3IOPA

Pdk-1 in complex with the inhibitor compound-8i
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
285
structure length
275
Chain Sequence
RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title The identification of 8,9-dimethoxy-5-(2-aminoalkoxy-pyridin-3-yl)-benzo[c][2,7]naphthyridin-4-ylamines as potent inhibitors of 3-phosphoinositide-dependent kinase-1 (PDK-1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 275
sequence length 285
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3iopA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3iopA01
3B8RA 3K3IA 3DZOA 3UE4A 4G3CA 3F5UA 4OTIA 2HZIA 2GNJA 2VNWA 3G0FA 4F1OA 3FKLA 2IW9A 3LFNA 5HTIA 3EWHA 3ZO3A 4JXFA 2PY3A 5AAGA 5L8LA 5DRBA 1ZY5A 2X6DA 2I0EA 4QP7A 2JDRA 3QTIA 3UIBA 3UG1A 3ZEWA 2QOKA 2EVAA 4PMTA 4IX5A 3PVWA 5HG8A 2O8YA 1PW2A 3EZRA 3EKNA 3UC3A 3HYHA 3MH1A 3VQUA 4PY1A 3HRCA 3BKBA 2OJGA 4O21A 2R3PA 4X2GA 3W2PA 3NPCA 5H8GA 4EBWA 3KK9A 4IB5A 2JFMA 3R7VA 4C37A 3C9WA 1YDRE 1M7NA 3SXFA 1JNKA 3LPBA 3UVPA 4MCVA 4E4NA 4OBOA 1ZOHA 3LLTA 3OC1A 2WMXA 4U6RA 4F65A 4RLLA 2ITNA 3PVUA 2OIBA 3G9LX 3ITZA 2PE0A 2R3IA 3LFQA 4E4MA 2VTLA 1GY3A 5CQUA 3VUDA 2QONA 2X7FA 2PVRA 1YXXA 4DEIA 4HVHA 1KE5A 4IJPA 3IONA 4I20A 3E8DA 4IM3A 5DI1A 5HNBA 2YM4A 3BZ3A 4WNPA 2CCIA 4XCUA 4RJ8A 1CTPE 2RG6A 4RQVA 4XG8A 4DEEA 1YXUA 5BVKA 5HCZA 3QD0A 5KMMA 4NM0A 3FMHA 4O0TA 4QMTA 3CP9A 3MW1A 3VIDA 5BYLA 3AD5A 3ENHA 4O2PA 3VS2A 2ETMA 1AQ1A 3PXKA 5M08A 3S3IA 2BKZA 2BROA 3CS9A 4YZNA 3WE8A 4BDCA 4YTCA 2IN6A 3HDNA 2QLUA 1PYXA 5HBJA 5M4IA 4B6LA 3GU7A 3MDYA 1OKYA 1UU8A 3MH3A 3R30A 4Q9SA 1VJYA 4EK8A 3RM7A 3ZC5A 5DT3A 3JY0A 5J1VA 4K33A 3TG1A 2BRMA 4Z3VA 3LFSA 4W9XA 3FLWA 4CGAA 2YWVA 2JBPA 4QP4A 3TEIA 4YO4A 3OW3A 4J53A 4KABA 3D9VA 2IZTA 3VUTA 1JSTA 3I81A 4FX3A 5DRDA 4DFNA 3HX4A 1KE7A 4L53A 4JIAA 4S34A 4D28A 5I9WA 3HLLA 1DM2A 4JAIA 3KF4A 3I1AA 3RWQA 4BGHA 5KKRB 4MX9A 3DZQA 2WOUA 3A8WA 4LYNA 4RIWB 4YSMA 4GJ2A 3LXKA 3NVKI 3WE4A 3DV3A 1LEZA 2OIDA 2XCHA 2W1DA 2ZMCA 4WBBB 3MVMA 3G51A 4NTSA 3A7JA 4PNIA 2EUFB 3ELJA 3Q9WA 4QMSA 2R2PA 4I0SA 4OTGA 3C4WA 2YCSA 5BVDA 2OH4A 3AXWA 5CAOA 4Z7GA 4WOVA 2FYSA 2BUJA 4UWCA 4XRLA 3W8LA 4BRXA 4NL0A 4RX8A 3V5TA 3R8PA 5L6PA 4BCMA 4YTFA 2CN8A 3V6SA 4IWOA 2AC5A 4CXAA 2ZOQA 2B9IA 2IZRA 3FYJX 4ZLZA 3TKHA 2W1ZA 4ERKA 3VBQA 2C0IA 3GFWA 2ITWA 4F0IA 4QP8A 5HG5A 3RBWA 4AT4A 5E8WA 3AC8A 4CTBA 4DINA 2CNVA 1OBDA 3PJ1A 2EB2A 3OW4A 3RPOA 4AA5A 4F9AA 1Q8UA 3HA8A 2PPQA 5KMKA 5L6OA 4I22A 4C2WA 1R1WA 4JG6A 2CDZA 4YZDA 1J7UA 3VHKA 5KMIA 3NAXA 3KY2A 1W82A 3A8XA 4L46A 5I0BA 4IANA 3A2CA 2H34A 2WHBA 2UW0A 3BE2A 3F6XA 4GK2A 4ITJA 3OWKA 4QYFA 1K9AA 4HYIA 4BDDA 2ITOA 1KV2A 1UVRA 3M11A 3EH9A 3OG7A 1PKDA 4HOKA 5EHYA 4ZTLA 2XP2A 2GS7A 3PE2A 3QQGA 5M06A 2OJ9A 3NIEA 2PUPA 5HORA 1XBBA 3NLBA 3H10A 3WZKA 2IO6A 4MXOA 4YHTA 4F9WA 3PRFA 5EDRA 4FKPA 5CALA 1OL6A 1TQIA 3H3CA 2C6MA 4O6LA 4GIIA 4PF4A 3M42A 5DLSA 2C5NA 2XK7A 3UO6A 3CY2A 3G6GA 3G90X 4KA3A 3ZM4A 1ERKA 4DC2A 2X7GA 3QUDA 3UZTA 3DDQA 4X3JA 2PUUA 3C7QA 4YZ9A 4RVLA 1H1PA 3CR0A 3MSSA 4G6OA 5AEPA 3COKA 1PXLA 3QXOA 4CKRA 4EWQA 4TYEA 4IB1A 1ND4A 4TW9A 3FI4A 3IECA 3ZFYA 1JAMA 3ZU7A 5HNIX 4PP9A 4S2ZA 1M7QA 1OKZA 2RGPA 2X2KA 2A27A 3GU5A 3DFAA 4XX9A 4MHAA 5DR2A 4FKWA 4LV8A 3V8SA 1O6YA 3VS4A 4XBUA 4O7VA 4FV4A 1ZXEA 3MTFA 1WBTA 5AR3A 3OOGA 4FV8A 4JRVA 3W10A 4CZTA 3G0EA 1PXNA 2X8DA 4RWLA 2QODA 4FKSA 5IA3A 2VZ6A 3JY9A 2PVMA 5DH3A 4D2RA 4E20A 5IA4A 4RFZA 4J8MA 4MBJA 4NJ3A 4YC6A 3V3VA 4HPUE 4H05A 3ACKA 3EL7A 3LOKA 5EM7A 3MIAA 3AC3A 1BI8A 3QA0A 4FNZA 3ZHPC 1Z57A 4IHPA 4NKAA 4RZVA 4LMNA 2YIQA 4IAAA 3RPSA 3BWFA 4DG2E 3CPBA 3R2BA 4GSBA 1WCCA 2YHVA 5EM5A 3G33A 1OM1A 3FMEA 4GK4A 2OO8X 3CCNA 5CEPA 1OZ1A 5AX3A 1R78A 2Y4IB 3KREA 4GT5A 3PG1A 5L3AA 4XS2A 3A7HA 3T9TA 2XRWA 4AZEA 2EWAA 2UW4A 2BHHA 3A4PA 1YDSE 4UYNA 2WTVA 2CKPA 4TWNA 3CGOA 2PE2A 2YCRA 5FEDA 4U41A 4XG9A 3HVCA 4N6YA 4BI0A 5CXZA 2I0YA 3DK7A 4L3LA 4RG0A 2CNUA 1OKWA 4MQ1A 4YJRA 5J7HA 3FKNA 3P1AA 5LOHA 3AMAA 4RIWA 4FGBA 3UO5A 4D9UA 3NIZA 3QTRA 3R1SA 4PMSA 4FG9A 4ZZNA 2C5OA 1KOAA 4M67A 3DKGA 4AG8A 2W1FA 3UOKA 2IWIA 3F3WA 3QD2B 1DAWA 2QR7A 3BV3A 4BFMA 5HIEA 2VWBA 1KE9A 4BDEA 3EFJA 5JH6A 3PJ8A 3VF9A 4CYJA 2WTKB 2VWYA 4IVCA 4LGDA 4APPA 3OS3A 5LVLA 3FZPA 2R3OA 2CCHA 4FKTA 4GUEA 5I3OA 3AT4A 5A6OA 2ZV2A 2PK9A 2YN8A 3EOCA 3FKOA 5LVNA 3R9OA 3BYSA 3QTUA 4MWIA 3UDBA 3LHJA 4CMUA 4QMLA 2HWOA 2XK4A 4GU9A 4IDTA 4MXCA 5EW8A 5H9BA 5CTPA 4NTTA 3PIYA 4B7TA 4O81A 4L8MA 2CKEA 2JAVA 4F9BA 5ACBC 3AGMA 1I09A 3OBJA 5ETIA 2NNWB 5BUEA 4ITHA 3I6WA 2GNGA 2QU6A 2Z7RA 3P5KA 2QD9A 2UW5A 3NNUA 3PZEA 3QRUA 3E88A 4GVAA 3PJ3A 4MK0A 5CSWA 1BKXA 2XVDA 5FM3A 2J0IA 3ZSGA 2CLXA 5E90A 4G3DA 5HKMA 4ZK5A 2YIWA 5EW9A 2OXYA 2I0VA 2H9VA 3IO7A 1FMKA 3WI6A 4EK6A 4IIRA 4JDHA 2IPXA 5JZJA 2UVZA 1OIUA 4K6ZA 3UIUA 3U54A 5HE3A 3ZLXA 4EUTA 5HTCA 2YIXA 4QPSA 3PSDA 4IMYA 3TTIA 5E4HA 2WTWA 2P2HA 3VUHA 1SVEA 3KMUA 4M68A 3QKLA 4FL2A 4O0RA 1ZMVA 4CT2A 2PVYA 4JIKA 4L7FA 3D4QA 3M1SA 5GNKA 3CE3A 3REPA 4DG0E 5CX9A 3EHAA 2WFYA 3IW8A 4K9YA 5DFPA 5DMZA 5CENA 5TE0A 3NYVA 2UZEA 3KF7A 3UC4A 4D55A 4I6QA 