5BUIA 3ORNA 4FT3A 2VWIA 4B99A 1FPUA 3KL8A 3EN9A 1BYGA 4YPSA 4L8MA 4ZEGA 4C4GA 2JIIA 5L2TA 4O7LA 3R8UA 2QONA 3ZEPA 4L3LA 4FTQA 4DLIA 3UMXA 5M06A 3LPBA 4GIHA 2O63A 1DM2A 3QYZA 4PRJA 2JIVA 5CU0A 4O7YA 3F66A 2UW3A 4FYNA 2BVAA 2J0MB 1O6LA 4O1PA 4FMQA 2WXVA 1JKKA 5DFPA 4I24A 3IDBA 4ONAA 3LCDA 3RNYA 4D2WA 4K6ZA 1J1CA 3BZ3A 4FE2A 3NMUF 2H34A 4Q9ZA 1XBBA 4IX3A 3SXSA 5J9ZA 3Q5ZA 5TE0A 4QP6A 4PL4A 4ANMA 5BUJA 5AUYA 4ACGA 1QPJA 4E8AA 1XO2B 2GTNA 2UZOA 3I79A 3FDNA 2C3JA 1TQPA 3TNHA 4DCAA 1OL2A 1KV1A 4LL5A 4QTAA 3U9CA 4OAVB 3MW1A 4PV0A 3RAHA 4EK5A 5DVRA 2CJMA 2ESMA 3MVMA 4UEUA 3DBCA 4FV5A 2PMLX 4EL9A 3C7QA 2XZSA 4IZAA 3C4FA 3GU5A 5E4HA 4KB8A 4MD8E 2UZLA 3ZXTA 4CFUA 4EOKA 5AP2A 3THBA 3FE3A 4YBJA 2PZRA 2ITTA 4GVAA 2HXLA 3ZUTA 4ITIA 1PKDA 4M7IA 2VO3A 4O86A 3U6JA 4ERWA 3O51A 3PYYA 5LVMA 4EYJA 4FICA 4LV5A 5E8UA 4ZSEA 3UTOA 4ZMEA 4UYAA 3NEWA 3ZRMA 4AAAA 2YM8A 3DKGA 4MQ2A 2I0EA 3LCTA 4MD9E 3COKA 3DBEA 3RZFA 4F7NA 1UWHA 3PPZA 2IVVA 4UYNA 4USFA 3ORZA 2B7AA 4FL2A 1U59A 2XIKA 2YITA 1R0PA 3BCEA 3CE3A 4L68A 4RIWA 4ZP5A 5ANEA 2C1AA 3CCNA 1WBSA 5L4QA 4M69B 4Y83A 3SHEA 3RM7A 4F4PA 4JAJA 5CF8A 4LRKA 4CRSA 3EQRA 4FG7A 4FSYA 4BIEA 5KKRB 4R3CA 3Q04A 4HVHA 3A99A 2I1MA 4TT7A 1Y8YA 3EOCA 4APPA 4BL1A 1NY3A 2WMWA 3LFAA 3KRRA 4UB7A 1OPJA 4FG8A 4P90A 1DS5A 3CJGA 4H3BA 1CDKA 2ETKA 4WKQA 4O83A 3NAYA 3RPSA 3OXIA 3NAXA 1U54B 4IHPA 3F3UA 2BFYA 2VTLA 1M14A 3PVBA 1ZXEA 2IJMA 2QLQA 5HE1A 3E3BX 2OLCA 2C6DA 3RHXA 4QYGA 4BCGA 2RIOA 3UG2A 5AV2A 1J7LA 4XRJA 4FC0A 4FKSA 1TQIA 5IQEA 4I6HA 1ZZLA 2PVYA 4FIIA 3TT0A 4EHGA 1OI9A 3FSFA 5KHXA 4HGEA 4YR8A 4CRLA 3FC1X 3FMLA 3V5PA 4HVDA 4EBVA 2IVTA 4L6QA 1M17A 1OIUA 2QI8A 3TWJA 4AE9A 2EXEA 1YXTA 4MWHA 5IEVA 4HYUA 3QTRA 3V3VA 1SM2A 3P0MA 4XX9A 2EVAA 1T45A 4ZMFA 4II5A 3ZYAA 4RJ7A 4DINA 3FYJX 2ITPA 3VS6A 2RKUA 4HPTE 4NW5A 4O0YA 4WG5A 4BCFA 2OXDA 3KXHA 3R7IA 4UV0A 2ITXA 5JMSA 5EHLA 5A6NA 4NM3A 3LJ0A 5A4TA 3PDTA 4BCNA 4JQ8A 4IDVA 2V22A 5KZ0A 1FGIA 4FTTA 5L8LA 3EZRA 2YIXA 3BYSA 4H58A 3ZUUA 4B8LA 5KCVA 2UVXA 4HCVA 3GU4A 4XP3A 3FMMA 4NCTA 4OLIA 5CAOA 3MTFA 2R3KA 5AM6A 1URCA 1HOWA 3I5ZA 3NX8A 4F6WA 4UY9A 4PDYA 4G3GA 3U6IA 1W8CA 4IAAA 4C02A 4D1ZA 1LEZA 4YJOA 3CLYA 2Y7JA 4M8TA 4NWMA 3MH0A 5LWMA 5EOLA 2BFXA 3R22A 2XNEA 4FVRA 4HOKA 5CU4A 5A14A 4LOOA 4IC7A 4WSYA 4QP1A 3UZRA 4C57A 3G9LX 4Y5QA 2LAVA 3U6HA 3PJ1A 4PTCA 3ZLYA 2W1GA 2C5OA 2WEVA 4NTTA 3V6RA 2DS1A 2AC5A 2HY81 1B38A 3I4BA 2WGJA 3MPAA 4EH6A 2Q0BA 3UGCA 2X2KA 3G9NA 4WG4A 4FZDB 3NCZA 1PXIA 1E1VA 2UW0A 5LVNA 3WE4A 3FXXA 3Q4TA 2X7OA 3A7IA 4XLVA 4A07A 2VGOA 4FK6A 4NTSA 4UMPA 2Z7QA 4LOPA 1A06A 2HENA 2R3NA 4I5MA 3P86A 5AR8A 5HIEA 5HNIX 2VWZA 5J95A 3KN6A 2ZM1A 3NW5A 2I6LA 4KIKA 4YGAA 3E5AA 4G3DA 1OM1A 3R8VA 4CT1A 5M57A 3FLNC 3IW5A 4I21A 4RX8A 3RTPA 4AA4A 3RMFA 4AGWA 5HQ0A 4PF4A 1F0QA 3PXYA 4HCUA 1GZNA 5JGBA 5CU6A 3MJ2A 2LGCA 3WI6A 5HVKA 3RPOA 3C0GA 3AMAA 3ZLSA 4X2JA 3GC7A 5AEPA 3HECA 5FBOA 3VS7A 3KRWA 2WQMA 1UV5A 5A46A 3ZSGA 3OS3A 4F63A 4UMQA 1Z57A 5JSMA 3BQRA 3JVSA 1PRYA 3WF6A 4DEBA 2PE0A 3Q2JA 2QG7A 4J98A 2VTOA 3R7OA 4F0FA 1WVWA 3T9TA 3QBNA 5IA1A 3BELA 2FSLX 4DTKA 5FEDA 3FPQA 4XEYA 1CTPE 4QMLA 2A27A 4IB1A 4UN0C 5AR3A 1XBAA 3HDNA 5AUUA 4C59A 4C37A 4CKJA 4C4EA 2X4ZA 2BHHA 3SQQA 2VTQA 5CAUA 5EI2A 5CQWA 1WMKA 3T3UA 5BYLA 2H9VA 3C0HA 4J99A 3L9PA 3TIZA 1KV2A 4BKZA 3FI3A 3CEKA 4AN9A 2REIA 3ENHA 2PULA 1T46A 2R3JA 5EW3A 1H00A 4DBNA 4ARKA 3QQKA 4BN1A 3V8WA 4LRJA 1UWJA 2HZ0A 3NNXA 3WILA 1VR2A 2QO7A 3C4EA 4PMPA 4DBXA 3HA6A 4RBLA 4GK3A 5EHYA 4PMTA 4XV3A 1J3HA 4R5YA 5HCYA 3FZOA 2X1NA 4QYYA 3SXFA 3WF9A 4OTFA 3B8RA 1R1WA 4RWKA 3P1AA 5BYYA 4Y73A 4U3ZA 1SVHA 4Q2AA 1KE8A 1ZAOA 5DWRA 3VBWA 4BY9E 2J50A 3MA3A 3FBVA 3UZPA 4QTEA 4R1VA 2GNLA 3F3ZA 4GW8A 1RJBA 5C4LA 4ANOA 5C9CA 5E8XA 4K2RA 5E7RA 1H25A 2SRCA 3PA3A 4EKLA 3ATSA 2IW6A 2EU9A 3R1NA 4RIWB 3H30A 2OFUA 4R77A 5I5ZA 4HGLA 3F2AA 4AP7A 3FMJA 1Y91A 2PVJA 4BGQA 4BBEA 2IPXA 2C1BA 2UZUE 2X9EA 3QTQA 4ZY6A 4EOQA 5IDNA 4D58A 3LLTA 5JGDA 3DBFA 3LHJA 4M13A 3CQWA 1QPDA 4H3PA 4B7TA 4BICA 4DYMA 4IW0A 3N51A 3K5UA 1H27A 5CT7A 5IQBA 4BF2A 2JDTA 4KBCA 4DEHA 5BVOA 4R5SA 1SMHA 4YLKA 1JNKA 5E1EA 3EQIA 4FV0A 3ZO2A 4JR7A 4CZTA 2VO6A 4CEGA 1YI6A 3W10A 4J1RA 4FV2A 5HVYA 2IG7A 3PJCA 4R3RA 2YDIA 5E1SA 3ZC5A 3QRIA 4LUEA 1VYWA 5DE2A 5JEBA 2E9NA 4XG8A 2RFNA 5AUXA 2C6IA 2JKOA 2NRUA 4D4SA 1F5QA 1L3RE 2C3LA 4TYJA 3V51A 4X3FA 2P55A 4BCMA 2BZJA 5I9XA 4TWCA 5LMKA 3OW3A 3HNGA 3LIJA 4UZDA 3C4WA 4JRNA 5IMEA 5HVJA 3ZO3A 3ZO1A 4IZYA 3VJNA 1V0OA 4ZXTA 5IA5A 5M08A 4AOTA 2XYNA 3QYWA 4FTOA 4I6QA 3BPRA 4EKKA 3PRIA 2ITZA 5DT4A 5EYCA 2B9HA 3W2QA 4L3JA 4F70A 5D10A 