3Q3BA

6-amino-4-(pyrimidin-4-yl)pyridones: novel glycogen synthase kinase-3 inhibitors
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
352
structure length
344
Chain Sequence
b'SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogen synthase kinase-3 beta
publication title 6-amino-4-(pyrimidin-4-yl)pyridones: novel glycogen synthase kinase-3β inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 99
structure length 344
sequence length 352
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3q3bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3q3bA01
4CG9A 4MYGA 2PTKA 4FICA 1KOBA 2PK9A 1PXMA 4FG9A 3CIKA 4C3FA 4EUUA 2UW3A 3LM0A 4QMQA 1WBWA 4D2RA 3VRZA 2J0KA 3LZBA 3QTWA 4BI1A 2WTJA 4YNOA 1YWRA 4RIXB 4BCQA 4ITIA 3CQUA 4BYJA 4QTCA 4BCFA 1SNUA 5HO7A 2VTTA 3NW7A 3R7OA 3LOKA 3RPSA 4FT7A 5EYMA 2GTNA 4K77A 3SKCA 4B8LA 3DT1A 3R00A 4GSBA 4DEBA 4M0YA 3MJ2A 2VWUA 5DRBA 2ITTA 4MAOA 3OTVA 3VBTA 4FV3A 4QMXA 4F7LA 5J9LA 4EZ5A 4BDBA 2W5AA 3LJ1A 4MBLA 4BIDA 4EK6A 4EZ7A 4IAAA 3TNQB 1PMEA 3D0EA 4ZLYA 4N6YA 2B54A 1ZARA 4D2SA 3I6WA 2ETRA 5LJJA 4O6LA 3T3VA 1ZY4A 2BFYA 4UALA 4IAFA 3CY3A 2AC5A 5IMXA 3BWFA 3Q96A 3GC0A 4H1JA 4TWPA 4C3PA 5EKNA 2UVZA 3GQIA 3OCBA 1JVPP 2WZJA 3PUPA 1KWPA 4K11A 3SVVA 4MWHA 4I5PA 3VC4A 4EQMA 4CLJA 2BRNA 5IA1A 1Q99A 4QP7A 4FT3A 3SQQA 4FZFB 5KKRC 3VS4A 5ETIA 5HTCA 2ZAZA 4IX3A 5K3YA 3ET7A 3NYXA 3HMNA 3R8VA 2R5TA 5M08A 3CPBA 4EHZA 5IEYA 3PJ1A 4YURA 2OH0E 3KVWA 4HPUE 3QQLA 3BQCA 4HCVA 4D9TA 2R3QA 3CD8A 3R22A 3Q4ZA 5IH5A 4CLIA 3QHWA 4PNIA 4O21A 4MCVA 4FTNA 4ACDA 4P5QA 4W4XA 3PXFA 2R4BA 4FZ6A 5CLPA 2YERA 4FR4A 5FM2A 2CJMA 3NUYA 5HVJA 4RFYA 3UNJA 1XH7A 3W18A 2WIHA 2NPQA 2YM5A 2GMXA 5IEXA 3F9NA 2PE0A 4C4FA 4Z3VA 5DE2A 4FTMA 5B0XA 2ZV8A 2X39A 2Y6MA 3VUGA 3R7UA 4EOPA 3FL4A 3C4ZA 2XVDA 4DFLA 5K4JA 2VN9A 4OTRA 4APCA 4FEQA 2F9GA 2YAAA 4RC2A 5AR7A 5K5XA 1BMKA 5HX6A 1H25A 5K5NA 3CKWA 4W8DA 3FAAA 3FLQA 5E8TA 5AUXA 5GZ9A 4YJOA 1GIJA 4U5JA 2YLFA 4U43A 5ANIA 4PPBA 5ETCA 3ZDUA 4MXOA 2XUUA 3KB7A 4JXFA 3P79A 2VTJA 4M68A 3RAKA 3CTHA 2J9MA 3D15A 4FTLA 2WELA 5L2QA 3IONA 4FVRA 3N51A 1TQIA 2X1NA 3NLBA 3R7GA 1E1XA 2W4OA 3V8TA 5KMOA 5M57A 1IAJA 2JITA 5DEYA 2BUJA 3IPHA 3KULB 5HE0A 3WF7A 1BL7A 4CRSA 4AE9A 3Q4TA 4ZZOA 3B8QA 5BUIA 4DBXA 4D0XA 5J5SA 2J0LA 2Y4IC 3TNIA 4V01A 1Q8YA 3A8XA 3DNDA 3NDMA 4IZ5A 3ORMA 5JSMA 4O7SA 4O7ZA 2GS2A 2YIXA 3EHAA 3EWHA 4F0IA 5AM6A 3DAKA 4YJUA 4EOKA 2Z02A 3M1SA 1IA9A 5L2TA 4HNFA 3KFAA 3QA0A 2QODA 2VTHA 3OC1A 4YZBA 2EB2A 3H0YA 4DT8A 4I5CA 3U87A 4DINA 2KULA 3HX4A 2QNJA 4C2WA 3SC1A 2XK7A 3C9WA 2GS7A 4K18A 3W2QA 1ZOHA 3WI6A 3DBCA 1PYXA 5LCJA 3QRKA 5FQDC 2PWLA 1Q8UA 2VWVA 4E5AX 2WMBA 4IFGA 2VX1A 4RVTA 4ALUA 4XV9A 3EL8A 5C4KA 4YJSA 1OGUA 4YC6A 1OKVA 1YQJA 5IQFA 2F4JA 4I6HA 3S95A 1YHWA 1ZY5A 3ENHA 4ANLA 2VAGA 2JC6A 3KRJA 2IZTA 4QMNA 4NM7A 5HX8A 1YHVA 1J91A 3IS5A 4FKRA 3U55A 4BHNA 3PP1A 2XRUA 2WNTA 4HJOA 3QZIA 4U40A 2WTVA 4C4JA 4E20A 5HIEA 3P86A 3FI2A 5AIRA 5HI2A 4GJ2A 4O7TA 5A46A 2J90A 3ATSA 1W7HA 4JOAA 2X4FA 5CALA 3WIKA 4LG4A 3F5UA 4BY9E 3TKUA 3PYYA 2B9IA 3MFSA 4GYGA 5CI7A 3WOWA 4FEWA 4YHFA 1UKIA 4NCTA 3I4BA 3R7IA 3U6JA 1B6CB 4DYMA 2QHMA 2XIXA 4OTFA 4Z55A 4DT9A 1XWSA 4CFNA 3VULA 2WAJA 3SW7A 4QPSA 3M11A 4QMTA 3D7TB 4YLLA 3V5PA 3PXKA 2BKZA 3ORPA 4U80A 3R01A 4M66A 4FT9A 4TN6A 3VS6A 3QUDA 2OLCA 5BVWA 5IMEA 3ERKA 4XYFA 4FK6A 3V8SA 3QKMA 4CTBA 5KMNA 5A9UA 4L45A 3MPAA 4QP4A 4FNXA 3EKNA 4O38A 2ITVA 4CG8A 5FBOA 2CNQA 4WRSA 3OTUA 4CMOA 4A9SA 1PMUA 3IG7A 3TG1A 2E9PA 3QX4A 3CCNA 1IEPA 3BE2A 1J7LA 3O17A 2J5EA 3AC1A 3H10A 5CU2A 5GHVA 1XJDA 2BHEA 4DLIA 3F3WA 4UWCA 2C6OA 4L7FA 3FLSA 3K5VA 1F3MC 3EFJA 3OEFX 5JK3A 3JVRA 4FNWA 4L9IA 2IZUA 5I9UA 1XR1A 5C03A 4CV8A 3G15A 4I94A 1GOLA 3QYZA 4CCBA 3ZM9A 1H26A 3V3VA 4RC4A 3B8RA 2R7BA 3RM6A 4D4VA 4O0VA 2PUIA 3GUBA 3R9DA 1YHSA 3BU5A 4JJRA 4UZDA 3VJOA 4O7VA 4AN9A 3QQKA 4IJ9A 1CM8A 3KXHA 4ANBA 4GU6A 2ZV7A 3IDBA 4AOTA 5J7BA 4RIWA 4F9YA 4HVHA 4UX9A 1OB3A 4IAZA 4QYEA 3CSVA 3A4PA 2R3OA 3ZUUA 1WMKA 5J9YA 3GCUA 4BGGA 4PTCA 4BDEA 4FL1A 3GC7A 2O5KA 2VWXA 3LQ5A 3QTUA 5CZIA 4BTJA 3LFCA 4LMUA 3A4OX 3RJCA 1SM2A 1FQ1B 2ITYA 3LFAA 4PPCA 4WSQA 4BBMA 2CCHA 1PMVA 4LRMA 4FKPA 3COHA 2HZIA 3QHRA 4MXCA 2ZVAA 4KA3A 5HE2A 3FLWA 3F2RA 4LRKA 3ZZWA 3JUHA 1URCA 1DI8A 2W5BA 4WOVA 3CQWA 2OK1A 1P5EA 1WZYA 4IB5A 1Y8GA 2YJRA 5AP0A 1V0BA 4X21A 3F2AA 5TO8A 4R3PA 3EQDA 2UW8A 4FKTA 4F9WA 2VTMA 4AW2A 5L6PA 2B0QA 3GCPA 2I0EA 2EXCX 4TW9A 3EQCA 4R8QA 4AZSA 4O0WA 5HIBA 3RP9A 2X7FA 2YCSA 5CSWA 3EFWA 2J5FA 4A06A 2C6DA 2XKCA 5DN3A 3MPMA 1S9IA 4U8ZA 4DH5A 1OKZA 3R30A 5EKOA 2V7AA 3NRMA 1TKIA 2YM7A 4ACHA 5CQWA 3RNIA 2XYUA 3NUXA 1KOAA 3QQHA 5ETAA 2UZNA 5EI8A 5J87A 3FL5A 4Y72A 4G16A 4DTBA 2QLQA 4ZAUA 3CKXA 3BI6A 4AWIA 4F6WA 3C4FA 5DIAA 3ANQA 4EHEA 5CEIA 2V7OA 5KX8A 5H2UA 4F9BA 3LXLA 3DK7A 3R0TA 4IX6A 4LYNA 3LXPA 2VX3A 3PPKA 2YCFA 5A6OA 4J7BA 3SDJA 3PFQA 3E8EA 3JYAA 3EH9A 3TWJA 5HE1A 2CGUA 2XM9A 3GI3A 3L9NA 3Q5IA 2QR8A 3TDWA 2YDJA 2OJIA 5HOAA 3RI1A 1NT2A 4DAWA 4BICA 3DK6A 4FL2A 2W1HA 4BVUA 5HU3A 3NCZA 4ZLOA 5AADA 4IZAA 4NJDA 2VV9A 1ZYSA 4XUFA 3BHVA 