3Q3BA

6-amino-4-(pyrimidin-4-yl)pyridones: novel glycogen synthase kinase-3 inhibitors
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
352
structure length
344
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogen synthase kinase-3 beta
publication title 6-amino-4-(pyrimidin-4-yl)pyridones: novel glycogen synthase kinase-3β inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 99
structure length 344
sequence length 352
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3q3bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3q3bA01
3NAYA 3F7ZA 1UVRA 2I40A 4DFNA 4DH3A 5CF6A 4KUJA 1GNGA 3IS5A 3NW5A 4IE9A 5BVKA 3FXWA 2P3GX 3QC4A 3V5TA 4BGHA 5E1SA 3KC3A 4TW9A 5H8BA 1JKSA 3H4JA 1NVQA 1YKRA 2HY0A 2B4SB 3NZ0A 5AWMA 2F9GA 3R6XA 4ACCA 4BDEA 4EQCA 1H07A 5DRDA 5HGIA 2F2UA 3U8WA 2J50A 3LCSA 4JIKA 4RX9A 4OAUC 1KUTA 3R30A 2OZAB 1GOLA 5IQHA 5I0BA 5A6OA 5JMSA 3UP7A 1YHSA 2BVAA 4ONAA 5M51A 4J98A 2G15A 3S4QA 3FI8A 3HV6A 5ANOA 4FTCA 3VBWA 2WMTA 4CMUA 3PWDA 3JPVA 3QGWA 4EBWA 4FK6A 3LXPA 3C5UA 4G16A 1PXOA 3FXZA 4LGDA 4PDOA 3L1SA 4RGJA 3Q5ZA 5KCVA 4AZEA 1TQMA 3N51A 4R5SA 4KRCA 2UZEA 3ORIA 2J90A 5FTQA 2WTIA 4AWIA 2JGZA 4R1VA 1JLUE 2IW8A 1TKIA 4IB1A 4BCQA 4ZJIA 3LJ2A 3QX2A 3VN9A 4TN6A 4OAVB 4WG3A 4AGDA 4U6RA 5FWKK 3GQLA 3UIUA 2PTKA 4BFMA 4YJPA 2P4IA 2R3NA 4UY9A 4DTBA 3I7BA 5FTOA 4L3PA 3TEIA 3I1AA 5IDNA 4BWPA 3BLQA 5CAVA 3MBLA 4HYIA 5AA8A 3H0ZA 1QCFA 3CP9A 4I94A 4X6RA 4FZFB 3REPA 3GC7A 5C4LA 2H34A 2ZAZA 5AIKA 5L2TA 2AUHA 3UODA 4DFBA 2OWBA 3BYOA 4GFMA 3CKXA 4R3RA 4PMTA 4WSQA 4WUNA 4C0TA 3D7ZA 2GDOA 4O6EA 4RPVA 4HVDA 5JZJA 2OH0E 2Z7QA 3D9VA 4OUCA 3W1FA 2OLCA 2R9SA 2DYLA 4BCJA 3RK9A 1GIHA 1Q3DA 2BFXA 3DJ5A 3PFQA 4IZ5A 5CXHA 4YP8A 3P7BA 4FIEA 5CVGA 4BDFA 2RG6A 4WNPA 4C4HA 3BLRA 5B2LA 5KNJA 4MD9E 1OIYA 3C7QA 3ENMA 3AOXA 4QP8A 4JL9A 5ANDA 1UKIA 3EFLA 2GFCA 2H9VA 1I09A 2WTWA 4JS8A 4NM3A 4PDPA 3I6WA 4OBPA 3OW3A 5L8JA 1H1SA 3ZUUA 4DT8A 1VYZA 5AV3A 3OBGA 3KEXA 2JITA 2SRCA 4AX8A 2YCFA 4CYJA 5EOBA 5ETFA 1OMWA 4B8LA 2WQMA 3QCXA 4ZP5A 4F1TA 3PPKA 4MXAA 3F5XA 1YDTE 1GZKA 4FNXA 5LVLA 1JAMA 2DWBA 4JQ8A 3ZTXA 5M07A 4UX9A 2UZNA 4CRSA 3BGQA 5M53A 5CX9A 2ZM4A 4HGLA 4B0GA 3KK8A 4LUEA 2YM8A 4JBPA 5EHYA 3POOA 1TQIA 4YO6A 5DEWA 2CPKE 2FO0A 2WMAA 5HE1A 4IANA 4D4YA 2VTPA 1WBNA 3VQUA 4ASZA 5AP7A 5K3YA 3RNIA 5IA4A 3VS6A 4GK2A 4EZ5A 1MRUA 5L6PA 5CAPA 4RWKA 2HELA 2KTYA 2I0HA 3FWQA 3OBJA 3Q60A 4FICA 4PTGA 2R2PA 4E8AA 3UIMA 2PWLA 4O7ZA 4XUFA 2E9NA 4I5PA 1R1WA 3KRJA 2C5OA 3QA8A 4RWJA 3DAKA 3MTLA 4NJDA 4GS6A 1OBDA 2XIXA 3F61A 5DR6A 2RFNA 5HG9A 5DT0A 5HE0A 3ZRMA 2XK3A 3B8QA 3O7LB 3RAIA 2CCIA 4KNBA 3A7FA 4GU6A 1GAGA 4RFMA 4WHZA 4OR5A 5CF4A 4L01A 1Y6BA 4ZLOA 2R3QA 3LCDA 4FBXA 5LMBA 3GBZA 3FV8A 2OZOA 5K9IA 3RP9A 3MTFA 1ZXEA 5DYJA 4U5JA 2BKZA 4DH1A 3R2YA 4IB3A 2PL0A 2ITTA 3TZ9A 5CVFA 2YM4A 4YNEA 1LEZA 5DNRA 5AFVA 2J2IB 1VZOA 5FG8A 3U4WA 5AX3A 2C3LA 4WIHA 2W5AA 5F95A 2B53A 3VQHA 3EYHA 3C50A 5D11A 2VTLA 1KV1A 3BU6A 4WBBB 2UV2A 3I4BA 4FKIA 5GIOE 3MJ1A 2CNUA 4KSPA 2J6MA 4EHVA 4PDYA 3TNIA 2P2HA 3D5WA 3ZONA 4JDHA 4DYMA 4XX9A 4GK3A 3Q3BA 4QPAA 4BCMA 5KBQA 2A19B 4NEUA 1UNLA 4RLKA 4C4JA 5A6NA 4E5WA 3QHWA 4PUZA 1AD5A 2VTOA 4W9XA 3LHJA 1BLXA 4AT5A 3RPSA 3LPBA 2W9FB 2JD5A 2WMVA 3AD4A 4MQ1A 4WO5A 4EWQA 4E93A 5KMIA 4O0TA 1H26A 4K9YA 1ZY4A 3FDNA 4XHKB 1CKPA 4GYGA 3FMNA 4F0IA 4YZBA 1YI3A 2OFVA 3FMKA 2BRNA 1PF8A 4YPSA 3I0OA 4QT1A 5BYZA 1SNXA 1Q24A 5CU3A 5BVOA 1H0WA 5L2IA 4K18A 4OTIA 4HPTE 5GZ9A 4D2PA 4FTLA 3QYWA 3FI2A 3ZCLA 4CFMA 4IH8A 3F5GA 2V5QA 5I9ZA 4GU9A 3RZBA 3Q2JA 2I7QA 3R8UA 3D14A 5C27A 2XBJA 4FKOA 3DBQA 3VW8A 3R21A 4I93A 1Q3WA 2QHNA 2Y8OA 4A4XA 1FPUA 3COMA 3CGOA 2UW7A 3HGKA 3NUNA 3O7LD 4J8MA 2DS1A 5HO8A 4FTUA 2R3FA 4XMOA 3PE2A 3OCSA 4HGSA 4XP3A 5BVFA 3LFFA 4H39A 5D41A 4LRKA 1R0PA 3MFRA 3Q5IA 5HLPA 3B2WA 3TDWA 2F7ZE 3BE2A 3ODYX 3C0GA 4HCTA 3RPRA 5JRQA 3HDMA 2UW6A 2V7AA 2Y4IB 4EC9A 2VTTA 3Q53A 3LKMA 2JIUA 2ZYBA 4FV5A 4YPDA 3E3PA 4F08A 3FMEA 2BDJA 5JZNA 4S32A 4FTKA 3R8MA 4E6CA 2XK6A 2C47A 4M67A 4CFWA 2GFSA 3A99A 5C01A 4D1SA 4F1MA 1JKLA 3SG8A 4BDGA 3BYVA 4OTDA 3ZO3A 2I0VA 4GT5A 1YXXA 4RC3A 3CJGA 2BZKB 3OFMA 4S34A 4E26A 2CHLA 1H25A 2JFLA 3UJGA 3QUEA 4EH9A 4PL5A 4FE2A 4RJ3A 4E6DA 4IM3A 1B6CB 3G51A 3KXZA 4Y46A 4M3QA 4Q9ZA 3GI3A 3I81A 3R83A 4W4XA 5KUPA 3PSBA 4ANQA 2JKOA 3EIDA 5AIRA 4D1ZA 1KE9A 3MDYA 2BTRA 4AP7A 1DAYA 3LFNA 3MIAA 3QRJA 3UYSA 2YIWA 4XV9A 4F0FA 2HWOA 3WZUA 3FEGA 4EKLA 3CY3A 2JBPA 1K3AA 4BRXA 4ITHA 4APCA 3GCUA 4AOJA 5IQAA 5IQDA 4FKWA 3P7AA 5LVPA 3QWKA 4UWBA 4YBJA 3BGZA 3TKUA 4EUUA 4M69A 1J3HA 3TUCA 4EH3A 3PVGA 3AMYA 3AD6A 4O1OA 5ANEA 5HE3A 4EWHA 1J7UA 4G5PA 5D12A 5T68A 2XK8A 4U41A 2B55A 3L8VA 4CVAA 4FEUA 3HV7A 3BPRA 4BCOA 4ENYA 3GOPA 1BL7A 1QPJA 2G1TA 3CY2A 4HYHA 1JKKA 3R7EA 2X2LA 2HOGA 2QO7A 3RALA 4O7LA 5DR2A 5AM7A 4ZMFA 3V5QA 2GCDA 1H00A 4JAJA 1YWVA 5L8KA 4ZTLA 1CSNA 3W2QA 4QMXA 4ZY6A 2PPQA 4UXLA 4BGGA 4FSMA 2PMOX 1SM2A 2QO9A 3ZLWA 4C34A 2QO2A 4EOIA 5FLFA 5BUEA 3GOKA 4GJ2A 2I0YA 4EK3A 2B9IA 1ATPE 2P33A 3NNUA 4FR4A 5AAGA 5M08A 1P5EA 3U55A 3TKHA 4NWMA 3NEWA 5HG8A 5HIBA 2GS6A 