3MN3A

An inhibited conformation for the protein kinase domain of the saccharomyces cerevisiae ampk homolog snf1
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
271
structure length
252
Chain Sequence
AHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFKVDLPEYLLPPDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Carbon catabolite-derepressing protein kinase
publication title An inhibited conformation for the protein kinase domain of the Saccharomyces cerevisiae AMPK homolog Snf1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 70
structure length 252
sequence length 271
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3mn3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3mn3A01
3FXXA 2BZKB 3SAYA 4JBQA 4IWDA 5M56A 4G1WA 3Q96A 5FTQA 4C3FA 1CKJA 5L8LA 4FSTA 4XRJA 3BRBA 4ARKA 5KBRA 3D2IA 4BDDA 5HG8A 4KKHA 2JIVA 2OG8A 5JGBA 3RP9A 1F5QA 2JITA 3OG7A 3DY7A 5F4NA 4AN2A 3OUNB 2H34A 3DZOA 1E9HA 4O0XA 3RMFA 2C3JA 2F7XE 2JC6A 5CZIA 2WFYA 4HCVA 4CYIA 2BUJA 4I0SA 5K5NA 3HMOA 3NNWA 4YR8A 1URWA 3QWKA 4ERWA 5FM3A 3F5GA 3ZZWA 1PKGA 4FYOA 5DLSA 3PXFA 4MWIA 5CEPA 1LUFA 4PPCA 1Q61A 4IAIA 5CYIA 5IUGA 2WMQA 2RIOA 3VBVA 3BQCA 3COKA 4OW8A 5CF8A 2R9SA 4EWQA 3GB2A 1V0BA 3Q5IA 4FKWA 4WNKA 2NNWB 1U54A 4DFYA 4YURA 4OBOA 4CLIA 3QQHA 2X81A 4CV9A 3GCUA 2QU5A 4FSMA 3BV2A 3IG7A 3KXNA 2BDFA 4PDPA 2OXYA 3UE4A 4CT1A 4FTQA 4PTEA 2VGOA 3LFAA 3RGFA 5AV0A 1CM8A 3D9VA 1PXMA 3JVRA 4O0WA 3NS9A 3VS4A 2VWBA 5M08A 5CVHA 5KE0A 5AV4A 2Y9QA 2R3FA 2XH5A 3R2BA 4EL9A 5ETFA 2VV9A 3W2OA 3EL7A 2ZV8A 1MUOA 4R3RA 3MVMA 3MY1A 4NU1A 4NTTA 5BVEA 3WZJA 3UZRA 4WA9A 4AT5A 3ZYAA 2ZAZA 2Y4PA 4DCAA 4C37A 5FTGA 4L3JA 3F69A 4GJ2A 5AX9A 3U4UA 4GRBA 4X21A 2QO2A 3UODA 5L2SA 4X2NA 5AR4A 3E87A 3QTSA 4PRJA 4QO9A 4O83A 2WD1A 4BCKA 3PVWA 2VTRA 3PA3A 5AA8A 2ETMA 2V62A 4O21A 4YO4A 3R7VA 2HY0A 3C0GA 4GFGA 4P5QA 3R2YA 4BDKA 3PXKA 3MFUA 4HVIA 5GIOE 5EH0A 5J79A 3U9CA 5AP6A 2NP8A 2QODA 3FLSA 3LQ8A 4XG6A 4DBXA 3F3UA 2JFLA 1M14A 4PX6A 3IPHA 5HO6A 3ZO4A 5HVJA 4E4XA 1ZMWA 4BBFA 5KZIA 2VNYA 4DH1A 5I9XA 4IEBA 3P7AA 3R6XA 3MY5A 4N6YA 4DGGA 5BX0A 4E93A 3A7IA 5LARA 2W1DA 3EL8A 3BEAA 1JKSA 4JQ7A 5EW3A 5HVYA 2IN6A 4QPSA 3R1SA 5LVLA 1OL5A 4CFMA 2I1MA 2W4JA 3F5XA 5KMOA 3VS5A 5TR6A 1OKWA 2XYNA 3HRBA 3LFBA 2GCDA 5LOHA 3LXLA 1ND4A 3T3VA 1NVRA 4FEUA 3RCJA 4AA0A 3W55A 4DGOA 4FF8A 2HYYA 5J1VA 5IA0A 2R3JA 1UU7A 3KK9A 3TG1A 5L2IA 2B0QA 4HVSA 4UMQA 4BCIA 1OITA 3VIDA 3ZCLA 4I5PA 3R1YA 4IB1A 3FLQA 4FV6A 3RAIA 2CGXA 1JQHA 1XQZA 2Z60A 5CVGA 3O8TA 1R3CA 5DFPA 1OPLA 4YBJA 2I0YA 4FTAA 3FMDA 4TNDA 4V0GB 1YHSA 3DKFA 1WMKA 5EKNA 2QOKA 1M17A 3HKOA 3HUCA 4A9RA 3V8WA 4E6QA 3EQPA 3O0GA 3PE1A 5A4EA 3ACJA 4C33A 2OXDA 5AAGA 3GC0A 4QT1A 3NVKI 4EK4A 1P4FA 3OZ6A 4J71A 3RTPA 4CGAA 3FL4A 5IQCA 4CTBA 2UZTA 2A1AB 5CAVA 3OFMA 4KBCA 4L01A 4NIFA 2W1HA 4E73A 5IMXA 4CZTA 4GUBA 1YQJA 1U54B 2JKMA 4BDCA 4C4IA 1YDTE 2W9ZB 4I94A 4L42A 4DC2A 3REPA 2FSMX 4BI1A 4DAWA 2ITNA 1E1XA 3F7ZA 3AC2A 3PWDA 2ZVAA 4MX9A 4WT6A 3LMGA 4FX3A 2PMIA 4E4MA 4XP0A 4I24A 3PY0A 5DGZA 5L8JA 2B52A 2C6KA 1W82A 4RZVA 1YXTA 1F3MC 4AE6A 2WEIA 5ANDA 2BKZA 2ZOQA 3ET7A 5KHWA 3MVHA 3C13A 5TKDA 3I1AA 5HO8A 3TZ9A 2BILB 5CEMA 3E63A 3GCSA 4UXLA 4DTAA 4IM3A 5G1XA 2V7AA 1IA9A 4FV3A 4M69A 4D2VA 4AN9A 1WBWA 2QOOA 4IZ7A 2JEDA 3LFSA 3MPAA 1FINA 4QPMA 4RPVA 3I7BA 1A48A 3FY0A 1OZ1A 2CHLA 3ORIA 3ATSA 1LPUA 4LRMA 2YDKA 4H3QA 5M4UA 3FMEA 3P5KA 4YUQA 3HMIA 3FQSA 2VTIA 2W1FA 4LUEA 5CNOA 4DFUA 3OEZA 1IA8A 4RIWB 5AJQA 3EYHA 4HZSA 4IC8A 4B99A 5LWNA 5BYZA 4Q5HA 2LGCA 3FYKX 3POOA 3U8WA 5A4TA 2OZAA 4DINA 5E1SA 4FKTA 2HWOA 2R3NA 2YAKA 5GJFA 3RALA 5ANIA 5GJGA 4DEBA 1H8FA 2W1IA 1W0XC 3ZLYA 3R83A 3DNDA 5AAFA 2G15A 4O7WA 4DGMA 4EHZA 1OM1A 3MA6A 2I6LA 3F66A 4QOXA 3PSDA 2VO0A 4TWCA 1ZYCA 3NUUA 4LV8A 1R39A 3IOPA 4FKUA 2WOTA 2CKOA 5E9EA 2BPMA 4CCBA 4E26A 4F9CA 3CD8A 4O0VA 2F57A 3LLTA 2IWIA 3FZTA 3OTUA 5C01A 3PPJA 3ENHA 2J7TA 5H8BA 5BMSA 4ORKA 3LFEA 4AA4A 2EWAA 5EM6A 2ETRA 4G16A 4RWLA 4WG3A 4RG0A 3AXWA 4LUDA 4O7RA 1Z5MA 3W16A 2ITVA 2BIKB 4XNEA 4XV3A 5T6KA 2C5OA 4J8NA 3P23A 3DZQA 4P4CA 3QTWA 4M0ZA 4CEGA 3FI8A 2QOQA 3DGKA 1Q8YA 2BRMA 4C58A 5DR2A 3GGFA 3V5TA 1KUTA 1JOWB 4NYEA 3EIDA 4EEVA 3DLSA 4PDSA 2C0TA 3LFQA 4TL0A 3LM5A 2B9HA 3FZPA 4A4XA 3ZDUA 3BI6A 4G5PA 3IGGA 2PZRA 5IA5A 2VWYA 5FRIA 4CXAA 3QXOA 4AACA 4WD5A 4BBMA 4I22A 3O51A 4AU8A 4RC4A 4QP9A 5AUYA 5ITAA 4ZS4A 3UC3A 4NIFB 4EH8A 3M1SA 3EFKA 2VX3A 3DLZA 3FBVA 3QQFA 1PXPA 2VTLA 4IQ6A 2XBAA 1XJDA 1CSNA 4IW0A 4MXCA 3WF8A 4KAOA 5CALA 2WQOA 3ETAA 1UU8A 1YVJA 5H3QA 2WMSA 4Y72A 4F6WA 4Z9LA 1GZOA 3A60A 2IVVA 3ELJA 3LIJA 2WTKC 3LXPA 3GI3A 5J1WA 3E93A 4QMUA 5AP7A 3AT3A 3AMBA 5I0BA 3E7OA 3AMYA 1OPKA 2RFSA 3FYJX 4LRKA 2C6LA 2H6DA 4C8BA 1E1VA 5DR9A 2WQMA 4M69B 4EI4A 4RC3A 4CVAA 3G15A 5EM7A 2SRCA 3GU4A 3QD4A 3PXQA 4BYIA 4WG4A 4S30A 2QURA 2IPXA 4FL1A 4QPAA 4ZXTA 5DHJA 3LCTA 4BF2A 4D5HA 2UVZA 4CTCA 3P08A 3DAJA 4MQ1A 4A06A 1IEPA 3QCSA 4L52A 4YTHA 3ENMA 4GU6A 3NSZA 1GOLA 3FMHA 3RBWA 5F20A 4BIDA 2C3LA 2XCKA 2QNJA 3R04A 2GPHA 3IW4A 4ZTRA 2PHKA 4X2JA 4ITIA 2I0EA 1Q3WA 5I3OA 1Y8GA 2BHEA 3QF9A 1Q3DA 