3Q3BA

6-amino-4-(pyrimidin-4-yl)pyridones: novel glycogen synthase kinase-3 inhibitors
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
352
structure length
344
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Glycogen synthase kinase-3 beta
publication title 6-amino-4-(pyrimidin-4-yl)pyridones: novel glycogen synthase kinase-3β inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 344
sequence length 352
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3q3bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3q3bA01
5L8JA 3KY2A 2BRGA 2UZLA 3D0EA 2VWZA 3WYXA 1YOJA 1CKJA 3NDMA 3O51A 3RINA 1ZMWA 4JG7A 2VTHA 2BMCA 5D1JA 3VS4A 5E9EA 1KV2A 2AC3A 2C1BA 4WG4A 4GYIA 3ZUUA 5CXHA 1OIRA 2UZUE 4BKJA 1RJBA 4X2JA 3MPAA 4DFNA 1PRYA 5D9HA 5HGIA 4O27B 2WMAA 4BCMA 3FZOA 5JEBA 3NMUF 2CN5A 4KKGA 3GXLA 4K11A 4OTIA 2OK1A 4ZTRA 5DR2A 3E63A 3TIYA 4JIKA 1ZYSA 3K2LA 4PNKA 4ZTHA 3LCKA 5GZAA 3NYVA 1P4OA 2J0IA 1WBTA 3FC1X 1XBBA 3N9XA 5GNKA 2HENA 2R3OA 3EHAA 4ITJA 2PK9A 4MAOA 3QFVA 2C4GA 5E8XA 4YJQA 2ZOQA 3SA0A 1RW8A 5BNJA 4PL3A 1NVQA 4I4EA 3RI1A 2JDVA 3D9VA 1FGIA 3KF7A 4I92A 4QP7A 5DI1A 4CT2A 3DJ5A 3OVVA 2XK9A 5AUYA 2BHEA 3UYSA 1CM8A 3HL7A 2WMWA 4RJ4A 5LVOA 4IW0A 3VUDA 5L8KA 5EM8A 1NT2A 4BRXA 1CKIA 2B1PA 1OITA 1PMUA 3ERKA 3NRMA 3RK9A 4ARKA 4C8BA 4E4XA 2XK4A 4FNYA 4RX8A 3ROCA 4QYHA 1Y6BA 4JDJA 4AW2A 4N70A 4E26A 2VO7A 3PA4A 3UBDA 4D0XA 2YIRA 4GT3A 1OKZA 3BYOA 4YPSA 3QUEA 2RFDA 4S32A 5C8NA 5TT7A 2GNJA 3GENA 2WHBA 3NNWA 4BDIA 5JT2A 4WRGA 3QD3A 2NRUA 3KFAA 2WEVA 3A4OX 2J4ZA 4UY9A 4D1XA 5BQ0A 2VTOA 4RWKA 4QT1A 3EFLA 4DH7A 4BDDA 1FINA 4EUTA 2ZB0A 1XQZA 3MH0A 3MVLA 5CU3A 1ZY4A 2W06A 2BROA 2YCSA 3C4FA 5AUXA 4RWJA 3MH2A 3QQJA 4FSQA 4B6LA 5IUHA 2PMOX 3JY0A 4ITHA 3VHKA 3C4EA 3KCKA 3PJ3A 3QQKA 3P78A 3L9MA 3PVWA 3QCXA 4C59A 2XBAA 4JLCA 2WNTA 2QG7A 3E8CA 2REIA 2W5AA 3OS3A 1SMHA 3CTQA 2W17A 1H28A 2BZKB 4DAWA 2PE2A 2VTAA 4E4LA 4EQMA 4I94A 1PMNA 3OP5A 5GJDA 5L2IA 5IQIA 2QLQA 2W5BA 4ZS4A 4FTIA 5I0BA 3IW5A 4K9YA 4O1OA 3R1NA 4NW5A 4LL0A 4I41A 4NJDA 1JKLA 2KTYA 3TI1A 4CGAA 1A9UA 2WQOA 3UO6A 3ENHA 4OLIA 5EYKA 1OIQA 3QRTA 1VYWA 3UVPA 2HWPA 5J5SA 5TF9A 3I4BA 3O7LD 2OIDA 3QTZA 4J99A 3R8VA 5CEOA 4IAZA 3KN6A 4QP9A 2Z8CA 3RGFA 3R8MA 5A6NA 3O96A 3IK3A 3E7OA 4HNFA 3E93A 4WNMA 1TQPA 2JBPA 3Q5ZA 4GT4A 2UVYA 1PF8A 1QPCA 4U44A 5CX9A 4BDFA 5BYZA 3TDWA 4QO9A 4TYGA 2BR1A 2Z7RA 3DK3A 3NX8A 3QTUA 3MY1A 5F1ZA 3QKKA 4Q5HA 1W83A 3JPVA 4FTJA 2FO0A 4BDKA 4DEGA 4O0WA 3EWHA 5LCKA 3E8DA 5DFPA 4I22A 4N57A 3RWQA 4EOJA 3TIZA 4BBEA 2CDZA 5CZIA 2OF2A 3FLZA 4AT5A 4KA3A 3ULZA 3NIEA 3OBGA 5B0XA 4KRCA 4WG5A 2JAVA 5IDPA 1W98A 3SX9A 4CV8A 1ZYCA 3VQHA 1DS5A 4GMYA 3GU8A 4QPMA 4NFNA 5DR9A 5EI8A 2PMLX 3QTWA 4FVQA 4QD6A 3ZO1A 5BUJA 2UW8A 3AD4A 4U80A 1URCA 3QA8A 4G2FA 3HKOA 5JRQA 4I0RA 2PZPA 3ORKA 3IPHA 1JKTA 2RF9A 4KKEA 4RJ5A 3OWLA 4GFOA 4RFMA 3VW6A 4CZTA 3FI8A 4AA5A 5M4UA 1OPKA 3LHJA 4A4LA 3HYHA 4GIIA 4USDA 3HDMA 4WG3A 3ID6C 2XK7A 4FSNA 4M97A 4BKZA 4DTBA 3D15A 3NAXA 3TZ8A 4ALVA 2JFLA 2XP2A 2C6OA 4PTGA 2W05A 1P4FA 2P2HA 3BEGA 3PXRA 4BYJA 3QXPA 3GC8A 4E4NA 4F9YA 4XBUA 5HNIX 4FV2A 1H08A 3K5UA 4MXAA 5BUIA 4RIYB 3W1FA 2OIQA 4NZWB 4DHFA 3R1YA 5IPJA 2DS1A 4HYHA 4QMTA 4UWCA 2QURA 2RFSA 3WARA 1E1XA 3PY3A 3ODYX 5HG9A 4LGHA 5AR7A 4J8MA 2B54A 1JAMA 4JBVA 2EXCX 2X6EA 3I81A 5TE0A 5IDNA 3MPMA 2GS6A 3QWJA 4GIHA 4FUXA 4KUJA 2R9SA 4RMZA 1YOLA 4PP7A 2IVSA 3EJ1A 3FZSA 3PXFA 3B2TA 4B8LA 4C4JA 3ZZWA 5FQDC 4BI2A 5AUTA 3E62A 1H27A 1IAHA 2UZBA 3PPZA 3QQGA 3DY7A 4U97A 1XH4A 5ETCA 4E6AA 4EUUA 4FZ7A 4ZK5A 1YI3A 2F57A 4ANMA 3KXNA 4NH1A 2YM4A 2BZJA 4JBPA 1F0QA 1KE7A 1SYKA 4Z7HA 2VX3A 2XK3A 3P7CA 5J79A 2X2MA 4NK9A 1GZOA 5CVFA 4DG2E 4H3QA 4MXOA 3TL8A 4GK3A 5FDXA 1YHVA 4I5HA 5FBOA 2FYSA 3CE3A 4ACMA 4BTMA 4ZZOA 3UIMA 3COHA 3FY2A 5H8BA 3ACJA 3NCZA 4MQ1A 2YM7A 2HAKA 4RIYA 1OIYA 3PIYA 4D28A 5BX0A 5IQHA 2XUUA 3L9PA 3D5UA 3O2MA 4F64A 1KWPA 4IB3A 1J7UA 3TXOA 3F6XA 5I5ZA 1FVVA 1DI9A 2VTJA 4YJNA 4AW5A 5ETIA 4FMQA 4FNXA 2UZWE 4FV3A 5CTPA 2JITA 1OECA 5HVJA 4QMXA 4G3GA 3QCSA 4CMTA 4R3PA 4F0GA 4U7ZA 5J7HA 2YDIA 1IR3A 3ELJA 3EFWA 1OKYA 4FL2A 3NUUA 4FZFB 2VV9A 1FMKA 2O65A 2P33A 2CSNA 3BWFA 3GB2A 1NA7A 4MX9A 3TN8A 3UNZA 2C5OA 2R5TA 3RM6A 4DEIA 1J7IA 2C1AA 2C6KA 4X21A 4AZEA 5LQFA 4O7NA 4KRDA 1SNXA 3LKMA 4FIIA 3GCVA 5M4FA 5BVKA 5L8LA 4DGMA 3RPRA 4R3CA 2GFSA 2GNGA 2BDFA 5FM3A 4ZY6A 3PRIA 5IEVA 4EH7A 4IAKA 5C01A 4FKVA 3ENMA 4EOLA 3RHKA 3DK7A 4NEUA 1B39A 4F9AA 3GC7A 1W8CA 4XX9A 4XBRA 3Q4TA 3MW1A 3TM0A 2C6IA 4ZLZA 5EM5A 2QOBA 4QMOA 5CSWA 4WNOA 3R8PA 2B52A 2OJGA 3PJ2A 5ANOA 5CT0A 2YZAA 1AQ1A 4BCOA 3IDBA 1Q41A 4BBFA 5AAFA 5CU0A 4E6CA 5AP4A 2PL0A 4CVAA 4UMPA 5G1XA 2BRHA 1FVRA 3LMIA 1TQMA 5CLPA 2YM3A 4LQMA 1APME 3UVQA 3UZRA 4RX9A 3ZM4A 4P5QA 3UIBA 4U43A 4KIQA 3RK5A 5KX8A 3OZ6A 1HCKA 4JXFA 3MB6A 4FT0A 4I24A 4RIXA 5HHWA 4ZLYA 3R04A 4IWQA 4PY1A 3Q9XA 4RLKA 4GH2A 2YCRA 3VS5A 1YXUA 2YIXA 4XHKB 3HAMA 3BBTB 4EQCA 1JLUE 3ZFYA 3VUKA 5BMMA 4ZLOA 3D7TB 3AG9A 3KXGA 4ZEGA 4GJ2A 4BN1A 4FIFA 2VZ6A 2YFXA 4AOTA 5A46A 2QO9A 1BI7A 5KBRA 5I9VA 1YWNA 2VX1A 4Y72A 3HMPA 5C9CA 