3FMHA 3NUUA 5AV0A 1ZOGA 4CMUA 2BAKA 3BQRA 4KUJA 3ORNA 3OT3A 2H8HA 4H3PA 4IWQA 4OTIA 5EM6A 4EL9A 4RX7A 4J97A 4FODA 2ZMDA 1JWHA 3ZONA 4LQMA 5TR6A 3S0OA 3Q32A 3LCOA 4WBBB 4XRJA 3LCSA 3QLGA 4BWPA 2R3JA 4MF0A 3AGMA 3QA8A 5AP3A 3KMUA 3RHKA 4BCOA 4ZMFA 4JAJA 4EJNA 2GNFA 3FSFA 2FGIA 4I4EA 3TZ9A 4TZRA 1NVRA 1JSTA 1H1SA 3EQBA 3ETAA 4BFMA 5EHLA 2PUNA 1SMHA 3RK9A 5BX0A 5BUEA 3VJNA 3RVGA 3NPCA 4UEUA 4DG2E 3PLAE 3W8QA 3QXPA 4H39A 3LQ3A 3PXYA 3QQGA 3PIYA 3VIDA 1H07A 4BDJA 1MRUA 3LKMA 3FMMA 4JLCA 4AX8A 4MWIA 3NGAA 1OUYA 3P08A 4BZDA 4EBWA 3TV6A 5IQHA 4CQGA 4R1YA 4G1WA 3MI9A 5IQAA 4GG7A 3A61A 4B4LA 4S32A 4XG2A 4FX3A 3FI3A 3OWPA 4C33A 4C0TA 3QAME 3FBVA 3ZM4A 1YOJA 3VBXA 3LPBA 3CR0A 4FG8A 2O2UA 2O0UA 3P9JA 1NVQA 4FKLA 4TY1A 1JSVA 5IU2A 4O82A 5EQPA 3MH3A 4NM3A 5FEDA 3T3UA 3HUCA 1HOWA 3ZBFA 4QMYA 4D4SA 3DLSA 5EDRA 4TRLA 4RX8A 4GKIA 4IHPA 4PF4A 1G5SA 5EQEA 2PVYA 4WA9A 3G9NA 5E7RA 2XKDA 3EKKA 3O7LD 4PNKA 1PRYA 4DFBA 4DH8A 1SVEA 3GB2A 2YIQA 4GVAA 3FY0A 2P2IA 3R7VA 2PU8A 4AU8A 4HZRA 2QKWB 4GT5A 3SX9A 5CEQA 3HV5A 4UB7A 3OY1A 5ETFA 3FZOA 5M44A 5AV3A 3Q2JA 3OBJA 4FKJA 1YWNA 5JFWA 5AM7A 2XJ2A 5D11A 3DK3A 3OMVA 2ITPA 2X9FA 4FI1A 1LP4A 2R3KA 4YTHA 3P1AA 1JKKA 3DY7A 3R9RA 5L3AA 3BE9A 3FSKA 4UV0A 3OROA 3SXFA 3I7CA 3OY3A 4BBFA 3MGYA 4D55A 1IRKA 4ERWA 1Q41A 4UMPA 3LMIA 2R0IA 4FT5A 4I5HA 2HZ4A 1XBCA 3F5XA 3HV3A 4EKKA 1WBVA 3GU6A 2C6IA 2JLDA 4K0YA 4J96A 4DEDA 4QYHA 1ZXEA 4RJ5A 2FSLX 5CX9A 4D2VA 3O23A 2UVYA 3DAEA 4BKYA 3KU2A 1APME 4RG0A 1UNGA 3GCVA 4D1XA 5ACBC 3AQVA 4IDTA 2RF9A 1E9HA 1WBOA 2WU7A 4O0XA 4XS2A 4CZUA 3F61A 4XNEA 4M7IA 2J0JA 4EEVA 5J79A 4DEGA 1YRPA 3VBYA 3P78A 4G6OA 3Q04A 4WG4A 3VWAA 4P5ZA 4FTRA 4DHFA 1M2PA 4DGNA 5IH4A 5DGZA 2OI4X 3C5UA 4Y8DA 4TNDA 4BZOA 3TCPA 2GCDA 4IJPA 1Q62A 4HPTE 3FXWA 3DXQA 1WBNA 5FWKK 2QO7A 3L9LA 4U0IA 2YM4A 3AC4A 1J1CA 4S31A 5LMAA 2OFUA 2XNEA 1IR3A 4RA4A 5D12A 3E62A 3K5UA 3E3PA 4Z7GA 5FDPA 4OBPA 4WUNA 2QO2A 3GNIB 5TE0A 2RL5A 3W10A 3AD5A 3OWKA 4TT7A 2YCRA 3U6IA 1SNXA 4TYIA 4E5WA 5CEPA 2P55A 4EZ3A 4WHZA 4F64A 2JIIA 5KE0A 4IAIA 2XMYA 4LGDA 3FKOA 3DAJA 4IVAA 3PJ3A 4F70A 3CLYA 5CSHA 2XNOA 1OBGA 3AT4A 4EQUA 2WQOA 2HAKA 3UP2A 4RA5A 4NCTC 5AWMA 5L8JA 3O8PA 4JNWA 3RTPA 2PE2A 4JBVA 5E91A 4KKGA 3L8SA 2BROA 4FOBA 1NW1A 2BIKB 2FA2A 5HU9A 4CNHA 2BPMA 1YI4A 4QP6A 3VNTA 4YSJA 2YAKA 4MQ1A 1GZNA 3IW6A 4NYEA 4Y46A 4BDFA 4M13A 2HENA 3W32A 1SVGA 4E93A 2BHHA 3S4QA 3DKGA 2G9XA 3MY5A 3PJCA 4EH5A 4IE9A 4AA0A 2PZYA 2WHBA 4QT1A 3RINA 1BKXA 2X2MA 3S1HA 2JFLA 2VGOA 2VD5A 3AT3A 3PVGA 3VQHA 1ZRZA 4TWOA 5C26A 3MH0A 2O8YA 5EHYA 4LGGA 4ASDA 2ZM3A 5I0BA 4AE6A 1I09A 1JBPE 5D9HA 5AUWA 3VRYA 3RZFA 4APPA 5A4QA 2QKRA 5BVOA 3VQUA 3GP0A 3HZTA 4Q5HA 1U46A 3UOKA 2R3RA 4RX9A 2QOOA 4IANA 4WSYA 4FYNA 4J95A 2WTDA 4W9WA 5KCVA 2R9SA 4MKCA 4UMTA 5AP6A 4LOPA 2HXLA 4YJRA 5JZNA 1A9UA 3V01A 3VW6A 5ANJA 4XOYA 5I9XA 5JN2A 3H0ZA 3R1NA 3F3ZA 2J0IA 1BL6A 4KB8A 3C4WA 4QYGA 2GNGA 3NYNA 5FBNC 4BIBA 2PL0A 3NS9A 3BGZA 3VF8A 2QO9A 2X8DA 3BU3A 4BWKA 3QD0A 4UN0C 2YDKA 2R3LA 4HYIA 4J8MA 2G1TA 4D2WA 4JI9A 3UBDA 1H1PA 4CFXA 5DH3A 3KN5A 4EYJA 4EUTA 2W1EA 2XZSA 4RLLA 2VO7A 3L8PA 3LAUA 2WMRA 3EN4A 2PVLA 4E1ZA 2PVHA 3ZO1A 3TTIA 3PA3A 2WQMA 2I1MA 2GDOA 3PE2A 2WMWA 4RFMA 3FMKA 3HEGA 4FUYA 4F1OA 1FBNA 2JAMA 4E26A 5AEPA 5M4IA 1WFCA 2GQSA 2ZDUA 4RWJA 4FSWA 5FDXA 1ZMWA 3LFFA 4O0TA 4YZCA 5AR8A 3GFEA 3MA6A 4D2PA 4QMWA 5HLWA 2CLQA 2EUFB 2J50A 4FIHA 4J8NA 1QCFA 2C0TA 4PY1A 5TKDA 2RFDA 2UUEA 3WF6A 5A4LA 3E63A 1NA7A 4XG8A 5HLPA 1YXXA 4ACCA 4HYHA 3WYXA 2FVDA 5IF1A 5IQEA 1Q8ZA 4AZEA 4RSSA 3G6HA 1F0QA 2QQ7A 3NVKI 3UDBA 3ZBXA 4IDVA 4Z9LA 2GQGA 4BTKA 2X2KA 2YZAA 5BMMA 4BDAA 4CFVA 1UKHA 3DFCB 3WE8A 4IW0A 3RKBA 3VHEA 1RQQA 3VS5A 4BCIA 4AZFA 4KIPA 4E6DA 4C4HA 3DQXA 1L8TA 3F69A 4FTIA 3HA8A 5HNGA 1OL2A 3MN3A 2R3GA 4FC0A 4N4SA 3HYHA 4YNEA 2RSVA 3FKLA 4YJTA 4YPDA 4UWYA 4A9YA 3I0OA 2XK6A 1GAGA 4GG5A 3PLSA 4NT4A 3EQHA 1OL6A 3AC2A 4Y73A 4YSMA 3S2PA 5GZ8A 3OOMA 3BYOA 1YXUA 4ZSGA 3PZHA 1Q8TA 2VZ6A 4XH6A 4AFJA 5F95A 4QOXA 2CGWA 4IVBA 3IQ7A 5IG1A 4L67A 5G1XA 2WQEA 3FMDA 4AZWA 4JIAA 1OPLA 4RX5A 3BV3A 3SV0A 4MTAA 3FDNA 2PVKA 4JS8A 3UYSA 4BDGA 4CT1A 3SG8A 4KD1A 2C30A 4JX3A 3QFVA 2IW9A 1M7QA 3I7BA 2X8IA 3R28A 3ORLA 4MK0A 5AJQA 5FXQA 1O6YA 1OIQA 3GEQA 3IKAA 5KZIA 4FV1A 5FGKA 3AXWA 4EI4A 4FSTA 4DFYA 3ZRLA 4EH7A 3HRFA 2H9VA 3Q6UA 4L01A 3F3UA 4I0RA 3NW6A 4CQEA 2FYSA 2A27A 2ESMA 2GQRA 3IW5A 4YTCA 4UMQA 4U45A 2A2AA 3EQGA 3NR9A 1TQPA 2WTIA 3AT2A 3GOKA 3I5ZA 4QD6A 4R3RA 4QTBA 4L8MA 5T6KA 4I3ZA 4LMNA 2UW4A 5I9VA 1GNGA 1ZYDA 4U42A 3MESA 2X7GA 3E92A 3PP0A 1H1QA 1MUOA 3P5KA 2P2HA 2YWVA 2R3IA 3DBDA 1CMKE 5M09A 2XYNA 5J5TA 3CGOA 3TEIA 3O7LB 4O84A 2WIPA 4FTCA 5HORA 3GT8A 3MB7A 2ZOQA 4AW0A 4D28A 3CTJA 4QTEA 5LWMA 2Y6OA 4IB0A 2XS0A 1ZMVA 5CNNA 1G8AA 1BX6A 5E4HA 4GS6A 2WMAA 2WEIA 3TIZA 5DEWA 3BU6A 2Z7QA 2H6DA 3RGFA 2E9OA 2YABA 2OJJA 4J53A 5T3QA 4MD7E 1W83A 3N4UA 4DTAA 2B1PA 2WQNA 2IN6A 2OF2A 4JX7A 4ZTQA 4P7EA 1X8BA 3KY2A 4EHVA 5K4IA 5J1VA 2PYWA 1XH6A 4PP9A 2JKQA 3KQ7A 2VWBA 4I20A 3VBWA 4C3RA 3NNWA 4DG0E 5K9IA 4O1OA 4IIRA 2OWBA 3E7OA 4IM0A 1ZYJA 4G9RA 4P90A 