5FM2A 3HKOA 4C3RA 3U9NA 4RFMA 4ZEGA 5CANA 1J7IA 2X6EA 2RFEA 3E7OA 2IVVA 4RQKA 3C4EA 4R3RA 4TXCA 4O0WA 4XV1A 5C01A 3RALA 3ZMMA 4IW0A 2OF2A 5JQ5A 3RPVA 4RX9A 1JOWB 3V51A 4EKKA 4YPSA 3ZONA 2PZIA 5AP3A 3FYKX 4CLJA 2GS6A 2J4ZA 4ZTHA 3IDCA 4R6VA 4E93A 1PMNA 3VVHA 5D12A 5KKRC 2YIYA 5F94A 2J51A 3H4JA 3S4QA 3FPMA 5HCYA 3U6JA 4RPVA 4D4VA 3MA3A 3WZEA 5T68A 4I6BA 1XQZA 4C34A 1YWNA 4XHKB 3NNWA 5D7AA 3O17A 4BYJA 1PXMA 4YURA 3QF9A 5DN3A 2R0IA 3NAYA 5CSXA 5IQAA 5B2KA 3UZRA 1P14A 2RIOA 5CLPA 3PUPA 2H6DA 4M69A 2ETKA 5FXQA 3BHHA 4CFWA 5AV2A 1PF8A 3VO3A 4ZSAA 2PWLA 5JT2A 3OCBA 1YI4A 2WMSA 4LRKA 2O63A 3E3PA 2G2HA 4HYSA 4F08A 1Z9XA 3DLZA 4QMXA 5HX8A 4DT9A 4Y46A 3EYGA 4LGGA 4BDAA 3F2RA 1MRUA 1T46A 3R9RA 4AQCA 4MYGA 3MYGA 3ZUVA 3ZUTA 2J0KA 5KMNA 3BWJA 2R3KA 4UMPA 3R0TA 3U4UA 3ZFXA 5K5XA 2JD5A 2XKDA 4IADA 2W96B 5JQ8A 4M3QA 4I4EA 2PUNA 4KRDA 4X2FA 4WNMA 3FC2A 4DFXE 4QP2A 3QGYA 3O7LB 4JDKA 4OT6A 3RNYA 3R01A 3Q4ZA 4GKHA 1FVVA 2P33A 2OK1A 2P0CA 5LARA 4C36A 3PLSA 5HCXA 2XK8A 4F9CA 4HNIA 4JI9A 4LQMA 5AADA 1OECA 4FKLA 3CTJA 2ITQA 5B2MA 3HAMA 5AIKA 2X8IA 1SVGA 3QKMA 2E9OA 2WNTA 2DWBA 5JGBA 5FEQA 3R02A 4FOCA 3SG9A 3LCKA 4JR7A 5AR4A 4B99A 4EH7A 3F5XA 5CNOA 3QQHA 2P55A 4NWMA 2OKRA 3LM0A 4W4YA 4ZY4A 3CTQA 3K3JA 3IDBA 2F57A 3V6RA 3RPRA 3NS9A 1WFCA 2X4FA 4TWCA 4GU6A 1GIHA 4EC9A 4FL1A 4AZSA 4TKSA 3KEXA 4ZMFA 2XIRA 4W9WA 3BHTA 3Q5ZA 3KA0A 4L45A 4NIFA 3ZYAA 1ZMWA 4AN9A 3ORTA 4ZZMA 3CQEA 4EYMA 3MB6A 4M7IA 4FSRA 4HPTE 3KXXA 2BALA 3TIZA 5HOAA 4E6DA 4E4LA 2QOHA 3R8LA 4HVDA 4O6EA 4ZAUA 3FQSA 4EH5A 3Q6WA 3VS0A 4BZDA 4EWHA 3S00A 4TN6A 4GVJA 2YM8A 1WBNA 4U44A 4B8MA 4GK3A 5IUIA 4EOIA 4EUUA 2GHLA 4EK4A 3E87A 3Q04A 2ZDTA 3QQJA 3GQIA 4HGEA 2B1PA 4GS6A 3SGCA 2FSLX 4EHZA 3BHUA 2YAAA 3HUCA 3UP2A 2OSCA 3NNVA 4I4FA 3IKAA 5HE1A 5JRSA 3OT8A 2EU9A 3BELA 4APCA 2ZVAA 3IQ7A 4G6NA 5EI8A 1KWPA 2XIXA 3BGQA 3BI6A 1Q97A 4CTCA 3VS1A 4AWIA 1HCKA 5EQEA 1JBPE 2YM7A 1P5EA 1PJKA 2GNIA 2O0UA 3OEFX 4TYGA 4BDGA 5KUPA 3QTXA 1UWJA 1GIIA 1YQJA 2WMBA 3OEZA 4LL5A 4XYFA 4AE9A 4FIEA 4NCTA 1NA7A 2GTNA 4FSYA 5E8XA 2Y4IC 4JG7A 3BEGA 5FTQA 3HECA 2BZHB 2YZLA 3VRYA 3FUPA 2YAKA 3SG8A 2G2FA 4K8AA 3KXGA 3OWJA 3ZBXA 3FMMA 5A4CA 3O8TA 4PL3A 4TNBA 4FSNA 2ERKA 4LOOA 4C3FA 4O82A 1Y8GA 4P7EA 2W1EA 4BDIA 1IA9A 4XG3A 4Y73A 2OJIA 3UBDA 3EL8A 2J5EA 4E3CA 3M2WA 4M97A 4CZYB 4L3PA 3AC4A 1QCFA 1NW1A 3LMHA 4RSSA 5BVOA 3FI2A 4CCUA 2Y4PA 3BE9A 2GCDA 4EH4A 5AM7A 2ACXA 3CC6A 1SNXA 2WTKC 3IK3A 4F0GA 2QKRA 3GB2A 5CT7A 1GZNA 4F70A 4YJUA 2UVYA 4KIOA 4F0FA 2C5VA 4O27B 1GZKA 1UNLA 1M2PA 1YHSA 2ZM1A 4FNWA 4L6QA 2WTCA 5M51A 5CZIA 1XH4A 4GYGA 4OUCA 4O86A 2BHEA 5M4FA 2ITPA 2XNPA 4I0RA 4C4FA 2HY81 4AOIA 2QOFA 2GMXA 4BCIA 2BR1A 3GCUA 4IVDA 4QYEA 4A4XA 4BYIA 2VWVA 1IRKA 4WT6A 2WQOA 3LCOA 3ANQA 1H08A 3NW6A 3JXWA 4FK6A 4IB3A 4WIHA 5TR6A 3DXPA 4DTAA 3EQIA 3PJ2A 3AC2A 5LXMA 4ZLOA 3FMDA 3EQFA 3R7EA 3ZLWA 4XMOA 2CPKE 3GEQA 3DBEA 3Q9ZA 3RP9A 2R64A 3IW5A 1WBOA 3H0ZA 3PXZA 4S32A 4UY9A 4N4SA 4YBKA 4ANMA 1ZYJA 4TT7A 2B7AA 3RI1A 3PDTA 4UWBA 4RWJA 2VO0A 4D1XA 1OKVA 1O6LA 3GGFA 3NCZA 3PP1A 4IWQA 1NT2A 4DFLA 3FSFA 2VRXA 2V22A 4CCBA 3R6XA 5LJJA 3QFVA 1UNGA 3QLGA 3EFWA 2WMTA 4O22A 4W8DA 1GAGA 4FR4A 4BDJA 1MP8A 3AT3A 4K18A 4OLIA 2C3IB 2XYUA 3MI9A 2W5AA 3F5PA 4NCTC 2ITTA 5DWRA 3ZO1A 4AXAA 5BUIA 3N4TA 2REIA 4NEUA 3S2PA 4EOPA 3C0HA 3PP0A 2ESMA 4KIKA 5CSVA 3VQHA 2O3PA 4BR3A 4AZFA 3CXWA 1YXVA 3QD4A 3AC5A 4O7TA 4YR8A 4ANOA 4F09A 3GC9A 3MWUA 3L1SA 3QX2A 3QC4A 4MF1A 3V5LA 4EC8A 4F9YA 4YUQA 2BAKA 3T8OA 4GUBA 2Z60A 3WF6A 5C26A 3PTGA 4Q5HA 4X21A 1ZMUA 2GU8A 4YSJA 4Z55A 3EQGA 3QU0A 2C6LA 1STCE 2FSTX 4R3PA 3I6UA 4RC2A 4OTPA 5CF6A 5LVMA 3FAAA 3GFEA 3SOCA 3UOJA 2QHMA 3BLHA 4IH8A 4AAAA 4I94A 4EORA 3BYOA 4BCGA 4OTRA 1YXSA 4RVTA 2FGIA 2WTDA 3W8QA 2HZNA 4FT5A 4GH2A 2XKFA 1KSWA 1V0PA 2W06A 2BTSA 4QQCA 2JIVA 4WUNA 4QNYA 2Z2WA 1UNHA 4AW1A 1XKKA 4BCNA 5I3RA 3UNJA 2ITZA 2C1AA 1QPCA 4IC8A 4PTGA 3VBYA 4M66A 2G1TA 4C4IA 3A61A 1XH8A 4EOSA 5BVNA 3QRIA 1F5QA 3TNHA 2OW3A 5HNGA 1LUFA 4ID7A 4WA9A 4XOYA 4DH1A 3F7ZA 2UW7A 4U97A 4J98A 3COMA 2Y8OA 3P4KA 4DFZE 2OXXA 3Q9YA 3UIXA 3E3BX 5EDQA 3RCDA 3DQWA 3CKWA 4PL5A 4DH8A 2OJJA 3E8CA 2WKMA 3W2OA 3W2QA 3T9IA 4UMTA 3UJGA 2A4LA 3EYHA 1KE8A 5H3QA 3RAIA 1TQPA 3BYUA 3FC1X 3O51A 4RC3A 3VJOA 3O96A 3HMPA 2QU5A 4PUZA 2R3RA 2WELA 2WPAA 3MPMA 3W55A 4IB0A 3CIKA 5CVFA 3HMMA 4A7CA 5M53A 4NK9A 3HP2A 3R7UA 1XJDA 3BRBA 1PMEA 5AAFA 3AC1A 3GI3A 4G3FA 4ZOGA 3NUXA 5DR9A 4LFIA 4Y5QA 2UVXA 3EB0A 4YO6A 4MNFA 5K0KA 1ZARA 2HELA 5FDPA 2W1IA 3Q2MA 3BYVA 3P08A 4PPCA 4W4XA 2Q83A 5C4LA 3B8QA 1RQQA 2UZNA 3Q96A 2OF4A 5BVEA 3KFAA 1OPKA 4YP8A 4CRSA 4R1VA 1ZYDA 4UB7A 2E9UA 1U54A 4QPAA 5E9EA 4CFMA 5EHOA 4D5KA 3CLYA 3ULIA 3TACA 3OCGA 1PMVA 2O2UA 2QLQA 3OWLA 4G6LA 3B2WA 4UMUA 2C1BA 1DI8A 2YA9A 2WEIA 4FZFB 3ROYA 4BB4A 3D2IA 4L01A 4FEXA 3OROA 4QOXA 3K2LA 4UZHA 5AUWA 3C5IA 5F1ZA 2XA4A 2G9XA 3UOHA 1OB3A 4ZIMA 2YIRA 4QMWA 3LCSA 3MGYA 2JEDA 4QMMA 4IWPA 4R5YA 3ZEPA 2WOTA 1H24A 1YRPA 2V55A 3UMXA 1H01A 4YC8A 3Q4UA 4FVRA 3R63A 2WB8A 2PVKA 2SRCA 4GL9A 1P2AA 3QGWA 4NJDA 3CD3A 5AMNA 4CLIA 3FHRA 1OMWA 5IZFA 2WMWA 