3COIA 1UWJA 5A54A 4IVAA 2GQGA 2C0TA 4LFIA 3PY0A 2WMXA 2JC6A 4EH2A 5L2TA 3GU5A 2I0VA 3BLHA 3MGYA 3IOPA 1H0WA 2IW9A 4BWPA 2PUPA 4D58A 2YZLA 4U6RA 4O6EA 1UV5A 3PXYA 1CSNA 5E92A 4PMMA 2WMQA 4AW0A 4H58A 2JKKA 4HZRA 1OPLA 2AC5A 3FKLA 5AA8A 3COMA 3EZVA 2ZV8A 2ETKA 4BB4A 4ONAA 4GUEA 3BGPA 3GEQA 2WQBA 3PPKA 4U0IA 4F6UA 3S4QA 4HYIA 3ZFMA 4YJRA 4NYEA 3CD3A 3K3JA 3DB8A 3LM0A 4RX7A 4UXLA 2B53A 3L8XA 4QP4A 4QP3A 4NJ3A 1YDSE 3E8NA 3P79A 4NTTA 5DBXA 4JRVA 3R73A 4II5A 1XH6A 3R7VA 4J96A 4O6LA 3RTPA 1L3RE 3OXZA 2V55A 2H6DA 5HOAA 3C51A 3D7TA 3VHEA 2BDJA 2B9JA 3W18A 1PKDA 4G9RA 4QRCA 3TJCA 4GFGA 2PVHA 2QU6A 4KB8A 4AU8A 3LCDA 4E4MA 1WZYA 3UO4A 5HTCA 4KIKB 5EKNA 4MTAA 4MWIA 5KMIA 2WTJA 3NW5A 2CJMA 1OMWA 3UO5A 2FA2A 2UUEA 2XNNA 3FHIA 3NNUA 5L6PA 4P90A 4GEOA 4TY1A 4L8MA 3AT3A 3GQLA 3A7GA 5ITAA 1QMZA 4A9UA 1ZAOA 5J95A 3EQRA 4BF2A 4YUQA 3V5LA 5D41A 3A99A 3BHYA 2VWIA 5A14A 5KNJA 2PVLA 4G31A 4FEUA 2GS2A 5CT7A 4FIHA 4JI9A 4UZHA 2FSLX 3ZONA 4FTTA 4BKYA 4EORA 4DH8A 2R4BA 4P2KA 5J1VA 1REJA 3DPKA 4OTFA 3FMLA 4YJSA 2HELA 5CQUA 5AP7A 4FTKA 4G3DA 5M56A 4A9YA 2ZM1A 5GZ9A 3AMAA 2A2AA 2W1DA 4DGNA 2RL5A 3BIZA 3O8PA 4UYAA 5LARA 5CEMA 3QTXA 4Z3VA 4ZJIA 4MNEA 4D2TA 4F1OA 2UVZA 4EOQA 1YKRA 3NUSA 4AOJA 4OTGA 4BZOA 4WUNA 3UC3A 4IJPA 3LVPA 2EB3A 2R3QA 2WGJA 4LL5A 3K54A 4I6BA 4CCUA 3PZEA 4M0YA 2XZSA 3LCSA 4KIKA 3SAYA 5L6OA 2EXEA 4CFVA 2UVXA 3IGOA 4GG7A 2YJSA 4ZIMA 2ITWA 5KZ0A 4DF3A 1J3HA 2RGPA 5ACBC 3RAHA 4K18A 1WBVA 3ZUVA 5HTIA 1LPUA 2ITUA 2DWBA 4ZTQA 5FXRA 2WQEA 3OEZA 4BIDA 4ANBA 3C4WA 1X8BA 4QP1A 4XNEA 2FGIA 3C4ZA 3NVMB 2CKEA 4FVPA 1Q24A 2DYLA 5L2WA 2ZB1A 4FOCA 1SVEA 4K33A 4BFMA 5DT0A 4RVMA 3KK8A 4PWNA 4A9TA 2PVJA 3FE3A 4MXCA 5CAQA 2WMUA 5CEIA 4KSQA 5B7VA 4ZJJA 4PL4A 3OCTA 4EK3A 3U6JA 2QHMA 4G5JA 5CNOA 2C68A 3FMEA 4H3BA 4WKQA 3PJ1A 4PDPA 4EOMA 3OXTA 4EYMA 1CKPA 5HZNA 2FVDA 4RJ3A 4UMUA 5IMXA 4I1ZA 1R39A 4CZUA 2YM6A 1FGKA 4IANA 3A62A 3R02A 4FA2A 5IQEA 3AD5A 2R3IA 1H26A 1Q8WA 5EW8A 2X1NA 3R1QA 2PZIA 4XG6A 3IDPA 3ALNA 3DXPA 3UOKA 3FSKA 3I79A 4JX3A 4CMOA 1H1RA 1SVHA 2O64A 3N51A 4PDYA 4PV0A 3U54A 2HZ0A 3L9LA 2X8DA 4BIBA 4HVSA 2UW5A 5DT4A 1ZXEA 3BYMA 3HECA 4QMZA 4BDJA 5FRIA 4MD9E 1RQQA 3FI3A 4FODA 4BY9E 2W4KA 4CRSA 3EYHA 4Y85A 3LXPA 4PMTA 5CYIA 4ACCA 4GK4A 3EKKA 5KBQA 4CYIA 3F3WA 5GIPE 2XNBA 1W82A 3R01A 4UALA 3ZRLA 3QCQA 4L46A 5BUEA 3TUBA 3S00A 4CQGA 5CXZA 3UQGA 5AX3A 3OFMA 3VF8A 3DBDA 4ALWA 4UEUA 4FKTA 4GSBA 5A4LA 4L3JA 4TWCA 3W16A 4F1TA 3AT4A 3I7CA 4QQTA 5BVOA 3RM7A 3GBZA 4FKSA 4JG8A 3OWKA 3LZBA 3PXKA 4E7WA 5AMNA 2BAJA 2EVAA 4TYHB 2HCKA 4NKSA 5J5TA 2UZVA 2A0CX 4W4VA 3DZOA 3O7LB 2ITNA 2Q0BA 3BX5A 3MESA 5M4IA 4YC6A 4IX6A 3SRVB 2WOUA 3Q4UA 2WFYA 4LGDA 3NVKI 4GKIA 1Q4LA 5EQPA 2I0HA 3BQCA 3JVSA 2WD1A 3O0GA 4FSUA 3FKNA 3QALE 1JPAA 2PY3A 4EK6A 1BLXA 4S34A 5FEEA 3TZ7A 4O7VA 4DYMA 5BYLA 4IADA 3IOKA 3VS6A 4IX5A 5E1EA 4KIPA 4QYGA 3UVRA 3MH3A 5HE0A 4DG3E 2QKWB 5HX8A 3WIGA 4X2GA 3BWJA 4I0SA 5DE2A 3NZ0A 1UU8A 4TWPA 3RNIA 4M8TA 3V51A 2JIUA 2V62A 3ORTA 4MCVA 3QQFA 4IZYA 4LRKA 4QTDA 4CTBA 2W1CA 5I9ZA 3CLYA 4FR4A 3KXMA 3LFDA 2J2IB 4TN6A 5AV4A 5HTBA 4FKWA 1BL7A 2OJ9A 3OCBA 4G5PA 4ID7A 4C62A 4O82A 3FLQA 5DLSA 1F5QA 3HEGA 2PZYA 4M67A 2NPQA 5JGBA 3HA8A 4HGTA 3REPA 3GI3A 5IUIA 5CENA 2ZDUA 1JQHA 3QZGA 2OU7A 2UV2A 4IAAA 4FEQA 3ZC6A 4C0TA 1R3CA 3D5WA 3FMJA 3SHEA 5C03A 3AGLA 3BELA 3OF0A 3PPJA 3IW6A 2PE1A 2WZJA 3LJ0A 3QWKA 4ZMEA 2O63A 5T6KA 3TDVA 3AQVA 3G33A 2GS7A 3BYUA 5CZHA 3SRVA 3RMFA 5E8WA 4CYJA 4YLLA 4D1ZA 4BBMA 3F2NA 4G6LA 3D2KA 3Q9WA 3QLGA 2B4SB 2PMIA 3MBLA 4QP6A 5BMSA 4CFWA 4IAFA 5ETFA 3O23A 4U8ZA 4BDGA 2VWVA 3R1SA 3C4XA 3QD4A 4FTQA 4IAYA 5EW9A 4ZTMA 1RDQE 5ETAA 4FKLA 2X2KA 5A9UA 2OIBA 4IEBA 1BX6A 2Y4PA 4L3LA 3HGKA 4EYJA 4FV1A 1O6LA 4F6WA 3PFQA 4X3JA 5CU4A 4B99A 3SLSA 2WMSA 4DGGA 2AYPA 3ZLSA 3TNHA 3R9RA 5IQDA 5DEWA 3NUAA 3D14A 4FEXA 5GIOE 4P5ZA 3N4VA 5F4NA 3LFEA 3VJNA 3NUPA 3R7OA 5EDQA 3QYZA 4U9AA 2NP8A 3CTHA 5JK3A 2QR8A 1DI8A 1JKKA 1OL6A 1SVGA 5FP6A 4PMSA 5KCVA 4APCA 2PE0A 3R8LA 1R0PA 3AC3A 4RIOA 3NUYA 5IQGA 4FEWA 5IQAA 2BRMA 2I40A 5AM7A 3SVVA 2XK6A 4JG6A 4MF1A 3R7YA 5LVNA 5J7BA 4B4LA 3UOJA 4O0XA 3MH1A 3CKXA 5D7VA 4DTAA 5DEYA 4FTUA 4ACDA 2HY81 3A4PA 3EN5A 4JBOA 4GVAA 4ZP5A 5CEPA 2ERKA 3PE2A 4FV0A 4EZ7A 2C3LA 3F61A 4DFUA 2BPMA 4I6HA 3EQDA 3ZHPC 4AS0A 1KOBA 4UWYA 4IC8A 3MWUA 4KBKA 3R0TA 1GIHA 5HEZA 3CJGA 4AGCA 2ONLA 2ZM3A 2Y9QA 2YACA 2PUUA 2G1TA 2J50A 3WZEA 2OXXA 2WB8A 3DAEA 5FGKA 3OG7A 5TR6A 3EFJA 4AE9A 5HIEA 2B9FA 3DS6A 5K4JA 5AIKA 5KMNA 4P7EA 3NIZA 1HCLA 3ZZEA 4IVCA 5M55A 1YXTA 3FMNA 4C4HA 4FK6A 4G3CA 3L8SA 3VF9A 2I7QA 3CC6A 2PVMA 4I93A 3P1AA 3U4UA 4JX7A 4YTIA 2XJ2A 3CPCA 1XH7A 4N4SA 4JDHA 4OAVB 2ETRA 2FH9A 3I6UA 3A7JA 3FWQA 3VUGA 1MRYA 4YZCA 1YRPA 4F7JA 3ATSA 2V0DA 3T9IA 3UP7A 3LFFA 5AP6A 1L8TA 2PYWA 4TKSA 4AACA 4UN0C 2BZIB 3OROA 5E8ZA 3PDTA 3ET7A 4TNBA 3ORNA 1LEZA 4PTEA 2OH4A 4EQUA 3HV7A 4GRBA 3C7QA 2O8YA 3EL7A 4I0TA 3SOCA 4ACGA 4G6NA 2JDTA 2VTSA 3TKUA 3TT0A 1WBSA 5HVKA 3GFEA 1XBAA 2DUVA 4K2RA 3ZC5A 2JDOA 2WMRA 4GFMA 3W2SA 4EH8A 3AC2A 3CQUA 1JBPE 1JWHA 2O0UA 4LV5A 2IZUA 4PUZA 5EHOA 3FXZA 