3ZO3A

The synthesis and evaluation of diazaspirocyclic protein kinase inhibitors
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
340
structure length
337
Chain Sequence
EQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor
molecule keywords CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA
publication title Synthesis and evaluation of heteroaryl substituted diazaspirocycles as scaffolds to probe the ATP-binding site of protein kinases.
pubmed doi rcsb
source organism Bos taurus
total genus 104
structure length 337
sequence length 340
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zo3A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zo3A02
3F5XA 3ZRKA 4RIXA 3TL8A 1JSTA 5L8KA 3TNPC 2Y0AA 1RJBA 5DBXA 3JY9A 4ITHA 4TYHB 4YHFA 4C62A 1DI9A 3CTHA 3R04A 1VYWA 1PMVA 4RRVA 5HNBA 5CAUA 2CHLA 5CSPA 5M44A 3POOA 5HBJA 1W8CA 5CU2A 3ZU7A 1Q8ZA 3ZFXA 3C51A 4Z55A 5ETCA 3R8PA 2WO6A 3DTWA 3MBLA 2J9MA 5EM7A 2W5HA 3DGKA 5M55A 4B8MA 4FV5A 2CSNA 3DA6A 3OP5A 3KF4A 3ZONA 4F0FA 2NPQA 2ZM3A 1FPUA 4I5MA 2WMXA 4BICA 4UXQA 3COHA 4GRBA 3MN3A 2OICA 3CGOA 5CEQA 5IA4A 4EK4A 2P2IA 1O6YA 3LFQA 2JGZA 3D7TB 3FPMA 4CZYB 3CQWA 2W1EA 4U41A 1KE7A 2C6KA 2NRUA 4TTHB 4YZ9A 5F4NA 4WOVA 4WNKA 5E1EA 2O2UA 5LARA 5BX0A 2ZV2A 3KL8A 4UMUA 3FMJA 3QXOA 5L3AA 3HP5A 2OU7A 4XG7A 3W2QA 1GNGA 1CMKE 3E3PA 4EYJA 3GCPA 3FY2A 4RZVA 3SXFA 4L46A 2XVDA 3MTLA 4LOOA 2OZOA 3FZSA 3SXSA 4R7HA 3FUPA 3LFNA 3LQ5A 3OT8A 3V5TA 2I0EA 3DDPA 3W8LA 4JNWA 2F9GA 3OTUA 4JVGA 2Y4IC 2WEVA 3LCTA 3L8SA 3LFBA 1JKLA 4X2JA 2ITTA 4TWNA 4QQTA 3CS9A 4GT4A 4EH4A 3RALA 4LUDA 3ERKA 3RM6A 5CU3A 2WPAA 3HMIA 3NW6A 1Z9XA 2PVFA 4H3PA 4X3FC 3UQCA 4FKOA 2IWIA 3ZYAA 3BGQA 3BHVA 3QUEA 3DQXA 5IA3A 2VGOA 4EEVA 2WU7A 4FL2A 5AUZA 3D7ZA 4G9RA 4RFYA 2BROA 4IFGA 5FTGA 3ZO4A 4XG8A 1G8SA 1OBDA 3LAUA 4IC8A 3RPYA 2YACA 5DR6A 3NNXA 3V5JA 3MTFA 3F2RA 4Y46A 5JFXA 2YERA 4H36A 2BHEA 3JVSA 2FYSA 4FIEA 2UZWE 5EG3A 5JRQA 1MRUA 2YZLA 3QCXA 4YP8A 3V6RA 2CJMA 4RVLA 1PRYA 4FTNA 4BKJA 5C8NA 4ASZA 4F64A 3WE8A 3LMHA 3LFDA 2E9PA 2JKKA 3LCOA 4KSPA 2W7XA 4QMMA 3PY3A 4EJNA 3BZ3A 3ORLA 2OWBA 5J5TA 2PUNA 4UMPA 4DEDA 4N6YA 2XYNA 3RHKA 5A6OA 2XNOA 3TJCA 3PG3A 3E7OA 3PA3A 4O0UA 2V62A 4NUSA 5L2TA 3Q4UA 4HVHA 4L01A 1OL5A 4PTGA 3MS9A 4E8AA 3Q5ZA 3V5QA 3ZH8A 2J0MB 3H9OA 3FQSA 3CY2A 5L6OA 3G9NA 4HYSA 4BRXA 4JRNA 4X3JA 1U5RA 4K11A 2BVAA 4KRCA 2Q0NA 5IUGA 1VZOA 2FSMX 5G1XA 5LXMA 3H30A 4ACGA 3N4VA 4JDKA 4EJ7A 2QURA 4IH8A 4O84A 4RJ8A 2O8YA 3MESA 4DN5A 3F3UA 3UO4A 5I9XA 2C6LA 3CR0A 2XUUA 4MBIA 4JBVA 3ZEPA 3SXRA 4CCBA 4K2RA 4EHVA 2PVHA 5FP5A 4F7NA 4C8BA 4O21A 4P90A 2X2MA 4WRGA 1Q3DA 2Q0BA 4QP7A 5DA3A 1P4OA 4HNIA 4AZTA 4RX5A 4FKUA 3UDBA 4D4VA 4I4FA 5AP6A 5D1JA 5H8GA 2W05A 5HG5A 4F63A 3UPXA 4TYEA 3U9NA 5M51A 3P78A 2X2LA 4ZS0A 5LOHA 3SD0A 2GNFA 5CU0A 3AD5A 2YAKA 3VBVA 3OBJA 3VW8A 3R63A 4EC9A 4D2RA 5CSWA 2W1HA 2R3QA 4NW6A 5HD7A 5JT2A 4R5SA 3QF9A 4EZ7A 4ITJA 3I79A 4FOCA 3SDJA 3H3CA 1PKDA 4LM5A 4OTIA 4F4PA 4G1WA 4LGGA 2OO8X 4HVSA 4CXAA 1R3CA 3TZ9A 4I24A 1CM8A 2UVXA 4ZSJA 4TT7A 4E6QA 2XKCA 3BV2A 2HY0A 4QQ5A 4A4LA 4DTBA 4FV9A 2V0DA 3QKMA 3EKKA 1JKKA 3UMXA 4ITIA 3TNQB 4HGEA 3UZPA 4AW0A 2JBOA 4HYIA 2UZNA 5ETAA 2HWOA 3MH1A 1YHSA 2BALA 3FQHA 5GZAA 3V6SA 5M09A 2QO9A 5F94A 4ZSLA 5HQ0A 3L9NA 2PE2A 2GTMA 4MWIA 4PDOA 4K18A 4W4WA 2G2FA 5E91A 2JD5A 1YHVA 2GS6A 1XH8A 2WQBA 4XX9A 5IQIA 2J5EA 4HW7A 4DEIA 3JR1A 3DAKA 4Q5HA 4R5YA 3ZBFA 3QZIA 4LGDA 3IW4A 1S9IA 5K5XA 4GUBA 2XM9A 2JAMA 5CSVA 5H8BA 3IONA 3DPKA 3AT3A 5T3QA 2VWUA 3ZLXA 5LWNA 1GAGA 2C6EA 2BIYA 4RC3A 1TQPA 3BE9A 3QTWA 1PHKA 3VUMA 4NL0A 5FD2A 4I1ZA 3R9DA 4KA3A 2R3MA 5B2MA 4MF1A 3R73A 4KS8A 2WMBA 4D2PA 4YUQA 1KV2A 2YJSA 1XO2B 3E5AA 3KN6A 4KKHA 2QU5A 4QPSA 3TKIA 3WYXA 4ZS4A 5D12A 4FKLA 5JK3A 4R3PA 1PMUA 5EM6A 3UJGA 5JQ5A 5IMEA 4RT7A 3RNYA 2GMXA 1YXVA 3ORPA 4U45A 5E92A 2KTYA 4BCNA 4ENYA 4Y72A 2EXEA 2Z7LA 2ZMCA 5DOSA 3VQUA 2WQNA 5DN3A 3MDYA 2QKRA 2FB8A 3JY0A 1FVTA 1OPKA 2WELA 4QP1A 1Q41A 3VUGA 5JGDA 4L42A 5F1ZA 2VWBA 5EI2A 1JLUE 4S31A 2I7QA 5KMNA 4II5A 3TIYA 2CMWA 4EL9A 2KULA 3S0OA 3POZA 2WKMA 4RJ6A 2W5BA 1IAHA 3PJ3A 1L8TA 3O51A 1W83A 4GEOA 2VX1A 3P7CA 3R7YA 4EK5A 1WVYA 3FMLA 3KN5A 1Q99A 2EB3A 1ZMUA 4PMMA 1ZLTA 3A7JA 5AV2A 2OIBA 1MQ4A 2QQ7A 4OR5A 4AA0A 5JMSA 5J9LA 1QPCA 4FTMA 2ZVAA 2W1DA 2YM6A 2XCKA 3AT4A 2YIWA 3FMNA 3GENA 3LMGA 3MA3A 5D7AA 5EKOA 4RC2A 2QONA 3O7LD 5A4QA 4GKHA 4FF8A 3MIAA 4AWIA 3UODA 3WF8A 4KUJA 5FTOA 4BDCA 1W84A 3QAME 2GTNA 3RK7A 4CG9A 1APME 3D5UA 4JDIA 1R78A 4FT0A 5IA0A 3R71A 3UNKA 2UZEA 3E3BX 5DG5A 5M4IA 3QX2A 4TPTA 2GNJA 3A8XA 4I94A 5AA9A 2XBAA 1FGIA 2HXLA 1U54A 1H4LA 2CN5A 5HLPA 5BYZA 3FMDA 5CXZA 4R78A 3HAMA 4EQMA 3FLSA 2QG7A 1UWHA 3U54A 3SGCA 2WOUA 3SRVA 2QO2A 1CTPE 3KK8A 3F82A 4RIOA 2Z7QA 2IZRA 3QRIA 4XG3A 3ZO3A 1J3HA 5IH5A 2X7GA 4D55A 4BVUA 4QP8A 3ITZA 4V01A 3UYTA 4DH8A 1CDKA 2PHKA 3H9FA 1NVSA 2HWPA 2PZRA 3RPSA 4RWIA 4AW1A 3DXQA 3NUUA 1ZOGA 1PXLA 3PSDA 2R3KA 4NCTC 2B4SB 3P23A 1LPUA 3ZUVA 2IN6A 4WUNA 2YLEA 5KMOA 2FVDA 5FRIA 4O22A 3UQFA 3RJCA 2EXMA 2UUEA 2C6DA 4I0SA 3FPQA 1CKPA 4U9AA 3FMMA 5BMMA 3W2SA 4J52A 4FTJA 