5L4QA 4FKOA 1UKIA 1YHWA 1ZZ2A 2VWIA 3EFKA 2F2UA 4RIYB 4MBIA 3KVXA 4X6RA 4BKYA 3DGKA 4A9YA 4WKQA 2CGWA 4FV9A 5I9VA 1GJOA 4MH7A 4CEGA 2YJRA 2XBJA 4UXLA 4JNWA 1A48A 4O7RA 4DFBA 5I9XA 2XNGA 1UU3A 3PVBA 1WZYA 5GINE 1JLUE 3PWDA 3MS9A 4UWYA 4AOTA 2HENA 1M2QA 4MQ2A 4BWPA 2PZYA 5GIOE 2OJFE 1KUTA 3SV0A 3GVUA 4FSZA 3JUHA 4CFVA 4CRLA 3CBLA 4ACHA 5LWMA 5M07A 1KV1A 2Y0AA 4QP6A 4EQMA 4MXYA 3WARA 2BRHA 2XM9A 4IZ5A 3W2RA 4E1ZA 1UV5A 4WSYA 1OUKA 4G2FA 4EHEA 3OMVA 4QQJA 5CF4A 3BYMA 4RT7A 1H1WA 4BBFA 4O83A 4HJOA 4RWKA 3IW6A 2XK6A 4UBAA 5JFXA 4ACGA 1OIQA 3L8SA 4P4CA 5E1SA 3QCYA 1S9IA 1FOTA 1Q41A 4P2KA 3RK9A 4ANSA 3ATTA 3PPKA 3CEKA 5CY3A 3NVMB 5CU2A 1W84A 4F6WA 1PY5A 2WU6A 3TNPC 2HOGA 2R4BA 1IASA 4AGCA 4G17A 2UZWE 4JDJA 2GNHA 5HGIA 2WTIA 3K5UA 4AP7A 4FA2A 2XYNA 1WBSA 4IAFA 4EH8A 1B38A 4YNEA 1XBAA 5CSHA 2IZSA 5CAPA 3EKKA 2VD5A 4EHGA 3C50A 2QKWB 2C3KA 3DK6A 3C13A 4IZYA 4OT5A 1F0QA 1E9HA 2ZDUA 4LOQA 4UN0C 2C69A 5AP2A 1OUYA 3MIYA 4GRBA 4E6CA 4C02A 4KIQA 4PTEA 2HIWA 3AT2A 3C5UA 3V04A 3BEAA 1YW2A 2H8HA 3GCQA 3LVPA 4A9RA 1DAYA 5HTBA 1OPJA 3UP7A 2B9FA 2C30A 2ZB0A 3BIZA 4X7QA 5IMEA 4G34A 3DBCA 4WUAA 4JDIA 3PXYA 5H8EA 1OIYA 2BFXA 2V7AA 3GBZA 3KMMA 3Q53A 4FIHA 4DA5A 3KB7A 3QTWA 4G31A 3C51A 4HCTA 1H00A 3II5A 3CQWA 4QPMA 4UZDA 4BI2A 5FXRA 2JIIA 2JKKA 3R04A 5IA0A 5H8BA 5HBEA 4AT3A 2J5FA 2XNEA 1A06A 4YLKA 3PWYA 3NW5A 3EQBA 4RJ6A 5FP6A 4BTMA 5J5TA 4KS7A 1FGKA 4FIJA 2HYYA 4FSMA 5AP7A 3RM6A 5I9YA 3FWQA 2GNLA 3KN5A 3SX9A 3D94A 3VUGA 4X6QC 3NWWA 1CKJA 3W16A 4FVPA 5KMOA 4ZS4A 3JS2A 2JIUA 1RE8A 2UW3A 5AUZA 3BCEA 3LFEA 1KOBA 4G9RA 4XH6A 3QRTA 3RZFA 2FUMA 4PDPA 5HZNA 1H1RA 3HRFA 2XIYA 1FVRA 3WILA 4DH7A 1J3HA 5AR7A 5HESA 2PMIA 4O0UA 4D2WA 4R5SA 3VJNA 4QD6A 4YHFA 4E5WA 4NFNA 4F64A 4MD9E 3DS6A 1UU7A 3OY3A 4R8QA 4TYJA 3TV6A 1W83A 3FXWA 1XO2B 2WU7A 3OTUA 4RIYA 4BWKA 1IR3A 4R1YA 2CKOA 3BLQA 3PIZA 1R3CA 2J50A 5AR5A 1PYEA 5F4NA 2WQMA 3P7AA 4JX7A 4ASEA 5A6NA 4X2NA 4H1JA 3PIXA 4V04A 5C1QB 3HV7A 2RSVA 1XWSA 1Q8ZA 3R7GA 3LE6A 2YLEA 3KXHA 5HHWA 3SRVA 2W0JA 1R39A 4M69B 2HW6A 5AP1A 4Y5HA 5EM8A 4PTCA 3W2CA 4AS0A 5A9UA 5GHVA 1I44A 3ACJA 3Q52A 5BX0A 5E1EA 3V01A 4II5A 5H2UA 4G5PA 5D11A 3MPAA 3VBXA 4D0WA 3H0YA 4RX7A 2WMRA 2W05A 3V5JA 4Q9ZA 3QL8A 4AW0A 3KKVA 2IZUA 4V01A 1BYGA 4FBXA 3NW7A 5HO8A 4JQEA 4FG7A 4X0MA 3BV2A 3MJ1A 3COIA 3EFLA 4C58A 4NH1A 3ORIA 4BBEA 4CKIA 3KCFA 3JYAA 3IPHA 5EG3A 2PL0A 5JGAA 3KRLA 1B39A 3FZRA 4KS8A 4XG6A 2J7TA 2A2AA 3ENMA 5D1JA 3QQLA 2CKQA 2VO6A 2UW6A 4EK3A 4PRJA 3MJ2A 4QMVA 3UOLA 2F9GA 3ALOA 5B2LA 3KCKA 1ZYSA 4RC4A 1ZLTA 3ORNA 4NFMA 4L44A 2LGCA 3ODYX 3ZTXA 1H25A 2NP8A 1RDQE 3A60A 3L9LA 4YJSA 4BL1A 1OI9A 4NM5A 3DNDA 1P4FA 2XKEA 5L6WL 5EYDA 2VGOA 3F3UA 3ANRA 3DBFA 3N51A 4GFOA 4QMNA 1Q3DA 2R3MA 5A4TA 4CV8A 1NXKA 2VWZA 4H39A 2X81A 2BRBA 4MXXA 4AX8A 3HV6A 4CG8A 4FT3A 4YJVA 4D1ZA 3FLQA 2XBAA 4NIFB 3FV8A 3QX4A 3TDVA 3A7FA 3QC9A 5F95A 4XRJA 2QC6A 5EYMA 3ZUUA 1H1SA 4BIBA 1XH7A 2C6KA 2B55A 1OL1A 2C6EA 3R22A 4U43A 4B8LA 4AE6A 2I1MA 4FTMA 4WRGA 2IJMA 3FZSA 4C35A 3WOWA 5FWKK 4AF3A 2YM6A 3GNIB 5AP0A 3I79A 3LJ2A 4OAVB 2JFLA 2VTPA 3WBLA 3ZRMA 4K0YA 4ALWA 2W5BA 2QOIA 3CD8A 5E8VA 5HBHA 5A4LA 3HL7A 4F7SA 2W99B 2G2IA 4LG4A 3KRJA 4HCVA 4QMZA 2DS1A 5KMLA 4PPBA 2OH0E 2BDFA 2XK3A 1NY3A 2DYLA 5TKDA 4DEAA 2EXCX 4FEQA 5DE2A 4EH9A 1K2PA 2XNOA 1KE6A 2J2IB 4QMYA 3QYZA 4JRNA 1JSVA 3MBLA 4UEUA 4Y85A 5EOLA 4QYYA 4CSVA 2BRGA 1VR2A 2UW9A 3QHRA 5BYZA 5IH5A 3LQ3A 2YJSA 3EJ1A 3H9OA 2LAVA 1U5RA 3WF8A 5HU3A 2PMLX 3P78A 3QUPA 2ITUA 3LW0A 3SVVA 3COHA 2P3GX 3PXRA 5EFQA 2OZOA 3C4CA 5B0XA 4LGHA 4ANLA 2PSQA 4I5PA 3EZVA 3D0EA 1BL7A 5J9LA 2PE1A 4FT9A 1JPAA 1Q3WA 4I93A 4ZSEA 4YTHA 1YI3A 3ZLYA 4FV2A 4QP3A 4BDHA 2BMCA 3F2AA 4J97A 4KAOA 4ZTMA 5M44A 2HCKA 5AV1A 5AJQA 4HCUA 5HQ0A 3QZFA 3SQQA 1S9JA 3WYXA 2GPHA 2GNFA 5A4EA 2ZB1A 4FNYA 1ZYCA 4KIPA 1H4LA 3QUEA 2GDOA 3VRZA 2VX1A 5LMAA 3EN4A 3FZOA 5C4KA 4OTFA 3CY3A 4IBMA 4HYHA 3OWPA 4FG8A 1L8TA 1H1QA 4XOZA 5AUVA 4TYIA 3T3VA 4CYIA 3W18A 4FV7A 3V5WA 3ZLSA 2XF0A 1CM8A 3OCSA 5GJFA 4BCOA 4QO9A 2A19B 1BX6A 3ODZX 4FIGA 2VTJA 4P5QA 4ZP5A 4BCHA 3GT8A 4H3QA 2R3GA 4IE9A 2G01A 3PRIA 4Q5EA 3UYSA 3C4XA 5JN2A 4LI5A 5IQEA 3BQCA 4CZUA 1CSNA 4H1MA 1TVOA 4HZRA 3KQ7A 4ZTQA 5KE0A 3UYTA 3ZO2A 3VBVA 3G2FA 4FSWA 2QO9A 2UZUE 1OBGA 4QMUA 2AYPA 2X2MA 3A62A 4CFNA 3QAME 3IW4A 4QTEA 3MB7A 5HVJA 4D9TA 3CSVA 4KWPA 3RHKA 1T45A 3PY0A 2VNYA 3MH0A 5HEZA 2R3NA 4AFEA 3WF9A 3FZ1A 4FKGA 5M57A 2BAQA 5IQFA 4E5AX 3GOPA 3LLAA 3EQRA 3O7LD 4NW6A 3GC8A 5HE2A 4BHZA 5M4CA 1H27A 4DEHA 5AR8A 3NZ0A 4I5MA 4NT4A 1L3RE 5DYJA 5GZ8A 2VWWA 4YLLA 5KX8A 4V05A 3SW4A 5HLWA 5TT7A 2OZAB 4J95A 3CJFA 5FDXA 1IEPA 4U40A 4KIKB 3HRBA 3OF0A 4G1WA 5EKOA 5I4NA 4G16A 2WAJA 2X4ZA 5M55A 4DYMA 1HCLA 3EN9A 4FKVA 3DAJA 4EOQA 5IQCA 4IFCA 3AMYA 5GZAA 1W0XC 4BCKA 4C3PA 5EH0A 3NUPA 4FSUA 4K77A 3DAKA 4QYHA 4ZSJA 5HE0A 4DG3E 4IVAA 4TL0A 3FI8A 3TV4A 4DH3A 1B6CB 4TWOA 3PJCA 2JDVA 5AV4A 4WBOA 1GOLA 3R8VA 1JWHA 3D7TB 3DKOA 1UU9A 4YTIA 5LWNA 3LFBA 2QO2A 3MPTA 3T3UA 5AA8A 1H28A 4YZMA 2XM8A 2PVHA 5IDPA 1ZOEA 5LCKA 2RFNA 2UZLA 3R1YA 3TUCA 5AP4A 5KZIA 4J99A 5LQFA 5GIPE 