4BCJA

Structure of cdk9 in complex with cyclin t and a 2-amino-4-heteroaryl- pyrimidine inhibitor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
321
structure length
309
Chain Sequence
DSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparative Structural and Functional Studies of 4-(Thiazol- 5-Yl)-2-(Phenylamino)Pyrimidine-5-Carbonitrile Cdk9 Inhibitors Suggest the Basis for Isotype Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
molecule keywords CYCLIN-DEPENDENT KINASE 9
total genus 83
structure length 309
sequence length 321
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bcjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bcjA01
4XOZA 5JEBA 4NJ3A 3R6XA 5HE2A 4X2FA 4NFNA 4H39A 4YLKA 3V5PA 1YHWA 2XKEA 3HNGA 4PF4A 2WAJA 3UODA 3VQHA 1BUHA 4HYUA 2ITNA 4TKSA 3HAVA 1B39A 3ODZX 3TT0A 4FV6A 3SA0A 3NYXA 1XQZA 4Z3VA 3FKNA 3GCPA 2Q83A 2YISA 3C1XA 5J1WA 3KRRA 3GENA 4TNDA 4XG2A 1W82A 3VS5A 2BZIB 4TYHA 4CV8A 4EQMA 3FXZA 4FBXA 2PVRA 5DR2A 4R3RA 1OIRA 1A06A 2ETMA 3BX5A 5FEQA 4UALA 3QHRA 3OOMA 2PVYA 2R3RA 3TNHA 1W7HA 2VTPA 2XNOA 3QCQA 2R3MA 2Y7JA 3D0EA 1SNUA 3FL5A 5DLSA 4EH8A 4F09A 3SXRA 2PK9A 4MQ1A 2CN8A 4B8LA 3QX4A 4EUUA 1TVOA 4XP3A 4I6HA 4XG6A 4RA4A 5HIDA 3SV0A 5GHVA 4O7YA 4EH7A 3WF5A 2CKPA 4ACDA 5G6VA 4LRJA 3ZO2A 2C5YA 1YI3A 3GP0A 3F7ZA 4FV3A 4M0YA 3Q4UA 1QPEA 4APPA 3VN9A 4Q2AA 3N4VA 2GTNA 3ZFYA 4BCMA 4AU8A 2VTIA 3NUNA 4V01A 2R4BA 2XIKA 3NR9A 5A54A 2HWOA 4J7BA 5DR9A 5LMKC 5CU4A 4K33A 3GU7A 4YP8A 3IG7A 4PDSA 5I9UA 5AV3A 5L8JA 4C8BA 4HNIA 1OPJA 4MX9A 5EKNA 1OKZA 3HLLA 4PTCA 3UMWA 3IW8A 3WYXA 5I4NA 3UVPA 4FIGA 5KUPA 3UBDA 1UWHA 3W16A 1Q8UA 4FR4A 4H1MA 1CDKA 5JQ8A 3V8WA 4QMUA 1FGKA 3ZCLA 4C58A 3IW7A 3W10A 3VS7A 3KREA 2OI4X 4W8DA 2BIYA 3SRVB 4FIEA 3DKCA 4M69B 3QTSA 2YIXA 3BWFA 3NNUA 5KBQA 5CLPA 2ITOA 4CMUA 3ZSHA 4PY1A 4JR7A 5HX6A 2EVAA 4YLJA 4P4CA 3VBQA 5GNKA 5HE3A 2OU7A 5E1SA 3HX4A 2VNWA 3TNQB 5LCJA 4R77A 1BMKA 4C38A 4XNEA 4ERKA 3G51A 3C0GA 3QWJA 3ZH8A 5KO1A 2Z60A 4M97A 4F1TA 3GNIB 3ITZA 4YJVA 5M56A 2XK3A 3RPOA 5JRQA 2YWPA 4JRNA 5BVEA 4FVPA 3PRFA 3W2SA 4FL3A 3JVRA 1GY3A 4F0IA 2ZOQA 3ORIA 5AV2A 4FTRA 3U9CA 2WB8A 3UIBA 5EW9A 4BGGA 4NFMA 2XEZA 3UP7A 3JR1A 3L8XA 3HDMA 3O71A 3NW7A 3HUCA 3EWHA 3QD4A 1WBWA 3O0GA 3BHHA 5CT7A 5J1VA 5IQHA 3K54A 3R8UA 3ZZWA 1URCA 4DFXE 3LW0A 3HA6A 3BBTB 4L43A 2WU7A 3GOKA 5FWKK 1H0WA 5EDQA 3QKKA 4EH6A 2Y6MA 5AP0A 3FY0A 3MPAA 3P08A 3KXHA 4M66A 2QOBA 4YO4A 4OTGA 5HG5A 2C3LA 2IVTA 1I44A 2R3LA 4L3LA 4AE9A 3TZ7A 5K0XA 4AGDA 3R7VA 5CYIA 1KE6A 2J4ZA 5JK3A 4DCAA 3F3ZA 5HCYA 2WTDA 1IR3A 4FKOA 1H1QA 1ZXEA 4IFCA 3UJGA 2X8EA 3C13A 4NEUA 2W9FB 3OROA 2WTCA 1IAJA 2W06A 4DH7A 2Z02A 3WF6A 5HD4A 2R0UA 1CM8A 1GZ8A 2W0JA 4NK9A 2WEVA 2OZAB 4G6OA 4HOKA 5EG3A 3VUGA 3ZOSA 3VBTA 4DCEA 3MDYA 1KE9A 4ZJVA 4O1PA 5JGAA 3I0OA 5E8WA 3SC1A 2VZ6A 1Y57A 4D9TA 4F9WA 4QP7A 4L01A 5H9BA 5CEIA 5IQBA 2I0HA 4I94A 1G5SA 2PE0A 4Y95A 2Y4IC 3OW4A 3I6WA 4FNYA 1KV2A 4FTNA 2ZM4A 4RX9A 3P79A 4FZDB 4XH6A 5LMKA 2OW3A 4EOOA 1DI8A 4BICA 5HBEA 2KULA 4UY9A 5J87A 4YPDA 3ZSIA 2Z7LA 1RDQE 4U43A 3OHTA 3ORPA 3R9HA 4RIXB 2PUUA 5CEQA 4BKJA 4FE2A 4RVLA 1DM2A 1OECA 2PZIA 1NT2A 3RI1A 2QOFA 5HCZA 2ONLC 4CT1A 2XS0A 3JUHA 1OKYA 1B6CB 3DLZA 3HRCA 4FVRA 4G3GA 5JGDA 1ZWSA 2B55A 3E5AA 3TM0A 3MVJA 2C5OA 4E6AA 3F3UA 3EQFA 3NZ0A 4J95A 4FKRA 2WD1A 3RNIA 3MVMA 5H2UA 3NX8A 3PJ3A 2ITZA 4G6LA 4CFUA 3LKMA 3II5A 2HXQA 4J98A 2IWIA 4DFZE 3ZUVA 3R1YA 4GV1A 4U3ZA 5AP2A 4CKIA 2ZDUA 4UWCA 4XX9A 5CNOA 4LOOA 5G1XA 1YXXA 4EC9A 3CPCA 1YVJA 5CZIA 4ZZNA 5EQYA 3RVGA 4AW0A 3AOXA 3ZUTA 4DEBA 4JXFA 5D10A 3BV2A 2QVSE 3R2BA 4IBMA 3FZPA 4KKGA 2DUVA 2AYPA 4EOIA 2JLDA 4XS2A 4I20A 3AT2A 4D1ZA 2X7GA 3M1SA 4UB7A 4XLVA 3T9IA 2W5BA 2PWLA 1IRKA 3ATTA 3SLSA 3AXWA 3Q32A 4D58A 1ZARA 4FA2A 1RE8A 4IM3A 4D1XA 2VNYA 3CQWA 2WZJA 2WIPA 2J50A 4JQ7A 5C26A 4ZY5A 4G3DA 3F3TA 5TOZA 2YM8A 4QMWA 2LGCA 3RWQA 5CI6A 3WZKA 3ZO1A 4WUAA 1KUTA 3PIYA 4EL9A 1OVEA 4TY1A 3PP0A 1FVTA 1YDTE 2PVJA 2VWBA 2XNPA 3A8WA 4HZRA 4JBPA 2NP8A 4QMLA 5CU3A 1OI9A 4D2SA 2F2UA 3OEFX 3SHEA 4M84A 3Q5ZA 3LMHA 5ANIA 5DFPA 3CR0A 3ELJA 2WTKC 2CLQA 3QD3A 4G34A 3D5VA 2B9FA 3FYKX 3IW5A 2X81A 3DXQA 1OZ1A 3KRWA 4TYJA 3AD6A 3BU3A 3U4UA 3U6JA 5EI6A 3CSVA 4BDEA 5I9YA 4FKIA 4JG7A 4FEQA 3UMXA 3GOPA 4YZ9A 4UMPA 5HE0A 3UZTA 2YITA 1U5RA 2W1CA 3N9XA 4LMNA 5F94A 3EFKA 3VC4A 3GGFA 4AACA 2XBJA 4YURA 4EZ3A 1VR2A 2E9NA 5FGKA 4IHPA 3L8SA 4C7TA 1XHAA 4K77A 4O21A 3RAKA 2UZEA 3EMGA 5JFSA 3PJ2A 2RFSA 5JMSA 1UU7A 1XR1A 4KBCA 4U3YA 3ULIA 5C8NA 4Q9ZA 1U46A 4AX8A 3I7CA 5CAOA 4O7SA 2BFXA 4RIOA 3OW3A 2NRUA 3BWJA 1NW1A 1J7IA 3KRXA 4GK2A 3OBJA 4ZEGA 3NGAA 4GIIA 2ZV7A 3L9NA 3VO3A 1G8SA 5CY3A 2BHEA 3DA6A 4XBUA 2ZM1A 3MYGA 4W4YA 3RHKA 2GU8A 3ZU7A 4BI2A 1ZY4A 2R5TA 4A07A 1JSTA 2G2HA 4FKSA 4ASXA 4C4JA 5M4FA 2WMUA 4XRJA 5LVNA 4FT0A 2HOGA 3ET7A 3QFVA 4ANNA 1H27A 2R3KA 4GKHA 5GINE 2XCHA 3QXPA 1Q99A 2EXEA 2CMWA 2DQ7X 4AZSA 4G16A 3F66A 3GC7A 3R0TA 3U51A 5KMKA 1S9JA 3Q6UA 5IQAA 4CFWA 4O0XA 1OUKA 2BRGA 1CSNA 4LGDA 3QX2A 3OUKA 4FSUA 4ZJJA 5E8VA 2XB7A 2W4OA 4YBJA 2EB2A 2OWBA 2F49A 4FZAB 3Q9WA 1H4LA 4C4EA 2B7AA 