3KMWA 5EKNA 2Q0BA 3QCQA 4YJRA 5AX9A 4EQUA 5B2MA 2BDFA 3LQ5A 5AUWA 3PJ8A 3OEFX 5IH4A 1NY3A 2F7XE 2XIZA 4L43A 4RFZA 4TYJA 2YABA 5EI6A 1ZLTA 4IJ9A 1OVEA 3P0MA 2QU6A 3EWHA 4WT6A 3ELJA 3E7VA 4FSRA 3CBLA 3KULA 2XVDA 3AXWA 1YWRA 2G01A 2LAVA 4FEWA 5KMNA 3E7OA 3OHTA 3PXYA 2GHGA 2C4GA 3LMHA 5C8KA 1XH4A 2YDJA 2GHMA 5HOAA 4H3QA 2FSLX 1UU9A 4NCTA 2XK9A 2WMXA 4ZEGA 2W0JA 2ITQA 3M1SA 4BIBA 3QXOA 4I1ZA 4I4FA 5TT7A 4AW2A 3A7IA 1PXPA 5HD7A 3H3CA 4V01A 4FL2A 2C1BA 4DEAA 1U54A 3AMAA 4JR7A 2HZNA 4IVCA 4JRVA 4K8AA 3TUBA 1ZYLA 3FY0A 4AW1A 3HAMA 3LLAA 5LWNA 4IM0A 4JBOA 1K2PA 2ONLA 3DQWA 4BDJA 2EB2A 3G5DA 3NAXA 4QMWA 4QP4A 2XUUA 5AV0A 5T6KA 3RCDA 3S95A 3R7GA 4HVHA 4CV8A 4DH8A 4G5JA 2JDOA 2IZTA 2JDRA 5FP5A 1AGWA 1WVYA 3GC8A 2VWUA 4RVKA 2BZHB 3V51A 2RFDA 4FT3A 3T8OA 2YIYA 4F7SA 3SRVA 4F9AA 1Q99A 1YI4A 3IONA 4QTCA 4EK8A 3SXSA 5DE2A 4GFGA 4TY1A 4KS7A 4BIDA 4OLIA 3FYJX 5FP6A 1DM2A 5C8MA 3F66A 2IO6A 4BHZA 4Z7HA 2XCHA 3OTUA 4FTQA 4RJ6A 5TOZA 2WFYA 1EH4A 4J7BA 1BUHA 4CFUA 4PY1A 4AGCA 4ITIA 2XA4A 4M12A 1QPEA 5EYDA 2IG7A 4XBUA 4EOLA 2HW6A 2VRXA 3ZLSA 5A4EA 4QPMA 3UVPA 3POZA 3DQXA 3LFDA 3ZBFA 4IDTA 4NKAA 3V04A 4BF2A 4CFVA 4CFFA 5A54A 1Q97A 3O71A 4Q9SA 3ORNA 4FKPA 5EI2A 3KN6A 4M7IA 2PVLA 1NA7A 4YHTA 4PDSA 4KB8A 2CKQA 2B1PA 3FJQE 2JFMA 4IM2A 2BAKA 3V8WA 5HG7A 3MGYA 5GJGA 5M56A 3UVQA 3LMGA 2C5VA 1XKKA 3RHKA 5FGKA 4J99A 5ANGA 4FIFA 3KRLA 3L8XA 3QC9A 3L9MA 5D1JA 4ALWA 4CQEA 3EFWA 3V3VA 1LEWA 3BV3A 4ANSA 3DBCA 5HQ0A 3DJ7A 4IZ7A 5CZIA 2IVSA 4AFJA 4DGOA 5GZAA 4AA0A 2IW6A 3D2IA 5CQUA 3AC2A 3Q4ZA 4LFIA 1CKJA 2HY81 4LG4A 5DOSA 4L46A 3FKLA 5E1EA 3PRFA 4GT3A 5TO8A 4KSQA 3WF8A 4GVJA 4KKEA 1OL5A 4R7IA 3U51A 5BMSA 4IZAA 3UNZA 3VC4A 3MVMA 2X1NA 2VGPA 4AOIA 3GU4A 4FNWA 4U40A 4D58A 4U43A 2WU6A 1IA9A 5TF9A 4ZSGA 3MVHA 1H27A 3GT8A 3AC5A 2JKQA 3GC0A 2XNBA 3PVBA 4N70A 4ZK5A 4PPAA 3ZDIA 2UVYA 4LL5A 4G2FA 3DFCB 3P1AA 2W1DA 5CXZA 3KVWA 2YA9A 2JIVA 2JC6A 5CU6A 4DEHA 2GNIA 2A4LA 2VAGA 4USDA 1KE8A 1NVSA 2BFYA 3VF9A 3PXZA 5HTBA 3EQGA 4USEA 3IKAA 4JNWA 3R9DA 5AR8A 2FUMA 1RE8A 3VS1A 3O17A 3Q4CA 2OKRA 4CTCA 1OKYA 4HVIA 4YBKA 4FG9A 3HVCA 5DEYA 3MESA 4WG5A 5L3AA 2YISA 3BHYA 5HCYA 2R0IA 3PP0A 3UMWA 4D55A 1Z57A 3DPKA 2X8DA 2RG5A 3EHAA 3RM7A 3V8TA 1RW8A 4RQKA 1WVWA 2PVFA 4U80A 5HI2A 2X81A 3C0HA 4TPTA 4U97A 4P7EA 2XIRA 5CAOA 4MX9A 4MF1A 1WVXA 1XHAA 2PZYA 3CTHA 4LV8A 3Q32A 3E8EA 4FKSA 5IQCA 4AS0A 3DZQA 4TWOA 3PG3A 2HZIA 4IZYA 2ESMA 2OJGA 4L3LA 4EYJA 2QOQA 5HTIA 1Q4LA 3QXPA 4X6QC 4FTMA 4CV9A 4AE9A 3IQ7A 2ETMA 3LCTA 4V0GA 3VJOA 5AADA 3G6HA 3E5AA 3RCJA 2F49A 2GS2A 4QQJA 2R3MA 5JSMA 2FH9A 5IH5A 2O8YA 3F2NA 2WMQA 3FPQA 4RC2A 4RIWB 2R4BA 5CZHA 3D7TB 4BBMA 4KABA 4QP9A 3JY9A 4HPUE 2YIRA 4YJVA 3SAYA 4ACMA 4I5MA 4Z7GA 2J0MB 4EH7A 2CNVA 3F6XA 4JDIA 5DH3A 1FVVA 3CJFA 4CLJA 1ZOEA 3EQCA 5L2QA 4NTSA 5HVKA 2NRUA 2OF4A 4HZSA 4CG9A 3MVLA 3UOLA 4UZHA 3FC2A 4G9RA 3CPCA 4DH5A 2G2HA 3WE4A 3FZPA 3HMIA 3THBA 4ENXA 3LCOA 4E20A 3PIZA 2BRGA 4UN0C 5IQFA 3FLQA 4IWQA 4A9SA 4O2ZA 4EJNA 1CKIA 3HECA 3PY0A 4BWKA 4L00A 4JVGA 3OW4A 3DNDA 4C57A 2X6DA 4FYOA 3ZFYA 5HTCA 3W32A 3EFJA 3MFSA 4BIEA 5IA1A 5D7VA 5EDPA 4EOKA 5J95A 4EZ7A 3A4PA 4AW5A 5I4NA 4M0YA 3SD0A 4R7BA 4G6LA 1FBNA 4UWYA 2CMWA 3FL5A 3I0QA 2WIPA 4OTGA 1FINA 1Y57A 4L68A 1AQ1A 4IX3A 4YZ9A 1YOJA 2OZAA 4F64A 4EKKA 2CGVA 4Q2AA 4MTAA 4AUAA 3DTCA 3WF6A 2PU8A 2QOBA 2XEZA 5GHVA 5DMZA 3FI4A 3T9TA 3PG1A 2X39A 4ITJA 4M66A 1PKDA 3FY2A 4IX6A 4L52A 4UWCA 2BDWA 3DU8A 2XKCA 2W1FA 1H08A 3OXTA 4FSYA 4ZJJA 3WI6A 4IC7A 1PXJA 5M55A 3PZHA 4BTMA 5KHXA 4GIIA 5EW8A 3DJ6A 3OTVA 4GH2A 4CFXA 4YZCA 4I0SA 4JQEA 1FMKA 5LARA 4HCVA 4ASEA 4DINA 5C26A 3MH0A 3E92A 3DAJA 4M8TA 4TYEA 3FHIA 3I60A 4ANMA 3FZTA 4YJNA 4G3DA 5HU9A 5E4HA 5E8VA 4BTFA 4FGRA 2V55A 4DEDA 2JDTA 3RAKA 3QTWA 5J5TA 2ZB1A 3MIYA 3KRXA 4F70A 2QOIA 2X9FA 4MNEB 3PY1A 1J91A 3ET7A 4CT1A 2OIBA 4ACGA 3GNIB 5EHOA 2UZOA 3DLSA 4LGHA 3V6RA 3D5XA 4ANLA 2O2UA 3WIGA 4XRLA 2E9UA 2FVDA 4Z16A 3TZMA 4PWNA 3SLSA 5FEQA 3PYYA 3MY0A 2YM5A 3PXQA 4WOVA 3UOHA 5KMJA 4RJ5A 5E8SA 2VTSA 2BZJA 1KE6A 2ZM3A 1X8BA 4IVDA 3HV3A 1J7IA 4FTOA 3RGFA 2WQEA 2CGWA 3OMVA 4NJ3A 2O5KA 3BWFA 5IQEA 4AE6A 2QHMA 2ZOQA 4EC8A 4AW0A 3PJ2A 2C69A 3BZ3A 3HA6A 1W84A 2NPQA 3I7CA 5DPVA 2GHLA 4FKUA 3WILA 2JBOA 3Q96A 4MBJA 2ERKA 2ITWA 3QCSA 3I6UA 5EK7A 2PMNX 1NT2A 1BYGA 2C6DA 1ZWSA 2CSNA 3P08A 4WNMA 4ZS0A 3W18A 3A60A 2YEXA 3BYUA 4I4EA 3I79A 4QMUA 2IPXA 3ZXTA 4IVBA 4IFCA 4FTTA 4KD1A 2YZLA 3LXKA 3L8SA 2JKKA 5CYIA 4QO9A 2HZ4A 5IA3A 3R04A 4DGLC 4FSWA 5A3XA 1XH6A 3NUAA 4E5AX 3EB0A 1PMUA 3ODZX 4O0YA 5CSWA 3VS2A 4PP7A 2WQOA 3F88A 4TRLA 3HX4A 4FEQA 2PUNA 4NU1A 3GFWA 4XYFA 3G15A 1DI8A 4F7NA 2C5XA 2ZDTA 4D0XA 4EHZA 5L8LA 3DKFA 4C58A 3DBEA 3SOAA 5EW9A 1MP8A 3OCTA 1OITA 4ARKA 3K2LA 1U46A 1U59A 3RK7A 3NX8A 3TACA 3WF9A 4GMYA 4E6QA 3EQIA 3HLLA 3MS9A 4TT7A 2XH5A 3BWJA 3QA0A 4NW5A 2CDZA 3G33A 4NM0A 4XV1A 1CTPE 1W8CA 3CTJA 3Q52A 3TKIA 3QTXA 4XG3A 4BWXA 5GJFA 4XG7A 4XG9A 3OWPA 3W2RA 4CZUA 3ZM9A 2VWBA 3IGGA 1YDSE 2P0CA 4DF3A 5CENA 3IW7A 5FUTA 4JDJA 2WELA 4NUSA 4EH6A 4XP2A 4JAIA 4C4EA 3UZRA 4FGBA 4G9CA 2YAAA 4II5A 3BIZA 3GXLA 