3IOPA

Pdk-1 in complex with the inhibitor compound-8i
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
285
structure length
275
Chain Sequence
b'RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title The identification of 8,9-dimethoxy-5-(2-aminoalkoxy-pyridin-3-yl)-benzo[c][2,7]naphthyridin-4-ylamines as potent inhibitors of 3-phosphoinositide-dependent kinase-1 (PDK-1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 275
sequence length 285
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3iopA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3iopA01
2UVYA 1KE9A 5FD2A 1BLXA 3IQ7A 4BDJA 4BWKA 3JS2A 5DMZA 4IZ7A 2UZTA 2AC5A 5E8UA 5KHXA 1HCKA 4U40A 2HWPA 2Z7RA 4ZSLA 3KRRA 5DR6A 2EXMA 4AUAA 4F70A 3UQCA 1W98A 2VTNA 4LL5A 3CTQA 2WGJA 1OBGA 4XP3A 3LCKA 2YAAA 2QOOA 3Q9ZA 3PJ2A 3UOJA 2BUJA 3MPMA 2YIYA 2YM7A 3W55A 5CENA 4MD9E 5HU3A 2ZM3A 1U46A 2OG8A 3UNJA 2XRUA 2XK4A 4D0XA 4LOQA 2WKMA 3CJGA 4PV0A 3KRXA 3VNTA 4ZTRA 1KV2A 1OL6A 2GNFA 5K9IA 3EZVA 3OW3A 3VF9A 4ZJVA 2HZ4A 2R7IA 4FIJA 4DH3A 5IQAA 4Q5EA 5A4LA 4O6LA 2WXVA 4PQNA 2W17A 4BVUA 2W1HA 1ZYDA 5IA0A 4OTGA 3FYJX 4AGDA 3ANRA 4KSQA 5FQDC 4JL9A 3WYXA 2HOGA 2OBJA 2RFDA 3OEFX 4MYGA 5CEQA 2VWBA 3FLWA 5A6OA 5HLWA 4L42A 4TYJA 4CFMA 3LMHA 4IIRA 3VN9A 5FEDA 4O0UA 1UKHA 4P5ZA 3ZFYA 5KKRB 3FMNA 4EQMA 4R3CA 2V62A 3FMKA 5JGBA 3FMLA 5JN2A 3MVMA 2CKQA 3TIZA 5I4NA 1UU9A 4NK9A 3VRYA 1LP4A 3RVGA 3WIKA 1TQMA 3SV0A 3KREA 5CSXA 5HGIA 5C27A 3KKVA 3NX8A 3R8VA 2X6EA 5EFQA 2OU7A 2Q0NA 3OZ6A 3BEGA 4EH5A 2Y9QA 4LUEA 4U3ZA 3R2BA 4DTKA 2PE2A 2WB8A 3NDMA 3TN8A 4JOAA 2PSQA 4GT4A 4RIXB 2VV9A 4YJUA 5DWRA 3O50A 5C26A 3Q3BA 5AFVA 5HO6A 5J5SA 2CDZA 5ACKA 3V01A 3S00A 4KA3A 2PZ5A 1H01A 1HCLA 3HV3A 3UIXA 5B7VA 4QMLA 4RT7A 3ZDIA 3GFWA 3LOKA 1P2AA 4PNIA 4H3BA 4BHZA 1ZAOA 4X21A 3Q6UA 3VUDA 4K77A 3O2MA 1H0VA 5JT2A 1QPEA 3F9NA 3P4KA 4LL0A 4EJ7A 3C4XA 4YBKA 4D58A 4YSMA 5KBRA 4BI1A 3C50A 4GS6A 4FV6A 4MBJA 1YOMA 2RL5A 4QMPA 3GNIB 4G31A 3ENHA 3GQLA 3VUMA 4CNHA 3FKOA 4CTCA 3QZHA 2JKOA 4BY9E 3E8CA 2WNTA 4XOZA 5FGKA 4J99A 4FZAB 4S32A 2J2IB 2WELA 4M3QA 4PP7A 2ONLC 2YM6A 1ZY5A 3GXLA 2UW5A 3HV4A 4ITJA 3V6RA 3NUAA 2R3KA 4F1OA 1YHWA 5TO8A 2VTPA 2UZOA 1B6CB 3DAEA 3NNWA 4NJ3A 4QMVA 5E8YA 3CGOA 5AUWA 4PDOA 4GFMA 4F9BA 3Q5IA 4BCOA 1W82A 1F5QA 3VAPA 5JFWA 3E92A 3W2QA 3QTXA 3RALA 4DH8A 1Y91A 5HG8A 1REJA 4ZSAA 2GHGA 4II5A 4YHTA 3AXWA 3EKKA 4H3QA 2JDSA 3FEGA 2I7QA 4O91A 3BWFA 2XCHA 5HG5A 2XM9A 4KB8A 4M68A 4FTIA 3MYGA 4G6OA 2P55A 3BKBA 3ORTA 5CS6A 4GT5A 3A8WA 5K5XA 3ZRLA 4BIDA 4DFXE 4O81A 4JQ8A 3Q2MA 4IX5A 4L3PA 4MNEA 3W33A 5LQFA 3D7TB 4FKQA 1XR1A 4YO4A 2PUUA 4JDJA 5M4FA 3KA0A 4GK4A 1UNLA 2C6MA 2XKEA 3VBQA 3FPQA 4TYHB 4YJQA 4NYEA 2G1TA 2JC6A 2XNMA 4CCUA 3FDNA 3RWPA 4FV2A 4BCPA 2WU7A 1M17A 1GZKA 2WTDA 5ICPA 4CRLA 5EI8A 4F09A 2R3IA 3LM0A 2XNOA 5M56A 3QUDA 3ZEWA 2BDFA 3K5VA 1NA7A 3BX5A 3EB0A 5H8GA 3EQDA 4QMOA 3U6IA 2VO7A 5TT7A 1XQZA 2ZB0A 3LFDA 4U5JA 3FC1X 2BFYA 5HOAA 4E1ZA 2GFSA 5ETCA 2F2CB 4OAVB 4QYFA 1A9UA 3K3JA 3TL8A 4FTNA 5EDQA 4EK5A 3M11A 3P1AA 3UOKA 2JITA 4RVMA 4FI1A 3U51A 2IVTA 3MVJA 2C3LA 4DCEA 4RWLA 3IS5A 2B9IA 4C36A 4NFMA 3BBTB 3WF8A 4X0MA 3A7HA 3BRBA 2HXLA 5D7AA 4ASXA 1YHVA 2WTKB 5CF5A 3BI6A 3G6HA 4YJSA 3MH2A 5A3XA 3FMMA 4U79A 3QWJA 3UDBA 3LE6A 4I94A 4OTDA 3PIYA 4AZFA 4C3FA 1JLUE 5LVMA 4RVKA 1KSWA 4LGGA 5A4CA 3CPBA 4IC8A 1P5EA 2XNPA 4RIWA 3TKHA 4FTOA 4RA4A 4JX3A 2WQBA 3A7FA 4EYJA 3A4PA 4X3FC 3NMUF 4IZYA 4GCJA 5KZ0A 3L9NA 4FUYA 4G5PA 4C4EA 2R2PA 2BRNA 4M0ZA 2XKCA 3PXYA 1PRYA 4W4YA 1ZZLA 4FZFB 4UZHA 3RMFA 4CQEA 3PJ8A 4FK3A 4RA5A 5CEIA 3BE9A 5LOHA 2VTIA 3WF7A 2HW7A 4MK0A 2BFXA 2XJ0A 3DBCA 5LARA 3ZTXA 3C1XA 5ANDA 1RE8A 3AD5A 5HIDA 4G34A 5D10A 2PYWA 3RWQA 1PXPA 5HCXA 2Y4PA 2WTJA 1NVQA 3FI3A 4M67A 1FPUA 3GU7A 1OIQA 2QOFA 4FV7A 2OO8X 3F7ZA 5AIRA 1YKRA 2I1MA 2R3OA 4FTMA 5G1XA 4UYAA 4K0YA 5BQ0A 3VS1A 2GTMA 5DR9A 2C5VA 1XH9A 1KE8A 3F3TA 4L6QA 5IH6A 3CKWA 1H1RA 4DFYA 5CYIA 3QGYA 4AP7A 4EK8A 3OS3A 3RPVA 4I5CA 3KL8A 5HBJA 4L9IA 5C9CA 4UXQA 4B7TA 4IAAA 4HPUE 3W2CA 3NUUA 4DINA 3VVHA 5IH4A 2EXCX 2VNWA 5C8KA 2OSCA 4YSJA 1H8FA 3MB7A 3WE8A 4N0SA 5K0XA 4LMUA 4I5PA 4UWCA 3LKMA 3F82A 5CSHA 3E7VA 4D1ZA 4F64A 4NIFA 3NYOA 4XP0A 5IMXA 4ASZA 3CY2A 4XG7A 3C4FA 1FOTA 4XMOA 3VIDA 1YOLA 3BYVA 4GG5A 4ZAUA 4FE2A 3PA5A 2UZEA 4RVTA 2HENA 3QTZA 1URCA 2C6DA 5CI6A 3ZFMA 3NNVA 1H26A 5FDXA 3A99A 4GK2A 5EH0A 5ANJA 4O27B 3PLAE 5CSPA 4H1JA 3QGWA 4C61A 4QMZA 4AZTA 4FT9A 4BBFA 1J7LA 2QLQA 3R7OA 3BYMA 2WU6A 3LIJA 2VO6A 5CAUA 5T3QA 4FKOA 3ET7A 3PVGA 3NZ0A 4O0VA 1H1WA 3BIZA 3G9NA 5FLFA 4CZTA 5CXZA 4LMNA 4YZDA 3L9PA 2B4SB 4IB0A 4MNFA 4PDYA 3C0GA 1ZYSA 4OTFA 4NJDA 5AX3A 5IEVA 5CZHA 3ULZA 3KC3A 4BCQA 4BB4A 4MX9A 4FKSA 4ZP5A 4PDSA 2YITA 1GNGA 5HLNA 4CLIA 4E5AX 3UPZA 4GFGA 5HESA 3PSDA 3QLFA 5EI2A 2B9HA 2YZAA 2C1AA 3HDNA 3O7LD 3R73A 2I0YA 4FKUA 4YTHA 2UUEA 1YW2A 4C0TA 3SGCA 5E90A 1OUYA 2X8IA 3LFEA 4IC7A 5EYKA 5FP5A 3LJ2A 4EHGA 5CLPA 4X2FA 1G8AA 4XV9A 5HNGA 5T68A 3K54A 2PZIA 1EH4A 4IJPA 4PL4A 4RFYA 3R9HA 1MQ4A 4Z3VA 4BCGA 5LJJA 3F3UA 3E62A 4DYMA 3T9IA 3LLTA 3N9XA 4RQVA 3ZDUA 5CAOA 