4CFXA 4ENYA 1IASA 1MQ4A 3KULB 4BTFA 1BUHA 3H9FA 3P7BA 4L45A 4XJ0A 4J95A 1BI8A 2CGVA 4IE9A 4K6ZA 5KMMA 5M08A 3F5XA 4YU2A 1PXNA 4TNDA 5JFSA 4TTHB 4B7TA 2OF4A 3EQGA 3HDNA 3PYYA 4I4FA 4W4XA 4YHJA 4XEYA 3QBNA 2GHLA 3RP9A 3C1XA 2HIWA 1IAJA 4UZDA 3DT1A 2IN6A 2CGXA 2YIQA 3LLTA 5AWMA 4B0GA 2OKRA 1RE8A 4YSJA 4H36A 2XJ0A 3RZBA 4D2WA 1H01A 4RQKA 3NPCA 4FTMA 3NYNA 4AQCA 4EHEA 3I6WA 3BU5A 3PE1A 3OT8A 3W2PA 1DAWA 1ZRZA 2V5QA 2R0UA 5EYMA 4FGBA 1O6YA 3QTSA 3VRZA 4ZSLA 2FUMA 4MD8E 4F0FA 3DJ7A 4XLVA 4FEVA 2Z7QA 4KBCA 3Q9YA 2R3MA 4O2PA 5KO1A 1YI6A 4V05A 2BIYA 4JAJA 5EI6A 5EM7A 3P08A 2OXYA 3BPRA 3LW0A 4FSYA 4YO6A 1CDKA 4IZ5A 1QL6A 3KULA 4C35A 2F7XE 4PRJA 4GS6A 4HCTA 1H1QA 2OH0E 5E4HA 4RVKA 5CU6A 4EL9A 5DA3A 3VUMA 3H10A 2ESMA 3S95A 3C0HA 5M06A 3Q9ZA 4A07A 3LQ5A 3R7GA 3MS9A 4FZ6A 5AUZA 1Q62A 3LIJA 3PA3A 1WBOA 3S3IA 4BZDA 4EC9A 2BUJA 4CRLA 2G2HA 2R3JA 3S1HA 4MEDA 4F0IA 3QC9A 3A2CA 5IUGA 4O7SA 4FKUA 5CF6A 2UZDA 1IEPA 1TKIA 5G6VA 4QNYA 5LCJA 2W99B 3AC1A 3VBQA 2I1MA 3F3UA 4IWDA 4RJ6A 5EHYA 3EQCA 1JOWB 1CMKE 4FG8A 4RZWA 3LPBA 2V22A 3FL5A 3PVBA 3LCOA 2X7FA 4F1MA 5HCYA 4IFGA 3DGKA 3ZXZA 4JR3A 4CSVA 3VRYA 1PXKA 3BZ3A 4J8NA 4EI4A 3LCTA 4CEGA 2VTQA 3MTFA 3R9OA 2ITYA 2YLEA 3SD0A 3CGOA 4C34A 4O81A 4RFYA 4EHGA 1U59A 4ZOGA 3PJ8A 4I6QA 5FUTA 2UW0A 2J0MB 2C6EA 4QYYA 3R63A 4YZDA 3FHRA 3R22A 3F66A 4YNOA 4O86A 4QTAA 2OO8X 2WTVA 3WF6A 4FNZA 3L1SA 4V01A 3QKLA 3V5PA 4EEVA 2B0QA 4BGQA 2F2UA 4FG9A 3OBJA 3E87A 1FVTA 5EOLA 4MHAA 4HJOA 1ND4A 4BDBA 5DIAA 3F2RA 4DH5A 4YO4A 1STCE 3F5PA 3OCGA 4FKRA 3RCDA 5IMEA 4BCPA 2CCIA 5F20A 4F70A 1W7HA 1JVPP 1R78A 3Q96A 5CY3A 3LFNA 1DM2A 2IO6A 2ZM4A 3DKCA 3ZO2A 5CEKA 5LMKC 3TUDA 2XCKA 5LJJA 3DAJA 5ANDA 2UW6A 4HCVA 4DFZE 3C0GA 5CF4A 2H8HA 5LWNA 4FV5A 4QMSA 5GINE 2BKZA 2PVYA 1YWRA 4I6FA 4R7IA 1GZNA 1WVYA 3TZMA 3BE2A 3H4JA 2WU6A 2P55A 3DA6A 4KKHA 1A48A 2PU8A 4YHTA 1K2PA 5FTQA 5J9YA 2IZSA 4M68A 2F7ZE 3NR9A 3FQHA 2GPHA 5AV0A 3UYTA 2Y8OA 4RWLA 3SG8A 3VC4A 2QOOA 3R2BA 5EOBA 3Q2MA 4J71A 1YVJA 4IX4A 5B2MA 4AXAA 3FEGA 3V04A 5M44A 2PMNX 3ZXTA 5CU2A 3N4UA 2G15A 5J9LA 4RIWB 4CFNA 4PPCA 4HNIA 2X7GA 2CHLA 4RSSA 3SG9A 1KE8A 5HQ0A 2OZAB 1XH5A 3MPTA 1M2PA 3COKA 4R1VA 5CAPA 1Q99A 4E73A 4BGHA 2FSOX 3OEFX 3QKMA 5DVRA 2GHMA 5KKRC 3ZEWA 1Z57A 3S2PA 4IDVA 4DE4A 2ITTA 1Y8YA 2E9PA 3IO7A 3R7IA 4YJTA 1YDRE 4KABA 4LOOA 3R9NA 3CY2A 4K77A 2BRNA 4OW8A 3OW4A 4AF3A 3UNJA 4L7FA 4ALUA 5A4CA 5JQ8A 3D7ZA 4PQNA 2J0LA 3LMGA 4XCUA 3OC1A 3BGZA 4U42A 3LE6A 3PUPA 4R78A 4BCGA 4S30A 1M7QA 3MJ1A 3LMHA 4E5WA 3KK9A 4H3PA 1QPDA 3PY1A 2Y7JA 3LJ2A 4BTJA 4K8AA 3KU2A 2PUNA 1U54B 2OFVA 4NTSA 4FUYA 1E9HA 2YA9A 4IDTA 1UU7A 4FT5A 2C3JA 4RIWA 4NT4A 2J0KA 3DTWA 5IA2A 5I9WA 2YHVA 4MK0A 3V5WA 4BCNA 3R8ZA 2J6MA 2RG5A 1PW2A 3DTCA 3HMOA 3R30A 4LRJA 4DITA 4HVHA 4UMQA 1ERKA 4A9RA 1JSUA 4W4WA 2PVKA 4EK4A 5EFQA 4Q9ZA 3SC1A 1GZ8A 2GHGA 4IZ7A 2HZ4A 1YOMA 4MVFA 4ASEA 4DFLA 4DFXE 1KOAA 4S2ZA 1UKIA 3ORIA 4I3ZA 5J8IA 4BWKA 4DEHA 4ENXA 2ONLC 3THBA 1YI4A 4A06A 4NCTA 3RBWA 3WE4A 2YWVA 2XF0A 4IM2A 4AZSA 3LQ8A 5AP1A 4I5PA 5IA3A 3RCJA 3IW4A 5EYCA 3UP2A 2Y6MA 3MIAA 3EB0A 1H07A 1R0EA 3HMIA 3KA0A 3C13A 2R2PA 2VUWA 3BLRA 2W1EA 2X2LA 4KINA 3UG1A 5EQEA 2CN8A 5AP3A 4EWHA 4H1JA 3GCSA 5EYDA 3MFRA 1Q3DA 4RBLA 2VX0A 2CKOA 3KMUA 4ZZMA 1YXSA 5IA0A 4GW8A 4PPBA 3QRKA 5KHXA 4KD1A 3IDCA 4ZS0A 4MQ2A 3JY9A 3O50A 4Q2AA 5L2QA 1UNHA 3BYVA 5JRSA 2UZTA 3ZBXA 4FV7A 5IEYA 2IPXA 4X3FB 4PPAA 2YISA 4GL9A 3FMMA 4F99A 5LVLA 4MD7E 2JKOA 3F7WA 3D4QA 2VWYA 3ZS5A 2QQ7A 2XVDA 3BU6A 5CI7A 2G01A 5AJQA 4D4VA 4DN5A 4FV4A 2VO6A 3BHUA 4ZAUA 5T68A 3UJGA 2J51A 4JDIA 2XNMA 4FTAA 1PXLA 3Q6UA 2PSQA 2YN8A 3R7UA 5M53A 5C27A 4WNPA 3KREA 4FTOA 4Y5HA 4QMUA 2C0IA 5AR3A 3U51A 4Z55A 3W2OA 3DLSA 4W8DA 2W1FA 3KN5A 2IW8A 2RIOA 4E3CA 5K5NA 4JS8A 2V7AA 2HK5A 4O83A 2HWOA 2I0YA 3RAWA 2WTIA 4FKQA 3Q5IA 4H05A 3MA3A 2EU9A 2IVUA 4HYUA 4BL1A 4YTCA 3LLAA 4N0SA 3L9NA 3QQUA 3ZDIA 4EH6A 3V5QA 3G6HA 5HICA 4EH5A 4EH9A 1OBDA 1ZOGA 2R3KA 3MFUA 3AC5A 3AC8A 3E64A 3G0EA 3MDYA 4FTCA 4L3PA 3W2QA 4A7CA 5FD2A 3ZOSA 2W1IA 3B2WA 2IW6A 5ANGA 4EKKA 1O9UA 3LFAA 2BDWA 3C0IA 4J53A 2WIHA 4JRNA 4C33A 3CQWA 2UW9A 4OTRA 4C36A 3OY1A 1NXKA 4L42A 4NM5A 3ZBFA 5DPVA 4O1PA 2GDOA 4AAAA 3P5KA 5IA1A 2XCHA 4QTCA 3ORPA 4JQEA 3F69A 3LQ3A 3F9NA 1H1PA 4N6ZA 3CQEA 4ANOA 5HU9A 3H9OA 2QODA 2YIWA 4U3YA 3WYYA 3F7ZA 4IQ6A 2ETMA 3RPVA 2XM9A 1QPEA 4R7BA 3QRUA 2UW3A 3GCPA 3ZCLA 3BKBA 4E20A 2XKEA 3CJFA 1FMOE 1OGUA 4G6OA 3RAIA 2CKQA 1ZZLA 4FTRA 4L00A 1OI9A 4D9UA 4YR8A 3ZSIA 3E92A 2QI8A 2VTTA 4O2ZA 3OCSA 4QMLA 4Y8DA 5H8GA 4YJPA 3RWPA 3OMVA 4AFEA 3FXXA 4IWOA 3EL8A 4JIAA 4M84A 3UIUA 4DGOA 3PXZA 5DHJA 3IKAA 2UW4A 4O0UA 4ZSJA 3JXWA 4TXCA 4A4OA 2P2IA 4EOKA 3TKHA 4CMUA 5EHLA 4OUCA 2YAKA 2R3PA 3ITZA 4L53A 3KQ7A 4AN9A 3VNTA 4QMWA 3TNIA 3LFSA 3PG1A 4KSPA 1UVRA 3V3VA 1WVXA 5HU3A 2OW3A 2QU5A 3W8LA 3D94A 2EXMA 3K3IA 2IZTA 3VUIA 4D2RA 5E8SA 3UE4A 2XM8A 2VRXA 4TWOA 3F3TA 5EK7A 3NNVA 4XV3A 3SKCA 4IVDA 4AFJA 3QX2A 3ZRMA 1VJYA 2VAGA 3MB7A 3Q4CA 4FTNA 4X2KA 4AX8A 5GZ8A 3TZ9A 3A7HA 5K9IA 1Q5KA 2I0EA 5EQYA 3E5AA 3UPXA 5CSXA 5AR4A 4QPSA 3R9DA 3E88A 5KUPA 