4S30A 4QMOA 2O0UA 5IQIA 4FNZA 2ZMDA 3E63A 4I23A 3CTQA 4HNFA 4BN1A 3NUUA 3IG7A 3DKOA 3MPMA 4U81A 4FL1A 3UC3A 3CKWA 1OIUA 4OTWA 3S3IA 3LVPA 3W2OA 2VN9A 3OWKA 1KOAA 4WNOA 3VHEA 4BICA 4B4LA 3TT0A 3WARA 1TVOA 4DTKA 4AZTA 1ZZ2A 2OO8X 5EM8A 5KZ0A 2B0QA 4GEOA 2JAMA 2XS0A 2FYSA 5DVRA 3HYHA 2R3PA 3QQHA 4FV9A 3GVUA 5K0XA 3NYVA 4BKYA 2PZRA 1FGKA 1Y91A 4GJ3A 3SG9A 2GMXA 1ZMWA 3SKCA 5AP6A 3QL8A 1V1KA 4OTPA 3ZBXA 4BZDA 4HCUA 1JBPE 3MW1A 1Z5MA 3EZRA 4QNAA 2GPHA 5AR3A 3TNHA 2J0IA 3KA0A 4AOTA 3BEGA 4F0GA 2DUVA 5LQFA 4YSJA 4FI1A 1UV5A 3C4EA 3VAPA 2QCSA 4XS2A 4BZNA 4PMPA 1M2QA 4N6ZA 4X21A 3CQWA 5E8WA 2NRYA 3F7WA 4MK0A 3LFCA 3TN8A 4KA3A 4J53A 4EUTA 4C3RA 2GQRA 3BE9A 2YJSA 4XP0A 4GIHA 5AR7A 3UVRA 3WF7A 3PLSA 1F5QA 3C51A 2VX0A 5DLSA 5CAUA 5HKMA 2UZVA 5CVHA 4O7TA 4QMTA 4I0TA 4X2FA 3VIDA 5AP4A 3BBWA 4N6YA 1G8AA 2X2KA 3KMUA 1KSWA 2BAQA 2W7XA 2WMRA 3LLTA 2VWXA 3DCVA 4KBKA 5FD2A 5HICA 3VF8A 5AR5A 5LMKA 3U9CA 2C3KA 2F4JA 3KKVA 3DLZA 4FT7A 3FPMA 4GV1A 4XOZA 2QI8A 2UW3A 1H0VA 3ZC6A 4YJSA 5FBNC 4EH4A 4RG0A 3R9NA 4D0WA 3UO4A 3EL7A 3SGCA 4FC0A 5G1XA 4UMRA 3EQPA 4GFOA 4PNKA 5I3RA 4BDDA 3IW6A 1PMNA 1XBCA 3PUPA 4BDIA 4KINA 3DA6A 4QYGA 3QTSA 4RIXB 2CN5A 2QR8A 3T3VA 2XNMA 3D15A 4L7FA 5DI1A 5DT4A 3LIJA 2WTKC 2FSOX 2HAKA 3FMDA 4FVPA 5CWZA 4AG8A 4YR8A 4GCJA 4YC3A 4FKLA 1MQ4A 4QMYA 5CLPA 2J4ZA 3MH2A 5EYCA 3R1SA 4YMJA 1OIRA 3NW6A 2G2FA 4Y73A 4DT9A 1UU7A 2X7OA 1IASA 3FLNC 3NUYA 5J5SA 3L9PA 3F5PA 4BCFA 1BMKA 3O50A 5EI8A 3T9IA 3OP5A 5BVDA 2WOUA 2YACA 4F99A 2Z7RA 5A14A 4P90A 3UGCA 3N4TA 4O0VA 4UALA 4PPCA 4A4LA 1FVTA 3NYXA 5HNBA 3JY0A 4OGRA 3PXKA 3GUBA 3AC3A 1UNHA 4FZ6A 2OICA 2OI4X 4M15A 5DWRA 4MVFA 3JUHA 5HVYA 1GIJA 2PMIA 4ZXTA 5FTGA 3BELA 3R02A 3SA0A 4RX5A 4IJPA 3FLWA 5IQGA 4IQ6A 3MYGA 4Y72A 3KQ7A 4EOOA 2XBAA 4QP3A 4Z3VA 4Y95A 3SVVA 1XR1A 3AD5A 3HUBA 4W4WA 4E6AA 3LFEA 5IMEA 1RDQE 5CT0A 2YM6A 2V7OA 2WTKB 3QKKA 4ACDA 2WGJA 1ZMUA 4FV4A 4CXAA 4XG2A 3A8WA 3VS7A 2C6LA 3VULA 2W5HA 2R7BA 3ZSGA 2VO6A 4GKIA 3CE3A 4O27B 3SC1A 3UG1A 3R1QA 3CLYA 3V5LA 4ANBA 3MA3A 2XKFA 2VU3A 3MWUA 3LXNA 4U7ZA 4YGAA 3FL4A 4RQVA 1Q5KA 3C4XA 3HMNA 1JVPP 3OF0A 4R78A 2R3KA 4G3EA 2VWWA 4G1WA 4O81A 1Z9XA 2YM3A 4WG4A 3HMPA 2E9PA 4C4FA 5JQ5A 4F7LA 2Z8CA 4H36A 4O0XA 3F9NA 3VUHA 3L8PA 3VRYA 1PMVA 2VO7A 4FVQA 5AP0A 3MA6A 4FKVA 5KKRC 5DG5A 5ANKA 5HVJA 4D5KA 2JIIA 3HZTA 4X0MA 1XH9A 3VW6A 2YLEA 3N4UA 5EQEA 3WOWA 4DITA 4EORA 2C6OA 4MXXA 4BC6A 5CALA 4BB4A 4HOKA 3BHVA 5LWMA 3B8RA 4OBOA 2REIA 3RNYA 3FMMA 4XH6A 4QTBA 2I1MA 3FMHA 3HRFA 1GJOA 2ITPA 3FLYA 4JLCA 4F09A 2RF9A 1H1QA 5JFXA 2QG7A 2JDVA 5JQ8A 2B9JA 4RVLA 3CCNA 4LQMA 4MAOA 1XH8A 5I9UA 4ZTRA 1XBAA 1FVRA 4CLIA 4WUAA 3VBYA 4QMNA 2BRHA 1WCCA 2ETRA 4BBFA 4X2KA 1OUKA 4CGAA 3QQJA 3R63A 3OVVA 2VTHA 1F0QA 5EM5A 3QQFA 4NT4A 4E4LA 2P2IA 3F82A 4QYEA 2ZV7A 3LM0A 3PSCA 5E8XA 1WBWA 4C33A 4A9RA 4O86A 2QOFA 1H1WA 1DAWA 4V04A 1PMEA 1KOBA 2ACXA 3EYGA 4FMQA 2W5BA 4NIFB 3TV4A 4CSVA 3S00A 1Q8TA 4FTRA 4EH2A 4TWPA 5AEPA 3FMJA 1OI9A 2GSFA 5F20A 2I0EA 2ZDUA 1OPJA 3I5ZA 3QU0A 3QUDA 5EG3A 3VO3A 5EQYA 4KKGA 4YHJA 2IVTA 2XKDA 5EW3A 1Q8UA 3H9RA 5FBOA 3C5IA 5BVNA 3DOGA 3E87A 4C02A 4J1RA 4K11A 4NSTA 3QF9A 3IW8A 1S9IA 5J7HA 4JR3A 1NVRA 4GRBA 3UTOA 2WAJA 4IC8A 4F9CA 2V0DA 1A9UA 4XV2A 3HV4A 5IUGA 3ZSHA 3DKGA 2O64A 4PV0A 3KN5A 1PXMA 3EN6A 4FIHA 2GS7A 2J5EA 3KF7A 5D9HA 3EMGA 1OM1A 4G3FA 3OWLA 5TE0A 4BCNA 2XF0A 4IAYA 3LJ1A 3EN5A 4B8MA 4P5QA 4ZZNA 1G5SA 4GVAA 5EDRA 5DT3A 4ERKA 3ZFXA 1VYWA 1P4FA 3JXWA 3CC6A 1VJYA 2VO3A 3V5JA 2BILB 2G2IA 5BQ0A 4UBAA 4X3JA 3MV5A 4I6QA 3IECA 4ZJVA 3QLGA 4AACA 4GT4A 2HCKA 5AR2A 4EQMA 4Y8DA 3EH9A 2W06A 3TIYA 2VV9A 1GY3A 2WHBA 1CDKA 4X2GA 1DI9A 1ZOGA 2CLXA 5CY3A 4O7WA 4RA4A 1DS5A 3VNTA 1KE7A 5KZIA 2RFSA 5BYLA 3NS9A 2VTNA 3FZ1A 1REJA 2OJ9A 3HV5A 4O96A 5H9BA 5HBEA 5IZFA 4TL0A 4O22A 3O8UA 3QAME 4Y5HA 3DZOA 3P78A 1H1RA 3GQIA 2VWZA 4IB5A 2X2MA 4FA2A 4O82A 3BI6A 2R3HA 3Q9XA 4AT3A 1Q8WA 4YZNA 4NL0A 2HIWA 3B2TA 2R3JA 2WD1A 3Q2MA 4WBOA 3ZMMA 1QL6A 1R0EA 3U6JA 4RX8A 3ETAA 5F1ZA 3NUSA 4AU8A 4KIOA 2F7EE 3ORXA 2WQBA 1VR2A 5T3QA 3H9FA 5LVOA 4CQGA 3E8CA 4E4XA 5HG5A 3QZGA 5FXRA 4JX7A 4PPBA 1TQPA 3N9XA 3VS4A 3ZLYA 1JSVA 5BYYA 4O7NA 4FZ7A 2VD5A 4UMPA 3KXXA 2CKOA 3NR9A 2XK7A 4KBCA 1VEBA 2J9MA 5ITAA 3S1HA 4R6VA 4K1BA 5AR4A 4O0UA 3WZEA 3ORLA 3FSKA 4PRJA 4BI2A 5H2UA 4IHPA 1Y8YA 4FT0A 3R7VA 5AUUA 1STCE 3FQHA 1UWHA 3FAAA 4LMNA 2ITOA 3MPAA 3R7UA 3RHXA 2OXXA 2W4OA 3P9JA 3CD3A 5CTPA 4DHFA 3ZRKA 4IVAA 3NYNA 1SVHA 4IXPA 5I9XA 3C1XA 4C37A 4C8BA 1XO2B 4QMPA 5AV2A 5LCJA 3UZTA 5AA9A 4BTKA 4RIYB 5FDPA 3BX5A 4X3FA 4X2JA 2G9XA 2WTVA 2XKEA 5DRBA 3BV2A 4NCTC 1JSUA 3TNQB 4GG7A 2PZIA 4CCBA 3CGFA 3DS6A 3QQGA 2EXMA 2UW4A 1SYKA 4K77A 2X4FA 4QMLA 5FEDA 5HO7A 3UIXA 5L4QA 3G6GA 4FIJA 1WFCA 3UNKA 4IFGA 1YDRE 3NCZA 2DQ7X 3PWYA 5J1VA 3V5PA 4AF3A 2UW5A 4YTCA 4W9WA 5CEOA 4FIGA 4L3JA 4PX6A 4RA5A 4TNDA 4C7TA 1ZY5A 2QOLA 4PTCA 5AUVA 1M17A 4C2VA 3GENA 3DT1A 5E8UA 5F9EA 3P5KA 4F9BA 4HZRA 1JPAA 5M4IA 2IVUA 2B54A 2O63A 2ONLC 2I6LA 2VO0A 2IWIA 3D5VA 1XWSA 4NK9A 2BZIB 3ACJA 4LYNA 2QKRA 5HIDA 3QKMA 4E7WA 5JKGA 3R9OA 3MVJA 4WRSA 4G6OA 