4MVFA 3COKA 1H08A 4RIWA 4PTEA 2XCHA 4XBRA 1OUYA 3OUNB 3DOGA 3B2WA 3NNWA 4MXZA 4EBWA 2G2HA 3QZGA 5HGIA 1JSUA 4E4XA 2ZB0A 5K3YA 5IZFA 5CAVA 4F0GA 2YM5A 5CY3A 5GIOE 4IB1A 2R9SA 2Z2WA 4XP0A 3W10A 5DE2A 4EC8A 1ZYDA 4L3PA 4ANMA 4D5KA 1NT2A 4F6SA 2EB2A 4YLLA 2DUVA 4FSTA 4BF2A 3S3IA 3C0IA 3ZLWA 4DYMA 4QMNA 1J7UA 2CN8A 3GC0A 3F9NA 3ORZA 3PUPA 4RVMA 3EQDA 3TZ7A 4KNBA 4J8NA 1XH6A 3SVVA 4JG8A 3CQUA 1PXKA 3DB6A 5HESA 4ALWA 4G6NA 3V5WA 3ZRLA 4AAAA 5FXQA 2EU9A 3PSCA 2PL0A 3QL8A 2PK9A 4G3CA 3E92A 4OTGA 4IWPA 4L68A 3P5KA 2C1BA 3VO3A 1ZZ2A 4UWCA 3BHUA 1L3RE 3ORTA 3RZBA 3VBQA 4BC6A 5AV4A 3CKWA 3EB0A 3K3IA 3GXLA 4QD6A 3R1SA 3Q4TA 4CLIA 4U6RA 5HO7A 2J5FA 3VJNA 5J95A 1FINA 5ACKA 1WBOA 4XJ0A 5A14A 4PUZA 5JSMA 2O65A 2ZDUA 4XG6A 2OZAB 3QCYA 4FK6A 1YXTA 3E63A 3PJ2A 4V0GA 4J53A 3H4JA 4YJUA 5CF5A 4M69B 3MY0A 2Z60A 3BELA 2RGPA 3DBDA 3PVGA 3Q60A 4BCPA 4E5AX 4BDJA 3THBA 3VRYA 5IMXA 4CT2A 2WQOA 3ENHA 3QTXA 4EKLA 5AV1A 2XK9A 3TV4A 4L45A 3TJDA 3ZO2A 3HV3A 3C1XA 5CT0A 2P33A 1ZY4A 4WBBB 2PMIA 5FQDC 1O6LA 3M11A 4R7BA 3Q9WA 4JX7A 1UA2A 2QC6A 3U9CA 5E1SA 4PV0A 4CKRA 5IUHA 1PXNA 3M1SA 3AXWA 3VUIA 2WAJA 4I5CA 2C68A 4BKYA 3DT1A 5ICPA 2Z7RA 4YURA 4ZTHA 3DV3A 2HW7A 3L9LA 5K0KA 5HG7A 4HVDA 4LI5A 3MB7A 4PDSA 4M12A 3PDTA 1B6CB 5HD4A 4O7SA 2IZSA 2H34A 5IQDA 3ENMA 2VNYA 4L3LA 1MRYA 3ANRA 5CEMA 3ATSA 2QKWB 2QOCA 3VS3A 2YM7A 2A0CX 3QYZA 1A9UA 5ANEA 4UWYA 4Q9SA 3RTPA 4FGRA 4D58A 3JUHA 2WU6A 4JQ7A 4FEQA 3UVRA 3NUAA 2QODA 4IANA 2AC3A 4O38A 3UG2A 3KVWA 4CFXA 3UIXA 3NCZA 4K8AA 3G2FA 3R7IA 4APCA 2XNNA 2IW9A 4FV3A 2OLCA 4BDBA 3V3VA 4CYJA 1GIJA 2VN9A 3R7EA 4XV9A 1OM1A 5HORA 1R1WA 5EDQA 4EK6A 1OZ1A 2W1FA 4HZSA 2WMQA 4B99A 5CXHA 2BZKB 4BCFA 3F5UA 3PXRA 3A4PA 4BGQA 4BHNA 5J7HA 3W16A 3OT3A 3E8DA 4YO4A 4O81A 2XK7A 3OW3A 3WARA 2DS1A 2VTNA 3EFJA 3ATTA 2WTIA 3PLSA 4HOKA 4QQJA 4WSYA 4FTQA 3IOPA 3DBQA 3KA0A 4F1TA 5LVLA 4TWOA 4PNIA 3QC9A 3FL5A 3R1QA 4ZSEA 1KOAA 5HCXA 5HICA 2W4JA 1PY5A 3Q2MA 4WSQA 1NVQA 4OT6A 4WIHA 3LXKA 4G3DA 4JG6A 4O7TA 2HYYA 3FLYA 2PZYA 2PVJA 2R3FA 3DK7A 3QZHA 4A9TA 1UU9A 3NSZA 5E9EA 2VWXA 1YOMA 2CLQA 1WCCA 2WEIA 5E8VA 5C03A 4F6WA 3ODZX 1OIUA 2B9IA 2R3OA 2RFEA 5JGAA 2CKPA 4F9CA 4O0YA 5CX9A 5FLFA 4E4MA 3W55A 5CALA 2ETMA 3C50A 3P86A 4FZAB 1H0WA 4FSWA 4DFBA 3FYJX 2IPXA 2JITA 4IW0A 3Q04A 2NP8A 4EOIA 3U4UA 3KXZA 2ERZE 2BAKA 4D2SA 2HAKA 4UEUA 5KHWA 4YJOA 1XQZA 4FI1A 3VW6A 3LLAA 3OHTA 4D2WA 3GCVA 1ZMVA 4ORKA 1OI9A 3KRRA 2E9NA 4ZJVA 4DBXA 3NYVA 3BLQA 5A4EA 3NAYA 4KBCA 3BBTB 3QC4A 3PIZA 3BGPA 4ERWA 4LUEA 2ETRA 3EQBA 4GFGA 3C5IA 3L9PA 5C01A 3FBVA 3G51A 1ZXEA 3BYUA 5DWRA 4YC6A 5LVNA 5HE2A 4UWBA 3V01A 4ZTLA 4APPA 3QA0A 4A9SA 5KKRB 3TEIA 4Z3VA 5H9BA 4J8MA 4XUFA 5IDNA 3T9TA 5CI6A 4AE6A 3CEKA 4DG3E 2NO3A 3C4XA 3RI1A 3BYOA 3WYYA 2BCJA 1GJOA 3NMUF 4JL9A 5IH4A 2ZDTA 4MK0A 5FM2A 5CLPA 2ITQA 3E7VA 1UNLA 4FTCA 2BRNA 2JDSA 3ACKA 4FZ7A 2GHLA 2PMLX 4DFXE 3D14A 5B2KA 3TNWA 3PA5A 4NJ3A 4EOKA 4HVIA 3LPBA 3BRBA 4ZJIA 4LRMA 2YIQA 4MNFA 3R8LA 3KULB 1JSVA 4QP3A 2R7IA 4ENXA 2C4GA 3HEGA 3RCJA 3SLSA 2VTRA 1OL1A 2A19B 4NW5A 4ZXTA 3V8WA 1TKIA 3QLGA 1MUOA 2A4LA 4W4XA 3PZEA 4PF4A 5HO6A 4DH5A 4E7WA 2WTCA 4IM3A 3NVKI 2F57A 4HCTA 3L1SA 2YHVA 2BMCA 4IE9A 3E64A 1CSNA 3IGOA 5DRDA 3GBZA 2B55A 3BHHA 3HLLA 3LVPA 3K3JA 4AGDA 1VEBA 3DNEA 2WTVA 3ORIA 3TDVA 4D2VA 3IPHA 2VTQA 3I81A 3E87A 2YWVA 3R30A 1PYEA 4RGJA 2WMRA 4RLKA 4FX3A 2R3IA 3LXPA 2OGVA 2X8DA 3ALNA 5DR2A 1YHWA 3TIZA 5ITAA 3NIZA 1BYGA 1Q62A 4XNEA 1OL7A 3UBDA 4AACA 4L52A 3NAXA 3QRUA 4CCUA 4JG7A 2WTKB 2G01A 3EL8A 4IC7A 4OT5A 3HKOA 4W9XA 5TT7A 3TTJA 3OWLA 2GQSA 2C5NA 5EHOA 3OROA 2OJFE 3QQKA 5KMJA 3PY0A 5AUVA 1OVEA 2BILB 2YM3A 3QQGA 5EHYA 4EH3A 5JRSA 5HTIA 2X1NA 3OY1A 4JQEA 4ZZNA 4NFMA 2J51A 2GFSA 2JDVA 4X2GA 4YPSA 5CENA 4CVAA 5L2WA 4RQVA 1A06A 3QTSA 4I4EA 5K9IA 2PVYA 4FKRA 4KB8A 3SOAA 5GJGA 4QYYA 4EHGA 3IW7A 5CT7A 4QMYA 4MKCA 3QBNA 2UW9A 3UGCA 4IXPA 4D9TA 1J91A 3AC2A 3B8QA 4FR4A 4BZNA 1OKYA 3P79A 1SVEA 4BTJA 1V0PA 3IGGA 3D2KA 4FIIA 4PRJA 4FYNA 5LMKC 5M08A 3OZ6A 2WHBA 3BEGA 1R0PA 5GIPE 2ONLA 1NW1A 4ZK5A 5DIAA 2GNGA 4X2NA 4BCIA 5BUIA 4FVQA 4RIYB 1XH5A 3KRXA 3UE4A 4FTKA 3PPZA 3SHEA 2QLQA 4RIXB 3R1YA 2OXDA 4QP2A 1PXPA 5CU4A 4E5BA 4IAIA 4RWKA 2J4ZA 5F95A 3OWPA 4YZDA 2WMTA 3KKVA 2FA2A 4QMVA 5B0XA 3HMOA 4O0VA 4CFFA 2EWAA 4HCUA 4F9BA 5I9WA 3KCKA 3H10A 2QR7A 4DGMA 1FVRA 2HY81 4GYIA 4B7TA 4A4OA 2C3KA 2PWLA 2ESMA 4RVKA 4TNBA 2VD5A 4MCVA 1DM2A 5DFPA 2QOOA 3WILA 1NVRA 3VRZA 1BKXA 4CD0A 3KMUA 3MV5A 4NM0A 2ZB1A 1Z5MA 3G0FA 2C0TA 2X6EA 3OBGA 3UIMA 2P3GX 3A8WA 2IZUA 4MEDA 5DT3A 5LVPA 2X4FA 3R8VA 3C0GA 4YZCA 3ULIA 3TUBA 4U5JA 2I6LA 5AWMA 4GT3A 4HPUE 4GMYA 3C13A 4TYIA 2R7BA 2W1GA 1M7QA 2W99B 3IDPA 5AP2A 5FDPA 3QGYA 1J7IA 1YVJA 4FTIA 3D94A 4H05A 4BIDA 2X9EA 4KSQA 3C5UA 3ZRMA 2BFXA 3GQLA 3LFEA 3W33A 3AC3A 4JJRA 1WBNA 3RZFA 3EQPA 2GFCA 1H0VA 2VX3A 5IEXA 4EORA 2WIHA 3K5VA 3DK6A 4E6AA 4DFYA 2W1ZA 4IDVA 2GQRA 3PLAE 4MXYA 1H01A 2UW7A 4U79A 2O64A 3EN4A 4UBAA 2ITYA 1GZ8A 2ZV9A 3PZHA 2LGCA 3DLSA 5FDXA 2WIPA 2PMOX 3OCGA 2B0QA 3MVLA 5IEYA 2WGJA 2YEXA 2QOBA 4KIKA 3ZDUA 4NU1A 5IA5A 4EZ5A 1ZARA 3R02A 2XRWA 3OCBA 2GNIA 