4MXZA 3V5JA 2BKKA 5DYJA 3CPBA 2GTNA 2C5XA 4QTDA 2WO6A 4FKPA 2VU3A 5I9VA 2HZ0A 1XH9A 4UZDA 2W5BA 4ZTLA 2PVNA 1JSVA 5EHLA 4BDAA 3UNKA 4HVHA 3ZSIA 5DRDA 3NVMB 5E4HA 3A8XA 2OH0E 4FIJA 3HAMA 3I81A 2PMNX 4IJPA 3TL8A 4BL1A 1XBBA 2P33A 3I4BA 4G9RA 2Z7RA 3A2CA 3Q6WA 2GQGA 1IRKA 3BQRA 3M11A 4IFCA 4J53A 4R5SA 4JG7A 4AFJA 4QMVA 5A4LA 2EU9A 2HELA 4E7WA 3NEWA 3FQHA 1XBAA 2JD5A 2PUPA 4OTDA 4EQCA 3ANRA 3I5NA 3MH0A 2HCKA 3FDNA 3LJ0A 5HHWA 4LGHA 4USFA 4WHZA 3MB7A 3R9NA 4IDTA 4RGJA 5L8KA 2PK9A 3L8XA 4FKOA 5D10A 2VGPA 3MN3A 2I0VA 5HLNA 3LMHA 4ZTSA 4FBXA 4P90A 4ZSGA 2JKKA 5F9EA 5CT0A 2ZV2A 3C9WA 5AWMA 5BYLA 2G9XA 2W1EA 4O96A 2G2HA 5E90A 4AZEA 3QGWA 5L6OA 3NW5A 4G6LA 3HDNA 5IG1A 5LWMA 3C4WA 2WHBA 4IXPA 3UG2A 4NUSA 4U6RA 1M52A 3QBNA 3W2QA 2OLCA 4H1MA 1BX6A 3R7EA 3PLAE 4EYJA 1NXKA 2Y6OA 2YIXA 4KD1A 4I21A 2WMTA 2GS6A 3DKOA 5EYMA 2I7QA 4NTSA 1OL1A 5FP6A 2V7OA 3R73A 4FC0A 2Z7QA 3V5WA 4YGAA 4W9XA 4D4RA 3U54A 2YACA 4O0YA 3HP2A 5EI6A 1WFCA 3WYYA 4FSUA 2JDOA 4OBQA 4YJRA 4RBLA 4J1RA 3DNEA 1H07A 4RVTA 4X6RA 2WMWA 4U3ZA 3BZ3A 3A7JA 2Y6MA 4ZY4A 3BYMA 4FODA 5DIAA 2JAVA 4G3DA 4MBLA 5DRBA 4KIKA 4HYIA 4U43A 4JT3A 3ZC5A 2GNJA 3Q3BA 2QOHA 3H0YA 3WF6A 4DTBA 3IW8A 4I23A 1OKVA 4RA4A 1UWHA 5TT7A 3KA0A 3PDTA 2QOLA 1W84A 1SVHA 4IVBA 5LVPA 4FKJA 3PJ3A 2OI4X 3CY2A 4BWPA 2GQRA 2YLFA 1GIJA 4KBAA 4UMRA 2XRUA 3DFAA 5EKOA 4NSTA 3UJGA 1FBNA 2W0JA 1Z9XA 2GMXA 3EZVA 1YDSE 4E3CA 2R0IA 3F9NA 2EVAA 3B8QA 2CLXA 2X2KA 3I5ZA 1H1QA 2C0IA 4CKJA 4XLVA 2OH4A 2Q0BA 4RWKA 4CG9A 3DKCA 3ZOSA 3LW0A 4QP6A 4J95A 2J9MA 2W99B 3RAHA 4D9TA 3F3TA 3HLLA 4NM0A 1M7NA 3LFNA 1V0OA 5C8MA 4NCTC 3SKCA 4JG6A 2PMLX 4H3BA 5EI8A 1SNXA 4C2VA 3MTLA 4NM7A 4BDIA 2XIXA 4ALWA 4R7HA 4CT2A 5KMNA 2YCFA 4RX8A 5AP4A 3ZRKA 4L46A 5KHXA 5EQPA 4X0MA 3BBWA 4BN1A 4NCTA 1Q41A 3E3PA 5FBNC 2J0LA 3IQ7A 3ULIA 5AR3A 5CXZA 2WOUA 5BPYA 3NWWA 5DBXA 5HE0A 2HZNA 5CAOA 3I79A 4PTCA 3C4CA 3R1QA 4BDEA 4FV4A 2ZJWA 4IX5A 3HDMA 1SZMA 4FL2A 3RKBA 3EN5A 3FLYA 4R3CA 4IAAA 4JIAA 5HG7A 4BCMA 1GIIA 1H1SA 3V01A 5BUEA 2GNLA 3PXRA 4UMTA 5HU3A 3LFDA 5HI2A 3IONA 3KKVA 2WTCA 2IJMA 4G31A 3KFAA 4FT3A 1W83A 3PA4A 4BTJA 5CEKA 4JIKA 1Q5KA 1JLUE 5HTCA 3TKUA 4DEAA 4DFXE 5KZ0A 5LVNA 2JDTA 4QYFA 3DDQA 2JIUA 3GU8A 4JVGA 5BVWA 1YXSA 4AOJA 4DGLC 2W4OA 4GIIA 4K77A 2GNFA 5AM7A 4EJ7A 2GNIA 3D5XA 4JI9A 2G1TA 2WTJA 4HCTA 4H58A 3RK9A 4W4WA 4BBEA 3UPXA 5J5SA 2ZDUA 3BGZA 2XK8A 3BYSA 3MY0A 4KSPA 4YTFA 4K0YA 4ZTMA 4YJPA 5E8XA 3R22A 4J99A 3CC6A 3NYNA 3TUBA 4ID7A 3A61A 1Y6BA 1Q62A 3C0HA 5BMMA 4ZMFA 2OWBA 4YMJA 4UB7A 5I5ZA 5JQ8A 2IZRA 2XIYA 5KO1A 2B53A 4FTLA 4F0IA 4Z7GA 2CKPA 1OB3A 1O6LA 2OZOA 3SQQA 4IDVA 4FI1A 4K1BA 4NK9A 1REKA 4YZBA 3NMUF 3PPKA 3MIYA 4BCPA 4AWIA 3K3JA 5CSPA 5IF1A 1Q4LA 3G2FA 4APPA 5AR2A 5IDPA 4Y5QA 4FKSA 4K2RA 4FG7A 4U8ZA 3TV4A 4Q9ZA 5HNIX 2BZIB 1ZMVA 3PVBA 5M51A 4PMMA 5B7VA 4EC9A 1DS5A 3AC3A 3KN6A 3QC4A 4I6FA 5DNRA 4EH2A 5B0XA 3VWAA 4R3PA 4JX7A 4RJ8A 1DAYA 4RFYA 4I6QA 4KIPA 2VX0A 4I93A 2DS1A 5D7VA 3SG9A 4PL3A 3MPTA 3G9LX 3DAKA 3LHJA 3OROA 2ITPA 4U42A 3P7CA 2P4IA 3KF4A 3VUMA 3GC9A 2YJRA 4S32A 2F2CB 2C1AA 3HV4A 4EK8A 1H1RA 4FZ7A 3SDJA 3G90X 5IA3A 2QD9A 2XK6A 5J95A 4YPDA 1R1WA 2BR1A 4UYAA 1JNKA 1V0PA 2C69A 3S95A 3LZBA 3H30A 4PDYA 5AM6A 3W2RA 4HCUA 1PW2A 1Q8TA 1PXKA 4F6UA 4QNAA 1YI6A 3TTIA 3VS2A 4TN6A 4UMUA 4MVFA 4F6SA 4KIQA 2A2AA 3PYYA 5TO8A 3K5UA 1RDQE 4YBKA 2W9FB 3ZRLA 5M06A 3CKXA 4KS8A 1ZOEA 5CSHA 3WILA 4IAZA 3C4ZA 4LI5A 4MBIA 4XBUA 5TOZA 3OCTA 4BTFA 2ITZA 4L45A 5J7HA 3R28A 4J98A 4C4JA 4FEWA 3LQ5A 3O71A 4CZUA 1KV2A 4GT3A 3W2CA 3KRLA 3ZONA 3M42A 3QQKA 2ITQA 2C3KA 3B2WA 4WOVA 2VO6A 4AW2A 3ZEWA 5KUPA 2EXEA 2XK7A 2V22A 2WZJA 5DVRA 3NR9A 4FGBA 3CSVA 4D58A 3E8EA 3QZHA 1CKPA 4I20A 2VO7A 5M09A 1J91A 1QPEA 3L8VA 3VS6A 2W17A 3FMJA 5FQDC 4BCFA 3QHRA 3SX9A 3JYAA 3Q32A 3HA8A 3EQGA 2ZM1A 3GU7A 1WZYA 4GG5A 4XV1A 3W32A 3WZEA 4C36A 5A4CA 1NT2A 4TWNA 3B8RA 4CMOA 5EK7A 2BRGA 3VQHA 3DBDA 5JGAA 2YWVA 3DK7A 2RFEA 2XP2A 3VW8A 2HW7A 3OY1A 5CAPA 2BAQA 1DM2A 2NO3A 3DAEA 3V3VA 3FKLA 4DYMA 4DG2E 1SNUA 4IFGA 4HW7A 1Q24A 2ETKA 2ITWA 4FKVA 3G0EA 4YZNA 4F64A 2RFDA 4I4EA 2W4KA 3ZUTA 4D9UA 4E6AA 4M7IA 4IB0A 3UP7A 4PNKA 4E20A 4EKKA 2P55A 3E7VA 4WRGA 4BZOA 3DXPA 4EK5A 4C4FA 4MD7E 3MJ1A 4I5MA 4C57A 2VTMA 2WTIA 4FEQA 5CI6A 5AR8A 2J5FA 5AV2A 1FGKA 3QRTA 4G34A 4RFMA 4WNPA 4B9DA 3PIZA 2R3IA 4ITHA 2GQSA 3QRIA 4DFBA 2OJGA 3P79A 3PSBA 3V6RA 3JR1A 4L3PA 4ZZMA 3TCPA 4ACGA 4EHVA 4BCGA 2A4LA 5HX6A 5HG9A 3UQGA 2YERA 2WEVA 3KULA 3IDBA 5CAUA 4DE4A 3V04A 4PP9A 3LQ3A 3NUYA 1B6CB 4JR3A 5ANJA 2EB3A 4BZDA 3DJ5A 4LYNA 4MXOA 4ANLA 2BAJA 2OICA 2ZDTA 2QKWB 4JLCA 3EFWA 4FUXA 4TRLA 4CNHA 4F9AA 1NY3A 1P5EA 2NRUA 1DI9A 1ZRZA 4TY1A 4B8LA 3ZEPA 4YLJA 5HCYA 4L8MA 2WQEA 2XJ1A 5HBHA 5LVMA 4FV0A 3RPOA 3GP0A 2HOGA 4TYJA 4D1ZA 5HORA 3RHKA 3CGOA 4FKGA 3GBZA 4GVAA 5E8TA 4CQGA 3MTFA 4DEHA 3KXMA 1IASA 4ONAA 4BR3A 4BDHA 2CNVA 4FT9A 4WUNA 3P4KA 3NNVA 3QD3A 4EH4A 3R8ZA 1R0EA 4JDIA 4II5A 4MKCA 1HOWA 2XNOA 3L9PA 2V55A 2VD5A 3GUBA 3QLGA 2B9JA 3KXHA 3BCEA 3C51A 4L44A 5DH3A 1J1CA 4EQMA 3A4OX 4IBMA 2R5TA 3E5AA 3E64A 4BGGA 4QMXA 4QP7A 3RINA 2BRHA 4G17A 3HRCA 5T68A 4C34A 