1UU3A 4DFLA 1APME 4I24A 1FMOE 5HO6A 5EYKA 4FTIA 3RZFA 2W1IA 3E93A 3QRKA 5H8GA 2PMLX 1LUFA 4ZAUA 1ZAOA 4FV7A 4I6FA 5CNNA 3D2KA 3OUNB 5EH0A 3ZXZA 5L2WA 4BDCA 4FEVA 1OL7A 5AJQA 2EVAA 1R3CA 5IKWA 2XRWA 2RGPA 5M4CA 2Y7JA 1XH7A 3ZDUA 3RBWA 4YJUA 5C03A 3LFBA 3WE8A 2OXDA 2FGIA 3OT8A 3OY3A 1S9JA 5JFWA 4RSSA 4RZVA 5EQPA 3UPXA 2IJMA 4KS8A 4YSMA 4O7YA 4KAOA 3IPHA 5IEVA 4YLJA 5IUIA 3S0OA 3QHRA 4G6NA 3VJNA 3NNVA 4U45A 2XK4A 3HA8A 4YC8A 4MD8E 2UUEA 4H05A 4JX3A 4D28A 4RIWA 2XNPA 2OIDA 3D7TA 1U4DA 2WTDA 1YWNA 3Q4TA 5KBRA 2C5NA 1XJDA 3O96A 4A9YA 2BTSA 4EOSA 4MXZA 3NWWA 1Q8YA 3QZIA 4HVSA 1OECA 3DV3A 4APPA 2YJRA 2V22A 4PF4A 4RX7A 3PVUA 3QTIA 4H58A 2BR1A 3PJ1A 3AC1A 4LOQA 4BCGA 4EL9A 3NIEA 4ZY4A 2B9HA 1YXVA 3AT4A 3TXOA 1JWHA 4ALUA 2CGXA 5C4KA 4ZTHA 3SXFA 2X0GA 4MEDA 5IH6A 3UO6A 5DFPA 4QQTA 1OUYA 2WTJA 4S31A 5AP2A 2FB8A 2OF2A 3VBQA 2Y6OA 1PXLA 1ZARA 3HRBA 3ZS5A 4F63A 3R9HA 5LJJA 5CI6A 3NIZA 2P55A 3UZPA 1NXKA 5CS6A 4CCUA 4E4NA 3RM6A 5A4QA 4RWIA 5E90A 3OWJA 4J71A 3IK3A 2OJJA 3F5UA 5AUYA 4FOBA 1OL6A 2IW9A 4YTFA 3KXGA 4MXOA 2BROA 2VNWA 3P4KA 4DCAA 3ALOA 1O6YA 3M2WA 4MBLA 1YQJA 4PMMA 3C13A 5J9YA 3ZEPA 2ZB0A 4R8QA 3I5NA 5HCXA 4JQ7A 3Q6UA 1OKWA 3VBVA 4D4VA 4B7TA 4GK4A 4O21A 5CI7A 3NGAA 3T3UA 5BPYA 2UZUE 2YIXA 4BDBA 2Y9QA 1CMKE 3IOKA 3MY1A 3PIYA 3W8QA 2OSCA 2JDSA 4MD7E 3H30A 3ITZA 3G90X 2VWVA 3NYOA 3R1NA 4QP1A 2WU7A 1FQ1B 3DKCA 3NUPA 4GW8A 2ZV8A 4OBQA 4K33A 3HL7A 4QMSA 2OJFE 2EUFB 4TYIA 1M2RA 4WNKA 5CU2A 3ZO2A 3FI3A 3JVSA 2ETKA 4PMSA 4LMUA 2VTIA 2R7IA 2XYUA 3O51A 3TV6A 3ORKA 5AM6A 4BDHA 1OKVA 4O83A 3ZZWA 3F3UA 3QWJA 3OEZA 1FGIA 4L6QA 3QZFA 5C8NA 2ITNA 4MNEA 5HNGA 2HYYA 4BVUA 3WZJA 5M4FA 4PP9A 4W4VA 3BU5A 4DN5A 3QFVA 3ZC5A 5CF5A 5CEKA 3QRIA 1P2AA 4QQCA 1MQBA 4YJTA 4AAAA 5C1QB 4FT9A 3VUMA 2QLUA 3FZOA 1XBBA 3LFAA 4IADA 3RWPA 3VVHA 3ZFMA 4DEBA 5LOHA 4DLIA 3R8VA 4FVRA 3MH1A 3KF4A 2YWVA 3UG2A 4AXAA 3QBNA 1GZ8A 2C5YA 4NM7A 4O38A 4U3ZA 2PY3A 4F9YA 3COIA 2WMBA 1LPUA 3QRUA 4FEXA 4D4SA 3V5WA 1UA2A 2C1AA 2X8EA 4IDVA 5FXSA 1SNUA 5EHLA 3R7IA 3BGPA 4G3CA 3UMXA 4IX5A 4GUEA 4NFMA 4JIAA 2GU8A 4CMTA 1GIIA 2QG5A 5L6OA 4EJ7A 1J1BA 3ANQA 4UXQA 3CD8A 2IVVA 4WKQA 5M57A 4GSBA 4I21A 5D7AA 2QR7A 5E7RA 1QPDA 3SOCA 3W16A 4KIKB 3FC1X 3QYZA 3UQCA 1IA8A 2E9VA 4EYMA 2H6DA 4TYHB 5K5NA 5CEQA 3PPZA 4FSNA 3NUXA 5HBHA 2XMYA 4TWCA 3ZUVA 4FKGA 4DCEA 4F6SA 3ORZA 4XG8A 5DBXA 4C4GA 4E1ZA 5IISA 1OPLA 2JKMA 4W4YA 5A4LA 4B6LA 3DDQA 1LR4A 3DDPA 1YW2A 2CCHA 4DFUA 2Z7SA 4DFZE 4XV3A 4FSTA 4PTEA 3RTPA 3AGLA 1YOMA 3R28A 1G3NA 3WYYA 3F3VA 2HZ0A 2GQGA 3OZ6A 4IX4A 3A2CA 2UZWE 5JGAA 4OTFA 4W8EA 4BL1A 3TZ8A 1H8FA 2FA2A 3BRBA 1R78A 3D83A 4HGEA 3R01A 4MHAA 4BGQA 3MB6A 3QCYA 5HNIX 5CAQA 4RC4A 2JEDA 5CEPA 3QD3A 3R2BA 4ZZOA 1O6KA 4RRVA 5M09A 3G9LX 5HCZA 3ANRA 1UU8A 5CF8A 5J9LA 3OCGA 4JI9A 5IMXA 3IOPA 5KE0A 2BAJA 3C4WA 4CT2A 1ZYDA 3KB7A 5JN2A 3FZRA 1B39A 4QTEA 4A07A 2C0TA 3BHHA 2XZSA 3ALNA 3O8PA 5JGDA 5E8YA 3V8SA 3N4VA 3H10A 2OGVA 3NW7A 3W33A 3OS3A 4I5CA 1OB3A 3QALE 4IW0A 2YFXA 4WRGA 1PXKA 1BI8A 4MCVA 3ZHPC 3HNGA 2VTRA 4NZWB 2A1AB 4I22A 4DGNA 4FSZA 3OG7A 2XIYA 2QOOA 2PYWA 4BHNA 3SXRA 5E91A 4KRDA 3TIZA 2YM7A 4ID7A 3FXXA 5AP5A 4L9IA 2C0IA 3WBLA 2ZM1A 3D94A 4TWNA 3II5A 4CTBA 4LV5A 2R3IA 2BALA 3K3IA 3H9OA 2QKWB 5JK3A 1Q62A 1W98A 3VUKA 4FTJA 4UZDA 4DH7A 3ORTA 4DEEA 3A62A 4C4IA 4O2PA 4J52A 2XJ1A 2NO3A 3ZZEA 3TNPC 3QTRA 3O23A 3ATTA 1OZ1A 3VS0A 5EM6A 4LOOA 3CS9A 5AAFA 5DHJA 2XM9A 5CSPA 4QPSA 3OXIA 3OROA 4HJOA 2PSQA 4QP6A 4UB7A 3ZUTA 2AC3A 4XCUA 4QYYA 4FSQA 2GTNA 1URWA 2UVZA 5HLNA 3TJDA 3JR1A 4ORKA 3PTGA 3AT3A 2OFUA 2YDKA 4QP7A 2Z2WA 4D1XA 2XB7A 4O84A 1OIQA 1R39A 4I92A 4LRMA 4A7CA 2UZLA 2ITUA 3IW4A 4QYFA 4CRLA 4N0SA 5JFVA 3D5UA 4RVMA 5M4UA 4P2KA 3G9NA 1H4LA 4RT7A 4FKRA 4M97A 4YC6A 3WF5A 4ZLZA 1YOLA 3VWAA 3NNWA 5KMMA 3LM5A 3NDMA 4U44A 5IU2A 3UE4A 3BHUA 3FYKX 3K54A 3K3JA 3PP1A 4J95A 4WD5A 3EKNA 4RMZA 5F94A 3EN7A 5E92A 4ALVA 1OGUA 1WZYA 3LZBA 4FKTA 4KWPA 4M0ZA 5BVEA 4BYJA 1PY5A 2X7FA 1E1VA 3PA4A 3M11A 1M7QA 4E73A 3E3BX 4J97A 4RIXA 1H1PA 5F4NA 3FQSA 3GCPA 4GUBA 1QMZA 2QC6A 3BQRA 5M06A 3K5VA 4O0SA 3BU3A 4OT6A 4LL0A 2YDIA 2ITZA 4MNFA 1NW1A 3AC4A 4GL9A 2R3GA 1FOTA 3GGFA 4FK3A 3VS5A 4B99A 4A9UA 3HDNA 2H96A 2F57A 2Y4PA 3EN4A 3O8TA 4IACA 5EFQA 4ACHA 2PE2A 2PULA 4RLLA 2W4KA 5HBJA 3EFKA 5CNOA 5J1WA 1K9AA 2A2AA 3KRWA 5IEXA 4IAFA 3NNXA 1YXSA 1M7NA 4DEGA 4BCIA 4CMOA 4H1JA 4MKCA 2VWIA 5GNKA 3UP2A 4EHGA 3QRTA 4RJ7A 3FLSA 3A4OX 4L42A 1JQHA 5JFSA 3E62A 5AUTA 4R5YA 5HZNA 3LJ0A 5LVNA 4FV8A 1MRYA 1WAKA 2W1CA 2E2BA 4BI1A 4DG0E 4XOYA 5HU3A 3BCEA 2CLQA 4TYGA 1Q41A 4AZSA 2PUPA 5L6WL 5IA2A 3CQEA 5JH6A 3AMBA 1Q61A 4HW7A 2AC5A 1ERKA 5KHWA 2W9ZB 4BY9E 3AQVA 4I6BA 4U9AA 3QD2B 2RIOA 5ETCA 2PUIA 2R3RA 3RMFA 1BI7A 5CANA 3CQUA 5A4TA 2Z60A 4E4MA 4CKIA 2QONA 3WYXA 4BI0A 2WEIA 2WMUA 3UQGA 3A7JA 5TKDA 4AA5A 4D2VA 3FBVA 5FEEA 5G6VA 5B7VA 3TNWA 3COKA 3MJ2A 2J7TA 3F3TA 3QD4A 4FF8A 2UW8A 4LUDA 5B0XA 2XNOA 5DIAA 4LOPA 1V0OA 5CSXA 5AP3A 3ZLXA 5BUIA 5KMKA 4QQ5A 1T46A 4AN9A 5K5XA 2WOTA 1IRKA 3Q9YA 2X8IA 4JXFA 4KBAA 3UNJA 4J96A 5DN3A 2BHHA 1UWJA 2RSVA 2W4JA 1I44A 1ZYSA 2J51A 