5BNJA 4FTCA 4I0SA 3U9NA 4ANMA 5E91A 4EK6A 4L46A 4BTMA 2A19B 2WGJA 3WF7A 3HYHA 3RINA 2Z7RA 4DFLA 5L2SA 2A4LA 5DE2A 4BGQA 5DT0A 2XK4A 3PPKA 4GW8A 3QWKA 3MFTA 3FI4A 3QZIA 2IW8A 1P4FA 4WNMA 4TYHB 2R64A 3WZJA 2UVYA 3OZ6A 3FY2A 1UU3A 5AUZA 3M2WA 2RFDA 4P5ZA 1J1CA 2Y0AA 5CS6A 1STCE 2B52A 3E7VA 3RM7A 3MN3A 2CSNA 2I0YA 3ANRA 5ETIA 4BB4A 3NMUF 3PY0A 1YDRE 3IONA 3R8LA 3QALE 2QHMA 3VIDA 3BGPA 5LQFA 3NLBA 1LR4A 3CIKA 2Z8CA 3WBLA 2RFNA 2ITTA 2JFLA 2XVDA 3BELA 3MTFA 3R04A 1Z5MA 4O6EA 4QMMA 2PMNX 3WZEA 5BX0A 1Y8YA 2CGUA 3KMUA 3R9NA 2UW9A 2VO3A 2O63A 4HVDA 5IISA 5KMOA 5FBNC 3NUSA 4MVFA 2VWZA 4MTAA 3TIYA 4FEWA 5AX9A 3MA3A 4RIWB 4NW5A 4FYOA 4C4GA 3TG1A 1YXTA 5L8LA 4RLKA 3ZRLA 2XEYA 4F63A 3CD3A 3DKOA 4PMSA 5TT7A 5LVLA 3QHWA 3OT3A 3RPYA 3ZS5A 2UW0A 5AUXA 3WIGA 2RG5A 5CQUA 3UTOA 4R7IA 2BAQA 2AUHA 4WNOA 3ZBXA 3MBLA 3RNYA 3H4JA 3PE1A 4II5A 4PNKA 1GIHA 4JDIA 3RAIA 4AZFA 3I81A 3VS2A 3FMHA 4QQ5A 3ZC6A 3RM6A 4A7CA 3HRBA 4GIHA 4RPVA 4GL9A 4O0UA 4GFMA 5DA3A 1PHKA 3FQHA 2E9VA 2QOKA 3PXKA 3PVUA 4BVUA 4J8NA 2UW6A 5CEOA 3EN6A 5HTBA 4KS8A 1REKA 4BCGA 1BYGA 2JBOA 2WMRA 2ZM3A 5HX8A 4RX5A 1ZY5A 2RIOA 2XKFA 3R30A 4H3BA 4CQGA 3AGMA 3FYJX 3RBWA 5M4UA 3GU6A 2GTMA 4L53A 4JAIA 2EUFB 3QRIA 1HCLA 1ZYJA 4FG8A 2GHMA 2C3JA 1PF8A 2VTSA 4IAAA 1KOBA 3BHVA 3QGYA 3E8EA 4PNIA 3DTWA 2FSOX 4WRGA 3UC4A 2BCJA 4X21A 5H3QA 4RT7A 3MSSA 3QKLA 4TT7A 4BCHA 2ZDTA 4AGWA 4CTBA 4XBRA 4DEDA 4IAZA 3DCVA 4U6RA 5HKMA 4EOSA 3VBWA 1WBOA 2WMTA 3OWJA 4JBVA 3H10A 2HENA 4G31A 5B2KA 3HEGA 4NT4A 1YI6A 2BRMA 4R7BA 3EIDA 3GVUA 2YIRA 1DI9A 5CVGA 3COMA 4FTAA 3EQCA 1JPAA 4S2ZA 4YC8A 3VAPA 2WQOA 1VEBA 3LPBA 3UG2A 2EXCX 5CVFA 4QP4A 4FT5A 2X0GA 4G6NA 2OSCA 4ZTRA 2BTSA 3S3IA 2XRUA 2WMQA 3CGOA 1UU8A 3MH3A 3B2WA 4YBKA 4MHAA 3FBVA 4CRSA 3B8RA 4NSTA 1YI4A 4CSVA 4CKRA 4O7RA 3F61A 2IZRA 4FZFB 3E93A 2QKRA 1ZMWA 2VWVA 3FC1X 5IQIA 2JDVA 4ALWA 1J1BA 2GQSA 3BEAA 3BI6A 4MF1A 3NYNA 3VS1A 4OAVB 5BVFA 3F5UA 1WCCA 4WG4A 3JXWA 4FF8A 5A14A 2YA9A 3AT4A 3NCGA 4XG3A 3VBXA 3E8DA 5DG5A 3EZRA 3GUBA 1CTPE 4OBPA 1AGWA 3ZONA 5I5ZA 3F5GA 4Y46A 4Y5QA 2VWUA 3EL7A 3RCJA 4AZVA 5CXZA 5E8UA 2O8YA 4O0SA 4BTJA 2HW7A 4O81A 1WMKA 2X4ZA 4BBEA 2YDJA 2WQEA 4ZJIA 4BIDA 2P0CA 5FBOA 4GUEA 5H8EA 3DQXA 4QPAA 2BUJA 2QODA 2PSQA 5C8MA 1UV5A 4ALVA 4KINA 2CGWA 1KE5A 1MRYA 3HMOA 4CXAA 4E4NA 5JRSA 5HOAA 4RWKA 3V8SA 5FXQA 4DEEA 2J90A 4IWOA 3S2PA 4FTMA 4FV1A 5F4NA 1GJOA 5HE1A 3R7GA 3LLTA 2JDRA 1IA8A 2ONLA 2J0KA 1TQPA 3OWLA 5CX9A 5KMLA 4CKJA 4BWXA 4O22A 4J8MA 1TKIA 5FTGA 1SNXA 4K18A 4RVMA 3F9NA 5FTQA 4E26A 4D5KA 3DTCA 3R9RA 4GT4A 4I5HA 4K2RA 3GU8A 2YDKA 3PLSA 1WBPA 3R1SA 3W8QA 2JDTA 1ZYCA 2JIVA 2F9GA 3DS6A 3LQ3A 3BKBA 4PL4A 1OGUA 4KAOA 5DT3A 2PE2A 4FSQA 4U40A 3BIZA 5FP6A 4JOAA 5AV4A 5F1ZA 2OG8A 4FTTA 4QO9A 5C4KA 4MXCA 1XO2B 2VX3A 4FTQA 3HV7A 3H9OA 4RJ3A 4IX4A 5GJGA 4E8AA 4IX5A 4EHZA 3EOCA 1OMWA 3NDMA 1T45A 5ETCA 4EYJA 3V3VA 4MBIA 4RC2A 1U54A 1M7QA 2X8DA 4FYNA 4F9CA 5A6OA 3ID6C 5JT2A 1XH9A 5T3QA 4M12A 5CSVA 2QOQA 1OPKA 2H8HA 4LYNA 4FKWA 4TZRA 4E4LA 4YSJA 4EEVA 3DGKA 4CVAA 4XV1A 4RQKA 5BVNA 4YUQA 4ZS4A 4BCOA 1R78A 4IEBA 5KMNA 3F2RA 3FSFA 3GBZA 3RMFA 4BCNA 3P0MA 4FV2A 4ITHA 4YTIA 3RAWA 3W33A 3EQDA 3ZUUA 4ZLYA 4L52A 1V0BA 2XF0A 2VX0A 4BCKA 4DGLC 5EI2A 4D1SA 5LVPA 3UOHA 4PUZA 3HAMA 4QMSA 4C34A 4U97A 2GS7A 5D41A 3VUIA 3MPMA 5I9WA 4IDVA 4O6LA 4UXLA 2UVXA 1CMKE 2JAMA 3MV5A 4R1VA 5DR6A 3DZQA 3TNIA 4O7VA 4R3CA 3EN7A 3R8ZA 2CLXA 3MW1A 1JKLA 5EDRA 4E6DA 3C5UA 4YTHA 3HKOA 3PUPA 5AR5A 4EWHA 3BGZA 5AAGA 2ACXA 1BL7A 2ITXA 1UA2A 3SOAA 1H0VA 1F0QA 3ZDIA 2IVSA 2R3NA 2WTIA 3A61A 2NO3A 4HJOA 3OMVA 5DEWA 3V51A 4B0GA 3UQFA 2JKMA 5D7VA 5JFVA 4GH2A 4EBWA 2Q0BA 4F6WA 4JAJA 4PDPA 3OS3A 4X3FC 4QYGA 5E8SA 4XG4A 4AZEA 2GPHA 3GC0A 3KC3A 1K3AA 3ORLA 1R0PA 4O7WA 4IX3A 3V5LA 5ETAA 5DOSA 3NEWA 4GK4A 2OFVA 2WXVA 2OLCA 4GFGA 1YOJA 4FSZA 4LGHA 4DFNA 4PL3A 5M53A 2JD5A 3MB7A 3Q53A 4TWOA 3MA6A 4DG2E 4MNEB 4IIRA 3A7FA 3C4EA 3PIXA 4ZLOA 4ZTMA 4KIQA 3RJCA 4CG9A 4BDGA 3U8WA 2G2FA 4C0TA 4GEOA 5E8YA 4GS6A 4QOXA 4F9AA 2HW6A 4BDAA 5EYKA 2OO8X 2Z7QA 1H07A 5F20A 4XYFA 5CALA 3FLZA 3VHEA 4E5WA 2VO7A 3AC8A 1DS5A 2E9PA 4I93A 3NYOA 5EW8A 2OF2A 4E7WA 1SM2A 2I6LA 3PSDA 2CNQA 4L67A 3ORXA 5HLPA 4MBJA 4CZTA 3IW6A 3R02A 3QKMA 4FIHA 3ZRMA 4AE6A 5DRBA 2WELA 3A7JA 4QMNA 1XH7A 4O0WA 3RTPA 1XBAA 2FGIA 4D4VA 4AW2A 3BZ3A 3L1SA 3HP2A 5GIPE 3BLHA 1H1WA 4ARKA 3UNKA 4R1YA 3F2NA 4E6CA 4FV0A 5C03A 3K5UA 4GU9A 4RQVA 5CSWA 3OWPA 2OH0E 2YFXA 4GYGA 2GNHA 3QYZA 4YGAA 1JSUA 5A3XA 3TV4A 4DG3E 2JKQA 3CGFA 2CKOA 3DLSA 5M55A 1H28A 3ZEWA 2BZHB 2ZAZA 4Z7HA 3E64A 5ANKA 3AG9A 2IO6A 2LAVA 3V5JA 5KNJA 1WAKA 2B54A 2C6KA 2PE1A 3ORKA 4A9RA 1JOWB 3OWKA 1HOWA 3D7TB 4HGEA 4ENXA 4ZTSA 5A46A 5A4QA 2O3PA 3PY1A 3IDPA 5ACBC 5DN3A 3ZHPC 2X8IA 1Q3WA 3DNDA 1V0PA 4J97A 4FX3A 4MAOA 5C1QB 1V0OA 1PRYA 2GHLA 4M15A 1UWJA 4S33A 3Q9XA 3KULA 5DPVA 4RIYA 2YIWA 5DHJA 5C27A 3EN4A 5HU9A 3BPRA 4O7NA 2C6IA 5BYLA 1UNLA 4O0TA 1YHSA 3A4OX 3H3CA 5EYDA 4QP3A 3ZTXA 3FHIA 5B2LA 3LCTA 4B6LA 3CLYA 4CFNA 1ZYSA 3RWPA 2VTQA 5KE0A 5I9ZA 2ETRA 1YHVA 1ZYDA 4CQEA 4WIHA 2OGVA 3I1AA 3IS5A 2BILB 4IZYA 4HPUE 3FMJA 2J7TA 