2ZB1A 2ZM4A 3ZHPC 3QD4A 4P4CA 3E8NA 1Z5MA 4QMLA 2JDVA 1IA8A 4PMMA 5IA0A 4YZDA 5CF6A 5FD2A 4A07A 2W1FA 3L8VA 4IVCA 5D7AA 4ORKA 2GNLA 3V04A 4J98A 5IH6A 4KIKA 3ITZA 2XNGA 2PZRA 3HKOA 3LFNA 3ACJA 3BYUA 4G3CA 4ITHA 2FUMA 4U3YA 2R2PA 3QYWA 4UMRA 3CTQA 4TYGA 4JIKA 5KZ0A 2VTLA 1QPJA 3UO4A 4PP7A 1OM1A 3SA0A 2HWPA 4R77A 2BVAA 4FKOA 4YLKA 3W1FA 5C8MA 3WZJA 4DITA 3BYMA 2UW6A 5L2WA 1JSUA 5GNKA 3UQGA 3OVVA 5DBXA 4X3FB 2UW5A 4NIFA 1OKYA 3NCGA 4CYIA 3P23A 4EOLA 5F1ZA 2ZV2A 4O7WA 4C4IA 2VTQA 4J71A 5EYKA 3SOCA 3WF9A 2C5VA 3QALE 4F09A 4G17A 4FZAB 5AP5A 4EHGA 1BI7A 3KGAA 1B38A 5C8NA 4GK4A 4I4FA 5BVDA 1OECA 3ZSIA 2REIA 4MX9A 4IZYA 3GU5A 1CKJA 3EYGA 2PMNX 4CCUA 5HBHA 2QOFA 1QPDA 4EK8A 5I9ZA 4JRVA 3ZFXA 3BHUA 3KRRA 4XG4A 5IEVA 1OPJA 4IZ7A 4XBUA 1KE9A 4I22A 2QOQA 3IECA 1QPCA 3P7AA 2RGPA 1IG1A 3BLQA 3DZQA 3HECA 4GT3A 3O8TA 4IBMA 5FM3A 4C8BA 4F7JA 4O7YA 2C1AA 4MQ2A 4CFFA 2WMVA 4GCJA 4JQEA 2R3MA 1WAKA 3PVUA 3BYVA 4F99A 5BNJA 2WMSA 4QMVA 5IQGA 3QQJA 3PWYA 5DFPA 5JMSA 3NIEA 1CKIA 3V8WA 4PMSA 3OXZA 4RLKA 1CTPE 1FMOE 4PX6A 5DR9A 1VYZA 3VBVA 5DVRA 5F20A 3ZYAA 4AP7A 3UZTA 3DXPA 4DGLC 4ZTMA 3I81A 1R78A 5E1SA 2X4ZA 3SXRA 1YWVA 2AYPA 4C02A 3ROCA 3EYHA 5H8EA 3KMWA 5HBJA 3QC4A 2C69A 4HCTA 3SAYA 3WZEA 1FINA 3BEAA 4G34A 5BUJA 3T9TA 4Q9ZA 2VTIA 2ITQA 5CSXA 3A7IA 3QZGA 4QP1A 2PULA 1WVXA 1ZYCA 3KEXA 5D10A 1Q61A 1XO2B 4RIXA 4EOIA 4DH7A 3UIUA 3F66A 5F9EA 4XX9A 2BDFA 5CVFA 2DS1A 1NVSA 2XNMA 5FXSA 4BKZA 1UNLA 4YZMA 3IW8A 3KXMA 2WO6A 3QTRA 3NMUF 4NTTA 5JZJA 2O65A 2UZBA 4FKGA 4O2PA 2B55A 3ZLSA 1EH4A 3AD4A 4GYIA 4RZVA 4H3QA 5DMZA 4O86A 2W0JA 3ATTA 4BL1A 5CSVA 4ERKA 3TUBA 3ZSHA 4MD9E 3UQFA 3OCTA 3EB0A 3CY2A 2P0CA 3LM5A 1HCLA 2YACA 2WQBA 4FSYA 4Z16A 5HHWA 5L2IA 2C6KA 5FRIA 5J1WA 5IKWA 1NY3A 2ERZE 4JBOA 2BCJA 2DQ7X 4KBKA 4FEVA 3PVBA 4PV0A 4O0YA 4E5BA 1KE5A 4X2FA 3II5A 3ZO3A 4O81A 5A4EA 4D4YA 4DFUA 3G0EA 3OD6X 5I3OA 2C3IB 4FTAA 5DR6A 2QG7A 1Z9XA 3OW4A 4I6FA 3A7FA 3I5NA 4FKWA 3NUSA 4M69B 4HGLA 4U9AA 4X7QA 4FIFA 3RPYA 4ARKA 4KWPA 4C58A 4WBOA 4NK9A 2OIDA 3D7ZA 5TOZA 3DJ7A 3QLFA 3BGPA 4L43A 4DFZE 4EOOA 2UW9A 3PTGA 5HG8A 4G3FA 4OTQA 4OTDA 1U54B 1QMZA 3W33A 3R8ZA 3MVHA 4FSQA 5LXMA 4IAKA 1M7NA 4FIEA 4GKHA 3PJ8A 2OICA 2YA9A 4MBIA 3ZZEA 3F82A 3SXSA 1M17A 2VRXA 2G2IA 4O6EA 3KXGA 4P2KA 4DEAA 4ZMEA 4ZJVA 4LUEA 2J51A 1ND4A 3ULZA 1Q24A 2FSTX 2IZSA 3F5PA 3MFTA 2ZV9A 4YJQA 3WARA 3N4VA 3I60A 3O0GA 3DBEA 1HCKA 5D7VA 2V62A 2PPQA 4TXCA 4AA5A 2DYLA 3ZLXA 4D1ZA 3DDPA 3UMXA 4EK3A 4MXXA 4O7NA 5M06A 1OL1A 3C51A 3FZTA 4OGRA 5ACKA 3ZLYA 5LVNA 2PHKA 5FTOA 3FZ1A 2PZPA 5KUPA 1VZOA 3D9VA 4R7HA 3FPMA 4ZTRA 3GC9A 3R83A 4EKLA 4CKIA 3BZ3A 4BB4A 5ITAA 3RCJA 2WTKC 3Q9ZA 4OBOA 4CSVA 2YM3A 4FNYA 5CY3A 2OH4A 3F3TA 3GBZA 5DR2A 5HG9A 3VO3A 1BYGA 3E88A 5DWRA 1J7IA 3R2YA 4JBQA 2I40A 1XH9A 3AC5A 3BKBA 4IXPA 4R3CA 5LARA 3PRIA 3TI1A 3VS3A 3OOGA 3KULA 3ZRKA 3OCSA 1LUFA 2ACXA 2VWYA 2C4GA 3RCDA 1E1VA 1O9UA 4UZHA 2J2IB 3KL8A 3QWJA 3UQCA 1H8FA 1OVEA 2CKQA 4HGEA 4NW6A 4DFNA 2XIZA 1PXNA 4K6ZA 2QLUA 3SRVB 4KRDA 4ANMA 1L3RE 2E9UA 4FGRA 2I0HA 2CCIA 3DXNA 4GEOA 5LQFA 4FEXA 1JKLA 1PKGA 4G3DA 1GY3A 3IK3A 2JBOA 1OPKA 3G6GA 2OG8A 2I0VA 3POOA 4G2FA 4HYSA 4IMYA 4AZVA 4D1SA 4DGOA 5FP5A 4HGSA 1VYWA 3KKVA 3V5WA 5B2LA 5IA2A 5HBEA 4TWCA 3RPRA 4CFWA 1Q97A 3K3IA 1UVRA 4ZOGA 4WUAA 3NUNA 5CNOA 4IACA 5I4NA 1OIYA 3KC3A 3SLSA 1IASA 3QZHA 5TF9A 4ID7A 5E8UA 3ZOSA 5BVFA 5E8YA 3MH1A 1U59A 5G6VA 3OUNB 3C13A 1YI6A 3FLNC 1H00A 4FKSA 2WMTA 3C0GA 3QRTA 4RRVA 3DFAA 4DFXE 1QL6A 4G5JA 4JDIA 3QKKA 4MXAA 3L1SA 3LCKA 3Q4UA 3KXZA 4KINA 4YC8A 4A4OA 3OZ6A 2IJMA 4KNBA 3VHKA 5M4CA 4RJ8A 4XRLA 3DKCA 3QBNA 3R7YA 5GJGA 4F65A 4BN1A 4ENYA 4QQJA 4USDA 4W4YA 2A0CX 3H9RA 3PA5A 2Y4PA 2P33A 3BCEA 3LXKA 3ULIA 4EWQA 2PVNA 5JH6A 3EN9A 3LCDA 3NNUA 3W8LA 4BIEA 3COKA 4FA2A 3MBLA 4YJVA 3UG2A 4NKAA 3RZBA 3MYGA 3UODA 3UNKA 3MSSA 5IDPA 5BVEA 5C01A 2X0GA 3D5UA 2WTWA 3FI4A 4TYHB 3KRXA 2VWIA 4MBJA 3C4EA 4Q9SA 5IPJA 3HAMA 3ALNA 4M15A 3KRWA 3D7TA 2B4SB 4RQVA 3KF7A 4FSUA 4V0GB 4AT4A 4PTGA 3TDVA 3ID6C 4EH2A 3LLTA 4BCNA 2QCSA 4IFCA 4CMTA 4X0MA 5I3RA 2B7AA 3FHIA 4WNPA 3R8PA 2OU7A 5HCYA 4AA4A 4ANOA 4ZTSA 3MV5A 4BTFA 1YXTA 2XKEA 3CJFA 3DV3A 2UZLA 4MXZA 3L9MA 2R3PA 3CPCA 5DLSA 1P4OA 5HE3A 5AA9A 3V6RA 4DCAA 5KMIA 4XLIA 4QQTA 3MJ1A 5CXZA 2VO3A 5IA3A 1R3CA 4U81A 4G9CA 4Y83A 4LV5A 5HKMA 3UJGA 3LIJA 4PQNA 4XG9A 3ZXTA 2WXVA 2XK9A 2ZJWA 1OL5A 4MNEB 5L6OA 3H9OA 2F57A 3KCKA 5EK7A 3DJ5A 3U4UA 4AOJA 1R1WA 3QUPA 5A3XA 3R1SA 3HV7A 2W9FB 2YM8A 3BLHA 4FIJA 4MF1A 5HG5A 4M84A 5M4UA 4GUEA 4HNIA 1UU8A 5A6NA 3RMFA 4JDHA 4DCEA 1MQBA 3R21A 4FBXA 3UNZA 5M56A 5LMKC 4XG3A 4KSPA 2G15A 3WE4A 3CQEA 4XLVA 4QTAA 3OBGA 3HNGA 3OXTA 4M97A 3KN6A 2QOCA 2HELA 4KRCA 1F5QA 3FMNA 4JL9A 4EH8A 2IO6A 3TT0A 5AR4A 2XA4A 1PXKA 3AMBA 4WO5A 2PVRA 1OUKA 2QURA 2OFVA 4OT5A 4RIYB 4XG7A 5CZHA 4GIHA 5KHWA 4B9DA 2BDJA 3IDCA 4RJ7A 5KHXA 5AFVA 3VS7A 4HW7A 2R3NA 3GVUA 2R3FA 5EOLA 4FV4A 4DBNA 4FZDB 3VF9A 4DGGA 1P4FA 3NX8A 4JAIA 4YJPA 5CENA 1H24A 1PJKA 2YHVA 3EMGA 3EQPA 1G8SA 2VWZA 3TKHA 3FC1X 2GFCA 3OEZA 2HK5A 4GW8A 4RT7A 3W2CA 4CXAA 4E4NA 4AS0A 4D2TA 2H96A 2XIKA 