2PVHA 3FQHA 3R9RA 3SVVA 1HCKA 3EL8A 3A8XA 3OWKA 3R73A 3UP7A 1SZMA 4EUTA 2FA2A 3Q9XA 5B7VA 2YZLA 3HA8A 4BHNA 5CSXA 4YTIA 2A2AA 4DF3A 5HE3A 4KS8A 3Q9YA 3TN8A 4O2ZA 4AW0A 2XJ0A 3G51A 1GIHA 2BZIB 3DBDA 5EYDA 4EH8A 3G15A 1Y57A 4EJNA 3FKLA 3DGKA 1FVVA 3VS3A 4B0GA 3POOA 3VWAA 4BBFA 5LVOA 4ZLOA 2C6OA 3BLHA 5H2UA 3VC4A 4WRSA 4I5CA 2VO0A 3JYAA 2Z2WA 4TYHA 4JG8A 3EB0A 4DH7A 3ACJA 3D4QA 3RPYA 2UUEA 5F94A 3S3IA 3ZSIA 4EQCA 5B2MA 3SW7A 4MBLA 5BPYA 2OSCA 2YM7A 3IPHA 4KINA 3R9OA 4ALUA 3PY0A 4D2SA 4YZDA 4EQMA 5EKOA 3E8CA 4TL0A 4P7EA 2PMIA 2C0TA 3FMDA 3P78A 5DT0A 5CEKA 3D83A 5LCJA 3IO7A 3OOGA 4UWYA 3S00A 1VZOA 1PYXA 2BAKA 4F9AA 4BDCA 2X6EA 2QO2A 3FL5A 4C3RA 5F95A 4V04A 4KRDA 3DS6A 2PK9A 1DI8A 3MI9A 5EFQA 2W1FA 5BVKA 4I93A 3TNQB 4FK3A 4EH2A 4YMJA 5M44A 3F7ZA 3VRYA 3EZVA 4PL5A 5EH0A 4C7TA 3EH9A 2YM6A 4JG7A 4JX7A 4CFXA 4QPAA 4BCKA 3ATTA 4JX3A 3CPBA 5FXQA 4FNWA 1M52A 4FZFB 4BGGA 3VS1A 4NFMA 3E92A 1HCLA 2O65A 3OOMA 4X21A 2PWLA 3V01A 2J6MA 4WNMA 4FZAB 3SG8A 3FLWA 4KRCA 3KKVA 2XM9A 4ZAUA 2XNMA 2GS2A 3KK8A 4KIKB 5E8ZA 4D9TA 4DFNA 3AC4A 2ERKA 3V6SA 4QP8A 3N4TA 5A4QA 3QX2A 4HPUE 4OW8A 5IH4A 4JS8A 2IZUA 4QOXA 3ZFXA 5EKNA 4NL0A 2A1AB 4GG5A 2ITWA 2YACA 2GFCA 4FTNA 3KXZA 1PYEA 3GC8A 1KOBA 1SNUA 2J4ZA 3OF0A 4S31A 5EDQA 2W06A 3RBWA 4ASXA 3VBYA 3CS9A 1J1BA 2BPMA 3EKKA 4C36A 4U6RA 4O7NA 2DQ7X 4L3PA 3F82A 4LFIA 2XH5A 3LJ2A 3QHWA 3V5LA 4ZOGA 1OGUA 4XYFA 4HGTA 4F9WA 3GU7A 2X81A 3HP2A 3QCSA 4KKGA 4M97A 4MXZA 3B2WA 4R7HA 2OIDA 3E8NA 4FV1A 4WOVA 3WF7A 3PZHA 1IA8A 2H8HA 4KKHA 3RNIA 3QKLA 3TNPC 1GZ8A 2GS7A 4O21A 4XG6A 4M67A 3MVHA 4YZ9A 2DUVA 2QU6A 3MB6A 4YJQA 3FKOA 5IG1A 5I9ZA 3V8SA 4LMUA 4YP8A 5J8IA 2VWYA 1CMKE 3GXLA 3JXWA 4GUBA 4OBPA 4WBOA 4EH9A 4B4LA 4MYGA 3WF8A 4O7TA 5FRIA 3ODZX 4G16A 4JBVA 2YERA 5H3QA 2PVMA 3FZTA 4RVKA 4ZSJA 1H0WA 2ZOQA 4EC9A 5AUTA 2YDKA 2CGUA 3D5XA 5GJGA 5M55A 5EDRA 5AIKA 5J1WA 2VWWA 2RG6A 3FY2A 4I0SA 5AP5A 3TJDA 3OBGA 4R7IA 3UNKA 4GSBA 4L67A 4ZS4A 3U8WA 2GQGA 2ZYBA 2WTKC 5K4JA 2EXCX 3WYYA 3F3WA 1WBTA 4XP0A 4O82A 4D0XA 2VX1A 3O96A 5CTPA 2WD1A 2F7XE 4CNHA 4JG6A 2YN8A 3D5UA 3TM0A 5T6KA 3KXXA 4O6EA 1Q99A 5AV1A 4LV8A 2XM8A 3N9XA 4QMZA 4TWPA 5L2SA 3O17A 5KZIA 4O22A 5E8WA 4EOLA 2PVNA 3D5VA 4MXXA 1PXMA 3KK9A 4DCEA 3ROYA 3BYOA 5EYKA 3DKFA 2O3PA 4WRGA 3ZEWA 1Q62A 4U5JA 4FT0A 3VW8A 2W96B 3KF4A 5DA3A 3BGZA 4WUNA 2UW4A 3CC6A 3AC8A 4NFNA 2GQSA 3HMOA 3FHRA 3TUDA 4ZSAA 4G9RA 4FA2A 1Z5MA 1H26A 1MQBA 3GUBA 4RVLA 4PQNA 2BALA 5D7VA 3EYHA 3FY0A 3FMNA 3RPVA 5DNRA 3VUMA 3RM6A 5JFXA 2I40A 1XH4A 3PE1A 4G5PA 4RX5A 5IKWA 4P5QA 3OT3A 4TYIA 4F09A 5HBJA 2ZVAA 1STCE 3BU3A 5JRSA 4EZ5A 1RDQE 1BL7A 5KMLA 2JDOA 4NK9A 4NT4A 2B4SB 5IPJA 4GYIA 2R2PA 3ENMA 3OXTA 4MAOA 5J5TA 4ZJJA 2X7FA 5HCZA 2CCHA 1QPEA 4O0SA 1WAKA 4X3FB 3LJ1A 2BDFA 2YISA 5DH3A 2YIRA 4RIYA 3FI8A 4AX8A 2P4IA 1WFCA 4F64A 3PP0A 4LQMA 2OI4X 2BDJA 4FTAA 4YHJA 5EM6A 5M4UA 3BU6A 4YNEA 3G33A 5EQYA 2OW3A 3RKBA 3E3PA 3U54A 2VV9A 5M4CA 1Q4LA 3S0OA 3QAME 2WMRA 5HBHA 4AF3A 1XH9A 4FV8A 1SVGA 4N6YA 4HYSA 2P33A 3W2RA 5JRQA 3NDMA 4CGAA 4NEUA 4DGNA 3BU5A 4FKQA 4IACA 4FT9A 3SW4A 1NT2A 1AGWA 2EWAA 4O7SA 2VU3A 5BYZA 1OMWA 3FLZA 2Z7SA 2GMXA 3F3TA 4GG7A 2HK5A 5DI1A 3WZKA 4F1OA 5BVDA 5GJFA 4XMOA 3GBZA 3SKCA 4FKGA 4GK2A 4HW7A 4MXAA 5T68A 5F9EA 5DN3A 2UZTA 2Z02A 3H9OA 3E93A 3ITZA 4KABA 3ULIA 2KULA 2ZV7A 4L53A 4RX7A 5L2WA 5HIBA 1OITA 3MJ1A 4XNEA 4TYHB 4A9TA 3M42A 4JIAA 3MH1A 4ZIMA 2B54A 3OMVA 4AW1A 5C4KA 3VNTA 4QTDA 5ETCA 4OBQA 4ASZA 3GFEA 3I0QA 3OXZA 3HP5A 5CLPA 2ONLA 5IH6A 5AAEA 4ERKA 2OU7A 3I7BA 2WIPA 3UJGA 4CKIA 4NKSA 4EWHA 3MH3A 5KBQA 3M1SA 4CFNA 1H07A 3UDBA 4WNKA 1W98A 2PZYA 3E63A 1E1XA 5M07A 2NO3A 2YEXA 3QKMA 5HX8A 4NH1A 3R04A 5FXRA 3BRBA 4AQCA 1OUYA 1O6KA 3CQEA 4JQEA 3ULZA 1OIRA 4AS0A 4M12A 3QTXA 3BLRA 2ITQA 3BEGA 5C01A 2ONLC 4MCVA 3HV5A 3CD8A 4KKEA 4XLIA 3H9RA 3MH2A 4IAIA 2ZV2A 4G31A 5B2KA 5HORA 3TACA 4XJ0A 2I0YA 5CAQA 4F0GA 1TKIA 5J7BA 4QQ5A 3PXRA 3BKBA 3CGFA 4H05A 1XBCA 3BV3A 4I5HA 4QTBA 3ZCLA 3R2YA 4O84A 2AC3A 3IW7A 5IF1A 2NNWB 2R3FA 4NM0A 4TTHB 3MV5A 2E2BA 4HGSA 5JKGA 5CEOA 3NVMB 4RC4A 3JR1A 2J0JA 1DAYA 1PF8A 2GNGA 4IANA 2C6LA 3CD3A 4J95A 3TV6A 3ZM4A 4FKRA 4E5WA 3BBWA 2JKKA 2PHKA 4IX5A 2YIYA 3COIA 3F5UA 5KMMA 1AQ1A 2OIQA 5AR5A 4I4EA 3VUKA 3DBQA 2QR8A 3O0GA 3EN7A 5HU3A 3ORMA 3ORPA 5M09A 3P9JA 4FSUA 4AZSA 4NIFA 5JZJA 5T3QA 3OZ6A 4IVDA 3DAJA 4BDHA 3K3IA 2PMOX 3D14A 1UNGA 2O2UA 3FL4A 4FIEA 1ZOHA 4FOBA 1PXLA 1V1KA 3VUIA 3I60A 4X2GA 3LQ8A 2WOTA 3DTCA 3KB7A 5LMBA 3OP5A 4JDHA 2ZV8A 2BIKB 4FX3A 3R2BA 4OTPA 2WTKB 3ZFYA 2R7BA 3C4ZA 3LXNA 2PYWA 2WQNA 4EHVA 1YWRA 2OF4A 1YHSA 3R0TA 3Q96A 