4FE2A 4CCBA 5K0KA 3KRWA 2XIKA 4JR7A 4QMQA 1PMEA 3GC9A 2J5EA 4TW9A 4KBAA 5E91A 5AR2A 3PIXA 2GMXA 2ITZA 2R0IA 5CNNA 4F7SA 4DCAA 5DNRA 2XJ1A 3PWYA 4G3EA 3POOA 3QZIA 3DDQA 2OGVA 4EONA 2GNFA 3S0OA 1PYEA 1MQBA 3FUPA 1PXOA 3MV5A 4TRLA 4GG5A 5DG5A 1U5QA 3HRCA 2GQSA 3POZA 5CANA 2RKUA 1SM2A 3FAAA 4Z9LA 1S9IA 4JL9A 3QGYA 4GT5A 3NYXA 5DRBA 3MIYA 4IB5A 4PDSA 4YJOA 4XG9A 4C38A 4EKLA 4EZ5A 5LOHA 4FKIA 4S33A 4E5BA 1MRVA 3G0FA 3V6RA 2QR7A 1PKGA 5AV1A 4DEDA 5GJFA 3PSDA 4YHFA 3DBFA 2W1GA 1U46A 5EKOA 3DDPA 2SRCA 3KKVA 2C5NA 1EH4A 3G90X 2QONA 2O5KA 4BCJA 2C3KA 3QD2B 4RVLA 2VTLA 4L44A 1OVEA 3RNYA 2CLXA 1W84A 2Z7SA 5DOSA 4JT3A 4HYSA 4Y95A 5DH3A 1KE6A 5EM6A 4IFCA 4RC3A 3U87A 4L52A 2PVNA 3I7BA 4NUSA 3EQHA 1B6CB 3Q32A 3R21A 4QMYA 4G16A 3VS1A 3BV2A 4A9SA 5IG1A 2R3RA 4AGDA 3PRFA 4XOZA 2YCFA 2BFXA 1UU9A 3I5ZA 4HOKA 4RC2A 4IZAA 1GNGA 3C9WA 3HA6A 3OTUA 4LRMA 1Y6AA 5D11A 3LXLA 3NUXA 5CS6A 2RG6A 5BVNA 3FC2A 3ZU7A 3C5UA 2XNGA 1SNUA 1WAKA 1ZOEA 4C4IA 3SXRA 2XKDA 4IXPA 4OBPA 5I3OA 4E6QA 1PXJA 3ALOA 2VTIA 4JBQA 3TKIA 4FF8A 3DFAA 4H1MA 2A27A 3UG2A 4Z7GA 3PVGA 4WUAA 2VTPA 4TZRA 4FNWA 2QG5A 3FMDA 3P4KA 3JUHA 5FEQA 3UPZA 4MWHA 3HUBA 3CS9A 2F7EE 4L7SA 4NFMA 4FICA 3LXNA 3L8VA 1ZYLA 1H1SA 2YJRA 3MVHA 4GV1A 5HBEA 2XB7A 1J1CA 3A8WA 4DBNA 4YC8A 3NSZA 3ZO3A 2X7OA 4FYOA 3QF9A 1O6KA 2RSVA 4ANQA 3UTOA 2EUFB 4DH3A 4TYIA 2GNIA 3H3CA 2WPAA 4RT7A 4FI1A 4RJ7A 3PSCA 3QAME 5ANEA 4JQ7A 4QOXA 3A7IA 4OAUC 4Y73A 4XS2A 5C8MA 3A61A 3WZDA 3GU6A 5AAGA 3V5JA 2Y4IB 2X4ZA 2H96A 2VTRA 3FZPA 2GNLA 4AP7A 3MY5A 2BVAA 2BAQA 2PHKA 2PZ5A 3HMMA 4UX9A 2HZIA 2WOTA 3AGMA 5FM2A 3ZH8A 5A4QA 5IH4A 5HBHA 5DRDA 4QTBA 3VS2A 1FOTA 4HVIA 5HLPA 2J5FA 2H34A 3CD8A 3QTQA 3UMWA 2ERZE 2QHNA 3OHTA 4TYHA 2YLFA 5AP2A 5IZFA 3ZM9A 4USEA 2OG8A 3EOCA 3FBVA 3DZQA 4BCFA 3QUPA 1PY5A 2AUHA 3RPYA 3Q53A 3DFCB 3MYGA 1A06A 2WMVA 4AN2A 3T8OA 3I5NA 4NW6A 4FKPA 4M13A 3TTJA 1H24A 4CKRA 2CNQA 2JEDA 3FYKX 2G9XA 4YMJA 2WTKB 2ZV9A 4C4GA 3FQEA 3R28A 1LP4A 3AMYA 3Q6WA 5FWKK 4BDHA 1NVSA 2VWBA 3O8UA 4P4CA 5AR5A 4G9CA 3UIXA 2CKPA 4FZAB 2WMTA 3OOMA 3VIDA 3V8SA 2BAKA 4PF4A 1MP8A 3PJCA 5FEDA 3ZLXA 2XYNA 1V0OA 4M0ZA 2WTWA 4EJNA 3D5VA 4QMVA 4WBOA 1P2AA 4K0YA 3TJDA 5E8YA 2XNOA 2GSFA 2XIYA 3NGAA 4DFBA 4D55A 3MTLA 1GY3A 4O7WA 4RWIA 4AGWA 3E3BX 4GUBA 4KS8A 2JGZA 5LMBA 3GNIB 3LFQA 3QXOA 5KE0A 4F63A 3ZLYA 4R8QA 5KMLA 4ASZA 4CG8A 3PLAE 4UV0A 4ZZNA 4QTEA 4XG2A 3G5DA 5ICPA 2VTMA 4C58A 1FQ1B 2XIZA 5ANJA 2XKCA 3AT2A 3FPMA 1K9AA 2IVVA 1U5RA 3MVJA 2R64A 3FLNC 4F9WA 1Z9XA 3BI6A 4YNEA 4GK2A 5F94A 3V8WA 3GVUA 4BGGA 3PZHA 4QQ5A 1URWA 5ACKA 3VUTA 4AZWA 2CNVA 3F88A 5H9BA 3B8RA 1SZMA 2A19B 4OR5A 5KMJA 1M17A 2G2IA 3I60A 5DYJA 4R5SA 4LYNA 3FLSA 4BR3A 5K5XA 4LI5A 1XBCA 5HCZA 3UC4A 4CKIA 4R77A 5A3XA 2W1HA 1VR2A 4X6RA 3EYGA 1V0PA 5E8TA 5CSVA 1IRKA 3U9NA 3OY3A 4YLJA 3R00A 4YP8A 4MXYA 3KL8A 3H30A 4XV1A 2JKQA 4FL3A 2W96B 2YM8A 2NRYA 2OXDA 5HVYA 2YABA 5H2UA 2B55A 4HGSA 4D2SA 4G3FA 5H3QA 2XBJA 2UW7A 3ACKA 4G17A 5KZIA 3HP2A 4ERWA 1KSWA 4QNAA 1JKSA 1NW1A 4MBIA 2HY0A 2JIVA 4O38A 5TO8A 4Z16A 5JH6A 2YCQA 4EZ3A 5AEPA 3BHTA 3OUKA 4L67A 3BE9A 1P14A 3UOLA 2A1AB 4UMTA 4AUAA 3RJCA 4DEEA 3TEIA 2OBJA 3ZYAA 4C4EA 5L6WL 2W4OA 5HI2A 4E8AA 3OWPA 2WTCA 3FLWA 4NWMA 2QOFA 1BYGA 3F82A 2B7AA 2JDRA 3DNDA 4FSMA 4L6QA 2QO2A 4FKGA 4EBWA 4EOOA 2QVSE 2W5HA 4YZ9A 5B2KA 4ORKA 1OL5A 4KNBA 4B8MA 4BICA 4XMOA 3E7VA 5IEXA 1OL1A 1BKXA 4FYNA 3UZTA 2ITOA 4DC2A 3FZTA 2ACXA 2XEZA 3DAKA 3UGCA 4DGLC 3ZDUA 1KE5A 3W8QA 4CV9A 1M2RA 2YDKA 3I0QA 2ZMCA 3NWWA 2XA4A 3QHRA 4IB1A 4YJUA 3W55A 3QA0A 4EBVA 4E1ZA 5BVFA 1MUOA 1XO2B 2CGWA 2PPQA 1REKA 3A8XA 2VWWA 3CPBA 2WXVA 4RGJA 3L8PA 4O0TA 3DCVA 2XRWA 4IVBA 3M2WA 4FIJA 3QRJA 3C4CA 4WIHA 4HVGA 1TQIA 3QL8A 1OPJA 2J90A 4ZSEA 3JR1A 4O84A 3ATTA 2PWLA 4D5KA 1ZYDA 4HPUE 4ZSGA 3VULA 1Q8UA 3DBQA 3AMBA 2GTMA 4KWPA 3NW7A 3OTVA 3CP9A 4FKOA 5FXSA 1JSVA 1E1VA 2VGOA 2ZYBA 3GOKA 4YBJA 4WT6A 5FXQA 3GU7A 3F3VA 3GQIA 4IB0A 3IONA 4FIGA 5EG3A 3TNWA 5J1WA 1XR1A 3WF7A 4F08A 4AT4A 2Z02A 2GTNA 2XK8A 2H9VA 3EZRA 3IECA 4NM3A 2GQRA 4PMPA 3NAYA 4MNFA 3CBLA 3DK6A 3DQXA 3LXKA 4AA0A 2WAJA 3HRBA 4HW7A 4CKJA 1XH8A 4L68A 5M57A 5C26A 3FKOA 3AXWA 3JVRA 3KRXA 4V04A 2OJJA 1BL6A 1H0VA 1NY3A 4FT3A 2ZV2A 3HLLA 3T9TA 1M14A 1M7NA 5HLNA 3F2AA 4C7TA 2HW6A 1NVRA 4JJRA 3EFKA 3DXQA 5IQBA 4FVRA 4EH3A 4IBMA 1YW2A 3DKFA 3OT3A 2UZNA 3U9CA 2C47A 4XUFA 1ATPE 4C2VA 4ZY4A 5M51A 1ZOHA 2C6TA 1ZARA 4NU1A 4ZJVA 4XP2A 4QP8A 1P5EA 1WBPA 3W33A 3ZUTA 3U6HA 2YWPA 1M2QA 5AADA 3ZSHA 2VU3A 3WI6A 4XG7A 4DEBA 3PTGA 4QMPA 3H0YA 2QLUA 5EH0A 4WOVA 3GCQA 1H8FA 4G34A 2ZMDA 4X0MA 2JD5A 4NL0A 2X6DA 1QCFA 2UZOA 3NW6A 3ZMMA 5GJGA 5HIDA 4EH4A 3SW4A 3VBXA 1R1WA 4OBQA 5HE1A 3R7EA 3U4WA 2PUIA 3Q52A 4EWQA 1YQJA 4CFMA 1Q8YA 4CNHA 1Q8TA 3CKWA 5ANIA 5I4NA 3U55A 5I3RA 4J98A 4ZTLA 5IH6A 4AZVA 3HAVA 2C3IB 4RQVA 3E3PA 3B8QA 4TYJA 2X8IA 4TL0A 5BVDA 3ORLA 4OTPA 5HE2A 3RPSA 1PJKA 3F3ZA 5K3YA 5IKWA 4C3FA 3EQPA 5DMZA 3KGAA 5I9UA 5DWRA 3VWAA 1OB3A 5IU2A 5DR6A 3R2YA 1MRUA 3NS9A 1OZ1A 4AG8A 4EOSA 2Y6OA 4M69B 2R3GA 5CVHA 2R3LA 4J97A 2GNHA 4J52A 5HBJA 1QPJA 5M09A 3KRRA 1LUFA 3F5UA 