3WE4A 5I3RA 4Y8DA 2UW4A 5AUWA 4ZTQA 4ZZNA 2WGJA 2CMWA 4OTIA 3DJ7A 4JDKA 5FUTA 4FSZA 4OTGA 4C4GA 4IX3A 3KEXA 1UNLA 1W8CA 4E6CA 3UP2A 4M66A 2BVAA 1RE8A 3EQIA 4UN0C 2VTSA 3V6SA 3VBYA 2GSFA 3PUPA 3ZFYA 5B2LA 3UIBA 4GW8A 2YEXA 4HNFA 5BNJA 4RRVA 4FEXA 4I92A 1SVEA 3ODYX 2HXLA 4QMMA 5JZNA 5LCKA 2JBOA 3ZO2A 5FD2A 3ZO3A 4EORA 1ZYSA 5M55A 2W06A 2JDSA 4GCJA 3T8OA 1YOLA 4AZSA 3AT2A 4H39A 4WO5A 4RC2A 5TF9A 4DG0E 5IA2A 4WBOA 5JKGA 5CF5A 3W1FA 1PXIA 3UQCA 1QPJA 4IZAA 4FT0A 1X8BA 4FKRA 3FLZA 4M15A 3KGAA 1BYGA 3QTQA 2X2MA 3R9DA 3S4QA 4FTNA 3PJ2A 4DA5A 3SXRA 1GAGA 1ZXEA 3PTGA 5A46A 2OU7A 2PUIA 4Y85A 3FI4A 4EH6A 5M44A 5F95A 3LLAA 3SC1A 1OL6A 1O9UA 2UW5A 2OJJA 2XK3A 4IZ5A 4QMPA 1WBTA 4ZK5A 3OCBA 1ZMUA 3GC7A 3H0ZA 2CN5A 4TYHA 3KMWA 3OEFX 3W8QA 3DQWA 5D9HA 1G8AA 4KB8A 4UXQA 4BZNA 3KULB 1J1BA 4EUUA 3HV6A 3UNZA 5FEEA 2UZBA 2VAGA 4MF0A 5LCJA 4X2GA 4EJNA 3IW6A 3W2PA 4GUEA 3ORMA 4QRCA 2XYUA 4EK6A 3FXZA 5DEWA 2UW8A 5AADA 3N4VA 3O7LD 4WIHA 2VWVA 2ZYBA 4K8AA 2XBJA 4Q2AA 2ITXA 4OT6A 4G9CA 2IW8A 1WBSA 2PE1A 2RKUA 3GCPA 3QZFA 2VN9A 3TIYA 4BHNA 3WE8A 4D4YA 4PQNA 5JMSA 2UZOA 3S0OA 3N4TA 3OCGA 1G8SA 1KOAA 2GHGA 3L8PA 2QO9A 2VWXA 3UYTA 4EC8A 1LEZA 3U87A 5IUIA 3OWLA 3OXZA 3P7BA 3DDPA 3QTIA 4WG5A 3DFCB 2BTRA 4GYGA 2JBPA 3K54A 3KK8A 4M68A 2FH9A 1SVGA 3DV3A 2XNEA 4XG4A 3RK5A 4AOTA 4QTAA 3ACKA 4FKQA 2DUVA 4I41A 4E8AA 1PMNA 2VTJA 4ASEA 4O7SA 2RGPA 5AP3A 3WOWA 3G6GA 4BI0A 1FVTA 2ITUA 3BBTB 4EZ3A 3QCXA 2XF0A 3ZUUA 4C38A 5H8EA 1OKZA 4FV1A 5CAQA 3OWPA 4DCEA 2W1ZA 4MBJA 4RIOA 4U40A 2YDJA 3CTQA 3UMWA 4G3CA 3NX8A 2CGUA 4RVLA 3PXYA 4Y5HA 2XIKA 3QXPA 5M4CA 3PWYA 3BE2A 3UOHA 3CXWA 3RWQA 5J8IA 2PE0A 4EONA 4HOKA 3PFQA 4PF4A 2GHLA 2XRWA 3A7GA 3GFEA 4XMOA 1QL6A 4CV8A 1FVVA 4M84A 4EOIA 4F7NA 5HLWA 4OTRA 4EHGA 3UZTA 4F1MA 3EN9A 4AE9A 3LCDA 4JRVA 4Y46A 1ZARA 4E1ZA 2FSLX 3KF7A 2XMYA 2XZSA 1CTPE 3JVSA 4OAUC 2F9GA 4EH5A 4WNOA 3EQHA 3H4JA 4HGTA 1OKYA 4PP7A 3FMMA 3MFSA 2C4GA 4TNBA 1T46A 2QOCA 2G2FA 1YWNA 2I0HA 2JKQA 3E88A 4FNWA 4O0UA 4RSSA 5JZJA 3E62A 5DG5A 2HAKA 2WMAA 3ORTA 4RX5A 4EH9A 4XJ0A 3VO3A 5H9BA 5DWRA 5IKWA 2YM3A 2O2UA 4RZWA 4XV2A 5CNNA 4YJSA 3BWJA 3N9XA 4PPAA 4MD9E 2YA9A 4QMOA 4M12A 4GT5A 5E8WA 1DAWA 3FPMA 4TXCA 3KB7A 3FI2A 4MYGA 2E9UA 3PJ1A 4XOZA 5JT2A 3ORKA 4HJOA 4EOSA 3VUDA 4P2KA 4TYHB 4HYSA 3ORPA 3F6XA 4U97A 1RW8A 4UALA 3QLFA 4MH7A 3EQCA 3PA5A 4XG7A 3ZXZA 1MQ4A 3VC4A 4HGLA 2XM8A 3L9LA 5C1QB 4RVMA 2WQNA 1H0WA 2FSOX 3K2LA 5DPVA 4DITA 3GC8A 2CKQA 4JBVA 4Q5EA 3EH9A 4LOQA 4I1ZA 1ZOHA 4O2PA 3NCZA 3UIXA 4ZSAA 2JAMA 2ZM4A 2CPKE 5AFVA 4J52A 5EDPA 2ZM3A 2R7BA 3AC8A 3D7ZA 4NKAA 4BIBA 2W1GA 5ETCA 3L8SA 4ZLYA 5HESA 4K11A 4MD8E 4YJVA 1DI8A 1Y91A 4XX9A 5FXSA 3LCKA 2P2HA 3O7LB 4UWBA 4WNMA 2AC3A 3C0IA 3EB0A 4KRDA 3QCYA 4FTTA 1Z57A 3IKAA 3TDVA 1FOTA 3FC2A 4QMYA 3HL7A 4BVUA 3SA0A 4GU9A 4IB5A 4KKGA 4M97A 1BL6A 4FNZA 4ITJA 1REJA 2Z7SA 3DBQA 3QQLA 2WMRA 2JDVA 4FG9A 2J2IB 2A0CX 2X1NA 4FSQA 3FWQA 3AGMA 4F1TA 4WSQA 5AAEA 2HW6A 3QU0A 2VWZA 3OY3A 5KMKA 4YHTA 3SG8A 5GZ9A 4BFMA 3QQGA 2JDRA 4O84A 2GNGA 3TV6A 5IH6A 3KVWA 3IDPA 2WMXA 3R7UA 1TQMA 4S2ZA 2PULA 3COHA 2CKEA 3KMMA 4NT4A 3DXQA 4E4NA 3VUHA 4ZSJA 1JKLA 2X4ZA 4PY1A 3OF0A 5IU2A 3DB8A 3F3VA 1QCFA 5CS6A 4JAJA 4DT9A 4NJDA 3QUEA 4AT3A 3EQFA 1TVOA 3UVPA 4LL5A 5AMNA 2QO7A 4PUZA 4KABA 2OK1A 3TNQB 1OMWA 3WF5A 3VULA 3MH2A 4QP8A 2VTHA 2OZAB 2X9FA 4NH1A 2X8DA 1MRVA 1U5RA 4FK3A 3UTOA 5KCVA 2C1BA 1ZZLA 3JUHA 4RJ4A 5I4NA 2QR7A 3QTXA 3UYSA 5LMAA 2CNUA 1YI3A 3NUSA 3R0TA 3GQIA 4QQTA 4FTKA 3CEKA 2G01A 4FNXA 4U79A 3MWUA 5HBEA 2AYPA 3DBCA 3KXZA 3BU6A 4GEOA 2C0OA 4DHFA 3F3ZA 5HLPA 2J0IA 4L67A 4AF3A 3FEGA 3BEGA 5GHVA 3HP5A 3ZBFA 4GKIA 2X2LA 3ERKA 4DH5A 1UV5A 2QLUA 2R3QA 3CR0A 3EKNA 1KSWA 3Q4UA 4W9WA 3TNWA 4NW5A 4AGDA 2UW6A 4EOPA 3F88A 4B6LA 3FHRA 4AW5A 2PVMA 5DI1A 5CF4A 4JBOA 3ZS5A 4FEVA 3VUTA 2PZYA 3D15A 4G2FA 2QKRA 3G0FA 2R64A 1ZYLA 1OECA 2F7EE 4H3PA 2RF9A 2BTSA 2YHVA 2E9PA 3A62A 5AP1A 1PRYA 2C68A 3BYVA 4HPTE 4XLIA 4F9WA 3OP5A 5IQBA 3KREA 1B38A 2PVYA 2BRNA 3COMA 1ZOGA 2H8HA 2A27A 2EB2A 2O64A 2WPAA 4N57A 2YCQA 4EOOA 4YJUA 4NZWB 2UV2A 3PG1A 4FSNA 4YZMA 4TWOA 3UDBA 3OC1A 3TTJA 2YCSA 4HGEA 3OWKA 5HD7A 5LMBA 2XB7A 3VJOA 2CSNA 5L2WA 2OGVA 2QOIA 4BDFA 5IEVA 4Y73A 2C6IA 3RI1A 3SGCA 3OVVA 2FA2A 5BUIA 3BWFA 4TPTA 4R77A 1PY5A 4LQMA 3ZU7A 4NFNA 4A7CA 1WVYA 1CDKA 4O0RA 5LMKC 3AC5A 3MIAA 4MXXA 2B9IA 5GIPE 1APME 2RG5A 2Q0NA 1TKIA 5H2UA 2ZB0A 4QTBA 3COIA 3HAVA 5K0XA 2CCHA 2UZLA 3Q4CA 3SOCA 5CASA 3QFVA 3W33A 3OMVA 2BDWA 2WTKB 3QZGA 2BZJA 3HV5A 5C8NA 4H1JA 5DN3A 4QTEA 5B2MA 3C4EA 2FVDA 2YISA 4GV1A 4USEA 1XHAA 1AGWA 2QONA 4GH2A 4ANBA 4AA5A 1PHKA 3ULZA 2Z8CA 3FZRA 3OOGA 2E9NA 3VF8A 3CS9A 2XNPA 5CQWA 5H8GA 4IB3A 5ICPA 2YM5A 3NUPA 4O6LA 4TTHB 1XWSA 4XH6A 5L3AA 4RA5A 3GU6A 2ONLC 3R7GA 4D4VA 3D14A 5IEXA 4O7ZA 5KKRB 2Z2WA 2YIWA 2W5HA 2E9OA 4WBBB 3TV7A 3UG1A 4FK6A 4CMTA 2WXVA 3HEGA 5I9WA 3BLRA 3DTWA 4OTPA 2X6EA 5CVFA 3UIMA 4D28A 5HD4A 3WZUA 2Q83A 3C7QA 3V5QA 3QQUA 4FT7A 4PMSA 4QYGA 3ZXTA 3VF9A 1SM2A 2Z02A 2ITYA 3CIKA 3E8DA 2OO8X 2KULA 3D5UA 5AUUA 4TW9A 4U81A 4I5CA 2XKDA 3D0EA 5CSWA 2VX1A 3NW6A 4OTFA 4LGGA 1O6YA 4RX9A 