5JFSA 4UMRA 3IW8A 4D28A 2WMSA 2GTMA 2GSFA 1BKXA 2F2UA 3MBLA 4AW5A 2YAAA 5BVFA 4FKIA 2C47A 4D0WA 5IISA 2CKEA 4ZJIA 3RAWA 3HX4A 5K3YA 4DC2A 1L8TA 2JGZA 2UW5A 3D15A 3HZTA 1NVSA 4K1BA 4O91A 3CGOA 2PVLA 3DZQA 3TTJA 5ANIA 4F1TA 2PE2A 1OL7A 4E7WA 2C0OA 3UPXA 2E9VA 2X6DA 1M7NA 3A8WA 2GNJA 3JUHA 1WZYA 1QPCA 5D41A 4A4LA 4K77A 2ITOA 2QKWB 3F5PA 3LXLA 2JC6A 4EUUA 5JZNA 4TWOA 4FEQA 3QZFA 3R83A 4U81A 2XCHA 3Q2MA 3PSDA 4JR3A 2JFMA 2JBPA 4MBJA 1ZRZA 4KAOA 3AC5A 1PXOA 2UZDA 1ATPE 3RHKA 4QQJA 2J5EA 4U40A 3MFSA 2ZM3A 2UW8A 3U55A 3PZEA 2CLQA 3DY7A 4YU2A 3EKNA 4NJ3A 3FAAA 4CLIA 4EOSA 2VUWA 3QA0A 4IAKA 3CKWA 3FXZA 3TKIA 3FV8A 1WBPA 2OF2A 4XBUA 3RK9A 3OVVA 5EDPA 4YURA 3HV3A 4UWBA 3QHRA 4PNIA 1SYKA 3L8SA 3EQHA 5BUEA 4DEDA 3I6UA 4KNBA 4Q5HA 5CI6A 5AAGA 5ETAA 4J52A 3NYNA 5K5NA 3RCJA 2EUFB 2QNJA 3KY2A 5C1QB 5KMIA 3WIKA 3BIZA 3WZEA 3Q9WA 2PZPA 4GL9A 4KBAA 1ZWSA 4AZWA 3NUUA 2OJIA 3R71A 4U8ZA 1WBOA 4RIYB 2G2HA 3QTSA 4I22A 5H8GA 5ACBC 4M14A 1OIQA 3H3CA 3I6WA 4BC6A 4DH3A 4HVGA 3EQPA 5L2IA 3UOKA 4QMMA 2X2MA 2Y8OA 4BZOA 4DFXE 5CX9A 5TOZA 2WQBA 4GIIA 3MYGA 3O8UA 1MRYA 3OUKA 2WMXA 2BRHA 2VO7A 2WTWA 4XG9A 4AT3A 4CCBA 4D5KA 4HNFA 3UIMA 5EI6A 4EC8A 5AV4A 3G6HA 3TV4A 3Q60A 5AIRA 3CSVA 3RVGA 3NYOA 3QCXA 3AC3A 4GS6A 4OTDA 3DCVA 4AGDA 3TDWA 2YM4A 1GJOA 2XS0A 4FTMA 1R3CA 3MY1A 4UALA 5KMNA 5FTGA 2WTIA 4MF0A 3DKCA 4XV1A 3UIXA 5FP5A 3RZBA 3V5QA 4N57A 4UXLA 3LMIA 5CQUA 5K0KA 2PVRA 3HLLA 3L1SA 4TNBA 1BI7A 5HI2A 3UODA 2G2IA 5ETFA 3VHEA 3CQUA 5I4NA 4D1XA 2PUPA 2Z8CA 4WBBB 5J79A 4FT5A 4LI5A 1OKYA 1ZY4A 2BDWA 2C5YA 4CZUA 1YOJA 2F2CB 4H3QA 3BHVA 3REPA 4F7LA 3HRCA 3RAKA 4QMPA 5IQFA 2W99B 4QMUA 4AU8A 4V0GA 2OJGA 5DIAA 3KVWA 2G9XA 3PTGA 3R00A 1UU7A 3HGKA 4OUCA 4YZCA 4BTJA 3AC1A 3C9WA 2HOGA 4PP9A 2VWUA 3UOJA 3DT1A 3LXKA 1XKKA 4IVCA 5J7HA 4PDSA 4FKTA 1PHKA 4RVTA 4JXFA 2PPQA 5G1XA 3ZHPC 1IG1A 3BHTA 4BDBA 3HV4A 4DEGA 3Q9ZA 3DJ6A 2BRBA 5AP1A 1JSTA 4GT5A 3ZRKA 4TYGA 2XUUA 2G01A 2YDJA 2JITA 3A4OX 3DNEA 3F9NA 4G2FA 4GH2A 2PTKA 1I44A 4IB3A 4S30A 4WT6A 4O2PA 5CT0A 1MRVA 4DGOA 4PX6A 4BZDA 4D4RA 3LLAA 4FI1A 1UNHA 3FJQE 2Z7RA 3QTUA 4FKUA 4P4CA 3R9DA 3ZONA 4ACCA 4BCPA 4W8DA 3OUNB 3QQHA 4QP9A 4YUQA 1H1RA 2R0IA 3FI2A 2XJ1A 2XK8A 5EG3A 3ZTXA 4UMTA 4PP7A 3C5IA 4TN6A 5AR7A 1MRUA 4MQ1A 3R1YA 5IUGA 4RWLA 4D9UA 2XNBA 2BAQA 5J87A 5LVPA 2W5BA 5CEIA 5KUPA 2OH0E 3KVXA 4YJSA 2P2HA 2QOQA 1GIJA 1G5SA 3HKOA 4BFMA 5KE0A 3S95A 1OIYA 1Q8YA 1EH4A 1URWA 1BUHA 4OR5A 5AV0A 3RK7A 4JBPA 2XK7A 3FMEA 5E8TA 5E92A 4ZTRA 2W1CA 4BB4A 4PMMA 4EYMA 4ASDA 4MNEA 4CV9A 4NIFB 3IDCA 3R1SA 5GINE 5CEPA 3FZ1A 4N4SA 2WNTA 4G34A 3QQGA 1YW2A 4L9IA 4N6ZA 5ANGA 1FMKA 5D12A 4ZK5A 3DXPA 3A7HA 2XRWA 4ZTSA 5HG7A 3LFBA 1ZARA 3DNDA 4JIKA 4CMOA 4M66A 5D7AA 5A6OA 5LQFA 4BYIA 2R3QA 3A60A 4ZTNA 4YO4A 2CHLA 1JSVA 3ZUVA 2XNPA 3OCTA 4IJPA 2VN9A 4FKPA 2R4BA 2R5TA 5C03A 3II5A 1KE5A 1OB3A 5CU2A 4FKWA 5I9VA 2WO6A 4E93A 2VWVA 4M15A 3TKUA 4DEEA 4W9XA 3DK6A 2BTRA 3KRXA 4FUXA 4PTEA 2JKQA 4LMNA 3ORXA 4O0RA 4FNXA 4FTJA 3R7EA 3GOKA 2IZRA 4GT3A 4IFCA 1KWPA 1UKHA 3UYTA 3ZMMA 5HU9A 5DRDA 5EM8A 4D2TA 3QTZA 3HUCA 4CV8A 5FBNC 4QP2A 3C1XA 3A61A 3NVKI 5IQCA 4AUAA 4RC3A 3ORTA 4DLJA 4R1YA 5C27A 2B55A 4FTIA 4L46A 4Z3VA 3WE8A 2QR7A 4S33A 4EH4A 3BI6A 2C4GA 3GCUA 1P5EA 2BRGA 2J9MA 3JPVA 5CS6A 3VBTA 4EK8A 2VGPA 3FPMA 1NA7A 5M4IA 4OAUC 5AUWA 4GVJA 4IBMA 3GI3A 4FSRA 2WU7A 3P4KA 4TZRA 1MUOA 4D55A 3HMIA 2B1PA 4AFJA 4ENXA 2XEYA 1J91A 1JLUE 5J9YA 4J96A 3G5DA 4YO6A 4CTCA 4ZLYA 4GJ3A 5F20A 2V62A 4RMZA 3PIXA 1Q3WA 1B6CB 3UYSA 1M2PA 1V0BA 1XHAA 3QCYA 4QMQA 3DB8A 4S32A 2QQ7A 3EFLA 2R3MA 4F9CA 5DRBA 2JKMA 2UZVA 5CASA 3D5WA 5HGIA 3AC2A 3VIDA 2CDZA 5JQ5A 3NUSA 2GHLA 2R3OA 4YLJA 3TNWA 3WZUA 3VS5A 4LGGA 5ETIA 2RG5A 3QTWA 1Y8GA 4MVFA 4BDEA 4JQ7A 1NVQA 3DB6A 3HMMA 3OY3A 4HYIA 3ANQA 3G0EA 3QZIA 4FV4A 4FV9A 1REJA 3OCBA 4IDTA 4ANSA 1FINA 3MPTA 2C69A 4EQUA 1H1WA 2BUJA 1YXUA 1ZMWA 2Y0AA 1JWHA 3ZZEA 2VTIA 3QF9A 3CIKA 1WCCA 4B6LA 4MBIA 1SVEA 2CNQA 3OTVA 4BTMA 4G9CA 3QD3A 4ITHA 4GMYA 4CXAA 3NUPA 4C4IA 5LVLA 2B0QA 2I0VA 4ZTHA 2CMWA 2PVFA 4I94A 3F5GA 3RCDA 4J7BA 2I7QA 2J5FA 2HAKA 3L8VA 4EK6A 4KUJA 2BILB 3W1FA 1JSUA 3BHUA 5CZIA 2P2IA 4LYNA 2VTNA 3U4UA 3GFWA 3KMWA 4J71A 5EI8A 3QZHA 1P2AA 4BKYA 1YDRE 3L9NA 5I9YA 5C8MA 2G2FA 4EOJA 1UVRA 4JDJA 4Z9LA 3C51A 4E5AX 2GPHA 5IU2A 3FXWA 3HV7A 4C34A 5EK7A 2PE1A 4RQKA 3F3VA 2I0HA 2WEIA 3ZDUA 3U87A 2W0JA 2CLXA 3R6XA 5HESA 5CAVA 1Q97A 4U3YA 5HG5A 1UKIA 3I1AA 3UVRA 3GC0A 4C2WA 3SG9A 5EYMA 4U41A 3NZ0A 5E90A 3BHHA 4V0GB 2C6TA 3GCPA 3HMPA 2W1EA 3TNIA 4JBQA 4W4YA 3A7FA 3E88A 4EI4A 3D7TB 3H9FA 3PIYA 3MN3A 1U46A 4U97A 2R9SA 