2W0JA 1M14A 2O5KA 3GU7A 4GK3A 1TQMA 2JKOA 3Q4CA 3TCPA 3ZSIA 3CSVA 5C4LA 2IO6A 1LP4A 4RJ5A 3RAHA 1XWSA 2I0YA 3F2NA 4GL9A 3C4WA 3MVJA 4YJVA 2W1IA 4M13A 4S30A 4ZTNA 3ANQA 4XG9A 4CT1A 3QUPA 4IJ9A 3ZHPC 2VWWA 4BBMA 4YHTA 3KXHA 5EYDA 5I0BA 5AMNA 3RMFA 3PSBA 4BGGA 4RVTA 3OCTA 2XJ0A 2VTAA 4RLLA 2UVYA 2SRCA 4JI9A 2OIQA 4OW8A 5AR2A 4ASXA 5CAPA 2QOHA 4WG5A 3Q6WA 4EH9A 2ITWA 5BYLA 2QD9A 5I9YA 3IOKA 5L2QA 4O2PA 3R7UA 2F7ZE 3FMEA 3KU2A 1REKA 1W0XC 5E8UA 4MXOA 2B7AA 4L43A 1QL6A 4OTPA 5CASA 3BE2A 3HZTA 3QD3A 2E2BA 3TNHA 5CEOA 3MIYA 5KCVA 3FE3A 3I1AA 4YMJA 4C2WA 4F09A 4DA5A 5D7VA 5HIEA 4IB0A 3OWKA 3OC1A 1ZOHA 3I7CA 1JKSA 3G90X 5DT4A 4E1ZA 3W1FA 2RG6A 2BHHA 3E8EA 1WAKA 2XNBA 2OJJA 4IVBA 2XIRA 2PE1A 1BMKA 5IA2A 5AR8A 2FSLX 5D11A 5AP3A 4N57A 3W2OA 4DLIA 4HYHA 4KKGA 3DKGA 2ITXA 5KZ0A 3IG7A 3OOMA 2UZOA 2O3PA 3EZRA 4IM0A 4BN1A 4O7WA 4C38A 2PULA 4FKQA 4ZLOA 4C3FA 4JX3A 3ZCLA 3HRCA 4G34A 1YOLA 3PJCA 3C0HA 3ACJA 3I7BA 4YGAA 2IVVA 4K0YA 4UYAA 4G3EA 4IADA 4NTSA 4B6LA 4BYJA 4KBKA 3FXXA 4L6QA 4IAAA 3FV8A 3TTIA 1WVXA 4IX5A 3G5DA 5CEPA 4FYOA 5FBOA 2X39A 4TN6A 4EWHA 5HO8A 4YSJA 3QWJA 4FKGA 2ETKA 3GU6A 3R8UA 4ID7A 2UW0A 3U6HA 4IBMA 2BIKB 2XK8A 5HCZA 5C4KA 4YBJA 3BQCA 5D41A 3TV7A 1GZNA 4JDJA 1J1CA 4BBFA 3CLYA 3Q53A 3VBYA 1Y8GA 4DF3A 3VS6A 3KY2A 1F3MC 4AZFA 4LGHA 3G15A 1BI8A 4AZEA 2XK3A 3RGFA 3GU4A 3O96A 1Q61A 4DE4A 4IB5A 4DFNA 3MSSA 2OW3A 2H8HA 4TYJA 4EYMA 4HJOA 3V5PA 4AN3A 3KXGA 3LXLA 3VHEA 2NRYA 3KQ7A 4ACMA 3WOWA 3LQ3A 2A2AA 2BTSA 2OFVA 2R3NA 5CF8A 5JZNA 3LJ2A 4JR7A 4I41A 4DGGA 1H8FA 5BVNA 3C7QA 3U87A 3ZLSA 4G2FA 3KGAA 5BVOA 5FGKA 3PWDA 3IQ7A 3DJ6A 2GSFA 1PMNA 1UU7A 2EXCX 2GS7A 3AG9A 1YDSE 4OUCA 3V8TA 4CFVA 1YQJA 5EW3A 1DAYA 4PDPA 5C1QB 1URCA 5KNJA 1OMWA 4FKTA 1M7NA 3OD6X 4QP4A 4N0SA 5DHJA 5DEYA 4L3JA 5HBEA 4D4RA 5GZ8A 2YISA 4IWOA 5I9VA 1OBGA 3HMPA 1PXIA 4EQCA 2PMNX 4K33A 4LV5A 2J50A 4IZAA 3QZFA 4FT7A 4HNFA 3Q9XA 5EYKA 4R6VA 4W4YA 5J8IA 4B9DA 2YLFA 3V04A 4ZY5A 1TVOA 2PVLA 4QYGA 3LHJA 5EDPA 2OSCA 4H1JA 5AP0A 3O23A 4BDFA 4BCQA 5ACBC 3F5GA 3VAPA 3DAEA 4EK8A 5EI6A 3HL7A 2UZUE 4GFOA 2OF4A 2XK6A 3CJGA 4O1PA 4PPCA 3HDNA 4WD5A 3BBWA 4GT5A 4U0IA 3H9RA 4DG2E 2ZMDA 5J7BA 3RM7A 3QTUA 4U7ZA 3QQHA 3KC3A 4NKSA 3EQFA 4ANQA 3FLZA 3TG1A 4RA4A 3WZUA 2EUFB 3ZS5A 5E8XA 4FNYA 2VWIA 3VUTA 3S00A 5E4HA 4OBQA 3ETAA 4MAOA 5ETFA 3FEGA 5L6PA 2ITZA 1ZYSA 3AC5A 1NA7A 2I0VA 4CSVA 4M7IA 1FOTA 2WD1A 3C4EA 4KIOA 3NUYA 4BZOA 1DAWA 2BDJA 4D4YA 4FSUA 3ID6C 3DTCA 3NVMB 1M2RA 3G9LX 3V5LA 3LE6A 4FKWA 2WMWA 3QXPA 3PJ8A 1YI3A 2J90A 3NUNA 3QD0A 4D1SA 4J1RA 3UPZA 4KIPA 3GFWA 3R7GA 1YXSA 4IM2A 4YLKA 4XOYA 1XBAA 4Y73A 4X7QA 1JVPP 2VX0A 4A7CA 5FBNC 1M2QA 4V05A 4D2TA 2CCIA 3T8OA 4IVDA 3OXIA 4TY1A 2NNWB 4L8MA 4C58A 1XH9A 2PVKA 3FYKX 4AF3A 4J95A 1Q24A 3PYYA 3SV0A 2ZJWA 3LCSA 3VVHA 2OF2A 4FT3A 4O0RA 5CSXA 5DGZA 2YZAA 1IR3A 5IDPA 4FG7A 3O0GA 4OTWA 3TZ8A 1U54B 4D1ZA 2HELA 3F6XA 3CE3A 4IJPA 3HRFA 4A4XA 3NUSA 1H1PA 3SRVB 3UIUA 4PWNA 3C4ZA 4MNEA 4EOQA 5KKRC 3OUKA 1YW2A 3DLZA 2OI4X 3BQRA 5JKGA 5HLNA 4I0RA 4ZLYA 4X3FA 1Y8YA 4GG5A 5IUIA 5LMAA 4C0TA 3OS3A 3PRFA 5GNKA 1YDRE 5E8ZA 4O0SA 4QMPA 3FJQE 4CLJA 3A7IA 5BQ0A 1VR2A 1PXOA 2QVSE 4UV0A 3C4CA 4FZ6A 3DU8A 4S34A 4E6DA 4NFNA 4WBOA 2GNHA 3GCUA 2QLUA 3ZUTA 3ZC5A 3BWFA 1U5QA 5EOLA 4FKSA 4MF0A 3E8CA 5EFQA 3MJ1A 3NYNA 1JBPE 3FL4A 4L44A 4FL1A 5CQWA 5I3RA 3EZVA 4MQ2A 3PP1A 5E8SA 4F9YA 3FKNA 4R8QA 3EN5A 4KWPA 4CFMA 4RIWB 4EOLA 1VJYA 2XM8A 4RWJA 4QTEA 4GW8A 3BKBA 5KBQA 4O83A 4RX7A 4E20A 2PPQA 3KRLA 1JQHA 4RA5A 3ZSHA 2CGUA 3COIA 4FV8A 2YCQA 1AD5A 3LM5A 3FZOA 4I20A 4MTAA 4TWPA 5EM5A 3G6HA 5GZ9A 3RAKA 4NM3A 2R64A 2BDFA 3BYVA 5AV0A 5M57A 2VTPA 2XJ2A 4UYNA 4DGNA 3VBTA 2UZLA 5M4FA 1KUTA 4CG8A 3AGMA 4ONAA 2XRUA 2BAQA 3P4KA 3UC4A 3PXYA 4DC2A 4ZMFA 2YCSA 2YJRA 1OKVA 2C47A 5A3XA 3A61A 4CMTA 5KMMA 3DKOA 3E93A 2IG7A 5BVKA 1ERKA 2ZOQA 3IDCA 3OTVA 4FTRA 3KXXA 3OG7A 3QTQA 1YI4A 1CKIA 3F3WA 3VS7A 2E9UA 3BYSA 3P0MA 4QMTA 2RF9A 2H9VA 4NIFA 4TXCA 4GCJA 2WTKC 3R7VA 2GHGA 4Z7GA 4O0XA 4ZIMA 4JBQA 2JDOA 2X2KA 4NSTA 3L8VA 1YRPA 3NCGA 4AN9A 2XK4A 1STCE 4MYGA 3ZZWA 3Q96A 1GIHA 2B53A 3U51A 3B2TA 2VO6A 4DGLC 5TOZA 3EJ1A 5HX8A 4X2KA 4FG9A 2XF0A 4LMNA 5I9ZA 3LW0A 4O91A 3RHXA 3K2LA 2UW6A 4WHZA 5BUEA 1JPAA 4JDHA 1MRVA 2WMVA 2XEZA 3EFLA 2ITOA 1Q8YA 3T9IA 4H3QA 2HENA 1ZYJA 4EK3A 3BGZA 1K9AA 1KE9A 2WFYA 2C5YA 3QKLA 2FH9A 2XKEA 4J71A 4KS7A 5IU2A 2B9JA 1RW8A 3PY1A 4FC0A 4XP3A 4V0GB 3AC1A 2VO3A 2RFSA 3EN7A 4ALUA 1R0EA 2W5AA 3GU5A 2Y6MA 1K2PA 4F7JA 4WG4A 3HRBA 1YWRA 3Q6UA 5CEIA 2GNLA 4IAKA 2B9FA 4DEEA 4BBEA 3KRJA 4ZTRA 4U8ZA 2VTHA 3REPA 5IQEA 3A7HA 3R9HA 3R8ZA 3TZMA 4AQCA 1SVGA 3DNDA 3P7BA 4I21A 5J1VA 3O2MA 2X7OA 4DINA 3VJOA 4OLIA 1NY3A 4FUXA 1T45A 2HZ0A 5CSHA 4CZTA 3FZ1A 4FA2A 4ZTSA 3QFVA 2QR8A 4DEHA 3QYWA 5A6NA 4QMWA 2GU8A 4ARKA 4JOAA 1K3AA 4GSBA 3D83A 2VTJA 3OFMA 4LOQA 4OTFA 4PY1A 4FEVA 3RNIA 1NXKA 4GU6A 3IK3A 2CCHA 2V7OA 3FZRA 2XYUA 4MXCA 3BI6A 3SOCA 4ZY6A 1SMHA 3I5NA 3RVGA 3PIYA 4NWMA 2IJMA 1YOJA 2WOTA 3R22A 5TF9A 4EZ3A 3AD4A 3BU5A 4NKAA 1UV5A 3QRJA 1ZRZA 2HXQA 2JC6A 4MXAA 3R9OA 5ETIA 4MBJA 3CJFA 2RG5A 5EQPA 5LWMA 3ODYX 2PZPA 