4USEA 3RPRA 3I81A 4QMNA 3OTUA 3TKIA 3MY0A 2JBPA 4HGEA 3BELA 3F2NA 2J7TA 3OCTA 4IM0A 1JVPP 2E9PA 5GZ9A 2ITPA 2VAGA 4I1ZA 3TZ9A 5K4JA 3R9DA 3I6UA 4O7TA 2P2IA 4CFVA 4YZCA 1YI4A 3D5WA 5B2MA 3LMGA 2YM8A 4AAAA 5AUVA 2ZJWA 4FNZA 5LWMA 3LQ3A 3OC1A 3NAYA 2C0OA 4GMYA 5FEQA 5AWMA 3ACKA 3AT2A 2Z7LA 2PWLA 3LQ5A 4DFNA 5M51A 5CAQA 4TYIA 1AD5A 4FEQA 2R3MA 3CEKA 3ROYA 3O71A 4C57A 4TNBA 4E3CA 2Y6OA 4ZS0A 3U54A 3SXSA 3FY2A 2H9VA 4AT3A 4FGRA 3OBGA 3QCQA 2O65A 3H9RA 3L8PA 3HV6A 3PVBA 4H3PA 4AS0A 5AAEA 5BVNA 4BKJA 4CT2A 2Z7SA 4DGMA 3FC2A 2XB7A 4FICA 4QP8A 2XBAA 5E8VA 4YU2A 3Q32A 4I23A 5HCZA 4LV8A 3CXWA 3TV7A 5IA2A 4U45A 3EH9A 1OI9A 2PY3A 3LZBA 1JKTA 1KE6A 2GNLA 2JAMA 4GJ2A 4M84A 5TE0A 2IZSA 4BZNA 3QRIA 4QYHA 2ZM1A 3HVCA 5E1EA 5ANOA 2BRGA 4DLJA 4BCFA 4F6UA 5GIPE 3VUIA 4GSBA 5J7BA 5D41A 2BILB 4GIIA 1BI7A 4X6RA 3ZSHA 2CLXA 1IRKA 4O2PA 5HBHA 2PTKA 4O82A 1RQQA 4M12A 3MVHA 2E9UA 3S4QA 1SYKA 4G9RA 5IKWA 4LOPA 1FVVA 1KWPA 2XM8A 4XEYA 2YWVA 3QZFA 3R0TA 1W7HA 3U6JA 3LJ0A 4HNFA 5EKOA 5E8TA 5EM7A 2W1IA 2ZMCA 2RGPA 5H3QA 3LMIA 4DH7A 3PA3A 3ROCA 5LMKA 1SVGA 2XNBA 3NW7A 3ZM4A 4D2RA 4U7ZA 3AD6A 3HV5A 2HWOA 2VN9A 3EFKA 4YC3A 3R9OA 3DB8A 3HAMA 3M42A 4I4EA 4IM3A 2YDKA 5K0KA 2GQRA 3DJ7A 4XBUA 5EG3A 3VUTA 4QT1A 4FKWA 4V0GA 3Q9XA 3EJ1A 1DAYA 2QLUA 5FXSA 1SNUA 2WD1A 3DNDA 4FVPA 1R0PA 4BHNA 1NVRA 1P14A 2C0IA 3BYUA 3IW5A 4IVDA 4M69A 3DKCA 2QO9A 2OFVA 4CVAA 5LMAA 3RPYA 4IH8A 2C5OA 3AQVA 3ELJA 4JS8A 4S31A 4FT5A 4O1OA 3CBLA 2G2IA 2YACA 4DITA 3S0OA 1J1BA 3OP5A 1JPAA 2IVUA 3QTIA 3QXOA 1UV5A 4RIYB 1DM2A 4K11A 5L6PA 4UX9A 5HVYA 3N51A 4K33A 3VHEA 1VYZA 3R7IA 2J0KA 3RCJA 2SRCA 4TXCA 4WHZA 1Q8YA 3LXKA 2F7XE 2LGCA 3EIDA 3PJ3A 3P78A 4JG6A 5EHOA 4LRMA 4C4FA 3V6SA 4FVRA 2R64A 2JKKA 4P7EA 2Z8CA 3MB6A 4BCHA 4FKVA 4BDAA 4CG9A 4H39A 4MQ2A 4Q9ZA 2OLCA 2FGIA 3MIYA 4LV5A 2PVFA 4UN0C 2OH0E 2WOUA 5AV2A 5KO1A 4ID7A 4NU1A 4N57A 3PPJA 5LMBA 3TT0A 3NIEA 5AADA 2Y4IC 3QCYA 3QYZA 4DCAA 5AAFA 4FTTA 3RGFA 2XJ2A 4R7IA 3I4BA 2BZJA 2ZYBA 1IA8A 3HP2A 2EUFB 2PZRA 1OMWA 3UOLA 2CNVA 2CHLA 4HNIA 4KIQA 4UXLA 4FKLA 2A19B 4R5SA 4XRLA 4F6SA 3EN4A 4TY1A 4NW6A 3KULA 4HYSA 5ACBC 4DBXA 4CT1A 3QKKA 1WBOA 1Q97A 5DNRA 5E91A 3SKCA 3UQGA 3W10A 4JT3A 3OBJA 1CTPE 5IG1A 1M7NA 2UW0A 3BGPA 3ZXZA 3Q5ZA 3UVRA 5DPVA 1MP8A 3C51A 4I0SA 4EBVA 1BX6A 4IWPA 5HTIA 4IAYA 4DGGA 5HX8A 4CFXA 3NUNA 4FSQA 2VTSA 4WA9A 2GCDA 2UZWE 1YHSA 1WBPA 4V05A 3GQIA 3LFCA 1MRVA 4TT7A 3NR9A 5J9YA 1WAKA 2QG5A 4FSMA 3F2RA 2J5EA 4OBPA 2UW3A 2PZYA 1G3NA 1Y8YA 3SW4A 2A4LA 4O0SA 4D4YA 3QUEA 3GT8A 4FK6A 4DT8A 5TF9A 3LVPA 1QCFA 5DR2A 1OGUA 2QC6A 5L8LA 1FINA 3A7JA 5D9HA 3PIZA 4M0YA 4EOOA 2NNWB 1H27A 2QU5A 4TRLA 2JBOA 2C4GA 3G5DA 3O23A 3EMGA 3OOGA 1BKXA 4KUJA 4U41A 4R8QA 3H9FA 3MFSA 3KXHA 2HIWA 2DYLA 3LXNA 4ZJJA 5JQ8A 2W9ZB 3QYWA 4FSZA 2UW7A 4FUXA 5DA3A 3HNGA 4IJ9A 2CSNA 3Q9WA 4FL3A 2FSTX 3HMMA 3PZEA 3B8QA 5FRIA 2W7XA 2ZV9A 3REPA 4QP1A 1NT2A 5BVFA 3MJ1A 3Q6WA 2VTTA 3OHTA 4F9WA 4FSTA 1F3MC 1Z9XA 3DDPA 3KCKA 4NUSA 2OW3A 3QX2A 4GUEA 4G6NA 1CM8A 4GG7A 3WF5A 3WZDA 3EQHA 2IVSA 3PFQA 2C0TA 4HJOA 5HLPA 4A9SA 4CXAA 3DS6A 3GEQA 4FKTA 4D55A 4O1PA 2GNJA 4E73A 2W4JA 3MBLA 2WEIA 3BV3A 3RJCA 1M14A 3U4WA 4GKHA 1GAGA 2BZHB 4N6ZA 2OK1A 2C6TA 3DXNA 2WZJA 3FMHA 3AC4A 5CEMA 4FEVA 4Y72A 5EOLA 3WOWA 3K3IA 5CU4A 4D1XA 4AU8A 3E3BX 3QQHA 4LGDA 5IEYA 4L8MA 4X2GA 1G8SA 1YI3A 4RJ8A 3TNWA 5J8IA 3CIKA 4A7CA 3QQGA 5DRBA 5E92A 3ZOSA 4FEXA 4EH8A 4WIHA 3MIAA 1JNKA 2UV2A 4B4LA 2YN8A 3FI8A 1QL6A 4H05A 2ZV8A 3O17A 3OUKA 5LVPA 3FXZA 2WFYA 4GU6A 4MD7E 2B0QA 4E26A 4TN6A 5C8MA 2BHEA 5AMNA 2ITNA 4NM7A 1R3CA 4IXPA 2FSMX 3E88A 2I0EA 2XK6A 3QQUA 3QTWA 4J71A 1VJYA 3GBZA 4HZSA 2PVJA 5KUPA 2XYUA 2QHMA 3QQJA 3DNEA 4MNEB 3IPHA 4BCIA 3PG1A 4QYYA 5FBNC 4G16A 4CG8A 3AG9A 3P7CA 2CLQA 1XBCA 2WAJA 4O6EA 3VRZA 4F99A 1V0OA 2YCSA 4RJ4A 5HEZA 4EOJA 4FGBA 4IFCA 3FLYA 2ITUA 2C5XA 2YCQA 2BIYA 3OWKA 3WZKA 4ANNA 5I5ZA 4C59A 4YBJA 4MXCA 3KXZA 4KNBA 3VHKA 4IX4A 4CLJA 3FZTA 4UMUA 5AV0A 3D94A 1R78A 4YPSA 4IVBA 3E63A 3QCXA 4MXZA 3UP7A 3UO6A 4TTHB 4U81A 4YP8A 2PZPA 4YZMA 3IGGA 4U0IA 4QTEA 5CASA 4H1MA 5AA9A 4LUDA 4YLLA 4AW1A 3BE2A 1Q8ZA 2JDRA 4IBMA 5KCVA 2WMUA 5LCJA 3AC8A 3WYYA 4HYUA 4BFMA 4DBNA 1OIUA 1OL5A 4FL1A 4Z16A 4C2VA 1ATPE 2WMAA 3U9NA 1OM1A 1YDSE 3FL4A 3QTQA 4BCNA 1UVRA 4O0TA 4ZY5A 4OT6A 2X81A 2WQMA 3G33A 5DE2A 4C35A 5F9EA 1XWSA 1DS5A 4A4XA 3LFBA 5HD4A 3GOPA 2BVAA 2P0CA 2BRMA 2ITYA 3VS4A 4J95A 4XP2A 4BTJA 3DQXA 2XRWA 1JSTA 2BAKA 4IAIA 2O0UA 4DN5A 4HVGA 5EYMA 1ERKA 2FSOX 3VUGA 2IW6A 5J1VA 4ZTHA 4GU9A 4RIWB 3S2PA 4TZRA 4XX9A 4QQJA 3FZSA 4N6YA 1KOBA 4K6ZA 3JVRA 4W4VA 4AG8A 4BDFA 4PP9A 4Y46A 3CS9A 2ETMA 5E1SA 2BTRA 5HBEA 4BCJA 5EW9A 4BKYA 3OCBA 4EUUA 4RX5A 2Q83A 3MDYA 2QOQA 2GNIA 5AP3A 2C5NA 1M2QA 4L3JA 3GI3A 1VZOA 4FT7A 3QAME 4YJRA 4AN9A 2Y6MA 4EKKA 3H4JA 3D2KA 4ZSGA 3VC4A 2CKOA 3LFSA 1YI6A 4LRKA 4BRXA 2BZIB 4KAOA 3R7VA 2G01A 3AC1A 4U44A 3RHKA 4MWIA 3ZMMA 4A9RA 4MH7A 4D2PA 2BTSA 3UO5A 1WVYA 5CT7A 3ZSIA 2ZDTA 2CMWA 3UMXA 5M44A 4A4LA 1JSUA 3E8EA 1UU8A 4ANLA 4WD5A 2IZUA 4G3GA 3PY3A 3DAJA 4J1RA 5DEYA 4AF3A 2DS1A 4IADA 2OI4X 5CF4A 3EKNA 4CV8A 