2ITXA 3SG9A 3MFUA 4FIIA 5AX3A 3LVPA 4C7TA 3NNXA 4OR5A 2VNWA 3SGCA 1BUHA 3H3CA 5EW3A 3ORIA 3FE3A 4B7TA 4C59A 3N9XA 4ZSAA 3PRFA 3K3JA 2BDWA 3CBLA 4BCKA 5IQBA 2GU8A 4KKEA 4WT6A 5AV1A 4NFMA 2BFXA 3Q9YA 3KXXA 3QD2B 2VTOA 1H0WA 4I0TA 4JG6A 3TUDA 3LLAA 3QUEA 4E4LA 4LOOA 5HZNA 1JPAA 4RZWA 5FEEA 4ALWA 2ITWA 4I24A 3VUMA 3PJ2A 4RPVA 5AA8A 3FI8A 4EONA 1YKRA 3U8WA 4ONAA 3N4TA 4IC7A 3UPZA 4H1MA 4ALVA 4F9AA 4FTJA 3QC9A 2JIUA 5CVHA 2XNNA 2XK4A 3AD6A 3Q9WA 1H08A 1IAHA 3QTXA 1UU7A 3EQFA 5E8SA 1QPEA 3OUKA 3DB6A 2KTYA 4WIHA 4ZZMA 2XF0A 3D2KA 3PY0A 2OZOA 3QRJA 1ZOEA 4OT6A 4QNYA 5HVYA 5JQ5A 2OZAB 2ITZA 2NO3A 3GU7A 4OBQA 3QU0A 4O0SA 2Z7LA 1YXSA 3F3VA 4Y95A 4ZTHA 4U97A 3E8DA 2XNBA 4FOCA 4GJ3A 5A4TA 4A4LA 4R1VA 3HDNA 2PUPA 5F4NA 5BYLA 5AV2A 4X2JA 1OI9A 2BRBA 4G5PA 4CTCA 3GENA 2XRWA 1WVYA 3LE6A 4B6LA 1CDKA 1RDQE 2OJ9A 3O2MA 1YI3A 1R39A 4L6QA 3C0IA 3HL7A 2ONLA 4GT4A 4EK4A 5CTPA 2OJFE 4YHJA 2C1BA 5CU4A 1FGKA 2A19B 4H05A 5K0XA 3SOAA 2OJGA 3DU8A 3FJQE 2EVAA 2OO8X 5FP6A 5HLNA 4YMJA 3DZOA 4ZY5A 2YIRA 2WB8A 5D41A 5EW9A 3TXOA 3UVRA 4OTGA 1DAWA 3VAPA 3G9LX 4JRNA 2YFXA 2C0IA 3ZUVA 4ACMA 2BKKA 3D14A 4XEYA 1PXJA 3I6UA 2BILB 2CN5A 1KV2A 4M0ZA 1ZZ2A 5CXHA 3U51A 3LXNA 3VUHA 4DG3E 5H8GA 3EQIA 2R0UA 4F9CA 4WNMA 1WVWA 2CNUA 5E8VA 3MIAA 5ANDA 5JGBA 2XK3A 2XH5A 2IG7A 4XP3A 5HO8A 5DG5A 3ZLWA 2BMCA 5CAUA 3ORKA 3HP2A 4WG3A 1PF8A 3ZO4A 2JEDA 4QP9A 3V5LA 1JKSA 4ASZA 4RMZA 4PL3A 3HV4A 1UA2A 2PY3A 5A4CA 4O7RA 3HVCA 3RK7A 1LPUA 3U6HA 5CT7A 4F6SA 3RALA 4AT3A 4FYOA 4ZSJA 1DI9A 4IWPA 1BLXA 5EHOA 1OL7A 5FG8A 1KSWA 2CGXA 3ENMA 5E1EA 3NUPA 5HCXA 1H0VA 2W5HA 3F5GA 3ZU7A 5I5ZA 4ZY6A 5JGDA 4L52A 4G3EA 1ZWSA 1CKPA 5LVOA 1ZAOA 4X3FC 1OMWA 1W8CA 4I23A 5H3QA 4FKVA 3V6SA 4BCGA 2X9EA 2Y9QA 5FEQA 3D94A 3HMPA 3ACKA 3UC4A 2ERKA 3I1AA 4QP8A 3UZRA 3AGLA 1AGWA 1SVHA 1SZMA 3F6XA 3DQWA 4I0SA 3LQ8A 3DTCA 5CASA 2OBJA 3QKLA 5E9EA 3HRBA 5DHJA 4I92A 4JQ8A 2UVXA 2HY0A 5AP1A 1V0PA 5KNJA 1DS5A 1RE8A 1YW2A 3C7QA 3DOGA 1FOTA 2C6LA 5JKGA 3VS1A 5B2MA 3TIYA 2XKFA 3EN5A 5CSPA 2YEXA 5FTGA 2X2LA 5CS6A 3HLLA 3JVSA 3DKFA 4NM5A 4O22A 4D4RA 4O1PA 3FQEA 5ANKA 1R0EA 5CANA 3TZ8A 3F7ZA 4QYFA 4TTHB 3UIMA 3OT8A 3R8LA 4B8MA 4O2ZA 5BVKA 1WBTA 1PMNA 4PTEA 4NU1A 4L7SA 3NYVA 3POZA 3RNYA 3VVHA 4CV9A 3KK8A 3MPTA 3FV8A 5IA4A 4AF3A 4ZZNA 3QCSA 5C1QB 4AGDA 4USFA 4NUSA 4DN5A 1DM2A 3HUBA 4IM3A 4L00A 1KE8A 4IQ6A 2QOIA 4A4XA 4BWXA 4YR8A 3OW3A 3Q6WA 5EG3A 4BHZA 2W1ZA 3O71A 5FXRA 4IX4A 5AUYA 2ZMCA 2WD1A 4QMSA 1M2RA 5AUVA 5KMLA 3GFWA 3BX5A 4X3JA 2XBAA 3FMLA 5DPVA 4N6ZA 4BZNA 5CF4A 2QONA 4E6CA 2ETMA 2QHNA 3PG1A 2JAVA 3TJDA 4TL0A 2WOTA 3ZCLA 4MEDA 2GNHA 4F0FA 2XCKA 2PE1A 5HTBA 4BDDA 3QCYA 4HVSA 3ODYX 2ZB0A 3VUDA 5IDNA 4C37A 4E4XA 2G2HA 4NFNA 4R7BA 2UZOA 4DEHA 3CE3A 4JBPA 2XIRA 2B9JA 5CYIA 4CYJA 3R63A 4YGAA 3VN9A 5CVGA 3W2SA 2V0DA 4YBKA 5HVKA 3R1YA 5EFQA 4NL0A 3VS0A 5AR5A 4IWDA 2IVVA 4AXAA 4FSMA 4FV0A 5HTIA 4F08A 4HYUA 3T8OA 3PIXA 2ITNA 2FH9A 3Q3BA 2OXYA 4RGJA 3E7VA 1YXVA 2O64A 2PSQA 2F7XE 3LHJA 2UW7A 3NEWA 4YZ9A 2W1IA 3BBTB 3R7EA 4B0GA 2HWOA 1PYEA 2E9NA 3TNWA 3UZPA 4IH8A 3RAIA 4F0GA 4BDIA 3WYYA 4AZTA 3QZFA 3EZRA 4J1RA 1GZ8A 2PMIA 2XBJA 4W8EA 2V5QA 5HNBA 4TKSA 2X6EA 1Q4LA 3R71A 4AW5A 2O63A 4IC8A 4PL5A 5JT2A 4FSZA 5J8IA 3IDPA 2BTSA 2W1GA 5L6WL 5HNIX 4GV1A 3RHXA 3G0FA 4LFIA 1URWA 2CSNA 4UWBA 3QL8A 1W84A 1UU3A 2CKEA 4BI0A 3PY3A 5JEBA 4YP8A 2I6LA 4S30A 4EH4A 4AN2A 5GZAA 4PMTA 3BHTA 4C2VA 3OHTA 2VTPA 2W05A 1PHKA 4RBLA 3BELA 4Y85A 3QGYA 2IW8A 3TTJA 4XP2A 1M52A 3FPQA 1REJA 1P2AA 2GTMA 4TPTA 5CAPA 2CMWA 4YO6A 4CZTA 4RVLA 3LFDA 4FUXA 4Y5QA 2RFEA 4MHAA 2XJ0A 2PVFA 4L53A 4AT5A 4BF2A 3MA3A 2HW6A 3ANRA 4C61A 4EC8A 2BALA 2VX0A 3L8XA 5DT3A 5M07A 3V5JA 4FIGA 4L46A 3A2CA 2J7TA 4OLIA 4XBRA 4XJ0A 2C3KA 2YZLA 2HXQA 3G5DA 3NSZA 5GJDA 5HIDA 5IUGA 1PKDA 1H1RA 3MVJA 1WBSA 3G33A 3QXOA 5E8ZA 4O7LA 3W2PA 4EORA 4QMUA 3ZC5A 4G6NA 2OIQA 4AUAA 5LMKA 1MQ4A 3MW1A 5M4FA 4NH1A 3UC3A 4FK3A 5AUTA 3QGWA 1K3AA 4IB3A 4ZTLA 4BDCA 2QVSE 3RAWA 2DUVA 4QPMA 2QR7A 3IGGA 2VO6A 4FV7A 4GK2A 4PDOA 1XBBA 5IUIA 2WMUA 4M8TA 3ZO2A 4F4PA 5KO1A 4CKJA 1W82A 3U9NA 5BPYA 4ZS4A 3C5IA 2VNYA 2BZIB 4EK5A 4FTTA 4YO4A 4DC2A 3V51A 3ODZX 4HCUA 3FHRA 3B2WA 4GUBA 4GVJA 3E93A 1FGIA 4FV2A 5HICA 3KA0A 3ORTA 1JQHA 3Q9XA 4QO9A 4RIWB 4KKHA 4V04A 4XV1A 2F49A 4L42A 4JR3A 4EOQA 3M2WA 4GFGA 2XCHA 1ATPE 1KV1A 1XH4A 4O96A 4DA5A 2A4LA 4KAOA 4CVAA 2GHMA 1H28A 3DTWA 5B2KA 4JDJA 4ANQA 2IPXA 4YBJA 4FEUA 4XP0A 3HMOA 3FKNA 3OXIA 4I41A 2YISA 3S3IA 2PMOX 3WZUA 5LMBA 5KBQA 1UV5A 3B2TA 3R9NA 1M2QA 1H4LA 1MP8A 3TUCA 3FXXA 2IW6A 2SRCA 3ZFYA 3C0HA 2C5YA 2QOLA 3FZRA 4QP2A 5GJFA 4JG8A 3VBQA 3R8MA 3GCSA 4IADA 5DNRA 1GZOA 3RPVA 4BCJA 4WNOA 3PSDA 2W99B 2F2CB 4PUZA 2VTNA 1H01A 1FVVA 1XQZA 4ASXA 2ONLC 3A62A 4NW5A 4XG6A 3DS6A 3CXWA 3G2FA 1REKA 1OIUA 4QRCA 4GU9A 5KMKA 5DOSA 4V05A 3R9HA 2XNPA 2JFMA 2W1DA 1ERKA 4L3LA 5BYYA 2C5NA 3ZC6A 4ZIMA 3TN8A 2J6MA 5EM7A 5BQ0A 4HZSA 3SD0A 2BTRA 1ZMUA 4GFOA 3UOLA 4YC3A 4BTMA 5J95A 2XP2A 2YN8A 3ALOA 4X6QC 1U5RA 3OG7A 4NZWB 4O27B 5M55A 2RKUA 2VTAA 3FUPA 3M42A 3R02A 3VUKA 2OW3A 3C1XA 4HVGA 2JIVA 2LGCA 3T9IA 4FT0A 