4XV1A

B-raf kinase v600e oncogenic mutant in complex with plx7904
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
268
structure length
239
Chain Sequence
DWEIPDGQITVGQRIGSGTVYKGKWHGDVAVKMLNVAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHASKFEMKKLIDIARQTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFGSGSILWMAPEVIRNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIEMVGRGSLSPDLSKVNCPKRMKRLMAECLKKKRDERPSFPRILAEIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
publication title RAF inhibitors that evade paradoxical MAPK pathway activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 239
sequence length 268
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4xv1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4xv1A01
2PTKA 4ITHA 4KBKA 3BX5A 4AZWA 2YLEA 4CCUA 4U3YA 3LFSA 4MCVA 2XM9A 5HNGA 4IHPA 3V8WA 4FTUA 2X2LA 3BCEA 1RQQA 3ID6C 4HGEA 1WAKA 2A2AA 2XVDA 3MBLA 4GT3A 5BVKA 1REJA 3LXKA 4X0MA 2CKOA 3V6RA 2BIYA 1H8FA 4PMTA 4FT9A 2GFSA 3I5NA 2GMXA 3ORPA 2UW8A 3IW6A 3KRLA 4J8MA 4CRSA 4F6SA 4W4XA 2ITYA 3DQWA 4RJ5A 3R22A 3Q5ZA 3ORZA 4DF3A 2B4SB 4MH7A 3AD4A 2XUUA 4BCNA 4BGQA 1OPLA 2W5BA 4MBLA 3B8QA 4CYJA 1UKIA 5CEKA 3IO7A 3SAYA 3MSSA 3ZTXA 4XV3A 4U97A 4HVDA 5LJJA 2C5OA 4E3CA 3PZEA 1ZMWA 2UZTA 3E92A 4V05A 3ROCA 3UMWA 2VTAA 4WD5A 3QAME 4II5A 3ORXA 3PVBA 4WNOA 3MVHA 3UOLA 5IMEA 2QR8A 4I24A 4M13A 3UVQA 4EORA 4MXOA 2FVDA 3HV4A 3D7TB 3OXTA 4FYOA 3V6SA 5J7HA 4BZNA 2ITTA 3QTIA 3PIXA 4WNPA 3UC3A 4W8EA 2RFNA 4YJTA 4Y8DA 5IA5A 5CENA 3CY3A 1RDQE 5CF4A 4M3QA 3OC1A 2NNWB 2O64A 1XH9A 3E87A 4MD8E 4EEVA 4XG3A 5LVPA 4DEHA 4DH8A 4MEDA 4ZLZA 4X2GA 2WFYA 5J9ZA 5TF9A 3EFKA 2O2UA 2PVJA 1FGKA 5EOBA 4YU2A 2WIHA 3UTOA 4BWKA 3UZRA 4I0TA 2VWVA 4MBIA 3RK7A 4FTRA 4DFLA 3NNUA 4I5CA 3HKOA 4FKUA 3VS2A 4L53A 3DQXA 4L3JA 3GEQA 5BVNA 4O7VA 5IMXA 4FNXA 4ONAA 3ODYX 1XH4A 3C0GA 4BIEA 3F7ZA 4EHVA 2WOTA 2ITNA 5L2SA 