2B53A 1O6KA 3DKFA 1TQMA 4BIEA 4GJ3A 5L2IA 2QG7A 5JRQA 1YWVA 3C4ZA 2FSOX 3VBTA 3OUKA 5M09A 4N0SA 3U6HA 4KNBA 1UA2A 3I7CA 4KINA 4FV3A 4U45A 3WZJA 4OTQA 4C33A 5E7RA 4OTDA 4E7WA 4RX5A 4TTHB 5TF9A 4HGTA 3QXPA 4JBVA 2W4OA 5IUGA 3R9HA 3VF8A 3KL8A 4EI4A 3MFRA 5A54A 5ANEA 3KK8A 3ZZWA 3F3VA 5BQ0A 1WAKA 4GG5A 4IAKA 4JBPA 2CGXA 5DBXA 5IUHA 3EN7A 4EZ5A 5CEMA 5CF8A 4CG9A 5KZ0A 4BBMA 3VNTA 3A4OX 1PXPA 4O1OA 2B54A 2C0TA 2HXLA 2OICA 4I24A 4D58A 3ORMA 3DJ7A 2AC3A 4XNEA 4BZOA 3R7IA 3VN9A 2FSMX 3CJGA 4AN3A 3IDPA 1XH6A 2YERA 3FMJA 3D83A 2KULA 2B9JA 4IX4A 3HZTA 3U8WA 3HA6A 4ANBA 4EH2A 4WNOA 2NRYA 2Y6MA 2VTHA 3HV4A 3MFSA 3CTHA 4I92A 4Q2AA 4U42A 4WO5A 4YJNA 4YGAA 4C59A 4ASDA 4QMOA 3D14A 3AD4A 3C4FA 3RK7A 2WIHA 1DI9A 2YLFA 3PFQA 3ZRLA 4DEGA 1U54B 3IOPA 3SXRA 5IQHA 3VAPA 2FB8A 3K5VA 3MVHA 2PVFA 3MVLA 4BN1A 4TYHB 3BPRA 1J91A 4TRLA 2O5KA 3AGLA 2X2LA 4CNHA 2BPMA 3ET7A 2XJ2A 1IA8A 1PXIA 4L7SA 4WRSA 5CNNA 4FUYA 3UNZA 4D0XA 2QOOA 3UGCA 4QQTA 1FVTA 3FSKA 1XH9A 2CMWA 3TNQB 2PYWA 4YC3A 2VTTA 3PG3A 2VUWA 4NYEA 5IEYA 2FH9A 3OD6X 4OBQA 4ZMEA 4JX3A 3TZ9A 2VGPA 5JK3A 4PMMA 4DITA 1IAJA 1PRYA 2OG8A 1REJA 4ACDA 4ZZOA 3FE3A 3NDMA 5AUXA 5HO6A 2PVLA 5A14A 4ZSLA 4X3FB 3DB6A 5CXHA 4FTNA 4EEVA 2XK9A 3ZFMA 4F6SA 2GQSA 3NYNA 4R78A 5CI6A 2IG7A 4FKRA 3GCPA 2C4GA 3JR1A 5ANOA 4RVMA 4BIDA 2KTYA 4D1SA 4GT4A 2ONLA 4XLVA 5CF5A 3R7OA 4WG3A 4FT7A 3HUBA 4BCPA 2ZAZA 2J9MA 3TI1A 4RJ7A 3W1FA 3NYXA 4CQGA 3F61A 3R9DA 4E4XA 4L00A 5E8ZA 2PMOX 3P7CA 2CGUA 3ETAA 4FTJA 3AQVA 4H3PA 2C3LA 4E26A 3F82A 5CI7A 4J1RA 3PY1A 3F9NA 3UVQA 2O65A 4M12A 5AUYA 2JKMA 3OOMA 2QI8A 5FP5A 4BDFA 1JKTA 4ZXTA 4KB8A 4EYJA 2OZAA 4I0TA 3OZ6A 1W98A 3PZHA 3LMGA 2E9PA 3F3TA 2VAGA 5IQBA 4DBNA 2VTQA 4EZ7A 1H0VA 2HXQA 3NX8A 4AW2A 2R3JA 2C47A 3FXXA 3R2YA 4C8BA 2FVDA 3KRXA 2VTOA 4LMUA 4NZWB 3UZPA 1DS5A 4O2ZA 2BILB 2X9EA 3R28A 4FK3A 4QP1A 3F7WA 4MD7E 1JKKA 3HGKA 1J1CA 2R0UA 4ANQA 4U79A 3NNXA 3NUSA 1XBCA 5JGDA 5EI2A 2HZ4A 5IISA 4FE2A 4IEBA 2JGZA 4D2VA 1Q61A 3D7TA 4HNFA 4B9DA 5BMSA 2YEXA 4J96A 4DH5A 2J0LA 3TZ8A 2R9SA 4W4VA 5T3QA 4IXPA 4X2JA 2WMUA 3L9NA 4EOLA 4CQEA 1MQBA 4FODA 5E8UA 5A4QA 4JOAA 1MUOA 4IZAA 1XR1A 1H0WA 4GCJA 1V0OA 3O2MA 3VW6A 3ZRKA 2Z02A 4DAWA 3VS5A 5C03A 5IG1A 2F7ZE 3D5WA 3G5DA 3QD3A 4HW7A 1BLXA 4F4PA 2CN5A 2G15A 2W4KA 1VYWA 2P2IA 2WD1A 3TUBA 4Y83A 2DUVA 3P79A 4TZRA 1YKRA 1YVJA 2X8EA 3DBDA 4HYUA 5FEEA 3UO4A 3UVRA 5J7BA 4RZWA 2EB3A 2VWUA 2Y6OA 4G3GA 5CVHA 4IC7A 1YWRA 1CMKE 5DNRA 4C61A 4HVGA 4GEOA 1U46A 5KCVA 5DIAA 1R0EA 3TKIA 2XJ1A 3FMKA 4PX6A 3UQGA 3UPZA 4D2SA 4J52A 5DPVA 3HDMA 1H07A 1OVEA 2CSNA 1GNGA 3QRKA 5CWZA 4FYNA 3FLYA 5K3YA 4MF0A 3F69A 2X9FA 4A9UA 3MY1A 3RWPA 2XNMA 3GU6A 2YZAA 5F9EA 4U0IA 4F1MA 4ASXA 5FG8A 1V0BA 3KVWA 5FBNC 2WXVA 3RCJA 3BGPA 4G3EA 5FTOA 4FVQA 3DJ5A 4FTLA 5ANDA 1M14A 4KKEA 5B7VA 2B9HA 4I23A 3NMUF 1WBWA 4YBJA 4MEDA 2F7XE 1M17A 2HY0A 3PSBA 3ZZEA 4ENYA 4FEUA 4JT3A 4PDOA 4TYHA 5FUTA 2WMQA 4O0YA 5BVWA 5AAEA 4KSPA 2OFUA 4Y8DA 4BKJA 4RJ4A 2CHLA 3FJQE 3OFMA 3P23A 4XP3A 5TO8A 3TL8A 2Y9QA 2WMAA 3PPZA 2BRNA 3I5ZA 2E2BA 1QMZA 1WVYA 4EOJA 4GFGA 4PP7A 4G9CA 3Q9XA 3UMWA 1M2RA 2AUHA 3R9NA 3U87A 4A9TA 4E6AA 1Q4LA 4C4EA 1BI7A 3EMGA 3R00A 3E8NA 4J7BA 4FV0A 2Q0NA 4P90A 4XEYA 2JDOA 3L9MA 4ZTSA 1WMKA 4A07A 5AWMA 3DLSA 2XIZA 4FSTA 4RA5A 3Q3BA 4Y95A 3DY7A 4ORKA 5E8TA 4X3FA 3HP5A 3CKXA 4ZJIA 4ARKA 4BI1A 3P9JA 5DT4A 3MV5A 2XUUA 4ZS0A 3RK5A 3R8MA 4R77A 4K11A 4IM2A 2WMVA 4QMPA 5IMXA 5JZNA 3DPKA 3E63A 2GTMA 3GXLA 5C8NA 5IQIA 3EQHA 2WQBA 4CFUA 3QHWA 4O0XA 5ANKA 1UKHA 3ZXZA 3PPJA 1YOLA 2QOBA 3LFAA 4A06A 2XH5A 3TUDA 3U55A 1JSUA 3F66A 4XUFA 3TJCA 4MNEB 5G6VA 3SKCA 4PMPA 1RJBA 2J6MA 4USDA 3RGFA 4BTKA 2BFYA 4BDKA 3POOA 2VTRA 3I60A 3SRVB 4A9SA 4FMQA 3CGFA 2BTRA 4DGGA 1SVHA 2W9ZB 3SD0A 2PMNX 1H8FA 2UZVA 2V5QA 3DTCA 4AGDA 3EN5A 3I4BA 5KMJA 5JMSA 5FXSA 5CAUA 4IACA 4O7WA 3ZH8A 3N9XA 1LR4A 3KU2A 4W4WA 4YJOA 5FGKA 4XG7A 1Y6AA 1VZOA 4S31A 2J0MB 5HO7A 1TKIA 2NPQA 2VO7A 3NR9A 5CU4A 4D2TA 3U9CA 3F5GA 4WG4A 3SLSA 1H26A 2YM3A 2Z7LA 4ZTNA 3FXZA 1Q24A 1SM2A 3NSZA 4O7YA 4PPAA 1W7HA 1ZRZA 3KMWA 3NUUA 5CEKA 4DEBA 4EHVA 3DT1A 5EW3A 5JFWA 3K54A 5LMKA 2GFCA 4FTAA 4GMYA 4I21A 2CGVA 4UX9A 4IAYA 3TKUA 3DJ6A 3E64A 2ITXA 2VTNA 3HMOA 1ZWSA 3WZUA 2F4JA 3NEWA 3PXQA 2JBOA 2ZV7A 5L8KA 4BGGA 2GQGA 5E91A 2YDIA 3BHYA 3RHXA 2QNJA 2R3HA 2BZJA 1MRVA 3P7BA 4IQ6A 4C4HA 1FBNA 3TN8A 3KXZA 4C4JA 4BY9E 4O0VA 2PVNA 5GZ9A 2FA2A 4YU2A 3NGAA 3OCTA 4FKUA 4QP9A 4RVKA 3HNGA 3G6HA 5J9YA 2W5HA 3LCTA 3ORPA 4FKQA 3QRJA 4CFFA 2GQRA 2Q0BA 4BICA 1Y6BA 3THBA 2H96A 4AACA 4IM0A 4ASZA 2WO6A 1FGIA 4X3FC 4ALUA 3FY2A 3QQUA 3GCSA 4JJRA 4U3YA 5DGZA 2WEVA 3Q60A 2YACA 3C0GA 4D4SA 4D4YA 4I1ZA 4LM5A 3TZ7A 3RJCA 4DGNA 3R71A 3LQ5A 5AV3A 5TOZA 3SOAA 4C0TA 3WIGA 5D41A 2UZOA 2W4JA 4AT5A 3LXNA 3FQHA 1UWHA 2QR8A 3FI3A 3QTQA 4M15A 5BUJA 4BDBA 3EQPA 5L2WA 4I41A 2A0CX 5IQDA 5KHWA 4BCJA 4RLKA 3EIDA 4ONAA 5HG7A 4BKZA 3QQFA 4GW8A 3ZOSA 4FEWA 2V62A 5CU0A 3GUBA 3ID6C 3MA6A 4FOBA 4FTRA 1PKGA 1VEBA 4EQCA 4FYOA 5DOSA 2HWPA 2RFSA 3D15A 3ROCA 1PXJA 2WIPA 5IF1A 3GU4A 1BUHA 3ORLA 3B2TA 2UV2A 1Y91A 3OHTA 1QPJA 4KBCA 4V0GA 