3QF9A 3BEGA 2EWAA 1A06A 1U5QA 3TV7A 3PZEA 3O50A 4NTSA 1XH8A 3MB6A 3PXRA 5AV4A 1JAMA 4R78A 3C4XA 2BZKB 5AAEA 2A1AB 4FSRA 5CAVA 4FL3A 3RPOA 3PIZA 2XM8A 1W98A 2WMQA 3E3BX 2CLXA 2UZTA 2ITUA 3QX2A 4QYYA 3CS9A 3UE4A 2WTCA 5E92A 3UGCA 5DYJA 2CHLA 3ZFMA 1M14A 2YJSA 4E4MA 3QQFA 2GNIA 1PY5A 1RW8A 4E6QA 5ANGA 2JDOA 2OXDA 3GCQA 2J4ZA 4TYEA 2RG5A 3BHYA 3E87A 5JFSA 3QQUA 2QU5A 2JBPA 5AP7A 2R7IA 3WIGA 1Y6BA 4BDKA 4AN3A 4YTFA 4UYNA 3TJCA 1TVOA 1VR2A 5CT0A 5CI6A 2F7EE 2CKOA 3DBFA 2X6DA 3O51A 1XBAA 4X2NA 4FMQA 4AGCA 4PWNA 4ANNA 4EJ7A 1OIRA 4S33A 2XIYA 5IUHA 5E8WA 5JQ8A 3UOHA 5DRDA 3BWJA 4EH9A 4LGHA 1S9JA 4GRBA 4GH2A 3AG9A 4H58A 3PSBA 3R8UA 5BMSA 5FTQA 3PE1A 4RWLA 3HMMA 2QI8A 3EOCA 3I0QA 2BAJA 2PZ5A 2P4IA 4W9XA 2B53A 3L9PA 2YITA 2VU3A 3R9OA 4FSNA 3QTZA 4NJ3A 4H3BA 2YWPA 3VUIA 2EXMA 2W4KA 4FGBA 2GPHA 5TT7A 3Q5ZA 5J7HA 2C6MA 4QMOA 3RM7A 4ZJJA 2CNVA 4UXLA 2PVJA 3P4KA 2GS6A 2WKMA 3FZPA 3TV4A 3PDTA 3U54A 1MRYA 2NP8A 2JDRA 4X3FA 5EYDA 4PL4A 2EXEA 2FB8A 3HRCA 3I79A 4KBCA 2WGJA 4U7ZA 5FLFA 4C38A 4BKJA 1LR4A 2XK8A 2Z60A 1YOLA 2ZM1A 3EZVA 2UZVA 4F6UA 1CSNA 4H36A 3QRUA 4EQCA 5KKRB 3MY1A 1A48A 4PDSA 4M12A 2JDTA 3NUAA 3R6XA 3A99A 2Y7JA 4G3GA 5IQIA 4J99A 3KMMA 2YIWA 5I9YA 5DT0A 2F2UA 3QTIA 1FVRA 3GGFA 4N70A 4WNKA 3HAVA 4K1BA 2YDIA 3W16A 4ITJA 1H1WA 4G6LA 4GL9A 3JXWA 5BVNA 2R3HA 1OKWA 4JR7A 4IVDA 2C5OA 4N0SA 1K9AA 4C4EA 4K9YA 5L4QA 2JKMA 5GINE 3WBLA 5IQDA 4E3CA 2XEYA 2WFYA 3QTSA 4K2RA 5IZFA 4KBAA 5CAOA 3OF0A 2X8EA 3BLRA 4EOMA 3IOKA 4ZK5A 4JQ7A 4BCHA 4FTKA 1I44A 4JDKA 4IAYA 4RFZA 4HOKA 5EYCA 3PA4A 3ELJA 2HCKA 1G3NA 2VTSA 4RQKA 5GIPE 4RJ4A 2JDSA 2CPKE 4FVQA 4LL5A 4O0UA 3COMA 3AMYA 3UMWA 4DH3A 4L44A 3U9CA 4QTDA 2UZUE 2EB3A 4QMMA 4CEGA 5HD7A 4BYIA 4LOQA 4R7IA 2IWIA 2QOKA 2UW0A 5ICPA 4DF3A 4LM5A 3Q52A 4R6VA 3FZSA 2DWBA 2ZYBA 1YVJA 4X2KA 5LCKA 4DEIA 1UU9A 3CEKA 1ZLTA 3P7CA 4IX5A 3QRIA 4PDYA 2GHLA 3MH2A 4BRXA 5JGAA 4DEEA 4R5SA 3AC3A 5AP4A 4NM0A 4II5A 2NRYA 5EDQA 4AGUA 2OIBA 4QMPA 3C50A 3UO5A 3DNEA 4KS8A 2HY81 2HZ0A 5D1JA 4LV8A 3AC8A 4A7CA 4IWOA 3OCGA 4D0WA 2BRMA 2E9VA 4KSQA 4RVMA 3ZDIA 4EYMA 5JRQA 5L8LA 3P7BA 3UIXA 2Y4IB 2Y0AA 4Q5EA 3H30A 3LFBA 5EDPA 3F7WA 3QCQA 5H9BA 3PG3A 3TZ7A 4C62A 5I9WA 1KUTA 4ZSLA 2Z2WA 3IO7A 2YCQA 3CP9A 5AP2A 3DDQA 1Y91A 4NKSA 2C5XA 2WEVA 1U4DA 3H4JA 5EW8A 3A8WA 5KMJA 2J0MB 4BC6A 4IB1A 2IVSA 1GIIA 2Z7SA 3D83A 1XKKA 4JG7A 3DCVA 4QNAA 1V1KA 4OUCA 4UMUA 5EQYA 4RJ3A 2FSOX 4N57A 4NEUA 4A9RA 1UNHA 5M53A 3CC6A 5M51A 1LEZA 5CQUA 4M69A 2P3GX 4GK3A 2I0YA 3UPXA 2ZDTA 5LVMA 5LVPA 4QQ5A 4AQCA 3LJ2A 5LOHA 3EQRA 4ZS0A 3RK5A 2WMXA 1VEBA 2B52A 3W55A 3PPJA 4CGAA 4EOSA 1U54A 4XMOA 4M67A 2W17A 5HQ0A 4BGHA 1FVTA 2OSCA 3W2RA 4FTUA 4BI2A 3ORZA 4E6AA 4OAUC 4F1TA 2F7ZE 3EIDA 3Q60A 4OW8A 3D5XA 5HD4A 2QOHA 5GIOE 2C3JA 1DAYA 3VS2A 2WU6A 4RC3A 3ZMMA 4BR3A 2B9FA 4M3QA 2X81A 3EL7A 4FV5A 3SW4A 4FV6A 4L3PA 4DLJA 1AD5A 5KMMA 3ZSGA 2OKRA 5HG7A 5J9ZA 4AOIA 4ACGA 4LI5A 5A14A 4I21A 4W4WA 3O96A 4OTPA 5JFVA 2ETKA 2AC3A 3ZXZA 2BZJA 4QPAA 1YOMA 4TWNA 4FVPA 4UXQA 3O8UA 1B39A 3LMHA 2NRUA 4L3JA 4NWMA 3MVMA 4S2ZA 1JOWB 2I7QA 1Q8WA 4DGMA 1TQMA 2RFNA 4R5YA 5C4LA 5IQCA 2GNJA 3KCFA 4MVFA 2WPAA 4JT3A 4QP3A 3UP7A 3IOPA 4YLJA 4HVDA 3DA6A 3R1QA 4ZEGA 4RWIA 5IISA 3GC8A 1OZ1A 2GFSA 4NSTA 4WKQA 2PVMA 4CRLA 3MIYA 3BYSA 5CU3A 3RWQA 3WF8A 3BPRA 2W7XA 2IZRA 4KABA 3MVLA 4BCPA 4RJ6A 2O3PA 4X2GA 4XV3A 5DT4A 1Q5KA 1SYKA 3GU8A 3TM0A 4YPSA 5AR2A 4L68A 1PXLA 5HCZA 2Z8CA 3AMAA 3QWKA 2H34A 3MS9A 3SRVA 5CEOA 3D4QA 3QTQA 4C4GA 5B7VA 4DE4A 4EC9A 2JD5A 3A7GA 4GMYA 2W96B 2B9HA 1JKTA 3OWLA 1Z57A 3TZMA 1Y6AA 1GJOA 3FQSA 4KIOA 5C27A 2BRHA 5AMNA 4LL0A 5CEKA 5EI2A 4USEA 2XB7A 4OTHA 4ZJIA 4EWHA 4Z7HA 3F88A 2RFSA 3IW7A 4EBVA 4C34A 1LEWA 4BBEA 5AX9A 3UYTA 3EN7A 3NZ0A 4D58A 4FKIA 4AW1A 1XHAA 2NNWB 5CU6A 2Q0BA 3ZS5A 2BR1A 2OXXA 4RIOA 4O83A 3BIZA 1YDRE 3GQLA 3NWWA 4ZXTA 1UWHA 4J52A 4O91A 3UTOA 5AUUA 3DLZA 1J7UA 1OITA 3NAXA 3OS3A 3QCXA 4CFUA 5KBRA 2WTKB 4GFMA 4K33A 3LCTA 3VW8A 3CD3A 2JKKA 5EM5A 4IEBA 3FMJA 1YDTE 2GSFA 3BBWA 3HDMA 4F7NA 4FE2A 5JRSA 4UBAA 4E8AA 1JLUE 4PPAA 1Y8YA 3RWPA 4YZNA 4PDPA 4AFEA 4U79A 1WCCA 1FMKA 3BHHA 4FZ7A 2IVUA 5EOBA 3NVMB 2PUUA 3PSCA 3EFLA 5ANOA 5HESA 4TNBA 1H27A 4PRJA 1P14A 3EN6A 3LFEA 2W1CA 1NXKA 3JY0A 4FG7A 2Q0NA 4TYHA 1GZKA 5AAFA 2OGVA 4D9UA 3K54A 3ZEPA 1V0OA 4U44A 4V0GA 3RAHA 4Q2AA 4ZTNA 3HP5A 4XCUA 5C8KA 4AGWA 4FKQA 1YDSE 3C4CA 2UZEA 4UY9A 2QC6A 4AG8A 5H8BA 3KRLA 2HW7A 4ASEA 4D5HA 4TYJA 4WG5A 4LUDA 1PXOA 1R0PA 2BIYA 3DPKA 4S34A 5IA5A 2QOBA 3KK9A 3V5QA 3A7JA 4XHKB 3AOXA 2VO0A 3TACA 3OFMA 4F7SA 3COIA 4FTQA 2JGZA 2WOUA 1UWJA 3ZRMA 5ANEA 4MNEA 3MTLA 4CT2A 1KE7A 3TNPC 4C36A 3GXLA 4DH1A 1K2PA 4HGTA 3BV2A 4AACA 3KVXA 4I5MA 1MRVA 3JR1A 3W2OA 3KXNA 5HGIA 2CN8A 2R64A 4QQCA 4HVIA 3DB8A 2FSMX 2V22A 3NYOA 5LVLA 4U41A 3THBA 4B99A 4Y5HA 3G90X 3QD3A 4F1MA 3R2BA 5AAGA 4K8AA 2VUWA 3UIBA 4WD5A 4I6QA 2XJ1A 2V55A 3A60A 1PXIA 4MNFA 1PW2A 3PXQA 5JFXA 2BZHB 3LMGA 3WZDA 1O6LA 1ZZLA 2UZWE 5C9CA 3LW0A 3TNHA 2BRGA 4BCMA 3E64A 1PXPA 4BGQA 4RIYA 2HOGA 4JVGA 3HMIA 4M14A 2QD9A 1WBPA 4W4VA 2C3LA 4X6RA 3NAYA 4YJNA 4OTWA 3SHEA 3MY0A 