4OW8A 3VS3A 3AT2A 3LOKA 4ASDA 4JG8A 5EYMA 3KRRA 4CYIA 5HESA 5D10A 5H3QA 4PL4A 3LAUA 1PJKA 5JRSA 3WZDA 5J79A 3TM0A 4AQCA 4RFYA 2PK9A 4JG6A 3F69A 1ZOHA 2WIHA 3HRCA 1M14A 5LMKC 3DTWA 4QTAA 4U0IA 4BCKA 4G34A 4G31A 3NVKI 5HIEA 3GU5A 4FZAB 3EQFA 4FOCA 3UOJA 1WMKA 2WMSA 3Q04A 4LRJA 3CR0A 5FDXA 3TWJA 1SZMA 3VBXA 4AN3A 1U5QA 5BX0A 1E1XA 4Z9LA 2BMCA 4EOJA 3ZYAA 5LVMA 5ANIA 2NNWB 3FMLA 1HCLA 2Y6MA 1ND4A 3LQ3A 3MB7A 2VGOA 3SX9A 2A27A 4DEIA 3EL8A 4BCPA 3DXNA 3QTUA 1ZYJA 3L9NA 3QTQA 5M44A 2OW3A 3JVRA 4CG8A 3WIKA 2LGCA 3DGKA 1H24A 3OUKA 5ETIA 3EKKA 4O7VA 4K6ZA 3VUIA 3C4FA 3IDBA 2WB8A 4NIFA 3TZ7A 2YITA 4ZTQA 2IZUA 3BYMA 3RK5A 3LXLA 4K0YA 5H8EA 3U9NA 3GCVA 1IAHA 2RL5A 2C3JA 3TCPA 4D2SA 2C30A 3DB8A 5DA3A 3DXPA 3UC4A 2C0OA 4MF0A 4R3PA 3ATSA 3VUDA 2Q0NA 2Y4IC 5LMAA 4G3GA 4XBRA 3TJCA 3OCBA 4EH5A 3KL8A 4NM5A 5J87A 4JJRA 3MFTA 3SW7A 1F3MC 3GC9A 3TL8A 3F3ZA 5HLWA 4G17A 3DBFA 4DGGA 5ACKA 3UYTA 5JT2A 2R3OA 4YLKA 4YO4A 3IW5A 4EONA 3IDCA 3LE6A 3KK9A 3CXWA 2BRMA 3K5UA 4MH7A 4NH1A 4WA9A 4EI4A 5EM7A 1OKZA 3AGMA 3ROYA 3UBDA 1OBGA 4U79A 3O0GA 4JT3A 4KIQA 1G8SA 3PA3A 3VHKA 4FV1A 4XJ0A 1U5RA 2X7GA 4ZSEA 1RQQA 3L9LA 5ICPA 4EOMA 3SHEA 5JEBA 3F2RA 5HX8A 3U6HA 2F2CB 3ACKA 2BHEA 2ZMCA 3FUPA 5EOLA 2YLFA 1O6LA 1WBOA 3DY7A 4N4SA 3QD0A 3LFQA 5TR6A 4LGGA 3ZOSA 4C3PA 4F7JA 3OXZA 5BUJA 4DE4A 2C6MA 3U87A 3E8NA 2WO6A 2GNGA 3GP0A 5KKRB 3TUDA 3HP2A 1A48A 2BPMA 4D5HA 4WSYA 2PUUA 3PLAE 4ANNA 4YZDA 4A06A 2HXLA 4CD0A 5CT7A 2C6TA 2QVSE 2VNYA 3PA5A 2ZVAA 4EBVA 4JG7A 4L8MA 4NKSA 2IZRA 5IQBA 2YERA 4L53A 3COHA 4YLLA 4IWPA 5ETAA 4BKZA 3QGYA 4EH8A 3RPVA 3TI1A 4XRJA 3W10A 3KREA 2Y0AA 1WBVA 4S2ZA 4BCHA 3UPZA 2ITYA 1PHKA 5HD4A 3EQRA 2X4ZA 4D2TA 1WBTA 4I5HA 5KMOA 4O7SA 4AZVA 2PE1A 4I41A 3Q9WA 4D2WA 3AC8A 3UOKA 3PVWA 5E8ZA 4DTAA 3ULIA 1J1CA 5KMLA 2JAVA 2XYNA 4FTNA 3H0YA 4L7SA 4OTHA 2W1ZA 2GNJA 5HHWA 5I3OA 2VX3A 4F6WA 3DK7A 3LW0A 1WBPA 4MYGA 1YXTA 3KXNA 4V05A 1XH5A 3PE1A 3SQQA 4YJOA 3C9WA 1L8TA 3A8XA 1JOWB 2OK1A 3W2SA 4ZIMA 3GU8A 4FV3A 4ZMEA 1GZNA 1W82A 2PE0A 5K4JA 2ERZE 2HWPA 4FZDB 4P5ZA 4IEBA 2PZPA 4UMTA 4ZSAA 5J7BA 4YUQA 1ZMVA 2O65A 4ZSJA 3U54A 4TTHB 2VWYA 4QNYA 2J0JA 3PSDA 3R7YA 1PXIA 2R0UA 4TXCA 1PYEA 2WMWA 3BEAA 4OT5A 4O91A 1JNKA 2BIYA 3ZM4A 2WZJA 4MWIA 3TV7A 4FV0A 1REKA 2XCKA 3PY3A 2RFEA 4H1MA 3PJ3A 4IAIA 5GJDA 1M52A 4RIYA 5KX8A 2KULA 3BKBA 4L44A 4YURA 2VTJA 5CSHA 4TNBA 5CASA 3QUPA 2QODA 3Q9ZA 4I6HA 4ZS4A 4JRNA 4XEYA 4QMVA 5HE2A 3S2PA 2Z02A 4DG2E 5GINE 2B9FA 1KV2A 3R8ZA 3RVGA 3TG1A 4QP2A 3C4CA 5KO1A 3OT3A 2PVMA 3P79A 4LM5A 4YZMA 4AN2A 4D9TA 4QMZA 1A06A 5LCKA 3DAEA 3ULZA 2R64A 2XNNA 4M68A 4C62A 5CU0A 2PVNA 4FYNA 5AP1A 3FKOA 3DK6A 4W8DA 3RJCA 3LFSA 4ZTNA 2CKEA 3A61A 4F4PA 5J8IA 2BUJA 4HGTA 1BL6A 3MI9A 1PYXA 2EXEA 3GU6A 4R1YA 5GZ8A 3NLBA 4QTDA 5B2KA 4C61A 5FM2A 3PDTA 4FV2A 3PZEA 3HUCA 4ZY5A 5IDPA 1YHWA 2B7AA 4YNOA 1W7HA 4M13A 3Q4UA 2R3LA 3W55A 2PVHA 3ORMA 3JS2A 4Y85A 3HEGA 2CGUA 4RJ4A 2XP2A 3WZKA 2QQ7A 4NYEA 3DK3A 2E9OA 1RJBA 4IWOA 4ANOA 2VTQA 2YZAA 1H01A 3HP5A 4FX3A 5FM3A 3TTIA 4BTJA 4HNIA 3W2CA 2C3IB 2IN6A 2UZDA 1J7LA 3GCQA 2GNHA 2BRBA 4LI5A 4M69B 2YHVA 4BKJA 3R8PA 3Q6WA 2CNQA 2XNEA 3FQEA 2PHKA 4YTIA 2YCRA 5CU4A 3ZH8A 2HW7A 1OL2A 3RPYA 5A46A 4Y5QA 4HYSA 2Z7LA 3D4QA 2QOHA 1XQZA 4QD6A 5JGBA 3KMMA 3DFAA 3E88A 2OG8A 5AV1A 3SW4A 2C6IA 4DFXE 2UW9A 4FL3A 5K0KA 2UZBA 3BYSA 3E8DA 4J8NA 5FRIA 4Q5EA 4F6UA 4CEGA 4O6LA 4MWHA 3KGAA 3BLHA 5HEZA 2J5FA 3MN3A 3OC1A 3HMMA 3IGOA 5A4CA 2VX1A 3F3WA 3FHRA 2XRUA 3NPCA 4OTQA 1V0BA 3KXHA 2EXCX 1O9UA 3CIKA 2WPAA 1P14A 2XIKA 3EN9A 3KY2A 4P4CA 2OXYA 3NMUF 4H3BA 2W1EA 4FIIA 4GYIA 3LCKA 3BHTA 4JBVA 3QZHA 3UO5A 2ZV9A 4A9TA 3UIBA 4C2WA 4JDKA 4MXYA 3KCKA 4RJ8A 4ZSLA 1KE5A 3BBTB 2W96B 4B9DA 2C68A 2GNLA 4E3CA 4DA5A 1QPCA 2CN8A 3BQCA 3ZRLA 3KULB 2YIQA 2H8HA 3ID6C 1SVEA 3GCSA 2EB3A 3QQLA 1IEPA 4UYAA 4YHFA 1UKHA 2B52A 4AT4A 1W0XC 4BR3A 3DBDA 1L3RE 2QNJA 2XJ0A 5CQWA 4EHEA 3CEKA 3ORPA 4UV0A 4X3FC 3G0FA 3E64A 3QKLA 3KXMA 2WKMA 1U54B 2XEYA 3NCGA 3OOMA 4DGMA 5IPJA 3QQUA 4RWLA 4JOAA 4R7HA 4DBNA 3GEQA 3DNEA 4C3FA 1IR3A 3OD6X 4FT5A 4NTTA 3U4UA 4DLJA 2UW0A 2W1GA 4BYIA 4HYUA 3RAWA 3RINA 1V0PA 4CZTA 3HMOA 4D4RA 3TDVA 2FSMX 2QOKA 4YJQA 2XM8A 3NVMB 2CJMA 1PRYA 4GKHA 4I0RA 5IF1A 4YU2A 4MXCA 3FLZA 4FG8A 4PQNA 1YI6A 3OY1A 4MQ2A 3FKNA 4BZOA 5L2SA 2QURA 4QOXA 3SRVB 2UVXA 5AAEA 4JBQA 3SV0A 4X2NA 3R00A 2OIQA 3C0IA 4EOQA 2UZTA 1ZZLA 3KFAA 1URCA 5FQDC 4IAAA 4XG4A 3TTJA 1YVJA 4ZOGA 4X3FB 4AA4A 4FODA 2HK5A 4DC2A 4DG3E 4OTRA 2PVRA 1GZOA 5CSVA 4F65A 1YRPA 2VUWA 4FKJA 4QMMA 4N57A 4IAZA 4O0WA 5IUHA 3HAVA 4C38A 2YN8A 2QOCA 3ERKA 3CPBA 5BVWA 4BBEA 2ITVA 3EZVA 5C9CA 3LMIA 3AG9A 4IIRA 2IZSA 3IO7A 3G2FA 3PXRA 3R71A 4PL3A 4QRCA 4AGWA 4EOPA 2QU5A 4Z55A 2VTAA 3ZSIA 5AV4A 4D9UA 3MPTA 2X9EA 4NFNA 1BX6A 4FUXA 1H28A 3SDJA 3MH3A 5GIPE 2W99B 4A4OA 3ZEWA 4AGUA 1T45A 2PVJA 3QQKA 3ZO1A 2WTCA 4XLIA 3HKOA 2GNFA 4RBLA 2BKKA 2R5TA 3FSFA 4E5BA 4KIKA 4ZLYA 1PW2A 5J9ZA 3PJCA 3NSZA 4I3ZA 4TYHA 3CSVA 3ENHA 3ZO4A 3A7HA 4EK4A 5I9WA 2PZ5A 4IB0A 2A0CX 4IWDA 4XLVA 5AUXA 5BMMA 2XJ2A 4R77A 1ZYCA 3P23A 4H3PA 3EQHA 2FSTX 3EJ1A 3R8LA 