2EXMA 3AXWA 5HX6A 2JIUA 4OGRA 4DFBA 3DA6A 5LJJA 2JEDA 3KXGA 3R63A 2XNGA 5TT7A 5FXSA 1LEWA 1YVJA 4L45A 1BMKA 4RRVA 4N70A 3OD6X 1CKPA 2BIYA 3H0ZA 4ZSGA 4FTCA 4O7WA 4K9YA 3W2SA 5KMKA 5ICPA 3OW4A 1GAGA 1GOLA 1XR1A 1H1SA 3GEQA 4WNPA 5A3XA 2QOCA 4C4FA 4FVPA 2IW9A 3UO5A 4OT6A 4MXYA 3P08A 5CXHA 3JS2A 3OG7A 1LP4A 2JDSA 4J97A 5DHJA 5KX8A 3UQCA 1YXSA 2QD9A 5BNJA 2R3LA 2V7AA 4FSMA 3PXFA 1ZYLA 4AG8A 2R64A 5EM5A 4I4FA 4AE6A 4C58A 1LPUA 2GS6A 5I0BA 3HVCA 4OTIA 3PPJA 3OWJA 3UP2A 2W1IA 5DG5A 3IW6A 2XEZA 4RPVA 4NYEA 2HZNA 4LGDA 4O38A 4MWIA 3FKNA 3VAPA 4BKJA 3K2LA 4C62A 2IN6A 3GVUA 2W9ZB 3KF7A 5HG8A 4DGLC 1VJYA 4AW2A 3LZBA 2UZEA 3EHAA 2XP2A 3FZSA 3QFVA 4UBAA 5ANKA 2B53A 2ZDUA 4DE4A 3DAEA 3WF5A 4CMTA 4FSWA 3FEGA 4EONA 2KTYA 3PIZA 3QRKA 3VBQA 5BVEA 4MNEB 3ZXZA 4MTAA 5HO6A 4AXAA 3W33A 3R8MA 2RFDA 5DMZA 5HLNA 4YC8A 1YOLA 2WZJA 3A7GA 4KIQA 2B52A 1KUTA 3G6GA 4NM7A 3UOHA 1IA9A 4Z16A 3JY9A 1R0EA 4ACMA 4ZY4A 5BMSA 3Q32A 3VQUA 1W82A 4CCUA 4EOPA 2NRYA 3EFWA 5FLFA 2FO0A 3F2NA 4Q9SA 5DEWA 5A54A 3PXKA 5CSHA 2WMVA 1DAWA 3I0OA 1GY3A 3ETAA 2DYLA 2R0UA 4L43A 4CT2A 5HTCA 3F61A 5CF5A 3Q6WA 4WHZA 5KHWA 3KXMA 3BLQA 3I81A 3PWYA 3QX4A 2QVSE 4USDA 2QC6A 4K8AA 4WG3A 4C38A 3AQVA 4YJTA 4YHFA 1YDSE 3QWJA 2YIQA 4C0TA 5GZ8A 2YWVA 2GCDA 1DI9A 4L42A 3AT3A 5E91A 4DG0E 2QODA 3NNVA 3TKHA 2QOIA 3D2KA 1XH8A 4AN2A 4F9BA 4XP2A 4U9AA 4RJ5A 5JH6A 3NLBA 1YWNA 3WARA 5I9UA 3BE9A 2X9FA 2XNNA 3GENA 2BRMA 4NSTA 4IM3A 5IQDA 1TQMA 1JBPE 3DTWA 2W05A 5IQHA 3UO4A 3PVUA 3UO6A 4YZMA 3MWUA 2CGWA 5FEQA 3LAUA 2VTTA 2WELA 1M7QA 3DKOA 4N0SA 4NJDA 4S34A 1YDTE 3PWDA 3NUYA 3NUNA 4XH6A 2OJ9A 4GU6A 3NYXA 1XH6A 4JOAA 3W2PA 4RLKA 2YCSA 3ET7A 3W18A 3EFJA 4GFGA 5FDXA 4ZTMA 5HKMA 3IS5A 4F65A 1OKVA 3F69A 1OBDA 5KMOA 4O6LA 4RIXA 3W2CA 3OTUA 5HTBA 4FKOA 3MS9A 4AZTA 3Q4CA 5CXZA 2RL5A 4QYEA 1O9UA 3AT2A 2XK6A 2F9GA 4M0YA 3V8TA 2XA4A 4LL0A 4NU1A 3EQCA 2G15A 2H96A 4QMXA 4FIJA 4CYJA 2UW6A 3EQDA 4RA5A 4RFYA 2BROA 2XJ2A 5M53A 3DJ7A 5TKDA 4BCOA 1JQHA 4BR3A 2QOFA 1WBVA 4IIRA 4X6RA 1WVYA 4A9YA 1W84A 2F57A 4YC6A 4DA5A 4U79A 4HVIA 4DFUA 1WBNA 4YTFA 2W9FB 5JN2A 4BI1A 4C3PA 5GJDA 3LFNA 2X39A 3DDQA 2ZJWA 4WIHA 4F08A 3EYGA 3AGLA 4U44A 1AD5A 4DG2E 4EEVA 1H8FA 2WAJA 4ZTLA 4E26A 3IGGA 1GNGA 2VD5A 4JDIA 3R7UA 3A7JA 2YJSA 1GZKA 2P0CA 3TTIA 3NGAA 3RALA 2E9UA 3ZBFA 5HD7A 3PPKA 2FUMA 3VS4A 4EOOA 4RFZA 3VUDA 3QXOA 4DH5A 2J0LA 1IR3A 3QRUA 5A4EA 2H6DA 4MNFA 4AZVA 2G1TA 5HHWA 4MF1A 2BKZA 5E8SA 4AOJA 5AP0A 3LE6A 2R7IA 4O7VA 4PNKA 3OT8A 3PVGA 5HTIA 1H1PA 4JJRA 4WNOA 4OTRA 4X2KA 4IX6A 4YSMA 4RC2A 3R8PA 4OTGA 2Y4PA 5CALA 1MP8A 3COMA 3HL7A 4J8NA 4FZ7A 4JNWA 4FTRA 5K9IA 4A4OA 4FG9A 3E64A 2WQOA 3JVRA 3EN5A 3ZH8A 4GFOA 1NVRA 4I0TA 2BR1A 2QOOA 3E8DA 4PDOA 1JKLA 5ANJA 2JFLA 4FR4A 3MGYA 4GV1A 4HVSA 3ZC6A 3T3VA 4ANLA 1YQJA 3RP9A 1U5QA 2Q0NA 2WFYA 1NXKA 2CN5A 5FM3A 4LRMA 4BTKA 3R28A 5A4LA 4I23A 1IAJA 5LWNA 4DITA 4FEVA 4O0UA 4E4LA 4FVQA 4PWNA 2XBJA 4FSQA 2W7XA 3DPKA 3ZM9A 4O0VA 3NUAA 3OROA 3SRVA 4KD1A 2GFSA 2JD5A 1QL6A 4D5HA 1UU8A 5J5SA 1UU3A 4QRCA 1YI3A 3WZJA 2UZBA 4R78A 3D94A 4PMSA 4EORA 4USEA 5AFVA 4KIPA 2V5QA 3ZU7A 5CSPA 3AT4A 4O1OA 3P79A 3S4QA 4ZJVA 4JL9A 4DG3E 3I5NA 1Q8ZA 2ACXA 3TCPA 3KCFA 3LFCA 5FM2A 3KREA 4QTCA 2J51A 2F7EE 1PXJA 4PPBA 4Z55A 4CFMA 3LW0A 1J7IA 3DU8A 5I3OA 3QQFA 3L9LA 1SNXA 2J0IA 2WTCA 2YHVA 4AT5A 2HW7A 1ZMUA 2PSQA 2ZM4A 4PDPA 3UG1A 5A9UA 4L44A 1OL6A 3T9IA 3FMKA 5FG8A 3R7GA 4G6OA 4BWXA 4IEBA 5M56A 3TUCA 2HZIA 4X0MA 2NP8A 4KIOA 1MQ4A 3E87A 4YBKA 4IFGA 2RF9A 3Q52A 5GIPE 3BBTB 3ZLXA 4BDAA 3HYHA 2XMYA 3DXNA 1ZYJA 4E73A 4I3ZA 2W5HA 5JK3A 4FT7A 1M2RA 2VAGA 2W4KA 4M68A 4DFYA 5FEEA 3LFFA 4FSTA 3VULA 3Q53A 3FLQA 5KNJA 3EQFA 2X8IA 5AAFA 3Q6UA 2JBOA 2R3IA 2ZDTA 3CTQA 4RLLA 4ZLZA 4ANBA 4E3CA 3NNWA 2AUHA 4YTCA 4G3EA 3GC9A 5L2QA 2VWBA 5CWZA 4FL3A 3UNJA 2QLUA 2OH4A 3VUHA 3R8ZA 1ZMVA 2VTSA 3OEZA 1YKRA 4ALVA 4FSNA 3QUEA 4EH3A 1ZOEA 4AOIA 4ENYA 4L52A 3E8EA 3UVPA 2YM5A 4IMYA 1QMZA 4L00A 1H01A 4HCTA 3MVLA 3PE2A 4YJRA 3HEGA 3R1QA 5AP7A 2GU8A 3IONA 5CSWA 3E7VA 2BCJA 5AR2A 2C6MA 5TF9A 5K0XA 3KQ7A 2CGXA 2CSNA 3NPCA 3N4UA 5IDPA 1QCFA 4I92A 3MB7A 4RVMA 3RGFA 1OKZA 3QD2B 3OWPA 4A06A 1X8BA 1CKIA 2P3GX 4BDGA 2Y4IC 3QXPA 5HEZA 4YJVA 4LM5A 3SOAA 3RAIA 2XBAA 5E9EA 2OIBA 4GUEA 2XRUA 4HZSA 2V0DA 2BZKB 2RSVA 5G6VA 2OXXA 1YXXA 4AT4A 2C5NA 2A19B 3ZSHA 4ZS0A 3SOCA 4E20A 2J2IB 4FODA 4BDJA 5J1VA 2CNUA 1BI8A 3O23A 4CG8A 3U51A 4TPTA 2YM3A 3UIUA 2QG5A 3OCSA 3CJFA 4RIXB 4LOQA 2OJJA 3F88A 4IADA 5CNOA 4WO5A 4KWPA 5L3AA 2WTJA 3HAMA 4QMVA 4IQ6A 2RFEA 2HXQA 3GB2A 3P23A 5KBRA 3SAYA 5EQPA 3CKXA 1KE6A 2W1DA 3C5UA 5HD4A 4MXOA 4QT1A 3LXPA 