3CP9A 3FMNA 4L42A 4QMPA 5K4JA 1ND4A 3DAEA 3KEXA 3VRZA 4RFMA 5EFQA 1P14A 4EORA 4FT7A 3LAUA 2XNGA 3CE3A 3GXLA 4GRBA 4WKQA 2R3PA 2WHBA 1U59A 2W17A 1ZMVA 2BAJA 5DMZA 4C35A 2QU5A 3QRKA 3TV7A 3P5KA 2QO7A 4YTCA 1Q62A 1JBPE 4IM2A 4C4FA 4FUYA 5IQDA 2UZLA 4FTOA 4JR3A 3LFAA 3CS9A 1UKIA 2JBPA 4MQ2A 5E8ZA 4TW9A 4AGUA 4EH2A 5HO7A 2IJMA 4E4MA 2GFSA 3VF8A 4KWPA 4CTCA 5KMJA 4FTJA 2RGPA 4YR8A 2A1AB 4FVQA 4JDJA 1M2QA 4FEUA 5M09A 2XM8A 3LFNA 2VO0A 5EOBA 3GU4A 3R00A 4FSRA 1KV1A 2YCRA 4HNFA 4WBOA 3VUHA 1Y8GA 3PWYA 5K9IA 1H1RA 4Y73A 4NKAA 3ORMA 4IXPA 4B8MA 3Q2MA 3LFDA 4C3RA 3P9JA 4DH5A 4EHVA 4CYJA 5K5XA 4FSYA 3FWQA 2C4GA 4DTKA 1BI8A 1XH5A 3NAXA 2FA2A 4IVCA 3HV4A 4FZ7A 3FC2A 3ZRKA 5CU6A 5FDXA 2C6MA 3NIZA 2B9IA 5CAPA 3TI1A 4WOVA 3QLGA 3O51A 3C5IA 5A4EA 1E9HA 2WQBA 2OXXA 2XKDA 4W9XA 2Z2WA 4IH8A 5JZNA 4ZK5A 4YHTA 3FXWA 5AUWA 3HGKA 2PULA 4NL0A 4JQEA 5CSHA 3EFLA 4FV7A 4RZWA 4N0SA 3MFSA 5F95A 2P2HA 3KKVA 5CI7A 2XK7A 4G2FA 1XWSA 3FMEA 3ORNA 4AZWA 4G3EA 3IECA 2CCIA 3SD0A 3AD4A 2B53A 3TZMA 4GKIA 3UZRA 3KXZA 4DT9A 4K9YA 4OTWA 3BBWA 4YJQA 5KMIA 2ZVAA 3S00A 1JLUE 4UWYA 4ANLA 4RJ8A 3RPRA 2C68A 5AR3A 2IVVA 1BI7A 2O65A 4P2KA 4DGGA 2BR1A 2XRWA 3OC1A 4HPTE 5AM7A 3QA0A 5AAFA 3HZTA 4K8AA 1LEWA 4IDTA 4AN2A 3KF4A 3PYYA 2PVLA 4OTFA 4OGRA 3VW8A 3QQUA 3Q6WA 1JQHA 1UVRA 2WEIA 3OXZA 1Q3DA 4PMMA 3VUMA 4TWCA 4AA5A 2VWYA 4AN3A 1OBDA 1I09A 1W98A 2OK1A 4I92A 1OIQA 2GNFA 5IQEA 3DXPA 2GNJA 4EWQA 1M7NA 4TYIA 4I22A 4QP1A 3CCNA 2A0CX 4H58A 3TL8A 4ANOA 1Y91A 4QNYA 3W8LA 4BRXA 4EI4A 4H05A 2V5QA 3ZXTA 5LJJA 3LQ5A 1XBBA 2OJFE 2J51A 1PXJA 4XOYA 5E4HA 3QD0A 3DXNA 3CTJA 3TZ8A 4DGNA 4RWLA 3LFEA 3WOWA 4FKJA 4WBBB 3PPJA 4QTBA 5AR2A 4ZTQA 4F7JA 5CASA 1H26A 3L8PA 4JIAA 5DNRA 4BR3A 4O91A 5AUTA 4FK6A 5M4IA 3R7EA 3F88A 3ODYX 4QTAA 4YJPA 2RSVA 3SDJA 3MVHA 4RJ5A 4FKVA 3G9NA 2C1BA 4WNKA 4JNWA 2PZPA 3DBQA 5FXSA 1YWRA 2WMBA 4MXYA 4D2WA 4L8MA 3A2CA 4UV0A 1M14A 2IW9A 3DB8A 2NPQA 4O86A 3ULZA 2R9SA 4PMTA 5HVKA 3C9WA 3PG1A 4LM5A 4Y83A 5ANDA 4FKGA 4FT9A 5HG7A 2W4JA 4XP2A 4MWHA 3WE8A 3TJDA 4CFXA 1FOTA 3ZEPA 2J5FA 4D4RA 3CBLA 4F6SA 5CAVA 3NUAA 3KQ7A 3M11A 1H08A 3LM0A 5HZNA 5FP5A 4EOLA 5HNIX 2Y8OA 3QBNA 3R71A 5HHWA 1OL5A 3OVVA 4RVTA 5J9YA 5J7BA 3QTIA 1PXOA 5IKWA 2C5VA 3MY0A 2XH5A 3RGFA 4KSPA 4EOMA 4R6VA 1Q8WA 2XIXA 3NPCA 4FK3A 3ROYA 4IVBA 3NSZA 1ZYLA 4CLIA 1CKPA 4M0ZA 4LRMA 3MH2A 3R8VA 3UPXA 5DEYA 2WFYA 3UNZA 2YN8A 3F82A 2XBAA 2IZSA 5CF6A 2W1HA 4ALUA 4F0FA 4N4SA 4F9YA 4G3CA 2OFUA 2X9EA 3KL8A 3QQJA 5FXRA 5JSMA 3B8QA 1K2PA 3AC2A 3OG7A 5HBJA 4DH3A 4BZNA 4HYHA 4FV9A 2G2IA 2GNIA 3R7UA 1HCKA 2XA4A 4IJ9A 5HTCA 4RVKA 3WE4A 5CEKA 4Z9LA 3GFWA 2W9ZB 2HAKA 1PMUA 4YSMA 1SVGA 5E1EA 2J0JA 3NNXA 2FH9A 2ZYBA 2J0IA 3AT3A 1VZOA 4DBNA 4FTIA 3BU6A 2HIWA 1R39A 4FSTA 5LVMA 2J9MA 3ENMA 4NJDA 5JQ5A 3DNEA 1BKXA 4FOCA 2BVAA 2R7IA 4R5SA 4FSNA 1QPCA 1Q24A 3IOKA 3N51A 3QAME 2E9OA 4KBKA 2QD9A 4BYIA 2QLQA 1W0XC 2EXMA 3R73A 1IAHA 3CJFA 3BCEA 3VWAA 3PSBA 5IUIA 2PYWA 4XP0A 3EFJA 2UZTA 3Q60A 4U42A 4BZOA 3HVCA 3Q52A 4AF3A 3A62A 5LARA 2JGZA 4X2NA 4UMUA 1WFCA 4KKEA 4YZBA 2PMIA 5L2TA 2Y9QA 3JVSA 3LFSA 4ZP5A 1M52A 2YAAA 3EQBA 3QL8A 5ETFA 4BI0A 4FC0A 1Q97A 4LG4A 2RF9A 3EKNA 4EJNA 3D94A 3QTXA 1OBGA 2BROA 1XH8A 4YJOA 3MS9A 4D4YA 4IZ7A 4FKLA 2UZWE 3UO5A 3FQSA 4RFZA 2YCFA 3KXMA 4L68A 3DV3A 2XNBA 4A9YA 1CKIA 4YO6A 5BMSA 3OCTA 4K11A 1NVRA 4DGMA 5FDPA 5EQPA 1P2AA 3DBDA 3G0EA 4CV9A 3NIEA 4XG7A 4C59A 4F70A 1Y6BA 3BYVA 2JKOA 4ITIA 3PJCA 4FV5A 5D1JA 3NNVA 5DRDA 4EH4A 2IG7A 4ZMEA 2VRXA 4S30A 3FZ1A 3WARA 4G3FA 4M13A 4XV9A 5HLWA 3VUTA 3ETAA 4QP6A 3E62A 2VTTA 4AWIA 3P1AA 4BDJA 1OIUA 2X6DA 2ZB1A 4FSMA 4Y8DA 5KZ0A 2W5AA 3I0QA 5EM8A 2I1MA 3PG3A 2X2LA 3PVBA 3WF9A 1YRPA 4TWNA 4F7NA 1R1WA 2OXDA 4NUSA 4WG5A 4EOKA 5IA4A 4AT5A 1WBVA 4RMZA 4HCVA 4RG0A 4LOPA 1XBCA 1DAYA 3D5UA 3KMMA 1QPJA 3FLQA 4NCTA 4O0VA 4XJ0A 3C51A 4APCA 5J79A 2C0OA 1YXUA 3BHUA 4Z7GA 1TQIA 4BDDA 4P5QA 1Q41A 3MB6A 3OCGA 4QMTA 1SZMA 4I6FA 4HGTA 4RRVA 2WMVA 2JC6A 2XJ2A 1JNKA 4X2KA 5L3AA 2QR8A 3G2FA 4UMRA 4FNZA 3ACKA 1XH6A 4C3PA 4BKZA 3UO4A 2CN5A 4FI1A 3UIMA 3FMLA 1YOLA 3MWUA 4YLLA 3IGGA 3D7ZA 3UOLA 5JGBA 3FL4A 4OT5A 5ANJA 4QNAA 3KF7A 3RK9A 4D28A 2GSFA 3F5PA 2HYYA 5GJDA 4ZZMA 2F4JA 1GZOA 2WOUA 1T46A 1FVRA 1QPDA 3TXOA 2ITWA 4ANQA 3KGAA 2QG5A 1H1PA 5HO6A 2OIBA 2F7XE 4NH1A 5BVWA 2X9FA 4WD5A 5ANEA 5JFXA 3LMIA 5CU0A 3MTLA 4FL2A 2XIRA 5LVOA 3BYSA 1R0EA 2O5KA 2PY3A 1K9AA 2XK6A 4OT6A 3ZDUA 4BIBA 3UYSA 5CSPA 4QD6A 3WF8A 3E7OA 2Z7SA 3OY3A 4DH8A 3E3PA 4IAKA 3FDNA 4YNOA 1Z57A 2CHLA 2J5EA 4IB0A 4BBMA 4DYMA 3CC6A 5FD2A 5J9LA 4EKLA 4RJ7A 3GC8A 4AS0A 5L4QA 1P4OA 4W4WA 3FZSA 2JDSA 3PZEA 3C4ZA 2P55A 4ZTNA 3LQ8A 1PXLA 2WKMA 2VTNA 4UWBA 4I1ZA 4ZMFA 2PUPA 3LZBA 3LXNA 4QMQA 3FI2A 4IANA 3A60A 3TTJA 2OIQA 3C4FA 3E3BX 1WVYA 5EM7A 2W1IA 3FV8A 1LUFA 4GSBA 1W83A 2VTMA 4KRCA 3RAHA 3D14A 4WNPA 4FEVA 5DYJA 3EZVA 4NM5A 3ORZA 2ZV2A 3K3JA 2OF4A 1XH4A 4MD9E 3R9DA 5M44A 3F3VA 2CJMA 4WSQA 3KRLA 3QQFA 4O7ZA 3NW5A 5HIBA 3QA8A 5AP5A 2XCKA 4JBQA 5AIRA 3PPZA 3FZOA 4ZTHA 5GZAA 2CKEA 4UMTA 3KCKA 1MRVA 4GVAA 3I5ZA 4W4VA 4AUAA 1WBNA 5HLNA 2NNWB 1URWA 4PQNA 3FI3A 4EC8A 5FRIA 