4XG3A 3Q52A 2H96A 3EQBA 3TKIA 4KKEA 1ATPE 4FOCA 4FSYA 4YJQA 4M13A 4AN3A 1OIUA 4BKJA 2J6MA 4O22A 4HPUE 4F9BA 3BV3A 5J7BA 4BC6A 1NVSA 3NUNA 1QPDA 3NCGA 4J7BA 4L9IA 1GJOA 4TWPA 2PZPA 4ZJVA 3RVGA 3VNTA 4GT4A 2R3KA 3NIEA 4MWHA 4BRXA 3MJ2A 1PXLA 4XP3A 3ZDIA 5J9ZA 2FO0A 1W7HA 5DT3A 4J96A 3VUIA 2NRYA 3ZUVA 4YJNA 4L53A 4AGCA 1KE9A 2Y4IC 3R7OA 3TNPC 1ZYDA 5AIKA 1LP4A 2VWIA 2YCRA 3O8UA 4ACHA 1NA7A 3IS5A 5HG5A 5BYYA 4KBKA 1PXOA 3CPCA 3DB6A 3Q9YA 4C59A 1UWJA 2UZUE 3EKKA 2EXMA 2OJ9A 3KC3A 3NNXA 4R7IA 4BIEA 1H24A 2PUNA 3G51A 1H4LA 5DMZA 2X7FA 3I0QA 4U5JA 5JSMA 3AD4A 1YRPA 3MH1A 3NDMA 4OTHA 4YHJA 1WBOA 4QMTA 4QNYA 4BCQA 4JNWA 3KY2A 2CJMA 3K5VA 4I6HA 4B4LA 1VR2A 2X4FA 3EYGA 4MNEA 5EOBA 2C5VA 2C5NA 2GHMA 3BYOA 5CX9A 5EOLA 3ZHPC 4DFZE 4E5AX 2WTWA 4F1OA 2R3RA 3FZOA 5FEDA 4MAOA 5HGIA 4E5BA 2X9EA 4KWPA 2XVDA 3ROYA 2GU8A 1WAKA 3TZ8A 5AR5A 5F1ZA 3TDWA 4Z16A 2J0MB 4D2SA 4X3FC 2R0UA 2PUUA 3NZ0A 5L2TA 3WZKA 4XYFA 2DYLA 3W10A 2F49A 4QYEA 4ACDA 2PL0A 2QCSA 3GU5A 4RMZA 4KIKB 4LMUA 4C7TA 1BI7A 1URCA 2HENA 2PVFA 3AQVA 4GK3A 4L3LA 5K0KA 1U4DA 3R7YA 4NM5A 1XO2B 2VNWA 4RJ6A 4X3FA 1KOBA 2PVRA 4D2WA 4DH3A 3NAXA 2W96B 3OCSA 4ZAUA 1ZLTA 3KXXA 4F7SA 2AC5A 3IECA 4JDJA 1Q97A 3SD0A 4ALVA 3HV7A 5F94A 4ANNA 4AOIA 2QHNA 3NYVA 3FHIA 4RLKA 3QAME 4GK4A 4A07A 2E2BA 3C4FA 4L68A 4XG2A 4ZLZA 3CQUA 4U7ZA 3OHTA 2BROA 3VBQA 4BDGA 3VUGA 2YN8A 4U9AA 1JVPP 3AD5A 4RVKA 2P3GX 1ZY4A 5JRSA 5IQAA 2QR8A 5C27A 4NWMA 1K2PA 3EJ1A 4QMZA 3SLSA 4UX9A 4I0TA 2XK4A 3OXIA 3TI1A 5C8KA 3ITZA 4PL5A 4QMNA 4M8TA 4AG8A 3MI9A 3T3UA 5AV3A 2WNTA 3RJCA 3C5UA 3R8UA 3PIYA 3F5UA 2UZWE 5FDPA 4TYGA 1SYKA 4K6ZA 1GZ8A 5I9UA 1JBPE 1KE5A 4K18A 3FL5A 3QHWA 2PWLA 2RFNA 4LOPA 3VQUA 5IQFA 4ZEGA 2UUEA 3CTJA 2CN8A 3CQEA 4DH8A 1LEWA 5J5TA 1J7UA 2P0CA 2WELA 4G5JA 4O6EA 2ACXA 3GOKA 1Y6AA 3CGFA 3FKOA 2QC6A 4EOQA 2VO3A 3JY0A 3RHXA 4O86A 4BCNA 3KMUA 1WVXA 3NAYA 4MTAA 5EG3A 4ZIMA 4CFXA 4F09A 3RWPA 3D2KA 3ORNA 1YWRA 1H28A 3P9JA 3EN6A 3QGYA 3R8PA 2X8EA 4EYMA 1YOMA 3FLWA 5AR7A 4CZYB 4M3QA 3KRWA 3DOGA 3OW4A 2XIZA 1AQ1A 2OIDA 2UZDA 2UZVA 3DCVA 4NKSA 4FYNA 4RWJA 2XKEA 3TACA 4DTKA 4F0GA 4EOMA 5HIEA 3QRJA 4FUYA 5DE2A 3C5IA 2CCIA 2HWPA 3EFLA 4EZ7A 3D7TA 1IAJA 3H9FA 5FEQA 4S31A 1PXJA 4JBPA 4FIFA 4LGDA 5DR6A 4O81A 3QD2B 3PVGA 2C6OA 3E8CA 4CRSA 2JLDA 3HZTA 3P0MA 3AMAA 2PYWA 3LKMA 3QTRA 4CMUA 5CT7A 4MNEB 4RIXA 4O1PA 1OUKA 1XKKA 4ZOGA 3BELA 4NJ3A 4BGQA 5IA1A 4QMLA 4HYHA 1H1WA 2IZUA 4C4EA 1OBDA 5HVKA 1YXVA 4K9YA 5IQDA 3ORZA 4FSWA 3BHUA 1S9IA 4JJRA 3TUDA 3AC4A 4J97A 3Q04A 3PG3A 2V5QA 3UOKA 2O65A 3MVJA 4IC7A 4ANOA 4PTGA 4CQEA 5JFXA 3CTHA 2XKCA 2O5KA 5T3QA 4AXAA 4A9YA 4FV5A 1U59A 4FE2A 1ZY5A 3P78A 3NIZA 3QX2A 3U9NA 4TZRA 4JRNA 1QPCA 4IMYA 3ZM9A 5EHYA 4QP4A 3TJDA 4ZY5A 1U5QA 4YC3A 5EQYA 3GENA 2HZIA 3N51A 4A9UA 2OIBA 4OTQA 4QYHA 2YDIA 2XNGA 2FUMA 2DWBA 3BKBA 4FVRA 2C3IB 3KL8A 3MDYA 4IANA 3VS1A 4EQUA 5M4IA 3BU3A 2UW9A 5AX3A 3UO4A 2YIYA 3C50A 4C35A 1OVEA 2XNNA 3LFFA 4GFOA 4D2PA 3PE2A 2B4SB 3ZO1A 2WU6A 3PSCA 5AV1A 5ANGA 3FKNA 3LVPA 1HCLA 3NRMA 5E8VA 5IMEA 4OR5A 3WF7A 4AQCA 3U6IA 3EQDA 3S2PA 1BLXA 3MS9A 4I6BA 5FLFA 3AC1A 3IK3A 5FP5A 4JG8A 4A9TA 4Y95A 2HY81 5D7AA 3DTCA 5DEYA 3RAKA 5HEZA 4Q9SA 2AUHA 5EM5A 1OL7A 2XNBA 4CFFA 1H1PA 3HUBA 5JQ5A 1GY3A 1VEBA 5G6VA 5HOAA 3LJ2A 3PLSA 3BHVA 5KBQA 1JSUA 5A3XA 4BHZA 4FNYA 3ZH8A 4V0GA 4DGNA 2WKMA 4ERKA 1H0VA 2FSTX 4IAFA 5CQUA 3VS7A 2GNHA 2X7GA 2XUUA 5DT0A 4BKYA 1WVWA 5CENA 1WBNA 2PVHA 2YFXA 5IPJA 4DH7A 4I5HA 4IWPA 2QVSE 1Y57A 5E8UA 2G2IA 2PPQA 4YJOA 5IISA 4F99A 4OAVB 4YU2A 4FG8A 4U0IA 4CCUA 4APCA 2PY3A 4PPBA 4CG8A 4AP7A 3KU2A 3ORXA 4C61A 5JRQA 5HIDA 3O17A 3U4WA 5CLPA 4FKLA 4PMPA 3ZM4A 4UWCA 3C4XA 4IJ9A 4W4YA 3R02A 3SXFA 3CP9A 3DU8A 3FPQA 2PMOX 4N70A 4WSYA 5EDRA 4ASDA 3KRRA 2ZMDA 4MHAA 5KMIA 2OJFE 3TT0A 5HX8A 1EH4A 1A06A 2UZEA 2NPQA 4LOOA 5L2QA 3QX4A 3BLQA 3VUKA 2PVKA 3D7TB 1M2PA 2QG5A 5FM2A 3PRFA 2B54A 3ZTXA 4FR4A 2C6MA 2XS0A 3HX4A 2UVXA 2YM6A 3PJCA 4A4LA 4CFUA 2R3MA 4UYNA 3BU5A 4L7SA 3A7HA 4F4PA 3LCOA 5A54A 3TNIA 1H01A 1BUHA 5CXHA 4BCOA 4RIXB 4HGSA 4BB4A 4CD0A 3O50A 2R3HA 3TJCA 4TKSA 4EOKA 3KRJA 2QOFA 4RWIA 4YP8A 2KTYA 2HZ4A 3HRFA 5HE2A 4FZ6A 3OBJA 2IZSA 4K33A 5IQIA 4F7JA 4RJ3A 1TQPA 3ORLA 4AS0A 3LE6A 4F0FA 4ZSLA 4CKRA 4CFVA 4XCUA 4S33A 3RPYA 4HNIA 3TNHA 4WUAA 3OT8A 4E5WA 4FZFB 5D41A 4BYJA 3F82A 3BGPA 4RIWA 5L6WL 3D83A 3NPCA 2REIA 1YW2A 2ERKA 3G33A 3ODZX 4G3GA 4P5ZA 4FVPA 4KRCA 4XBRA 4YLKA 5E8YA 5CEQA 4ASZA 3LFCA 4B0GA 3U6JA 4R7BA 3Q60A 1M2RA 4W8DA 1R0PA 2YIQA 4B7TA 4OGRA 3F7WA 4FIHA 5GZ8A 4NFMA 2Y8OA 5JK3A 3F61A 1MP8A 4XS2A 5EM8A 5ACKA 4WKQA 5CSVA 4YLLA 3R8LA 2VTQA 4X2KA 3A4PA 2X39A 4YZ9A 4AZVA 5EQEA 4O1OA 4UEUA 3UBDA 4C62A 3PY3A 5A9UA 5BVFA 4O7TA 4XP2A 2OFUA 5C26A 3MESA 3MB6A 3HMNA 3FMKA 5EW9A 4YNEA 2R4BA 3ANQA 3HMPA 3QKKA 4DLJA 2XEZA 1ZAOA 3RPRA 3CD3A 4FZDB 2FGIA 4IIRA 4DEIA 2F2UA 4O82A 3QCQA 1JWHA 3IO7A 5BVNA 3ALNA 2IVUA 1Q8WA 2YITA 4FTJA 4IAKA 5B2KA 5HTBA 4ENXA 3TXOA 4XHKB 5CY3A 4W4XA 4A4OA 5IQGA 3FC1X 1IG1A 4XV9A 5IQEA 4YJTA 4HVDA 3UO5A 1FMKA 2WIHA 3EHAA 1VYWA 4O38A 4X2FA 3UC4A 2XNMA 3H10A 3M2WA 4GMYA 4CYJA 5ANEA 2YJSA 1FQ1B 3R7IA 