4CLJA 3FUPA 1IASA 3RWQA 3VUGA 3MIYA 4QMNA 3W8QA 3T8OA 5IMXA 3EMGA 1OVEA 2WOUA 4ACDA 3F7WA 1BL6A 3IECA 2YFXA 3R30A 1RQQA 1ZY5A 4FF8A 1OKWA 1OUKA 4YLLA 4NKAA 3TIYA 2GNHA 4DAWA 4X2FA 3UQGA 4BCQA 4F0IA 5HLWA 4FV3A 1JKTA 4EK3A 3SV0A 5IH5A 3P7AA 4QMWA 5IUIA 4F99A 4K18A 4WD5A 3RJCA 2XK3A 3EQBA 4QMTA 4DGMA 4JDKA 5CZHA 1Q41A 4OBOA 3PG3A 4DTAA 5CEMA 3OCGA 3A2CA 4XRLA 3K5VA 3TJCA 3V5TA 4YC3A 1KE9A 4FV6A 3R9HA 4U0IA 1KSWA 2YCFA 4I41A 4IVAA 2X4FA 3UE4A 4EZ7A 2QOKA 2X7GA 4XG3A 3MFTA 4NZWB 3PG1A 4J8MA 2UVZA 3GP0A 2GNIA 3BX5A 1Q3DA 2Y6OA 1GZOA 2CKPA 3C13A 3TXOA 1UNLA 2C6EA 5CENA 3ODYX 4BRXA 5HO8A 5AJQA 5AA9A 4EWQA 4I5PA 4QYFA 5FTQA 1GIIA 1YI4A 4BBMA 2C3KA 1BLXA 4WUAA 1Q8UA 2XK9A 3BHYA 4JI9A 5CEQA 3TG1A 2VWXA 5BMMA 5FUTA 2ETRA 3GCQA 4CFVA 4QPMA 3OFMA 1YWVA 4TYEA 3R9NA 2J90A 1R78A 2IZTA 3KCKA 2OFVA 3OC1A 3QQUA 3GNIB 4A4XA 3MPMA 4R8QA 3PLSA 2OK1A 4OT5A 3KULB 3UOLA 4Y8DA 1G8AA 4QP3A 4QP7A 2QKRA 3RWPA 3R7YA 3CP9A 5IUHA 4IWQA 5CY3A 5DBXA 3KMUA 4I20A 3FSKA 3FQEA 3UNZA 4W4VA 2BRNA 2UVYA 3VQHA 1Z9XA 5DYJA 3SRVB 4I1ZA 1M2QA 5BQ0A 4EK4A 5JFWA 2ZMDA 2Z60A 4IVBA 3W16A 2CKQA 4M84A 2J7TA 3ZBXA 2XIRA 3GU6A 3PA5A 4FKJA 1IEPA 3ANRA 3HV6A 3EWHA 4DHFA 4D4VA 3D7TA 5EW9A 3BV2A 4O0WA 3HDMA 4AGUA 5AX9A 4FBXA 4K11A 3MTLA 1FQ1B 2X8EA 2WPAA 4KSQA 3U4WA 4ANQA 4BDIA 4DFLA 1H28A 2HWPA 3G90X 3PP1A 3BGPA 4O0TA 3A62A 2C5VA 3ORLA 2XIXA 2Q83A 1S9IA 3QUPA 3BEAA 1ZOGA 3WIGA 4CFWA 4FGRA 4GK4A 3GCSA 3V5WA 1RW8A 2R3HA 2OZAA 1PJKA 1P4FA 2PZIA 5LCKA 4EHEA 2CN8A 4EBWA 5AWMA 3TV7A 2B9FA 3C4CA 3TZ8A 3RINA 3FZRA 3H10A 2FYSA 3FI4A 4R3PA 4A9RA 3DOGA 3ZS5A 4MEDA 2WHBA 3DJ5A 3QGYA 2QHMA 5H8BA 3UIBA 2C30A 3VO3A 5M51A 1OBGA 3ALNA 3E62A 3P5KA 4DEIA 5C8KA 3IK3A 2E9PA 4ITJA 5AP4A 2YAKA 3FHIA 4RX9A 4MD7E 4DN5A 4BZNA 3SC1A 3TUBA 5DR6A 4E6QA 3QQLA 2CGVA 3BWFA 4F7JA 3EN6A 2GNFA 3AD4A 2PUIA 4FTUA 2HCKA 2VTRA 2IVSA 4V01A 4BIBA 3RI1A 5HO7A 4IB0A 5DEYA 1LR4A 4O81A 2BMCA 1OL5A 3NS9A 5EHOA 3OY1A 5ITAA 3F2RA 4RWJA 4OTWA 4PPAA 3UMWA 4A9SA 3ORIA 3ZFMA 3C0IA 5IA3A 3IG7A 3ZZWA 4NCTC 5FGKA 4DTBA 3ZO4A 2IW8A 4BDDA 2Y4IB 1YXVA 3EN4A 4HJOA 2XVDA 5DPVA 3ZOSA 1V0PA 1U4DA 2IVUA 3QC9A 4QPSA 4E1ZA 1LUFA 5EQEA 2QOLA 2HZ4A 4UWCA 5DGZA 3W32A 4DGGA 1Q8WA 1FMOE 4JVGA 4ZZNA 5HBEA 4W4XA 5HE2A 2FSMX 3DQXA 4KSPA 3SGCA 2WMTA 1P4OA 1KE7A 2W1HA 3KFAA 3VBVA 4FKLA 4BI0A 3QWKA 2BHEA 3DQWA 3QQJA 5GZAA 4MHAA 4BGHA 4DFZE 5K4IA 2W1ZA 1H08A 3ACKA 1YRPA 3O7LB 4ACHA 2ZB0A 4BIDA 1JPAA 4ANNA 4QO9A 3VBXA 4Z7HA 4U43A 5IA4A 2VTAA 1W7HA 4YSJA 3KMMA 5D9HA 4CYIA 4NW6A 4RJ6A 2WMQA 3NW7A 4L7SA 3W55A 4NM5A 5FDPA 4HYHA 1IRKA 3PXQA 4XV2A 2PUNA 3QLFA 3OEFX 4X7QA 3D7ZA 5E8YA 2ZV9A 5IZFA 3UC3A 4ZZOA 3QUDA 5D11A 4O96A 4F1MA 3U9NA 4XOYA 4EJ7A 4E5BA 4QD6A 4AWIA 5E8VA 4CVAA 3I7CA 3C50A 3POZA 1Q8TA 4YJUA 4ZSLA 2QHNA 3GGFA 1ZZ2A 2F7ZE 1K9AA 3BYVA 4U45A 3EFKA 3QLGA 5AR4A 2X0GA 2C0IA 3SXRA 3UQFA 1CM8A 3F6XA 3IGOA 5AP6A 3PY1A 2ZB1A 3HAVA 4O27B 4FL1A 3W8LA 5HG9A 2VZ6A 3P7BA 5CYIA 5HZNA 2IO6A 3ALOA 2CPKE 2UZNA 2E9OA 5CVHA 4ZY5A 5JFVA 2VNYA 3VHKA 3R01A 4RJ8A 3DFAA 2QURA 3O50A 2C5XA 2YWPA 3E7OA 1BX6A 5AM7A 5AA8A 3GQLA 3DK7A 4UX9A 3EL7A 3PY3A 1H4LA 3LFSA 4XUFA 4YHTA 5L6OA 3AD6A 1FVTA 5CVGA 5DOSA 4EZ3A 5TO8A 2GHGA 3BYUA 4IAZA 5DR2A 1ERKA 1O6YA 4GYGA 4RSSA 3KGAA 3O7LD 3NRMA 3QTIA 5CF4A 3NIZA 3TZ7A 2ITUA 3AGMA 1WVXA 3SDJA 3KU2A 4AZFA 3IDPA 2GDOA 3DV3A 3DZOA 4WSQA 5AMNA 3VVHA 3B8QA 5IA2A 3H4JA 2XF0A 4RZVA 2XB7A 3PXZA 3VN9A 5LMAA 3FZPA 3G2FA 4FTKA 1P14A 2BZHB 4D2RA 3WOWA 4FEWA 4XBRA 4CQGA 5KMJA 4APCA 5AUVA 4XV9A 4Q5EA 5ACKA 5BX0A 4FYOA 3S2PA 2VTHA 1ZYCA 4UXQA 4Y5HA 4O0XA 1W0XC 4MKCA 3LQ3A 2PUUA 3HMNA 3CY3A 3H0YA 4QMYA 4RA4A 5HIDA 2HWOA 4Y95A 4ZZMA 1TVOA 4ASEA 4H39A 3UZTA 3M11A 3MESA 3ROCA 2O64A 3FLSA 5CAPA 2GQRA 3FWQA 1W83A 3PSBA 2UZWE 3KRLA 3LCKA 4I6FA 2WTVA 4FUYA 4H1MA 4RFMA 2VX3A 3Q3BA 2JAVA 3QGWA 4QQTA 5JGAA 3F5XA 5D1JA 5HCXA 2OWBA 2VTPA 1PXNA 4FEXA 1CKJA 4G6NA 4B9DA 3D9VA 1OECA 2BAJA 4M3QA 4MK0A 1R39A 1RE8A 3GQIA 3OBJA 3NNUA 5ANOA 3IQ7A 4G3CA 1APME 3VW6A 4EOIA 5EW8A 4AA5A 3NYVA 2IWIA 4IB5A 4R6VA 4AACA 3D2IA 1ZYSA 2YCQA 3KRJA 3MSSA 4MH7A 4RWIA 4IAFA 4C2VA 2F49A 2W4OA 4P2KA 5FQDC 4D2VA 3SD0A 2YLEA 2BTSA 4BDKA 3CBLA 5HICA 2VTMA 2R3PA 3AMBA 3LM0A 3PFQA 3RK5A 4BWPA 3HUBA 2IZSA 2WIHA 2ITNA 4KA3A 1ZLTA 3EQGA 1Q5KA 3L8PA 4XOZA 3RPRA 2HELA 5IEYA 4AFEA 2OBJA 4U42A 4CFFA 2A4LA 4Y85A 4X3FC 3IOPA 5DR9A 5LMKC 4TY1A 1IAHA 2OZAB 4PPCA 1H0VA 5AX3A 2HW6A 3LMGA 3LFQA 3QKKA 3VS0A 4CZYB 4EOMA 4O7ZA 1YHWA 2WMUA 3PJ3A 5IQGA 3NSZA 4TW9A 4EHZA 4GRBA 3V04A 4IWPA 4E4NA 2AYPA 4FIHA 3PJ2A 4JT3A 2VX0A 3G0FA 4BI2A 1S9JA 2JDVA 2C6KA 2RGPA 4GKIA 5IA0A 1UA2A 2YLFA 4C35A 4W8EA 2C3IB 2DWBA