4GJ3A 4GKHA 4R7HA 4U41A 5L2SA 5JFVA 4CG9A 3FSFA 4L43A 1Q97A 5HNBA 4AW1A 3P7AA 5A4TA 1LR4A 4BCHA 4I5CA 4LOPA 3VJOA 4C02A 1YDTE 2C6MA 1ZYJA 1H00A 5I9YA 2F49A 4QQCA 1OUKA 3FQSA 3WIKA 4ANSA 4DTKA 3TV4A 3F5GA 4RA5A 5IISA 1S9JA 4O0YA 1VZOA 3ODZX 2QKRA 3VAPA 3CR0A 4WSQA 3TG1A 3DKOA 4YTFA 4FV9A 4RVTA 3KMWA 3O71A 4CFFA 3QU0A 3BBWA 3M11A 4F7LA 5FLFA 1M52A 5CVGA 2J9MA 3NEWA 1TVOA 2E9UA 3KXZA 3ZSGA 5BVEA 4O7LA 2CMWA 3EN9A 3QYWA 3FI4A 3NNXA 4FV8A 5D7AA 5D10A 5FDPA 4M7IA 3UOHA 5JKGA 4LMNA 4LOQA 2VNYA 1PXPA 2HW7A 3FXWA 4M69A 5HLWA 3EH9A 3DXNA 3IQ7A 5LWMA 3GT8A 4JNWA 3QZHA 5JQ5A 4D4RA 3MN3A 1YWVA 1ZZ2A 4LGGA 4HGLA 2X9FA 3E8EA 4IMYA 4YJVA 3LOKA 4I5MA 2A4LA 5LXMA 3FZ1A 2VNWA 1XHAA 2RFEA 3R83A 1UKHA 4ASDA 5EW3A 2F4JA 3SXSA 5AIRA 3CGFA 2Y4IC 5T3QA 3BRBA 4YLKA 5JGDA 1FBNA 4BWXA 4D0WA 4ANNA 4ZMFA 4CLIA 3KVWA 2JFMA 2Y0AA 3KXHA 3MJ2A 4H39A 2C30A 3CEKA 4X6QC 4XLIA 5EDRA 4W9WA 3TV6A 4C57A 4XH6A 2YIYA 1UA2A 3OW3A 3MI9A 4CLJA 1WBNA 2HOGA 3A60A 3BCEA 4F9CA 2QCSA 2E2BA 2QO7A 3WBLA 1G8SA 2P0CA 2IWIA 2OZAA 3UZPA 3VBWA 2CCHA 5L3AA 3N4TA 1UNGA 3HV3A 2WTKC 4XRLA 2EB2A 2OWBA 2QNJA 4CXAA 2XS0A 3IGGA 4WRSA 4D4SA 4O96A 4C3RA 3KF4A 4E93A 4U81A 4RPVA 2X9EA 2O2UA 4BCIA 4JDKA 1UU3A 4AZTA 3K5VA 3RAKA 3D5XA 5HE3A 4MH7A 3CTJA 3H0ZA 3FDNA 2BZHB 2C5VA 3HV4A 4D2PA 4E5AX 4X7QA 4GU9A 3EQBA 2ITPA 5JFXA 2E9OA 3DOGA 4FTLA 1Y57A 2VN9A 4RJ8A 2P3GX 3MFTA 3QUDA 5JMSA 2I6LA 4IM3A 4Y46A 4RIXB 3RZFA 2ZDTA 1H4LA 3FI2A 3P23A 3KEXA 4L9IA 4DCEA 2BHHA 3EN6A 3O8TA 3GGFA 3MA6A 2YERA 4HPTE 2JBOA 2R3NA 2OJIA 4OBOA 1U54A 4FGRA 2WEIA 1BMKA 1J1BA 2B9IA 2W1ZA 1F3MC 3FMHA 2X4FA 4FX3A 4U3ZA 3EQFA 4KAOA 4QYEA 3BYSA 2LAVA 2VTNA 1ZMVA 4YZBA 2X39A 2IJMA 3GUBA 2QC6A 5AP0A 1GJOA 1KE9A 2HZNA 1YXVA 3KVXA 4PNIA 1OL7A 2PTKA 4C61A 3OOGA 4QMNA 3PP0A 4CZYB 3IW8A 2GFCA 3BEAA 4LUDA 5C4KA 3QLFA 3DLZA 2YM5A 2JLDA 3KRJA 3PXQA 3ZEPA 4EJ7A 1IA8A 4MYGA 1Q61A 4RRVA 3ZFXA 4NSTA 4E6DA 4WA9A 3VBYA 1AD5A 4YC3A 2W9ZB 4V0GB 4DEAA 3SV0A 2X81A 2W9FB 2FB8A 5CSPA 3DBCA 4RG0A 1J91A 2YDJA 3LJ1A 3DQWA 4D5HA 3TUCA 4MF0A 3D2IA 5CASA 3V5TA 3VBVA 2UZEA 2ZV7A 1ZMUA 2XIXA 2B9HA 3CIKA 4DA5A 1G8AA 3W2RA 3MVMA 2ITQA 4XG8A 3R71A 4RLLA 5DT3A 5IQCA 1IA9A 1DAYA 4J1RA 3LM5A 3FYJX 3FY0A 3UODA 4M12A 2OLCA 5LVPA 4IX3A 4R3RA 2V7OA 4GU6A 5B2LA 1KV1A 5EDPA 2QOIA 4AE6A 4IHPA 4R1YA 3SGCA 1PXIA 4ITIA 4W4YA 4NKAA 3VS3A 3QQLA 4MXXA 4RA4A 4RFZA 4YGAA 2BALA 3Q60A 4LMUA 3GCUA 4X3FA 4QPAA 3VVHA 2IZRA 4KS7A 4OTQA 4ZTNA 5HNGA 4XG4A 4UWBA 2PVRA 4Q9SA 5C4LA 1G5SA 3WE8A 3TWJA 4F6SA 1IG1A 1YXXA 4GCJA 4QP2A 1VYZA 3V8TA 3TCPA 2W4JA 4GVJA 2C5YA 1XH9A 4BI0A 3UNKA 3BU3A 1Q3WA 3EMGA 4XYFA 4V0GA 2LGCA 5AX9A 3SW7A 3EN7A 3QC4A 3OWJA 3C5IA 3W10A 4IH8A 5HG5A 2CLQA 4WD5A 4EC8A 4U45A 4EK5A 4FBXA 4M14A 3WZKA 3GFWA 2PVFA 3H9RA 4O0RA 4YSMA 1U4DA 4UBAA 3TV7A 2OI4X 3KB7A 4OTDA 5EI2A 4B9DA 4RZVA 1V0BA 2X8EA 2IG7A 3GC0A 2E9VA 2ZAZA 4MNEB 4NM7A 2XNEA 4QQJA 3WF8A 3C50A 1H1WA 1WMKA 2G2FA 3QCYA 1PMVA 4LV8A 4FSRA 5CI6A 3BQRA 3CY3A 3II5A 3G9NA 3M42A 3FZRA 3HVCA 2Z7LA 4G1WA 4J7BA 4PDOA 5HG7A 3WZJA 4DT9A 3KXXA 1VEBA 5KHWA 3D83A 4Y5QA 1OM1A 5BVWA 3UDBA 2XH5A 4XG3A 4RX5A 1Y8GA 2C5XA 4YZMA 3IW7A 4FOBA 4O0VA 4YTHA 3VW8A 5DN3A 3WOWA 3GOPA 4BC6A 3GU4A 5JGAA 4DLJA 3EQIA 4WNKA 2R7BA 5HO8A 4XP3A 3HNGA 3DNEA 5TOZA 3VS0A 4FZDB 4M66A 5CSHA 4ACHA 2YITA 3LFBA 4C37A 4CQEA 1JSTA 3MFSA 2WQNA 4WBBB 4YZNA 3G6GA 1Z5MA 2VWXA 2CNUA 4BYIA 3ZRKA 5J87A 4IAIA 2C69A 4FSTA 1LEWA 3CCNA 4FSZA 3SOAA 3FPQA 5CF5A 4HCUA 1V1KA 3WZUA 2XEYA 4IM0A 3RK7A 5D12A 1JNKA 3HP5A 5CQWA 5FTOA 4D2VA 2NNWB 3V01A 3NCGA 5JZNA 4D1SA 3CSVA 4USFA 2WO6A 3DJ6A 4ASXA 3VBTA 2W7XA 3ULIA 3VUHA 5CAOA 2YEXA 3ORZA 4O0SA 4AZFA 4EOPA 4YURA 3FV8A 5IF1A 3RALA 4LUEA 2JAMA 2BFYA 1I09A 3PVUA 4R6VA 5L4QA 1OIUA 1WVWA 4RC4A 4AGUA 1GZKA 4BHZA 1J7LA 5FTGA 4GYGA 5FP5A 4Y83A 3DB6A 4TT7A 3Q3BA 2XNPA 5LMAA 2VGPA 3W32A 3WILA 4R5YA 3T3UA 4APPA 4LM5A 4BIEA 4BZNA 4ZSAA 1KUTA 2WMBA 4LG4A 2YAAA 1I44A 3LFCA 4UXQA 2GU8A 4IIRA 2QD9A 5BPYA 5AFVA 5CAUA 4PTCA 4S31A 3KCFA 4TYEA 3RHXA 3ZTXA 3HX4A 2CPKE 2OZOA 1T45A 1ZWSA 1WBWA 2WELA 4MKCA 4JOAA 2J7TA 2QOCA 3KRLA 3TTIA 4O91A 1CTPE 2ITVA 4PP9A 3Q4ZA 3P86A 3IS5A 3Q04A 4NM0A 5HIBA 3G2FA 1XKKA 4BDCA 3R8UA 1OBGA 4O7YA 5HESA 2DQ7X 4K1BA 3TNPC 3M1SA 3R6XA 1T46A 3JS2A 5GHVA 1GAGA 4OTHA 4BDEA 4HVDA 2PULA 1XWSA 2VO3A 4IC7A 4F4PA 2FSMX 4MBJA 4I23A 5IA4A 3BHHA 4X2NA 3MY0A 3U6IA 4AWIA 3U8WA 4TPTA 5BYYA 4WSYA 4BHNA 1G3NA 5AUVA 3EN4A 2F9GA 5KMOA 4FV6A 3AOXA 2BKKA 4FKJA 4JQ8A 3FMKA 4TWNA 4D9TA 4ANLA 2PZRA 3RPOA 4DBXA 4EHVA 2BIKB 4U5JA 4CD0A 4O7TA 5AM6A 3VN9A 4O7RA 1WCCA 2Q83A 5I9XA 3P0MA 3G9LX 3HV6A 4N6YA 4XV9A 3Q2JA 3FLYA 3PLSA 1Y91A 5IH5A 2JKMA 3PSBA 4JAIA 4UMRA 2O3PA 3ORXA 3NUNA 2XIRA 4XOYA 2OJFE 2X0GA 4BVUA 4BCQA 5AR8A 3BV3A 3T3VA 1GIIA 2QOHA 3BGQA 3QHWA 1OUYA 5E8UA 4KIOA 4C2WA 1XJDA 2OSCA 3ORMA 5A6OA 4M3QA 4DT8A 3BHVA 5CALA 3P9JA 3DV3A 5HO6A 4OT6A 4BI1A 5AA9A 5JFWA 4AOIA 4JVGA 1ZLTA 5LVMA 3PIZA 4W8EA 3WF9A 2XRUA 5F95A 3NLBA 5F9EA 1YHWA 3CXWA 3SDJA 2XMYA 2XYUA 5DGZA 1GOLA 2J0JA 3QX4A 4DLIA 2C6DA 1OKVA 2WQMA 1HOWA 2QOQA 4MXZA 2BILB 2P4IA 1UWHA 5C8KA 