4X7QA 4D4SA 4CFWA 2ZMCA 4YO6A 2VRXA 4V04A 3S00A 2F7ZE 1KWPA 4HVGA 3KXGA 3GVUA 3Q9XA 4NW6A 3NUAA 3EN7A 3QTZA 5CU4A 3WF9A 4ZJIA 3R9RA 4C3RA 5BVDA 3A99A 1J7IA 4MK0A 3RK7A 3PZHA 4EKLA 3T9IA 1M2QA 1KE6A 3W18A 4JL9A 5HE3A 4DBNA 3LOKA 3UVRA 2R3PA 4EOJA 2QLQA 3HMMA 3R71A 1K9AA 4Y83A 2ZB1A 3SHEA 3U51A 2R2PA 3VBWA 2F4JA 3LCSA 4F63A 4TYIA 3DKGA 3K3IA 1OBGA 4ZS0A 3U55A 4MCVA 3MYGA 1NVQA 3F2AA 2OF4A 5EFQA 4KA3A 4C2WA 2FYSA 4GK2A 5K4JA 4YSJA 4FTCA 3DS6A 4IE9A 4I3ZA 3PP1A 3UMXA 5CF6A 3A8WA 4O0TA 3ZZEA 3BGQA 1V1KA 2HIWA 1UU9A 4FTRA 3CJGA 1XH7A 5ACBC 4D0XA 4R1YA 4JR7A 5DT4A 5GINE 1XH6A 2O0UA 1YDRE 5LJJA 5FGKA 4RIYA 3O8PA 5KMJA 2BFYA 4RFZA 3RPVA 3NNUA 3F5PA 3TZ7A 1YHVA 3NYXA 4QQ5A 1OIYA 4ZSEA 1GZKA 1PYEA 3QUDA 3Q4TA 5BUJA 5KMLA 3HV3A 1NW1A 5CU6A 4EUTA 4FTOA 3BHHA 3V8SA 4UWYA 1T45A 4C4HA 3FSKA 4FTMA 2CGVA 3EMGA 3NUXA 2WMBA 3G9NA 4EZ5A 1VYZA 5M07A 4KSQA 3OS3A 1P4OA 3MFTA 4ENYA 4RQKA 4DFNA 4GKHA 2YM8A 3CE3A 3L9NA 4DLIA 4AGWA 3LXNA 2YWPA 3QALE 5E7RA 3SRVA 4BY9E 5HZNA 3BPRA 3OT3A 1MQBA 3S3IA 4U3YA 1UKHA 3PY1A 3ZFXA 3TM0A 5D12A 3DPKA 3MSSA 4AW1A 3FAAA 2Z7LA 4GIHA 4U80A 4ANMA 2WTVA 5KNJA 4BTMA 3GOPA 3IOKA 4L6QA 2PVJA 4BGHA 4D1SA 3GEQA 5HQ0A 3FY2A 2C5YA 4GJ3A 4ZLOA 2OBJA 3OUKA 5ETAA 4FGRA 5HKMA 4ASXA 1YI4A 3LJ1A 1HCKA 4G3EA 1YKRA 3FV8A 3HECA 4AZWA 2V0DA 3QA0A 4FV8A 3D4QA 4C0TA 5HCXA 4ZZOA 3FZSA 2W1CA 3BYUA 3TEIA 2GDOA 3TZMA 3QWJA 4D5KA 4DEGA 3DA6A 4V01A 3VRYA 4C02A 1I09A 5JH6A 4EWHA 3UQFA 4FV7A 3WIGA 4AX8A 3QTUA 4RT7A 4EK3A 2XIRA 2JKOA 3MH3A 3THBA 3I6UA 3WIKA 5M57A 2W7XA 3P86A 2O3PA 4W8EA 3QQJA 3S1HA 3TN8A 2E9VA 2PE2A 4JQ8A 4RJ5A 5A4QA 4FMQA 3DK3A 2JFMA 3SXSA 2QG7A 5D11A 2YM4A 3MBLA 4XUFA 4Z7HA 2VTNA 3QRKA 5AEPA 4O7LA 5IEYA 5C4LA 3KCFA 2RG6A 4FTUA 5CU3A 5HO7A 1IR3A 4KNBA 2XJ0A 1JKTA 5E8ZA 3CKWA 4QP3A 4KS7A 4OLIA 4YSMA 1O6KA 4UBAA 3V8TA 4G3FA 4ZTHA 3IGOA 3II5A 2QQ7A 2PVLA 3HA6A 1R78A 3DBFA 4QD6A 4CRLA 2I40A 2BFXA 1ERKA 5BVKA 3QUPA 2XM9A 1ZWSA 3DT1A 4FKIA 3UVQA 1L3RE 1Y8YA 4YTCA 5FWKK 1H26A 3F3WA 5AUZA 3ZC6A 3ZLWA 4BI2A 1JSTA 1F0QA 2BIYA 3CLYA 4F7LA 5BQ0A 4HZRA 4U44A 3CY3A 4GSBA 2PTKA 2VTOA 3FLNC 3LXKA 3QKMA 4FIGA 4MQ2A 4ZMEA 4RIYB 1WCCA 3BIZA 4OUCA 1JKKA 3KVXA 1VJYA 3QC9A 5C4KA 5CU0A 3I0OA 1OUYA 5KKRC 1K3AA 1J7LA 4DF3A 1ZYJA 3ZLSA 4YNOA 2JIIA 4Z3VA 5GZAA 5JGDA 4LV5A 1G5SA 1PXNA 3ZRMA 5CEOA 3OW3A 1G3NA 3Q9ZA 3ID6C 4GFMA 4D55A 4F70A 1YXXA 5AUTA 5CEIA 2YAAA 4I0RA 1OPJA 3R8MA 3SRVB 2OSCA 2IO6A 3OWJA 4JOAA 4LRJA 4QQJA 1W98A 4R78A 4FT5A 2WB8A 3CCNA 2ERZE 5CU2A 2XJ2A 1BL7A 1YXUA 4L00A 4O2ZA 5J87A 3QL8A 4X6QC 5HNGA 2J51A 5M4FA 4AUAA 3IDCA 2O8YA 3A7FA 4IAYA 4B8MA 3L9MA 1PKDA 3KQ7A 3EFJA 5K9IA 1FPUA 4UZHA 5AP0A 1UA2A 3IW5A 3FI3A 1H25A 1WBVA 4J8MA 4EH7A 2ITTA 3R8VA 2XCHA 3DXNA 2IW9A 2BHHA 5HCZA 3O23A 2X0GA 5JFWA 1GNGA 2EUFB 4FSRA 2WMUA 2YM7A 5K3YA 2WU7A 3P1AA 1YWVA 3OBGA 4DG3E 3GXLA 4KINA 5DOSA 1RJBA 5L4QA 1RQQA 2OIQA 3RM7A 1FVRA 4YHFA 4MF1A 4YTIA 4AW0A 4MEDA 1XR1A 3JY9A 2R3GA 4R8QA 3OTVA 4ZY6A 3FZ1A 3F2RA 3BHTA 3UNJA 4YZCA 2QI8A 5E92A 1YOJA 1PJKA 3EZRA 5CWZA 2CGWA 2WIPA 3BHYA 3WARA 3RM6A 4LG4A 2UW3A 3QA8A 5E8SA 3R9HA 5L6PA 3D94A 4CLJA 5HU9A 1L8TA 3ATTA 3AGLA 3PVUA 3V5LA 4IVDA 3JXWA 1Q8UA 4MXAA 1GZNA 2JGZA 3Q5ZA 3TWJA 3UIUA 3ZMMA 1OIRA 3I6WA 4O0SA 5HTIA 4D2RA 3HVCA 2WTDA 3WBLA 3ZSHA 3TIZA 5FDXA 1VZOA 3QZIA 3OXTA 2PSQA 2RL5A 4I4FA 4AT4A 3EWHA 5ANOA 4NM3A 4EBVA 1PMVA 3SV0A 3WYXA 4E6DA 3E3BX 5K4IA 3UZPA 3R63A 5CSXA 3BE9A 2UVYA 4LMNA 3PIXA 1MRUA 3AT4A 4GVJA 5GNKA 4ANSA 5HE1A 1MRYA 3RZBA 3AG9A 5LMKA 4MXYA 3Q53A 2DQ7X 2ITOA 3RPSA 2HK5A 5EHOA 3RAWA 4M67A 5AIRA 3GT8A 4YC6A 3UGCA 1H00A 4QP1A 1STCE 4BWKA 2BDJA 5IUHA 4JQEA 4G6OA 4IH8A 3MGYA 3GCVA 4L43A 3KN5A 2J5EA 3T9TA 4PWNA 5A6OA 2YABA 5CZHA 3W2SA 4D2TA 3DJ6A 3HNGA 5HIBA 2XEYA 3PRIA 5EYDA 3VVHA 1BI8A 4FOBA 2ESMA 1KV1A 1PMUA 3R21A 3RNIA 4IX6A 4CFNA 3SW7A 3N4UA 2R7IA 2EXCX 4F65A 2QHMA 3TKHA 2IG7A 3G5DA 1H27A 4ZP5A 3ZSGA 5FTOA 4AZTA 2ONLA 3LMIA 3WI6A 5CANA 4BCJA 2OW3A 2X7OA 4ZJJA 4G6NA 4YC8A 2YZAA 3Q4ZA 5JFVA 4AFEA 4PDOA 1P2AA 5KX8A 3UPZA 2UZNA 4LFIA 1TQIA 5E91A 3D5WA 4MNFA 3FE3A 3UOLA 3BX5A 2VTAA 1YHWA 1S9JA 4O91A 3ROCA 1PMEA 5FXQA 2GFCA 2CNQA 4C3PA 4M14A 3RZFA 2C47A 2IW6A 5C9CA 5I9ZA 4U45A 2PZIA 3GFWA 4M0YA 3QYWA 4N4SA 4TYEA 4EHEA 4RLLA 3FUPA 1BKXA 3FMLA 2RSVA 4IACA 1JAMA 2XA4A 4A9SA 3HGKA 1GIHA 2B7AA 1H08A 3QRUA 4IADA 5EYCA 5C03A 2YZLA 5D1JA 1OL2A 2OJIA 3L1SA 4QP2A 4FTIA 4N0SA 4IVCA 4KIOA 3R00A 4OBPA 1WBPA 3EQRA 5LQFA 3FQEA 4QQCA 3F2NA 4RJ7A 4DEEA 3GQLA 1UNHA 2VWWA 4PMTA 4JX3A 3Q2MA 4FIEA 4UV0A 1KE7A 3FXWA 4TT7A 3SW4A 4EH3A 5IA4A 3POZA 5HNBA 3NLBA 2WQBA 3Q9WA 2CDZA 1SMHA 2O63A 2W05A 4IHPA 2BCJA 3R01A 3EOCA 4USDA 4O7VA 4EBWA 1P14A 3AD6A 2J50A 3B2TA 4Z55A 3H3CA 3NW7A 3PZEA 4FZAB 3QKLA 4HYUA 2ZV7A 5FBOA 5HICA 4O7YA 2W5AA 2ZV9A 1AD5A 1CKIA 2J0KA 4EOLA 2J0JA 3AOXA 3IW7A 1CMKE 5JFSA 2OFVA 4H36A 4O7NA 4QMSA 2WMVA 5LVOA 4RX7A 2X6DA 3DBEA 3CJFA 3O2MA 3HYHA 3BLHA 3Q6UA 1XH4A 3R1NA 2BZHB 3VJNA 5CI7A 3E92A 4XEYA 4ACMA 4CKIA 5A14A 4IWQA 3D5VA 4ZTNA 5E1EA 1JPAA 4XOYA 5EI2A 1OI9A 4IM2A 3VAPA 3OOMA 3VS0A 1J3HA 3VN9A 4IZYA 4X3JA 2CLQA 3JS2A 4OTWA 2PU8A 4FV9A 