chains in the Genus database with same CATH superfamily
2XK4A 3IKAA 4FZ6A 3BE2A 3WBLA 4CKRA 4E4MA 3C4XA 3QA8A 3CXWA 5C26A 2J0KA 4FIFA 4IXPA 1REKA 4FNZA 4YJNA 5CNNA 2BKKA 3GCVA 2XNOA 4H36A 4FOCA 2F4JA 2VTJA 4U80A 4BVUA 5F4NA 5JT2A 1UU9A 1NW1A 3VJOA 2R3GA 1OZ1A 2VRXA 3MIAA 1ND4A 3DK3A 4A9UA 4LGHA 3N4VA 2OZOA 4M0ZA 4QMSA 4C3FA 5A4CA 3EIDA 3FYKX 4NUSA 4CQEA 4Y46A 1Y6AA 4IH8A 2FB8A 2FVDA 4RJ3A 1JAMA 4HZRA 4TNDA 2C68A 4BHZA 2VNWA 3O2MA 3VRZA 4K0YA 4RJ4A 3NCGA 3MY0A 4TXCA 3Q4ZA 2OO8X 3HRFA 3QD4A 5ANDA 4A7CA 5EOBA 4ALWA 4C4JA 3UDZA 4YNOA 4O7RA 2ZMCA 5AP3A 4G17A 2YJRA 2V55A 4Y72A 3NW6A 4JBOA 4LUDA 5AV3A 4IM2A 5KO1A 5CI7A 1PY5A 1PMNA 4FTLA 4DEAA 5H9BA 4RGJA 3QD0A 5L6WL 1Q61A 2YA9A 1FOTA 3AG9A 3TDVA 2QOBA 3SLSA 3LKMA 2OGVA 4RG0A 3LCSA 5BVWA 4WA9A 4TRLA 4C61A 1JVPP 5GNKA 3LFDA 1A9UA 1I09A 3COHA 4S2ZA 2ITVA 2GHMA 4G1WA 3A4PA 4TWNA 1CSNA 5L6PA 2CNVA 3QL8A 4EH7A 4GT4A 2V7OA 3DFCB 4IAYA 5FWKK 4FV7A 4RIOA 4Z7GA 4BCIA 1B39A 5L8JA 1A48A 3D0EA 4F6UA 2Y9QA 3KN5A 1K2PA 3CTHA 3ID6C 3SX9A 4BCJA 4BYJA 2OG8A 2YIWA 1F3MC 4FGBA 4JLCA 5CANA 1OPKA 4XS2A 5CVFA 1VYZA 2XIZA 3LVPA 2R3RA 2FH9A 1YOMA 4DT9A 2QU5A 5JQ8A 2ETMA 2X2LA 3GU8A 4PY1A 3UC4A 3PA4A 3WZDA 1XQZA 5LARA 4MXCA 3JY0A 3MVJA 4V05A 4C33A 4LG4A 4QYHA 5B2LA 2FSTX 2XKCA 5F1ZA 1FVRA 2B9IA 4IJ9A 1OGYA 4QNAA 3LMHA 2O5KA 3LM5A 4YZNA 4G6LA 2XCKA 2HYYA 5CSVA 4XHKB 2PZ5A 3LFEA 4G5JA 3B2TA 4IE9A 1KOAA 3MA6A 4YZBA 4D2PA 3MFUA 3QALE 3UVQA 4UMUA 2O0UA 4X6QC 5L8KA 3TMOA 4H1JA 3Q4UA 4XG4A 5AUZA 5EM7A 3ORKA 2ZAZA 2FSOX 4E6AA 4XG2A 5H8EA 4EH5A 3BYMA 4K33A 4CG9A 1PMVA 4FIGA 4I6BA 4PTGA 1J7UA 5HLPA 5IQAA 3Q5IA 3MDYA 3KIOC 1XMLA 2Y6MA 4X2NA 3W2OA 4RT7A 2HY0A 4PL3A 1G8SA 4IZ7A 4PUZA 4RQVA 2EB3A 1PMUA 4TKSA 4E6DA 3V5JA 1VEBA 5LOHA 5LXMA 5M4FA 4UZHA 3R8LA 5DT3A 3R21A 1G8JA 2YCRA 1XH7A 5GZ9A 1PXPA 3IW4A 4F9YA 2JLDA 3HRBA 4FKVA 3UPZA 5IEXA 4MX9A 4ZTQA 1FBNA 3VF9A 2QCSA 3AMYA 2X8DA 3NFGB 4JAIA 4L7FA 2W4JA 3L9MA 4M69A 3K3JA 4IZ5A 5HNGA 5AADA 5BVNA 4QP4A 4XCUA 5FP6A 5FTOA 2CCIA 1OPLA 3K54A 4DHZA 1ZYDA 3DLSA 3P7CA 3L8XA 4AN3A 4C8BA 2UV2A 4BCHA 4G3FA 2OKRA 2FGIA 4I0RA 3PRFA 1U5RA 4AGCA 4RZWA 4IWOA 3AD5A 5HNBA 3PJ8A 3DAKA 4X3JA 4FSZA 3KULA 3CR0A 4BDFA 3KXNA 5J9LA 5C8NA 3NIEA 3DLZA 1U54A 2HIWA 3GOPA 2PMNX 3MFRA 4O4CA 3PVWA 5CF6A 4GU9A 4CSVA 2QOHA 3TEIA 3TZ9A 1JKSA 4GJ2A 5IQIA 5KKRC 4BTFA 1JOWB 4AA0A 2WQEA 4FNYA 5HE0A 3S1HA 3O5AA 4BWKA 2O8YA 1PKGA 1Y6BA 1XWSA 3BQCA 1PW2A 3FMHA 1XJDA 4FRFA 5DLSA 3VF8A 4CTBA 4F78A 4C4HA 1H24A 4L01A 5K5XA 5GHVA 2WB8A 4W4WA 5CU3A 4D4YA 3O8TA 3W0QA 1H1QA 3M2WA 3NR9A 2XKFA 2PU8A 2XKEA 3LCOA 5I9WA 3QZGA 2ERZE 3CY2A 2PL0A 3OWLA 3LOKA 3PUPA 3OHTA 3UBDA 3R02A 2W5AA 5I3RA 3PLAE 1PXKA 2NPQA 2XYUA 4OTHA 3QCQA 3R7VA 5TR6A 2YABA 3KEXA 4KBKA 1WBWA 2JDRA 2OXYA 4DH1A 3QC4A 2PY3A 3EJ1A 4AZEA 3IOKA 3VUTA 4FEUA 4F6SA 4DHIB 4OTQA 3BGQA 5GIOE 3CPCA 2RFSA 2XKDA 4YTHA 2ITYA 2PVKA 4HNIA 4ID7A 4DT8A 3FQSA 3QRTA 3LQ5A 4IWDA 4F7SA 4QQCA 4W9WA 4YJPA 3WYXA 4GKHA 3O71A 2EB2A 4IM0A 2WMBA 1E9HA 4U7ZA 2UW9A 3ERKA 4QMOA 4E6CA 4E4XA 3AOXA 4ORKA 2WTDA 1XH5A 4GCJA 3KA0A 3NUXA 3DDPA 5HOAA 3DXQA 4YPDA 3ZLWA 4IC8A 4J53A 4CD0A 3QRJA 3TL8A 5B0XA 4D1SA 3O8PA 4JRVA 4QNYA 1G3NA 3MY5A 4IX4A 5FD2A 3QU0A 2Z7LA 2CKOA 3GT8A 3PSCA 4CMUA 3NWWA 4P5ZA 1Q24A 2OICA 3BWJA 3ZRLA 3W0PA 1FGKA 3ZDIA 1OL1A 3SA0A 2XIYA 2WKMA 3TZMA 2WU6A 3CTJA 3VS2A 3TI1A 1PMEA 4KS7A 4R7BA 1YHVA 3KC3A 3FLYA 2W17A 2JAMA 2OJFE 4GEOA 1K3AA 3ELJA 2WMAA 1TZDA 2A0CX 2B9JA 3FC2A 4XG7A 4GFMA 4B8MA 4DH8A 3P5JC 2QO9A 2UW7A 2YZAA 5BUIA 3ORNA 4FT3A 2VWIA 4B99A 1FPUA 3KL8A 3EN9A 1BYGA 4YPSA 4L8MA 4ZEGA 4C4GA 2JIIA 5L2TA 4O7LA 3R8UA 2QONA 3ZEPA 4L3LA 4FTQA 4DLIA 3UMXA 5M06A 3LPBA 4GIHA 2O63A 1DM2A 3QYZA 4PRJA 2JIVA 5CU0A 4O7YA 3F66A 2UW3A 4FYNA 2BVAA 2J0MB 1O6LA 4O1PA 4FMQA 2WXVA 1JKKA 5DFPA 4I24A 3IDBA 4ONAA 3LCDA 3RNYA 4D2WA 4K6ZA 1J1CA 3BZ3A 4FE2A 3NMUF 2H34A 4Q9ZA 1XBBA 4IX3A 3SXSA 5J9ZA 3Q5ZA 5TE0A 4QP6A 4PL4A 4ANMA 5BUJA 5AUYA 4ACGA 1QPJA 4E8AA 1XO2B 2GTNA 2UZOA 3I79A 3FDNA 2C3JA 1TQPA 3TNHA 4DCAA 1OL2A 1KV1A 4LL5A 4QTAA 3U9CA 4OAVB 3MW1A 4PV0A 3RAHA 4EK5A 5DVRA 2CJMA 2ESMA 3MVMA 4UEUA 3DBCA 4FV5A 2PMLX 4EL9A 3C7QA 2XZSA 4IZAA 3C4FA 3GU5A 5E4HA 4KB8A 4MD8E 2UZLA 3ZXTA 4CFUA 4EOKA 5AP2A 3THBA 3FE3A 4YBJA 2PZRA 2ITTA 4GVAA 2HXLA 3ZUTA 4ITIA 1PKDA 4M7IA 2VO3A 4O86A 3U6JA 4ERWA 3O51A 3PYYA 5LVMA 4EYJA 4FICA 4LV5A 5E8UA 4ZSEA 3UTOA 4ZMEA 4UYAA 3NEWA 3ZRMA 4AAAA 2YM8A 3DKGA 4MQ2A 2I0EA 3LCTA 4MD9E 3COKA 3DBEA 3RZFA 4F7NA 1UWHA 3PPZA 2IVVA 4UYNA 4USFA 3ORZA 2B7AA 4FL2A 1U59A 2XIKA 2YITA 1R0PA 3BCEA 