4FKPA 3EB0A 4H3PA 2GNGA 4G5JA 2VTJA 4X0MA 5ITAA 3E87A 3VVHA 4IC8A 3V6SA 4I41A 4GT3A 4BHNA 3R7IA 2W05A 5B0XA 1JKKA 4FKQA 5K4IA 5LMBA 3TIZA 4N57A 5IUGA 3FLWA 5KMMA 4R78A 3PA3A 5EHYA 5E9EA 4C4IA 4QQTA 5FEEA 4R7HA 1UNGA 3ERKA 4KNBA 3MFUA 4L6QA 3ZLSA 4ANSA 3KXNA 1H01A 5I0BA 5EHLA 2XK8A 3HMNA 2HY0A 1ZRZA 4CYIA 5KX8A 2C6LA 2I0EA 3IPHA 4JDHA 4DFYA 2BZJA 2QOIA 3I5NA 1OL7A 3AC5A 4IWPA 3EQIA 3KY2A 2YZAA 4AA0A 1OB3A 4O38A 4MBLA 3BHTA 4RZVA 4IE9A 5HQ0A 1MQ4A 1TQMA 1PKDA 3VS6A 4PDOA 3VRYA 2YCSA 1UNHA 2XUUA 2YM4A 2YDIA 4W4XA 1L3RE 4X3FA 1O6LA 3COKA 4ZLZA 2ITYA 4YJRA 5D9HA 3TDVA 1AD5A 3D2KA 4RX8A 1YOMA 5AM6A 4BCFA 4MXZA 2B4SB 5AP3A 2W1DA 1OIYA 4ZZOA 3MPTA 3BV3A 2IZTA 3C4XA 2UW8A 3EJ1A 3NS9A 3EKKA 3OBGA 4PWNA 3EQGA 4R5YA 1FQ1B 4GJ3A 5CZHA 5DBXA 4FNWA 3LCDA 3WI6A 5CF5A 5GZ8A 2B9HA 3MESA 1F3MC 3OXIA 3Q96A 1REJA 2GCDA 4TRLA 4QYYA 2W7XA 2HK5A 1PY5A 3CQUA 3PIZA 1M17A 3QGWA 5AFVA 4YNEA 2CGVA 3TKHA 1EH4A 1NA7A 3GQIA 4XHKB 4UX9A 4DBXA 3OP5A 4NW6A 4E4XA 4F1OA 2YHVA 5D12A 2GS2A 5I9VA 4FEXA 2PVFA 3BGQA 5CVHA 3DY7A 3GFEA 4OLIA 5I3OA 4ASDA 5C8KA 4YTFA 4CCUA 3JY9A 3BE2A 3MY1A 3TKIA 1U5QA 2YJSA 3D83A 3GCVA 5AWMA 3JYAA 3AC1A 3PXYA 4ZY4A 4O96A 1BLXA 4JS8A 4CZUA 4I4EA 3ZSGA 5J5SA 2C47A 5J5TA 4HGLA 5DVRA 3EQRA 3WIKA 4E3CA 2XJ0A 3ORTA 3QF9A 4FZ6A 4QT1A 4MXXA 4QYHA 3W55A 3I79A 4HVIA 2J0LA 2O2UA 4PRJA 5HG9A 3RALA 2XMYA 4KIKA 3W2QA 4M3QA 3TEIA 2UW5A 5IPJA 5AP6A 5TKDA 4EYMA 4BDIA 4O0YA 4RX7A 2BKKA 4ZXTA 2C0IA 3AD5A 4PP7A 1LP4A 3UO6A 3AC3A 3HUBA 5FTOA 3F69A 3PA5A 4LRKA 2QURA 3W2CA 5AA8A 4ONAA 4J99A 5AA9A 4ZIMA 3S0OA 4O7TA 4ORKA 5BVDA 4I4FA 4GJ2A 3BYOA 3PTGA 4A9TA 3UOJA 4NKSA 1GAGA 3P4KA 3W18A 4L3JA 1FPUA 1PXNA 3P78A 3SRVA 2QOCA 2XYNA 3CEKA 4ACCA 3IDCA 3DDQA 2C5NA 2W1GA 4DA5A 5D11A 3NW6A 5AV1A 3TCPA 4C2WA 1MQBA 4DFUA 4J96A 4MNFA 4BN1A 3E88A 4EBVA 3FLNC 5JZJA 2WMXA 3TWJA 5AP1A 1FINA 2GHGA 4FIFA 4BBFA 4CMOA 2QI8A 3LHJA 2WMSA 4J53A 3QUPA 3ZO4A 3DAKA 4DT8A 1J7UA 3BYMA 3RK5A 2QCSA 3CY3A 3R8MA 1R3CA 4NM0A 3OY1A 3W2PA 2VTRA 3Q04A 1NY3A 3TZ9A 4AQCA 1FMOE 3UDBA 3GEQA 1M2RA 4H1JA 4U79A 5AV0A 2VD5A 3MIYA 3EYHA 2OIDA 3DFAA 4IB5A 3VF9A 1SVHA 2E2BA 4L9IA 5IEVA 5CU2A 3VJNA 2XK9A 4GG7A 3UG1A 3FMKA 4WO5A 4NU1A 4L7SA 2PVKA 3ANQA 5H8BA 3W2OA 2PVHA 3C50A 3DZOA 3EL8A 1PXIA 3THBA 2UZUE 3VHKA 2ZV9A 3QRTA 4BIEA 3QTZA 3SG9A 3EHAA 4ASZA 2E9UA 4CGAA 4XEYA 3OCBA 3T3VA 4F0GA 2G01A 4U80A 3NAYA 3UYTA 4DF3A 1FMKA 5J7HA 4XMOA 3BEGA 2X2MA 4JG8A 3LFBA 3KMWA 3DK6A 4WG3A 5LWNA 3UP2A 3VS4A 1L8TA 3HL7A 2B0QA 4PPCA 2R3FA 4YZDA 3U54A 4DTAA 4MH7A 5EYMA 2X6EA 4JVGA 2F7EE 3QUDA 3FI8A 4X7QA 5BVKA 3DJ5A 5HCXA 3O17A 3PP1A 4KRDA 2JIUA 3QC9A 4BCIA 2V7AA 5GIOE 2Y4IB 4N6ZA 2UZNA 4QPSA 2YZLA 4AG8A 4D55A 2C6TA 4EJ7A 4NM7A 4EHGA 2Y6OA 2W1FA 3TDWA 4MCVA 2C6OA 3A4PA 1O9UA 1O6KA 4RIYB 3F5XA 4TPTA 2OKRA 1QCFA 5ACKA 3DB6A 3FAAA 3A7GA 3RKBA 4CD0A 4DLJA 3BU5A 3C4CA 4K0YA 4DEHA 4A9UA 4EK4A 4Z16A 4LV5A 2V0DA 3VS3A 4QP8A 2C3IB 3EH9A 3ROCA 5IA0A 2W4KA 4R3PA 3IQ7A 2ZMDA 3A8XA 4CZYB 2VWWA 4DEGA 4HCTA 3PSCA 3VS0A 2RFEA 3LXLA 3NUUA 2HY81 4H36A 4F1MA 1SYKA 1GZKA 2PMOX 4IW0A 3U6HA 5CXHA 2BRBA 3FLYA 2OZAA 3Q9ZA 5EYCA 2CKQA 1OKVA 3RPVA 2BIKB 1Q8TA 2WTVA 2JIIA 3OXTA 4BGHA 2ZB0A 1IG1A 2ZMCA 3QUEA 5HTIA 2PUNA 4JL9A 4YHJA 1M2PA 3FJQE 3H9RA 3BQCA 5EOLA 4HCUA 3SOCA 4DG0E 3O8PA 2V22A 2REIA 2VN9A 3G33A 4OTIA 3V04A 4CEGA 1ZMUA 2QG7A 4K1BA 3LFFA 5AX3A 3R83A 1W84A 3TJCA 4CRLA 4M7IA 3QZHA 2FSLX 2W5HA 2G15A 3Q4ZA 4FKUA 3ZLXA 4S34A 4C57A 3TTIA 5B2MA 1KE7A 4EH5A 1CKJA 2WQMA 4YJTA 3TN8A 4IMYA 3H9FA 2C6DA 4I6QA 4QMZA 5EI8A 5IA1A 2HZ4A 2GQRA 1OL1A 2PTKA 3MVLA 4U8ZA 2R3QA 2ERZE 4U0IA 5KBRA 1WVWA 3KXXA 3BLRA 5CF4A 1YWNA 2QR7A 3F2AA 4D2RA 5HORA 3Q2JA 3UC3A 1PJKA 4X2GA 4A4OA 4DN5A 4KUJA 1S9IA 4U44A 4B7TA 3P7BA 2UVZA 4AP7A 2PZRA 3E92A 1PMVA 4AN9A 3CD8A 1DAWA 2SRCA 4HYIA 2B9JA 3PXZA 1WVXA 2Q0NA 2JAVA 3PZHA 4Q9SA 2XZSA 2QOLA 4AFJA 1JKSA 4LL0A 5AUVA 3QXOA 2ERKA 5IQFA 4IVAA 4QTCA 3G6HA 4PMPA 4ZSAA 5C01A 4RLLA 3WYYA 1Q8YA 4KBAA 4A06A 1LPUA 3QYWA 5IF1A 3NVKI 4I3ZA 2R3GA 2UZDA 3CTQA 4I0TA 5IH4A 1WBSA 4JI9A 1PYEA 4IAFA 4FIIA 3C7QA 5ANOA 3CPBA 3MGYA 4PPAA 1H25A 1E1XA 2HWPA 4GT5A 3POOA 4ZTLA 3KFAA 4XG9A 4QPMA 1ZLTA 3G90X 2Y4PA 3M42A 2I40A 3N4TA 4KS7A 3MJ2A 1WZYA 3HV3A 2XP2A 2YM3A 5HVYA 3LIJA 5AR4A 4I21A 3R1NA 4FKTA 4JBOA 3OUNB 3GI3A 4YPSA 2WU6A 3C0HA 3P7CA 2X7FA 4FG9A 1BL6A 4S32A 4USDA 4FICA 3RHXA 5EKOA 4C61A 4EK8A 1RW8A 3V5TA 5M51A 4X6RA 5A6NA 3ACJA 4OTRA 4RJ6A 3AMAA 1ZAOA 4XRLA 1GIJA 5BUIA 3RK7A 3C0IA 1GIIA 1Z9XA 3OEZA 4TNBA 2J0MB 3PJ1A 4DITA 4IWQA 5CSXA 3E8NA 1PXKA 5AMNA 4EH9A 2C6EA 1SMHA 4GYIA 4NWMA 1KWPA 5IMXA 4D2TA 3KULB 3TACA 4BL1A 4F99A 5B7VA 2EU9A 2WTWA 2UW3A 5EHOA 2YJRA 3OTUA 4WSYA 1VYZA 1SVEA 2R3JA 5KKRB 2VO6A 5AR8A 2R3IA 2WIHA 2R0IA 3KRJA 4LI5A 4TXCA 4JIKA 3FPQA 2EWAA 3ENHA 4FODA 4MWIA 3IGOA 5IMEA 3LVPA 4LFIA 2UZBA 4C4HA 5HU3A 1U54B 2FYSA 2YCQA 5FM3A 3T8OA 2AC3A 4A9SA 3TUBA 4KIOA 4I5CA 2UW7A 3COIA 2R3HA 4FGBA 4FTKA 1H24A 3LE6A 2RKUA 4CMTA 4BC6A 3LMGA 4CG8A 4BWPA 4DFBA 4JX3A 2F7ZE 4QQCA 5C4LA 5ANGA 4O2PA 3OD6X 3WZUA 4BHZA 3LCOA 3SXFA 3KB7A 2X7OA 4XUFA 4LMUA 1ZOGA 3UPZA 3DBFA 