3MY5A 4BDEA 1PMUA 4GW8A 4F9YA 3F88A 3NRMA 4YZNA 3ZZEA 1ZZ2A 4F4PA 3GFEA 5CVFA 2ITZA 3ZO1A 3A60A 1A06A 3UG2A 4QNYA 4E4NA 1J7IA 2PPQA 4FZ7A 2YABA 4QMQA 4BTMA 1U54A 2UZVA 3DTWA 3H3CA 4WOVA 4RJ5A 3GB2A 2IG7A 4NIFB 2FVDA 3H0YA 1W0XC 4JIAA 4QYEA 2IVVA 4XBRA 4RJ7A 4DGNA 3IO7A 4U43A 4YMJA 3G51A 4WUNA 3Q9YA 3IDPA 1QPDA 4EKLA 5JMSA 1XJDA 4I4FA 1OECA 1H0WA 3FJQE 4V04A 4F7JA 5KNJA 2YIQA 4FIIA 2VO0A 4BDHA 4ZMEA 5FTGA 1OPJA 3RBWA 4RMZA 3VWAA 2R3PA 3DK6A 3DKOA 3EFWA 1H00A 2XMYA 3FQHA 3QWKA 4FEUA 3R1QA 2VTLA 3MJ2A 3FKLA 3PJ1A 2BROA 1P4OA 3BBWA 3QUPA 4J8MA 4ZLYA 2DQ7X 3PPKA 5K4IA 3Q53A 1X8BA 3UYSA 3U9CA 3BHHA 1Q8WA 1F0QA 3PSBA 3GGFA 5HO7A 1IR3A 1IAJA 1LPUA 4RQKA 2WOTA 3W8QA 1J1CA 2YDJA 3E5AA 4FT3A 4OTWA 2YEXA 2JD5A 3LM5A 2E9OA 3M2WA 3QALE 5DLSA 3VO3A 4C38A 5ITAA 1ZMWA 1GIJA 4RX9A 1XHAA 2J0JA 5AR8A 4YURA 2V7OA 2YISA 4FTCA 4B0GA 3FPMA 3S3IA 3PWYA 2UZNA 5HTCA 1JKLA 2E9VA 4ZLOA 3VS7A 4ZZMA 2VWYA 2WHBA 5I3RA 4NM0A 4YTIA 3OXZA 2UW8A 4NCTA 5C01A 1SNXA 4O96A 5KZIA 4QTDA 4EOKA 3BU6A 5HD7A 2B1PA 4YR8A 2CKPA 1URWA 4FZ6A 3NWWA 4NT4A 3E8NA 3E3PA 3AMAA 3OEZA 3R71A 3OVVA 4O84A 4L53A 2FH9A 4E6AA 5ETFA 5IQHA 3AGLA 3C4WA 5KKRC 3BU5A 3HV7A 1OKYA 4AW0A 3ALOA 3PG3A 4IMYA 4PTEA 4JBOA 1DI9A 4L45A 3R9NA 4AA5A 5FTQA 4U80A 1XBBA 3A8XA 4OAUC 1P4FA 4FIHA 2JGZA 2ZMDA 2PVHA 4WRSA 4ZSEA 5A14A 5JSMA 3Q96A 4ZZOA 3QTRA 2PUPA 2WMBA 2G2FA 2A27A 3WE4A 4O0XA 2YDIA 2A0CX 3DJ6A 1ZMVA 1BI8A 3D2IA 3C0HA 1NVSA 2JFMA 2R5TA 3GU4A 3G15A 5C4KA 2R3JA 4QP2A 4APCA 4HVIA 2QOKA 5CEPA 4K9YA 1I44A 3ANQA 3QF9A 4JAJA 5JFVA 3MH1A 4GK3A 4G2FA 2YCFA 2ZVAA 4CQGA 4NW5A 4GJ3A 1MQBA 5DH3A 2HXQA 4G3FA 3T8OA 3PRIA 4Q5HA 5AP4A 4M13A 4XG6A 5F95A 1RDQE 4IANA 4EOPA 3TDWA 3V51A 3QTSA 3ZH8A 5HICA 4EHZA 3KXXA 3GC9A 2AC3A 5IQIA 3I0OA 3R28A 4CFWA 4ANSA 3UIUA 4ANQA 2JIIA 3CLYA 4QMXA 3JUHA 2NPQA 4IAFA 4CMOA 3NUSA 1PXNA 4E8AA 3JR1A 3ZLSA 1Q61A 2OH4A 4RZWA 3UVPA 2IPXA 3LXLA 3P5KA 3CE3A 2E9NA 4LYNA 2YZLA 1U5QA 2WEVA 3LCDA 3CQEA 3CTJA 4EI4A 4RGJA 3LFAA 4PNKA 2ERZE 4W8DA 2GMXA 5KMLA 2R9SA 3PIXA 3SVVA 3FY0A 3DZQA 4V01A 1OZ1A 4WBBB 3KU2A 3W8LA 4QP7A 3VUKA 2VTHA 1WZYA 5IDPA 4IDVA 3VS6A 4CMTA 2VUWA 5KHWA 1FVTA 4DF3A 3ALNA 2XIYA 4QMWA 3KMWA 2UZUE 2Z60A 3R8LA 3RAIA 1YRPA 1M7QA 4JIKA 3TV6A 4JXFA 3GVUA 3KF4A 3ID6C 2QHNA 3HMIA 3WARA 3S95A 4FA2A 4S34A 4ANMA 2OXXA 5HKMA 4BR3A 4KS8A 4MBLA 3VS5A 3E64A 3IW8A 4AN3A 5E8XA 3KRJA 4GVJA 4R78A 3R7UA 4FTJA 4C3RA 2OIDA 3P7AA 2R0IA 5AV3A 3W2RA 1XH4A 3F66A 3UVQA 4M69B 5A4TA 5H9BA 3F5UA 4A9UA 3OXTA 2IJMA 5A6NA 4TL0A 4DEBA 2OZAA 3KXGA 4O2ZA 4X3JA 3P7BA 2XIZA 5JH6A 3UMWA 3F5PA 4JAIA 2X9FA 5DG5A 1STCE 5DHJA 2IW8A 2VWVA 5D1JA 1JAMA 4E93A 2OIBA 4KIKA 4AFEA 5CANA 2WO6A 3V8WA 4APPA 3A4OX 2X6DA 3IKAA 4P90A 4K8AA 2CJMA 3NPCA 4I5HA 4LG4A 2CCHA 3RM7A 4EWQA 2ONLA 4NH1A 4O83A 3PXQA 2VTQA 5EDPA 4EOQA 4F65A 1YDTE 3JXWA 4HZRA 3OWPA 3ZXTA 2J90A 5CF8A 5EQPA 3VUHA 1NY3A 2FYSA 5AR7A 4AOIA 4A9TA 4OBQA 3MPAA 3OROA 4UMQA 4EC9A 4DC2A 4FTUA 3O0GA 3BYOA 2ZAZA 1KE7A 5AX9A 1G5SA 5HI2A 3V3VA 4DG0E 4KKEA 3NW6A 1Q4LA 2G15A 5J9ZA 3ZLWA 4F7NA 3DK3A 3HA8A 1PKDA 4M7IA 3KEXA 4IX3A 5FXRA 1PF8A 2PMOX 3U8WA 4G1WA 2WTKC 3D5XA 2QVSE 5CX9A 4AE6A 4D9UA 2YJRA 3KULB 4FTAA 3OMVA 5C03A 5TKDA 2WMWA 5AA8A 2VTMA 1E1XA 1RW8A 4O7SA 5IZFA 3AMYA 4BDKA 1SVEA 3R63A 5IUIA 4TWNA 3HEGA 4KABA 3C5IA 1HOWA 2W1CA 3PY0A 3HRFA 4UY9A 1T45A 1NXKA 2OJJA 4WRGA 3QQKA 4DFZE 4FL2A 4ERWA 2PL0A 4K2RA 4RC4A 3IDBA 4FNYA 2V55A 3MVLA 2OXYA 2GS7A 4JLCA 3U87A 4FV5A 3SXFA 3K5UA 3PY1A 2W5HA 5CSVA 1CDKA 4AX8A 4USDA 1LEWA 3DBQA 2W0JA 3GC8A 4L44A 4NL0A 4FVQA 4FV0A 5IQGA 4RC2A 3IOPA 3DGKA 4IVAA 2C3IB 3PVWA 2GNHA 3I5NA 4M14A 4M97A 3T3VA 3KK9A 3ODYX 3ZU7A 2FO0A 3NIZA 2Y7JA 3Q52A 4X2JA 3UO4A 4ZSJA 2C1BA 1OL1A 2AUHA 1MRYA 5J87A 5AP5A 4PY1A 5KMJA 4F9CA 3CD3A 2GPHA 1PW2A 4L52A 4PUZA 2W99B 4CKIA 4EH7A 2WIPA 3W16A 3DLZA 3ORLA 4PMSA 5IDNA 3D7ZA 4JDKA 1PYEA 5EK7A 3TTJA 4DA5A 4QQCA 3UOHA 3VS3A 3E7OA 3TIYA 3G0EA 5BPYA 2EB2A 5K3YA 3UPXA 2HYYA 3NVMB 5EQYA 2ETRA 3BZ3A 3L8VA 4WG4A 5EHYA 5EHLA 3LLAA 3R04A 4YNEA 4HGTA 5M4CA 4HGSA 4HGLA 4C3PA 4J53A 2XKDA 4ZZNA 2ZV7A 3GC0A 5EM5A 4CZUA 3SAYA 1BMKA 3RK5A 3SOAA 4H58A 4X3FA 3WZEA 5E9EA 3F3VA 4ARKA 3P79A 1SM2A 4K18A 4OTRA 2PMNX 3BU3A 3TJDA 2Z7QA 3IW7A 3R9RA 3PTGA 3BGQA 3HMOA 3QRJA 4RX7A 4E4MA 1IASA 4JRVA 5BYZA 5M57A 5IH5A 1H1PA 2CPKE 4B8LA 5FG8A 4AZSA 3PZHA 3QHRA 4YUQA 4QPMA 5CZIA 3PSCA 1ZYLA 3OY1A 3RZFA 2EXEA 2C68A 3FSKA 4HYIA 5D11A 4C7TA 2QKWB 4FKJA 4CYIA 4D2VA 3O7LB 4HW7A 1Z5MA 2GQGA 5L2QA 4FYNA 1GIIA 3ZO2A 3EWHA 2J0LA 3MV5A 2BZKB 3SRVA 4D0WA 3AC3A 3FYKX 3VS0A 4KBAA 4IM2A 1YVJA 4YJVA 4ALWA 3R22A 3DJ5A 1QMZA 1KE5A 2OF2A 3R02A 3R1YA 4IHPA 4TWCA 3FI2A 4XCUA 3OFMA 3AT4A 3FL5A 3HL7A 4JR7A 3FWQA 3TTIA 2WIHA 1O6LA 4ACDA 4AZEA 3MFUA 4Z7GA 4MQ1A 5HIBA 4NSTA 4PMTA 1Q41A 3QFVA 3PA4A 3QZIA 3V8SA 4FX3A 2B54A 1UU7A 1UWJA 5B0XA 3VBXA 4EZ5A 5AUUA 4JQ7A 3DY7A 2Z02A 2IW9A 5CQUA 3NCGA 3OW4A 4F7SA 5DFPA 3P86A 3K2LA 5AM7A 4FV1A 4U6RA 4O7RA 1TKIA 2PK9A 2GU8A 2PVNA 3QRKA 3MN3A 4ZTLA 5AV1A 4ZIMA 4Y95A 4Z7HA 3DXPA 2YAKA 4JDIA 4GYIA 4ZTMA 5JGAA 1CKIA 4QTAA 4PL5A 4ZJIA 4X2NA 2X7FA 