3AD6A 4F7NA 5HKMA 3I0OA 1B38A 2WKMA 3HZTA 5E1SA 5FBNC 5HO7A 3FL4A 4BCKA 3QQHA 4DINA 5FG8A 4ERKA 5HX6A 2BTRA 3QD0A 5AAEA 3AC4A 5IQFA 4F65A 2HXLA 3NYOA 4HGEA 1OL2A 5CEQA 3HMNA 5CF8A 1AGWA 2XKFA 1K3AA 3EKNA 2QOKA 2RFNA 4NIFB 4XV2A 4W9XA 3R9HA 4O21A 1OKWA 5AP5A 3GP0A 4NCTC 2HYYA 2WTDA 2W0JA 3LAUA 1WFCA 4WHZA 4FC0A 3UQCA 3KC3A 3BLQA 4OGRA 2VD5A 2WU7A 3W2CA 2KULA 4PL5A 4WO5A 5E7RA 1H25A 5K4IA 5ANKA 3HUCA 3VS7A 3MSSA 5KKRB 5LMKA 3UMXA 1UNLA 2C0OA 2VWUA 5K0XA 5KMKA 5AV3A 3OD6X 5HCXA 5M07A 2VO0A 4DG0E 5AUUA 3QGWA 3QRIA 4YBKA 4EHZA 2GCDA 3O17A 2JIIA 2BCJA 2Q0NA 4ZY5A 3PA5A 3ROYA 2BTSA 3IG7A 3VQUA 4O22A 3VO3A 3SXFA 2JDSA 4M15A 5E8VA 4F9BA 4UB7A 4XRJA 1GIJA 4AA4A 4DFYA 4U40A 4ZXTA 4AN3A 3WF5A 4QYFA 4X2FA 2FSTX 4FG7A 3HV5A 3PP1A 4FIEA 4DH1A 2BRBA 5C1QB 3UQFA 4FT9A 3ZO4A 4IACA 5HD4A 3RKBA 4O7ZA 4CT1A 1PHKA 3OXIA 3ANRA 3A7FA 2CGUA 5JN2A 2HXQA 4Q5EA 2Z2WA 3EIDA 3JYAA 4NIFA 4XP0A 5IA5A 4UYNA 5CWZA 5H8EA 3DU8A 4BDAA 4AT3A 4F09A 3QZFA 4CFUA 1W0XC 3ANQA 5J9ZA 3QTIA 3HRFA 4ZTSA 4FT7A 3OUNB 2NO3A 3G15A 3DBEA 5A4EA 4D4YA 4FSWA 3TACA 1ZY5A 4A4XA 2Z60A 2OICA 2F2CB 2WIPA 5JSMA 5JZJA 2ZVAA 4I20A 3PG3A 3ETAA 5M4CA 4MBLA 4EK8A 5CAVA 2ZJWA 2EWAA 4OTWA 4C3PA 4OT5A 4YPDA 5HORA 2OFUA 5TKDA 4PX6A 3SQQA 4L01A 3DKGA 2R3HA 1FPUA 4U79A 5E90A 3V6SA 4HZSA 4IJ9A 4EOIA 3KMMA 4QMMA 4FK3A 3PWDA 5HG8A 1PXMA 3G51A 2C6LA 5HD7A 3I1AA 3TNQB 2IVTA 4FL1A 4IWPA 4BTKA 1PYXA 4X3FC 5AV2A 1YHSA 3QTRA 1Q8ZA 2ITXA 2R3FA 4I21A 3RVGA 5AUWA 2R7IA 2E9NA 4C4FA 3ZLWA 4CTCA 2QOLA 3FJQE
chains in the Genus database with same CATH superfamily
5L8JA 3KY2A 2BRGA 2UZLA 3D0EA 2VWZA 3WYXA 1YOJA 1CKJA 3NDMA 3O51A 3RINA 1ZMWA 4JG7A 2VTHA 2BMCA 5D1JA 3VS4A 5E9EA 1KV2A 2AC3A 2C1BA 4WG4A 4GYIA 3ZUUA 5CXHA 1OIRA 2UZUE 4BKJA 1RJBA 4X2JA 3MPAA 4DFNA 1PRYA 5D9HA 5HGIA 4O27B 2WMAA 4BCMA 3FZOA 5JEBA 3NMUF 2CN5A 4KKGA 3GXLA 4K11A 2X0PA 4OTIA 2OK1A 4ZTRA 5DR2A 3E63A 3TIYA 4JIKA 1ZYSA 3K2LA 4PNKA 4ZTHA 3LCKA 5GZAA 3NYVA 1P4OA 2J0IA 1WBTA 3FC1X 1XBBA 3N9XA 5GNKA 2HENA 2R3OA 3EHAA 4ITJA 2PK9A 4MAOA 3QFVA 2C4GA 5E8XA 4YJQA 2ZOQA 3SA0A 1RW8A 5BNJA 4PL3A 1NVQA 4I4EA 2XALA 2XANA 3RI1A 2JDVA 3D9VA 1FGIA 3KF7A 4I92A 4QP7A 5DI1A 4CT2A 3DJ5A 3OVVA 2XK9A 5AUYA 2BHEA 3UYSA 1CM8A 3HL7A 2WMWA 4RJ4A 5LVOA 4IW0A 3VUDA 5L8KA 5EM8A 1NT2A 4BRXA 1CKIA 2B1PA 1OITA 1PMUA 3ERKA 3NRMA 3RK9A 4ARKA 4C8BA 4E4XA 2XK4A 4FNYA 4RX8A 3ROCA 4QYHA 1Y6BA 4JDJA 4AW2A 4N70A 4E26A 2VO7A 3PA4A 3UBDA 4D0XA 2YIRA 4GT3A 1OKZA 3BYOA 4YPSA 3QUEA 2RFDA 4S32A 5C8NA 5TT7A 2GNJA 3GENA 2WHBA 3NNWA 4BDIA 5JT2A 4WRGA 3QD3A 2NRUA 3KFAA 2WEVA 3A4OX 2J4ZA 4UY9A 4D1XA 5BQ0A 2VTOA 4RWKA 4QT1A 3EFLA 4DH7A 4BDDA 1FINA 4EUTA 2ZB0A 1XQZA 3MH0A 3MVLA 5CU3A 1ZY4A 2W06A 2BROA 2YCSA 3C4FA 5AUXA 4RWJA 1TZDA 3MH2A 3QQJA 4FSQA 4B6LA 5IUHA 2PMOX 3JY0A 4ITHA 3VHKA 3C4EA 3KCKA 3PJ3A 3QQKA 3P78A 2X0QA 3L9MA 3PVWA 3QCXA 4C59A 2XBAA 4JLCA 2WNTA 2QG7A 3E8CA 2REIA 2W5AA 3OS3A 1SMHA 3CTQA 2W17A 1H28A 2BZKB 4DAWA 2PE2A 2VTAA 4E4LA 4EQMA 4I94A 1PMNA 3OP5A 5GJDA 5L2IA 5IQIA 5BV3A 2QLQA 2W5BA 4ZS4A 4FTIA 5I0BA 3IW5A 4K9YA 4O1OA 3R1NA 4NW5A 4LL0A 4I41A 4NJDA 1JKLA 2KTYA 3TI1A 4CGAA 1A9UA 2WQOA 3UO6A 3ENHA 4OLIA 5EYKA 1OIQA 3QRTA 1VYWA 3UVPA 2HWPA 5J5SA 5TF9A 3I4BA 3O7LD 2OIDA 3QTZA 4J99A 3R8VA 5CEOA 4IAZA 3KN6A 4QP9A 2Z8CA 3RGFA 3R8MA 5A6NA 3O96A 3IK3A 3E7OA 4HNFA 3E93A 4WNMA 1TQPA 2JBPA 3Q5ZA 4GT4A 2UVYA 1PF8A 1QPCA 4U44A 5CX9A 4BDFA 5BYZA 3TDWA 4QO9A 4TYGA 2BR1A 2Z7RA 3DK3A 3NX8A 3QTUA 3MY1A 5F1ZA 3QKKA 4Q5HA 1W83A 3JPVA 4FTJA 2FO0A 4BDKA 4DEGA 4O0WA 3EWHA 5LCKA 3E8DA 5DFPA 4I22A 4N57A 3RWQA 4EOJA 3TIZA 4BBEA 2CDZA 5CZIA 2OF2A 3FLZA 4AT5A 4KA3A 3ULZA 3NIEA 3OBGA 5B0XA 4KRCA 4WG5A 2JAVA 5IDPA 1W98A 3SX9A 4CV8A 1ZYCA 3VQHA 1DS5A 4GMYA 3GU8A 4O4BB 4QPMA 4NFNA 5DR9A 5EI8A 2PMLX 3QTWA 4FVQA 4QD6A 3ZO1A 5BUJA 2UW8A 3AD4A 4U80A 1URCA 3QA8A 4G2FA 3HKOA 5JRQA 4I0RA 2PZPA 3ORKA 3IPHA 1JKTA 2RF9A 4KKEA 4RJ5A 3OWLA 4GFOA 4RFMA 3VW6A 4CZTA 3FI8A 4AA5A 5M4UA 1OPKA 3LHJA 4A4LA 3HYHA 4GIIA 4USDA 3HDMA 4WG3A 3ID6C 2XK7A 4FSNA 4M97A 4BKZA 4DTBA 3D15A 3NAXA 3TZ8A 4ALVA 2JFLA 2XP2A 2C6OA 4PTGA 2W05A 1P4FA 2P2HA 3BEGA 3PXRA 4BYJA 3QXPA 3GC8A 4E4NA 4F9YA 4XBUA 5HNIX 4FV2A 1H08A 3K5UA 4MXAA 3BL7A 5BUIA 4RIYB 3W1FA 2OIQA 4NZWB 4DHFA 3R1YA 5IPJA 2DS1A 4HYHA 4QMTA 4UWCA 2QURA 2RFSA 3WARA 1E1XA 3PY3A 3ODYX 5HG9A 4LGHA 5AR7A 4J8MA 2B54A 1JAMA 4JBVA 2EXCX 2X6EA 3I81A 5TE0A 5IDNA 3MPMA 2GS6A 3QWJA 4GIHA 4FUXA 4KUJA 2R9SA 4RMZA 1YOLA 4PP7A 2IVSA 3EJ1A 3FZSA 3PXFA 3B2TA 4B8LA 4C4JA 3ZZWA 5FQDC 4BI2A 5AUTA 3E62A 1H27A 1IAHA 2UZBA 3PPZA 3QQGA 3DY7A 4U97A 1XH4A 5ETCA 4E6AA 4EUUA 4FZ7A 4ZK5A 1YI3A 2F57A 4ANMA 3KXNA 4NH1A 2YM4A 2BZJA 4JBPA 1F0QA 1KE7A 1SYKA 4Z7HA 2VX3A 2XK3A 3P7CA 5J79A 2X2MA 4NK9A 1GZOA 5CVFA 4DG2E 4H3QA 4MXOA 3TL8A 4GK3A 5FDXA 1YHVA 4I5HA 5FBOA 2FYSA 3CE3A 4ACMA 4BTMA 4ZZOA 3UIMA 3COHA 3FY2A 5H8BA 3ACJA 3NCZA 4MQ1A 2YM7A 2HAKA 4RIYA 1OIYA 3PIYA 4D28A 5BX0A 5IQHA 2XUUA 3L9PA 3D5UA 3O2MA 4F64A 1KWPA 4IB3A 1J7UA 3TXOA 3F6XA 5I5ZA 1FVVA 1DI9A 2VTJA 4YJNA 4AW5A 5ETIA 4FMQA 4FNXA 2UZWE 4FV3A 5CTPA 2JITA 1OECA 