2UUEA 2XNEA 4FUXA 4O7LA 2YERA 4C62A 1ZZLA 5AIKA 5FLFA 3GB2A 4JX7A 4IVDA 4BKYA 5HNBA 1FBNA 2V62A 4GCJA 3EN5A 4UBAA 4X3JA 4ZAUA 5IZFA 2NRYA 4YMJA 2JDOA 4GG5A 3D5XA 2QO2A 4N6YA 2JFMA 4GUBA 2OZOA 5AEPA 4XCUA 3CQEA 1WBTA 3EFWA 3UZPA 3QQLA 4U45A 3OT8A 2WQNA 4D0WA 3QCSA 3FEGA 1YXSA 1H8FA 4EK3A 4ITJA 4F64A 3PJ8A 4L44A 4BDBA 3S4QA 1PKGA 3DQWA 4AAAA 2C5XA 2XNNA 3ZFMA 1E1VA 3LXPA 4XV3A 3PFQA 4EUTA 4A4XA 2YACA 3Q9YA 4TWPA 4DGOA 2CNUA 5KHWA 3SGCA 4M14A 3NUXA 4CFMA 4D9UA 4O83A 3SXSA 3R63A 3LCKA 4LUEA 2G1TA 2HZIA 3DK3A 4WRSA 3SQQA 2W96B 3G6GA 3TUDA 5AP7A 3WZDA 4EHEA 2BKZA 3O8UA 4EOQA 4F08A 3PY3A 2YABA 4YC6A 2BDJA 2HZNA 3POZA 1P5EA 2W99B 2V7OA 4I6BA 4KD1A 4OR5A 2VTAA 4LQMA 5AUYA 5AADA 3DOGA 4J71A 3LFCA 4V04A 3EYGA 3MY5A 5M4CA 3I4BA 2O64A 2OJIA 3ALNA 4XG8A 3HMPA 5HIEA 1IASA 1MRUA 1UU9A 3U87A 4FTLA 3S1HA 3DT1A 3SW7A 4DE4A 3VJOA 4J1RA 4EH3A 4ZY6A 2JEDA 4QMXA 4AW1A 4DHFA 1KSWA 2HCKA 4RSSA 2F2CB 4MKCA 1OITA 3K3IA 4YHFA 1QL6A 3HMMA 3RCDA 3UGCA 4C36A 4YU2A 1ERKA 3G15A 4IZAA 4L3PA 2ITVA 3FMDA 2V55A 2PU8A 4NTTA 4OTPA 2H34A 3NRMA 4LL5A 4UEUA 5IEYA 3LFQA 4IZ5A 5CNNA 5CTPA 5FM2A 3ZM4A 5BYYA 5H8GA 4BWKA 1OUYA 5A4CA 3NUPA 1U4DA 3BLQA 3Q4TA 4ERWA 4O84A 1NVQA 4XLIA 4F4PA 1FVVA 3IDBA 5HVJA 3N4UA 4C3FA 2R3OA 3R2YA 3F3WA 3O96A 2CDZA 5AP4A 2YIYA 3GCUA 4AW5A 5IH6A 2H9VA 3QTWA 5AAEA 2GFCA 4BDCA 5J9ZA 3NVMB 4IX6A 4HYSA 4NIFA 4X3FB 3REPA 3UNJA 3O2MA 3U4WA 2ZJWA 3AMYA 3R22A 1H1SA 5DI1A 3V6RA 3W32A 5IEXA 4B99A 4IFGA 3L9PA 3PXFA 4KKHA 4FTUA 5IG1A 3I6UA 4HZSA 2BPMA 4QTDA 4O82A 2OJJA 2YEXA 2R7BA 4ZSGA 2IPXA 4TN6A 5T6KA 3DU8A 2WNTA 4ZSEA 5IA3A 5LOHA 2C0TA 5E8XA 4NZWB 3P86A 2QOHA 4U5JA 4I5MA 2QNJA 3MFRA 3FMMA 1OM1A 2YLFA 4I23A 4E73A 5KZIA 2CPKE 1OPLA 4MEDA 1APME 5BMMA 4CCBA 5IUHA 5EW3A 4PX6A 3OCSA 2PL0A 5BUJA 2O0UA 1GOLA 3DKGA 3G9LX 4ZSLA 3CTHA 4IJPA 4BDFA 3SVVA 4RFYA 2CGXA 3CKWA 3QRUA 3QQGA 2XJ1A 3HV6A 4FT3A 4QMVA 1F5QA 4AT3A 5A9UA 2I7QA 3FQEA 3R7YA 1JVPP 2X4FA 4O1OA 4OTDA 2VV9A 1X8BA 2WOTA 3QLFA 1OL6A 3C4WA 4ASEA 3LOKA 4GVJA 4YZNA 3HDNA 4V05A 3P7AA 3RPSA 4EOPA 4F6UA 3SW4A 2H6DA 4PDYA 4YJUA 1QMZA 4MXAA 4D5HA 4BDKA 1YDSE 5TO8A 3BRBA 4C37A 3KN5A 4L7FA 3RP9A 4QP9A 3T3UA 4JLCA 5DT4A 5IDPA 3L9MA 2PVMA 3FKLA 4GMYA 2DWBA 5CANA 5JKGA 5AJQA 2VX1A 4IAIA 5E7RA 4ZSJA 4EQUA 2VAGA 2WMAA 4O0RA 4JQ8A 5HICA 4FG7A 4BF2A 3LJ2A 2J2IB 1BX6A 1XJDA 4MF0A 4OAUC 2OJ9A 4D2VA 3FXXA 4E5AX 1GNGA 1YW2A 3TKUA 2BRHA 1PXPA 3D2IA 2A27A 1YQJA 5BUEA 4FV8A 4MK0A 4A4LA 4C33A 4PTEA 4FMQA 5IA2A 4TYEA 3R01A 4UN0C 5I9XA 2FVDA 5JN2A 3A99A 4BCPA 4QQJA 2DS1A 2OBJA 2XM9A 4ZS0A 4CFFA 4EZ7A 5CAUA 4KIPA 3LJ0A 2G9XA 2P3GX 2X39A 4JJRA 3JS2A 4IM0A 4USEA 3ZZEA 3IKAA 1ATPE 4MD7E 3A7HA 4AOTA 2WTJA 4V0GB 2QQ7A 3JPVA 4RIXA 2XNMA 5TE0A 4Q5EA 5EM5A 4E6QA 3SX9A 2CNVA 5BPYA 2OICA 4DINA 4NM3A 3ATSA 2YM6A 5LXMA 1Q61A 3ZMMA 4BY9E 1G8AA 5HGIA 4NIFB 4DAWA 3RZBA 5IQGA 3F6XA 2YAKA 2UW4A 4E5BA 4UMQA 1V1KA 2XKCA 3FE3A 2J6MA 5IA5A 4G5PA 5KKRC 3SKCA 3QCXA 3O8TA 4QP2A 2XIYA 5BYZA 4AOJA 4AT4A 4AXAA 2A2AA 3E8CA 4CLJA 3U6IA 3QZFA 4QMYA 5E92A 3ZFXA 2OJGA 1H00A 3H0YA 3QQKA 4ZOGA 4HVGA 2C3KA 4YZCA 4JT3A 4CFVA 2QHNA 4E20A 2WO6A 4ENYA 2H96A 3Q5IA 1RQQA 3TUCA 3U55A 3E63A 3F7WA 3R28A 5HI2A 3LJ1A 5A4TA 3K2LA 4U7ZA 2QLUA 3R9OA 3V8TA 4AFEA 4CT2A 3BYUA 5D7AA 3PVGA 3T9TA 4KA3A 3IW4A 4ACHA 2P4IA 4BDHA 2BALA 2W1EA 3EQPA 3PDTA 5FUTA 2ZV8A 4P90A 1LEZA 3D4QA 5LCKA 4E93A 5LWMA 3DBEA 3DK7A 4O2ZA 4RC4A 5EH0A 1YXVA 3B2TA 5HD7A 3DAJA 2VWIA 4RA5A 4OBOA 5CWZA 5K3YA 2C69A 3ZLWA 1MUOA 3KU2A 4I5PA 4F65A 5CEPA 2HELA 5GZ9A 2UV2A 3VNTA 2JKKA 1KE8A 4GU6A 4K6ZA 4MXOA 1PMNA 4QMOA 4RJ4A 1Y6AA 3FZTA 5DGZA 2GS6A 2AC5A 4C2VA 4CNHA 5L8KA 3PLAE 2P2IA 5HEZA 3UQGA 3W2RA 4BZDA 5IH5A 3R21A 2PPQA 4IC7A 4B9DA 4EZ5A 1ZOHA 2EB3A 2PUIA 4B4LA 1UKHA 4DH1A 3FHRA 4IQ6A 2VTLA 4IAYA 4IWDA 2QONA 3DPKA 2QKWB 1MP8A 5A4LA 4L00A 3GQLA 4YJNA 1RJBA 4Q5HA 2UZVA 3VQUA 2WPAA 4QRCA 4PPBA 3VUDA 4GFOA 4G9CA 1Q8ZA 5HNGA 5IU2A 1ZZ2A 3EQHA 2BMCA 3LM5A 4X6QC 4FGRA 4LV8A 3KA0A 2IN6A 2I0VA 4BTFA 2XIZA 5DIAA 5IDNA 3QCYA 1A48A 2VGOA 4Y85A 4D2PA 3QQHA 3QTRA 5CAQA 3I7BA 4W8EA 3GCSA 2C30A 3ZO3A 4DC2A 3SG8A 3A7IA 4OUCA 3UVQA 2W1ZA 4O27B 2VWXA 3V5QA 3KK9A 5HBHA 3HV5A 4JDKA 3G0FA 4YC3A 4G1WA 3BQRA 4WHZA 3TV6A 4EOJA 2YWVA 4OTHA 3QTQA 4JRVA 5ICPA 3HRFA 3FPMA 4R8QA 3VULA 4WT6A 3ZXZA 3H0ZA 4PV0A 3AGLA 4EK5A 4M8TA 5L2WA 3V5WA 1KOAA 3DFCB 3UE4A 5M07A 4ANBA 4PL5A 5HG8A 4NCTC 1J7LA 5IQCA 5L6WL 2BAKA 3HMIA 4Y72A 1VJYA 4IB3A 2VTOA 2WTKB 2ITUA 5CEMA 2IZUA 4OTQA 3DKFA 3FZRA 2F57A 4MD8E 2PZYA 2BHHA 3Q4CA 4MNEA 5DWRA 4G17A 3MIAA 2GMXA 2BTRA 1J91A 4LUDA 5EM6A 5C9CA 4AGCA 4L45A 2QO9A 3IK3A 3R8PA 4FOBA 2YIQA 1O6YA 3AMBA 2BFYA 3FKOA 3QRJA 3MH0A 1G3NA 3COHA 4G9RA 4RIWA 5HESA 4WA9A 3UQCA 3GU5A 3PRIA 1A9UA 4X2JA 4EKKA 4P7EA 5KHXA 5EQEA 3UOKA 2FB8A 4PP9A 5J95A 3L8VA 3VW6A 3OFMA 4RWJA 4M67A 3BHYA 4EQCA 1PYXA 4AA4A 4KABA 4AOIA 5K5NA 2FSTX 3QTUA 4N70A 4BTKA 5F9EA 2KTYA 4BCJA 2VU3A 3GC9A 3AC4A 4QYEA 5E8TA 4F7LA 3UIUA 3MJ1A 4U9AA 4ACGA 4YJSA 4TTHB 5AUUA 2RG6A 2BRNA 2IVUA 3PXRA 1XKKA 4KSQA 5KCVA 2OH4A 5BQ0A 2BDFA 2OXYA 3MI9A 4HVSA 4IACA 2CCHA 4LGGA 4UXQA 1IA9A 5M06A 