2C5OA 2QCSA 4RJ3A 3PVWA 5C9CA 3A60A 2ACXA 3WF6A 4HZRA 2X9FA 2C30A 3VHKA 4AN2A 4AX8A 3VBXA 5BMSA 2PE0A 3QQLA 3R2BA 2VTLA 4JAIA 5EHLA 4RMZA 5AP4A 3GVUA 3DBCA 2R3JA 3QHWA 4GH2A 4WRSA 4QYEA 4XCUA 2PZ5A 1PKGA 2YN8A 4YNEA 3BX5A 1KWPA 4Y5HA 3HMMA 4TKSA 3T3VA 3HP2A 2I0HA 4L53A 2P55A 2C1AA 3AQVA 3IW6A 2BFYA 2BZJA 2VAGA 5AR4A 3OOGA 5GHVA 3RINA 5A4LA 5LCJA 3GC8A 3KXNA 3NZ0A 3OXTA 3QTRA 4GS6A 4P5QA 5C26A 3WF9A 1Q8WA 4MD8E 1YDTE 2C3LA 2HZNA 4LV8A 2WTDA 4A9UA 1H28A 4ZY4A 1QPJA 1T46A 1YXUA 2XIXA 4YHJA 5JN2A 2Z02A 3NEWA 3I60A 3NRMA 4M0ZA 4R3RA 1B39A 4C3PA 5HLWA 5J9ZA 5K5NA 4TW9A 3GCSA 4BI1A 4EOPA 5CVFA 4WNPA 1UU8A 4CNHA 1OIQA 4XHKB 4UN0C 5B2LA 4ANBA 4ZJJA 4P4CA 4IB3A 5CZHA 3HV5A 3EIDA 4C33A 3NX8A 4PTCA 5AIRA 3HAVA 3IW5A 3G33A 2YM4A 3I4BA 4CQEA 1PXMA 3NYOA 3D15A 3AD6A 4MD9E 3RKBA 2VO0A 4XYFA 3OVVA 3RCDA 4U3YA 4W8DA 3QTIA 5HHWA 4WA9A 4E4NA 1OPJA 4KRDA 3ZOSA 4AW2A 4D0XA 4QTBA 5JEBA 1KE8A 3F3VA 4V04A 2IVSA 4XV1A 4NYEA 4FKPA 4RFMA 5CTPA 5AX3A 3UMWA 4F7SA 1OECA 2PVNA 3JXWA 4O7VA 5KX8A 4BI0A 4A9RA 2YITA 1SVHA 4E4LA 1UNGA 5CYIA 2WMUA 3QGWA 4IAFA 4RPVA 1Y57A 4FV2A 2F7XE 4A06A 4AT5A 4AFJA 4C4HA 4ZTQA 5CI7A 5AUTA 2YCRA 5BUJA 3H0ZA 3QD2B 3UOKA 2YDKA 3EMGA 2QOQA 4QMZA 4DEBA 3PXKA 3RPRA 3LIJA 3HA8A 5TKDA 2WTJA 1YWVA 3OY3A 3QALE 4FIJA 1H24A 1RDQE 2BRGA 3G0EA 4UMTA 4Q9ZA 3OF0A 3B8RA 2PZIA 3EN9A 2C6OA 3EQIA 4RQKA 5HBHA 3CTQA 4NCTA 4Q5EA 5ANOA 3IECA 3VUHA 4TNDA 1JNKA 1UWJA 2A1AB 3ELJA 5A4TA 2WNTA 4M68A 1IEPA 4X0MA 3I5ZA 4DEGA 2PVRA 4AW5A 3UYSA 4F65A 4BDDA 4FKJA 3VNTA 4A9YA 2ITUA 2C5XA 2HK5A 4XS2A 5AR3A 5TE0A 2GPHA 3AOXA 1Q4LA 1OKZA 4M15A 4USDA 3TACA 3OW4A 4FNZA 4KBAA 2CGXA 5M4CA 4FK3A 2VZ6A 4OTDA 2C6MA 3VF8A 1JOWB 2AC5A 2WQEA 4AT3A 4TL0A 4PMPA 4ASEA 3Q4ZA 4DHFA 4KKEA 1O6KA 4BTKA 2F2UA 5FG8A 2OIDA 5AIKA 2R3GA 3VN9A 2W9ZB 1Q8TA 4YO6A 1OB3A 2PVMA 5AAGA 1SNUA 4Y83A 3NYXA 5AJQA 2VU3A 3TKHA 4E93A 5J1WA 3EQGA 4GIIA 2VTIA 4BHZA 4FTUA 4QP9A 2PUPA 4U40A 4IEBA 5L2SA 2PU8A 4ACHA 3RK9A 2OK1A 5CAQA 4C4IA 4ASDA 2VWYA 5FP6A 3NW7A 4PL3A 4AGCA 3HGKA 3DDQA 1UVRA 3OCSA 3UOJA 2BZIB 2Y8OA 3ZFMA 2HW6A 4S32A 5IEVA 3FLNC 4JQ8A 5ANDA 4ALVA 1JWHA 2XKDA 3HX4A 5BVEA 3T3UA 4JRVA 3QLFA 4BCHA 3CPCA 4I6HA 4PX6A 2Y6OA 2ZM1A 3DBEA 3JYAA 5AA8A 3IKAA 3QQJA 5HG8A 1BUHA 5DLSA 3UVPA 4ANLA 3PIXA 4W9WA 1FBNA 4CTCA 4AG8A 4F1OA 4IAYA 1WBPA 3WF5A 2P4IA 4BKZA 4BWPA 2CKQA 4PNKA 2YCFA 3GC9A 3W2CA 3VUKA 4Q2AA 5BVFA 4PDYA 3DQWA 1MP8A 3MFSA 4FSZA 4YJPA 2J6MA 4YTIA 1IRKA 5EH0A 5JFSA 2DQ7X 2VUWA 4FNXA 3VS2A 3D4QA 5AR5A 4GV1A 3UZRA 4DGOA 2OBJA 3EYHA 3FDNA 3FC1X 1ZWSA 3BV3A 4GK2A 3Q3BA 3RWPA 4EHZA 4CV8A 4FVPA 2ITNA 4S33A 4WUAA 4YLJA 1GY3A 4BL1A 3QX4A 3W32A 5AAEA 3DKCA 3JVRA 1Y6BA 4R3CA 1V1KA 3KVXA 4L67A 3WZDA 5AR7A 3Q5IA 5CQUA 3F66A 4OTHA 4DCAA 2R2PA 5T6KA 5AFVA 1UNHA 3GC7A 5IQCA 2QHNA 5AP5A 1IA9A 1ATPE 4FODA 4FTTA 2JIIA 4LRKA 2UVZA 5HU9A 5IPJA 1Q5KA 4YJNA 3CY3A 4ZSAA 3CTJA 5LVOA 4H39A 4I5HA 5AX9A 2AYPA 4CGAA 1WBTA 1Y6AA 3U6JA 1DS5A 1V0BA 4XP2A 3DY7A 5D9HA 3BLHA 5HI2A 3NIEA 5FEQA 3KREA 3OWJA 4UZDA 2VTMA 4BZDA 1YI6A 3C4FA 4I3ZA 2Y7JA 2W06A 4GVAA 4FMQA 5JFWA 3O8UA 2UW3A 3AT2A 3LM0A 2JBPA 4FT5A 2OJGA 4TRLA 5EW9A 5IA1A 5AP1A 3KRWA 3TV6A 1G3NA 3VBWA 2YAAA 4CFNA 1QCFA 3QRKA 4C4GA 5CF4A 4EOSA 1OKWA 3HV4A 4XV3A 3IS5A 3C9WA 2R4BA 3NR9A 2CLXA 1KE5A 4M8TA 3GU8A 4FKVA 4TYGA 4FTOA 5LJJA 2W96B 1LR4A 3DZQA 5IKWA 3D7TA 3K5UA 5IQFA 4DCEA 2QG5A 3MPAA 5KE0A 3S4QA 3FMKA 1QPDA 3GT8A 5M56A 2V7AA 3OEFX 4DITA 3NUXA 2X6DA 2GQGA 4LOPA 4R7IA 4O1OA 3WIGA 5AAFA 4FEUA 2H6DA 3HV7A 3BYMA 4CRLA 4D1XA 3EFWA 2J7TA 2YFXA 2YA9A 4QP6A 4EH2A 3AMYA 4XG2A 3OXZA 5EYMA 2OKRA 4J97A 2PYWA 2BKZA 3W8QA 4C3RA 3MVHA 5IQAA 3DAJA 4WT6A 5HIDA 3TNIA 4FIHA 2XS0A 5JZJA 1SM2A 3DKFA 3MFUA 3FY0A 3HDMA 3S1HA 5DT0A 4KIKB 3GGFA 3R9NA 2Z8CA 4KABA 4RSSA 5H2UA 2REIA 2BTRA 3R00A 4JAJA 5H8EA 3GNIB 5HOAA 4CFUA 1XBCA 5EM8A 4C02A 3TDWA 2X8EA 5T68A 4O6EA 4PPAA 1UU3A 4JBOA 3L8XA 1RE8A 1W7HA 1F5QA 2YWPA 4GU9A 2VWZA 4BB4A 2UZDA 3R83A 3DJ5A 3MH0A 4JLCA 3U6IA 5A4CA 1H1SA 4UX9A 1JKTA 4YNOA 4BY9E 1Q3WA 3RPVA 2HZ4A 4KIQA 2BZHB 2G2IA 2QOIA 2ZM4A 5JGBA 3N4TA 1A48A 2B52A 3HV6A 5EQYA 1URWA 1ZMWA 2QOKA 3JS2A 3O8PA 4G5JA 5KMIA 1P4FA 3DK3A 2RSVA 2A27A 3GUBA 4FT9A 4FTAA 3TXOA 4FSMA 5DNRA 1PJKA 3V51A 4FEXA 4UZHA 4EBVA 3SG8A 3UOHA 3UNJA 4AA4A 3DFCB 4DH1A 4GJ2A 4X2FA 5M06A 1LUFA 1S9JA 2WMSA 4I22A 2VTOA 5D10A 1BLXA 3CPBA 3ORKA 2UW8A 3WBLA 3ZFYA 3MH2A 4QTDA 3FMHA 3TI1A 3FQEA 3PJ1A 4F70A 1ND4A 2IW6A 3TKUA 4ZZOA 1CKJA 1ZY5A 2QU6A 5DMZA 4CKIA 3IW8A 3ZMMA 2OJIA 3W18A 2V55A 4FV0A 4M84A 2ZV7A 3LFAA 3PA4A 4HGLA 4ZTMA 3FI3A 3NNVA 4AXAA 2XNPA 3ET7A 4C61A 3PP0A 4DT9A 4IWDA 4O86A 4O0TA 1P14A 3EH9A 4MQ1A 3VS4A 1HOWA 4QNAA 4AP7A 2W1CA 3TN8A 1R39A 2ZAZA 1M17A 3WZJA 4F6UA 5B7VA 3K54A 4XV2A 4AFEA 2ITVA 2J0LA 3SA0A 4DEAA 3R9RA 2PY3A 2YABA 4KINA 3CBLA 4IHPA 1H27A 4C59A 2BRBA 4HYUA 4CEGA 3BLRA 4BDHA 4BWKA 4HGTA 2BR1A 5G6VA 4IWQA 5A54A 4X21A 4DFLA 5IF1A 4C4JA 2XIYA 4DT8A 1MQBA 3TT0A 2CGWA 3BHYA 3Q9YA 2Q83A 2ITPA 3P9JA 3R28A 5HNIX 3D5XA 4QYFA 5AP7A 4JR3A 4ACCA 4LMUA 4E26A 5C8KA 1W82A 4JS8A 2RFDA 4YTFA 5AM6A 3VS1A 4J98A 4U42A 4QPAA 2C3IB 