4YO6A 3VS2A 3L1SA 1KOAA 4RBLA 2XNNA 4AWIA 3LJ1A 5HORA 3V04A 3CPCA 4OTIA 1IAHA 3ZLYA 1WVWA 3COIA 1RJBA 3TEIA 4CZYB 2VGOA 4FIGA 4C02A 4CKRA 4RLLA 3CQWA 4CKJA 5FDPA 2UVZA 1VEBA 3PJCA 3EQBA 4ALVA 1FGIA 1H07A 2ITTA 2IZTA 5AR5A 3FBVA 5IA3A 2WQNA 3PYYA 4BBMA 2YA9A 2JDVA 5CALA 3UGCA 4O7VA 5C4LA 4W4XA 3TV4A 4BDIA 5KMMA 4M66A 4BWPA 2F57A 4FV4A 4DEAA 4BZOA 1GOLA 4NTSA 2WQEA 3MSSA 4ITHA 4QPAA 3RAWA 5BVDA 2CNUA 3FZOA 5M09A 5JZNA 4GL9A 4AQCA 3BCEA 4FF8A 3DCVA 3G6GA 3GCUA 2PVYA 3DBDA 4HCTA 4RSSA 5BYLA 1JKKA 1ZWSA 2W5BA 3LCSA 2V22A 3MY1A 3PDTA 4E7WA 4XNEA 4EORA 4F6WA 4AN2A 2QOIA 3NW5A 3R1NA 1H25A 3NLBA 3R2YA 1Q3DA 4AOJA 5H8EA 4BIBA 2RG6A 3EN7A 4EL9A 4RFMA 5FM3A 5LVNA 5IQBA 3NUYA 4L46A 4ERKA 2IWIA 3RINA 2BKKA 1UU3A 3V5QA 3DA6A 3ZLXA 3EQRA 2ZOQA 2F9GA 2A1AB 2P2HA 3TI1A 3UC3A 4DEDA 4R7BA 4RPVA 4EK4A 5BMMA 4EZ7A 2F49A 4UV0A 4BN1A 4CFNA 2ZB1A 1PKGA 2QOHA 3TNHA 1OITA 2W96B 1OB3A 1K2PA 1WBNA 2ITVA 2X4ZA 5CT0A 3VBVA 4AZVA 5IMEA 4E4LA 2PUNA 2GFCA 2JDTA 3LW0A 4IDTA 4O0RA 4C4IA 1OKZA 3HKOA 5LVOA 3BHYA 3QCSA 4AW2A 4NM5A 3DZOA 4XLIA 4BTKA 4D5HA 2R3NA 3OOMA 3SC1A 3WIGA 2QR7A 3FXWA 5DRDA 5DT4A 4IFGA 2GHMA 3ATSA 4BWXA 2X1NA 3BHVA 4ZMFA 1OUKA 3CKXA 3QTUA 1JSVA 3DKFA 4MXAA 4XG3A 4I5MA 1GIHA 5L2IA 4O7YA 1K9AA 2G9XA 3UP2A 3PVUA 3DKGA 1U54B 4HVHA 2GNGA 2BRHA 3MGYA 5HCYA 4NWMA 5EW3A 1SZMA 2DWBA 3RAKA 4IZAA 5KMOA 4JJRA 4UWYA 4FOCA 5G6VA 3SD0A 3UODA 5BNJA 2YFXA 2JAVA 2C69A 2HCKA 2VWIA 3EHAA 4HOKA 3A62A 2X7OA 4DEHA 5A9UA 5IPJA 5C8NA 5CEOA 1WCCA 3TNPC 4AGWA 3RNIA 3GENA 4X7QA 4G3CA 2B55A 1AQ1A 4R1VA 4UMPA 4J98A 4ZEGA 3UBDA 3EN6A 4PPBA 4BYIA 2OJ9A 3NUPA 1PXLA 4UWBA 4DG3E 2Z2WA 2HZNA 2WTIA 4L43A 4EONA 5HIEA 3QD0A 5HG7A 4DG2E 2ERKA 4Z55A 5AEPA 2IZRA 2XK9A 1IG1A 4DEIA 4EQUA 5BVOA 4O7WA 2QURA 1UNGA 3VJNA 1CMKE 2OJIA 2VTJA 5DT3A 3FZ1A 3HYHA 1QPCA 4JR3A 3UJGA 5C1QB 5KX8A 4IAKA 2UW6A 5FWKK 4FNXA 4AA0A 3I60A 4E6QA 3ERKA 5DIAA 2X2MA 2YIRA 1YXTA 2F4JA 2XUUA 4UZDA 5AUYA 1XH7A 4CFFA 5M07A 2OJGA 4ZTSA 3DTCA 2YLFA 3BWJA 1Q3WA 3DBEA 3VQHA 4GKIA 4BI0A 1ND4A 3D4QA 4FV8A 2H6DA 4D4RA 1VR2A 4HPTE 3MI9A 5JFXA 2X2KA 5BVWA 5IA1A 2YWPA 3MESA 2C6OA 1OIRA 2PE1A 3JVSA 5HVKA 3AOXA 3NSZA 3ZUTA 5JGDA 3OTVA 4RJ3A 4RRVA 3O8TA 3F5XA 3OT3A 3BLRA 3ZZWA 3G9LX 3TACA 3TG1A 3AC2A 1JQHA 5I9VA 4FZDB 4G17A 4I6FA 2NP8A 3MTLA 4XHKB 4I21A 2QD9A 2B7AA 4CSVA 3UYTA 2XNEA 3VBTA 3C5UA 3M1SA 5A54A 5AP7A 4MXOA 3ZC5A 4G3DA 5L2TA 3R8MA 5CNOA 4XG9A 5FBOA 5KMNA 1KV1A 1W8CA 4JBVA 5AJQA 5HHWA 3MS9A 4MXYA 4KKHA 4ENYA 3KMMA 4TPTA 2ITWA 4XG2A 4Q9SA 4JBQA 4FYOA 1OKVA 3PPZA 4EJNA 2PULA 1UWHA 2WMXA 5CU0A 3DU8A 1OPLA 1XH5A 4EZ3A 1Y6AA 4D2TA 2CCIA 3LFQA 3LHJA 1WFCA 1YXXA 2C3JA 4I22A 3FZPA 1Y57A 2C6IA 3MA3A 3R21A 4WKQA 3ZYAA 3THBA 5AUTA 5BVKA 3U6HA 4W9XA 5J1WA 3DDQA 3KMUA 3UG1A 3AGMA 4QMMA 3COHA 5AP0A 3RNYA 5EKNA 3CQUA 3C4CA 4KWPA 3A61A 3I79A 5BUEA 2OZOA 4C4HA 2BDJA 5IQEA 1PMNA 4I20A 3ORZA 5AR3A 1Q62A 3HMNA 3RM6A 4MWHA 2OIQA 3W2OA 3AC5A 4Y8DA 4Q2AA 2QO2A 4FKPA 4HVSA 4I3ZA 4QRCA 4EEVA 3UZRA 5HNIX 4I6QA 1FVRA 3QRTA 4HVDA 3F6XA 5F20A 3ZRMA 3TUCA 4FSWA 2WMSA 4FBXA 2J0IA 1PJKA 3DV3A 4TNDA 4XV3A 3IW6A 5ETIA 3TWJA 3ZUUA 3ORNA 4ASEA 3UNKA 3KK8A 4PPAA 3ODZX 1U4DA 2XP2A 4I24A 4WNPA 1GZOA 3ZBXA 4FSYA 4QTCA 4YGAA 3JY0A 4O38A 4BICA 2QNJA 4BCMA 4DFLA 5JFSA 5AM6A 4Y5HA 3P08A 3E93A 4TYEA 4XYFA 1SVHA 5AP1A 4NM3A 3QXPA 3QBNA 3LCTA 4QD6A 4BGQA 5D12A 3QX4A 4C37A 2YIXA 5GJFA 3CD8A 1FMOE 5HE0A 4I0TA 5DVRA 4G9CA 5ANIA 1Y6BA 3EQFA 3P23A 4OLIA 5GJDA 4QP9A 3I5ZA 5LCKA 5HX6A 1MUOA 4FV9A 1T46A 2OZAB 4QPSA 5AR4A 4FTKA 4FV3A 3VBWA 4KRCA 3F7WA 4PX6A 4R3RA 3ZRKA 5CXHA 1PMVA 3PXFA 3HECA 5AUXA 1OKWA 1Q5KA 4D9TA 3HGKA 4YJNA 4KIOA 2Y0AA 4RG0A 5J5TA 3AD4A 4AT5A 2QODA 4IZ5A 2VTRA 2FUMA 3NUXA 1LR4A 2ZM4A 4KIKB 2XA4A 4DFUA 4DT9A 3MA6A 2PMIA 4KIPA 4JX7A 4OGRA 1O6KA 4D4SA 3KGAA 4YC8A 5L2SA 3FLQA 4FIEA 2RFEA 2C6KA 2ZV2A 4XV2A 4YLKA 3C7QA 4BL1A 4M15A 3FMDA 3OWJA 2WTVA 4B6LA 3ENMA 3IECA 4FG8A 1ZARA 4O7LA 2IO6A 4CV9A 4YJTA 2HAKA 1R39A 4U42A 1I09A 2YCRA 4G3EA 4OUCA 2YM5A 3R8ZA 3WF9A 2VWUA 2EB3A 5A46A 4O86A 4X6QC 2C6EA 3GCVA 3TZ7A 5EQEA 4MHAA 2UZBA 4PRJA 4AW5A 4LRJA 3WILA 4I6BA 4JVGA 2J9MA 5FUTA 4A07A 3QD2B 2P3GX 4MKCA 4D28A 2AYPA 2OF4A 4FTLA 4QMTA 4CD0A 3D83A 3IGOA 3KXNA 4XUFA 4YTCA 4IB1A 4RC3A 3EOCA 1O6YA 1UKIA 5M4UA 5DYJA 4BGHA 1R0EA 5CF6A 1R1WA 4YLJA 5LXMA 1XBAA 4WSYA 3WZJA 2PVRA 4N4SA 5CU6A 2X39A 3S1HA 4Y83A 4DE4A 2BRBA 3PXKA 2RIOA 3ORKA 4PWNA 4U97A 5I9WA 2W4OA 4AFJA 3B2TA 4DGOA 2NO3A 4IWOA 3V8TA 4MTAA 4CMUA 1ZYJA 5CTPA 5E8ZA 4ZTQA 4DH5A 3KY2A 5ANEA 1O9UA 4Z9LA 1BUHA 4C4JA 3W32A 2YJSA 3QKMA 4QP4A 3QHWA 4J52A 5DT0A 4I93A 1YOJA 2NRUA 3BLHA 1OPKA 4XOYA 3L9LA 1ZY4A 3MH3A 3UIMA 1B39A 3NYXA 3SOCA 4WNOA 4F1MA 3NVKI 4TWPA 4LQMA 1U59A 3EL7A 2R3FA 3LXPA 1V0BA 4G5JA 3CCNA 2B53A 4O0WA 1YXUA 4QOXA 3UC4A 4BDCA 4GFOA 3E87A 4AOTA 1PXIA 1PY5A 3OG7A 4FODA 4ACHA 5A4QA 2REIA 4ITIA 4FEWA 4NZWB 4DFBA 3QC9A 3TZ8A 4E6DA 4ZLZA 1UA2A 5KMIA 3RKBA 3FLNC 1KUTA 4ZS4A 5AIKA 4BF2A 3QL8A 3Q4TA 3SXRA 3FQEA 3CJFA 4Y85A 2GDOA 4YPDA 2VTOA 5LVLA 2O3PA 2PE0A 5AR2A 2B9FA 1AGWA 1A48A 5HE3A 3EFLA 4ONAA 4X3FB 3UNZA 4IB3A 