2BDWA 3OTVA 3DJ6A 3NYVA 4FIJA 4DEIA 5EK7A 3D9VA 3AQVA 3R1QA 2C1AA 4EONA 2PZ5A 3VUKA 5CQWA 3O50A 2VUWA 5JFWA 3ZYAA 2HZ0A 4ACMA 2BZKB 4M68A 4V0GA 2QC6A 3DDPA 3LCSA 2UZOA 4ID7A 4AZTA 4BFMA 2HXLA 4OBQA 3IO7A 4BI1A 3FLSA 2WMWA 5DH3A 5J8IA 3VBVA 3O23A 3DBCA 3CY2A 3K5VA 3D15A 4KIKB 4UYNA 4JG6A 4YZMA 5T68A 4M69A 4DEAA 4DTBA 5M08A 4USFA 4RGJA 2QOOA 3P23A 4GK3A 1W8CA 3D7TA 2PHKA 3QC4A 3CKXA 1FGIA 3PVWA 4UYAA 5I3RA 2VTHA 1GZNA 2ITQA 2X2KA 5FEDA 2GNLA 4XV2A 1NVSA 3QU0A 2PVNA 5E90A 3OOGA 5CENA 2XYUA 3LLAA 4LOQA 4IB1A 2R2PA 4FSWA 5AR7A 3UVRA 5GJFA 4HVHA 4S31A 5FG8A 2ESMA 2DYLA 2FUMA 3ZM9A 3V01A 5K0KA 5L6PA 1Q4LA 3NNWA 4F7SA 3DJ7A 3NUYA 3KVWA 2GDOA 3GCQA 3HECA 3O7LB 4RC3A 3IOPA 3PWDA 3KK8A 3BE9A 4MYGA 5FQDC 3TNWA 3KN6A 4UZHA 3I60A 3SAYA 3S95A 2FO0A 1PXMA 1NXKA 2GQGA 3G5DA 5TR6A 1PMEA 2ITPA 4FV4A 3JY0A 2IW6A 1PW2A 2YM5A 5CT0A 3HP5A 1IEPA 4NTSA 3R7OA 1YKRA 4J52A 4NYEA 3KXGA 4Z55A 2QU6A 3WILA 2PMLX 4U81A 3RZFA 1JWHA 5CF8A 3CJGA 1ZOEA 3Q3BA 3TNPC 2X1NA 3PE2A 4PTGA 3W1FA 3FSKA 3H30A 3UIXA 4E1ZA 1JSVA 5JH6A 3EN9A 4U41A 1AQ1A 4RBLA 5TF9A 3GT8A 3VBYA 4TYGA 3ZLYA 4QTEA 1VYWA 4D0XA 5M57A 4FNXA 1Q5KA 4F9BA 3KVXA 4D4SA 2FSMX 3QZGA 4DLIA 4HGSA 3KCFA 2ETKA 2YM7A 3OF0A 4WUNA 3NWWA 2JITA 4I0RA 3PA4A 4I24A 3CXWA 3FUPA 4RWIA 4Y5HA 3O7LD 5L2QA 5LMAA 4KB8A 2RL5A 4BYJA 5L2IA 1OL2A 2YLEA 4UZDA 5EDPA 3ZBFA 3D5WA 1JAMA 4W9WA 4H3QA 3ZC5A 1B38A 5HO8A 3HA8A 3NCZA 3PXQA 5L6OA 4HW7A 2P33A 3LXKA 1YWVA 3QD2B 3ALOA 4QYFA 1OKWA 4TL0A 4FL1A 4IADA 4C02A 2VGPA 3MH1A 4BCQA 5BVOA 2B1PA 1JKTA 4OW8A 1J3HA 3L9LA
chains in the Genus database with same CATH superfamily
4XOZA 5JEBA 4NJ3A 3R6XA 5HE2A 4X2FA 4NFNA 4H39A 4YLKA 3V5PA 1YHWA 2XKEA 3HNGA 4PF4A 2WAJA 3UODA 3VQHA 1BUHA 4HYUA 2ITNA 4TKSA 3HAVA 1B39A 3ODZX 3TT0A 4FV6A 3SA0A 3NYXA 1XQZA 4Z3VA 3FKNA 3GCPA 2Q83A 2YISA 3C1XA 5J1WA 3KRRA 3GENA 4TNDA 4XG2A 1W82A 3VS5A 2BZIB 4TYHA 4CV8A 4EQMA 3FXZA 4FBXA 2PVRA 5DR2A 4R3RA 1OIRA 1A06A 2ETMA 3BX5A 5FEQA 4UALA 3QHRA 3OOMA 2PVYA 2R3RA 3TNHA 1W7HA 2VTPA 2XNOA 3QCQA 2R3MA 2Y7JA 3D0EA 1SNUA 3FL5A 5DLSA 4EH8A 4F09A 3SXRA 2PK9A 4MQ1A 2CN8A 4B8LA 3QX4A 4EUUA 1TVOA 4XP3A 4I6HA 4XG6A 4RA4A 5HIDA 3SV0A 5GHVA 4O7YA 4EH7A 3WF5A 2CKPA 4ACDA 5G6VA 4LRJA 3ZO2A 2C5YA 1YI3A 3GP0A 3F7ZA 4FV3A 4M0YA 3Q4UA 1QPEA 4APPA 3VN9A 4Q2AA 3N4VA 2GTNA 3ZFYA 4BCMA 4AU8A 2VTIA 3NUNA 4V01A 2R4BA 2XIKA 3NR9A 5A54A 2HWOA 4J7BA 5DR9A 5LMKC 5CU4A 4K33A 3GU7A 4YP8A 3IG7A 4PDSA 5I9UA 5AV3A 5L8JA 4C8BA 4HNIA 1OPJA 4MX9A 5EKNA 1OKZA 3HLLA 4PTCA 3UMWA 3IW8A 3WYXA 5I4NA 3UVPA 4FIGA 5KUPA 3UBDA 1UWHA 3W16A 1Q8UA 4FR4A 4H1MA 1CDKA 5JQ8A 3V8WA 4QMUA 1FGKA 3ZCLA 4C58A 3IW7A 3W10A 3VS7A 3KREA 2OI4X 4W8DA 2BIYA 3SRVB 4FIEA 3DKCA 4M69B 3QTSA 2YIXA 3BWFA 3NNUA 5KBQA 5CLPA 2ITOA 4CMUA 3ZSHA 4PY1A 4JR7A 5HX6A 2EVAA 4YLJA 4P4CA 3VBQA 5GNKA 5HE3A 2OU7A 5E1SA 3HX4A 2VNWA 3TNQB 5LCJA 4R77A 1BMKA 4C38A 4XNEA 4ERKA 3G51A 3BLAA 3C0GA 3QWJA 3ZH8A 5KO1A 2Z60A 4M97A 4F1TA 3GNIB 3ITZA 4YJVA 5M56A 2XK3A 3RPOA 5JRQA 2YWPA 4JRNA 5BVEA 4FVPA 3PRFA 3W2SA 4FL3A 3JVRA 1GY3A 4F0IA 3W0NA 2ZOQA 3ORIA 5AV2A 4FTRA 3U9CA 2WB8A 3UIBA 5EW9A 4BGGA 4NFMA 2XEZA 3UP7A 3JR1A 3L8XA 3HDMA 3O71A 3NW7A 3HUCA 3EWHA 3QD4A 1WBWA 3O0GA 3BHHA 5CT7A 5J1VA 5IQHA 3K54A 3R8UA 3ZZWA 1URCA 4DFXE 3NFGB 3LW0A 3HA6A 3BBTB 4L43A 2WU7A 3GOKA 5FWKK 1H0WA 5EDQA 3QKKA 4EH6A 2Y6MA 5AP0A 3FY0A 3MPAA 3P08A 3BL9A 3KXHA 4M66A 2QOBA 4YO4A 4OTGA 5HG5A 2C3LA 2IVTA 1I44A 2R3LA 4L3LA 4AE9A 3TZ7A 5K0XA 4AGDA 3PFYA 3R7VA 5CYIA 1KE6A 2J4ZA 5JK3A 4DCAA 3F3ZA 5HCYA 2WTDA 1IR3A 4FKOA 1H1QA 1ZXEA 4IFCA 3UJGA 2X8EA 3C13A 4NEUA 2W9FB 3OROA 2WTCA 1IAJA 2W06A 4DH7A 2Z02A 3WF6A 5HD4A 2R0UA 1CM8A 1GZ8A 2W0JA 4NK9A 2WEVA 2OZAB 4G6OA 4HOKA 5EG3A 3VUGA 3ZOSA 3VBTA 4DCEA 3MDYA 1KE9A 4ZJVA 4O1PA 5JGAA 3I0OA 5E8WA 3SC1A 2VZ6A 1Y57A 4D9TA 4F9WA 4QP7A 4L01A 5H9BA 5CEIA 5IQBA 2I0HA 4I94A 1G5SA 2PE0A 4Y95A 2Y4IC 3OW4A 3I6WA 4FNYA 1KV2A 4FTNA 2ZM4A 4RX9A 3P79A 4FZDB 4XH6A 5LMKA 2OW3A 4EOOA 1DI8A 4BICA 5HBEA 2KULA 4UY9A 5J87A 4YPDA 3ZSIA 2Z7LA 1RDQE 4U43A 3OHTA 3ORPA 3R9HA 4RIXB 2PUUA 5CEQA 4BKJA 4FE2A 4RVLA 1DM2A 1OECA 2PZIA 1NT2A 3RI1A 2QOFA 5HCZA 2ONLC 4CT1A 2XS0A 3JUHA 1OKYA 1B6CB 3DLZA 3HRCA 4FVRA 4G3GA 5JGDA 1ZWSA 2B55A 3E5AA 3TM0A 3MVJA 2C5OA 4E6AA 3F3UA 3EQFA 3NZ0A 4J95A 4FKRA 2WD1A 3RNIA 3MVMA 5H2UA 3NX8A 3PJ3A 2ITZA 4G6LA 4CFUA 3LKMA 3II5A 2HXQA 4J98A 2IWIA 4DFZE 3ZUVA 3R1YA 4GV1A 4U3ZA 5AP2A 4CKIA 2ZDUA 4UWCA 4XX9A 5CNOA 4LOOA 5G1XA 1YXXA 4EC9A 3CPCA 1YVJA 5CZIA 4ZZNA 5EQYA 3RVGA 4AW0A 3AOXA 3ZUTA 4DEBA 4JXFA 5D10A 3BV2A 2QVSE 3R2BA 4IBMA 3FZPA 4KKGA 2DUVA 2AYPA 4EOIA 2JLDA 4XS2A 4I20A 3AT2A 4D1ZA 2X7GA 3M1SA 4UB7A 4XLVA 3T9IA 2W5BA 2PWLA 1IRKA 3ATTA 3SLSA 3AXWA 3Q32A 4D58A 1ZARA 4FA2A 1RE8A 4IM3A 4D1XA 2VNYA 3CQWA 2WZJA 2WIPA 2J50A 4JQ7A 5C26A 4ZY5A 4G3DA 3F3TA 5TOZA 2YM8A 4QMWA 2LGCA 3RWQA 5CI6A 3WZKA 3ZO1A 4WUAA 1KUTA 3PIYA 4EL9A 1OVEA 4QDVA 4TY1A 3PP0A 1FVTA 1YDTE 2PVJA 2VWBA 2XNPA 3A8WA 4HZRA 4JBPA 2NP8A 4QMLA 5CU3A 1OI9A 4D2SA 2F2UA 3OEFX 3SHEA 4M84A 3Q5ZA 3LMHA 5ANIA 5DFPA 3CR0A 3ELJA 2WTKC 2CLQA 3QD3A 4G34A 3D5VA 2B9FA 3FYKX 