4EEVA 4RZWA 4M84A 1HCKA 3MSSA 5AUZA 5DGZA 3RWQA 3V6SA 2GQSA 2OBJA 1OL1A 3EQBA 4RIOA 5ACBC 3QLFA 3RI1A 1JKTA 4FSUA 2QLQA 1M2PA 2Q83A 5A9UA 4UEUA 1Q8ZA 1HOWA 1Y8GA 1CM8A 4YTHA 3DB6A 4ZTMA 3W2PA 1WBSA 5I9YA 3R9RA 3ZU7A 4IAKA 4C36A 3ROCA 4XNEA 4BDKA 1ZRZA 2NP8A 2RKUA 3QX4A 4U42A 3FZSA 2CKPA 2WQNA 1W83A 4IMYA 4KKHA 3KVXA 5HORA 2VTMA 3C4ZA 1B38A 2VZ6A 1P4OA 4Y83A 4O7RA 4K2RA 5CEIA 2AYPA 4MBIA 4U8ZA 4EK5A 3RAHA 5E8TA 1JSTA 4DFYA 1IAJA 1OPKA 4QYHA 5I9VA 4ZZMA 2YCQA 4XG6A 4GG5A 4F1OA 3PRIA 4AFEA 2ZJWA 3JYAA 4ZTSA 3D0EA 2OH4A 4RVTA 5K4IA 4CNHA 2J0KA 4AZFA 3RPOA 4TKSA 4TZRA 3W8LA 1BKXA 2OJIA 2JLDA 1Y6AA 4DBXA 2YAKA 4KIPA 5EDQA 3LQ8A 3PIXA 3P86A 1MUOA 4R3CA 2J0LA 5DR9A 2QD9A 5BNJA 5IA0A 3QTZA 4EK6A 3PXFA 3R1YA 3U6IA 2ITXA 4L67A 3FE3A 2EU9A 4O1PA 4I20A 5LXMA 3P7CA 3DXQA 3A7GA 4C35A 4BDAA 3UQFA 4FTAA 2EWAA 3PPJA 4ERWA 2C6EA 4O0RA 5IG1A 1UNGA 1SVGA 2WXVA 2OU7A 3MY5A 3NRMA 4HVGA 2HENA 3OOGA 5ANJA 4FNYA 2BIKB 2W1HA 4S33A 4ASXA 4AZWA 4QMQA 2HXQA 1PKGA 2XNGA 4UMQA 3R73A 4F9WA 3VUTA 2W17A 4V0GB 2PVYA 2X6EA 3GFEA 4U3YA 3MFUA 4NW6A 4PNIA 4X7QA 5EKOA 5FXQA 4C59A 5HX6A 1MRVA 2O3PA 5IA5A 2GTMA 1PXNA 2WEVA 1YXUA 3M42A 5AMNA 3EOCA 2ZV2A 5I5ZA 3G0EA 2WNTA 3R7OA 1E9HA 3V01A 2V62A 3UDBA 4FG7A 3VRZA 4UMUA 1LP4A 2YCSA 2YWPA 4CKJA 3RKBA 4CKRA 3KCFA 4Q5HA 4CFNA 3GB2A 4EZ3A 3R22A 3R0TA 2BCJA 3IDPA 4L45A 1KWPA 2C6KA 3F2AA 4D2RA 1IG1A 4M14A 3VBTA 4UYNA 4CZYB 4IBMA 1SMHA 4FKQA 4FV6A 5E9EA 3VUGA 2W05A 3GU7A 3O2MA 3EQDA 1YHVA 3KU2A 4DAWA 5CEMA 4USFA 5IEYA 4FUYA 2PVKA
chains in the Genus database with same CATH superfamily
3NAYA 3F7ZA 1UVRA 2I40A 4DFNA 4DH3A 5CF6A 4KUJA 1GNGA 3IS5A 3NW5A 4IE9A 1XMMA 5BVKA 3FXWA 2P3GX 3QC4A 3V5TA 4BGHA 5E1SA 3KC3A 1W2DA 4TW9A 5H8BA 1JKSA 3H4JA 1NVQA 1YKRA 2HY0A 2B4SB 3NZ0A 5AWMA 2F9GA 3R6XA 4ACCA 4BDEA 4EQCA 1H07A 5DRDA 5HGIA 2F2UA 3U8WA 2J50A 3LCSA 4JIKA 4RX9A 4OAUC 1KUTA 3R30A 2OZAB 1GOLA 5IQHA 5I0BA 5A6OA 5JMSA 3UP7A 1YHSA 2BVAA 4ONAA 5M51A 4J98A 2G15A 3S4QA 3FI8A 3HV6A 5ANOA 4FTCA 3VBWA 2WMTA 4CMUA 3PWDA 3JPVA 3QGWA 4EBWA 4QDEA 4FK6A 3LXPA 3TYKA 3C5UA 4G16A 1PXOA 3FXZA 4LGDA 4PDOA 3L1SA 4RGJA 3Q5ZA 5KCVA 4AZEA 1TQMA 3N51A 4R5SA 4KRCA 2UZEA 3ORIA 2J90A 5FTQA 2WTIA 4AWIA 2JGZA 4R1VA 1JLUE 2IW8A 1TKIA 4IB1A 4BCQA 4ZJIA 3LJ2A 3QX2A 3VN9A 4TN6A 4OAVB 4WG3A 4AGDA 4U6RA 5FWKK 3GQLA 3UIUA 2PTKA 4BFMA 4YJPA 2P4IA 2R3NA 4UY9A 4DTBA 3I7BA 5FTOA 4L3PA 3TEIA 3I1AA 5IDNA 4BWPA 3BLQA 5CAVA 3MBLA 4HYIA 5AA8A 3H0ZA 1QCFA 3CP9A 4I94A 4X6RA 4FZFB 3REPA 3GC7A 5C4LA 2H34A 2ZAZA 5AIKA 5L2TA 2AUHA 3UODA 4DFBA 2OWBA 4BJJA 3BYOA 4GFMA 3CKXA 4R3RA 4PMTA 4WSQA 4WUNA 4C0TA 3D7ZA 2GDOA 4O6EA 4RPVA 4HVDA 5JZJA 2OH0E 2Z7QA 3D9VA 4OUCA 3W1FA 2OLCA 2R9SA 2DYLA 4BCJA 3RK9A 1GIHA 1Q3DA 2BFXA 3DJ5A 3PFQA 4IZ5A 5CXHA 4YP8A 3P7BA 4FIEA 5CVGA 4BDFA 2RG6A 4WNPA 4C4HA 3BLRA 5B2LA 5KNJA 4MD9E 1OIYA 3C7QA 3ENMA 3AOXA 4QP8A 4JL9A 5ANDA 1UKIA 3EFLA 2GFCA 2H9VA 1I09A 2WTWA 4JS8A 4NM3A 4PDPA 3I6WA 4OBPA 3OW3A 5L8JA 1H1SA 3ZUUA 4DT8A 1VYZA 5AV3A 3OBGA 3KEXA 2JITA 2SRCA 5BV3A 4AX8A 2YCFA 4CYJA 5EOBA 5ETFA 1OMWA 4B8LA 2WQMA 3QCXA 4ZP5A 4F1TA 3PPKA 4MXAA 3W0MA 3F5XA 1YDTE 1GZKA 4FNXA 5LVLA 1JAMA 2DWBA 4JQ8A 3ZTXA 5M07A 4UX9A 2UZNA 4CRSA 3BGQA 5M53A 5CX9A 2ZM4A 4HGLA 4B0GA 3KK8A 4LUEA 2YM8A 4JBPA 5EHYA 3POOA 1TQIA 4YO6A 5DEWA 2CPKE 2FO0A 2WMAA 5HE1A 4IANA 4D4YA 2VTPA 1WBNA 3VQUA 4ASZA 5AP7A 5K3YA 3RNIA 5IA4A 4AXCA 3VS6A 4GK2A 4EZ5A 1MRUA 5L6PA 5CAPA 4RWKA 2HELA 2KTYA 2I0HA 3FWQA 3OBJA 3Q60A 4FICA 4PTGA 2R2PA 4E8AA 3UIMA 2PWLA 4O7ZA 4XUFA 2E9NA 4I5PA 1R1WA 3KRJA 2C5OA 3QA8A 4RWJA 3DAKA 3MTLA 4NJDA 4GS6A 1OBDA 2XIXA 3F61A 5DR6A 2RFNA 5HG9A 5DT0A 5HE0A 3ZRMA 2XK3A 3B8QA 3O7LB 3RAIA 2CCIA 4KNBA 3A7FA 4GU6A 1GAGA 4RFMA 4WHZA 4OR5A 5CF4A 4L01A 1Y6BA 4ZLOA 2R3QA 3LCDA 4FBXA 5LMBA 3GBZA 3FV8A 2OZOA 5K9IA 3RP9A 3MTFA 1ZXEA 5DYJA 4U5JA 2BKZA 4DH1A 3R2YA 4IB3A 2PL0A 2ITTA 4O4BB 5CVFA 2YM4A 4YNEA 3TZ9A 1LEZA 5DNRA 5AFVA 2J2IB 1VZOA 5FG8A 3U4WA 5AX3A 2C3LA 4WIHA 2W5AA 5F95A 2B53A 3VQHA 3EYHA 3C50A 5D11A 2VTLA 1KV1A 3BU6A 4WBBB 2UV2A 3I4BA 4FKIA 5GIOE 3MJ1A 2CNUA 4KSPA 2J6MA 4EHVA 4PDYA 3TNIA 2P2HA 3D5WA 3ZONA 4JDHA 4DYMA 4JMQA 4XX9A 4GK3A 3Q3BA 4QPAA 4BCMA 5KBQA 3W0QA 2A19B 4NEUA 1UNLA 4RLKA 4C4JA 5A6NA 4E5WA 3QHWA 4PUZA 1AD5A 2VTOA 4W9XA 3LHJA 1BLXA 4AT5A 3RPSA 3LPBA 2W9FB 2JD5A 2WMVA 3AD4A 4MQ1A 4WO5A 4EWQA 4E93A 5KMIA 4O0TA 1H26A 4K9YA 1ZY4A 3FDNA 4XHKB 1CKPA 4GYGA 3FMNA 4F0IA 4YZBA 1YI3A 2OFVA 3FMKA 2BRNA 4FJVA 1PF8A 4YPSA 3I0OA 4QT1A 5BYZA 1SNXA 1Q24A 5CU3A 5BVOA 1H0WA 5L2IA 4K18A 4OTIA 4HPTE 2AEGA 5GZ9A 4D2PA 4FTLA 3QYWA 3FI2A 3ZCLA 4CFMA 4IH8A 3F5GA 2V5QA 3NFGB 5I9ZA 4DDIA 4GU9A 3RZBA 3Q2JA 2I7QA 3R8UA 3D14A 5C27A 2XBJA 4FKOA 3DBQA 3VW8A 3R21A 4I93A 1Q3WA 2QHNA 2Y8OA 4A4XA 1FPUA 3COMA 3CGOA 2UW7A 3HGKA 3NUNA 3O7LD 4J8MA 2DS1A 5HO8A 4FTUA 2R3FA 4XMOA 3PE2A 3OCSA 4HGSA 4XP3A 5BVFA 3LFFA 4H39A 5D41A 4LRKA 1R0PA 3MFRA 3Q5IA 5HLPA 3B2WA 3TDWA 2F7ZE 3BE2A 3ODYX 3C0GA 4HCTA 3RPRA 5JRQA 3HDMA 2UW6A 2V7AA 2Y4IB 4EC9A 2VTTA 3Q53A 3LKMA 2JIUA 2ZYBA 4FV5A 4YPDA 3E3PA 4F08A 3FMEA 2BDJA 5JZNA 4S32A 