4CYIA 5FEEA 4PL4A 4QTAA 3VULA 1IAJA 1YXXA 1V0OA 2OXXA 3CD3A 4K6ZA 3GOPA 2VRXA 2OFUA 4M3QA 5HEZA 2JFMA 3W2PA 4ZAUA 1H1WA 3UG1A 4LG4A 1GZKA 3MW1A 2WMAA 2VNWA 3FKOA 3HUCA 4JXFA 4Z16A 3AC8A 4RC4A 4J7BA 3UVQA 1Q8UA 2BKKA 4C35A 2C5VA 3NDMA 3QCSA 4QO9A 4G9CA 1WBSA 4NJDA 4E3CA 2C0OA 5I3OA 4DAWA 5IH6A 4FIFA 5HE3A 2HCKA 4Z7HA 3II5A 3QCQA 3R7OA 5DYJA 4CV9A 1BL6A 5M07A 1ZYCA 4GJ3A 4ANNA 2RKUA 1FMOE 4UMQA 3KEXA 2ZV8A 3ZEWA 1Y91A 3GI3A 5CANA 2WQMA 3CCNA 3MGYA 4G3FA 5JQ8A 4WO5A 5HU3A 2R0UA 5HIBA 3BU6A 2UV2A 1OIYA 5J87A 4K9YA 5IQGA 4QYHA 1IG1A 3S95A 3BU3A 4QPMA 1GZOA 2UZTA 1EH4A 3MB6A 5HVJA 2XIZA 4B0GA 3A62A 4BCOA 1H1QA 3LJ1A 3QUDA 5BPYA 5FTQA 2OG8A 5AV3A 4AS0A 5LVMA 3EQRA 3A4OX 2JAVA 4IZ7A 3ORXA 3LJ0A 2DWBA 3ORMA 3Q9ZA 2J2IB 3QQUA 3PXQA 2Y9QA 1YKRA 4WNOA 5ANJA 4DLJA 5L8LA 2QOFA 2YIYA 4W4VA 5CVHA 1FVVA 4YJSA 2WXVA 2OH0E 3UQGA 3AMBA 5HVKA 3DZOA 4Y8DA 1WFCA 2I40A 2PUUA 2XEYA 3MPMA 4IZYA 3RPOA 3VUDA 4C4FA 5LMKA 3MH3A 5L8JA 3MFRA 3D0EA 2VTSA 3LZBA 5E7RA 3RBWA 4DFUA 3F69A 2B54A 3ORNA 5EOBA 3EFKA 3FI8A 4RZWA 3EYGA 4PMTA 4CKJA 2FGIA 4YZNA 2P2HA 4LYNA 3P08A 5AUUA 2BRMA 1U46A 5KUPA 3U4WA 4B8LA 4EH8A 4BDGA 5L2IA 2XNEA 1DI8A 3KMWA 4GIHA 4M0YA 1VYZA 3UIBA 2QI8A 3KF7A 4FIGA 4QMLA 5HTCA 2VGPA 3FXWA 4MWHA 4IQ6A 3QA8A 1PW2A 2ZYBA 4RFZA 4EH7A 4GG7A 4RG0A 2YM8A 4IVAA 3F7WA 4O96A 4D5HA 3PXZA 4YZMA 4EH6A 1FQ1B 4AOTA 4EHEA 1UKIA 3VC4A 4QMSA 4MHAA 4XLIA 5J79A 3E8NA 3FHRA 4O27B 5I5ZA 4UY9A 3MYGA 2W4OA 2G1TA 3U55A 1HCKA 3UNZA 4F7LA 4MXXA 5HVYA 3DXPA 4GVJA 4L9IA 3CIKA 3QU0A 3KK9A 1PYXA 4FGBA 1IA8A 2IVTA 1XKKA 4NH1A 4ACDA 4PP7A 3KMMA 2HOGA 3EOCA 3PPJA 4M67A 2VO7A 5HTBA 3M2WA 2Z7SA 4BDKA 1UKHA 4OAUC 3ZC6A 1OIRA 2BAJA 4ZMEA 3NGAA 3I0OA 5KMLA 4FSQA 3ZXZA 3SW7A 1TQIA 4H58A 3RWQA 1I44A 3RP9A 4XOZA 3ALOA 1P5EA 5KO1A 5DEWA 4XEYA 4U80A 4IDTA 4YBKA 4DFZE 2YIXA 4USEA 2J0KA 4PP9A 4AZWA 4O7ZA 2Y4IB 1ZOEA 3R6XA 4J99A 5IG1A 4AGWA 5FXSA 1U4DA 4LFIA 3ROYA 3ZDIA 5CF6A 4MNEB 1XH4A 4NK9A 4DTAA 4EONA 5F9EA 5EYCA 4OTQA 5DPVA 5L4QA 2J0JA 4U3ZA 2JDRA 4X3FB 3F3ZA 4L7FA 4BI2A 1E9HA 3NPCA 3CGFA 3Q32A 2GCDA 4IX6A 3SW4A 4M97A 3F7ZA 4L00A 2BDWA 5E8YA 3R0TA 1XBBA 4AUAA 4HPTE 5J9YA 3TWJA 3F5PA 3UOLA 5K0XA 3QKKA 2X8IA 3NNUA 5ANIA 4AU8A 5HZNA 2YDIA 5HE0A 3L9MA 2AUHA 1WVWA 4FV4A 3RK5A 4BCGA 4CQGA 4CZUA 4FOBA 4FSRA 4Y5QA 1KE6A 3FWQA 4W8EA 4JBPA 1REJA 3WI6A 4ERKA 1B38A 4G31A 4QRCA 2CNQA 1FMKA 4BWXA 4YR8A 4YJRA 5CS6A 4YTHA 3DFAA 4FZDB 3ZSGA 3FLWA 1XHAA 4OBOA 5L6WL 3TUCA 4UXLA 4I0TA 3ZBXA 2I1MA 3H0YA 3PG1A 3D5VA 2JKMA 3I0QA 1O9UA 3Q52A 3ZXTA 2PUIA 5CVGA 4I92A 4WNMA 3NWWA 3P7AA 3SX9A 4AT4A 4F1MA 4EOJA 2B1PA 5K4JA 5KMKA 3ZTXA 1PF8A 2RL5A 2JFLA 3R8MA 5IQBA 3PRIA 5CZIA 4QMUA 4AZSA 3LKMA 4MD7E 4BIEA 5BVWA 4D9UA 4O7NA 2R0IA 3GQIA 2XIKA 4G5PA 2J0IA 2OH4A 3LOKA 4BIBA 2X4ZA 4FNWA 4R77A 2E9VA 2QHMA 4YPDA 2XBJA 3JPVA 3FHIA 4FTLA 4QMOA 4RWLA 3FXZA 1OITA 4RX9A 4FL3A 5ANKA 3CQEA 4FZFB 1G5SA 4NIFB 4DH7A 1BI7A 4NT4A 3CXWA 2X7FA 3R1NA 5HG9A 3VF9A 2C6TA 3CKXA 1E1VA 3DXNA 4EOOA 3MPTA 5FM3A 4USFA 2JLDA 2QNJA 4NM7A 1H1RA 3L8PA 3QTZA 4ANOA 4NZWB 4K1BA 4RJ7A 3AC4A 2V22A 3R2YA 5FUTA 4A07A 2G9XA 2OXYA 3F3TA 3N51A 5C8MA 4CRSA 4EH5A 4PQNA 4B4LA 1Q97A 4FUYA 2H96A 5HNGA 3BIZA 4AGUA 3VS0A 3MI9A 4UMRA 1WBVA 5EK7A 2PSQA 1H00A 2OZAA 3KB7A 4WG3A 4RX8A 2XH5A 1KV1A 3AGLA 4I23A 5EDRA 5IISA 4D0WA 4YJQA 4M69A 3N4UA 2C0IA 3GB2A 4IVCA 4NTTA 4F99A 2ONLC 2IZTA 4ZZMA 3BWJA 4DG0E 4IAZA 4XRLA 4YZBA 4O7YA 3NLBA 2VTTA 3MVMA 1P2AA 4O82A 3BCEA 1KOBA 3HYHA 2F49A 1BX6A 4GK4A 4IIRA 4MBLA 4OGRA 3WF7A 3G6GA 3FLQA 4YSMA 1WMKA 3W2RA 5J5SA 4FEWA 4BDAA 2GS2A 2HIWA 4BDIA 3FI4A 3P1AA 4EQUA 4AZVA 5K4IA 2XP2A 1AGWA 4XRJA 2GDOA 3LQ8A 3O50A 1OL6A 3MWUA 3PE2A 3ZO1A 4EI4A 4GUEA 4S2ZA 4QNYA 5M4UA 3FSKA 5E90A 4O7LA 3ZZEA 3KCFA 4XG4A 2JDTA 4Y85A 3IO7A 4JIKA 2X0GA 4XH6A 4CFWA 4C37A 2XNMA 2HZIA 2G15A 4YU2A 3LMIA 3VWAA 4P2KA 4RBLA 4ZOGA 3NUPA 4C2VA 1ZZLA 2E9OA 3Q2JA 2UZVA 3O71A 2CDZA 3D2IA 3WIKA 4E6CA 3FI2A 1J7LA 3UZTA 4U97A 3GCQA 4J96A 2JEDA 4N70A 4XLVA 4YC8A 4TZRA 4YJTA 4OTRA 5LQFA 3FC2A 3F88A 3D9VA 3F2AA 1OL2A 3GEQA 4LL0A 3MA6A 4HVGA 2R3LA 5CU6A 1F0QA 3LCKA 5CEKA 4D28A 2WB8A 4I5PA 3SG9A 1SYKA 3COMA 4IMYA 4IZ5A 4O0WA 4FICA 3A99A 4P5ZA 3UP7A 3HMNA 3TM0A 1BL7A 1RQQA 3PVBA 2OJ9A 4LQMA 5CAOA 3EHAA 4U81A 3RAIA 1PMEA 4OAVB 4QQCA 5HE1A 2R3HA 2VWVA 3EN6A 4I93A 4FE2A 4QOXA 3FKLA 4FVRA 2O0UA 4G6LA 3HA6A 5CWZA 3EKNA 4I6QA 3QQFA 4G16A 4RJ4A 2F4JA 4KD1A 4MH7A 4YC3A 5CNOA 5EW8A 4FBXA 4IFCA 3GFEA 4ZSGA 1H07A 3EQCA 4QMQA 2W4KA 3DJ7A 5IQHA 4U44A 2R5TA 1WZYA 4O7RA 5EQEA 5AM7A 3FZTA 3N9XA 4BCJA 4DH3A 4DTKA 3MY1A 5GINE 3ROCA 4ZP5A 3WZEA 3EQHA 5FWKK 1QMZA 3EWHA 4IX3A 4O6LA 2QOLA 5KZIA 4GKIA 4M14A 3PWYA 2CGVA 1OUKA 4D4SA 5EKNA 4AE9A 4R1YA 3UTOA 2WTWA 3LXNA 1HCLA 2XJ1A 4FKIA 4NM5A 4QMXA 2XMYA 5CNNA 4F9AA 2FUMA 3O7LB 3PXFA 3UO6A 2XA4A 5C27A 4ANSA 5DVRA 5FXRA 4BCKA 5KHXA 4I6FA 5KBRA 3V8SA 1G8AA 2QO7A 1KSWA 4FV1A 3ZM9A 4LRJA 3PE1A 4NEUA 4BDEA 1GOLA 2YDJA 4N6ZA 3VQHA 5DR9A 4HGSA 4WKQA 5GJDA 3I6UA 4IX4A 2C3JA 4BTMA 4E73A 3O8TA 4BFMA 2XKFA 3EL7A 4BYIA 4EUUA 4DBNA 4Y95A 1ZAOA 2UW5A 5EI8A 4PL5A 3TUDA 4FV6A 3GP0A 2XNGA 3SAYA 