3CE3A 4L68A 4RIWA 4ZP5A 5ANEA 2C1AA 3CCNA 1WBSA 5L4QA 4M69B 4Y83A 3SHEA 3RM7A 4F4PA 4JAJA 5CF8A 4LRKA 4CRSA 3EQRA 4FG7A 4FSYA 4BIEA 5KKRB 4R3CA 3Q04A 4HVHA 3A99A 2I1MA 4TT7A 1Y8YA 3EOCA 4APPA 4BL1A 1NY3A 2WMWA 3LFAA 3KRRA 4UB7A 1OPJA 4FG8A 4P90A 1DS5A 3CJGA 4H3BA 1CDKA 2ETKA 4WKQA 4O83A 3NAYA 3RPSA 3OXIA 3NAXA 1U54B 4IHPA 3F3UA 2BFYA 2VTLA 1M14A 3PVBA 1ZXEA 2IJMA 2QLQA 5HE1A 3E3BX 2OLCA 2C6DA 3RHXA 4QYGA 4BCGA 2RIOA 3UG2A 5AV2A 1J7LA 4XRJA 4FC0A 4FKSA 1TQIA 5IQEA 4I6HA 1ZZLA 2AQXA 2PVYA 4FIIA 3TT0A 4EHGA 1OI9A 3FSFA 5KHXA 4HGEA 4YR8A 4CRLA 3FC1X 3FMLA 3V5PA 4HVDA 4EBVA 2IVTA 4L6QA 1M17A 1OIUA 2QI8A 3TWJA 4AE9A 2EXEA 1YXTA 4MWHA 5IEVA 4HYUA 3QTRA 3V3VA 1SM2A 3P0MA 4XX9A 2EVAA 1T45A 4ZMFA 4II5A 3ZYAA 4RJ7A 4DINA 3FYJX 2ITPA 3VS6A 1ST0A 2RKUA 4HPTE 4NW5A 4O0YA 4WG5A 4BCFA 2OXDA 3KXHA 3R7IA 4UV0A 2ITXA 5JMSA 5EHLA 5A6NA 4NM3A 3LJ0A 5A4TA 3PDTA 4BCNA 4JQ8A 4IDVA 2V22A 5KZ0A 1FGIA 4FTTA 5L8LA 3EZRA 2YIXA 3BYSA 4H58A 3ZUUA 4B8LA 5KCVA 2UVXA 4HCVA 3GU4A 4XP3A 3FMMA 4NCTA 4OLIA 5CAOA 3MTFA 2R3KA 5AM6A 1URCA 1HOWA 3I5ZA 3NX8A 4F6WA 4UY9A 4PDYA 4G3GA 3U6IA 1W8CA 4IAAA 4C02A 4D1ZA 1LEZA 4YJOA 3CLYA 2Y7JA 4M8TA 4NWMA 3MH0A 5LWMA 5EOLA 2BFXA 3R22A 2XNEA 4FVRA 4HOKA 4O4EA 5CU4A 5A14A 4LOOA 4IC7A 4WSYA 4QP1A 3UZRA 4C57A 3G9LX 4Y5QA 2LAVA 3U6HA 3PJ1A 4PTCA 3ZLYA 2W1GA 2C5OA 2WEVA 4NTTA 3V6RA 2DS1A 2AC5A 2HY81 1B38A 3I4BA 2WGJA 3MPAA 4EH6A 2Q0BA 3UGCA 2X2KA 3G9NA 4WG4A 4FZDB 3NCZA 1PXIA 1E1VA 2UW0A 5LVNA 3WE4A 3FXXA 3Q4TA 2X7OA 3A7IA 4XLVA 4A07A 2VGOA 2XALA 4FK6A 4NTSA 4UMPA 2Z7QA 4LOPA 1A06A 2HENA 2R3NA 4I5MA 3P86A 5AR8A 5HIEA 5HNIX 2VWZA 5J95A 3KN6A 2ZM1A 4AXEA 3NW5A 2I6LA 4KIKA 4YGAA 3E5AA 4G3DA 1OM1A 3R8VA 4CT1A 5M57A 3FLNC 3IW5A 4I21A 4RX8A 3RTPA 4AA4A 3RMFA 4AGWA 5HQ0A 2ZFYA 4PF4A 1F0QA 3PXYA 4HCUA 1GZNA 5JGBA 5CU6A 3MJ2A 2LGCA 3WI6A 5HVKA 3RPOA 3C0GA 3AMAA 3ZLSA 4X2JA 3GC7A 5AEPA 3HECA 5FBOA 3VS7A 3KRWA 2WQMA 1UV5A 5A46A 3ZSGA 3OS3A 4F63A 4UMQA 1Z57A 5JSMA 3BQRA 3JVSA 1PRYA 3WF6A 4DEBA 3UDTA 2PE0A 3Q2JA 2QG7A 4J98A 2VTOA 3R7OA 4F0FA 1WVWA 3T9TA 3QBNA 5IA1A 3BELA 2FSLX 4DTKA 5FEDA 3FPQA 4XEYA 1CTPE 4QMLA 2A27A 4IB1A 4UN0C 5AR3A 1XBAA 3HDNA 5AUUA 4C59A 4C37A 4CKJA 4C4EA 2X4ZA 2BHHA 3SQQA 2VTQA 5CAUA 5EI2A 5CQWA 1WMKA 3T3UA 5BYLA 2H9VA 3C0HA 4J99A 3L9PA 3TIZA 1KV2A 4BKZA 3FI3A 3CEKA 4AN9A 2REIA 3ENHA 2PULA 1T46A 2R3JA 5EW3A 1H00A 4DBNA 4ARKA 3QQKA 4BN1A 3V8WA 4LRJA 1UWJA 2HZ0A 3NNXA 3WILA 1VR2A 2QO7A 3C4EA 4PMPA 4DBXA 3HA6A 4RBLA 4GK3A 5EHYA 4PMTA 4XV3A 1J3HA 4R5YA 5HCYA 3FZOA 2X1NA 4QYYA 3SXFA 3WF9A 4OTFA 3B8RA 1R1WA 4RWKA 3P1AA 5BYYA 4Y73A 4U3ZA 1SVHA 4Q2AA 1KE8A 1ZAOA 5DWRA 3VBWA 4BY9E 2J50A 3MA3A 3FBVA 3UZPA 4QTEA 4R1VA 2GNLA 3F3ZA 4GW8A 1RJBA 5C4LA 4ANOA 5C9CA 5E8XA 4K2RA 5E7RA 1H25A 2SRCA 3PA3A 4EKLA 3ATSA 2IW6A 2EU9A 3R1NA 4RIWB 3H30A 2OFUA 4R77A 5I5ZA 4HGLA 3F2AA 4AP7A 3FMJA 1Y91A 2PVJA 4BGQA 4BBEA 2IPXA 2C1BA 2UZUE 2X9EA 3QTQA 4ZY6A 4EOQA 5IDNA 4D58A 4AXDA 3LLTA 5JGDA 3DBFA 3LHJA 4M13A 3CQWA 1QPDA 4H3PA 4B7TA 4BICA 4DYMA 4IW0A 3N51A 3K5UA 1H27A 5CT7A 5IQBA 4BF2A 2JDTA 4KBCA 4DEHA 5BVOA 4R5SA 1SMHA 4YLKA 1JNKA 5E1EA 3EQIA 4FV0A 3ZO2A 4JR7A 4CZTA 2VO6A 4CEGA 3W0OA 1YI6A 3W10A 4J1RA 4FV2A 5HVYA 2IG7A 3PJCA 4R3RA 2YDIA 5E1SA 3ZC5A 3QRIA 4LUEA 1VYWA 5DE2A 5JEBA 2E9NA 4XG8A 2RFNA 5AUXA 2C6IA 2JKOA 2NRUA 4D4SA 1F5QA 1L3RE 2C3LA 4TYJA 3V51A 4X3FA 2P55A 4BCMA 2BZJA 5I9XA 4TWCA 5LMKA 3OW3A 3HNGA 3LIJA 4UZDA 3C4WA 4JRNA 5IMEA 5HVJA 3ZO3A 3ZO1A 4IZYA 3VJNA 1V0OA 4ZXTA 5IA5A 5M08A 4AOTA 2XYNA 3QYWA 4FTOA 4I6QA 3BPRA 4EKKA 3PRIA 2ITZA 5DT4A 5EYCA 2B9HA 3W2QA 4L3JA 4F70A 5D10A 2PVHA 3FQHA 3R9RA 3SVVA 1HCKA 3EL8A 3A8XA 3OWKA 3R73A 3UP7A 3BLAA 1SZMA 4EUTA 2FA2A 3Q9XA 5B7VA 2YZLA 2XAOA 3HA8A 4BHNA 5CSXA 4YTIA 2A2AA 4DF3A 5HE3A 4KS8A 3Q9YA 3TN8A 4O2ZA 4AW0A 2XJ0A 3G51A 1GIHA 2BZIB 3DBDA 5EYDA 4EH8A 3G15A 1Y57A 4EJNA 3FKLA 3DGKA 1FVVA 3VS3A 4B0GA 3POOA 3VWAA 4BBFA 5LVOA 4ZLOA 2C6OA 3BLHA 5H2UA 3VC4A 4WRSA 4I5CA 2VO0A 3JYAA 2Z2WA 4TYHA 4JG8A 3EB0A 4DH7A 3ACJA 3D4QA 3RPYA 2UUEA 5F94A 3S3IA 3ZSIA 4EQCA 5B2MA 3SW7A 4MBLA 5BPYA 4QDEA 2OSCA 2YM7A 3IPHA 4KINA 3R9OA 4ALUA 3PY0A 4D2SA 4YZDA 4EQMA 5EKOA 3E8CA 4TL0A 4P7EA 2PMIA 2C0TA 3FMDA 3P78A 5DT0A 5CEKA 3D83A 5LCJA 3IO7A 3OOGA 4UWYA 3S00A 1VZOA 1PYXA 2BAKA 4F9AA 4BDCA 2X6EA 2QO2A 3FL5A 4C3RA 5F95A 4V04A 4KRDA 3DS6A 2PK9A 1DI8A 3MI9A 5EFQA 2W1FA 5BVKA 4I93A 3TNQB 4FK3A 4EH2A 4YMJA 5M44A 3F7ZA 3VRYA 3EZVA 4PL5A 5EH0A 4C7TA 3EH9A 2YM6A 4JG7A 4JX7A 4CFXA 4QPAA 4BCKA 3ATTA 4JX3A 3CPBA 5FXQA 4FNWA 1M52A 4FZFB 4BGGA 3VS1A 4NFMA 3E92A 1HCLA 2O65A 3OOMA 4X21A 