4FTKA 3R8MA 4E6CA 4I6LA 2XK6A 2C47A 4M67A 4CFWA 2GFSA 3A99A 5C01A 4D1SA 4F1MA 1JKLA 3SG8A 4BDGA 3BYVA 4OTDA 3ZO3A 2I0VA 4GT5A 1YXXA 4RC3A 3CJGA 2BZKB 3OFMA 4S34A 4E26A 2CHLA 1H25A 2JFLA 3UJGA 3QUEA 4EH9A 4PL5A 4FE2A 4RJ3A 4E6DA 4IM3A 1B6CB 3G51A 3KXZA 4Y46A 4M3QA 4Q9ZA 3GI3A 3I81A 3R83A 4W4XA 5KUPA 3PSBA 4ANQA 2JKOA 3EIDA 5AIRA 4D1ZA 1KE9A 3MDYA 2BTRA 4AP7A 1DAYA 3LFNA 3MIAA 3QRJA 3UYSA 2YIWA 4XV9A 4F0FA 2HWOA 3WZUA 1XMLA 3FEGA 4EKLA 3CY3A 2JBPA 1K3AA 4BRXA 4QDVA 4ITHA 4APCA 3GCUA 4AOJA 5IQAA 5IQDA 4FKWA 3P7AA 5LVPA 3QWKA 4UWBA 4YBJA 3BGZA 3TKUA 4EUUA 4M69A 1J3HA 3TUCA 4EH3A 3PVGA 3AMYA 3AD6A 4O1OA 5ANEA 5HE3A 4EWHA 1J7UA 4G5PA 5D12A 5T68A 2XK8A 4U41A 2B55A 3L8VA 4CVAA 4FEUA 3HV7A 3BPRA 4BCOA 4ENYA 3GOPA 1BL7A 1QPJA 2G1TA 3CY2A 4HYHA 2XAOA 1JKKA 3R7EA 2X2LA 2HOGA 2QO7A 3RALA 4O7LA 5DR2A 5AM7A 4ZMFA 3V5QA 2GCDA 1H00A 4JAJA 1YWVA 5L8KA 4ZTLA 1CSNA 3W2QA 4QMXA 4ZY6A 2PPQA 4UXLA 4BGGA 4FSMA 2PMOX 1SM2A 2QO9A 3ZLWA 4C34A 2QO2A 4EOIA 5FLFA 5BUEA 3GOKA 4GJ2A 2I0YA 4EK3A 2B9IA 1ATPE 2P33A 3NNUA 4FR4A 5AAGA 5M08A 1P5EA 3U55A 3TKHA 4NWMA 3NEWA 5HG8A 5HIBA 2GS6A 3KMWA 5EKNA 2Q0BA 3W0PA 3QCQA 4YJRA 5AX9A 4EQUA 5B2MA 2BDFA 3LQ5A 5AUWA 3PJ8A 2IF8A 3OEFX 5IH4A 1NY3A 2F7XE 2XIZA 4L43A 4RFZA 4TYJA 2YABA 5EI6A 1ZLTA 4IJ9A 1OVEA 3P0MA 2QU6A 3EWHA 4WT6A 3ELJA 3E7VA 4FSRA 3CBLA 3KULA 2XVDA 3AXWA 1YWRA 2G01A 2LAVA 4FEWA 5KMNA 3E7OA 3OHTA 3PXYA 2GHGA 2C4GA 3LMHA 5C8KA 1XH4A 2YDJA 2GHMA 5HOAA 4H3QA 2FSLX 1UU9A 4NCTA 2XK9A 2WMXA 4ZEGA 2W0JA 2ITQA 3M1SA 4BIBA 3QXOA 4I1ZA 4I4FA 5TT7A 4AW2A 3A7IA 1PXPA 5HD7A 3H3CA 4V01A 4FL2A 2C1BA 4DEAA 1U54A 3AMAA 4JR7A 2HZNA 4IVCA 4JRVA 4K8AA 3TUBA 1ZYLA 3FY0A 4AW1A 3HAMA 3LLAA 5LWNA 4IM0A 4JBOA 1K2PA 2ONLA 3DQWA 4BDJA 2EB2A 3G5DA 3NAXA 4QMWA 4QP4A 2XUUA 5AV0A 5T6KA 3RCDA 3S95A 3R7GA 4HVHA 4CV8A 4DH8A 4G5JA 2JDOA 2IZTA 2JDRA 5FP5A 1AGWA 1WVYA 3GC8A 2VWUA 4RVKA 2BZHB 3V51A 2RFDA 4FT3A 3T8OA 2YIYA 4F7SA 3SRVA 4F9AA 1Q99A 1YI4A 3IONA 4QTCA 4EK8A 3SXSA 1VLRA 5DE2A 4GFGA 4TY1A 4KS7A 4BIDA 4OLIA 3FYJX 5FP6A 1DM2A 5C8MA 3F66A 2IO6A 4BHZA 4Z7HA 2XCHA 3OTUA 4FTQA 4RJ6A 5TOZA 2WFYA 1EH4A 4J7BA 1BUHA 4CFUA 4PY1A 4AGCA 4ITIA 2XA4A 4M12A 1QPEA 5EYDA 2IG7A 4XBUA 4EOLA 2HW6A 2VRXA 3ZLSA 5A4EA 4QPMA 3UVPA 3POZA 3DQXA 3LFDA 3ZBFA 4IDTA 4NKAA 3V04A 4BF2A 4CFVA 4CFFA 5A54A 1Q97A 3O71A 4Q9SA 3ORNA 4FKPA 5EI2A 3KN6A 4M7IA 2PVLA 1NA7A 4YHTA 4PDSA 4KB8A 2CKQA 2B1PA 3FJQE 2JFMA 4IM2A 2BAKA 3V8WA 5HG7A 3MGYA 5GJGA 5M56A 3UVQA 3LMGA 2C5VA 1XKKA 3RHKA 5FGKA 4J99A 5ANGA 4FIFA 3KRLA 3L8XA 3QC9A 3L9MA 5D1JA 4ALWA 4CQEA 3EFWA 3V3VA 1LEWA 3BV3A 4ANSA 3DBCA 5HQ0A 3DJ7A 4IZ7A 5CZIA 2IVSA 4AFJA 4DGOA 5GZAA 4AA0A 2IW6A 3D2IA 5CQUA 3AC2A 3Q4ZA 4LFIA 1CKJA 2HY81 4LG4A 5DOSA 4L46A 3FKLA 5E1EA 3PRFA 4GT3A 5TO8A 4KSQA 3WF8A 4GVJA 4KKEA 1OL5A 4R7IA 3U51A 5BMSA 4IZAA 3UNZA 3VC4A 3MVMA 2X1NA 2VGPA 4AOIA 3GU4A 4FNWA 4U40A 4D58A 4U43A 2WU6A 1IA9A 5TF9A 4ZSGA 3MVHA 1H27A 3GT8A 3AC5A 2JKQA 3GC0A 2XNBA 3PVBA 4N70A 4ZK5A 4PPAA 3ZDIA 2UVYA 4LL5A 4G2FA 3DFCB 3P1AA 2W1DA 5CXZA 3KVWA 2XANA 2YA9A 2JIVA 2JC6A 5CU6A 4DEHA 2GNIA 2A4LA 2VAGA 4USDA 1KE8A 1NVSA 2BFYA 3VF9A 3PXZA 5HTBA 3EQGA 4USEA 3IKAA 3AKKA 4JNWA 3R9DA 5AR8A 2FUMA 1RE8A 3VS1A 3ML1A 3O17A 3Q4CA 2OKRA 4CTCA 1OKYA 4HVIA 4YBKA 4FG9A 3HVCA 5DEYA 3MESA 4WG5A 5L3AA 3VONA 2YISA 3BHYA 5HCYA 2R0IA 3PP0A 3UMWA 4D55A 1Z57A 3DPKA 2X8DA 2RG5A 3EHAA 3RM7A 3V8TA 1RW8A 4RQKA 1WVWA 2PVFA 4U80A 5HI2A 2X81A 3C0HA 4TPTA 4U97A 4P7EA 2XIRA 5CAOA 3AKLA 4MX9A 4MF1A 1WVXA 1XHAA 2PZYA 3CTHA 4LV8A 3Q32A 3E8EA 4FKSA 5IQCA 4AS0A 3DZQA 4TWOA 3PG3A 2HZIA 4IZYA 2ESMA 2OJGA 4L3LA 4EYJA 2QOQA 5HTIA 1Q4LA 3QXPA 4X6QC 4FTMA 4CV9A 4AE9A 3IQ7A 2ETMA 3LCTA 4V0GA 3VJOA 5AADA 3G6HA 3E5AA 3RCJA 2F49A 2GS2A 4QQJA 2R3MA 5JSMA 2FH9A 5IH5A 2O8YA 3F2NA 2WMQA 3FPQA 4RC2A 4RIWB 2R4BA 5CZHA 3D7TB 4BBMA 4KABA 4QP9A 3JY9A 4HPUE 2YIRA 4YJVA 3SAYA 4ACMA 4I5MA 4Z7GA 2J0MB 4EH7A 2CNVA 3F6XA 4JDIA 5DH3A 1FVVA 3CJFA 4CLJA 1ZOEA 3EQCA 5L2QA 4NTSA 5HVKA 2NRUA 2OF4A 4HZSA 4CG9A 3MVLA 3UOLA 4UZHA 3FC2A 4G9RA 3CPCA 4DH5A 2G2HA 3WE4A 3FZPA 3HMIA 3THBA 4ENXA 3LCOA 4E20A 3PIZA 2BRGA 4UN0C 5IQFA 3FLQA 4IWQA 4A9SA 4O2ZA 4EJNA 1CKIA 3HECA 3PY0A 4BWKA 4L00A 4JVGA 3OW4A 3DNDA 4C57A 2X6DA 4FYOA 3ZFYA 5HTCA 3W32A 3EFJA 3MFSA 4BIEA 5IA1A 5D7VA 5EDPA 4EOKA 5J95A 4EZ7A 3A4PA 4AW5A 5I4NA 4M0YA 3SD0A 4R7BA 4G6LA 1FBNA 4UWYA 2CMWA 3FL5A 3I0QA 2WIPA 4OTGA 1FINA 1Y57A 4L68A 1AQ1A 4IX3A 4YZ9A 1YOJA 2OZAA 4F64A 4EKKA 2CGVA 4Q2AA 4MTAA 4AUAA 3DTCA 3WF6A 2PU8A 2QOBA 2XEZA 5GHVA 5DMZA 3FI4A 3T9TA 3PG1A 2X39A 4ITJA 4M66A 1PKDA 3FY2A 4IX6A 4L52A 4UWCA 2BDWA 3DU8A 2XKCA 2W1FA 1H08A 3OXTA 4FSYA 4ZJJA 3WI6A 4IC7A 1PXJA 5M55A 3PZHA 4BTMA 5KHXA 4GIIA 5EW8A 3DJ6A 3OTVA 4GH2A 4CFXA 4YZCA 4I0SA 4JQEA 1FMKA 5LARA 4HCVA 4ASEA 4DINA 5C26A 4DHZA 3MH0A 3E92A 3DAJA 4M8TA 4TYEA 3FHIA 3I60A 4ANMA 3FZTA 4YJNA 4G3DA 5HU9A 5E4HA 5E8VA 4BTFA 4FGRA 2V55A 4DEDA 2JDTA 3RAKA 3QTWA 5J5TA 2ZB1A 3MIYA 3KRXA 4F70A 2QOIA 2X9FA 4MNEB 3PY1A 1J91A 3ET7A 4CT1A 2OIBA 4ACGA 3GNIB 5EHOA 1W2FA 2UZOA 3DLSA 4LGHA 3V6RA 3D5XA 4ANLA 