4BR3A 3PFQA 4H3BA 3ULZA 3GOKA 3WZKA 5AUWA 3VS5A 3U8WA 5AUXA 3SKCA 2CNUA 3WE4A 3F61A 3LFFA 1YWNA 4K77A 2XB7A 3KFAA 4CTBA 4Z9LA 4FSYA 4EOMA 1H25A 4U43A 3LFCA 4UB7A 3OMVA 2X81A 4G3GA 1XJDA 2DYLA 4P7EA 4BCMA 4G17A 3OEZA 4I6BA 4N4SA 2B9HA 4R1VA 3LFSA 5JH6A 4O2ZA 3I6WA 1X8BA 1IASA 3DCVA 5I4NA 3E88A 1H26A 3MFTA 3HECA 3ZLYA 4PPBA 4C57A 2FO0A 3UP2A 1OPLA 2RFNA 2EVAA 2LAVA 4BGHA 2PTKA 3QHRA 3A2CA 3DB8A 1LEZA 2UZBA 1M2PA 3BPRA 5DI1A 1OGUA 1ZYLA 2R3RA 3DS6A 3KULA 3KXMA 3HUBA 4EUTA 4AA5A 5HKMA 5A46A 2O63A 3QD4A 3LCDA 1AQ1A 1PXJA 2IW8A 3RAWA 4F9WA 3UO5A 3A7GA 5I9UA 3PVUA 4C7TA 2C69A 4PMSA 3HVCA 1Z57A 5TO8A 5BVDA 5HCYA 5AEPA 3QWKA 4M66A 5ANGA 4EKKA 1I09A 2XZSA 3CC6A 1FGKA 4FSNA 1J1BA 5H3QA 5A9UA 3SQQA 2F2CB 4FG8A 4X6RA 2UW4A 4L7SA 2CKOA 4H1MA 5BYYA 2C6IA 5DH3A 4YTCA 2W9FB 5FEDA 2BPMA 2ERKA 3BEAA 3PTGA 2CKEA 2IVUA 3ZUUA 3NW5A 3UC3A 3ZM4A 4BTFA 4C34A 5HX6A 3CP9A 3LLTA 3D5WA 3SC1A 1M52A 2FSOX 4OBPA 3O17A 3VIDA 2W17A 4IACA 1XR1A 4ZEGA 4XMOA 4AOJA 2JIUA 5JFVA 2WZJA 3S2PA 1WBWA 3E62A 2F7EE 2JIVA 3MJ2A 3MY5A 4QTCA 2RIOA 4C36A 4JT3A 4F0IA 4ZLZA 1U59A 2GHMA 3M42A 3CD8A 3NS9A 2FSTX 4TWCA 2Y4PA 3A7FA 2P0CA 4F08A 4CMUA 5AADA 4FV7A 4KAOA 4XBUA 4AOIA 4X6QC 4LL5A 3DBFA 5LMBA 4UALA 5E8TA 3HNGA 4QT1A 1XH7A 5BNJA 2R3PA 3AMAA 2V5QA 4G6OA 2JKQA 4GFMA 5F20A 3QRTA 2CNVA 1SNXA 4HCVA 5LCKA 4CMOA 2BRHA 2VV9A 5E8WA 2BUJA 4C4EA 1GIIA 2YIRA 3PPKA 2CPKE 3R01A 4GYGA 5AUYA 1SZMA 3FSFA 3IDBA 3R21A 3FZPA 4EWQA 1W98A 5DRBA 5GJFA 1QPEA 4RIYA 1JAMA 4MX9A 5M53A 4E5WA 3BHTA 1LEWA 4TYHA 3FAAA 5TR6A 4JIAA 1E1XA
chains in the Genus database with same CATH superfamily
3F5XA 3ZRKA 4RIXA 3TL8A 1JSTA 5L8KA 2X0OA 3TNPC 2Y0AA 1RJBA 5DBXA 3JY9A 4ITHA 4TYHB 4YHFA 4C62A 1DI9A 3CTHA 3R04A 1VYWA 1PMVA 4RRVA 5HNBA 5CAUA 2CHLA 5CSPA 5M44A 3ML1A 3POOA 5HBJA 1W8CA 5CU2A 3ZU7A 1Q8ZA 3ZFXA 3C51A 4Z55A 5ETCA 3R8PA 2WO6A 3DTWA 3MBLA 2J9MA 5EM7A 2W5HA 3DGKA 5M55A 4B8MA 4FV5A 2CSNA 2AEGA 3DA6A 3OP5A 3KF4A 3ZONA 4F0FA 2NPQA 2ZM3A 1FPUA 4I5MA 2WMXA 4BICA 4UXQA 3COHA 4GRBA 3MN3A 2OICA 3CGOA 5CEQA 5IA4A 4AAYA 4EK4A 2P2IA 1O6YA 3LFQA 2JGZA 3D7TB 3FPMA 4CZYB 3CQWA 2W1EA 4U41A 1KE7A 2C6KA 2NRUA 4TTHB 4YZ9A 5F4NA 4WOVA 4WNKA 5E1EA 2O2UA 5LARA 5BX0A 2ZV2A 3KL8A 4UMUA 3FMJA 3QXOA 5L3AA 3HP5A 2OU7A 4XG7A 3W2QA 1GNGA 1CMKE 3E3PA 4EYJA 3GCPA 3FY2A 4RZVA 3SXFA 4L46A 2XVDA 3MTLA 4LOOA 2OZOA 3FZSA 3SXSA 4R7HA 3FUPA 3LFNA 3LQ5A 3OT8A 3V5TA 2I0EA 3DDPA 3W8LA 4JNWA 2F9GA 3OTUA 4JVGA 2Y4IC 2WEVA 3LCTA 3L8SA 3LFBA 1JKLA 4X2JA 2ITTA 4TWNA 4QQTA 3CS9A 4GT4A 4EH4A 3RALA 4LUDA 3ERKA 3RM6A 5CU3A 2WPAA 3HMIA 3NW6A 1Z9XA 2PVFA 2X0QA 4H3PA 4X3FC 3UQCA 4FKOA 2IWIA 3ZYAA 3BGQA 3BHVA 3QUEA 3DQXA 5IA3A 2VGOA 4EEVA 2WU7A 4FL2A 5AUZA 3D7ZA 4G9RA 4RFYA 2BROA 4IFGA 5FTGA 3ZO4A 4XG8A 1G8SA 1OBDA 3LAUA 4IC8A 3RPYA 2YACA 5DR6A 3NNXA 3V5JA 3MTFA 3F2RA 4Y46A 5JFXA 2YERA 4H36A 2BHEA 3JVSA 2FYSA 4FIEA 2UZWE 5EG3A 5JRQA 1MRUA 2YZLA 3QCXA 4YP8A 3V6RA 2CJMA 4RVLA 1PRYA 4FTNA 4BKJA 5C8NA 4ASZA 4F64A 3WE8A 3LMHA 3LFDA 2E9PA 2JKKA 3LCOA 4KSPA 2W7XA 4FRFA 3PY3A 4QMMA 4EJNA 3BZ3A 3ORLA 2OWBA 5J5TA 2PUNA 4UMPA 4DEDA 4N6YA 2XYNA 3RHKA 5A6OA 2XNOA 3TJCA 3PG3A 3E7OA 3PA3A 4O0UA 2V62A 4NUSA 5L2TA 3Q4UA 4HVHA 4L01A 1OL5A 4PTGA 3MS9A 4E8AA 3Q5ZA 3KIOC 3V5QA 3ZH8A 2J0MB 3H9OA 3FQSA 3CY2A 5L6OA 3G9NA 4HYSA 4BRXA 4JRNA 4X3JA 1U5RA 4K11A 2BVAA 4KRCA 2Q0NA 5IUGA 1VZOA 2FSMX 5G1XA 5LXMA 3H30A 4ACGA 3N4VA 4JDKA 4EJ7A 2QURA 4IH8A 4O84A 4RJ8A 2O8YA 3MESA 4DN5A 2AQXA 3F3UA 3UO4A 5I9XA 2C6LA 3CR0A 2XUUA 4MBIA 4JBVA 3ZEPA 3SXRA 4CCBA 4K2RA 4EHVA 2PVHA 5FP5A 4F7NA 4C8BA 4O21A 4P90A 2X2MA 4WRGA 1Q3DA 2Q0BA 4QP7A 5DA3A 1P4OA 4HNIA 4AZTA 4RX5A 4FKUA 3UDBA 4D4VA 4I4FA 5AP6A 5D1JA 5H8GA 2W05A 5HG5A 4F63A 3UPXA 4TYEA 3U9NA 5M51A 3P78A 2X2LA 4ZS0A 5LOHA 3SD0A 2GNFA 5CU0A 3AD5A 2YAKA 3VBVA 3OBJA 3VW8A 3R63A 4EC9A 4D2RA 5CSWA 2W1HA 2R3QA 4NW6A 5HD7A 5JT2A 4R5SA 3QF9A 4EZ7A 4ITJA 3I79A 4FOCA 3SDJA 3H3CA 1PKDA 4LM5A 4OTIA 4F4PA 4G1WA 4LGGA 2OO8X 4HVSA 4CXAA 1R3CA 1G8KA 3TZ9A 4I24A 1CM8A 2UVXA 4ZSJA 4TT7A 4E6QA 2XKCA 3BV2A 2HY0A 4QQ5A 4A4LA 4DTBA 4FV9A 2V0DA 3QKMA 3EKKA 1JKKA 3UMXA 4ITIA 3TNQB 4HGEA 3UZPA 4AW0A 2JBOA 4HYIA 2UZNA 5ETAA 2HWOA 3MH1A 1YHSA 2BALA 3FQHA 5GZAA 3V6SA 5M09A 2QO9A 5F94A 4ZSLA 5HQ0A 3L9NA 2PE2A 2GTMA 4MWIA 4PDOA 4K18A 4W4WA 2G2FA 5E91A 2JD5A 1YHVA 2GS6A 1XH8A 2WQBA 4XX9A 5IQIA 2J5EA 4HW7A 4DEIA 3JR1A 3DAKA 4Q5HA 4R5YA 3ZBFA 3QZIA 4LGDA 3IW4A 1S9IA 5K5XA 4GUBA 2XM9A 2JAMA 5CSVA 5H8BA 3IONA 3DPKA 3AT3A 5T3QA 2VWUA 3ZLXA 5LWNA 1GAGA 2C6EA 2BIYA 4RC3A 1TQPA 3BE9A 3QTWA 4QDVA 1PHKA 3VUMA 4NL0A 5FD2A 4I1ZA 3R9DA 4KA3A 2R3MA 5B2MA 4MF1A 3R73A 4KS8A 2WMBA 4D2PA 4YUQA 1KV2A 2YJSA 1XO2B 3E5AA 3KN6A 4KKHA 2QU5A 4QPSA 3TKIA 3WYXA 4ZS4A 5D12A 4FKLA 5JK3A 4R3PA 1PMUA 5EM6A 3UJGA 5JQ5A 5IMEA 4RT7A 3RNYA 2GMXA 1YXVA 3ORPA 4U45A 5E92A 2KTYA 4BCNA 4ENYA 4Y72A 2EXEA 2Z7LA 2ZMCA 5DOSA 3VQUA 2WQNA 5DN3A 3MDYA 2QKRA 2FB8A 3JY0A 1FVTA 1OPKA 2WELA 4QP1A 1Q41A 3VUGA 5JGDA 4L42A 5F1ZA 2VWBA 5EI2A 1JLUE 4S31A 2I7QA 5KMNA 4II5A 3TIYA 2CMWA 4EL9A 2KULA 3S0OA 3POZA 2WKMA 4RJ6A 2W5BA 1IAHA 3PJ3A 1L8TA 