3IW5A 2X81A 3DXQA 1OZ1A 3KRWA 4TYJA 3AD6A 3BU3A 3U4UA 3U6JA 5EI6A 3CSVA 4BDEA 5I9YA 4FKIA 4JG7A 4FEQA 3UMXA 3GOPA 4YZ9A 4UMPA 5HE0A 3UZTA 2YITA 1U5RA 2W1CA 3N9XA 2X0QA 4LMNA 5F94A 3EFKA 3VC4A 3GGFA 4AACA 2XBJA 4YURA 4EZ3A 1VR2A 2E9NA 5FGKA 4IHPA 3L8SA 4C7TA 1XHAA 4K77A 4O21A 3RAKA 2UZEA 3EMGA 5JFSA 3PJ2A 2RFSA 5JMSA 1UU7A 1XR1A 4KBCA 4U3YA 3ULIA 5C8NA 4Q9ZA 1U46A 4AX8A 3I7CA 5CAOA 4O7SA 2BFXA 4RIOA 3OW3A 2NRUA 3BWJA 1NW1A 1J7IA 3KRXA 4GK2A 3OBJA 4ZEGA 3NGAA 4GIIA 2ZV7A 3L9NA 3VO3A 1G8SA 5CY3A 2BHEA 3DA6A 4XBUA 2ZM1A 3MYGA 4W4YA 3RHKA 2GU8A 3ZU7A 4BI2A 1ZY4A 2R5TA 4A07A 1JSTA 2G2HA 2ZFYA 4FKSA 4ASXA 4C4JA 5M4FA 2WMUA 4XRJA 5LVNA 4FT0A 2HOGA 3ET7A 3QFVA 4ANNA 1H27A 2R3KA 4GKHA 5GINE 2XCHA 3QXPA 1Q99A 2EXEA 2CMWA 2DQ7X 4AZSA 4G16A 3F66A 3GC7A 3R0TA 3U51A 5KMKA 1S9JA 3Q6UA 5IQAA 4CFWA 4O0XA 1OUKA 2BRGA 1CSNA 1G8JA 4LGDA 3QX2A 3OUKA 4FSUA 4ZJJA 5E8VA 2XB7A 2W4OA 4YBJA 2EB2A 2OWBA 2F49A 4FZAB 3Q9WA 1H4LA 4C4EA 3VONA 2B7AA 5BNJA 4FTCA 4I0SA 3U9NA 4ANMA 5E91A 4EK6A 4L46A 4BTMA 2A19B 2WGJA 3WF7A 3HYHA 3RINA 2Z7RA 4DFLA 5L2SA 2A4LA 5DE2A 4BGQA 5DT0A 2XK4A 3PPKA 4GW8A 3QWKA 3MFTA 3FI4A 3QZIA 2IW8A 1P4FA 1XMLA 4WNMA 4TYHB 2R64A 3WZJA 2UVYA 3OZ6A 3FY2A 1UU3A 5AUZA 3M2WA 2RFDA 4P5ZA 4AAYA 1J1CA 2Y0AA 5CS6A 1STCE 2B52A 3E7VA 3RM7A 3MN3A 2CSNA 2I0YA 3ANRA 5ETIA 4BB4A 3NMUF 3PY0A 1YDRE 3IONA 3R8LA 3QALE 2QHMA 3VIDA 3BGPA 5LQFA 1OGYA 3NLBA 1LR4A 3CIKA 2Z8CA 3WBLA 2RFNA 2ITTA 2JFLA 2XVDA 3BELA 3MTFA 3R04A 1Z5MA 4O6EA 4QMMA 2PMNX 3WZEA 5BX0A 1Y8YA 2CGUA 3KMUA 3R9NA 2UW9A 2VO3A 2O63A 4HVDA 5IISA 5KMOA 5FBNC 3NUSA 4MVFA 2VWZA 4MTAA 3TIYA 4FEWA 5AX9A 3MA3A 4RIWB 4NW5A 4FYOA 4C4GA 3TG1A 1YXTA 5L8LA 4RLKA 3ZRLA 2XEYA 4F63A 3CD3A 3DKOA 4PMSA 5TT7A 5LVLA 3QHWA 3OT3A 3RPYA 3ZS5A 2UW0A 5AUXA 3WIGA 2RG5A 5CQUA 3UTOA 4R7IA 2BAQA 2AUHA 4WNOA 3ZBXA 3MBLA 3RNYA 3H4JA 3PE1A 4II5A 4PNKA 1GIHA 4JDIA 3RAIA 4AZFA 3I81A 3VS2A 3FMHA 4QQ5A 3ZC6A 3RM6A 4A7CA 3HRBA 4GIHA 4RPVA 4GL9A 4O0UA 4GFMA 5DA3A 1PHKA 3FQHA 2E9VA 2QOKA 3PXKA 4AXDA 3PVUA 4BVUA 4J8NA 2UW6A 5CEOA 3EN6A 5HTBA 4KS8A 1REKA 4BCGA 1BYGA 2JBOA 2WMRA 2ZM3A 5HX8A 4RX5A 1ZY5A 2RIOA 2XKFA 3R30A 4H3BA 4CQGA 3AGMA 3FYJX 3RBWA 5M4UA 3GU6A 2GTMA 4L53A 4JAIA 2EUFB 3QRIA 1HCLA 1ZYJA 4FG8A 2GHMA 2C3JA 1PF8A 2VTSA 4IAAA 1KOBA 3BHVA 3QGYA 3E8EA 4PNIA 3DTWA 2FSOX 4WRGA 3UC4A 2BCJA 1TZDA 4X21A 5H3QA 4RT7A 3MSSA 3QKLA 4TT7A 4BCHA 2ZDTA 4AGWA 4CTBA 4XBRA 4DEDA 4IAZA 4F78A 3DCVA 4U6RA 5HKMA 4EOSA 3VBWA 1WBOA 2WMTA 3OWJA 4JBVA 3H10A 2HENA 4G31A 5B2KA 3HEGA 4NT4A 1YI6A 2BRMA 4R7BA 1W2CA 3EIDA 3GVUA 2YIRA 1DI9A 5CVGA 3COMA 4FTAA 3EQCA 1JPAA 4S2ZA 4YC8A 3VAPA 2WQOA 1VEBA 3LPBA 3UG2A 2EXCX 5CVFA 4QP4A 4FT5A 2X0GA 4G6NA 2OSCA 4ZTRA 2BTSA 3S3IA 2XRUA 2WMQA 3CGOA 1UU8A 3MH3A 3B2WA 4YBKA 4MHAA 3FBVA 4CRSA 3B8RA 4NSTA 1YI4A 4CSVA 4CKRA 4O7RA 3F61A 2IZRA 4FZFB 3E93A 2QKRA 1ZMWA 2VWVA 3FC1X 5IQIA 2JDVA 4ALWA 1J1BA 2GQSA 3BEAA 3BI6A 4MF1A 3NYNA 3VS1A 4OAVB 5BVFA 3F5UA 1WCCA 4WG4A 3JXWA 4FF8A 5A14A 2YA9A 3AT4A 3NCGA 4XG3A 3VBXA 3E8DA 5DG5A 3EZRA 3GUBA 1CTPE 4OBPA 1AGWA 3ZONA 5I5ZA 3F5GA 4Y46A 4Y5QA 2VWUA 3EL7A 3RCJA 4AZVA 5CXZA 5E8UA 3AKKA 2O8YA 4O0SA 4BTJA 2HW7A 4O81A 1WMKA 2X4ZA 4BBEA 2YDJA 2WQEA 4ZJIA 4BIDA 2P0CA 5FBOA 4GUEA 5H8EA 3DQXA 4QPAA 2BUJA 2QODA 2PSQA 5C8MA 1UV5A 4ALVA 4KINA 2CGWA 1KE5A 1MRYA 3HMOA 4CXAA 4E4NA 5JRSA 5HOAA 4RWKA 3V8SA 5FXQA 4DEEA 2J90A 4IWOA 3S2PA 4FTMA 4FV1A 5F4NA 1GJOA 5HE1A 3R7GA 3LLTA 2JDRA 1IA8A 2ONLA 2XAOA 2J0KA 1TQPA 3OWLA 5CX9A 5KMLA 4CKJA 4BWXA 4O22A 4O4BB 4J8MA 1TKIA 5FTGA 1SNXA 4K18A 4RVMA 3F9NA 5FTQA 4E26A 4D5KA 3DTCA 3R9RA 4GT4A 4I5HA 4K2RA 3GU8A 2YDKA 3PLSA 1WBPA 3R1SA 3W8QA 2JDTA 1ZYCA 2JIVA 2F9GA 3DS6A 3LQ3A 3BKBA 4PL4A 1OGUA 4KAOA 5DT3A 2PE2A 4FSQA 4U40A 3BIZA 5FP6A 4JOAA 5AV4A 5F1ZA 2OG8A 4FTTA 4QO9A 5C4KA 4MXCA 1XO2B 2VX3A 4FTQA 3HV7A 3H9OA 4RJ3A 4IX4A 5GJGA 4E8AA 4IX5A 4EHZA 3EOCA 1OMWA 3NDMA 1T45A 5ETCA 4EYJA 3V3VA 4MBIA 4RC2A 1U54A 1M7QA 2X8DA 4FYNA 4F9CA 5A6OA 3ID6C 5JT2A 1XH9A 5T3QA 4M12A 5CSVA 2QOQA 1OPKA 2H8HA 4LYNA 4FKWA 4TZRA 4E4LA 4YSJA 4EEVA 3DGKA 4CVAA 4XV1A 4RQKA 5BVNA 4YUQA 4ZS4A 4BCOA 1R78A 4IEBA 5KMNA 3F2RA 3FSFA 3GBZA 3RMFA 4BCNA 3P0MA 4FV2A 4ITHA 4YTIA 3RAWA 3W33A 3EQDA 3ZUUA 4ZLYA 4L52A 1V0BA 2XF0A 2VX0A 4BCKA 4DGLC 5EI2A 4D1SA 5LVPA 3UOHA 4PUZA 3HAMA 4QMSA 4C34A 4U97A 2GS7A 5D41A 3VUIA 3MPMA 5I9WA 4IDVA 4O6LA 4UXLA 2UVXA 1CMKE 2JAMA 3MV5A 4R1VA 5DR6A 3DZQA 3TNIA 4MUQA 4R3CA 3EN7A 5BUIA 3R8ZA 2CLXA 3MW1A 1JKLA 5EDRA 4E6DA 3C5UA 4YTHA 3HKOA 3PUPA 5AR5A 4EWHA 3BGZA 5AAGA 2ACXA 1BL7A 2ITXA 1UA2A 3SOAA 1H0VA 1F0QA 3ZDIA 2IVSA 2R3NA 2WTIA 3A61A 2NO3A 4HJOA 3OMVA 5DEWA 3V51A 4B0GA 3UQFA 3W0MA 2JKMA 5D7VA 5JFVA 3O5AA 4GH2A 4EBWA 2Q0BA 4F6WA 4JAJA 4PDPA 3OS3A 4X3FC 4QYGA 5E8SA 4XG4A 4AZEA 2GPHA 3GC0A 3KC3A 1K3AA 3ORLA 1R0PA 4O7WA 4IX3A 3V5LA 5ETAA 5DOSA 3NEWA 4GK4A 2OFVA 2WXVA 2OLCA 4GFGA 1YOJA 4FSZA 4LGHA 4DFNA 4PL3A 5M53A 2JD5A 3MB7A 3Q53A 4TWOA 3MA6A 4DG2E 4AXFA 4MNEB 4IIRA 3A7FA 3C4EA 3PIXA 4ZLOA 4ZTMA 4KIQA 3RJCA 4CG9A 4BDGA 3U8WA 2G2FA 4C0TA 4GEOA 5E8YA 4GS6A 4QOXA 4F9AA 2HW6A 4BDAA 5EYKA 