3WZKA 4E7WA 4ZP5A 3DGKA 5A54A 5CU0A 3G51A 3H9FA 2HIWA 3U4WA 2C47A 2QU6A 3NNVA 3Q4CA 5T68A 4CFMA 4DTKA 2W4JA 1J3HA 2ITOA 2PMLX 3D5WA 3BGQA 3PVWA 3V5TA 3KREA 2G2FA 2C0OA 3Q53A 4EOJA 4IM2A 3DBQA 3RBWA 4OAVB 3FYJX 4KS7A 3DKOA 3E8CA 3HA6A 3PXZA 3ZTXA 1Q3WA 2RG6A 3UO6A 4YUQA 3LFSA 2YLEA 3MFRA 2CDZA 2W06A 3UVPA 2X7OA 4UYAA 2CKPA 3ZH8A 3K2LA 3NIZA 5CAQA 4F63A 3FQHA 1Y57A 3P0MA 4LRJA 3IW4A 3PWDA 4C35A 4XV2A 4KIKB 2EU9A 2OF4A 3MDYA 4EH3A 4I93A 4CZYB 4XOZA 4I1ZA 5E8XA 3JY9A 5AR3A 2Y8OA 4O0RA 5EI6A 3ZUTA 1OBDA 2C68A 3R73A 2VTRA 5F94A 5EH0A 1W0XC 5BYZA 3FLYA 4YTIA 3WILA 3F2NA 2FO0A 3A7HA 3CJGA 3R04A 4FV8A 4GIIA 3UVQA 3LFQA 3LJ0A 4D5KA 3WF5A 3FLZA 1AQ1A 4RVKA 3FMEA 1VJYA 4NIFB 3DJ6A 3KF4A 3FXZA 4EH6A 1O6KA 2XEZA 3E5AA 5LWNA 3EJ1A 3FY2A 4KIQA 1T45A 3NW5A 1GIHA 3FYKX 2QG5A 3HGKA 3FEGA 4AAAA 2OZAA 4YHTA 3JS2A 4QMZA 2YIYA 2W9ZB 2VWWA 2AUHA 4WRGA 5AUZA 5L2SA 5FUTA 3D2IA 4U6RA 4FF8A 3MTFA 1J1BA 3ORXA 5CEMA 3UG1A 3VUTA 1RJBA 4CKRA 3D5VA 2BAQA 3CGFA 4BDHA 3FC2A 4I6BA 2C6EA 5E90A 3REPA 3ZEWA 4A9UA 4CD0A 4ENXA 4MH7A 2YM6A 3EFKA 3UOJA 4YU2A 3TKIA 5CF5A 2E2BA 3BRBA 2UV2A 2JKOA 4ZSEA 5HEZA 1JNKA 5DI1A 4A9TA 4MD8E 4FTOA 1XH5A 2GHGA 4RWKA 2VGPA 3MWUA 3HV6A 3JPVA 1FPUA 3ROYA 2PZIA 4MXYA 5L8KA 5AIKA 3OWJA 4E73A 1Q3DA 3S00A 2RIOA 1ZYLA 3OP5A 3IGOA 4FV9A 3Q2MA 4ANSA 3FWQA 4ZLZA 5DA3A 4C57A 3GOPA 5CWZA 3PY1A 5CF8A 2Q83A 4PMPA 2UZDA 4FKUA 2G01A 2IVTA 2HYYA 5HO6A 2LAVA 2C6TA 2HZNA 2CGVA 5EM8A 3PPZA 4ZY4A 4G31A 1STCE 1T46A 2Z7RA 3GU4A 5K0KA 3TL8A 1BI8A 1KE6A 4U3ZA 4FNZA
chains in the Genus database with same CATH superfamily
4CG9A 4MYGA 2PTKA 4FICA 1KOBA 2PK9A 1PXMA 4FG9A 3CIKA 4C3FA 4EUUA 3TYKA 2UW3A 3LM0A 4QMQA 1WBWA 4D2RA 3VRZA 2J0KA 3LZBA 3QTWA 4BI1A 2WTJA 4YNOA 1YWRA 4RIXB 4BCQA 4ITIA 3CQUA 4BYJA 4QTCA 4BCFA 1SNUA 5HO7A 2VTTA 3NW7A 3R7OA 3LOKA 3RPSA 4FT7A 5EYMA 2GTNA 4K77A 3SKCA 4B8LA 3DT1A 3R00A 4GSBA 4DEBA 4M0YA 3MJ2A 2VWUA 5DRBA 2ITTA 4MAOA 3OTVA 3VBTA 4FV3A 4QMXA 4F7LA 5J9LA 4EZ5A 4BDBA 2W5AA 3LJ1A 3W0RA 4MBLA 4BIDA 4EK6A 4EZ7A 4IAAA 3TNQB 1PMEA 3D0EA 4ZLYA 4N6YA 2B54A 1ZARA 4D2SA 3I6WA 2ETRA 5LJJA 4O6LA 3T3VA 1ZY4A 2BFYA 4UALA 4IAFA 3CY3A 2AC5A 5IMXA 3BWFA 3Q96A 3GC0A 4H1JA 4TWPA 4C3PA 5EKNA 2UVZA 3GQIA 3OCBA 1JVPP 2WZJA 3PUPA 1KWPA 4K11A 3SVVA 4MWHA 4I5PA 3VC4A 4EQMA 4CLJA 2BRNA 5IA1A 1Q99A 4QP7A 4FT3A 3SQQA 4FZFB 5KKRC 3VS4A 1ST4A 5ETIA 5HTCA 2ZAZA 4IX3A 5K3YA 3ET7A 3NYXA 3HMNA 3R8VA 2R5TA 4QDEA 5M08A 3CPBA 4EHZA 5IEYA 3PJ1A 4YURA 2OH0E 3KVWA 4HPUE 3QQLA 3BQCA 4HCVA 4D9TA 2R3QA 3CD8A 3R22A 3Q4ZA 5IH5A 4CLIA 3QHWA 4PNIA 4O21A 4MCVA 4FTNA 4ACDA 4P5QA 4W4XA 1VLRA 3PXFA 2R4BA 4FZ6A 5CLPA 2YERA 4FR4A 5FM2A 2CJMA 3NUYA 5HVJA 4RFYA 3UNJA 1XH7A 3W18A 2WIHA 2NPQA 2YM5A 2GMXA 5IEXA 3F9NA 2PE0A 4C4FA 4Z3VA 5DE2A 4FTMA 5B0XA 2ZV8A 2X39A 2Y6MA 3VUGA 3R7UA 4EOPA 3FL4A 3C4ZA 2XVDA 4DFLA 5K4JA 2VN9A 4OTRA 4APCA 4FEQA 2F9GA 2YAAA 4RC2A 5AR7A 5K5XA 1BMKA 5HX6A 1H25A 5K5NA 3CKWA 4W8DA 3FAAA 3FLQA 5E8TA 5AUXA 5GZ9A 4YJOA 1GIJA 4U5JA 2YLFA 4U43A 2XALA 5ANIA 4PPBA 5ETCA 3NFGB 3ZDUA 4MXOA 2XUUA 3KB7A 4JXFA 3P79A 2VTJA 4M68A 3RAKA 3CTHA 2J9MA 3D15A 4FTLA 2WELA 5L2QA 3IONA 4FVRA 3N51A 1TQIA 2X1NA 3NLBA 3R7GA 1E1XA 2W4OA 3V8TA 5KMOA 5M57A 1IAJA 4O4DA 2JITA 5DEYA 2BUJA 3IPHA 3KULB 5HE0A 3WF7A 1BL7A 4CRSA 4AE9A 3Q4TA 4ZZOA 3B8QA 5BUIA 4DBXA 4D0XA 5J5SA 2J0LA 2Y4IC 3TNIA 4V01A 1Q8YA 3A8XA 3DNDA 3NDMA 4IZ5A 3ORMA 5JSMA 4O7SA 4O7ZA 2GS2A 3W0NA 2YIXA 3EHAA 3EWHA 4F0IA 5AM6A 3DAKA 4YJUA 4EOKA 2Z02A 3M1SA 1IA9A 5L2TA 4HNFA 3KFAA 3QA0A 4O4CA 2QODA 2VTHA 3OC1A 4YZBA 2EB2A 3H0YA 4DT8A 4I5CA 3U87A 4DINA 2KULA 3HX4A 2QNJA 4C2WA 3SC1A 2XK7A 3C9WA 2GS7A 4K18A 3W2QA 1ZOHA 3WI6A 3DBCA 1PYXA 5LCJA 3QRKA 5FQDC 2PWLA 1Q8UA 2VWVA 4E5AX 2WMBA 4IFGA 2VX1A 4RVTA 4ALUA 4XV9A 3EL8A 5C4KA 4YJSA 1OGUA 4YC6A 1OKVA 1YQJA 5IQFA 2F4JA 4I6HA 3S95A 1YHWA 1ZY5A 3ENHA 4ANLA 2VAGA 2JC6A 3KRJA 2IZTA 4QMNA 4NM7A 5HX8A 1YHVA 1J91A 3IS5A 4FKRA 3U55A 4BHNA 3PP1A 2XRUA 2WNTA 4HJOA 3QZIA 4U40A 2WTVA 4C4JA 4E20A 5HIEA 3P86A 3FI2A 5AIRA 5HI2A 4GJ2A 4O7TA 5A46A 2J90A 3ATSA 1W7HA 4JOAA 2X4FA 5CALA 3WIKA 4LG4A 3F5UA 4BY9E 3TKUA 3PYYA 2B9IA 3MFSA 4GYGA 5CI7A 3WOWA 4FEWA 4YHFA 1UKIA 4NCTA 3I4BA 3R7IA 3U6JA 1B6CB 4DYMA 2QHMA 2XIXA 4OTFA 4Z55A 1XMLA 4DT9A 1XWSA 4CFNA 3VULA 2WAJA 3SW7A 4QPSA 3M11A 4QMTA 3D7TB 4YLLA 3V5PA 3PXKA 2BKZA 3ORPA 4U80A 3R01A 4M66A 4FT9A 4TN6A 3VS6A 3QUDA 2OLCA 5BVWA 5IMEA 3ERKA 4XYFA 4FK6A 3V8SA 3QKMA 4CTBA 5KMNA 5A9UA 3VONA 4L45A 3MPAA 4QP4A 4FNXA 3EKNA 4O38A 2ITVA 4CG8A 5FBOA 2CNQA 4WRSA 3OTUA 4CMOA 4A9SA 1PMUA 3IG7A 3TG1A 2E9PA 3QX4A 3CCNA 1IEPA 3BE2A 1J7LA 3O17A 2J5EA 3AC1A 3H10A 5CU2A 5GHVA 1XJDA 2BHEA 4DLIA 3F3WA 4UWCA 2C6OA 4L7FA 2AEGA 3FLSA 3K5VA 1F3MC 3EFJA 3OEFX 5JK3A 3JVRA 4FNWA 4L9IA 2IZUA 5I9UA 1XR1A 5C03A 4CV8A 3G15A 4I94A 1GOLA 3QYZA 4CCBA 3ZM9A 1H26A 3V3VA 4RC4A 3B8RA 2R7BA 3RM6A 4D4VA 4O0VA 2PUIA 3GUBA 3R9DA 1YHSA 3BU5A 4JJRA 4UZDA 3VJOA 4O7VA 4AN9A 3QQKA 4IJ9A 1CM8A 3KXHA 4ANBA 4GU6A 2ZV7A 3IDBA 4AOTA 5J7BA 4RIWA 4F9YA 4HVHA 4UX9A 1OB3A 4IAZA 4QYEA 3CSVA 3A4PA 2R3OA 3ZUUA 1WMKA 5J9YA 