3O51A 1W83A 4GEOA 2VX1A 3P7CA 3R7YA 4EK5A 1WVYA 3FMLA 3KN5A 1Q99A 2EB3A 1ZMUA 4PMMA 1ZLTA 3A7JA 5AV2A 2OIBA 1MQ4A 2QQ7A 4OR5A 4AA0A 5JMSA 5J9LA 1QPCA 4FTMA 2ZVAA 2W1DA 2YM6A 2XCKA 3AT4A 2YIWA 3FMNA 3GENA 3LMGA 3MA3A 5D7AA 5EKOA 4RC2A 2QONA 3O7LD 5A4QA 4GKHA 4FF8A 3MIAA 4AWIA 3UODA 3WF8A 4KUJA 5FTOA 4BDCA 3NFFB 1W84A 3QAME 2GTNA 3RK7A 4CG9A 1APME 3D5UA 4JDIA 1R78A 4FT0A 5IA0A 3R71A 3UNKA 2UZEA 3E3BX 5DG5A 5M4IA 3QX2A 4TPTA 2GNJA 3A8XA 4I94A 5AA9A 2XBAA 2IF8A 1FGIA 2HXLA 1U54A 1H4LA 2CN5A 5HLPA 5BYZA 3FMDA 5CXZA 4R78A 3HAMA 4EQMA 3FLSA 2QG7A 1UWHA 3U54A 3SGCA 2WOUA 3SRVA 2QO2A 1CTPE 3KK8A 3F82A 4RIOA 2Z7QA 2IZRA 3QRIA 4XG3A 3AKLA 3ZO3A 1J3HA 5IH5A 2X7GA 4D55A 4BVUA 4QP8A 3ITZA 4V01A 3UYTA 4DH8A 1CDKA 2PHKA 3H9FA 1NVSA 2HWPA 2PZRA 3RPSA 4RWIA 4AW1A 3DXQA 3NUUA 1ZOGA 1PXLA 3PSDA 2R3KA 4NCTC 2B4SB 3P23A 1LPUA 3ZUVA 2IN6A 4WUNA 2YLEA 5KMOA 2FVDA 5FRIA 4O22A 3UQFA 3RJCA 2EXMA 2UUEA 2C6DA 4I0SA 3FPQA 2ZFYA 1CKPA 4U9AA 3FMMA 5BMMA 3W2SA 4J52A 4FTJA 4MVFA 3COKA 1H08A 4RIWA 4PTEA 2XCHA 4XBRA 1OUYA 3OUNB 3DOGA 3B2WA 3NNWA 4MXZA 4EBWA 2G2HA 3QZGA 5HGIA 1JSUA 4E4XA 2ZB0A 4BJJA 5K3YA 5IZFA 5CAVA 4F0GA 2YM5A 5CY3A 5GIOE 4IB1A 2R9SA 2Z2WA 4XP0A 3W10A 5DE2A 4EC8A 1ZYDA 4L3PA 4ANMA 4D5KA 1NT2A 4F6SA 2EB2A 4YLLA 2DUVA 4FSTA 4BF2A 3S3IA 3C0IA 3ZLWA 4DYMA 4QMNA 1J7UA 2CN8A 3GC0A 3F9NA 3ORZA 3PUPA 4RVMA 3EQDA 3TZ7A 4KNBA 4J8NA 1XH6A 3SVVA 4JG8A 3CQUA 1PXKA 3DB6A 5HESA 4ALWA 4G6NA 3V5WA 3ZRLA 4AAAA 5FXQA 2EU9A 3PSCA 2PL0A 3QL8A 2PK9A 4G3CA 3E92A 4OTGA 4IWPA 4L68A 3P5KA 2C1BA 3VO3A 1ZZ2A 4UWCA 3BHUA 1L3RE 3ORTA 3RZBA 3VBQA 4BC6A 5AV4A 3CKWA 3EB0A 3K3IA 3GXLA 4QD6A 3R1SA 3Q4TA 4CLIA 4U6RA 5HO7A 2J5FA 3VJNA 5J95A 1FINA 5ACKA 1WBOA 1XMMA 4XJ0A 5A14A 4PUZA 5JSMA 2O65A 2ZDUA 4JMQA 4XG6A 4QEBA 2OZAB 2IEWA 3QCYA 4FK6A 1YXTA 3E63A 3PJ2A 4V0GA 4J53A 3W0QA 3H4JA 4YJUA 5CF5A 4M69B 3MY0A 2Z60A 3BELA 2RGPA 3DBDA 3PVGA 3Q60A 4BCPA 4E5AX 4BDJA 3THBA 3VRYA 5IMXA 4CT2A 2WQOA 3ENHA 3QTXA 4EKLA 5AV1A 2XK9A 3TV4A 4L45A 3TJDA 3ZO2A 3HV3A 3C1XA 5CT0A 2P33A 1ZY4A 4WBBB 2PMIA 5FQDC 1O6LA 3M11A 4R7BA 3Q9WA 4JX7A 1UA2A 2QC6A 3U9CA 5E1SA 4PV0A 4CKRA 5IUHA 1PXNA 3M1SA 3AXWA 3VUIA 2WAJA 4I5CA 2C68A 4BKYA 3DT1A 5ICPA 2Z7RA 4YURA 4ZTHA 3DV3A 2HW7A 3L9LA 5K0KA 5HG7A 4HVDA 4LI5A 3MB7A 4PDSA 4M12A 3PDTA 1B6CB 5HD4A 4O7SA 2IZSA 2H34A 5IQDA 3ENMA 2VNYA 4L3LA 1MRYA 3ANRA 5CEMA 3ATSA 2QKWB 2QOCA 3VS3A 2YM7A 2A0CX 3QYZA 1A9UA 5ANEA 4UWYA 4FJVA 4Q9SA 3RTPA 4FGRA 4D58A 3JUHA 2WU6A 4JQ7A 4FEQA 3UVRA 3NUAA 2QODA 4IANA 2AC3A 4O38A 3UG2A 3KVWA 4CFXA 3UIXA 3NCZA 4K8AA 3G2FA 3R7IA 4APCA 2XNNA 2IW9A 4FV3A 2OLCA 4BDBA 3V3VA 4CYJA 1GIJA 2VN9A 3R7EA 4XV9A 1OM1A 5HORA 1R1WA 5EDQA 4EK6A 1OZ1A 2W1FA 4HZSA 2WMQA 4B99A 5CXHA 2BZKB 4BCFA 3F5UA 3PXRA 3A4PA 4BGQA 4BHNA 5J7HA 3W16A 3OT3A 3E8DA 4YO4A 4O81A 2XK7A 3OW3A 3WARA 2DS1A 2VTNA 3EFJA 3ATTA 2WTIA 3PLSA 4HOKA 4QQJA 4WSYA 4FTQA 3IOPA 3DBQA 3KA0A 4F1TA 5LVLA 4TWOA 4PNIA 3QC9A 3FL5A 3R1QA 4ZSEA 1KOAA 5HCXA 5HICA 2W4JA 1PY5A 3Q2MA 4WSQA 1NVQA 4OT6A 4WIHA 3LXKA 4G3DA 4JG6A 4O7TA 2HYYA 3FLYA 2PZYA 2PVJA 2R3FA 3DK7A 3QZHA 4A9TA 1UU9A 3NSZA 5E9EA 2VWXA 1YOMA 2CLQA 1WCCA 2WEIA 5E8VA 4O4BB 5C03A 4F6WA 3ODZX 1OIUA 2B9IA 2R3OA 2RFEA 5JGAA 2CKPA 4F9CA 4O0YA 5CX9A 5FLFA 4E4MA 3W55A 5CALA 2ETMA 3C50A 3P86A 4FZAB 1H0WA 4FSWA 4DFBA 3FYJX 2IPXA 2JITA 4IW0A 3Q04A 2NP8A 4EOIA 3U4UA 3KXZA 2ERZE 2BAKA 4D2SA 2HAKA 4UEUA 5KHWA 4YJOA 1XQZA 4FI1A 3VW6A 3LLAA 3OHTA 4D2WA 3P5JC 3GCVA 1ZMVA 4ORKA 1OI9A 3KRRA 2E9NA 4ZJVA 4DBXA 3NYVA 3BLQA 5A4EA 3NAYA 4KBCA 3BBTB 3QC4A 3PIZA 3BGPA 4ERWA 4LUEA 2ETRA 3EQBA 4GFGA 3C5IA 3L9PA 5C01A 3FBVA 3G51A 1ZXEA 3BYUA 5DWRA 4YC6A 5LVNA 5HE2A 2XAMA 4UWBA 3V01A 4ZTLA 4APPA 3QA0A 4A9SA 5KKRB 3TEIA 4Z3VA 5H9BA 4J8MA 4XUFA 5IDNA 3T9TA 5CI6A 4AE6A 3CEKA 4DG3E 2NO3A 3C4XA 3RI1A 3BYOA 3WYYA 2BCJA 1GJOA 3NMUF 4JL9A 5IH4A 2ZDTA 4MK0A 5FM2A 5CLPA 2ITQA 3E7VA 1UNLA 4FTCA 2BRNA 2JDSA 3ACKA 4FZ7A 2GHLA 2PMLX 4DFXE 3D14A 5B2KA 3TNWA 3PA5A 4NJ3A 4EOKA 4HVIA 3LPBA 3BRBA 4ZJIA 4LRMA 2YIQA 4MNFA 3R8LA 3KULB 1JSVA 4QP3A 2R7IA 4ENXA 2C4GA 3HEGA 3RCJA 3SLSA 2VTRA 1OL1A 2A19B 4AXEA 4NW5A 4ZXTA 3V8WA 1TKIA 3QLGA 1MUOA 2A4LA 4W4XA 3PZEA 4PF4A 5HO6A 4DH5A 4E7WA 2WTCA 4IM3A 3NVKI 2F57A 4HCTA 3L1SA 2YHVA 2BMCA 4IE9A 3E64A 1CSNA 3IGOA 3W0SA 5DRDA 3GBZA 2B55A 3BHHA 3HLLA 3LVPA 3K3JA 4AGDA 1VEBA 3DNEA 2WTVA 3ORIA 3TDVA 4D2VA 3IPHA 2VTQA 3I81A 3E87A 2YWVA 3R30A 1PYEA 4RGJA 2WMRA 4RLKA 4FX3A 2R3IA 3LXPA 2OGVA 2X8DA 3ALNA 5DR2A 1YHWA 3TIZA 5ITAA 3NIZA 1BYGA 1Q62A 4XNEA 1OL7A 3UBDA 4AACA 4L52A 3NAXA 3QRUA 4CCUA 4JG7A 2WTKB 2G01A 3EL8A 4IC7A 4OT5A 3HKOA 4W9XA 5TT7A 3TTJA 3OWLA 2GQSA 2C5NA 5EHOA 3OROA 2OJFE 3QQKA 5KMJA 3PY0A 5AUVA 1OVEA 2BILB 2YM3A 3QQGA 5EHYA 4EH3A 5JRSA 5HTIA 2X1NA 3OY1A 4JQEA 4ZZNA 4NFMA 2J51A 2GFSA 2JDVA 4X2GA 4YPSA 5CENA 4CVAA 5L2WA 4RQVA 1A06A 3QTSA 4I4EA 3W0OA 5K9IA 2PVYA 4FKRA 4KB8A 3SOAA 5GJGA 4QYYA 4EHGA 3IW7A 5CT7A 4QMYA 4MKCA 3QBNA 2UW9A 3UGCA 4IXPA 4D9TA 1J91A 3AC2A 3B8QA 4FR4A 4BZNA 1OKYA 3P79A 1SVEA 4BTJA 1V0PA 3IGGA 3D2KA 4FIIA 4PRJA 4FYNA 5LMKC 5M08A 3OZ6A 2WHBA 3BEGA 1R0PA 