5GNKA 4EH6A 1TQPA 3RTPA 1CKPA 1WBVA 1OL7A 5TOZA 1DAWA 2BKZA 5BX0A 3ORMA 4S33A 3DFCB 1FQ1B 1V0PA 3BYSA 3KCFA 3ORPA 4KS7A 4WO5A 3KQ7A 5EOBA 2YM3A 2B9JA 1S9JA 3MPTA 2F2UA 5JRSA 2ACXA 4WBOA 5BUIA 5CAPA 3MH0A 4KD1A 4CGAA 1FBNA 3FQSA 3SG8A 3TKUA 4AGCA 3A7GA 4S30A 4EHVA 2QQ7A 1L3RE 3C4EA 4C33A 4ZY4A 4I92A 4NTTA 3NAXA 2XF0A 5I3OA 4C62A 4EHEA 1PXOA 4E5BA 3GU8A 5CWZA 4A06A 3IG7A 2XBJA 4FT0A 5CU3A 1BYGA 3SRVB 3RPSA 3QD4A 2VX3A 3DT1A 4O7ZA 3EN5A 5B2LA 3N4UA 3FI4A 4TKSA 1WBWA 1WBTA 5GJGA 4QTBA 4IE9A 4Y5QA 3TXOA 5IF1A 3ZUVA 5IUGA 2R3LA 3Q4ZA 3VBYA 3OT8A 3Q4CA 5IQFA 4BYJA 4U9AA 3FV8A 3P9JA 4GUBA 4RIOA 2VU3A 1H1SA 3ZC6A 3BQRA 2RFNA 2XIKA 4EK3A 3RZBA 4F0IA 1PXJA 2ZDUA 3L9MA 2VWXA 1XH8A 3D15A 4QP3A 4YJOA 4M8TA 2CKEA 1CSNA 4FC0A 3OUNB 4PMMA 2KULA 2XH5A 3R6XA 1TVOA 5E4HA 5CEKA 4J7BA 2WMTA 4MAOA 3U4UA 5HVJA 2XNGA 1Z57A 2V5QA 3FAAA 3IDCA 3LPBA 4K1BA 4EH9A 4GVAA 2XK3A 3D5VA 1IEPA 3SHEA 1H08A 2W1EA 1BL7A 3QLGA 4BZDA 2C3KA 5CI7A 3EN9A 3OWLA 3GC7A 4V0GB 5IEXA 2X8DA 4C34A 2R0UA 4YC6A 4EQCA 1XKKA 4D1SA 4UBAA 2X4FA 4KSPA 4RFZA 5AP6A 3GU5A 1SMHA 3HUCA 3MW1A 5J95A 5K5NA 2VZ6A 2VX1A 5IISA 3WBLA 4BDBA 3R7YA 2PMLX 3ZCLA 2XEZA 5EI6A 2XYNA 3MFTA 2PHKA 3ZBFA 3FMJA 2HW6A 4GT3A 4OT5A 1OBDA 1WVXA 3FHRA 4LM5A 4KKGA 4PMPA 3OD6X 4QNAA 1W84A 4YZBA 4F7LA 3N4VA 4O7NA 5I0BA 4NEUA 5F94A 1PHKA 3O51A 3BQCA 4TYGA 2B52A 3EYGA 5H8BA 5CVGA 5M4IA 5CY3A 2VGPA 4BIEA 3HP5A 4KRDA 4RJ6A 4FIFA 3DXQA 5AUZA 4DTAA 2WQOA 2WTCA 3JY9A 5KBQA 2YM4A 1W83A 1ZOGA 2OKRA 3V5LA 4ASDA 2JIVA 4OW8A 3PLSA 4FKRA 3FZRA 3H10A 2CGXA 4ALUA 5J79A 2ESMA 4FG9A 4KBCA 1WMKA 2G2HA 2OJFE 2LAVA 5L6WL 2V0DA 3F69A 3NGAA 4CTBA 2H34A 5EYCA 3BHTA 3GCPA 3C4ZA 4EH2A 3HZTA 3NYNA 1Q8TA 2XCKA 2ETKA 3EQPA 4JBPA 4KINA 4PTGA 1YWRA 3KN5A 4KBKA 5CQWA 5FTOA 5FEEA 3MTFA 4G6LA 3UZTA 3BEAA 3EL8A 5BVEA 1YDRE 3FE3A 4JG8A 3LCOA 2X7GA 2W1ZA 1H28A 4RIXA 4FMQA 3NYVA 4CYJA 5LMKC 3UZPA 5DN3A 1OL2A 1BL6A 5D7VA 5EM8A 1J91A 1H24A 5ANGA 4PL3A 1V1KA 2H8HA 4JRNA 4QMUA 2OGVA 2C30A 1PYXA 2X2LA 4C8BA 4EYMA 3DBFA 3BPRA 4XG8A 1LUFA 3CR0A 5HZNA 3CY3A 2VRXA 4AA4A 2JFLA 3GCQA 3QD3A 3EFJA 3OXIA 4AE9A 4IX6A 5HNBA 3DQWA 3POOA 1APME 5CU2A 2XJ1A 3B2WA 2CNQA 2O5KA 3COKA 3R00A 4IB5A 2UZDA 5F4NA 3OCSA 2R4BA 4O0YA 4ZOGA 2QKRA 4FSUA 3QU0A 5DEWA 3TCPA 4F63A 3SQQA 1FMKA 3PRFA 4N70A 2JEDA 3PWDA 4S2ZA 5FP6A 3VULA 3T9TA 3QZGA 1YXSA 5AAGA 5AV4A 2QG7A 4FNWA 2VO3A 3NNXA 3OCGA 4JNWA 4EOSA 4B8MA 2W06A 4O21A 2BR1A 3DAKA 3HX4A 4UYNA 5J7HA 3EQCA 5JZJA 3SG9A 4ANBA 3Q4UA 4EOIA 4XRJA 4HYHA 5CNNA 5CSWA 3W2SA 4RWKA 3HA6A 4JQEA 5HE1A 2GQSA 1Q8UA 3DPKA 2W1GA 5HTBA 3CP9A 5A4EA 2XEYA 5E8WA 3T3UA 4J97A 4D4VA 4AXAA 1GJOA 4BDDA 3ORXA 5IQCA 2RG5A 5L8KA 4B9DA 3RK7A 5KMKA 4EH3A 4FOBA 4DLIA 4LOOA 4ZTNA 4QMSA 5M06A 1M52A 3D5UA 1JWHA 3E8DA 3TZMA 3Q60A 4QP6A 2O2UA 4U8ZA 5JEBA 3IW4A 2PVMA 3D7TA 2GTNA 4QQ5A 2QCSA 1REKA 4PPCA 3JYAA 2JDOA 3SDJA 3DB6A 5JK3A 2UVXA 4TYHA 2PUIA 1PXKA 1TQIA 2HELA 3O8PA 4L3LA 5DI1A 3KVXA 4EH4A 3PP0A 4BKZA 1K3AA 3DOGA 4EC8A 4RZVA 5BMSA 1J3HA 3WI6A 4MEDA 1J7UA 4PF4A 4IWQA 4MF1A 3WF6A 2R3GA 3BHUA 4XG4A 3HDMA 3V5TA 3FLZA 3VW8A 3V5WA 2P4IA 5GZ8A 5HU9A 2BAQA 3CSVA 2I40A 2QOBA 4WNMA 3V5PA 5IU2A 5LWNA 3DK7A 3LAUA 4GV1A 5ETAA 4F0FA 5E8SA 2VWZA 2W1FA 3BLQA 5EYDA 4MD8E 5IQDA 4WNKA 4PTCA 2W1DA 4W8EA 3L8XA 4YJPA 2Y4IB 2UZLA 4IAZA 2XZSA 3GP0A 3W18A 3RAHA 3I7CA 4IWDA 3I1AA 4L00A 4JI9A 3MWUA 2F7EE 5EDRA 1Q24A 2CGUA 2HK5A 3EQIA 2WMVA 4J96A 1L8TA 2A2AA 3KB7A 2VNYA 4L68A 3R83A 1UNHA 4CRSA 3R1SA 4DH1A 2BAJA 2XS0A 4LFIA 4P2KA 2J51A 4RWIA 3BGZA 3PXRA 4ZXTA 1E9HA 2XK7A 3HRCA 3LQ8A 2FSLX 3F61A 4GEOA 4L7FA 4U3YA 4UALA 4ZY6A 1H1QA 2QOCA 2W05A 5BYYA 3TM0A 2JKMA 4NKAA 3CC6A 4FG7A 4RWJA 4EWHA 1YXVA 2W5AA 1XO2B 3ORIA 2BCJA 4F0GA 2VD5A 2HY81 3GOKA 4P5QA 3O8UA 2QOLA 4E20A 2UW9A 3A7IA 2WPAA 3EZRA 2O8YA 2QU6A 3SA0A 4XV1A 1QPJA 4I0RA 4GIHA 4GYGA 5JKGA 1FGKA 3KRLA 4IW0A 3ITZA 4XH6A 4QYGA 2O64A 4H36A 2O63A 2XVDA 4DTBA 3LFFA 4R6VA 4UEUA 3C9WA 3R7GA 3TDVA 2RF9A 3GCSA 3IOKA 2C5YA 3II5A 1GZNA 4P4CA 3OF0A 5M53A 4RX8A 4FKIA 3KXMA 2FB8A 5I9ZA 4NKSA 2CN8A 3ZFXA 4ZK5A 2R3HA 1GZ8A 1ZXEA 2IN6A 3B8RA 4FSRA 4PDPA 3ZO4A 2J0MB 5DOSA 3V5JA 2XKFA 3FHIA 4EOLA 5JQ5A 3N4TA 5M08A 4YZ9A 4C4GA 1DI8A 3QA0A 4GH2A 3RHXA 3TNQB 4DEEA 5F1ZA 4AT4A 4CEGA 2BMCA 2F7ZE 2NRYA 1MRUA 3BV2A 3RK9A 3ZSGA 2J4ZA 3HLLA 4UMRA 3OY3A 4AGUA 4D5KA 4YTFA 2PVKA 2R7BA 3QC4A 1M2RA 2X9EA 2YLEA 3TUBA 1ZOEA 3FXXA 3H9OA 3RPOA 4QQTA 3EQGA 2EVAA 1OVEA 3D14A 3G90X 4WG3A 5CAVA 5HQ0A 4R3PA 3A2CA 5CVHA 5GINE 2UW4A 2I6LA 3CGFA 3L8SA 5E7RA 5HG9A 2QI8A 4R77A 3VJOA 1U5RA 1YQJA 2CGWA 3COMA 5L6OA 5HE2A 2YIWA 1Q99A 3I6WA 4F08A 5FM2A 3WZUA 2HZIA 5EM6A 4ORKA 2Y8OA 2W9FB 4F1TA 1ZOHA 4R7HA 2ITXA 3JPVA 4TW9A 1Y8GA 4MXXA 5I9XA 2PU8A 2ITQA 1XH6A 4FR4A 4C58A 5L3AA 4UB7A 2QO7A 4EOMA 4J8NA 5AP2A 4USFA 1B38A 1YWVA 2PVLA 3D9VA 2C47A 4TWOA 5L8JA 4LGHA 5H2UA 4DAWA 2I0HA 3P0MA 3W1FA 4JDHA 3KN6A 4R1YA 1LEZA 4ANOA 4L7SA 1H4LA 5T6KA 1PMEA 4HCVA 3NCZA 1E1VA 4JG7A 2OXDA 2WTWA 4DEGA 3QRUA 5L4QA 3HRBA 2CN5A 3RCDA 4OTHA 4MVFA 3KRWA 4E5WA 3Q2JA 2Q0BA 2J50A 2W4KA 3DFAA 3ULIA 3KFAA 2FA2A 2H96A 4Y73A 4MCVA 