4IWOA 3VRZA 4R5YA 3MA3A 4GS6A 5KMMA 3DQXA 1U46A 1XH8A 2YLEA 3PJ8A 1PF8A 2C6EA 2BALA 5IH5A 3R9OA 3UOJA 3PPZA 3KRXA 2Y7JA 1PYXA 2C30A 2IVTA 3NGAA 4FIIA 5GJDA 4P7EA 3V5PA 4ACCA 4KUJA 3C1XA 3CQWA 3G6HA 3ZFMA 4BCHA 5IZFA 3LM0A 3KCKA 2B9FA 3SOAA 4N6ZA 2VTPA 2GFSA 3DK6A 4QMWA 2Y0AA 2R3OA 5FG8A 2QOBA 3W8LA 2X8IA 3MW1A 3MPMA 4XG8A 2GS2A 2LAVA 4UY9A 3TUCA 1IAHA 1KE8A 4XRLA 4DN5A 4IM0A 1B39A 5HBJA 4BTKA 2BAKA 4BDBA 5LXMA 4AGUA 4YPSA 4FL3A 3CBLA 5ETIA 2YIRA 3LPBA 3MFRA 3WZDA 5A6NA 3I7CA 2XK9A 3MVLA 4FV2A 4BKZA 4F9YA 2IVSA 5AUXA 3OD6X 4OT5A 4D1XA 3GCQA 4FVQA 2VTTA 3MV5A 4FA2A 2FB8A 4LM5A 3RNYA 3Q2JA 1UU3A 3PXZA 4IVAA 2A19B 3PP0A 4S34A 1UKIA 4BDJA 4JS8A 3O96A 1XH5A 1BMKA 4JDHA 1FGIA 3FSFA 3R30A 4QTCA 5EW8A 2H9VA 2OXXA 5BVOA 1M7QA 3UO6A 5EYKA 4RQVA 3SVVA 4PV0A 2J4ZA 5M53A 3ZLXA 2UW7A 5J9YA 4WRSA 5AP5A 5JEBA 2J90A 2BRBA 4JAIA 3GNIB 1LR4A 2R3LA 3VW6A 4GG7A 2XKFA 2C6TA 5AUVA 4IX4A 2Y4IB 4D0WA 3U6HA 1QMZA 2B55A 3EN4A 3NYOA 3QD0A 4XG9A 2VZ6A 1UVRA 5K5XA 3E8NA 1FMOE 3VBTA 1UNGA 5DA3A 3ALOA 1OGUA 3VHEA 5TE0A 2BMCA 5AA9A 1I44A 1XBCA 5IH4A 2C6DA 2WAJA 1A9UA 4BWXA 4E4LA 4GL9A 4NL0A 3H9OA 4L7FA 4V05A 1OIQA 3VS3A 4R1VA 2UW0A 4DFLA 3H9RA 2PZ5A 3I60A 5EDQA 4JXFA 4CSVA 4W4VA 5AP2A 3ZBXA 5IQHA 4ANQA 4PNIA 3VBXA 2QU6A 3RCDA 3FJQE 4R6VA 5IDNA 2P2IA 5I9YA 4AAAA 2OF2A 4ALUA 1ZZ2A 3LAUA 4YZDA 4LL0A 4X3FB 4QMQA 3VHKA 3QYZA 4FICA 4U41A 4GYIA 3JPVA 2HXQA 5FXRA 5JN2A 2VUWA 4O27B 4H05A 1Q99A 5CTPA 5ANKA 2IZTA 2VWUA 4NEUA 2B1PA 3FMNA 4UMPA 4PL4A 2GS7A 3V51A 4BICA 5J9LA 2GTMA 1Q8ZA 4DEDA 4F08A 4DT8A 2OKRA 4QYYA 4AZFA
chains in the Genus database with same CATH superfamily
3FXXA 2BZKB 3SAYA 4JBQA 4IWDA 5M56A 4G1WA 3Q96A 5FTQA 4C3FA 1CKJA 5L8LA 4FSTA 4XRJA 3BRBA 4ARKA 5KBRA 3D2IA 4BDDA 5HG8A 4KKHA 2JIVA 2OG8A 2IEWA 3RP9A 5JGBA 1F5QA 2JITA 3OG7A 3DY7A 5F4NA 4AN2A 3OUNB 2H34A 3DZOA 1E9HA 4O0XA 3RMFA 2C3JA 2F7XE 2JC6A 5CZIA 2WFYA 4HCVA 4CYIA 2BUJA 4I0SA 5K5NA 3HMOA 3NNWA 4YR8A 1URWA 3QWKA 4ERWA 5FM3A 3F5GA 3ZZWA 1PKGA 4FYOA 5DLSA 3PXFA 4MWIA 5CEPA 1LUFA 4PPCA 1Q61A 4IAIA 5CYIA 5IUGA 2WMQA 2RIOA 3VBVA 3BQCA 3COKA 4OW8A 5CF8A 2R9SA 4EWQA 3GB2A 1V0BA 3Q5IA 4FKWA 4WNKA 2NNWB 1U54A 4DFYA 4YURA 4OBOA 4CLIA 3QQHA 2X81A 4CV9A 3GCUA 2QU5A 4FSMA 3BV2A 3IG7A 3KXNA 2BDFA 4PDPA 2OXYA 3UE4A 4CT1A 4FTQA 4PTEA 2VGOA 3LFAA 3RGFA 5AV0A 1CM8A 3D9VA 1PXMA 3JVRA 4O0WA 3NS9A 3VS4A 2VWBA 5M08A 5CVHA 5KE0A 5AV4A 2Y9QA 2R3FA 2XH5A 3R2BA 4EL9A 5ETFA 2VV9A 3W2OA 3EL7A 2ZV8A 1MUOA 4R3RA 3MVMA 3MY1A 4NU1A 4NTTA 5BVEA 3WZJA 3UZRA 4WA9A 4AT5A 3ZYAA 2ZAZA 2Y4PA 4DCAA 4C37A 5FTGA 4L3JA 3F69A 4GJ2A 5AX9A 3U4UA 4GRBA 4X21A 2QO2A 3UODA 5L2SA 4X2NA 5AR4A 3E87A 3QTSA 4PRJA 4QO9A 4O83A 2WD1A 4BCKA 3PVWA 2VTRA 3PA3A 5AA8A 2ETMA 2V62A 4O21A 4YO4A 3R7VA 2HY0A 3C0GA 4GFGA 4P5QA 3R2YA 4BDKA 3PXKA 3MFUA 4HVIA 5GIOE 5EH0A 5J79A 3U9CA 5AP6A 2NP8A 2QODA 3FLSA 3LQ8A 4XG6A 4DBXA 3F3UA 2JFLA 1M14A 4PX6A 3IPHA 5HO6A 3ZO4A 5HVJA 4E4XA 1ZMWA 4BBFA 5KZIA 2VNYA 4DH1A 5I9XA 4IEBA 3P7AA 3R6XA 3MY5A 4N6YA 4DGGA 5BX0A 4E93A 3A7IA 5LARA 2W1DA 3EL8A 3BEAA 1JKSA 4JQ7A 5EW3A 5HVYA 2IN6A 4QPSA 3R1SA 5LVLA 1OL5A 4CFMA 2I1MA 2W4JA 3F5XA 5KMOA 3VS5A 5TR6A 1OKWA 2XYNA 3HRBA 3LFBA 2GCDA 5LOHA 3LXLA 1ND4A 3T3VA 1NVRA 4FEUA 3RCJA 4AA0A 3W55A 4DGOA 4FF8A 2HYYA 5J1VA 5IA0A 2R3JA 1UU7A 3KK9A 3TG1A 5L2IA 2B0QA 4HVSA 4UMQA 4BCIA 1OITA 3VIDA 3ZCLA 4I5PA 3R1YA 4IB1A 3FLQA 4FV6A 3RAIA 2CGXA 1JQHA 1XQZA 2Z60A 5CVGA 3O8TA 1R3CA 5DFPA 1OPLA 4YBJA 2I0YA 4FTAA 3FMDA 4TNDA 4V0GB 1YHSA 3DKFA 1WMKA 5EKNA 2QOKA 1M17A 3HKOA 3HUCA 4A9RA 3V8WA 4E6QA 3EQPA 3O0GA 3PE1A 5A4EA 3ACJA 4C33A 2OXDA 5AAGA 3GC0A 4QT1A 3NVKI 4EK4A 1P4FA 3OZ6A 4J71A 3RTPA 4CGAA 3FL4A 5IQCA 4CTBA 2UZTA 2A1AB 5CAVA 3OFMA 4KBCA 4L01A 4NIFA 2W1HA 4E73A 5IMXA 4CZTA 4GUBA 1YQJA 1U54B 2JKMA 4BDCA 4C4IA 1YDTE 2W9ZB 4I94A 4L42A 4DC2A 3REPA 2XAOA 2FSMX 4BI1A 4DAWA 2ITNA 1E1XA 3F7ZA 3AC2A 3PWDA 2ZVAA 4MX9A 4WT6A 3LMGA 4FX3A 2PMIA 4E4MA 4XP0A 4I24A 3PY0A 5DGZA 5L8JA 2B52A 2C6KA 1W82A 4RZVA 1YXTA 1F3MC 4AE6A 2WEIA 5ANDA 2BKZA 2ZOQA 3ET7A 5KHWA 3MVHA 3C13A 5TKDA 3O5AA 3I1AA 5HO8A 3TZ9A 2BILB 5CEMA 3E63A 3GCSA 4UXLA 4DTAA 4IM3A 5G1XA 2V7AA 1IA9A 4FV3A 4M69A 4D2VA 4AN9A 1WBWA 2QOOA 4IZ7A 2JEDA 3LFSA 3MPAA 1FINA 4QPMA 4RPVA 3I7BA 1A48A 3FY0A 1OZ1A 2CHLA 3ORIA 3ATSA 1LPUA 4LRMA 4AXEA 2YDKA 4H3QA 5M4UA 3FMEA 3P5KA 4YUQA 3HMIA 3FQSA 2VTIA 2W1FA 4LUEA 5CNOA 4DFUA 2AQXA 3OEZA 1IA8A 4RIWB 5AJQA 3EYHA 4HZSA 4IC8A 4B99A 5LWNA 5BYZA 4Q5HA 2LGCA 3FYKX 3POOA 3U8WA 5A4TA 2OZAA 4DINA 5E1SA 4FKTA 2HWOA 2R3NA 2YAKA 5GJFA 3RALA 5ANIA 5GJGA 4DEBA 1H8FA 2W1IA 1W0XC 3ZLYA 3R83A 3DNDA 5AAFA 2G15A 4O7WA 4DGMA 4EHZA 1OM1A 3MA6A 2I6LA 3F66A 4QOXA 3PSDA 2VO0A 4TWCA 1ZYCA 3NUUA 4LV8A 1R39A 3IOPA 4FKUA 2WOTA 2CKOA 5E9EA 2BPMA 4CCBA 4E26A 4F9CA 3CD8A 4O0VA 2F57A 3LLTA 2IWIA 3FZTA 3OTUA 5C01A 3PPJA 3ENHA 2J7TA 5H8BA 5BMSA 4ORKA 3LFEA 4AA4A 2EWAA 5EM6A 2ETRA 4G16A 4RWLA 4WG3A 4RG0A 3AXWA 4LUDA 4O7RA 1Z5MA 3W16A 2ITVA 2BIKB 4XNEA 4XV3A 5T6KA 2C5OA 4J8NA 3P23A 3DZQA 4P4CA 3QTWA 4M0ZA 4CEGA 3FI8A 3W0SA 2QOQA 3DGKA 1Q8YA 2BRMA 4C58A 5DR2A 3GGFA 3V5TA 1KUTA 1JOWB 