3LXLA 3QBNA 4XBRA 5J5SA 2V7OA 4EBVA 3CQUA 1MQ4A 1FMOE 2R5TA 2OXDA 2O64A 4QTAA 5J8IA 2BZIB 2ERZE 4L9IA 2OI4X 3LFDA 5BPYA 4PDYA 1HOWA 3TJDA 5HU9A 4JQ7A 3G15A 1G3NA 4BZNA 1Q99A 2VX0A 5A3XA 2BIKB 4PQNA 2UZDA 2W1HA 2XNBA 3QLFA 1WBPA 3S95A 1Q8TA 2PZRA 3OVVA 4KUJA 3DTWA 5J95A 4FV5A 2JAMA 5DVRA 3KXMA 4KBKA 4A4LA 5LMKC 4OBPA 1FINA 5ETCA 2X39A 3O23A 1NVRA 4YJQA 4ZJVA 4EOKA 2VU3A 4DN5A 4RIXB 1A9UA 2JDTA 4L68A 4O38A 2R3QA 2E9NA 3UIMA 4BTJA 4MNEA 4XLIA 3KRWA 1SYKA 2QOLA 3N4UA 3MTLA 4FNXA 3UTOA 1M52A 2BCJA 2IVTA 1YOJA 3AMBA 3O8PA 3W32A 2C68A 3FMNA 3D5UA 3PA5A 1JKLA 5GJDA 2QQ7A 3Q5IA 1E1XA 4E73A 4EONA 1GZOA 5ANJA 4EKLA 4QRCA 5CYIA 4FF8A 5CAQA 4AA0A 3VWAA 3KGAA 1QPDA 5IA2A 4JR3A 3E92A 3MVJA 4FSQA 4XG4A 3LJ1A 5KO1A 5HIBA 3Q4CA 1SMHA 4UMQA 3LM5A 3BU3A 2NO3A 2QOCA 2C6OA 5CT0A 3DXQA 4HVIA 1E1VA 4CVAA 5EOBA 4RJ3A 4CD0A 4ZTRA 5CU6A 4BWXA 4W8EA 3VULA 4E5BA 2PU8A 3NRMA 2VN9A 5AX9A 2GFSA 3A99A 3BGZA 4UXQA 3DBQA 4M8TA 4YZCA 4O7LA 4KRCA 1Y57A 5CS6A 2RF9A 4DLJA 5CAVA 4USEA 1IG1A 1V1KA 3H9FA 4FTKA 4RJ5A 1ZAOA 4BF2A 2B52A 3TNWA 3ZDIA 2YM5A 2ITYA 4FZ6A 2QURA 4PL4A 4C38A 4BC6A 4NKSA 3VUIA 4EH6A 4IWDA 3ZC6A 3MFTA 3OTVA 4B4LA 5IDNA 5DR6A 1CKIA 5FLFA 3SXSA 5CASA 4A4OA 4CMTA 4NSTA 4WHZA 4ACCA 3FBVA 5ANGA 2WZJA 5C8MA 3DOGA 5DT0A 3RMFA 3TXOA 4R7BA 3DA6A 3VW8A 4F99A 2BDWA 1XH5A 2W17A 3KN6A 3R1NA 4WNKA 2OLCA 3FL5A 5E92A 4F1TA 4L3JA 3UG2A 4BVUA 3UQFA 4MAOA 3WZDA 1CKPA 2JLDA 4Y72A 5ICPA 4I3ZA 2F7EE 3MN3A 5AFVA 2FO0A 3GQLA 4N70A 5FQDC 1GIJA 4U81A 5ANIA 5CU3A 3EN6A 3OXTA 2RL5A 3R1QA 4RFYA 4S30A 3UPXA 3DXNA 4AZTA 3L8PA 4BGQA 4C57A 3ORZA 2BDJA 2OBJA 2IVSA 3KC3A 5T6KA 5HD4A 3A7GA 2C6DA 3P86A 2RKUA 5CEIA 4M0YA 4XP0A 2R7BA 3P0MA 3ALNA 3SC1A 4AN2A 2YWPA 3RPYA 4Z9LA 3TV7A 4AOJA 2YFXA 2X0GA 3SDJA 5AV0A 4EQUA 3QZGA 4LRMA 4DE4A 4MXAA 1Q5KA 1BL6A 4JG8A 4GV1A 4EJ7A 5EYCA 2WTJA 3HMNA 2GS2A 4FIFA 5J1WA 5E8YA 1PXKA 5EKNA 4PDSA 3RZBA 5CSPA 3HV5A 2VTAA 4GT3A 2C6IA 3QTSA 4FZ7A 1OGUA 2J0JA 4DCAA 4FKJA 5IEVA 5KNJA 3LZBA 4USFA 2WGJA 1O9UA 5DHJA 3H30A 3TT0A 3ZS5A 3VBWA 4AGWA 1J1BA 4JQ8A 5KBRA 3LKMA 3FHIA 3MESA 2F49A 4HGLA 3GP0A 3GC7A 4U9AA 3JPVA 1URWA 1U4DA 5EDPA 3QWKA 2I0HA 4AZVA 3QCSA 5EQYA 3Q4TA 1QL6A 2QVSE 3QZHA 4NUSA 4RGJA 5JFVA 4O84A 2QCSA 2YITA 1Q8YA 3TDWA 4HZSA 3L8XA 4RIXA 4O7ZA 1YXTA 4I5HA 4HVSA 1OITA 3IOKA 3ORKA 5ETFA 5JEBA 5DG5A 4ERWA 5FD2A 5HVKA 2XEZA 5I9ZA 1URCA 3LFCA 3MY0A 5LVOA 3EQDA 3OY1A 4WD5A 4F7NA 3I0QA 4JBQA 1MRYA 3BHVA 1JVPP 2YDKA 3UNKA 1AGWA 4YJPA 4DBXA 5HLPA 3R8ZA 3BBWA 5EM6A 5GJGA 1SNUA 4FIIA 5HD7A 3MY5A 4GG7A 5JKGA 3WIKA 1K3AA 1WVXA 1ATPE 3N4VA 3SW7A 5KBQA 5L2SA 3RKBA 3IGOA 4LUDA 4YPDA 4N6ZA 5J9ZA 4AA4A 1LEWA 4U7ZA 3D2KA 2ZV8A 3E62A 4ITIA 4JS8A 1GZ8A 5G1XA 4IJ9A 3VS7A 5K0XA 2B4SB 2ZM4A 3BU6A 3FMLA 4QT1A 3ZBFA 5K5NA 4MWHA 2YCQA 4XP2A 2PTKA 1JKSA 3QCQA 3ZSHA 2XS0A 4O96A 4XV2A 3VS6A 5CEOA 4GKIA 3LIJA 4OW8A 2DQ7X 4QTCA 4K2RA 4LRJA 2UZBA 4ZJJA 4L52A 4C2VA 3VHEA 3D5VA 4R7IA 3FEGA 2C0OA 3FY0A 2CLQA 4ENXA 4MBLA 3O50A 3OXIA 2XZSA 4EL9A 2PZPA 4AGUA 2JKOA 3KULB 4GFMA 4M13A 1Q62A 3I0OA 4UALA 2OU7A 4IX6A 1NVQA 4OAUC 3SA0A 3H9RA 4IVBA 4ANNA 1OL2A 4FEVA 1PXOA 3V8TA 2ZMDA 3ATSA 2XRUA 2NRUA 5IU2A 3W2SA 2I40A 3TCPA 4C7TA 2XB7A 4JBOA 5F20A 2BZKB 4M14A 4JAJA 4O7SA 4Z16A 4C62A 3Q32A 2WQEA 1YDTE 4KKGA 5EK7A 2CNQA 3HAVA 4FL3A 4RA4A 1PMUA 3O8UA 4L43A 5IH4A 5IQGA 2RFDA 4MD8E 4BHNA 5L8JA 3IW7A 3O71A 4F63A 3MH2A 4PWNA 4B0GA 4AUAA 5HLNA 4NM7A 4LOPA 4OR5A 4PV0A 2C3JA 4P5ZA 2QO7A 5ITAA 2BAJA 4I5CA 2VO3A 1AD5A 3PA4A 4G5JA 2XEYA 3W33A 5AP6A 4Z7HA 1J7LA 5C9CA 5ETAA 2OIQA 5EYKA 4RRVA 3BX5A 3PA3A 4MTAA 3IS5A 4RBLA 2P4IA 5FTGA 4NU1A 3ORXA 4IZ7A 4J71A 4O0SA 5FBOA 1OL7A 3DAEA 3F88A 3L8VA 2R3LA 1YHVA 2YABA 4IDVA 1X8BA 4UV0A 3MFUA 4AZWA 5LCJA 3PLAE 1G5SA 4L67A 1ZY4A 3TZMA 3QWJA 4NM3A 4O7NA 2X7OA 5L2TA 3Q2JA 2YCFA 4YMJA 3DB8A 5AIRA 4YLJA 1FQ1B 4WG5A 4N57A 4AW5A 4TY1A 4D4RA 4RMZA 3NCGA 3BU5A 2B0QA 3L9PA 5IH6A 4EK5A 3FZTA 3NUAA 2UUEA 4M0ZA 2HAKA 2ITVA 3QA8A 2VTMA 3I5NA 4OTHA 2CJMA 4C4GA 4CMOA 2ZYBA 4DGLC 5EI6A 4EOMA 3DQXA 3E8EA 5J87A 3LCDA 2OWBA 4FV6A 1R0PA 5I9UA 4DGOA 4F6UA 4FZAB 4TWPA 4ZSGA 3LQ8A 5HX6A 2J90A 2VTIA 3IG7A 3LJ0A 3DU8A 3E93A 1NVSA 4BCQA 4FGRA 1ZOGA 4FTUA 4EJNA 3NUYA 2X1NA 3S0OA 2OGVA 2GHGA 4CV9A 5D10A 3IGGA 4JL9A 3D7ZA 3F3ZA 5CEQA 4F7JA 2XIKA 2RG5A 4I6FA 2IW6A 2E9VA 4KBAA 5CVGA 2UZTA 5LVPA 4DHFA 4NW5A 4TPTA 2W9FB 5AUTA 5BNJA 4IAZA 3S1HA 3PXFA 3LMIA 4DGMA 3PY3A 2HW7A 2EXEA 4ACMA 4L42A 2W1GA 5DEWA 2VV9A 3OUNB 3R7YA 3AG9A 2Z7SA 3QTZA 3SHEA 4DLIA 4ZY5A 4H3BA 5I5ZA 3Q6UA 3O0GA 4OTWA 5IPJA 4UYAA 4HGSA 4YNOA 5HG9A 3TNIA 3DCVA 4EH3A 1LP4A 1ZZLA 3HMIA 1APME 2Z7QA 5ACKA 4FKIA 3RAKA 3DKCA 3JVSA 4CKJA 3QQKA 3R21A 2F2CB 2IVUA 4DCEA 2XJ0A 3BBTB 2V0DA 3U6IA 3DNEA 4YHJA 1JQHA 3E7VA 3PSCA 1VYZA 3FLSA 3PYYA 4FTQA 2VWXA 4IAIA 1PHKA 3C0IA 5KHXA 3CPCA 3FPQA 2PZ5A 1FPUA 2YDJA 3E5AA 5A46A 3TM0A 3AD6A 4U80A 2PVJA 2ZJWA 4WSQA 3UODA 3LXPA 5JFSA 5K4IA 5HIDA 2BKKA 4ZLYA 3DDPA 4KSQA 2XKCA 4QTDA 5IKWA 3RINA 2ETRA 4AFJA 4DTBA 3R83A 5AP5A 3TWJA 1U5QA 5CQWA 3WF7A 3NUNA 2XNNA 5BVFA 1P4OA 3OBGA 3LAUA 3QYWA 5HVYA 2W7XA 1WVWA 4FT0A 1U59A 