5GIPE 2ONLA 1NW1A 4ZK5A 4DDGA 5DIAA 2GNGA 4X2NA 4DHZA 4BCIA 5BUIA 4FVQA 4RIYB 1XH5A 3KRXA 3UE4A 4FTKA 3PPZA 3SHEA 2QLQA 4RIXB 3R1YA 2OXDA 4QP2A 1PXPA 5CU4A 4E5BA 4IAIA 4RWKA 2J4ZA 5F95A 4O4DA 3OWPA 4YZDA 2WMTA 3KKVA 2FA2A 4QMVA 5B0XA 3HMOA 4O0VA 4CFFA 2EWAA 4HCUA 4F9BA 3W0MA 5I9WA 3KCKA 3H10A 1OGYA 2QR7A 4DGMA 1FVRA 2HY81 4GYIA 4B7TA 4A4OA 2C3KA 2PWLA 2ESMA 4RVKA 4TNBA 2VD5A 4MCVA 1DM2A 5DFPA 2QOOA 3WILA 1NVRA 3VRZA 1BKXA 4CD0A 3KMUA 3MV5A 4NM0A 2ZB1A 1Z5MA 3G0FA 2C0TA 2X6EA 3OBGA 3UIMA 2P3GX 3A8WA 2IZUA 4MEDA 5DT3A 5LVPA 2X4FA 3R8VA 3C0GA 4YZCA 3ULIA 3TUBA 4U5JA 2I6LA 5AWMA 4GT3A 4HPUE 4GMYA 3C13A 4TYIA 2R7BA 2W1GA 1M7QA 2W99B 3IDPA 5AP2A 5FDPA 3QGYA 1J7IA 4I6LA 1YVJA 4FTIA 3D94A 4H05A 4BIDA 2X9EA 4KSQA 3C5UA 3ZRMA 2BFXA 3GQLA 3LFEA 3W33A 3AC3A 4JJRA 1WBNA 3RZFA 3EQPA 2GFCA 1H0VA 2VX3A 5IEXA 4EORA 2WIHA 1W2DA 3K5VA 3DK6A 4E6AA 4DFYA 2W1ZA 4IDVA 2GQRA 3PLAE 4MXYA 1H01A 2UW7A 4U79A 2O64A 3EN4A 4UBAA 2ITYA 1GZ8A 2ZV9A 3PZHA 2LGCA 3DLSA 5FDXA 2WIPA 2PMOX 3OCGA 2B0QA 1TZDA 3MVLA 5IEYA 2WGJA 2YEXA 2QOBA 4KIKA 3ZDUA 4NU1A 5IA5A 4EZ5A 1ZARA 3R02A 2XRWA 3OCBA 2GNIA 2W0JA 1M14A 2O5KA 3GU7A 4GK3A 1TQMA 2JKOA 3Q4CA 3TCPA 3ZSIA 3CSVA 5C4LA 2IO6A 1LP4A 4RJ5A 3RAHA 1XWSA 2I0YA 3F2NA 4GL9A 3C4WA 3MVJA 4YJVA 2W1IA 4M13A 4S30A 4ZTNA 3ANQA 4XG9A 4CT1A 3QUPA 4IJ9A 3ZHPC 2VWWA 4BBMA 4YHTA 3KXHA 5EYDA 5I0BA 5AMNA 3RMFA 3PSBA 4BGGA 4RVTA 3OCTA 2XJ0A 2VTAA 4RLLA 2UVYA 2SRCA 4JI9A 2OIQA 4OW8A 5AR2A 4ASXA 5CAPA 2QOHA 4WG5A 3Q6WA 4EH9A 2ITWA 5BYLA 3BL7A 2QD9A 5I9YA 3IOKA 5L2QA 4O2PA 3R7UA 2F7ZE 3FMEA 3KU2A 1REKA 1W0XC 5E8UA 4MXOA 1ST4A 2B7AA 4L43A 1QL6A 4OTPA 5CASA 3BE2A 3HZTA 3QD3A 2E2BA 3TNHA 5CEOA 3MIYA 5KCVA 3FE3A 3I1AA 4YMJA 4C2WA 4F09A 4DA5A 5D7VA 5HIEA 4IB0A 3OWKA 3OC1A 1ZOHA 3I7CA 1JKSA 3G90X 5DT4A 4E1ZA 3W1FA 2RG6A 2BHHA 3E8EA 1WAKA 2XNBA 2OJJA 4IVBA 2XIRA 2PE1A 1BMKA 5IA2A 5AR8A 2XALA 2FSLX 5D11A 5AP3A 4N57A 3W2OA 4DLIA 4HYHA 4KKGA 3DKGA 2ITXA 5KZ0A 3IG7A 3OOMA 2UZOA 2O3PA 3EZRA 4IM0A 4BN1A 4O7WA 4C38A 2PULA 4FKQA 4ZLOA 4C3FA 4JX3A 3ZCLA 3HRCA 4G34A 1YOLA 3PJCA 3C0HA 3ACJA 3I7BA 4YGAA 2IVVA 4K0YA 4UYAA 4G3EA 4IADA 4NTSA 4B6LA 4BYJA 4KBKA 3FXXA 4L6QA 4IAAA 3FV8A 3TTIA 1WVXA 4IX5A 3G5DA 5CEPA 4FYOA 5FBOA 2X39A 4TN6A 4EWHA 5HO8A 4YSJA 3QWJA 4FKGA 2ETKA 3GU6A 3R8UA 4ID7A 3AKJA 2UW0A 3U6HA 4IBMA 2BIKB 2XK8A 5HCZA 5C4KA 4YBJA 3BQCA 5D41A 3TV7A 1GZNA 4JDJA 1J1CA 4BBFA 3NFGB 3CLYA 3Q53A 3VBYA 3BL9A 1Y8GA 4DF3A 3VS6A 3KY2A 1F3MC 4AZFA 4LGHA 3G15A 1BI8A 4AZEA 2XK3A 3RGFA 3GU4A 3O96A 1Q61A 4DE4A 4IB5A 4DFNA 3MSSA 2OW3A 2XAOA 2H8HA 4TYJA 4EYMA 4HJOA 3V5PA 4AN3A 3KXGA 3LXLA 3VHEA 2NRYA 3KQ7A 4ACMA 3WOWA 3LQ3A 2A2AA 2BTSA 2OFVA 2R3NA 5CF8A 5JZNA 3LJ2A 4JR7A 4I41A 4DGGA 1H8FA 5BVNA 3C7QA 3U87A 3ZLSA 4G2FA 3KGAA 5BVOA 5FGKA 3PWDA 3IQ7A 3DJ6A 2GSFA 1PMNA 1UU7A 2EXCX 2GS7A 3AG9A 1YDSE 4OUCA 3V8TA 4CFVA 1YQJA 5EW3A 1DAYA 4AXDA 4DDIA 4PDPA 5C1QB 1URCA 5KNJA 1OMWA 4FKTA 1M7NA 3OD6X 4QP4A 4N0SA 5DHJA 5DEYA 4L3JA 5HBEA 4D4RA 5GZ8A 2YISA 4IWOA 5I9VA 1OBGA 3HMPA 1PXIA 4EQCA 2PMNX 4K33A 4LV5A 2J50A 4IZAA 3QZFA 4FT7A 4HNFA 3Q9XA 5EYKA 4R6VA 4W4YA 5J8IA 4B9DA 2YLFA 3V04A 4ZY5A 1TVOA 2PVLA 4QYGA 3LHJA 5EDPA 2OSCA 4H1JA 5AP0A 3O23A 4BDFA 4BCQA 5ACBC 3F5GA 3VAPA 3DAEA 4EK8A 5EI6A 3HL7A 2UZUE 4GFOA 2OF4A 2XK6A 3CJGA 4O1PA 4PPCA 3HDNA 4WD5A 3BBWA 4GT5A 1W2FA 4U0IA 3H9RA 4DG2E 2ZMDA 5J7BA 3RM7A 3QTUA 4U7ZA 3QQHA 3KC3A 4NKSA 3EQFA 4ANQA 3FLZA 3TG1A 4RA4A 3WZUA 2EUFB 3ZS5A 5E8XA 4FNYA 2VWIA 3VUTA 3S00A 5E4HA 4OBQA 3ETAA 4MAOA 5ETFA 3FEGA 5L6PA 2ITZA 1ZYSA 3AC5A 1NA7A 2I0VA 4CSVA 4M7IA 1FOTA 2WD1A 3C4EA 4KIOA 3NUYA 4BZOA 1DAWA 2BDJA 4D4YA 4FSUA 3ID6C 3DTCA 3NVMB 1M2RA 3G9LX 3V5LA 3LE6A 4FKWA 2WMWA 3QXPA 3PJ8A 1YI3A 2J90A 2X0PA 3NUNA 3QD0A 4J1RA 4D1SA 3UPZA 4KIPA 3GFWA 3R7GA 1YXSA 4IM2A 4YLKA 4XOYA 1XBAA 4Y73A 4O4FA 4X7QA 1JVPP 2VX0A 4A7CA 5FBNC 1M2QA 4V05A 4D2TA 2CCIA 3T8OA 4IVDA 3OXIA 4TY1A 2NNWB 4L8MA 4C58A 1XH9A 2PVKA 3FYKX 4AF3A 4J95A 1Q24A 3PYYA 3SV0A 2ZJWA 3LCSA 3VVHA 2OF2A 4FT3A 4O0RA 5CSXA 5DGZA 2YZAA 1IR3A 5IDPA 4FG7A 3O0GA 4OTWA 3TZ8A 1U54B 4D1ZA 2HELA 3F6XA 3CE3A 4IJPA 3HRFA 4A4XA 3NUSA 1H1PA 3SRVB 3UIUA 4PWNA 3C4ZA 4MNEA 4EOQA 5KKRC 3OUKA 1YW2A 3DLZA 2OI4X 3BQRA 5JKGA 5HLNA 4I0RA 4ZLYA 4X3FA 1Y8YA 4GG5A 5IUIA 5LMAA 4C0TA 3OS3A 3PRFA 5GNKA 1YDRE 5E8ZA 4O0SA 4QMPA 3FJQE 4CLJA 3A7IA 5BQ0A 1VR2A 1PXOA 2QVSE 4UV0A 3C4CA 4FZ6A 3DU8A 4S34A 4E6DA 4NFNA 4WBOA 2GNHA 3GCUA 2QLUA 3ZUTA 3ZC5A 3BWFA 1U5QA 5EOLA 4FKSA 4MF0A 3E8CA 5EFQA 3MJ1A 3NYNA 1JBPE 3FL4A 4L44A 4FL1A 5CQWA 5I3RA 3EZVA 4MQ2A 3PP1A 5E8SA 4F9YA 3FKNA 4R8QA 3EN5A 4KWPA 4CFMA 4RIWB 4EOLA 1VJYA 2XM8A 4RWJA 4QTEA 4GW8A 3BKBA 5KBQA 2A98A 4O83A 4RX7A 4E20A 4BJJB 2PPQA 3KRLA 1JQHA 4RA5A 3ZSHA 2CGUA 3COIA 4FV8A 2YCQA 1AD5A 3LM5A 3FZOA 4I20A 4MTAA 4TWPA 5EM5A 3G6HA 5GZ9A 3RAKA 4NM3A 2R64A 2BDFA 3BYVA 5AV0A 5M57A 2VTPA 2XJ2A 4UYNA 4DGNA 3VBTA 2UZLA 5M4FA 1KUTA 4CG8A 3AGMA 4ONAA 2XRUA 2BAQA 3P4KA 1W2CA 3PXYA 3UC4A 4DC2A 4ZMFA 2YCSA 2YJRA 1OKVA 2C47A 5A3XA 3A61A 4CMTA 5KMMA 3DKOA 3E93A 2IG7A 5BVKA 1ERKA 2ZOQA 3IDCA 3OTVA 4FTRA 3KXXA 3OG7A