2OO8X 2Z7QA 3TMOA 1H07A 5F20A 4XYFA 5CALA 3FLZA 3VHEA 4E5WA 2VO7A 3AC8A 1DS5A 2E9PA 4I93A 3NYOA 5EW8A 2OF2A 4E7WA 1SM2A 2I6LA 3PSDA 2CNQA 4L67A 3ORXA 5HLPA 4MBJA 4CZTA 3IW6A 3R02A 3QKMA 4FIHA 3ZRMA 4AE6A 5DRBA 2WELA 3A7JA 4QMNA 1XH7A 4O0WA 3RTPA 4DDIA 1XBAA 2FGIA 4D4VA 4AW2A 3BZ3A 3L1SA 3HP2A 5GIPE 3BLHA 1H1WA 4ARKA 3UNKA 3AKJA 4R1YA 3F2NA 4E6CA 4FV0A 5C03A 3K5UA 4GU9A 4RQVA 5CSWA 3OWPA 2OH0E 2YFXA 4GYGA 2GNHA 3QYZA 4YGAA 1JSUA 5A3XA 3TV4A 4DG3E 2JKQA 3CGFA 2CKOA 3DLSA 4QEBA 5M55A 1H28A 3ZEWA 2BZHB 2ZAZA 4Z7HA 3E64A 3W0RA 5ANKA 3AG9A 2IO6A 2LAVA 3V5JA 5KNJA 1WAKA 2B54A 2C6KA 2PE1A 3ORKA 4A9RA 1JOWB 3OWKA 1HOWA 3D7TB 4HGEA 4ENXA 4ZTSA 5A46A 5A4QA 2O3PA 3PY1A 3IDPA 5ACBC 5DN3A 3ZHPC 2X8IA 1Q3WA 3DNDA 1V0PA 4J97A 4FX3A 4MAOA 5C1QB 1V0OA 1PRYA 2GHLA 4M15A 1UWJA 4S33A 3Q9XA 3KULA 5DPVA 4RIYA 2YIWA 5DHJA 5C27A 3EN4A 5HU9A 3BPRA 4O7NA 2C6IA 5BYLA 1UNLA 4O0TA 1YHSA 3A4OX 3H3CA 5EYDA 4QP3A 3ZTXA 3FHIA 5B2LA 3LCTA 4B6LA 3CLYA 4CFNA 1ZYSA 3RWPA 2VTQA 5KE0A 5I9ZA 3W0SA 2ETRA 1YHVA 1ZYDA 4CQEA 4WIHA 2OGVA 3I1AA 3IS5A 2BILB 4IZYA 4HPUE 3FMJA 2J7TA 3CP9A 3FMNA 4L42A 4QMPA 5K4JA 1ND4A 3DAEA 3KEXA 3VRZA 4RFMA 5EFQA 1P14A 4EORA 4FT7A 3LAUA 2XNGA 3CE3A 3GXLA 4GRBA 4WKQA 2R3PA 2WHBA 1U59A 2W17A 1ZMVA 2BAJA 5DMZA 4C35A 2QU5A 3QRKA 3TV7A 3P5KA 2QO7A 4YTCA 1Q62A 1JBPE 4IM2A 4C4FA 4FUYA 5IQDA 2UZLA 4FTOA 4JR3A 3LFAA 3CS9A 1UKIA 2JBPA 4MQ2A 5E8ZA 4TW9A 4AGUA 4EH2A 5HO7A 2IJMA 4E4MA 2GFSA 3VF8A 4KWPA 4CTCA 5KMJA 4FTJA 2RGPA 4YR8A 2A1AB 4FVQA 4JDJA 1M2QA 4FEUA 4O4CA 5M09A 2XM8A 3LFNA 2VO0A 5EOBA 3GU4A 3R00A 4FSRA 1KV1A 2YCRA 4HNFA 4WBOA 3VUHA 1Y8GA 3PWYA 5K9IA 1H1RA 4Y73A 4NKAA 3ORMA 4IXPA 4B8MA 3Q2MA 3LFDA 4C3RA 3P9JA 4DH5A 4EHVA 4CYJA 5K5XA 4FSYA 3FWQA 2C4GA 4DTKA 1BI8A 1XH5A 3NAXA 2FA2A 4IVCA 3HV4A 4FZ7A 3FC2A 3ZRKA 3P5JC 5CU6A 5FDXA 2C6MA 3NIZA 2B9IA 5CAPA 3TI1A 4WOVA 3QLGA 3O51A 3C5IA 5A4EA 1E9HA 2WQBA 2OXXA 2XKDA 4W9XA 2Z2WA 4IH8A 5JZNA 4ZK5A 4YHTA 3FXWA 5AUWA 3HGKA 2PULA 4NL0A 4JQEA 5CSHA 4DHZA 3EFLA 4FV7A 4RZWA 4N0SA 3MFSA 5F95A 2P2HA 3KKVA 5CI7A 2XK7A 4G2FA 1XWSA 3FMEA 3ORNA 4O4FA 4G3EA 4AZWA 3IECA 2CCIA 3SD0A 3AD4A 2B53A 3TZMA 4GKIA 3UZRA 3KXZA 4DT9A 4K9YA 4OTWA 3BBWA 4YJQA 5KMIA 2ZVAA 3S00A 1JLUE 4UWYA 4ANLA 4RJ8A 4DDGA 3RPRA 2C68A 5AR3A 2IVVA 1BI7A 2O65A 4P2KA 4DGGA 2BR1A 2XRWA 3OC1A 4HPTE 5AM7A 3QA0A 5AAFA 3HZTA 4K8AA 1LEWA 4IDTA 4AN2A 3KF4A 3PYYA 2PVLA 4OTFA 4OGRA 3VW8A 3QQUA 3Q6WA 1JQHA 1UVRA 2WEIA 3OXZA 1Q3DA 4PMMA 3VUMA 4TWCA 4AA5A 2VWYA 2X0PA 4AN3A 1OBDA 1I09A 1W98A 2OK1A 4I92A 1OIQA 2GNFA 5IQEA 3DXPA 2GNJA 4EWQA 1M7NA 4TYIA 4I22A 4QP1A 3CCNA 2A0CX 4H58A 3TL8A 4ANOA 1Y91A 4QNYA 3W8LA 4BRXA 4EI4A 1G8KA 4H05A 2V5QA 3ZXTA 5LJJA 3LQ5A 1XBBA 2OJFE 2J51A 4O7VA 1PXJA 4XOYA 5E4HA 3QD0A 3DXNA 3CTJA 3TZ8A 4DGNA 4RWLA 3LFEA 3WOWA 4FKJA 4WBBB 3PPJA 4QTBA 5AR2A 4ZTQA 4F7JA 5CASA 1H26A 3L8PA 4JIAA 5DNRA 4BR3A 4O91A 5AUTA 4FK6A 5M4IA 3R7EA 3F88A 3ODYX 4QTAA 4YJPA 2RSVA 3SDJA 3MVHA 4RJ5A 4FKVA 3G9NA 2C1BA 4WNKA 4JNWA 2PZPA 3DBQA 5FXSA 1YWRA 2WMBA 4MXYA 4D2WA 4L8MA 3A2CA 4UV0A 1M14A 2IW9A 3DB8A 2NPQA 4O86A 3ULZA 2R9SA 4PMTA 5HVKA 1ST4A 3C9WA 3PG1A 4LM5A 4Y83A 5ANDA 4FKGA 4FT9A 5HG7A 2W4JA 4XP2A 4MWHA 3WE8A 3TJDA 4CFXA 1FOTA 3ZEPA 2J5FA 4D4RA 3CBLA 4F6SA 5CAVA 3NUAA 3KQ7A 3M11A 1H08A 3LM0A 5HZNA 5FP5A 4EOLA 5HNIX 2Y8OA 3QBNA 3R71A 5HHWA 1OL5A 3OVVA 4RVTA 5J9YA 5J7BA 3QTIA 1PXOA 5IKWA 2C5VA 3MY0A 2XH5A 3RGFA 4KSPA 4EOMA 4R6VA 1Q8WA 2XIXA 3NPCA 4FK3A 3ROYA 4IVBA 3NSZA 1ZYLA 4CLIA 1CKPA 4M0ZA 4LRMA 3MH2A 3R8VA 4AXCA 3UPXA 5DEYA 2WFYA 3UNZA 2YN8A 3F82A 2XBAA 2IZSA 5CF6A 2W1HA 4ALUA 4F0FA 4N4SA 4F9YA 4G3CA 2OFUA 2X9EA 3KL8A 3QQJA 5FXRA 5JSMA 3B8QA 1K2PA 3AC2A 3OG7A 5HBJA 4DH3A 4BZNA 4HYHA 4FV9A 2G2IA 2GNIA 3R7UA 3UDZA 1HCKA 2XA4A 4IJ9A 5HTCA 4RVKA 3WE4A 5CEKA 4Z9LA 3GFWA 2W9ZB 2HAKA 1PMUA 4YSMA 1SVGA 5E1EA 2J0JA 4FRFA 3NNXA 2XANA 2FH9A 2ZYBA 2J0IA 3AT3A 1VZOA 4DBNA 4FTIA 3BU6A 2HIWA 1R39A 2AEGA 4FSTA 5LVMA 3BL7A 2J9MA 3ENMA 4NJDA 5JQ5A 3DNEA 1BKXA 4FOCA 2BVAA 2R7IA 4R5SA 4FSNA 1QPCA 1Q24A 3IOKA 3N51A 3QAME 2E9OA 4KBKA 2QD9A 4BYIA 2QLQA 1W0XC 2EXMA 3R73A 1IAHA 3CJFA 3BCEA 3VWAA 3PSBA 5IUIA 2PYWA 4XP0A 3EFJA 2UZTA 3Q60A 4U42A 4BZOA 3HVCA 3Q52A 4AF3A 3A62A 5LARA 2JGZA 4X2NA 4UMUA 1WFCA 4KKEA 4YZBA 2PMIA 5L2TA 2Y9QA 3JVSA 3LFSA 4ZP5A 1M52A 2YAAA 3EQBA 3QL8A 5ETFA 4BI0A 4FC0A 1Q97A 4LG4A 2RF9A 3EKNA 4EJNA 3D94A 3QTXA 1OBGA 2BROA 1XH8A 4YJOA 3MS9A 4D4YA 4IZ7A 4FKLA 2UZWE 3UO5A 3FQSA 4RFZA 2YCFA 3KXMA 4L68A 3DV3A 2XNBA 4A9YA 1CKIA 4YO6A 5BMSA 3OCTA 4K11A 1NVRA 4DGMA 5FDPA 5EQPA 1P2AA 3DBDA 3G0EA 4CV9A 3NIEA 4XG7A 4C59A 4F70A 1Y6BA 3BYVA 2JKOA 4ITIA 3PJCA 4FV5A 5D1JA 3NNVA 5DRDA 4EH4A 2IG7A 4ZMEA 2VRXA 4S30A 3FZ1A 3WARA 4G3FA 4M13A 4XV9A 5HLWA 3VUTA 2A98A 3ETAA 4QP6A 3E62A 2VTTA 4AWIA 3P1AA 4BDJA 1OIUA 2X6DA 2ZB1A 4FSMA 4Y8DA 5KZ0A 2W5AA 3I0QA 5EM8A 2I1MA 3PG3A 2X2LA 3PVBA 3WF9A 1YRPA 4TWNA 4F7NA 1R1WA 2OXDA 4NUSA 4WG5A 4EOKA 5IA4A 4AT5A 1WBVA 4RMZA 4HCVA 4RG0A 4LOPA 1XBCA 1DAYA 3D5UA 3KMMA 1QPJA 3FLQA 4NCTA 4O0VA 4XJ0A 3C51A 4APCA 5J79A 2C0OA 1YXUA 3BHUA 4Z7GA 1TQIA 4BDDA 4P5QA