2PWLA 3V01A 2J6MA 4WNMA 4FZAB 3SG8A 3FLWA 4KRCA 3KKVA 2XARA 2XM9A 4ZAUA 2XNMA 2GS2A 3KK8A 4KIKB 5E8ZA 4D9TA 4DFNA 3AC4A 2ERKA 3V6SA 4QP8A 3N4TA 5A4QA 3QX2A 4HPUE 4OW8A 5IH4A 4JS8A 2IZUA 4QOXA 3ZFXA 5EKNA 4NL0A 2A1AB 4GG5A 2ITWA 2YACA 2GFCA 4FTNA 3KXZA 1PYEA 3GC8A 1KOBA 1SNUA 2J4ZA 3OF0A 4S31A 5EDQA 2W06A 3RBWA 4ASXA 3VBYA 3CS9A 1J1BA 2BPMA 3EKKA 4C36A 4U6RA 4O7NA 2DQ7X 4L3PA 3F82A 4LFIA 3BL7A 2XH5A 3LJ2A 3QHWA 3V5LA 4ZOGA 1OGUA 4XYFA 4HGTA 4F9WA 3GU7A 2X81A 3HP2A 3QCSA 4KKGA 4M97A 4MXZA 3B2WA 4R7HA 2OIDA 3E8NA 4FV1A 4WOVA 3WF7A 3PZHA 1IA8A 2H8HA 4KKHA 3RNIA 3QKLA 3TNPC 1GZ8A 2GS7A 4O21A 4XG6A 4M67A 3MVHA 4YZ9A 2DUVA 2QU6A 3MB6A 4YJQA 3FKOA 5IG1A 5I9ZA 3V8SA 4LMUA 4YP8A 5J8IA 2VWYA 1CMKE 3GXLA 3JXWA 4GUBA 4OBPA 4WBOA 4EH9A 4B4LA 4MYGA 3WF8A 4O7TA 5FRIA 3ODZX 4G16A 4JBVA 2YERA 5H3QA 2PVMA 3FZTA 4RVKA 4ZSJA 1H0WA 2ZOQA 4EC9A 5AUTA 2YDKA 2CGUA 3D5XA 5GJGA 5M55A 5EDRA 5AIKA 5J1WA 4AXCA 2VWWA 2RG6A 3FY2A 4I0SA 5AP5A 3TJDA 3OBGA 4R7IA 3UNKA 4GSBA 4L67A 4ZS4A 3U8WA 2GQGA 2ZYBA 2WTKC 5K4JA 2EXCX 3WYYA 3F3WA 1WBTA 4XP0A 4O82A 4D0XA 2VX1A 3O96A 5CTPA 2WD1A 2F7XE 4CNHA 4JG6A 2YN8A 3D5UA 3TM0A 5T6KA 3KXXA 4O6EA 1Q99A 5AV1A 4LV8A 2XM8A 3N9XA 4QMZA 4TWPA 5L2SA 3O17A 5KZIA 4O22A 5E8WA 4EOLA 2PVNA 3D5VA 4MXXA 1PXMA 3KK9A 4DCEA 3ROYA 3BYOA 5EYKA 3DKFA 2O3PA 4WRGA 3ZEWA 1Q62A 4U5JA 4FT0A 3VW8A 2W96B 3KF4A 5DA3A 3BGZA 4WUNA 2UW4A 3CC6A 1W2CA 3AC8A 4NFNA 2GQSA 3HMOA 3FHRA 3TUDA 3AKJA 4ZSAA 2XAMA 4G9RA 4FA2A 1Z5MA 1H26A 1MQBA 3GUBA 4RVLA 4PQNA 2BALA 5D7VA 3EYHA 3FY0A 3FMNA 3RPVA 5DNRA 3VUMA 3RM6A 5JFXA 2I40A 1XH4A 3PE1A 4G5PA 4RX5A 5IKWA 4P5QA 3OT3A 4TYIA 4F09A 5HBJA 2ZVAA 1STCE 3BU3A 5JRSA 1W2FA 4EZ5A 1RDQE 1BL7A 5KMLA 2JDOA 4NK9A 4NT4A 2B4SB 5IPJA 4GYIA 2R2PA 3ENMA 3OXTA 4MAOA 5J5TA 4ZJJA 2X7FA 5HCZA 2CCHA 1QPEA 4O0SA 1WAKA 4X3FB 3LJ1A 2BDFA 2YISA 5DH3A 2YIRA 4RIYA 3FI8A 4AX8A 2P4IA 1WFCA 4F64A 3PP0A 4LQMA 2OI4X 2BDJA 4FTAA 4YHJA 5EM6A 5M4UA 3BU6A 4YNEA 3G33A 5EQYA 2OW3A 3RKBA 3E3PA 3U54A 2VV9A 5M4CA 1Q4LA 3S0OA 3QAME 2WMRA 5HBHA 4AF3A 1XH9A 4FV8A 1SVGA 4N6YA 4HYSA 2P33A 3W2RA 5JRQA 3NDMA 4CGAA 4NEUA 4DGNA 3BU5A 4FKQA 4IACA 4FT9A 3SW4A 1NT2A 1AGWA 2EWAA 4O7SA 2VU3A 5BYZA 1OMWA 3FLZA 2Z7SA 2GMXA 3F3TA 4GG7A 2HK5A 5DI1A 3WZKA 4F1OA 5BVDA 5GJFA 4XMOA 3GBZA 3SKCA 4FKGA 4GK2A 4HW7A 4FJVA 4MXAA 5T68A 5F9EA 5DN3A 2UZTA 2Z02A 3H9OA 3E93A 1G8KA 3ITZA 4KABA 3ULIA 2KULA 2ZV7A 4L53A 4RX7A 5L2WA 5HIBA 1OITA 3MJ1A 4XNEA 4TYHB 4A9TA 3M42A 4JIAA 3MH1A 4ZIMA 2B54A 3OMVA 4AW1A 5C4KA 3VNTA 4QTDA 5ETCA 4OBQA 4ASZA 3GFEA 3I0QA 3OXZA 3HP5A 5CLPA 2ONLA 5IH6A 5AAEA 4ERKA 2OU7A 3I7BA 2WIPA 3UJGA 4CKIA 4NKSA 4EWHA 3MH3A 5KBQA 3M1SA 4CFNA 1H07A 3UDBA 4WNKA 1W98A 2PZYA 3E63A 1E1XA 5M07A 2NO3A 2YEXA 3QKMA 5HX8A 4NH1A 3R04A 5FXRA 3BRBA 4AQCA 1OUYA 1O6KA 3CQEA 4JQEA 3ULZA 1OIRA 1W2DA 4AS0A 4M12A 3QTXA 2NYAA 3BLRA 2ITQA 3BEGA 5C01A 2ONLC 4MCVA 3HV5A 3CD8A 4KKEA 4XLIA 3H9RA 3MH2A 4IAIA 2ZV2A 4G31A 5B2KA 5HORA 3TACA 4XJ0A 2I0YA 5CAQA 4F0GA 1TKIA 5J7BA 4QQ5A 3PXRA 3BL9A 3BKBA 3CGFA 4H05A 1XBCA 3BV3A 4I5HA 4QTBA 3ZCLA 3R2YA 4O84A 2AC3A 3IW7A 5IF1A 2NNWB 2R3FA 4NM0A 4TTHB 3MV5A 2E2BA 4HGSA 5JKGA 5CEOA 3NVMB 4RC4A 3JR1A 2J0JA 2X0PA 1DAYA 1PF8A 2GNGA 4IANA 2C6LA 3CD3A 4J95A 3TV6A 3ZM4A 4FKRA 4E5WA 3BBWA 2JKKA 2PHKA 4IX5A 2YIYA 3COIA 3F5UA 5KMMA 1AQ1A 1VLRA 2OIQA 5AR5A 4I4EA 3VUKA 3DBQA 2QR8A 3O0GA 3EN7A 5HU3A 3ORMA 3ORPA 5M09A 3P9JA 4FSUA 4AZSA 4NIFA 5JZJA 5T3QA 3OZ6A 4IVDA 3DAJA 4BDHA 3K3IA 2PMOX 3D14A 1UNGA 2O2UA 3FL4A 4FIEA 1ZOHA 4FOBA 1PXLA 1V1KA 3VUIA 4DDIA 3I60A 4X2GA 3LQ8A 2WOTA 3DTCA 3KB7A 5LMBA 3OP5A 4JDHA 2ZV8A 2BIKB 4FX3A 3R2BA 4OTPA 2WTKB 3ZFYA 2R7BA 3C4ZA 3LXNA 2PYWA 2WQNA 4EHVA 1YWRA 2OF4A 1YHSA 3R0TA 3Q96A 5JFSA 4UMRA 3IW8A 4D28A 2WMSA 2GTMA 2GSFA 1BKXA 2F2UA 3MBLA 4AW5A 2YAAA 5BVFA 4FKIA 2C47A 4D0WA 5IISA 2CKEA 4ZJIA 3RAWA 3HX4A 5K3YA 4DC2A 1L8TA 2JGZA 2UW5A 3D15A 3HZTA 1NVSA 4K1BA 4O91A 3CGOA 2PVLA 3DZQA 3TTJA 5ANIA 4F1TA 2PE2A 1OL7A 4E7WA 2C0OA 3UPXA 2E9VA 2X6DA 1M7NA 3A8WA 2GNJA 3JUHA 1WZYA 1QPCA 5D41A 4A4LA 4K77A 2ITOA 2QKWB 3F5PA 3LXLA 2JC6A 4EUUA 5JZNA 4TWOA 4FEQA 3QZFA 3R83A 4U81A 2XCHA 3Q2MA 3PSDA 4JR3A 2JFMA 2JBPA 4MBJA 1ZRZA 4KAOA 3AC5A 1PXOA 2UZDA 1ATPE 3RHKA 4QQJA 2J5EA 4U40A 3MFSA 2ZM3A 2UW8A 3U55A 3PZEA 2CLQA 3DY7A 4YU2A 3EKNA 4NJ3A 3FAAA 4CLIA 4EOSA 2VUWA 3QA0A 4IAKA 3CKWA 3FXZA 3TKIA 3FV8A 1WBPA 2OF2A 4XBUA 3RK9A 3OVVA 5EDPA 4YURA 3HV3A 4UWBA 3QHRA 4PNIA 1SYKA 3L8SA 3EQHA 5BUEA 4DEDA 3I6UA 4KNBA 4Q5HA 5CI6A 5AAGA 3W0NA 5ETAA 4J52A 3NYNA 5K5NA 3RCJA 2EUFB 2QNJA 3KY2A 5C1QB 5KMIA 3WIKA 3BIZA 3WZEA