2R3FA 3KULA 3LFFA 3QALE 5AM6A 4H36A 2BIYA 3ZXTA 2C6TA 4FV1A 5BMMA 2GHMA 3EQCA 4FZDB 2HZ0A 2PULA 2JITA 2Y7JA 2JDSA 3F2NA 5IA5A 5AR2A 5LMBA 4R7HA 4U3ZA 5D9HA 4DEDA 3DK3A 3FLNC 4QMQA 1Z5MA 1Y8YA 1CDKA 3GOKA 4RWIA 2R7IA 1XHAA 3U4WA 5K9IA 4S33A 2JKQA 2QHNA 1RW8A 2Z8CA 1OL5A 4E6QA 3WF5A 1EH4A 4I6HA 2ZM3A 2UW8A 2JC6A 4XV3A 4JLCA 1SZMA 3NYOA 3BLRA 4MXZA 4OGRA 2BVAA 3POZA 4KD1A 5HICA 4FTIA 3QCXA 3U51A 2VTSA 1OIRA 5AUUA 3ULZA 5C8KA 3RAHA 3G9NA 2PUIA 3TIYA 3FLZA 3RTPA 3KRRA 3AOXA 1QPEA 3PVGA 4PNKA 1REKA 3JVRA 3TTJA 3ERKA 3I7BA 1IAHA 5BYYA 5AA9A 3ZCLA 2C5YA 3GC0A 3BQRA 3ZO4A 4J8NA 3GCVA 3GENA 4R3CA 4BCFA 4LL0A 4DFYA 4YJTA 4BTFA 4DT8A 4M84A 5DEYA 4U8ZA 1ZYLA 3ZDUA 3HEGA 3QZIA 4GYIA 4H58A 4LUEA 2HK5A 1OPLA 4QQ5A 5FRIA 4CFXA 3C1XA 3D5XA 4K1BA 4FTOA 3FQEA 4XG2A 4XJ0A 4DTKA 1YI6A 4FC0A 5CZHA 4JVGA 3RNIA 1WBVA 2W1CA 1G8AA 4TNDA 3V8WA 4D2PA 4GIHA 1BMKA 3VS3A 4IFGA 3R8UA 2ONLC 4D5HA 5D7VA 3ZM9A 5M4UA 4QTBA 2XMYA 3GU8A 2EXMA 4O91A 3QKKA 4F7LA 4EZ3A 2IW8A 3RVGA 3FDNA 3VUKA 5HI2A 5K4JA 2YISA 3VC4A 1LPUA 4O1PA 2VX3A 4LV5A 3ZSIA 3R73A 1W8CA 5L2QA 4MKCA 3UQCA 4ALVA 3RAWA 4U5JA 2OFVA 5J79A 2XCKA 4ZY6A 3A7IA 4MVFA 4FICA 4DF3A 5EQPA 3V5QA 3V5PA 4V0GB 4E8AA 3FL4A 4IX3A 4QYGA 4AU8A 4KKHA 3PE1A 3OXZA 4EOOA 4FI1A 4UMRA 2QOQA 5M56A 2ZV9A 4FTCA 4YZBA 3VUMA 1G8SA 3HV3A 5DA3A 5IA1A 3DFCB 2GSFA 1Q8WA 5EHLA 1YOMA 2I6LA 5E8SA 1F3MC 4QNAA 5C27A 5IEXA 2QG5A 4CT1A 4X2KA 3WYYA 3KXNA 4DFUA 4FTTA 2WQNA 4XV9A 2I7QA 3OT3A 3OP5A 4RIOA 2A1AB 4FUXA 3SAYA 2C5XA 5JSMA 2PHKA
chains in the Genus database with same CATH superfamily
3B8RA 3K3IA 3DZOA 3UE4A 4G3CA 3F5UA 4OTIA 2HZIA 2GNJA 2VNWA 3G0FA 4F1OA 3FKLA 2IW9A 3LFNA 5HTIA 3EWHA 3ZO3A 4JXFA 2PY3A 5AAGA 5L8LA 5DRBA 1ZY5A 2X6DA 2I0EA 4QP7A 2JDRA 3QTIA 3UIBA 3UG1A 3ZEWA 2QOKA 2EVAA 4PMTA 4IX5A 3PVWA 5HG8A 4QDVA 2O8YA 1PW2A 3EZRA 3EKNA 3UC3A 3HYHA 3MH1A 3VQUA 4PY1A 2A98A 3BKBA 2OJGA 3HRCA 2R3PA 4O21A 4X2GA 3NPCA 5H8GA 3W2PA 4EBWA 3KK9A 4IB5A 2JFMA 3R7VA 4C37A 3C9WA 1YDRE 1M7NA 3SXFA 1JNKA 3LPBA 3UVPA 4MCVA 4E4NA 4OBOA 1ZOHA 3LLTA 3OC1A 2WMXA 4U6RA 4F65A 4RLLA 2ITNA 3PVUA 2OIBA 3G9LX 3ITZA 2PE0A 2R3IA 3LFQA 4E4MA 2VTLA 1GY3A 5CQUA 3VUDA 2QONA 2X7FA 2PVRA 1YXXA 4DEIA 4HVHA 2X0PA 1KE5A 4IJPA 3IONA 4I20A 3E8DA 4IM3A 5DI1A 5HNBA 2YM4A 3BZ3A 4WNPA 2CCIA 4XCUA 4RJ8A 1CTPE 2RG6A 4RQVA 4XG8A 4DEEA 1YXUA 5BVKA 5HCZA 3QD0A 5KMMA 4NM0A 3FMHA 4O0TA 4QMTA 3CP9A 3MW1A 3VIDA 5BYLA 3AD5A 3ENHA 4O2PA 3VS2A 2ETMA 1AQ1A 3PXKA 5M08A 3S3IA 2BKZA 2BROA 3CS9A 4YZNA 3WE8A 4BDCA 4YTCA 2IN6A 3HDNA 2QLUA 1PYXA 5HBJA 5M4IA 4B6LA 3GU7A 3MDYA 1OKYA 1UU8A 3MH3A 3R30A 4Q9SA 3W0QA 1VJYA 4EK8A 3RM7A 3ZC5A 5DT3A 3JY0A 5J1VA 4K33A 3TG1A 2BRMA 4Z3VA 3LFSA 4W9XA 3FLWA 4CGAA 2YWVA 2JBPA 4QP4A 3TEIA 4YO4A 3OW3A 4J53A 4KABA 3D9VA 2IZTA 3VUTA 1JSTA 3I81A 4FX3A 5DRDA 4DFNA 3HX4A 1KE7A 4L53A 4JIAA 4S34A 4D28A 5I9WA 3HLLA 1DM2A 4JAIA 3KF4A 3I1AA 3RWQA 4BGHA 5KKRB 4MX9A 2AQXA 3DZQA 2WOUA 3A8WA 4LYNA 4RIWB 4YSMA 4GJ2A 3LXKA 3NVKI 3WE4A 3W0MA 3DV3A 3TMOA 1LEZA 2OIDA 2XCHA 2W1DA 2ZMCA 4WBBB 3MVMA 3G51A 4NTSA 3A7JA 4O4FA 4PNIA 2EUFB 3ELJA 3Q9WA 4QMSA 2R2PA 4I0SA 4OTGA 3C4WA 2YCSA 5BVDA 2OH4A 3AXWA 5CAOA 4Z7GA 4WOVA 2FYSA 2BUJA 4UWCA 4XRLA 3W8LA 4BRXA 4NL0A 4RX8A 3V5TA 3R8PA 5L6PA 4BCMA 4YTFA 2CN8A 3V6SA 4IWOA 2AC5A 4CXAA 2ZOQA 2B9IA 2IZRA 3FYJX 4ZLZA 3TKHA 2W1ZA 4ERKA 3VBQA 4O4CA 2C0IA 3GFWA 2ITWA 3UDTA 4F0IA 4QP8A 5HG5A 3RBWA 4AT4A 5E8WA 3AC8A 4CTBA 4DINA 2CNVA 1OBDA 3PJ1A 2EB2A 3OW4A 3RPOA 4AA5A 4F9AA 1Q8UA 3HA8A 2PPQA 5KMKA 5L6OA 4I22A 4C2WA 1R1WA 4JG6A 2CDZA 4YZDA 1J7UA 3VHKA 5KMIA 3NAXA 3KY2A 1W82A 3A8XA 4L46A 5I0BA 4IANA 3A2CA 2H34A 2WHBA 2UW0A 3BE2A 3F6XA 4GK2A 4ITJA 3OWKA 4LDTA 4QYFA 1K9AA 4HYIA 4BDDA 2ITOA 1KV2A 1UVRA 3M11A 3EH9A 3OG7A 1PKDA 4HOKA 5EHYA 4ZTLA 2XP2A 2GS7A 3PE2A 3QQGA 5M06A 2OJ9A 3NIEA 2PUPA 5HORA 1XBBA 3NLBA 3H10A 3WZKA 2IO6A 4MXOA 4YHTA 4F9WA 3PRFA 5EDRA 4FKPA 5CALA 1OL6A 1TQIA 3H3CA 2C6MA 4O6LA 4GIIA 4PF4A 3M42A 5DLSA 2C5NA 2XK7A 3UO6A 3CY2A 5BV3A 3G6GA 3G90X 4KA3A 3ZM4A 1ERKA 4DC2A 2X7GA 3QUDA 3UZTA 3DDQA 4X3JA 2PUUA 3C7QA 4YZ9A 4RVLA 1H1PA 3CR0A 3MSSA 4G6OA 5AEPA 3COKA 1PXLA 3QXOA 4CKRA 4EWQA 4TYEA 4IB1A 1ND4A 4TW9A 3FI4A 3IECA 3ZFYA 1JAMA 3ZU7A 5HNIX 4PP9A 4S2ZA 1M7QA 1OKZA 2RGPA 2X2KA 2A27A 3GU5A 3DFAA 4XX9A 4MHAA 5DR2A 4FKWA 4LV8A 3V8SA 1O6YA 3VS4A 4XBUA 4O7VA 4FV4A 1ZXEA 3MTFA 1WBTA 5AR3A 3OOGA 4FV8A 4JRVA 3W10A 4CZTA 3G0EA 1PXNA 2X8DA 4RWLA 2QODA 4FKSA 5IA3A 3UDSA 2VZ6A 3JY9A 2PVMA 5DH3A 4D2RA 4E20A 5IA4A 4RFZA 4J8MA 4MBJA 4NJ3A 4YC6A 3V3VA 4HPUE 4H05A 3ACKA 3EL7A 3LOKA 5EM7A 3MIAA 3AC3A 1BI8A 3QA0A 4FNZA 3ZHPC 1Z57A 4IHPA 4NKAA 4RZVA 4LMNA 2YIQA 4IAAA 3RPSA 3BWFA 4DG2E 3CPBA 3R2BA 4GSBA 1WCCA 2YHVA 5EM5A 3G33A 1OM1A 3FMEA 4GK4A 2OO8X 3CCNA 5CEPA 1OZ1A 5AX3A 1R78A 2Y4IB 3KREA 4GT5A 3PG1A 5L3AA 4XS2A 3A7HA 3T9TA 2XRWA 4AZEA 2EWAA 2UW4A 2BHHA 3A4PA 1YDSE 4UYNA 2WTVA 2CKPA 4TWNA 3CGOA 2PE2A 2YCRA 5FEDA 4U41A 4XG9A 3HVCA 4N6YA 4BI0A 5CXZA 2I0YA 3DK7A 4L3LA 4RG0A 2CNUA 1OKWA 4MQ1A 4YJRA 5J7HA 3FKNA 3P1AA 5LOHA 3AMAA 4RIWA 4FRFA 4FGBA 3UO5A 4D9UA 3NIZA 