4ACMA 4A9YA 3EYHA 4LI5A 2R3QA 3VW6A 3TUDA 4YNOA 2WMQA 3ZEPA 3PXZA 3DLSA 2BPMA 3HMPA 2RKUA 4L67A 4QMYA 5ANKA 4B99A 4EBWA 4F9AA 2KTYA 2QR8A 5I9YA 2BALA 3UE4A 4BGGA 2OFUA 4BI2A 2ITOA 3GU6A 2P33A 2CGVA 4IEBA 4W4WA 2HZ0A 4MF0A 4OTPA 3RI1A 5EW8A 3SLSA 2I0VA 3PE2A 4QO9A 5DGZA 3TNIA 3ACJA 3FUPA 5B2KA 2YHVA 3SX9A 3F5GA 3PUPA 4ENXA 4I41A 4BTFA 2DUVA 5IA4A 3QQFA 3CTHA 5M55A 3W2PA 4EUTA 1OIYA 2GS2A 4IACA 1IA9A 4FKGA 2GHLA 2GSFA 2WMRA 3F3ZA 3NS9A 1PXMA 3PP1A 3Q04A 1CKJA 3O96A 4IVCA 2X0GA 1ZYCA 3AMBA 5DBXA 4DHFA 3D0EA 4BCKA 5I9UA 2BHHA 3FSFA 3ZS5A 1GY3A 3NEWA 3FLSA 5KE0A 4YHJA 4ACGA 4HCUA 4EK6A 2J6MA 4L01A 4XJ0A 4W9WA 3PE1A 3ZHPC 1ZRZA 4ACCA 1ZLTA 3I7BA 5J9LA 3H0ZA 3UIBA 4AZWA 3QA8A 4BDGA 4E4XA 2JIUA 3FKNA 3R8PA 4FTQA 4RLKA 4XLVA 4E6CA 5BUJA 3ZM9A 3I0QA 1M2PA 3TJCA 3UTOA 2HY0A 3C13A 2RFSA 3HAVA 4DGLC 2VX0A 3F2AA 3R8UA 2VWWA 4IQ6A 4X2KA 5TR6A 4O22A 1NW1A 4I6HA 2YERA 2JLDA 3G0FA 3R01A 3R30A 4AACA 3ATTA 3KVWA 5GZAA 3ETAA 4D2WA 2BDWA 4WSQA 3VQUA 3QQLA 3R7EA 4FTRA 3SW7A 3G2FA 4WT6A 4BC6A 5IUHA 2XK8A 1ZMUA 2VTAA 1WBSA 3AT3A 3LFNA 4WUAA 4XS2A 3KF7A 3FMEA 4GRBA 5GIOE 5GHVA 4FSNA 4R5YA 3VF8A 2EWAA 3C0IA 1JBPE 3H30A 3QKLA 4MBIA 5FXQA 5IA5A 3IONA 2QONA 3ZONA 2R3RA 3HUBA 3GUBA 2V7AA 3POZA 1S9IA 1JOWB 3ZO3A 2EU9A 4C2WA 2OWBA 5JRQA 1YWNA 2J5FA 3MFRA 2C6LA 3UQFA 4CCBA 4BBEA 4OTQA 4YHFA 4OR5A 2E2BA 3IK3A 2XIRA 1JKSA 3U55A 4OBOA 2X8EA 1VYWA 4A4OA 2OICA 2JKQA 2BIKB 3F3WA 4NCTC 4NFNA 2GS6A 4RIYA 2RSVA 3RP9A 4UMTA 2XIXA 4CFUA 4WG5A 4D2SA 5L2WA 3NNUA 4RVLA 5HO8A
chains in the Genus database with same CATH superfamily
2UVYA 1KE9A 5FD2A 1BLXA 3IQ7A 4BDJA 4BWKA 3JS2A 5DMZA 4IZ7A 2UZTA 2AC5A 5E8UA 5KHXA 1HCKA 4U40A 2HWPA 2Z7RA 4ZSLA 3KRRA 5DR6A 2EXMA 4AUAA 4DDGA 4F70A 3UQCA 1W98A 2VTNA 4LL5A 3CTQA 2WGJA 1OBGA 4XP3A 3LCKA 2YAAA 2QOOA 3Q9ZA 3PJ2A 3UOJA 2BUJA 3MPMA 2YIYA 2YM7A 3W55A 5CENA 4MD9E 5HU3A 2ZM3A 1U46A 2OG8A 3UNJA 2XRUA 2XK4A 4D0XA 4LOQA 2WKMA 3CJGA 4O4FA 4PV0A 3KRXA 3VNTA 4ZTRA 1KV2A 1OL6A 2GNFA 5K9IA 3EZVA 3OW3A 3VF9A 4ZJVA 2HZ4A 2R7IA 4FIJA 4DH3A 5IQAA 4Q5EA 5A4LA 4O6LA 2WXVA 4PQNA 2W17A 4BVUA 2W1HA 1ZYDA 5IA0A 4OTGA 3FYJX 4AGDA 3ANRA 4KSQA 5FQDC 4JL9A 3WYXA 2HOGA 4DHZA 2OBJA 2RFDA 3OEFX 4MYGA 5CEQA 2VWBA 3FLWA 5A6OA 5HLWA 4L42A 4TYJA 4CFMA 3LMHA 4IIRA 3VN9A 5FEDA 4O0UA 1UKHA 4P5ZA 3ZFYA 5KKRB 3FMNA 4EQMA 4R3CA 2V62A 3FMKA 5JGBA 3FMLA 5JN2A 3MVMA 2CKQA 3TIZA 5I4NA 1UU9A 4NK9A 3VRYA 1LP4A 3RVGA 3WIKA 1TQMA 3SV0A 3KREA 5CSXA 5HGIA 5C27A 3KKVA 3NX8A 4O4EA 3R8VA 2X6EA 5EFQA 2OU7A 2Q0NA 3OZ6A 3BEGA 4EH5A 2Y9QA 4O4CA 4LUEA 4U3ZA 3R2BA 4DTKA 2PE2A 2WB8A 3NDMA 3TN8A 4JOAA 2PSQA 4GT4A 4RIXB 2VV9A 4YJUA 5DWRA 3O50A 5C26A 1ST4A 3Q3BA 5AFVA 5HO6A 5J5SA 2CDZA 5ACKA 3V01A 3S00A 4KA3A 2PZ5A 1H01A 1HCLA 3HV3A 3UIXA 5B7VA 4QMLA 4RT7A 3ZDIA 3GFWA 3LOKA 1P2AA 4PNIA 4H3BA 4BHZA 1ZAOA 4X21A 3Q6UA 3VUDA 4K77A 3O2MA 1H0VA 5JT2A 1QPEA 3F9NA 3P4KA 4LL0A 4EJ7A 3C4XA 4YBKA 4D58A 4YSMA 5KBRA 4BI1A 3C50A 4GS6A 4FV6A 4MBJA 1YOMA 2RL5A 4QMPA 3GNIB 4G31A 3ENHA 3GQLA 3VUMA 4CNHA 3FKOA 4CTCA 3QZHA 3W0MA 2JKOA 4BY9E 3E8CA 2WNTA 4XOZA 5FGKA 4J99A 4FZAB 4S32A 2J2IB 2WELA 4M3QA 4PP7A 2ONLC 2YM6A 1ZY5A 3GXLA 2UW5A 3HV4A 4ITJA 3V6RA 3NUAA 2R3KA 4F1OA 1YHWA 5TO8A 2VTPA 2UZOA 1B6CB 3DAEA 3NNWA 4NJ3A 4QMVA 2A98A 5E8YA 3CGOA 5AUWA 4PDOA 4GFMA 4F9BA 3Q5IA 4BCOA 1W82A 1F5QA 3VAPA 5JFWA 3E92A 3W2QA 3QTXA 3RALA 4DH8A 1Y91A 5HG8A 1REJA 4ZSAA 2GHGA 4II5A 4YHTA 3AXWA 3EKKA 4H3QA 2JDSA 3FEGA 2I7QA 4O91A 3BWFA 2XCHA 5HG5A 2XM9A 4KB8A 4M68A 4FTIA 3MYGA 4G6OA 2P55A 3BKBA 3ORTA 5CS6A 4GT5A 3A8WA 5K5XA 3ZRLA 4BIDA 4DFXE 4O81A 4JQ8A 3Q2MA 4IX5A 4L3PA 4MNEA 3W33A 5LQFA 3D7TB 4FKQA 1XR1A 4YO4A 2PUUA 4JDJA 5M4FA 3KA0A 4GK4A 1UNLA 2C6MA 2XKEA 3VBQA 3FPQA 4TYHB 4YJQA 4NYEA 2G1TA 2JC6A 2XNMA 4CCUA 3FDNA 4AXCA 3RWPA 4FV2A 4BCPA 2WU7A 1M17A 1GZKA 2WTDA 5ICPA 4CRLA 5EI8A 4F09A 2R3IA 3LM0A 2XNOA 5M56A 3QUDA 3ZEWA 2BDFA 3K5VA 1NA7A 3BX5A 3EB0A 5H8GA 3EQDA 4QMOA 3U6IA 2VO7A 5TT7A 1XQZA 2ZB0A 3LFDA 4U5JA 3FC1X 2BFYA 5HOAA 4E1ZA 2GFSA 5ETCA 2F2CB 4OAVB 4QYFA 1A9UA 3K3JA 3TL8A 4FTNA 5EDQA 4EK5A 3M11A 3P1AA 3UOKA 2JITA 4RVMA 4FI1A 3U51A 2IVTA 3MVJA 2C3LA 4DCEA 4RWLA 3IS5A 2B9IA 4C36A 4NFMA 3BBTB 3WF8A 4X0MA 3A7HA 2IEWA 3BRBA 2HXLA 5D7AA 4ASXA 1YHVA 2WTKB 5CF5A 3BI6A 3G6HA 4YJSA 3MH2A 5A3XA 3FMMA 4U79A 3QWJA 3UDBA 3LE6A 4I94A 4OTDA 3PIYA 4AZFA 4C3FA 1JLUE 5LVMA 4RVKA 1KSWA 4LGGA 5A4CA 3CPBA 4IC8A 1P5EA 2XNPA 4RIWA 3TKHA 4FTOA 4RA4A 4JX3A 2WQBA 3A7FA 4EYJA 3A4PA 4X3FC 3NMUF 4IZYA 4GCJA 5KZ0A 3L9NA 4FUYA 4G5PA 4C4EA 2R2PA 2BRNA 4M0ZA 2XKCA 3PXYA 1PRYA 4W4YA 1ZZLA 4FZFB 4UZHA 3RMFA 4O4DA 3PJ8A 4FK3A 4RA5A 5CEIA 3BE9A 4CQEA 2VTIA 3WF7A 2HW7A 4MK0A 2BFXA 2XJ0A 3DBCA 5LARA 3ZTXA 3C1XA 5ANDA 1RE8A 3AD5A 5HIDA 4G34A 5D10A 2PYWA 3RWQA 1PXPA 5HCXA 2Y4PA 2WTJA 1NVQA 3FI3A 4M67A 1FPUA 3GU7A 1OIQA 2QOFA 4FV7A 2OO8X 3F7ZA 5AIRA 1YKRA 2I1MA 2R3OA 4FTMA 5G1XA 4UYAA 4K0YA 5BQ0A 4DDIA 3VS1A 2GTMA 5DR9A 2C5VA 1XH9A 1KE8A 3F3TA 4L6QA 5IH6A 3CKWA 1H1RA 4DFYA 5CYIA 3QGYA 4AP7A 4EK8A 3OS3A 3RPVA 4I5CA 3KL8A 5HBJA 4L9IA 5C9CA 4UXQA 4B7TA 4DHJA 4IAAA 4HPUE 