2O2UA 3WIGA 4XRLA 2E9UA 2FVDA 4Z16A 3TZMA 4PWNA 3SLSA 5FEQA 3PYYA 3MY0A 2YM5A 3PXQA 4WOVA 3UOHA 5KMJA 4RJ5A 5E8SA 2VTSA 2BZJA 1KE6A 2ZM3A 1X8BA 4IVDA 3HV3A 1J7IA 4FTOA 3RGFA 2WQEA 2CGWA 3OMVA 4NJ3A 2O5KA 3BWFA 5IQEA 4AE6A 2QHMA 2ZOQA 4EC8A 4AW0A 3PJ2A 2C69A 3BZ3A 3HA6A 1W84A 2NPQA 3I7CA 5DPVA 2GHLA 4FKUA 3WILA 2JBOA 3P5JC 3Q96A 4MBJA 2ERKA 2ITWA 3QCSA 3I6UA 5EK7A 2PMNX 1NT2A 1BYGA 2C6DA 1ZWSA 2CSNA 3P08A 4WNMA 4ZS0A 3W18A 3A60A 2YEXA 3BYUA 4I4EA 3I79A 4QMUA 2IPXA 3ZXTA 4IVBA 4IFCA 4FTTA 4KD1A 2YZLA 2ZFYA 3LXKA 3L8SA 2JKKA 5CYIA 4QO9A 2HZ4A 5IA3A 3R04A 4DGLC 4FSWA 5A3XA 1XH6A 3NUAA 4E5AX 3EB0A 1PMUA 3ODZX 4O0YA 5CSWA 3VS2A 4PP7A 2WQOA 3F88A 4TRLA 3HX4A 4FEQA 2PUNA 4NU1A 3GFWA 4XYFA 3G15A 1DI8A 4F7NA 2C5XA 2ZDTA 4D0XA 4EHZA 5L8LA 3DKFA 4C58A 3DBEA 3SOAA 5EW9A 1MP8A 3OCTA 1OITA 4ARKA 3K2LA 1U46A 1U59A 3RK7A 3NX8A 3TACA 3WF9A 4GMYA 4E6QA 3EQIA 3HLLA 3MS9A 4TT7A 2XH5A 3BWJA 3QA0A 4NW5A 2CDZA 3G33A 4NM0A 4XV1A 1CTPE 1W8CA 3CTJA 3Q52A 3TKIA 3QTXA 4LDTA 4XG3A 4BWXA 5GJFA 4XG7A 4XG9A 3OWPA 3W2RA 4CZUA 3ZM9A 2VWBA 3IGGA 1YDSE 2P0CA 4DF3A 5CENA 3IW7A 5FUTA 4JDJA 2WELA 4NUSA 4EH6A 4XP2A 3UDSA 4JAIA 4C4EA 3UZRA 4FGBA 4G9CA 2YAAA 4II5A 3BIZA 3GXLA 4S30A 4QMOA 2O0UA 5IQIA 4FNZA 2ZMDA 3E63A 4I23A 3CTQA 4HNFA 4BN1A 3NUUA 3IG7A 3DKOA 3MPMA 4U81A 4FL1A 3UC3A 3CKWA 1OIUA 4OTWA 3S3IA 3LVPA 3W2OA 2VN9A 3OWKA 1KOAA 4WNOA 3VHEA 4BICA 4B4LA 3TT0A 3WARA 1TVOA 4DTKA 4AZTA 1ZZ2A 2OO8X 5EM8A 5KZ0A 2B0QA 4GEOA 2JAMA 2XS0A 2FYSA 5DVRA 3HYHA 2R3PA 3QQHA 4FV9A 3GVUA 5K0XA 3NYVA 4BKYA 2PZRA 1FGKA 1Y91A 4GJ3A 3SG9A 2GMXA 1ZMWA 3SKCA 5AP6A 3QL8A 1V1KA 4OTPA 3ZBXA 4BZDA 4HCUA 1JBPE 3MW1A 1Z5MA 3EZRA 4QNAA 2GPHA 5AR3A 3TNHA 2J0IA 3KA0A 4AOTA 3BEGA 4F0GA 2DUVA 5LQFA 4YSJA 4FI1A 1UV5A 3C4EA 3VAPA 2QCSA 4XS2A 4BZNA 4PMPA 1M2QA 4N6ZA 4X21A 3CQWA 5E8WA 2NRYA 3F7WA 4MK0A 3LFCA 3TN8A 4KA3A 4J53A 4EUTA 4C3RA 2GQRA 3KIOC 3BE9A 2YJSA 4XP0A 4GIHA 5AR7A 3UVRA 3WF7A 3PLSA 1F5QA 3C51A 2VX0A 5DLSA 5CAUA 5HKMA 2UZVA 5CVHA 4O7TA 4QMTA 4I0TA 4X2FA 3VIDA 5AP4A 3BBWA 4N6YA 1G8AA 2X2KA 3O5AA 3KMUA 1KSWA 2BAQA 2W7XA 2WMRA 3LLTA 2VWXA 3DCVA 4KBKA 5FD2A 5HICA 3VF8A 5AR5A 5LMKA 3U9CA 2C3KA 2F4JA 3KKVA 3DLZA 4FT7A 3FPMA 4GV1A 4XOZA 2QI8A 2UW3A 1H0VA 3ZC6A 4YJSA 5FBNC 4EH4A 4RG0A 3R9NA 4D0WA 3UO4A 3EL7A 3SGCA 4FC0A 5G1XA 4UMRA 3EQPA 4GFOA 4PNKA 5I3RA 4BDDA 3IW6A 1PMNA 1XBCA 3PUPA 4BDIA 4KINA 3DA6A 4QYGA 3QTSA 4RIXB 2CN5A 2QR8A 3T3VA 2XNMA 3D15A 4L7FA 5DI1A 5DT4A 3LIJA 2WTKC 2FSOX 2HAKA 3FMDA 4FVPA 5CWZA 4AG8A 4YR8A 4GCJA 4YC3A 4FKLA 1MQ4A 4QMYA 5CLPA 2J4ZA 3MH2A 5EYCA 3R1SA 4YMJA 1OIRA 3NW6A 2G2FA 4Y73A 4DT9A 1UU7A 2X7OA 1IASA 3FLNC 3NUYA 5J5SA 3L9PA 3F5PA 4BCFA 1BMKA 3O50A 5EI8A 3T9IA 3OP5A 5BVDA 2WOUA 2YACA 4F99A 2Z7RA 5A14A 4P90A 3UGCA 3N4TA 4O0VA 4UALA 4PPCA 4A4LA 1FVTA 3NYXA 5HNBA 3JY0A 4OGRA 3PXKA 3GUBA 3AC3A 1UNHA 4FZ6A 2OICA 2OI4X 4M15A 5DWRA 4MVFA 3JUHA 5HVYA 1GIJA 2PMIA 4ZXTA 3BL9A 5FTGA 3BELA 3R02A 3SA0A 4RX5A 4IJPA 3FLWA 5IQGA 3TMOA 4IQ6A 3MYGA 4Y72A 3KQ7A 4EOOA 2XBAA 4QP3A 4Z3VA 4Y95A 3SVVA 1XR1A 3AD5A 3HUBA 4W4WA 4E6AA 3LFEA 5IMEA 1RDQE 5CT0A 2YM6A 2V7OA 2WTKB 3QKKA 4ACDA 2WGJA 1ZMUA 4FV4A 4CXAA 3W0SA 4XG2A 3A8WA 3VS7A 2C6LA 3VULA 2W5HA 2R7BA 3ZSGA 2VO6A 4GKIA 3CE3A 4O27B 3SC1A 3UG1A 3R1QA 3CLYA 3V5LA 4ANBA 3MA3A 2XKFA 2VU3A 3MWUA 3LXNA 4U7ZA 4YGAA 3FL4A 4RQVA 1Q5KA 3C4XA 3HMNA 1JVPP 3OF0A 4R78A 2R3KA 3W0NA 4G3EA 2VWWA 4G1WA 4O81A 1Z9XA 2YM3A 4WG4A 3HMPA 2E9PA 4C4FA 5JQ5A 4F7LA 2Z8CA 4H36A 4O0XA 1W2CA 3F9NA 3VUHA 3L8PA 3VRYA 1PMVA 2VO7A 4FVQA 5AP0A 3MA6A 4FKVA 5KKRC 5DG5A 5ANKA 5HVJA 4D5KA 2JIIA 3HZTA 4X0MA 1XH9A 3VW6A 2YLEA 3N4UA 5EQEA 3WOWA 4DITA 4EORA 2C6OA 4MXXA 4BC6A 5CALA 4BB4A 4HOKA 3BHVA 5LWMA 3B8RA 4OBOA 2REIA 3RNYA 3FMMA 4XH6A 4QTBA 2I1MA 3FMHA 3HRFA 1GJOA 2ITPA 3FLYA 4JLCA 4F09A 2RF9A 1H1QA 5JFXA 2QG7A 2JDVA 5JQ8A 2B9JA 4RVLA 3CCNA 4LQMA 4MAOA 1XH8A 5I9UA 4ZTRA 1XBAA 1FVRA 4CLIA 4WUAA 3VBYA 4QMNA 2BRHA 1WCCA 2ETRA 4BBFA 4X2KA 1OUKA 4CGAA 3QQJA 3R63A 3OVVA 2VTHA 1F0QA 5EM5A 3QQFA 4NT4A 4E4LA 2P2IA 3F82A 4QYEA 1ST0A 2ZV7A 3LM0A 3PSCA 5E8XA 1WBWA 4C33A 4A9RA 4O86A 2QOFA 1H1WA 1DAWA 4V04A 1PMEA 1KOBA 2ACXA 3EYGA 4FMQA 2W5BA 4NIFB 3TV4A 4CSVA 3S00A 1Q8TA 4FTRA 4EH2A 4TWPA 5AEPA 3FMJA 1OI9A 2GSFA 5F20A 2I0EA 2ZDUA 1OPJA 3I5ZA 3QU0A 3QUDA 5EG3A 3VO3A 5EQYA 4KKGA 4YHJA 2IVTA 2XKDA 5EW3A 1Q8UA 3H9RA 5FBOA 3C5IA 5BVNA 3DOGA 3E87A 4C02A 4J1RA 4K11A 4NSTA 3QF9A 3IW8A 1S9IA 5J7HA 4JR3A 1NVRA 4GRBA 3UTOA 2WAJA 4IC8A 4F9CA 2V0DA 1A9UA 4XV2A 3HV4A 5IUGA 3ZSHA 3DKGA 2O64A 4PV0A 3KN5A 1PXMA 3EN6A 4FIHA 2GS7A 2J5EA 3KF7A 5D9HA 3EMGA 1OM1A 4G3FA 3OWLA 5TE0A 4BCNA 2XF0A 4IAYA 3LJ1A 3EN5A 4B8MA 4P5QA 4ZZNA 1G5SA 4GVAA 5EDRA 3PFYA 5DT3A 4ERKA 3ZFXA 1VYWA 1P4FA 3JXWA 3CC6A 1VJYA 2VO3A 3V5JA 2BILB 2G2IA 5BQ0A 4UBAA 4X3JA 3MV5A 4I6QA 3IECA 4ZJVA 3QLGA 4AACA 4GT4A 2HCKA 5AR2A 4EQMA 4Y8DA 3EH9A 2W06A 1G8JA 3TIYA 2VV9A 1GY3A 2WHBA 1CDKA 4X2GA 1DI9A 1ZOGA 2CLXA 5CY3A 4O7WA 4RA4A 1DS5A 3VNTA 1KE7A 5KZIA 2RFSA 5BYLA 3NS9A 2VTNA 3FZ1A 1REJA 2OJ9A 3HV5A 4O96A 5H9BA 5HBEA 5IZFA 4TL0A 4O22A 3O8UA 4O4FA