3QTRA 3R1SA 4PMSA 4FG9A 4ZZNA 2C5OA 1KOAA 4M67A 3DKGA 4AG8A 2W1FA 3UOKA 2IWIA 3F3WA 3QD2B 1DAWA 2QR7A 3BV3A 4BFMA 5HIEA 2VWBA 1KE9A 4BDEA 3EFJA 5JH6A 3PJ8A 3VF9A 4CYJA 2WTKB 2VWYA 4IVCA 4LGDA 4APPA 3OS3A 5LVLA 3FZPA 2R3OA 2CCHA 4FKTA 4GUEA 5I3OA 3AT4A 5A6OA 2ZV2A 2PK9A 2YN8A 3EOCA 3FKOA 5LVNA 3R9OA 3BYSA 3QTUA 4MWIA 3UDBA 3LHJA 4CMUA 3O5AA 4QMLA 2HWOA 2XK4A 4GU9A 4IDTA 4MXCA 5EW8A 5H9BA 5CTPA 4NTTA 3PIYA 4B7TA 4O81A 4L8MA 2CKEA 2JAVA 4F9BA 5ACBC 3AGMA 1I09A 3OBJA 5ETIA 2NNWB 5BUEA 4ITHA 3I6WA 2GNGA 2QU6A 2Z7RA 3P5KA 2QD9A 2UW5A 3NNUA 3PZEA 3QRUA 3E88A 4GVAA 3PJ3A 4MK0A 5CSWA 1BKXA 2XVDA 5FM3A 2J0IA 3ZSGA 2CLXA 5E90A 4G3DA 5HKMA 4ZK5A 2YIWA 5EW9A 2OXYA 2I0VA 2H9VA 3IO7A 1FMKA 3WI6A 4EK6A 4IIRA 4JDHA 2IPXA 5JZJA 2UVZA 1OIUA 4K6ZA 3UIUA 3U54A 5HE3A 3ZLXA 4EUTA 5HTCA 2YIXA 4QPSA 3PSDA 4IMYA 3TTIA 5E4HA 2WTWA 2P2HA 3VUHA 1SVEA 3KMUA 4M68A 3QKLA 4FL2A 4O0RA 1ZMVA 4CT2A 4LV7A 2PVYA 4JIKA 4L7FA 3D4QA 3M1SA 5GNKA 3CE3A 3REPA 4DG0E 5CX9A 3EHAA 2WFYA 3IW8A 4K9YA 5DFPA 1TZDA 5CENA 5DMZA 5TE0A 3NYVA 2UZEA 3KF7A 3UC4A 4D55A 4I6QA 5FM2A 3HKOA 4C3RA 3U9NA 4RFMA 4ZEGA 5CANA 1J7IA 2X6EA 2RFEA 3E7OA 2IVVA 4RQKA 3C4EA 4R3RA 4TXCA 4O0WA 4XV1A 5C01A 3RALA 3ZMMA 4IW0A 2OF2A 5JQ5A 3RPVA 4RX9A 1JOWB 3V51A 4EKKA 4YPSA 3ZONA 2PZIA 5AP3A 3FYKX 4CLJA 2GS6A 2J4ZA 4ZTHA 3IDCA 4R6VA 4E93A 1PMNA 3W0SA 3VVHA 5D12A 5KKRC 2YIYA 5F94A 2J51A 3H4JA 3S4QA 3FPMA 5HCYA 3U6JA 4RPVA 4D4VA 3MA3A 3WZEA 5T68A 4I6BA 1XQZA 4C34A 1YWNA 4XHKB 3NNWA 5D7AA 3O17A 4BYJA 1PXMA 4YURA 3QF9A 5DN3A 2R0IA 3NAYA 5CSXA 5IQAA 5B2KA 3UZRA 1P14A 2RIOA 5CLPA 3PUPA 2H6DA 4M69A 2ETKA 5FXQA 3BHHA 4CFWA 5AV2A 1PF8A 3VO3A 4ZSAA 2PWLA 5JT2A 3OCBA 1YI4A 2WMSA 4LRKA 2O63A 3E3PA 2G2HA 4HYSA 4F08A 1Z9XA 3DLZA 4QMXA 5HX8A 4DT9A 4Y46A 3EYGA 4LGGA 4BDAA 3F2RA 1MRUA 1T46A 3R9RA 4AQCA 4MYGA 3MYGA 3ZUVA 3ZUTA 2J0KA 5KMNA 3BWJA 2R3KA 4UMPA 3R0TA 3U4UA 3ZFXA 5K5XA 2JD5A 2XKDA 4IADA 2W96B 5JQ8A 2XANA 4M3QA 4I4EA 2PUNA 4KRDA 4X2FA 4WNMA 3FC2A 4DFXE 4QP2A 3QGYA 3O7LB 4JDKA 4OT6A 3RNYA 3R01A 3Q4ZA 4GKHA 1FVVA 2P33A 2OK1A 2P0CA 5LARA 4C36A 3PLSA 5HCXA 2XK8A 4F9CA 4HNIA 4JI9A 4LQMA 5AADA 1OECA 4FKLA 3CTJA 2ITQA 5B2MA 3HAMA 5AIKA 2X8IA 1SVGA 3QKMA 2E9OA 2WNTA 2DWBA 5JGBA 5FEQA 3R02A 4FOCA 3SG9A 3LCKA 4JR7A 5AR4A 4B99A 4EH7A 3F5XA 5CNOA 3QQHA 2P55A 4NWMA 2OKRA 3LM0A 4W4YA 4ZY4A 3CTQA 3K3JA 3IDBA 2F57A 3V6RA 3RPRA 3NS9A 1WFCA 2X4FA 4TWCA 4GU6A 1GIHA 4EC9A 4FL1A 4AZSA 4TKSA 3KEXA 4ZMFA 2XIRA 4W9WA 2IF8A 3BHTA 3KA0A 3Q5ZA 4L45A 4NIFA 1ZMWA 3ZYAA 4AN9A 3ORTA 4ZZMA 3CQEA 4EYMA 3MB6A 4M7IA 4FSRA 4HPTE 3KXXA 2BALA 3TIZA 5HOAA 4E6DA 4E4LA 2QOHA 3R8LA 4HVDA 4O6EA 4ZAUA 3FQSA 4EH5A 3Q6WA 3VS0A 4BZDA 4EWHA 3S00A 4TN6A 4GVJA 2YM8A 1WBNA 4U44A 4B8MA 4GK3A 5IUIA 4EOIA 4EUUA 2GHLA 4EK4A 3E87A 3Q04A 2ZDTA 3QQJA 3GQIA 4HGEA 2B1PA 4GS6A 3SGCA 2FSLX 4EHZA 3BHUA 2YAAA 3HUCA 3UP2A 2OSCA 3NNVA 4I4FA 3IKAA 5HE1A 5JRSA 3OT8A 2EU9A 3BELA 4APCA 2ZVAA 3IQ7A 4G6NA 5EI8A 1KWPA 2XIXA 3BGQA 3BI6A 1Q97A 4CTCA 3VS1A 4AWIA 1HCKA 5EQEA 1JBPE 2YM7A 1P5EA 1PJKA 2GNIA 2O0UA 3OEFX 4TYGA 4BDGA 5KUPA 3QTXA 1W2CA 1UWJA 1GIIA 1YQJA 2WMBA 3OEZA 4LL5A 4XYFA 4AE9A 4FIEA 4NCTA 1NA7A 2GTNA 4FSYA 5E8XA 2Y4IC 4JG7A 3BEGA 5FTQA 3HECA 2BZHB 2YZLA 3VRYA 3FUPA 2YAKA 3SG8A 2G2FA 4K8AA 3KXGA 3OWJA 2IEWA 3FMMA 3ZBXA 3O8TA 4PL3A 4TNBA 5A4CA 4FSNA 2ERKA 4LOOA 4C3FA 4O82A 1Y8GA 4P7EA 2W1EA 4BDIA 1IA9A 4XG3A 4Y73A 2OJIA 3UBDA 3EL8A 2J5EA 4E3CA 3M2WA 4M97A 4CZYB 4L3PA 3AC4A 3UDZA 1QCFA 1NW1A 3LMHA 4RSSA 5BVOA 3FI2A 4CCUA 2Y4PA 3BE9A 2GCDA 4EH4A 5AM7A 2ACXA 3CC6A 1SNXA 2WTKC 3IK3A 4F0GA 2QKRA 3GB2A 5CT7A 1GZNA 4F70A 4YJUA 2UVYA 4KIOA 4F0FA 2C5VA 4O27B 1GZKA 1UNLA 1M2PA 1YHSA 2ZM1A 4FNWA 4L6QA 2WTCA 5M51A 5CZIA 1XH4A 4GYGA 4OUCA 4O86A 2BHEA 5M4FA 2ITPA 2XNPA 4I0RA 4C4FA 2HY81 4AOIA 2QOFA 2GMXA 4BCIA 2BR1A 3GCUA 4IVDA 4QYEA 4A4XA 4BYIA 2VWVA 1IRKA 4WT6A 2WQOA 3LCOA 3ANQA 1H08A 3NW6A 3JXWA 4FK6A 4IB3A 4WIHA 5TR6A 3DXPA 3KIOC 3ML1A 4DTAA 3EQIA 3PJ2A 4AQKA 3AC2A 5LXMA 4ZLOA 3FMDA 3EQFA 3R7EA 3ZLWA 4XMOA 2CPKE 3GEQA 3DBEA 3Q9ZA 3RP9A 2R64A 3IW5A 1WBOA 3H0ZA 3PXZA 4S32A 4UY9A 4N4SA 4YBKA 4ANMA 1ZYJA 4TT7A 2B7AA 3RI1A 3PDTA 4UWBA 4RWJA 2VO0A 4D1XA 1OKVA 1O6LA 3GGFA 3NCZA 3PP1A 4IWQA 4AAYA 1NT2A 4DFLA 3FSFA 2VRXA 2V22A 4CCBA 3R6XA 5LJJA 3QFVA 1UNGA 3QLGA 3EFWA 2WMTA 4O22A 4W8DA 1GAGA 4FR4A 4BDJA 1MP8A 3AT3A 4K18A 4OLIA 2C3IB 2XYUA 3MI9A 2W5AA 3F5PA 4NCTC 2ITTA 5DWRA 3ZO1A 4AXAA 5BUIA 3N4TA 2REIA 4NEUA 3S2PA 4EOPA 3C0HA 3PP0A 2ESMA 4KIKA 5CSVA 3VQHA 2O3PA 4BR3A 4AZFA 3CXWA 1YXVA 3QD4A 3AC5A 4O7TA 4YR8A 4ANOA 4F09A 3GC9A 3MWUA 3L1SA 3QX2A 3QC4A 4MF1A 3V5LA 4EC8A 4F9YA 4YUQA 2BAKA 3T8OA 4GUBA 2Z60A 3WF6A 5C26A 3PTGA 4Q5HA 4X21A 1ZMUA 2GU8A 4YSJA 4Z55A 3EQGA 3QU0A 2C6LA 1STCE 2FSTX 4R3PA 3I6UA 4RC2A 4OTPA 5CF6A 5LVMA 2NYAA 3FAAA 3GFEA 3SOCA 3UOJA 2QHMA 3BLHA 4IH8A 4AAAA 4I94A 4EORA 3BYOA 4BCGA 4OTRA 1YXSA 4RVTA 2FGIA 2WTDA 3W8QA 2HZNA 4FT5A 4GH2A 2XKFA 1KSWA 1V0PA 2W06A 2BTSA 4QQCA 2JIVA 4WUNA 4QNYA 2Z2WA 1UNHA 4AW1A 1XKKA 4BCNA 5I3RA 1XMLA 3UNJA 2ITZA 2C1AA 1QPCA 4IC8A 4PTGA 3VBYA 4M66A 2G1TA 4C4IA 