5HVJA 3BL9A 4QMXA 4G3GA 3QCSA 4CMTA 4R3PA 4F0GA 4U7ZA 5J7HA 2YDIA 1IR3A 3ELJA 3EFWA 1OKYA 4FL2A 3NUUA 4FZFB 2VV9A 1FMKA 2O65A 2P33A 2CSNA 3BWFA 3GB2A 1NA7A 4MX9A 3TN8A 3UNZA 2C5OA 2R5TA 3RM6A 4DEIA 1J7IA 2C1AA 2C6KA 4X21A 4AZEA 5LQFA 4O7NA 4KRDA 1SNXA 3LKMA 4FIIA 3GCVA 5M4FA 5BVKA 5L8LA 4DGMA 3RPRA 4R3CA 2GFSA 2GNGA 2BDFA 5FM3A 4ZY6A 3PRIA 5IEVA 4EH7A 4IAKA 5C01A 4FKVA 3ENMA 4EOLA 3RHKA 3DK7A 4NEUA 1B39A 4F9AA 3GC7A 1W8CA 4XX9A 4XBRA 3Q4TA 3MW1A 3TM0A 2C6IA 4ZLZA 5EM5A 2QOBA 4QMOA 5CSWA 4WNOA 3R8PA 2B52A 2OJGA 3PJ2A 5ANOA 5CT0A 2YZAA 1AQ1A 4BCOA 3IDBA 1Q41A 4BBFA 5AAFA 5CU0A 4E6CA 5AP4A 2PL0A 4CVAA 4UMPA 5G1XA 2BRHA 1FVRA 3LMIA 1TQMA 5CLPA 2YM3A 4LQMA 1APME 3UVQA 3UZRA 4RX9A 3ZM4A 4P5QA 3UIBA 4U43A 4KIQA 3RK5A 5KX8A 3OZ6A 1HCKA 4JXFA 3MB6A 4FT0A 4I24A 4RIXA 5HHWA 4ZLYA 3R04A 4IWQA 4PY1A 3Q9XA 4RLKA 4GH2A 2YCRA 3VS5A 1YXUA 2YIXA 4XHKB 3HAMA 3BBTB 4EQCA 1JLUE 3ZFYA 3VUKA 5BMMA 4ZLOA 3D7TB 3AG9A 3KXGA 4ZEGA 4GJ2A 4BN1A 4FIFA 2VZ6A 2YFXA 4AOTA 5A46A 2QO9A 1BI7A 5KBRA 5I9VA 1YWNA 2VX1A 4Y72A 3HMPA 5C9CA 3COIA 1UWJA 5A54A 4IVAA 2GQGA 2C0TA 4LFIA 3PY0A 2WMXA 2JC6A 4EH2A 5L2TA 3GU5A 2I0VA 3BLHA 3MGYA 3IOPA 1H0WA 2IW9A 4BWPA 2PUPA 4D58A 2YZLA 4U6RA 4O6EA 1UV5A 3PXYA 1CSNA 5E92A 4PMMA 2WMQA 4AW0A 4H58A 2JKKA 4HZRA 1OPLA 2AC5A 3FKLA 5AA8A 3COMA 3EZVA 2ZV8A 2ETKA 4BB4A 4ONAA 4GUEA 3BGPA 3GEQA 2WQBA 3PPKA 4U0IA 4F6UA 3S4QA 4HYIA 3ZFMA 4YJRA 4NYEA 3CD3A 3K3JA 3DB8A 3LM0A 4RX7A 4UXLA 2B53A 3L8XA 4QP4A 4QP3A 4NJ3A 1YDSE 3E8NA 3P79A 4NTTA 5DBXA 4JRVA 3R73A 4II5A 1XH6A 3R7VA 4J96A 4O6LA 3RTPA 4BJJA 1L3RE 3OXZA 2V55A 2H6DA 5HOAA 3C51A 3D7TA 3VHEA 2BDJA 2B9JA 3W18A 1PKDA 4G9RA 4QRCA 3TJCA 4GFGA 2PVHA 2QU6A 4KB8A 4AU8A 3LCDA 3W0OA 4E4MA 1WZYA 3UO4A 5HTCA 4KIKB 5EKNA 4MTAA 4MWIA 5KMIA 2WTJA 3NW5A 2CJMA 1OMWA 3UO5A 2FA2A 2UUEA 2XNNA 3FHIA 3NNUA 5L6PA 4P90A 4GEOA 4TY1A 4L8MA 3AT3A 3GQLA 3A7GA 5ITAA 1QMZA 4A9UA 1ZAOA 5J95A 3EQRA 4BF2A 4YUQA 3V5LA 5D41A 3A99A 3BHYA 2VWIA 5A14A 5KNJA 2PVLA 4G31A 4FEUA 2GS2A 5CT7A 4FIHA 4JI9A 4UZHA 2FSLX 3ZONA 4FTTA 4BKYA 4EORA 4DH8A 2R4BA 4P2KA 5J1VA 1REJA 3DPKA 4OTFA 3FMLA 4YJSA 2HELA 5CQUA 5AP7A 4FTKA 4G3DA 5M56A 3BLAA 4A9YA 2ZM1A 5GZ9A 3AMAA 2A2AA 2W1DA 4DGNA 2RL5A 3BIZA 3O8PA 4UYAA 5LARA 5CEMA 3QTXA 4Z3VA 4ZJIA 4MNEA 4D2TA 4F1OA 2UVZA 4EOQA 1YKRA 3NUSA 4AOJA 4OTGA 4BZOA 4WUNA 3UC3A 4IJPA 3LVPA 2EB3A 2R3QA 2WGJA 4LL5A 3K54A 4I6BA 4CCUA 3PZEA 4M0YA 2XZSA 3LCSA 4KIKA 3SAYA 5L6OA 2EXEA 4CFVA 2UVXA 3IGOA 4GG7A 2YJSA 4ZIMA 2ITWA 5KZ0A 4DF3A 1J3HA 2RGPA 5ACBC 3RAHA 4K18A 1WBVA 3ZUVA 5HTIA 1LPUA 2ITUA 2DWBA 4ZTQA 5FXRA 2WQEA 3OEZA 4BIDA 4ANBA 3C4WA 1X8BA 4QP1A 4XNEA 2FGIA 3C4ZA 3NVMB 2CKEA 4FVPA 1Q24A 2DYLA 5L2WA 2ZB1A 4FOCA 1SVEA 4K33A 4BFMA 5DT0A 4RVMA 3KK8A 4PWNA 4A9TA 2PVJA 3FE3A 4MXCA 5CAQA 2WMUA 5CEIA 4KSQA 5B7VA 4ZJJA 4PL4A 3OCTA 4EK3A 3U6JA 2QHMA 4G5JA 5CNOA 2C68A 3FMEA 4H3BA 4WKQA 3PJ1A 4PDPA 4EOMA 3OXTA 4EYMA 1CKPA 5HZNA 1ST0A 2FVDA 4RJ3A 4UMUA 5IMXA 4I1ZA 1R39A 4CZUA 2YM6A 1FGKA 4IANA 3A62A 3R02A 4FA2A 5IQEA 3AD5A 2R3IA 1H26A 1Q8WA 5EW8A 4QEBA 2X1NA 3R1QA 2PZIA 4XG6A 3IDPA 2A98A 3ALNA 3DXPA 3UOKA 3FSKA 3I79A 4JX3A 4CMOA 1H1RA 1SVHA 2O64A 3N51A 4PDYA 4PV0A 3U54A 2HZ0A 3L9LA 2X8DA 4BIBA 4HVSA 2UW5A 3VONA 5DT4A 1ZXEA 3BYMA 3HECA 4QMZA 4BDJA 5FRIA 4MD9E 1RQQA 3FI3A 4FODA 4BY9E 2W4KA 4CRSA 3EYHA 4Y85A 3LXPA 4PMTA 5CYIA 4ACCA 4GK4A 3EKKA 5KBQA 4CYIA 3F3WA 5GIPE 2XNBA 1W82A 3R01A 4UALA 3ZRLA 3QCQA 4L46A 5BUEA 3TUBA 3S00A 4CQGA 5CXZA 3UQGA 5AX3A 3OFMA 3VF8A 3DBDA 4ALWA 4UEUA 4FKTA 4GSBA 5A4LA 4L3JA 4TWCA 3W16A 4F1TA 3AT4A 3I7CA 2XAOA 4QQTA 5BVOA 3RM7A 3GBZA 4FKSA 4JG8A 3OWKA 3LZBA 3PXKA 4E7WA 5AMNA 2BAJA 2EVAA 4TYHB 2HCKA 4NKSA 5J5TA 2UZVA 2A0CX 4W4VA 3DZOA 3O7LB 2ITNA 2Q0BA 3BX5A 3MESA 5M4IA 4YC6A 4IX6A 3SRVB 2WOUA 3Q4UA 2WFYA 4LGDA 3NVKI 4AAYA 4GKIA 1Q4LA 5EQPA 2I0HA 3BQCA 3JVSA 2WD1A 3O0GA 4FSUA 3FKNA 3QALE 1JPAA 2PY3A 4EK6A 1BLXA 4S34A 5FEEA 3TZ7A 4O7VA 4DYMA 5BYLA 4IADA 3IOKA 3VS6A 4IX5A 5E1EA 4KIPA 4QYGA 3UVRA 3MH3A 5HE0A 4DG3E 2QKWB 5HX8A 3WIGA 4X2GA 3BWJA 4I0SA 5DE2A 4DDGA 3NZ0A 1UU8A 4TWPA 3RNIA 4M8TA 3V51A 2JIUA 2V62A 3ORTA 4MCVA 3QQFA 4IZYA 4LRKA 4QTDA 4CTBA 2W1CA 5I9ZA 3CLYA 4FR4A 3KXMA 3LFDA 2J2IB 4TN6A 5AV4A 5HTBA 4FKWA 1BL7A 2OJ9A 3OCBA 4G5PA 4ID7A 4C62A 4O82A 3FLQA 3W0QA 4AXCA 5DLSA 1F5QA 3HEGA 2PZYA 4M67A 2NPQA 5JGBA 3HA8A 4HGTA 3REPA 3GI3A 5IUIA 5CENA 2ZDUA 1JQHA 3QZGA 2OU7A 2UV2A 4IAAA 4FEQA 3ZC6A 4C0TA 1R3CA 3D5WA 3FMJA 3SHEA 5C03A 3AGLA 3BELA 3OF0A 3PPJA 3IW6A 2PE1A 2WZJA 3LJ0A 3QWKA 4ZMEA 2O63A 5T6KA 3TDVA 3AQVA 3G33A 2GS7A 3BYUA 5CZHA 3SRVA 3RMFA 5E8WA 4CYJA 4YLLA 4D1ZA 4BBMA 3F2NA 4G6LA 3D2KA 3Q9WA 3QLGA 2B4SB 2PMIA 3MBLA 4QP6A 5BMSA 4CFWA 4IAFA 5ETFA 3O23A 4U8ZA 4BDGA 2VWVA 3R1SA 3C4XA 3QD4A 4FTQA 4IAYA 5EW9A 4ZTMA 1RDQE 5ETAA 4FKLA 2X2KA 5A9UA 2OIBA 4IEBA 1BX6A 2Y4PA 4L3LA 3HGKA 4EYJA 4FV1A 1O6LA 4F6WA 3PFQA 4X3JA 5CU4A 4B99A 3SLSA 2WMSA 4DGGA 2AYPA 3ZLSA 3TNHA 3R9RA 5IQDA 5DEWA 3NUAA 3D14A 4FEXA 5GIOE 4P5ZA 3N4VA 5F4NA 3LFEA 3VJNA 3NUPA 3R7OA 5EDQA 3QYZA 4U9AA 2NP8A 3CTHA 5JK3A 2QR8A 1DI8A 