3GCUA 4BGGA 4PTCA 4BDEA 4FL1A 3GC7A 2O5KA 2VWXA 3LQ5A 3QTUA 5CZIA 4BTJA 3LFCA 4LMUA 3A4OX 3RJCA 1SM2A 1FQ1B 2ITYA 3LFAA 4PPCA 4WSQA 4BBMA 2CCHA 1PMVA 4LRMA 4FKPA 3COHA 2HZIA 3QHRA 4MXCA 2ZVAA 4KA3A 5HE2A 3FLWA 3F2RA 4LRKA 3ZZWA 3JUHA 1URCA 1DI8A 2W5BA 4WOVA 3CQWA 2OK1A 1P5EA 1WZYA 4IB5A 1Y8GA 2YJRA 5AP0A 1V0BA 4X21A 3F2AA 5TO8A 4R3PA 3EQDA 2UW8A 4FKTA 4F9WA 2VTMA 4AW2A 5L6PA 2B0QA 3GCPA 2I0EA 2EXCX 4TW9A 3EQCA 4R8QA 4AZSA 4O0WA 5HIBA 3RP9A 2X7FA 2YCSA 5CSWA 3EFWA 2J5FA 4A06A 2C6DA 2XKCA 5DN3A 3MPMA 1S9IA 4U8ZA 4DH5A 1OKZA 3R30A 5EKOA 2V7AA 3NRMA 1TKIA 2YM7A 4ACHA 5CQWA 3RNIA 2XYUA 3NUXA 1KOAA 3QQHA 5ETAA 2UZNA 5EI8A 5J87A 3FL5A 4Y72A 4G16A 4DTBA 2QLQA 4ZAUA 3CKXA 3BI6A 4AWIA 4F6WA 3C4FA 5DIAA 3ANQA 4EHEA 5CEIA 2V7OA 5KX8A 5H2UA 4F9BA 3LXLA 3DK7A 3R0TA 4IX6A 4LYNA 3LXPA 2VX3A 3PPKA 2YCFA 5A6OA 4J7BA 3SDJA 3PFQA 3E8EA 3JYAA 3EH9A 3TWJA 5HE1A 2CGUA 2XM9A 3GI3A 3L9NA 3Q5IA 2QR8A 3TDWA 2YDJA 2OJIA 5HOAA 3RI1A 1NT2A 4DAWA 4BICA 3DK6A 4FL2A 2W1HA 4BVUA 5HU3A 3NCZA 4ZLOA 5AADA 4IZAA 4NJDA 2VV9A 1ZYSA 4XUFA 3NFFB 3BHVA 3FMHA 3NUUA 5AV0A 1ZOGA 4CMUA 2BAKA 3BQRA 4KUJA 3ORNA 3OT3A 2H8HA 4H3PA 4IWQA 4OTIA 5EM6A 4EL9A 4RX7A 4J97A 4FODA 2ZMDA 1JWHA 3ZONA 4LQMA 5TR6A 3S0OA 3Q32A 3LCOA 4WBBB 4XRJA 3LCSA 3QLGA 4BWPA 2R3JA 4MF0A 3AGMA 3QA8A 5AP3A 3KMUA 3RHKA 4BCOA 4ZMFA 4JAJA 4EJNA 2GNFA 3FSFA 2FGIA 4I4EA 3TZ9A 4TZRA 1NVRA 1JSTA 1H1SA 3EQBA 3ETAA 4BFMA 5EHLA 2PUNA 1SMHA 3RK9A 5BX0A 5BUEA 3VJNA 3RVGA 3NPCA 4UEUA 4DG2E 3PLAE 3W8QA 3QXPA 4H39A 3LQ3A 3PXYA 3QQGA 3PIYA 3VIDA 1H07A 4BDJA 1MRUA 3LKMA 3FMMA 4JLCA 4AX8A 4MWIA 3NGAA 4DHZA 1OUYA 3P08A 4BZDA 4EBWA 3TV6A 5IQHA 4CQGA 4R1YA 4G1WA 3MI9A 5IQAA 4GG7A 3A61A 4B4LA 4S32A 4XG2A 4FX3A 3FI3A 3OWPA 4C33A 4C0TA 3QAME 3FBVA 3ZM4A 1YOJA 3VBXA 3LPBA 3CR0A 4FG8A 2O2UA 2O0UA 3P9JA 1NVQA 4FKLA 4TY1A 1JSVA 5IU2A 4O82A 5EQPA 3MH3A 4NM3A 5FEDA 3T3UA 3HUCA 1HOWA 3ZBFA 4QMYA 4D4SA 3DLSA 5EDRA 4TRLA 4RX8A 4GKIA 4IHPA 4PF4A 1G5SA 5EQEA 2PVYA 4WA9A 3G9NA 5E7RA 2XKDA 3EKKA 3O7LD 4PNKA 1PRYA 4DFBA 4DH8A 1SVEA 3GB2A 2YIQA 4GVAA 3FY0A 2P2IA 3R7VA 2PU8A 4AU8A 4HZRA 2QKWB 4GT5A 3SX9A 5CEQA 3HV5A 4UB7A 3OY1A 5ETFA 3FZOA 5M44A 5AV3A 3Q2JA 3OBJA 4FKJA 1YWNA 5JFWA 5AM7A 2XJ2A 5D11A 3DK3A 3PFYA 3OMVA 2ITPA 2X9FA 4FI1A 1LP4A 2R3KA 4YTHA 3P1AA 2NYAA 1JKKA 3DY7A 3R9RA 5L3AA 4AXFA 3BE9A 3FSKA 4UV0A 3OROA 3SXFA 3I7CA 3OY3A 4BBFA 3MGYA 4D55A 1IRKA 4ERWA 1Q41A 4UMPA 3LMIA 2R0IA 4FT5A 4I5HA 2HZ4A 1XBCA 3F5XA 3HV3A 4EKKA 1WBVA 3GU6A 2C6IA 2JLDA 4K0YA 4J96A 4DEDA 4QYHA 1ZXEA 4RJ5A 2FSLX 5CX9A 4D2VA 3O23A 2UVYA 3DAEA 4BKYA 3KU2A 1APME 4RG0A 1UNGA 3GCVA 4D1XA 5ACBC 3AQVA 4IDTA 2RF9A 1E9HA 1WBOA 2WU7A 4O0XA 4XS2A 4CZUA 3F61A 4XNEA 4M7IA 2J0JA 4EEVA 5J79A 4DEGA 1YRPA 3VBYA 3P78A 4G6OA 3Q04A 4WG4A 3VWAA 4P5ZA 4FTRA 4DHFA 1M2PA 4DGNA 5IH4A 5DGZA 2OI4X 3C5UA 4Y8DA 4TNDA 4BZOA 3TCPA 2GCDA 4IJPA 1Q62A 4HPTE 3FXWA 3DXQA 1WBNA 5FWKK 2QO7A 3L9LA 4U0IA 2YM4A 3AC4A 1J1CA 4S31A 5LMAA 2OFUA 2XNEA 1IR3A 4RA4A 5D12A 3E62A 3K5UA 3E3PA 4Z7GA 5FDPA 4OBPA 4WUNA 2QO2A 3GNIB 5TE0A 2RL5A 3W10A 3AD5A 3OWKA 4TT7A 2YCRA 3U6IA 1SNXA 4TYIA 4E5WA 5CEPA 2P55A 4EZ3A 4WHZA 4F64A 1W2DA 2JIIA 5KE0A 4IAIA 2XMYA 4LGDA 3FKOA 3DAJA 4IVAA 3PJ3A 4F70A 3CLYA 3W0MA 5CSHA 2XNOA 1OBGA 3AT4A 4EQUA 2WQOA 2HAKA 3UP2A 4RA5A 4NCTC 5AWMA 5L8JA 3O8PA 4JNWA 3RTPA 2PE2A 4JBVA 5E91A 4KKGA 3L8SA 2BROA 4FOBA 1NW1A 2BIKB 2FA2A 5HU9A 4CNHA 2BPMA 1YI4A 4QP6A 3VNTA 4YSJA 2YAKA 4MQ1A 1GZNA 3IW6A 4NYEA 4Y46A 4BDFA 3ML1A 4DHIB 4M13A 2HENA 3W32A 1SVGA 4E93A 2BHHA 3S4QA 3DKGA 2G9XA 3MY5A 3PJCA 4EH5A 4IE9A 4AA0A 2PZYA 2WHBA 4QT1A 3RINA 1BKXA 2X2MA 3S1HA 2JFLA 2VGOA 2VD5A 3AT3A 3PVGA 3VQHA 1ZRZA 4TWOA 5C26A 3MH0A 2O8YA 5EHYA 4LGGA 4ASDA 2ZM3A 5I0BA 4AE6A 1I09A 1JBPE 5D9HA 5AUWA 3VRYA 3RZFA 4APPA 5A4QA 2QKRA 5BVOA 3VQUA 3GP0A 3HZTA 4Q5HA 1U46A 3UOKA 2R3RA 4RX9A 2QOOA 4IANA 4WSYA 4FYNA 4J95A 2WTDA 4W9WA 5KCVA 2R9SA 4MKCA 4UMTA 5AP6A 4LOPA 2HXLA 4YJRA 5JZNA 1A9UA 3V01A 3VW6A 5ANJA 4XOYA 5I9XA 5JN2A 3H0ZA 3R1NA 3F3ZA 2J0IA 1BL6A 4KB8A 3C4WA 4QYGA 2GNGA 3NYNA 5FBNC 4BIBA 2PL0A 3NS9A 3BGZA 3VF8A 2QO9A 2X8DA 3BU3A 4BWKA 3QD0A 4UN0C 2YDKA 2R3LA 4HYIA 4J8MA 2G1TA 4D2WA 4JI9A 3UBDA 1H1PA 4CFXA 5DH3A 3KN5A 4EYJA 4EUTA 2W1EA 2XZSA 4RLLA 2VO7A 3L8PA 3LAUA 2WMRA 3EN4A 2PVLA 4E1ZA 2PVHA 3ZO1A 3TTIA 3PA3A 2WQMA 2I1MA 2GDOA 3PE2A 2WMWA 4RFMA 3FMKA 3HEGA 4FUYA 4F1OA 1FBNA 2JAMA 4E26A 5AEPA 5M4IA 1WFCA 2GQSA 2ZDUA 4RWJA 4FSWA 5FDXA 1ZMWA 3LFFA 4O0TA 4YZCA 5AR8A 3GFEA 2XANA 3MA6A 4D2PA 4QMWA 5HLWA 2CLQA 2EUFB 2J50A 4FIHA 4J8NA 1QCFA 2C0TA 4PY1A 5TKDA 2RFDA 2UUEA 3WF6A 5A4LA 3E63A 1NA7A 4XG8A 5HLPA 1YXXA 4ACCA 4HYHA 3WYXA 2FVDA 5IF1A 5IQEA 1Q8ZA 4AZEA 4RSSA 3G6HA 1F0QA 2A98A 2QQ7A 3NVKI 3UDBA 3ZBXA 3BL9A 4IDVA 4Z9LA 2GQGA 4BTKA 2X2KA 2YZAA 5BMMA 4BDAA 4CFVA 1OGYA 1UKHA 3DFCB 3WE8A 4IW0A 3RKBA 3VHEA 1RQQA 3VS5A 4BCIA 4AZFA 4KIPA 4E6DA 4C4HA 3DQXA 1L8TA 3F69A 4FTIA 3HA8A 5HNGA 1OL2A 3MN3A 2R3GA 4FC0A 4N4SA 3HYHA 4YNEA 2RSVA 3FKLA 4YJTA 4YPDA 4UWYA 4A9YA 3I0OA 2XK6A 1GAGA 4GG5A 3PLSA 4NT4A 3EQHA 1OL6A 3AC2A 4Y73A 4YSMA 3S2PA 5GZ8A 