3A61A 1XH8A 4EOSA 5BVNA 3QRIA 1F5QA 3TNHA 2OW3A 5HNGA 1LUFA 4ID7A 4WA9A 4XOYA 4DH1A 3F7ZA 1ST4A 2UW7A 4U97A 4J98A 3COMA 2Y8OA 3P4KA 4DFZE 2OXXA 3Q9YA 3UIXA 3E3BX 5EDQA 3RCDA 3DQWA 3CKWA 4PL5A 4DH8A 2OJJA 3E8CA 2WKMA 3W2OA 3W2QA 3T9IA 4UMTA 3UJGA 2A4LA 3EYHA 1KE8A 5H3QA 3RAIA 1TQPA 3BYUA 3FC1X 3O51A 4RC3A 3VJOA 3O96A 3HMPA 2QU5A 4PUZA 2R3RA 2WELA 2WPAA 3MPMA 3W55A 4IB0A 3CIKA 5CVFA 3HMMA 4A7CA 5M53A 4NK9A 3HP2A 3R7UA 1XJDA 3BRBA 1PMEA 5AAFA 3AC1A 3GI3A 4G3FA 4ZOGA 3NUXA 5DR9A 4LFIA 4Y5QA 2UVXA 3EB0A 4YO6A 4MNFA 5K0KA 1ZARA 2HELA 5FDPA 2W1IA 3Q2MA 3BYVA 3P08A 4PPCA 4W4XA 2Q83A 5C4LA 3B8QA 1RQQA 2UZNA 3Q96A 2OF4A 5BVEA 3KFAA 1OPKA 4YP8A 4CRSA 4R1VA 1ZYDA 4UB7A 2E9UA 1U54A 4QPAA 5E9EA 4CFMA 5EHOA 4D5KA 3CLYA 3ULIA 3TACA 3OCGA 1PMVA 2O2UA 2QLQA 3OWLA 4G6LA 3B2WA 4UMUA 2C1BA 1DI8A 2YA9A 2WEIA 4FZFB 3ROYA 4BB4A 3D2IA 4L01A 4FEXA 3OROA 4QOXA 3K2LA 4UZHA 5AUWA 3C5IA 5F1ZA 2XA4A 2G9XA 3UOHA 1OB3A 4ZIMA 2YIRA 4QMWA 3LCSA 3MGYA 2JEDA 4QMMA 4IWPA 4R5YA 3ZEPA 2WOTA 1H24A 1YRPA 2V55A 3UMXA 1H01A 4YC8A 3Q4UA 4FVRA 3R63A 2WB8A 2PVKA 2SRCA 4GL9A 1P2AA 3QGWA 4NJDA 3CD3A 5AMNA 4CLIA 3FHRA 1OMWA 5IZFA 2WMWA 5L4QA 4FKOA 1UKIA 1YHWA 1ZZ2A 2VWIA 3EFKA 2F2UA 4RIYB 4MBIA 3KVXA 4X6RA 4BKYA 3DGKA 4A9YA 4WKQA 2CGWA 4FV9A 5I9VA 1GJOA 4MH7A 4CEGA 2YJRA 2XBJA 4UXLA 4JNWA 1A48A 4O7RA 4DFBA 5I9XA 2XNGA 1UU3A 3PVBA 1WZYA 5GINE 1JLUE 3PWDA 3MS9A 4UWYA 4AOTA 2HENA 1M2QA 4MQ2A 4BWPA 2PZYA 5GIOE 2OJFE 1KUTA 3SV0A 3GVUA 4FSZA 3JUHA 4CFVA 4CRLA 3CBLA 4ACHA 5LWMA 5M07A 1KV1A 2Y0AA 4QP6A 4EQMA 4MXYA 3WARA 2BRHA 2XM9A 4IZ5A 3W2RA 4E1ZA 1UV5A 4WSYA 1OUKA 4G2FA 4EHEA 3OMVA 4QQJA 5CF4A 3BYMA 4RT7A 1H1WA 4BBFA 4O83A 2X0QA 4HJOA 4RWKA 3IW6A 2XK6A 4UBAA 5JFXA 4ACGA 1OIQA 3L8SA 4P4CA 5E1SA 3QCYA 1S9IA 1FOTA 1Q41A 4P2KA 3RK9A 4ANSA 3ATTA 3PPKA 3CEKA 5CY3A 3NVMB 5CU2A 1W84A 4F6WA 1PY5A 2WU6A 3TNPC 2HOGA 2R4BA 1IASA 4AGCA 4G17A 2UZWE 4JDJA 2GNHA 5HGIA 2WTIA 1W2FA 3K5UA 4AP7A 4FA2A 2XYNA 1WBSA 4IAFA 4EH8A 1B38A 4YNEA 1XBAA 5CSHA 2IZSA 5CAPA 3EKKA 2VD5A 4EHGA 3C50A 2QKWB 2C3KA 3DK6A 4JMQA 3C13A 4IZYA 4OT5A 1F0QA 1E9HA 2ZDUA 4LOQA 4UN0C 2C69A 5AP2A 1OUYA 3MIYA 4GRBA 4E6CA 4C02A 4KIQA 4PTEA 2HIWA 3AT2A 3C5UA 3V04A 3BEAA 1YW2A 2H8HA 3GCQA 3LVPA 4A9RA 1DAYA 5HTBA 1OPJA 3UP7A 2B9FA 2C30A 2ZB0A 3BIZA 4X7QA 5IMEA 4G34A 3DBCA 4WUAA 4JDIA 3PXYA 5H8EA 1OIYA 2BFXA 2V7AA 3GBZA 3KMMA 3Q53A 4FIHA 4DA5A 3KB7A 3QTWA 4G31A 3C51A 4HCTA 1H00A 3II5A 3CQWA 4QPMA 4UZDA 4BI2A 5FXRA 2JIIA 2JKKA 3R04A 5IA0A 5H8BA 5HBEA 4AT3A 2J5FA 2XNEA 1A06A 4YLKA 3PWYA 3NW5A 3EQBA 4RJ6A 5FP6A 4BTMA 5J5TA 1G8KA 4KS7A 1FGKA 4FIJA 2HYYA 4FSMA 5AP7A 3RM6A 5I9YA 3FWQA 2GNLA 3KN5A 3SX9A 3D94A 3VUGA 4X6QC 3NWWA 1CKJA 3W16A 4FVPA 5KMOA 4ZS4A 3JS2A 2JIUA 1RE8A 2UW3A 5AUZA 3BCEA 3LFEA 1KOBA 4G9RA 4XH6A 3QRTA 3RZFA 2FUMA 4PDPA 5HZNA 1H1RA 3HRFA 2XIYA 1FVRA 3WILA 4DH7A 1J3HA 5AR7A 5HESA 2PMIA 4O0UA 4D2WA 4R5SA 3VJNA 4QD6A 4YHFA 4E5WA 4NFNA 4F64A 4MD9E 3DS6A 1UU7A 3OY3A 4R8QA 4TYJA 3TV6A 1W83A 3FXWA 1XO2B 2WU7A 3OTUA 4RIYA 4BWKA 1IR3A 4R1YA 2CKOA 3BLQA 3PIZA 1R3CA 2J50A 5AR5A 1PYEA 5F4NA 2WQMA 3P7AA 4JX7A 4ASEA 5A6NA 4X2NA 4H1JA 3PIXA 4V04A 5C1QB 3HV7A 2RSVA 1XWSA 1Q8ZA 3R7GA 3LE6A 2YLEA 3KXHA 5HHWA 3SRVA 2W0JA 1R39A 4M69B 2HW6A 5AP1A 4Y5HA 5EM8A 4PTCA 3W2CA 4AS0A 5A9UA 5GHVA 1I44A 3ACJA 3Q52A 5BX0A 5E1EA 3V01A 4II5A 5H2UA 4G5PA 5D11A 3MPAA 3VBXA 4D0WA 3H0YA 4RX7A 2WMRA 2W05A 3V5JA 4Q9ZA 3QL8A 4AW0A 3KKVA 2IZUA 4V01A 1BYGA 4FBXA 3NW7A 5HO8A 4JQEA 4FG7A 4X0MA 3BV2A 3MJ1A 3COIA 3EFLA 4C58A 4NH1A 3ORIA 4BBEA 4CKIA 3KCFA 3JYAA 3IPHA 5EG3A 2PL0A 5JGAA 3KRLA 1B39A 3FZRA 4KS8A 4XG6A 2J7TA 2A2AA 3ENMA 5D1JA 3QQLA 2CKQA 2VO6A 2UW6A 4EK3A 4PRJA 3MJ2A 4QMVA 3UOLA 2F9GA 3ALOA 5B2LA 3KCKA 1ZYSA 1OGYA 4RC4A 1ZLTA 3ORNA 4NFMA 4L44A 2LGCA 3ODYX 3ZTXA 1H25A 4MUQA 2NP8A 1RDQE 3A60A 3L9LA 4YJSA 4BL1A 1OI9A 4NM5A 3DNDA 1P4FA 2XKEA 5L6WL 5EYDA 2VGOA 3F3UA 3ANRA 4I6LA 3DBFA 3N51A 4GFOA 4QMNA 1Q3DA 2R3MA 5A4TA 4CV8A 1NXKA 2VWZA 4H39A 4QEBA 2X81A 2BRBA 4MXXA 4AX8A 3HV6A 4CG8A 4FT3A 4YJVA 4D1ZA 3FLQA 2XBAA 4NIFB 3FV8A 3QX4A 3TDVA 3A7FA 3QC9A 5F95A 4XRJA 2QC6A 5EYMA 3ZUUA 1H1SA 4BIBA 1XH7A 2C6KA 2B55A 1OL1A 2C6EA 3R22A 4U43A 4B8LA 4AE6A 2I1MA 4FTMA 4WRGA 4DHJA 2IJMA 3FZSA 4C35A 3WOWA 5FWKK 4AF3A 2YM6A 3GNIB 5AP0A 3I79A 3LJ2A 4OAVB 2JFLA 2VTPA 3WBLA 3ZRMA 4K0YA 4ALWA 2W5BA 2QOIA 3CD8A 5E8VA 5HBHA 5A4LA 3AKLA 3HL7A 4F7SA 2W99B 2G2IA 4LG4A 3KRJA 4HCVA 4QMZA 2DS1A 5KMLA 4PPBA 2OH0E 2BDFA 2XK3A 1NY3A 2DYLA 5TKDA 4DEAA 2EXCX 4FEQA 5DE2A 4EH9A 1K2PA 2XNOA 1KE6A 2J2IB 4QMYA 3QYZA 4JRNA 1JSVA 3MBLA 4UEUA 4Y85A 5EOLA 4QYYA 4CSVA 3VONA 2BRGA 1VR2A 2UW9A 3QHRA 5BYZA 5IH5A 3LQ3A 2YJSA 3EJ1A 3H9OA 2LAVA 1U5RA 3WF8A 5HU3A 2PMLX 4O4BB 3P78A 3QUPA 2ITUA 3LW0A 3SVVA 3COHA 2P3GX 3PXRA 5EFQA 2OZOA 3C4CA 5B0XA 4LGHA 4ANLA 2PSQA 4I5PA 3EZVA 3D0EA 1BL7A 5J9LA 2PE1A 4FT9A 1JPAA 1Q3WA 4I93A 4ZSEA 4YTHA 1YI3A 3ZLYA 4FV2A 4QP3A 4BDHA 2BMCA 3F2AA 4J97A 4KAOA 4ZTMA 5M44A 2HCKA 5AV1A 5AJQA 4HCUA 5HQ0A 3QZFA 3SQQA 1S9JA 3WYXA 2GPHA 2GNFA 5A4EA 2ZB1A 4FNYA 1ZYCA 4KIPA 1H4LA 3QUEA 2GDOA 3VRZA