4NYEA 3EIDA 4EEVA 3DLSA 4PDSA 2C0TA 3LFQA 4TL0A 3LM5A 2B9HA 3KIOC 3FZPA 4A4XA 3ZDUA 3BI6A 4G5PA 3IGGA 2PZRA 5IA5A 2VWYA 5FRIA 4CXAA 3QXOA 4AACA 2A98A 4WD5A 4BBMA 4I22A 3O51A 4AU8A 4RC4A 4QP9A 5AUYA 5ITAA 4ZS4A 3UC3A 4NIFB 4EH8A 3M1SA 3EFKA 2VX3A 3DLZA 3FBVA 3QQFA 1PXPA 2VTLA 4IQ6A 2XBAA 1XJDA 1CSNA 4IW0A 4MXCA 3WF8A 4KAOA 5CALA 2WQOA 3ETAA 1UU8A 1YVJA 5H3QA 2WMSA 4Y72A 4F6WA 4Z9LA 1GZOA 3A60A 2IVVA 3ELJA 3LIJA 2WTKC 3LXPA 3GI3A 5J1WA 3E93A 4QMUA 5AP7A 3AT3A 3AMBA 5I0BA 3E7OA 3AMYA 1OPKA 2RFSA 3FYJX 4LRKA 2C6LA 2H6DA 4C8BA 1E1VA 5DR9A 4DDIA 2WQMA 4M69B 4EI4A 4RC3A 4CVAA 3G15A 5EM7A 2SRCA 3GU4A 3QD4A 3PXQA 4BYIA 4WG4A 4S30A 2QURA 2IPXA 4FL1A 4QPAA 4ZXTA 5DHJA 3LCTA 4BF2A 4D5HA 2UVZA 4CTCA 3P08A 3DAJA 4MQ1A 1TFFA 4DDGA 4A06A 1IEPA 3QCSA 4L52A 4YTHA 3ENMA 4GU6A 3NSZA 1GOLA 3FMHA 3RBWA 5F20A 4BIDA 2C3LA 2XCKA 2QNJA 3R04A 2GPHA 3IW4A 4ZTRA 2PHKA 4X2JA 4ITIA 2I0EA 1Q3WA 5I3OA 1Y8GA 2BHEA 3QF9A 1Q3DA 4MXZA 3V5JA 2BKKA 5DYJA 3CPBA 2GTNA 2C5XA 4QTDA 2WO6A 4FKPA 2VU3A 5I9VA 2HZ0A 1XH9A 4UZDA 2W5BA 4ZTLA 2PVNA 3UDSA 1JSVA 5EHLA 4BDAA 3UNKA 4HVHA 3ZSIA 5DRDA 3NVMB 5E4HA 3A8XA 2OH0E 4FIJA 3HAMA 3I81A 2PMNX 4IJPA 3TL8A 4BL1A 1XBBA 2P33A 3I4BA 4G9RA 2Z7RA 3A2CA 3Q6WA 2GQGA 1IRKA 3BQRA 3M11A 4IFCA 4J53A 4R5SA 4JG7A 4AFJA 4QMVA 5A4LA 2EU9A 2HELA 4E7WA 3NEWA 3W0OA 3FQHA 1XBAA 2JD5A 3BLAA 2PUPA 4OTDA 4EQCA 3ANRA 3I5NA 3MH0A 2HCKA 3FDNA 3LJ0A 5HHWA 4LGHA 4USFA 4WHZA 3MB7A 3R9NA 4IDTA 4RGJA 5L8KA 2PK9A 3L8XA 4FKOA 5D10A 2VGPA 3MN3A 2I0VA 5HLNA 3LMHA 4ZTSA 4FBXA 4P90A 4ZSGA 2JKKA 5F9EA 5CT0A 2ZV2A 3C9WA 5AWMA 5BYLA 2G9XA 2W1EA 4O96A 2G2HA 5E90A 4AZEA 3QGWA 5L6OA 3NW5A 4G6LA 3HDNA 5IG1A 5LWMA 3C4WA 2WHBA 4IXPA 3UG2A 4NUSA 4U6RA 1M52A 3QBNA 3W2QA 2OLCA 4H1MA 1BX6A 3R7EA 3PLAE 4EYJA 1NXKA 2Y6OA 2YIXA 4KD1A 4I21A 2WMTA 2GS6A 3DKOA 5EYMA 2I7QA 4NTSA 1OL1A 5FP6A 2V7OA 3R73A 4FC0A 2Z7QA 3V5WA 4YGAA 4W9XA 4D4RA 3U54A 2YACA 4O0YA 3HP2A 5EI6A 1WFCA 3WYYA 4FSUA 2JDOA 4OBQA 4YJRA 4RBLA 4J1RA 3DNEA 1H07A 4RVTA 4X6RA 2WMWA 4U3ZA 3BZ3A 3A7JA 2Y6MA 4ZY4A 3BYMA 4FODA 5DIAA 2JAVA 4G3DA 4MBLA 5DRBA 4KIKA 4HYIA 4U43A 4JT3A 3ZC5A 2GNJA 3Q3BA 2QOHA 3H0YA 3WF6A 4DTBA 3IW8A 4I23A 1OKVA 4RA4A 1UWHA 5TT7A 3KA0A 3PDTA 2QOLA 1W84A 1SVHA 4IVBA 5LVPA 4FKJA 3PJ3A 2OI4X 3CY2A 4BWPA 2GQRA 2YLFA 1GIJA 4KBAA 4UMRA 2XRUA 3DFAA 5EKOA 4NSTA 3UJGA 1FBNA 2W0JA 1Z9XA 2GMXA 3EZVA 1YDSE 4E3CA 2R0IA 3F9NA 2EVAA 3B8QA 2CLXA 2X2KA 3I5ZA 1H1QA 2C0IA 4CKJA 4XLVA 2OH4A 2Q0BA 4RWKA 4CG9A 3DKCA 3ZOSA 3LW0A 4QP6A 4J95A 2J9MA 2W99B 3RAHA 4D9TA 3F3TA 3HLLA 4NM0A 1M7NA 3LFNA 1V0OA 5C8MA 4NCTC 3SKCA 4JG6A 2PMLX 4H3BA 5EI8A 1SNXA 4C2VA 3MTLA 4NM7A 4BDIA 2XIXA 4ALWA 4R7HA 4CT2A 5KMNA 2YCFA 4RX8A 5AP4A 3ZRKA 4L46A 5KHXA 5EQPA 4X0MA 3BBWA 4BN1A 4NCTA 1Q41A 3E3PA 5FBNC 2J0LA 3IQ7A 3ULIA 5AR3A 5CXZA 1ST4A 2WOUA 5BPYA 3NWWA 5DBXA 5HE0A 2HZNA 5CAOA 3I79A 4PTCA 3C4CA 3R1QA 4BDEA 4FV4A 2ZJWA 4IX5A 3HDMA 1SZMA 4FL2A 3RKBA 3EN5A 3FLYA 4R3CA 4IAAA 4JIAA 5HG7A 4BCMA 1GIIA 1H1SA 3V01A 5BUEA 2GNLA 3PXRA 4UMTA 5HU3A 3LFDA 5HI2A 3IONA 3KKVA 2WTCA 2IJMA 4G31A 3KFAA 4FT3A 1W83A 3PA4A 4BTJA 5CEKA 4JIKA 1Q5KA 1JLUE 5HTCA 3TKUA 4DEAA 4DFXE 5KZ0A 5LVNA 2JDTA 4QYFA 3DDQA 2JIUA 3GU8A 4JVGA 5BVWA 1YXSA 4AOJA 4DGLC 2W4OA 4GIIA 4K77A 2GNFA 5AM7A 4EJ7A 2GNIA 3D5XA 4JI9A 2G1TA 2WTJA 4HCTA 4H58A 3RK9A 4W4WA 4BBEA 3UPXA 5J5SA 2ZDUA 3BGZA 2XK8A 3BYSA 3MY0A 4KSPA 4YTFA 4K0YA 4ZTMA 4YJPA 5E8XA 3R22A 4J99A 3CC6A 3NYNA 3TUBA 4ID7A 3A61A 1Y6BA 1Q62A 3C0HA 5BMMA 4ZMFA 2OWBA 4YMJA 4UB7A 5I5ZA 5JQ8A 2IZRA 2XIYA 5KO1A 2B53A 4FTLA 4F0IA 4Z7GA 1OGYA 2CKPA 1OB3A 1O6LA 2OZOA 3SQQA 4IDVA 4FI1A 4K1BA 4NK9A 1REKA 4YZBA 3NMUF 3PPKA 3MIYA 4BCPA 4AWIA 3K3JA 5CSPA 5IF1A 1Q4LA 3G2FA 4APPA 5AR2A 5IDPA 4Y5QA 4FKSA 4K2RA 4FG7A 4U8ZA 3TV4A 3NFFB 4Q9ZA 5HNIX 2BZIB 1ZMVA 3PVBA 5M51A 4PMMA 5B7VA 4EC9A 1DS5A 3AC3A 3KN6A 3QC4A 4I6FA 5DNRA 4EH2A 5B0XA 3VWAA 4R3PA 4JX7A 4RJ8A 1DAYA 4RFYA 4I6QA 4KIPA 4F78A 2VX0A 4I93A 4FJVA 2DS1A 5D7VA 3SG9A 4PL3A 3MPTA 3G9LX 3DAKA 3LHJA 3OROA 2ITPA 4U42A 3P7CA 2P4IA 3KF4A 3VUMA 3GC9A 2YJRA 4S32A 2F2CB 2C1AA 3HV4A 4EK8A 1H1RA 4FZ7A 3SDJA 3G90X 5IA3A 2QD9A 2XK6A 5J95A 4YPDA 1R1WA 2BR1A 4UYAA 1JNKA 1V0PA 2C69A 3S95A 3LZBA 3H30A 4PDYA 5AM6A 3W2RA 4HCUA 1PW2A 1Q8TA 1PXKA 4F6UA 4QNAA 1YI6A 3TTIA 3VS2A 4TN6A 4UMUA 4MVFA 4F6SA 4KIQA 2A2AA 3PYYA 5TO8A 3K5UA 1RDQE 4YBKA 2W9FB 3ZRLA 5M06A 3CKXA 4KS8A 1ZOEA 5CSHA 3WILA 4IAZA 3C4ZA 4LI5A 4MBIA 4XBUA 5TOZA 3OCTA 4BTFA 2ITZA 4L45A 5J7HA 3R28A 4J98A 4C4JA 4FEWA 3LQ5A 3O71A 4CZUA 1KV2A 4GT3A 3W2CA 3KRLA 3ZONA 3M42A 3QQKA 2ITQA 2C3KA 3B2WA 4WOVA 2VO6A 4AW2A 3ZEWA 5KUPA 2NYAA 2EXEA 2XK7A 2V22A 2WZJA 5DVRA 3NR9A 4FGBA 3CSVA 4D58A 3E8EA 3QZHA 1CKPA 4I20A 2VO7A 5M09A 1J91A 1QPEA 3L8VA 3VS6A 2W17A 3FMJA 5FQDC 4BCFA 3QHRA 3SX9A 3JYAA 3Q32A 3HA8A 3EQGA 4FRFA 2ZM1A 3GU7A 1WZYA 4GG5A 4XV1A 3W32A 3WZEA 4C36A 5A4CA 1NT2A 4TWNA 3B8RA 4CMOA 5EK7A 2BRGA 3VQHA 3DBDA 5JGAA 2YWVA 3DK7A 2RFEA 2XP2A 3VW8A 2HW7A 3OY1A 5CAPA 2BAQA 1DM2A 2NO3A 3DAEA 3V3VA 3FKLA 4DYMA 4DG2E 1SNUA 4IFGA 4HW7A 1Q24A 2ETKA 2ITWA 4FKVA 3G0EA 4YZNA 4F64A 2RFDA 4I4EA 