3W2CA 3NUUA 4DINA 3VVHA 5IH4A 2EXCX 2VNWA 5C8KA 2OSCA 4YSJA 1H8FA 3MB7A 3WE8A 4N0SA 5K0XA 4LMUA 4I5PA 4UWCA 3LKMA 3F82A 5CSHA 3E7VA 4D1ZA 4F64A 4NIFA 3NYOA 4XP0A 5IMXA 4ASZA 3CY2A 4XG7A 3C4FA 1FOTA 4XMOA 3VIDA 1YOLA 3BYVA 4GG5A 4ZAUA 4FE2A 3PA5A 2UZEA 4RVTA 2HENA 3QTZA 1URCA 2C6DA 5CI6A 3ZFMA 3NNVA 1H26A 5FDXA 3A99A 4GK2A 5EH0A 5ANJA 4O27B 3PLAE 5CSPA 4H1JA 3QGWA 4C61A 4QMZA 4AZTA 4FT9A 4BBFA 1J7LA 2QLQA 1TFFA 3R7OA 3BYMA 2WU6A 3LIJA 2VO6A 5CAUA 5T3QA 4FKOA 3ET7A 3PVGA 3NZ0A 4O0VA 1H1WA 3BIZA 3G9NA 5FLFA 4CZTA 5CXZA 4LMNA 4YZDA 3L9PA 2B4SB 4IB0A 4MNFA 4PDYA 3C0GA 1ZYSA 4OTFA 4NJDA 5AX3A 3W0SA 5IEVA 5CZHA 3ULZA 3KC3A 4BCQA 4BB4A 4MX9A 4FKSA 4ZP5A 4PDSA 2YITA 1GNGA 5HLNA 4AXEA 4CLIA 4E5AX 3UPZA 4GFGA 5HESA 3PSDA 3QLFA 5EI2A 2B9HA 2YZAA 2C1AA 3HDNA 3O7LD 3R73A 2I0YA 4FKUA 4YTHA 2UUEA 1YW2A 4C0TA 3SGCA 5E90A 1OUYA 2X8IA 3LFEA 4IC7A 5EYKA 5FP5A 3LJ2A 4EHGA 5CLPA 4X2FA 1G8AA 4XV9A 5HNGA 5T68A 3K54A 2PZIA 1EH4A 4IJPA 4PL4A 4RFYA 3R9HA 1MQ4A 4Z3VA 4BCGA 5LJJA 3F3UA 3E62A 4DYMA 3T9IA 3LLTA 3N9XA 4RQVA 3ZDUA 5CAOA 4USEA 3RPRA 3I81A 4QMNA 3OTUA 3TKIA 3MY0A 2JBPA 4HGEA 3BELA 3F2NA 2J7TA 3OCTA 4IM0A 1JVPP 2E9PA 5GZ9A 2ITPA 2VAGA 4I1ZA 3TZ9A 5K4JA 3R9DA 3I6UA 4O7TA 2P2IA 4CFVA 4YZCA 1YI4A 3D5WA 5B2MA 3LMGA 2YM8A 4AAAA 5AUVA 2ZJWA 4FNZA 5LWMA 3LQ3A 3OC1A 3NAYA 2C0OA 4GMYA 5FEQA 5AWMA 3ACKA 3AT2A 2Z7LA 2PWLA 3LQ5A 4DFNA 5M51A 5CAQA 4TYIA 1AD5A 4FEQA 2R3MA 3CEKA 3ROYA 3O71A 4C57A 4TNBA 4E3CA 2Y6OA 4ZS0A 3U54A 3SXSA 3FY2A 2H9VA 4AT3A 4FGRA 3OBGA 3QCQA 2O65A 3H9RA 3L8PA 3HV6A 3PVBA 4H3PA 4AS0A 5AAEA 5BVNA 4BKJA 4CT2A 2Z7SA 4DGMA 4LV7A 3FC2A 2XB7A 4FICA 4QP8A 2XBAA 5E8VA 4YU2A 3Q32A 4I23A 5HCZA 4LV8A 3CXWA 3TV7A 5IA2A 4U45A 2IF8A 3EH9A 1OI9A 2PY3A 3LZBA 1JKTA 1KE6A 2GNLA 2JAMA 4GJ2A 4M84A 5TE0A 2IZSA 4BZNA 3QRIA 3W0RA 4QYHA 2ZM1A 3HVCA 5E1EA 5ANOA 2BRGA 4DLJA 4BCFA 4F6UA 5GIPE 3VUIA 4GSBA 5J7BA 5D41A 2BILB 4GIIA 1BI7A 4X6RA 3ZSHA 2CLXA 1IRKA 4O2PA 5HBHA 2PTKA 4O82A 1RQQA 4M12A 3MVHA 2E9UA 3W0OA 3S4QA 1SYKA 4G9RA 5IKWA 4LOPA 1FVVA 1KWPA 2X0QA 2XM8A 4XEYA 2YWVA 3QZFA 3R0TA 1W7HA 3U6JA 3LJ0A 4HNFA 5EKOA 5E8TA 5EM7A 2W1IA 2ZMCA 2RGPA 5H3QA 3LMIA 4DH7A 3PA3A 3ROCA 5LMKA 1SVGA 2XNBA 3NW7A 3ZM4A 4D2RA 4U7ZA 3AD6A 3HV5A 2HWOA 2VN9A 3EFKA 4YC3A 3R9OA 3DB8A 3HAMA 3M42A 4I4EA 4IM3A 2NYAA 2YDKA 5K0KA 2GQRA 3DJ7A 4XBUA 5EG3A 3VUTA 4QT1A 4FKWA 4V0GA 2AQXA 3Q9XA 3EJ1A 1DAYA 2QLUA 5FXSA 1SNUA 2WD1A 3DNDA 4FVPA 1R0PA 4BHNA 1NVRA 1P14A 2C0IA 3BYUA 3IW5A 4IVDA 4M69A 3DKCA 2QO9A 2OFVA 4CVAA 5LMAA 3RPYA 4IH8A 2C5OA 3AQVA 3ELJA 4JS8A 4S31A 4FT5A 4O1OA 3CBLA 2G2IA 2XANA 2YACA 4DITA 3S0OA 3VONA 1J1BA 3OP5A 1JPAA 2IVUA 3QTIA 3QXOA 1UV5A 4RIYB 1DM2A 4K11A 5L6PA 4UX9A 5HVYA 3N51A 4K33A 3VHEA 1VYZA 3R7IA 2J0KA 3RCJA 2SRCA 4TXCA 4WHZA 1Q8YA 3LXKA 2F7XE 2LGCA 3EIDA 3PJ3A 3P78A 4JG6A 5EHOA 4LRMA 4C4FA 3V6SA 4FVRA 2R64A 2JKKA 4P7EA 2Z8CA 3MB6A 4BCHA 4FKVA 4BDAA 4CG9A 4H39A 4MQ2A 4Q9ZA 2OLCA 2FGIA 3MIYA 4LV5A 2PVFA 4UN0C 2OH0E 2WOUA 5AV2A 3TMOA 5KO1A 4ID7A 4NU1A 4N57A 3PPJA 5LMBA 3TT0A 3NIEA 5AADA 2Y4IC 3QCYA 3QYZA 4DCAA 5AAFA 4FTTA 3RGFA 2XJ2A 4R7IA 3I4BA 2BZJA 2ZYBA 1IA8A 3HP2A 4I6LA 2EUFB 2PZRA 1OMWA 3UOLA 2CNVA 2CHLA 4HNIA 4KIQA 4AXDA 4UXLA 2X0PA 2A19B 4FKLA 4R5SA 4XRLA 4F6SA 3EN4A 4TY1A 4NW6A 3KULA 4HYSA 5ACBC 4DBXA 4CT1A 3QKKA 1WBOA 1Q97A 5DNRA 5E91A 3SKCA 3UQGA 3W10A 4JT3A 3OBJA 1CTPE 5IG1A 1M7NA 2UW0A 3BGPA 3ZXZA 3Q5ZA 3UVRA 5DPVA 1MP8A 3C51A 4I0SA 4EBVA 1BX6A 4IWPA 5HTIA 4IAYA 4DGGA 5HX8A 4CFXA 3NUNA 4FSQA 2VTSA 1XMLA 4WA9A 2GCDA 2UZWE 1YHSA 1WBPA 4V05A 3GQIA 3LFCA 1MRVA 4TT7A 3NR9A 5J9YA 1WAKA 2QG5A 4QDVA 4FSMA 3F2RA 2J5EA 4OBPA 2UW3A 2PZYA 1G3NA 1Y8YA 3SW4A 2A4LA 4O0SA 4D4YA 3QUEA 3GT8A 4FK6A 4DT8A 5TF9A 3LVPA 1QCFA 5DR2A 1OGUA 2QC6A 5L8LA 1FINA 3A7JA 5D9HA 3PIZA 4M0YA 4EOOA 2NNWB 1H27A 2QU5A 3O5AA 4TRLA 2JBOA 2C4GA 3G5DA 3O23A 3EMGA 3OOGA 1BKXA 4KUJA 4U41A 4R8QA 3H9FA 3MFSA 3KXHA 2HIWA 2DYLA 3LXNA 4ZJJA 5JQ8A 2W9ZB 3QYWA 4FSZA 2UW7A 4FUXA 5DA3A 3HNGA 4IJ9A 2CSNA 3Q9WA 4FL3A 2FSTX 3HMMA 3PZEA 3B8QA 5FRIA 2W7XA 2ZV9A 3REPA 1XMMA 4QP1A 1NT2A 5BVFA 3MJ1A 3Q6WA 2VTTA 3OHTA 4F9WA 4FSTA 1F3MC 1Z9XA 3DDPA 3KCKA 4NUSA 2OW3A 3QX2A 4GUEA 4G6NA 1CM8A 4GG7A 3WF5A 3WZDA 3EQHA 2IVSA 3PFQA 2C0TA 4HJOA 5HLPA 4A9SA 4CXAA 3DS6A 3GEQA 4FKTA 4D55A 4O1PA 2GNJA 4E73A 2W4JA 3MBLA 2WEIA 3BV3A 3RJCA 1M14A 3U4WA 4GKHA 1GAGA 2BZHB 4N6ZA 2OK1A 2C6TA 3DXNA 2WZJA 3FMHA 3AC4A 5CEMA 4FEVA 4Y72A 5EOLA 3WOWA 3K3IA 5CU4A 4D1XA 4AU8A 3P5JC 3E3BX 3QQHA 4LGDA 5IEYA 4L8MA 4X2GA 3AKLA 1G8SA 1YI3A 4RJ8A 3TNWA 5J8IA 3CIKA 3UDZA 4A7CA 3QQGA 5DRBA 5E92A 3ZOSA 4FEXA 4EH8A 4WIHA 3MIAA 1JNKA 2UV2A 4B4LA 2YN8A 3FI8A 1QL6A 4H05A 2ZV8A 3O17A 3OUKA 5LVPA 3FXZA 2WFYA 4GU6A 4MD7E 1W2CA 2B0QA 4E26A 4TN6A 5C8MA 2BHEA 5AMNA 2ITNA 4NM7A 1R3CA 4IXPA 2FSMX 3E88A 2I0EA 2XK6A 3QQUA 3QTWA 4J71A 1VJYA 3GBZA 4HZSA 2PVJA 5KUPA 2XYUA 2QHMA 3QQJA 3DNEA 4MNEB 3IPHA 4BCIA 3PG1A 4QYYA 5FBNC 4G16A 4CG8A 3AG9A 3P7CA 2CLQA 1XBCA 2WAJA 4O6EA 3VRZA 4F99A 1V0OA 2YCSA 4RJ4A 5HEZA 4EOJA 4FGBA 4IFCA 3FLYA 2ITUA 2C5XA 2YCQA 2BIYA 3OWKA 3WZKA 4ANNA 5I5ZA 