3OOMA 3BYOA 1YXUA 4ZSGA 3PZHA 1Q8TA 2VZ6A 4XH6A 4AFJA 5F95A 4QOXA 2CGWA 4IVBA 3IQ7A 5IG1A 4L67A 5G1XA 2WQEA 3FMDA 4AZWA 4JIAA 1OPLA 4RX5A 3BV3A 3SV0A 4MTAA 3FDNA 2PVKA 4JS8A 3UYSA 4BDGA 4CT1A 3SG8A 4KD1A 2C30A 4JX3A 3QFVA 2IW9A 1M7QA 3I7BA 2X8IA 3R28A 3ORLA 4MK0A 5AJQA 5FXQA 1O6YA 1OIQA 3GEQA 3IKAA 5KZIA 4FV1A 5FGKA 3AXWA 4EI4A 4FSTA 4DFYA 3ZRLA 4EH7A 3HRFA 2H9VA 3Q6UA 4L01A 3F3UA 4I0RA 3NW6A 4CQEA 2FYSA 2A27A 2ESMA 2GQRA 3IW5A 4YTCA 4UMQA 4U45A 2A2AA 3EQGA 3NR9A 1TQPA 2WTIA 3AT2A 3GOKA 3I5ZA 4QD6A 4R3RA 3W0PA 4QTBA 4L8MA 5T6KA 4I3ZA 4LMNA 2UW4A 5I9VA 1GNGA 1ZYDA 4U42A 3MESA 2X7GA 3E92A 3PP0A 1H1QA 1MUOA 3P5KA 2P2HA 2YWVA 2R3IA 4FRFA 3DBDA 1CMKE 5M09A 2XYNA 5J5TA 3CGOA 3TEIA 3O7LB 4O84A 2WIPA 4FTCA 5HORA 3GT8A 3MB7A 2ZOQA 4AW0A 4D28A 3CTJA 4QTEA 5LWMA 2Y6OA 4IB0A 2XS0A 1ZMVA 5CNNA 1G8AA 1BX6A 5E4HA 4GS6A 2WMAA 2WEIA 3TIZA 5DEWA 3BU6A 2Z7QA 2H6DA 3RGFA 2E9OA 2YABA 2OJJA 4J53A 5T3QA 4MD7E 1W83A 3N4UA 4DTAA 2B1PA 2WQNA 2IN6A 2OF2A 4JX7A 4ZTQA 4P7EA 1X8BA 3KY2A 4EHVA 5K4IA 5J1VA 2PYWA 1XH6A 4PP9A 2JKQA 3KQ7A 2VWBA 4I20A 3VBWA 4C3RA 3NNWA 4DG0E 5K9IA 4O1OA 4IIRA 2OWBA 3E7OA 4IM0A 1ZYJA 4G9RA 4P90A 2ZB1A 2ZM4A 3ZHPC 3QD4A 4P4CA 3E8NA 1Z5MA 4QMLA 2JDVA 1IA8A 4PMMA 5IA0A 4YZDA 5CF6A 5FD2A 4LDTA 4A07A 2W1FA 3L8VA 4IVCA 5D7AA 4ORKA 2GNLA 3V04A 4J98A 5IH6A 4KIKA 3ITZA 2XNGA 2PZRA 3HKOA 3LFNA 3ACJA 3BYUA 4G3CA 4ITHA 2FUMA 4U3YA 2R2PA 3QYWA 4UMRA 3CTQA 4TYGA 4JIKA 3UDSA 5KZ0A 2VTLA 1QPJA 3UO4A 4PP7A 1OM1A 3SA0A 2HWPA 4R77A 2BVAA 4FKOA 4YLKA 3W1FA 5C8MA 3WZJA 4DITA 3BYMA 2UW6A 5L2WA 1JSUA 5GNKA 3UQGA 3OVVA 5DBXA 4X3FB 2UW5A 4NIFA 1OKYA 3NCGA 4CYIA 3P23A 4EOLA 5F1ZA 2ZV2A 4O7WA 4C4IA 2VTQA 4J71A 5EYKA 3SOCA 3WF9A 2C5VA 3QALE 4F09A 4G17A 4FZAB 5AP5A 4EHGA 1BI7A 3KGAA 1B38A 5C8NA 4GK4A 4I4FA 5BVDA 1OECA 3ZSIA 2REIA 4MX9A 4IZYA 3GU5A 1CKJA 3EYGA 2PMNX 4CCUA 5HBHA 2QOFA 1QPDA 4EK8A 5I9ZA 4JRVA 3ZFXA 3BHUA 3KRRA 4XG4A 5IEVA 1OPJA 4IZ7A 4XBUA 1KE9A 4I22A 2QOQA 3IECA 1QPCA 3P7AA 2RGPA 1IG1A 3BLQA 3DZQA 3HECA 4GT3A 3O8TA 4IBMA 5FM3A 4C8BA 4F7JA 4O7YA 2C1AA 4MQ2A 4CFFA 2WMVA 4GCJA 4JQEA 2R3MA 1WAKA 3PVUA 3BYVA 4F99A 5BNJA 2WMSA 4QMVA 5IQGA 3QQJA 3PWYA 5DFPA 5JMSA 3NIEA 1CKIA 3V8WA 4PMSA 3OXZA 4RLKA 1CTPE 1FMOE 4PX6A 5DR9A 1VYZA 3VBVA 5DVRA 5F20A 3ZYAA 4AP7A 3UZTA 3DXPA 4DGLC 4ZTMA 3I81A 1R78A 5E1SA 2X4ZA 3SXRA 1YWVA 2AYPA 4C02A 3ROCA 3EYHA 5H8EA 3KMWA 5HBJA 3QC4A 2C69A 4HCTA 3SAYA 3WZEA 1FINA 3BEAA 4G34A 5BUJA 3T9TA 4Q9ZA 2VTIA 2ITQA 5CSXA 3A7IA 3QZGA 4QP1A 2PULA 1WVXA 1ZYCA 3KEXA 5D10A 1Q61A 1XO2B 3BL7A 4RIXA 4EOIA 4DH7A 3UIUA 3F66A 5F9EA 4XX9A 2BDFA 5CVFA 2DS1A 1NVSA 2XNMA 5FXSA 4BKZA 1UNLA 4YZMA 3IW8A 3KXMA 2WO6A 3QTRA 3NMUF 4NTTA 4LV7A 5JZJA 2O65A 2UZBA 4FKGA 4O2PA 2B55A 3ZLSA 1EH4A 3AD4A 4GYIA 4RZVA 4H3QA 5DMZA 4O86A 2W0JA 3ATTA 4BL1A 5CSVA 4ERKA 3TUBA 3ZSHA 4MD9E 3UQFA 3OCTA 3EB0A 3CY2A 2P0CA 3LM5A 1HCLA 2YACA 2WQBA 4FSYA 4Z16A 5HHWA 5L2IA 2C6KA 5FRIA 5J1WA 5IKWA 1NY3A 2ERZE 4JBOA 2BCJA 2DQ7X 4KBKA 4FEVA 3PVBA 4PV0A 4O0YA 4E5BA 1KE5A 4X2FA 3II5A 3ZO3A 4O81A 5A4EA 4D4YA 4DFUA 3G0EA 3OD6X 5I3OA 2C3IB 4FTAA 5DR6A 2QG7A 1Z9XA 2IEWA 2AQXA 3OW4A 4I6FA 3A7FA 3I5NA 4FKWA 3NUSA 4M69B 4HGLA 4U9AA 4X7QA 4FIFA 3RPYA 4ARKA 4KWPA 4C58A 4WBOA 4NK9A 2OIDA 3D7ZA 5TOZA 3DJ7A 3QLFA 3BGPA 4L43A 4DFZE 4EOOA 2UW9A 3PTGA 5HG8A 4G3FA 4OTQA 4OTDA 1U54B 1QMZA 3W33A 3R8ZA 3MVHA 4FSQA 5LXMA 4IAKA 1M7NA 4FIEA 4GKHA 3PJ8A 2OICA 2YA9A 4MBIA 3ZZEA 3F82A 3SXSA 1M17A 2VRXA 2G2IA 4O6EA 3KXGA 4P2KA 4DEAA 4ZMEA 4ZJVA 4LUEA 2J51A 1ND4A 3ULZA 1Q24A 2FSTX 2IZSA 3F5PA 3MFTA 2ZV9A 4YJQA 3WARA 3N4VA 3I60A 3O0GA 3DBEA 1HCKA 5D7VA 2V62A 2PPQA 4TXCA 4AA5A 3P5JC 2DYLA 3ZLXA 4D1ZA 3DDPA 3UMXA 4EK3A 4MXXA 4O7NA 5M06A 1OL1A 3C51A 3FZTA 4OGRA 5ACKA 3ZLYA 5LVNA 2PHKA 5FTOA 3FZ1A 2PZPA 5KUPA 1VZOA 3D9VA 4R7HA 3FPMA 4ZTRA 3GC9A 3R83A 4EKLA 4CKIA 3BZ3A 4BB4A 5ITAA 3RCJA 2WTKC 3Q9ZA 4OBOA 4CSVA 2YM3A 4FNYA 5CY3A 2OH4A 3F3TA 3GBZA 5DR2A 5HG9A 3VO3A 1BYGA 3E88A 5DWRA 1J7IA 3R2YA 4JBQA 2I40A 1XH9A 3AC5A 3BKBA 4IXPA 4R3CA 5LARA 3PRIA 3TI1A 3VS3A 3OOGA 3KULA 3ZRKA 3OCSA 1LUFA 2ACXA 2VWYA 2C4GA 3RCDA 1E1VA 1O9UA 4UZHA 2J2IB 3KL8A 3QWJA 3UQCA 1H8FA 1OVEA 2CKQA 4HGEA 4NW6A 4DFNA 2XIZA 1PXNA 4K6ZA 2QLUA 3SRVB 4KRDA 4ANMA 1L3RE 2E9UA 4FGRA 2I0HA 2CCIA 3DXNA 4GEOA 5LQFA 4FEXA 1JKLA 1PKGA 4G3DA 1GY3A 3IK3A 2JBOA 1OPKA 3G6GA 2OG8A 2I0VA 3POOA 4G2FA 4HYSA 4IMYA 4AZVA 4D1SA 4DGOA 5FP5A 4HGSA 1VYWA 3KKVA 3V5WA 5B2LA 5IA2A 5HBEA 4TWCA 3RPRA 4CFWA 1Q97A 3K3IA 1UVRA 4ZOGA 4WUAA 3NUNA 5CNOA 4IACA 5I4NA 1OIYA 3KC3A 3SLSA 3W0QA 1IASA 3QZHA 5TF9A 4ID7A 5E8UA 3ZOSA 5BVFA 5E8YA 3MH1A 1U59A 5G6VA 3OUNB 4AXCA 3C13A 1YI6A 3FLNC 1H00A 4FKSA 2WMTA 3C0GA 3QRTA 4RRVA 3DFAA 4AXEA 4DFXE 1QL6A 4G5JA 4JDIA 3QKKA 4MXAA 3L1SA 3LCKA 3Q4UA 3KXZA 4KINA 4YC8A 4A4OA 3OZ6A 2IJMA 4KNBA 3VHKA 5M4CA 4RJ8A 4XRLA 3DKCA 3QBNA 3R7YA 5GJGA 4F65A 4BN1A 4ENYA 4QQJA 4USDA 3UDTA 4W4YA 2A0CX 3H9RA 3PA5A 2Y4PA 2P33A 3BCEA 3LXKA 3ULIA 4EWQA 2PVNA 5JH6A 3EN9A 3LCDA 3NNUA 3W8LA 4BIEA 3COKA 4FA2A 3MBLA 4YJVA 3UG2A 4NKAA 3RZBA 3MYGA 3UODA 3UNKA 3MSSA 5IDPA 5BVEA