2W4KA 3ZUTA 4D9UA 4E6AA 4M7IA 4IB0A 3UP7A 4PNKA 4E20A 4EKKA 2P55A 3E7VA 4WRGA 4BZOA 3DXPA 4DHZA 4EK5A 4C4FA 4MD7E 3MJ1A 4I5MA 4C57A 2VTMA 2WTIA 4FEQA 5CI6A 5AR8A 2J5FA 5AV2A 1FGKA 3QRTA 4G34A 4RFMA 4WNPA 4B9DA 3PIZA 2R3IA 4ITHA 2GQSA 3QRIA 4DFBA 2OJGA 3P79A 3PSBA 3V6RA 3JR1A 4L3PA 4ZZMA 3TCPA 4ACGA 4EHVA 4BCGA 2A4LA 5HX6A 5HG9A 3UQGA 3TYKA 2YERA 2WEVA 3KULA 3IDBA 5CAUA 3W0MA 4DE4A 3V04A 4PP9A 3LQ3A 3NUYA 1B6CB 4JR3A 5ANJA 2EB3A 4BZDA 3DJ5A 4LYNA 4MXOA 4ANLA 2BAJA 2OICA 2ZDTA 2QKWB 4JLCA 3EFWA 4FUXA 4TRLA 4CNHA 4F9AA 1NY3A 1P5EA 2NRUA 1DI9A 1ZRZA 4TY1A 4B8LA 3ZEPA 4YLJA 5HCYA 4L8MA 2WQEA 2XJ1A 5HBHA 5LVMA 4FV0A 3RPOA 3GP0A 2HOGA 4TYJA 4D1ZA 5HORA 3RHKA 3CGOA 4FKGA 3GBZA 4GVAA 5E8TA 4CQGA 3MTFA 4DEHA 3KXMA 1IASA 4ONAA 4BR3A 4BDHA 2CNVA 4FT9A 4WUNA 3P4KA 3NNVA 3QD3A 4EH4A 3R8ZA 1R0EA 4JDIA 4II5A 4MKCA 1HOWA 2XNOA 3L9PA 2V55A 2VD5A 3GUBA 3QLGA 2B9JA 3KXHA 3BCEA 3C51A 4L44A 5DH3A 1J1CA 4EQMA 3A4OX 4IBMA 2R5TA 3E5AA 3E64A 4BGGA 4QMXA 4QP7A 3RINA 2BRHA 4G17A 3HRCA 5T68A 4C34A 3WE4A 5I3RA 4Y8DA 2UW4A 5AUWA 4ZTQA 4ZZNA 2WGJA 2CMWA 4OTIA 3DJ7A 4JDKA 5FUTA 4FSZA 4OTGA 4C4GA 4IX3A 3KEXA 1UNLA 1W8CA 4E6CA 3UP2A 4M66A 2BVAA 1RE8A 4DHIB 3EQIA 4UN0C 2VTSA 3V6SA 3VBYA 2GSFA 3PUPA 3ZFYA 5B2LA 3UIBA 4GW8A 2YEXA 4HNFA 5BNJA 4QDEA 4RRVA 4FEXA 4I92A 1SVEA 3ODYX 2HXLA 4QMMA 5JZNA 5LCKA 2JBOA 3ZO2A 5FD2A 3ZO3A 4EORA 1ZYSA 5M55A 2W06A 2JDSA 4GCJA 3T8OA 1YOLA 4AZSA 3AT2A 4H39A 4WO5A 4RC2A 5TF9A 4DG0E 5IA2A 4WBOA 5JKGA 5CF5A 3W1FA 1PXIA 3UQCA 1QPJA 4IZAA 3BL7A 4FT0A 1X8BA 4FKRA 3FLZA 4M15A 3KGAA 1BYGA 2IF8A 2X2MA 3QTQA 3R9DA 3S4QA 4FTNA 3PJ2A 4DA5A 3SXRA 1GAGA 1ZXEA 3PTGA 5A46A 2OU7A 2PUIA 4Y85A 3FI4A 4EH6A 5M44A 5F95A 3LLAA 3SC1A 1OL6A 1O9UA 2UW5A 2OJJA 2XK3A 4IZ5A 4QMPA 1WBTA 4ZK5A 3OCBA 1ZMUA 3GC7A 3H0ZA 2CN5A 4TYHA 3KMWA 3OEFX 3W8QA 3DQWA 5D9HA 1G8AA 4KB8A 4UXQA 4BZNA 3KULB 1J1BA 4EUUA 3HV6A 3UNZA 5FEEA 2UZBA 2VAGA 4MF0A 5LCJA 4X2GA 4EJNA 3IW6A 3W2PA 4GUEA 3ORMA 4QRCA 2XYUA 4EK6A 3FXZA 5DEWA 2UW8A 5AADA 3N4VA 3O7LD 4WIHA 2VWVA 2ZYBA 4K8AA 3W0QA 2XBJA 4Q2AA 2ITXA 4OT6A 4G9CA 2IW8A 1WBSA 2PE1A 2RKUA 3GCPA 3QZFA 2VN9A 3TIYA 4BHNA 3WE8A 4D4YA 4PQNA 5JMSA 2UZOA 3S0OA 3N4TA 3OCGA 1G8SA 1KOAA 2GHGA 3L8PA 2QO9A 2VWXA 3UYTA 4EC8A 1LEZA 3U87A 5IUIA 3OWLA 3OXZA 3P7BA 3DDPA 3QTIA 4WG5A 3DFCB 2BTRA 4GYGA 2JBPA 3K54A 3KK8A 4M68A 2FH9A 1SVGA 3DV3A 4O4CA 2XNEA 4XG4A 3RK5A 4AOTA 4QTAA 3ACKA 4FKQA 2DUVA 4I41A 4E8AA 1PMNA 2VTJA 4ASEA 4O7SA 2RGPA 5AP3A 3WOWA 3G6GA 4BI0A 1FVTA 2ITUA 3BBTB 4EZ3A 3QCXA 2XF0A 3ZUUA 4C38A 5H8EA 1OKZA 4FV1A 5CAQA 3OWPA 4DCEA 2W1ZA 4MBJA 4RIOA 4U40A 2YDJA 3CTQA 3UMWA 4G3CA 3NX8A 2CGUA 4RVLA 3PXYA 4Y5HA 2XIKA 3QXPA 5M4CA 3PWYA 3BE2A 3UOHA 3CXWA 3RWQA 5J8IA 2PE0A 4EONA 4HOKA 3PFQA 4PF4A 2GHLA 2XRWA 3A7GA 3GFEA 4XMOA 1QL6A 4CV8A 1FVVA 4M84A 4EOIA 4F7NA 5HLWA 4OTRA 4EHGA 3UZTA 4F1MA 3EN9A 4AE9A 3LCDA 4JRVA 4Y46A 1ZARA 4E1ZA 2FSLX 3KF7A 2XMYA 2XZSA 1CTPE 3JVSA 4OAUC 2F9GA 4EH5A 4O4FA 4WNOA 3EQHA 3H4JA 4HGTA 1OKYA 4PP7A 3FMMA 3MFSA 2C4GA 1W2FA 4TNBA 1T46A 2QOCA 2G2FA 1YWNA 2I0HA 2JKQA 3E88A 4FNWA 4O0UA 4RSSA 5JZJA 3E62A 5DG5A 2HAKA 2WMAA 3ORTA 4RX5A 4EH9A 4XJ0A 3VO3A 5H9BA 5DWRA 5IKWA 2YM3A 2O2UA 4RZWA 4XV2A 5CNNA 4YJSA 3BWJA 3N9XA 4PPAA 4MD9E 2YA9A 4QMOA 4M12A 4GT5A 5E8WA 1DAWA 3FPMA 4TXCA 3KB7A 3FI2A 4MYGA 2E9UA 3PJ1A 4XOZA 5JT2A 3ORKA 4HJOA 4EOSA 3VUDA 4P2KA 4TYHB 4HYSA 3ORPA 3F6XA 4U97A 1RW8A 4UALA 3QLFA 4MH7A 3EQCA 3PA5A 4XG7A 3ZXZA 1MQ4A 3VC4A 4HGLA 2XARA 2XM8A 3L9LA 5C1QB 4RVMA 2WQNA 1H0WA 2FSOX 3K2LA 5DPVA 4DITA 3GC8A 2CKQA 4JBVA 4Q5EA 3EH9A 4LOQA 4I1ZA 1ZOHA 4O2PA 3NCZA 3UIXA 4ZSAA 2JAMA 2ZM4A 2CPKE 5AFVA 4J52A 5EDPA 2ZM3A 2R7BA 3AC8A 3D7ZA 4NKAA 4BIBA 2W1GA 5ETCA 3L8SA 4ZLYA 5HESA 4K11A 4MD8E 4YJVA 1DI8A 1Y91A 4XX9A 5FXSA 3W0RA 3LCKA 2P2HA 3O7LB 4UWBA 4WNMA 2AC3A 3C0IA 3EB0A 4KRDA 3QCYA 4FTTA 1Z57A 3IKAA 3TDVA 1FOTA 3FC2A 4QMYA 3HL7A 4BVUA 3SA0A 4GU9A 4IB5A 4KKGA 4M97A 1BL6A 4FNZA 4ITJA 1REJA 2Z7SA 3DBQA 3QQLA 2WMRA 2JDVA 4FG9A 2J2IB 2A0CX 2X1NA 4FSQA 3FWQA 3AGMA 4F1TA 4WSQA 5AAEA 2HW6A 3QU0A 2VWZA 3OY3A 5KMKA 4YHTA 3SG8A 5GZ9A 4BFMA 3QQGA 2JDRA 4O84A 2GNGA 3TV6A 1XMMA 5IH6A 3KVWA 3IDPA 2WMXA 3R7UA 1TQMA 4S2ZA 2PULA 3COHA 2CKEA 3KMMA 4NT4A 3DXQA 4E4NA 3VUHA 4ZSJA 1JKLA 2X4ZA 4PY1A 3OF0A 5IU2A 3DB8A 3F3VA 1QCFA 5CS6A 4AXCA 4JAJA 4DT9A 4NJDA 3QUEA 4AT3A 3EQFA 1TVOA 3UVPA 4LL5A 5AMNA 2QO7A 4PUZA 4KABA 2OK1A 3TNQB 1OMWA 3WF5A 3VULA 3MH2A 4QP8A 2VTHA 2OZAB 2X9FA 4NH1A 2X8DA 1MRVA 1U5RA 4FK3A 3UTOA 5KCVA 2C1BA 1ZZLA 3JUHA 4RJ4A 5I4NA 2QR7A 3QTXA 3UYSA 5LMAA 2CNUA 1YI3A 3NUSA 3R0TA 3GQIA 4QQTA 4FTKA 3CEKA 2G01A 4FNXA 4U79A 3MWUA 5HBEA 2AYPA 3DBCA 3KXZA 3BU6A 4GEOA 2C0OA 2XALA 4DHFA 3F3ZA 5HLPA 2J0IA 4L67A 4AF3A 3FEGA 3BEGA 5GHVA 3HP5A 3ZBFA 4GKIA 2X2LA 3ERKA 4DH5A 1UV5A 2QLUA 2R3QA 3CR0A 3EKNA 1KSWA 3Q4UA 4W9WA 3TNWA 4NW5A 4AGDA 2UW6A 4EOPA 3F88A 4B6LA 3FHRA 4AW5A 2PVMA 5DI1A 5CF4A 4JBOA 3ZS5A 4FEVA 3VUTA 2PZYA 3D15A 4G2FA 2QKRA 3G0FA 2R64A 1ZYLA 1OECA 2F7EE 4H3PA 2RF9A 2BTSA 2YHVA 2E9PA 3A62A 5AP1A 1PRYA 2C68A 3BYVA 4HPTE 4XLIA 4F9WA 3OP5A 5IQBA 3KREA 1B38A 2PVYA