4C59A 4YBJA 4MXCA 3KXZA 4KNBA 3VHKA 4IX4A 4CLJA 4AXFA 3FZTA 4UMUA 5AV0A 3D94A 1R78A 4YPSA 4IVBA 3E63A 3QCXA 4MXZA 3UP7A 3UO6A 4TTHB 4U81A 4YP8A 2PZPA 4YZMA 3IGGA 4U0IA 4QTEA 5CASA 4H1MA 5AA9A 4LUDA 4YLLA 4AW1A 3BE2A 1Q8ZA 2JDRA 4IBMA 5KCVA 2WMUA 5LCJA 3AC8A 3WYYA 4HYUA 4BFMA 4DBNA 1OIUA 1OL5A 4FL1A 4Z16A 4C2VA 1ATPE 2WMAA 3U9NA 1OM1A 1YDSE 3FL4A 3QTQA 4BCNA 1UVRA 3BLAA 4O0TA 4ZY5A 4OT6A 2X81A 3NFGB 2WQMA 3G33A 5DE2A 4C35A 5F9EA 1XWSA 1DS5A 4A4XA 3LFBA 5HD4A 3GOPA 2BVAA 2P0CA 2BRMA 2ITYA 3VS4A 4J95A 4XP2A 4BTJA 3DQXA 2XRWA 1JSTA 2BAKA 4IAIA 2O0UA 4DN5A 4HVGA 5EYMA 1ERKA 4BJJA 2FSOX 3VUGA 2IW6A 5J1VA 4ZTHA 4GU9A 4RIWB 3S2PA 4TZRA 4XX9A 4QQJA 3BL9A 3FZSA 4N6YA 1KOBA 4K6ZA 3JVRA 4W4VA 4AG8A 4BDFA 4PP9A 4Y46A 3CS9A 2ETMA 5E1SA 2BTRA 5HBEA 4BCJA 5EW9A 4BKYA 3OCBA 4EUUA 4RX5A 2Q83A 3MDYA 2QOQA 2GNIA 5AP3A 2C5NA 1M2QA 4L3JA 3GI3A 1VZOA 4FT7A 3QAME 4YJRA 4AN9A 2Y6MA 4EKKA 3H4JA 3D2KA 4ZSGA 3VC4A 2CKOA 3LFSA 1YI6A 4LRKA 4BRXA 2BZIB 4KAOA 3R7VA 2G01A 3AC1A 4U44A 3RHKA 4MWIA 3ZMMA 4A9RA 4MH7A 4D2PA 2BTSA 3UO5A 3NFFB 1WVYA 5CT7A 3ZSIA 2ZDTA 2CMWA 3UMXA 5M44A 4A4LA 1JSUA 3E8EA 1UU8A 4ANLA 4WD5A 2IZUA 4G3GA 3PY3A 3DAJA 4J1RA 5DEYA 4AF3A 2DS1A 4IADA 2OI4X 5CF4A 3EKNA 4CV8A 3MY5A 4BDEA 1PMUA 4GW8A 4F9YA 3F88A 3NRMA 4YZNA 3ZZEA 1ZZ2A 4F4PA 3GFEA 5CVFA 2ITZA 3ZO1A 3A60A 1A06A 3UG2A 4QNYA 4E4NA 1J7IA 2PPQA 4FZ7A 2YABA 4QMQA 4BTMA 1U54A 2UZVA 3DTWA 3H3CA 4WOVA 4RJ5A 3GB2A 2IG7A 4NIFB 2FVDA 3H0YA 1W0XC 4JIAA 4QYEA 2IVVA 4XBRA 4RJ7A 4DGNA 3IO7A 4U43A 4YMJA 3G51A 4WUNA 3Q9YA 3IDPA 1QPDA 4EKLA 5JMSA 1XJDA 4I4FA 1OECA 1H0WA 3FJQE 4V04A 4F7JA 5KNJA 2YIQA 4FIIA 2VO0A 4BDHA 4ZMEA 5FTGA 1OPJA 3RBWA 4RMZA 3VWAA 2R3PA 3DK6A 3DKOA 3EFWA 1H00A 2XMYA 3FQHA 3QWKA 4FEUA 3R1QA 2VTLA 3MJ2A 3FKLA 3PJ1A 2BROA 1P4OA 3BBWA 3QUPA 4J8MA 4ZLYA 2DQ7X 3PPKA 5K4IA 3AKKA 3Q53A 4AAYA 1X8BA 3UYSA 3U9CA 2XAOA 3BHHA 1Q8WA 1F0QA 3PSBA 3GGFA 5HO7A 1IR3A 1IAJA 1LPUA 4RQKA 2WOTA 3W8QA 1J1CA 2YDJA 3E5AA 4FT3A 4OTWA 2YEXA 2JD5A 3LM5A 2E9OA 3M2WA 3QALE 5DLSA 3VO3A 4C38A 5ITAA 1ZMWA 1GIJA 4RX9A 1XHAA 2J0JA 5AR8A 4YURA 2V7OA 2YISA 4FTCA 4B0GA 3FPMA 3S3IA 3PWYA 2UZNA 5HTCA 1JKLA 2E9VA 4ZLOA 3VS7A 4ZZMA 2VWYA 2WHBA 5I3RA 4NM0A 4YTIA 3OXZA 2UW8A 4NCTA 5C01A 1SNXA 4O96A 5KZIA 4QTDA 4EOKA 3BU6A 5HD7A 2B1PA 4YR8A 2CKPA 1URWA 4FZ6A 3NWWA 4NT4A 3E8NA 3E3PA 3AMAA 3OEZA 3R71A 3OVVA 4O84A 4L53A 2FH9A 4E6AA 5ETFA 5IQHA 3AGLA 3C4WA 5KKRC 3BU5A 3HV7A 1OKYA 4AW0A 3ALOA 3PG3A 4IMYA 4PTEA 4JBOA 1DI9A 4L45A 3R9NA 4AA5A 5FTQA 4U80A 1XBBA 3A8XA 4OAUC 1P4FA 4FIHA 2JGZA 2ZMDA 2PVHA 4WRSA 4ZSEA 5A14A 5JSMA 3Q96A 4ZZOA 3QTRA 2PUPA 2WMBA 2G2FA 2A27A 3WE4A 4O0XA 2YDIA 2A0CX 3DJ6A 1ZMVA 1BI8A 3D2IA 3C0HA 1NVSA 2JFMA 2R5TA 3UDSA 3GU4A 3G15A 5C4KA 2R3JA 4QP2A 4APCA 4HVIA 2QOKA 5CEPA 4K9YA 1I44A 3ANQA 3QF9A 4JAJA 5JFVA 3MH1A 4GK3A 4G2FA 2YCFA 2ZVAA 4CQGA 4NW5A 4GJ3A 1MQBA 5DH3A 2HXQA 4G3FA 3T8OA 3PRIA 4Q5HA 5AP4A 4M13A 4XG6A 5F95A 1RDQE 4IANA 4EOPA 3TDWA 3V51A 3QTSA 3ZH8A 5HICA 4EHZA 3KXXA 3GC9A 2AC3A 5IQIA 3I0OA 3R28A 4CFWA 4ANSA 3UIUA 4ANQA 2JIIA 3CLYA 4QMXA 3JUHA 2NPQA 4IAFA 4CMOA 3NUSA 1PXNA 4E8AA 3JR1A 3ZLSA 1Q61A 2OH4A 4RZWA 3UVPA 2IPXA 3LXLA 3P5KA 3CE3A 2E9NA 4LYNA 2YZLA 1U5QA 2WEVA 3LCDA 3CQEA 3CTJA 4EI4A 4RGJA 3LFAA 4PNKA 2ERZE 4W8DA 2GMXA 5KMLA 2R9SA 3PIXA 3SVVA 3FY0A 3DZQA 4V01A 1OZ1A 4WBBB 3KU2A 3W8LA 4QP7A 3VUKA 2VTHA 1WZYA 5IDPA 4IDVA 3VS6A 4CMTA 2VUWA 5KHWA 1FVTA 4DF3A 3ALNA 2XIYA 4QMWA 3KMWA 2UZUE 2Z60A 3R8LA 3RAIA 1YRPA 1M7QA 4JIKA 3TV6A 4JXFA 3GVUA 3KF4A 3ID6C 2QHNA 3HMIA 3WARA 2AEGA 3S95A 4FA2A 4S34A 4ANMA 2OXXA 5HKMA 4BR3A 4KS8A 4MBLA 3VS5A 3E64A 3IW8A 4AN3A 5E8XA 3KRJA 4GVJA 4R78A 3R7UA 4FTJA 4C3RA 2OIDA 3P7AA 2R0IA 5AV3A 3W2RA 1XH4A 3F66A 3UVQA 4M69B 5A4TA 5H9BA 3F5UA 4A9UA 3OXTA 2IJMA 5A6NA 4TL0A 4DEBA 2OZAA 3KXGA 4O2ZA 4X3JA 3P7BA 2XIZA 5JH6A 3UMWA 3F5PA 4JAIA 2X9FA 5DG5A 1STCE 5DHJA 2IW8A 2VWVA 5D1JA 1JAMA 4E93A 2OIBA 4KIKA 4AFEA 5CANA 2WO6A 3V8WA 4APPA 3A4OX 2X6DA 3IKAA 4P90A 4K8AA 2CJMA 3NPCA 4I5HA 4LG4A 2CCHA 3RM7A 4EWQA 2ONLA 4NH1A 4O83A 3PXQA 2VTQA 5EDPA 4EOQA 4F65A 1YDTE 3JXWA 4HZRA 3OWPA 3ZXTA 2J90A 5CF8A 5EQPA 3VUHA 1NY3A 2FYSA 5AR7A 4AOIA 4A9TA 4OBQA 3MPAA 3OROA 4UMQA 4EC9A 4DC2A 4FTUA 3O0GA 3BYOA 2ZAZA 1KE7A 5AX9A 1G5SA 5HI2A 3V3VA 4DG0E 4KKEA 3NW6A 1Q4LA 2G15A 5J9ZA 3ZLWA 4F7NA 3DK3A 3HA8A 1PKDA 4M7IA 3KEXA 4IX3A 5FXRA 1PF8A 2PMOX 3U8WA 4G1WA 2WTKC 3D5XA 2QVSE 5CX9A 4AE6A 4D9UA 2YJRA 3KULB 4FTAA 3OMVA 5C03A 5TKDA 2WMWA 5AA8A 2VTMA 1E1XA 1RW8A 4O7SA 5IZFA 3AMYA 4BDKA 1SVEA 3R63A 5IUIA 4TWNA 3HEGA 4KABA 3C5IA 1HOWA 2W1CA 3PY0A 3HRFA 4UY9A 1T45A 1NXKA 2OJJA 4WRGA 3QQKA 4DFZE 4FL2A 4ERWA 2PL0A 4K2RA 4RC4A 3IDBA 4FNYA 2V55A 3MVLA 2OXYA 2GS7A 4JLCA 3U87A 4FV5A 3SXFA 3K5UA 3PY1A 2W5HA 5CSVA 1CDKA 4AX8A 4USDA 1LEWA 3DBQA 2W0JA 3GC8A 4L44A 4NL0A 4FVQA 4FV0A 5IQGA 4RC2A 3IOPA 3DGKA 4IVAA 2C3IB 3PVWA 2GNHA 3I5NA 4M14A 4M97A 3T3VA 3KK9A 3ODYX 3ZU7A 2FO0A 3NIZA 2Y7JA 3Q52A 4X2JA 3UO4A 4ZSJA 2C1BA 1OL1A 2AUHA 1MRYA 5J87A 5AP5A 4PY1A 5KMJA 4F9CA 3CD3A 2GPHA 1PW2A 4L52A 4PUZA 2W99B 4CKIA 4EH7A 2WIPA