1JKKA 1OL6A 1SVGA 5FP6A 4PMSA 5KCVA 4APCA 2PE0A 3R8LA 1R0PA 3AC3A 4RIOA 3NUYA 5IQGA 4FEWA 5IQAA 2BRMA 2I40A 5AM7A 3SVVA 2XK6A 4JG6A 4MF1A 3R7YA 5LVNA 5J7BA 4B4LA 3UOJA 4O0XA 3MH1A 3CKXA 5D7VA 4DTAA 5DEYA 4FTUA 4ACDA 2HY81 3A4PA 3EN5A 4JBOA 4GVAA 4ZP5A 5CEPA 2ERKA 3PE2A 4FV0A 4EZ7A 2C3LA 3F61A 4DFUA 2BPMA 4I6HA 3EQDA 3ZHPC 4AS0A 1KOBA 4UWYA 4IC8A 3MWUA 4KBKA 3R0TA 1GIHA 5HEZA 3CJGA 4AGCA 2ONLA 2ZM3A 2Y9QA 2YACA 2PUUA 2G1TA 2J50A 3WZEA 2OXXA 2WB8A 3TMOA 3DAEA 5FGKA 3OG7A 5TR6A 3EFJA 4AE9A 5HIEA 2B9FA 3DS6A 5K4JA 5AIKA 5KMNA 4P7EA 3NIZA 1HCLA 3ZZEA 4IVCA 5M55A 1YXTA 3FMNA 4C4HA 4FK6A 4G3CA 3L8SA 3VF9A 2I7QA 3CC6A 2PVMA 4I93A 3P1AA 3U4UA 4JX7A 4YTIA 2XJ2A 3CPCA 1XH7A 4N4SA 4JDHA 4OAVB 2ETRA 2FH9A 3I6UA 3A7JA 3FWQA 3VUGA 1MRYA 4YZCA 1YRPA 4F7JA 3ATSA 2V0DA 3T9IA 3UP7A 3LFFA 5AP6A 1L8TA 2PYWA 4TKSA 4AACA 4UN0C 2BZIB 3PFYA 3OROA 5E8ZA 3PDTA 3ET7A 4TNBA 3ORNA 1LEZA 4PTEA 2OH4A 4EQUA 3HV7A 4GRBA 3C7QA 2O8YA 3EL7A 4I0TA 3SOCA 4ACGA 4G6NA 2JDTA 2VTSA 3TKUA 1W2FA 1WBSA 3TT0A 3GFEA 1XBAA 2DUVA 4K2RA 3ZC5A 5HVKA 2JDOA 2WMRA 4GFMA 3W2SA 4EH8A 3AC2A 3CQUA 1JBPE 1JWHA 2O0UA 4LV5A 2IZUA 4PUZA 5EHOA 3FXZA 4CFXA 4ENYA 1IASA 1MQ4A 3KULB 4BTFA 1BUHA 3H9FA 3P7BA 4L45A 4XJ0A 4J95A 1BI8A 2CGVA 4IE9A 4K6ZA 5KMMA 5M08A 3F5XA 4YU2A 1PXNA 4TNDA 5JFSA 4TTHB 4B7TA 2OF4A 3EQGA 3HDNA 3PYYA 4I4FA 4W4XA 4YHJA 4O4FA 4XEYA 3QBNA 2GHLA 3RP9A 3UDTA 3C1XA 2HIWA 1IAJA 4UZDA 3DT1A 2IN6A 2CGXA 2YIQA 3LLTA 5AWMA 4B0GA 2OKRA 1RE8A 4YSJA 4H36A 2XJ0A 3RZBA 4D2WA 1H01A 4RQKA 3NPCA 4FTMA 3NYNA 4AQCA 4EHEA 3I6WA 3BU5A 3PE1A 3OT8A 3W2PA 1DAWA 1ZRZA 2V5QA 2R0UA 5EYMA 4FGBA 1O6YA 3QTSA 3VRZA 4ZSLA 2FUMA 4MD8E 4F0FA 3DJ7A 4XLVA 4FEVA 2Z7QA 4KBCA 3Q9YA 2R3MA 4O2PA 5KO1A 1YI6A 4V05A 2BIYA 4JAJA 5EI6A 5EM7A 3P08A 2OXYA 3BPRA 3LW0A 4FSYA 4YO6A 1CDKA 4IZ5A 1QL6A 3KULA 4C35A 2F7XE 4PRJA 4GS6A 4HCTA 1H1QA 2OH0E 5E4HA 4RVKA 5CU6A 4EL9A 5DA3A 3VUMA 3H10A 2ESMA 3S95A 3C0HA 5M06A 3Q9ZA 4A07A 3LQ5A 3R7GA 3MS9A 4FZ6A 5AUZA 1Q62A 3UDSA 3LIJA 3PA3A 1WBOA 3S3IA 4BZDA 4EC9A 2BUJA 4CRLA 2G2HA 2R3JA 3S1HA 4MEDA 4F0IA 3QC9A 3A2CA 5IUGA 4O7SA 4FKUA 5CF6A 2UZDA 1IEPA 1TKIA 5G6VA 4QNYA 5LCJA 2W99B 3AC1A 3VBQA 2I1MA 3F3UA 4IWDA 4RJ6A 5EHYA 3EQCA 1JOWB 1CMKE 4FG8A 4RZWA 3LPBA 2V22A 3FL5A 3PVBA 3LCOA 2X7FA 4F1MA 5HCYA 4IFGA 3DGKA 3ZXZA 4JR3A 4CSVA 3VRYA 1PXKA 3BZ3A 4J8NA 4EI4A 3LCTA 4CEGA 2VTQA 3MTFA 3R9OA 2ITYA 2YLEA 3SD0A 3CGOA 4C34A 4O81A 4RFYA 4EHGA 1U59A 4ZOGA 3PJ8A 4I6QA 5FUTA 2UW0A 2J0MB 2C6EA 4QYYA 3R63A 4YZDA 3FHRA 3R22A 3F66A 4YNOA 4O86A 4QTAA 2OO8X 2WTVA 3WF6A 4FNZA 3L1SA 4V01A 3QKLA 3V5PA 4EEVA 2B0QA 4BGQA 2F2UA 4FG9A 3OBJA 3E87A 1FVTA 5EOLA 4MHAA 4HJOA 1ND4A 4BDBA 5DIAA 3F2RA 4DH5A 4YO4A 1STCE 3F5PA 3OCGA 4FKRA 3RCDA 5IMEA 4BCPA 2CCIA 5F20A 4F70A 1W7HA 1JVPP 1R78A 3Q96A 5CY3A 3LFNA 1DM2A 2IO6A 2ZM4A 3DKCA 3ZO2A 5CEKA 5LMKC 3TUDA 2XCKA 5LJJA 3DAJA 5ANDA 2UW6A 4HCVA 4DFZE 3C0GA 5CF4A 2H8HA 5LWNA 4FV5A 4QMSA 5GINE 2BKZA 2PVYA 1YWRA 4I6FA 4R7IA 1GZNA 1WVYA 3TZMA 3BE2A 3H4JA 2WU6A 2P55A 3DA6A 4KKHA 1A48A 2PU8A 4YHTA 1K2PA 5FTQA 5J9YA 2IZSA 4M68A 2F7ZE 3NR9A 3FQHA 2GPHA 5AV0A 3UYTA 2Y8OA 4RWLA 3SG8A 3VC4A 2QOOA 3R2BA 5EOBA 3Q2MA 4J71A 1YVJA 4IX4A 5B2MA 4AXAA 3FEGA 3V04A 5M44A 2PMNX 3ZXTA 5CU2A 3N4UA 2G15A 5J9LA 4RIWB 4CFNA 4PPCA 4HNIA 2X7GA 2CHLA 4RSSA 3SG9A 1KE8A 5HQ0A 2OZAB 1XH5A 3MPTA 1M2PA 3COKA 4R1VA 5CAPA 1Q99A 4E73A 4BGHA 2FSOX 3OEFX 3QKMA 5DVRA 2GHMA 5KKRC 3ZEWA 1Z57A 3S2PA 4IDVA 4DE4A 2ITTA 1Y8YA 2E9PA 3IO7A 3R7IA 4YJTA 1YDRE 4KABA 4LOOA 3R9NA 3CY2A 4K77A 2BRNA 4OW8A 3OW4A 4AF3A 3UNJA 4L7FA 4ALUA 5A4CA 5JQ8A 3D7ZA 4PQNA 2J0LA 3LMGA 4XCUA 3OC1A 3BGZA 4U42A 3LE6A 3PUPA 4R78A 4BCGA 4S30A 1M7QA 3MJ1A 3LMHA 4E5WA 3KK9A 4H3PA 1QPDA 3PY1A 2Y7JA 3LJ2A 4BTJA 4K8AA 3KIOC 3KU2A 2PUNA 1U54B 2OFVA 4NTSA 4FUYA 1E9HA 2YA9A 4IDTA 1UU7A 4FT5A 2C3JA 4RIWA 4NT4A 2J0KA 3DTWA 5IA2A 5I9WA 2YHVA 4MK0A 3V5WA 4BCNA 3R8ZA 2J6MA 2RG5A 1PW2A 3DTCA 3HMOA 3R30A 4LRJA 4DITA 4HVHA 4UMQA 1ERKA 4A9RA 1JSUA 4W4WA 2PVKA 4EK4A 5EFQA 4Q9ZA 3SC1A 2AEGA 1GZ8A 2GHGA 4IZ7A 2HZ4A 1YOMA 4MVFA 4ASEA 4DFLA 4DFXE 1KOAA 4S2ZA 1UKIA 3ORIA 4I3ZA 5J8IA 4BWKA 4DEHA 4ENXA 2ONLC 3THBA 1YI4A 4A06A 4NCTA 3RBWA 3WE4A 2YWVA 2XF0A 4IM2A 4AZSA 3LQ8A 5AP1A 4I5PA 5IA3A 3RCJA 3IW4A 5EYCA 3UP2A 2Y6MA 3MIAA 4AXEA 3EB0A 1H07A 1R0EA 3HMIA 3KA0A 3C13A 2R2PA 2VUWA 3BLRA 2W1EA 2X2LA 4KINA 3UG1A 5EQEA 2CN8A 5AP3A 4EWHA 4H1JA 3GCSA 5EYDA 3MFRA 1Q3DA 4RBLA 2VX0A 2CKOA 3KMUA 4ZZMA 1YXSA 5IA0A 4GW8A 4PPBA 3QRKA 5KHXA 4KD1A 3IDCA 4ZS0A 4MQ2A 3JY9A 3O50A 4Q2AA 5L2QA 3BYVA 1UNHA 5JRSA 2UZTA 3ZBXA 4FV7A 5IEYA 2IPXA 4X3FB 4PPAA 2YISA 4GL9A 3FMMA 4F99A 5LVLA 4MD7E 2JKOA 3F7WA 3D4QA 2VWYA 3ZS5A 2QQ7A 2XVDA 3BU6A 5CI7A 2G01A 5AJQA 4D4VA 4DN5A 4FV4A 2VO6A 3BHUA 4ZAUA 5T68A 3UJGA 2J51A 4JDIA 2XNMA 4FTAA 1PXLA 3Q6UA 2PSQA 2YN8A 3R7UA 5M53A 5C27A 3W0MA 4WNPA 3KREA 4FTOA 4Y5HA 4QMUA 2C0IA 5AR3A 3U51A 4Z55A 3W2OA 3DLSA 4W8DA 2W1FA 3KN5A 2IW8A 2RIOA 4E3CA 5K5NA 4JS8A 2V7AA 2HK5A 4O83A 2HWOA 2I0YA 3RAWA 2WTIA 4FKQA 3Q5IA 4H05A 3MA3A 2EU9A 2IVUA 4HYUA 4BL1A 4YTCA 3LLAA 4N0SA