2HXQA 2WGJA 1OKZA 2WTJA 3UNJA 3V8SA 5L3AA 1ZY5A 2UW6A 1Y57A 1JAMA 2QOFA 3SDJA 1JPAA 1OL2A 1QPCA 4I20A 4A7CA 2Q0BA 4DEIA 4ACDA 3GC0A 5LCJA 3QQKA 2XEZA 3D94A 3QRIA 4HYHA 4N0SA 3U6HA 2IWIA 1YKRA 3NCZA 4N6ZA 4DC2A 3KCKA 4QTEA 3FI3A 5AIKA 1HCLA 2OIBA 3C4XA 2JIIA 4XOYA 2XJ1A 4KABA 4A9YA 5D12A 4EC9A 4YJNA 4JBOA 3VVHA 5HE3A 2J0IA 3K2LA 4CXAA 4TYIA 4JBQA 2BUJA 3EIDA 3KXNA 4WO5A 1URWA 3DOGA 3EN5A 4RWJA 2VWUA 3FMHA 2R3OA 4X2FA 1YWNA 3ITZA 1NVQA 5JFWA 2ITZA 3R7IA 2BDWA 4LL0A 1Q4LA 4ACMA 2CNVA 1YVJA 5HVYA 2V22A 3UIMA 3HGKA 5D7VA 3E8NA 3FLZA 4PRJA 3FI4A 4EOQA 5ANDA 3CD8A 3DU8A 2YCFA 1OBDA 2ZB1A 3BHUA 1L8TA 1OL7A 3HAMA 3Q9XA 4QYEA 4ZTSA 4YO6A 5IDPA 5JGDA 4IDTA 1XH6A 1CSNA 5GIPE 5E8WA 3AGLA 3QWJA 3L8VA 1REKA 4WIHA 4ANSA 3KULA 3NUYA 1JWHA 3OOMA 2EU9A 4J98A 2X7FA 3TT0A 4UMRA 4GVJA 4HZRA 5KBRA 2O3PA 2WMWA 3PG3A 3BV3A 3GGFA 1PXMA 4H3QA 2B9JA 4BGHA 4HVSA 1KE7A 3R30A 2WKMA 4L46A 5EI6A 5IUHA 1LUFA 4RFMA 3ZLWA 3FPQA 4JAJA 4BI2A 2C1BA 3LCTA 2P2IA 3KA0A 3DGKA 3WI6A 4IVCA 2C3JA 4QMPA 3GCQA 2W06A 1PW2A 3FXWA 3ULIA 2OZAA 3WF6A 5AR2A 1PXJA 1W82A 3A61A 3DXNA 4S2ZA 4UWCA 5DEYA 4MBJA 4IE9A 3AC5A 2CCIA 4BKJA 5CVFA 5JFSA 4QTCA 5ETFA 3ZFMA 1PY5A 2PSQA 2BRHA 3NW6A 5AP7A 4EUTA 2X9FA 2E9PA 5HICA 5CXZA 3VAPA 3IW4A 2FSLX 2JLDA 3GUBA 3UOHA 3HUBA 1WVWA 4KIOA 3PG1A 2JITA 5BQ0A 3LFBA 2BDFA 4KAOA 4FV8A 2V7AA 5FEEA 2YIWA 2BKZA 5JQ5A 3E8CA 5J7BA 4Y72A 4I92A 4RMZA 2YWPA 3Q3BA 2NRUA 2OF4A 4M8TA 1KOBA 3AT2A 4Q5HA 5FBOA 4M0YA 2VWYA 2UUEA 3DA6A 2OKRA 2I1MA 4I22A 3PA3A 5IQIA 1I44A 3RKBA 3ZZEA 3FJQE 4MWHA 4LMUA 4O7RA 3FHIA 4U42A 4NIFA 3PY0A 4M69A 4UALA 3HMNA 3MH0A 3Q4TA 4C59A 3NW7A 4WA9A 5L8LA 4FTIA 3UZPA 2ZDUA 1H27A 3I6WA 2HAKA 4RIYB 3KN5A 4FUYA 3DXPA 4GVAA 3NUNA 4F9CA 1OPKA 1ZOGA 1U4DA 1SVHA 2C6DA 3O8PA 4BDGA 3CPCA 2C3LA 2W9ZB 5CSWA 5L8JA 3U87A 3VS7A 3R7EA 4BDKA 3TNIA 1DAYA 4E8AA 4MXCA 1YXSA 2GTNA 1LR4A 3G15A 3GNIB 2UW3A 4DAWA 3PXZA 4YJSA 4RWIA 1R1WA 2JDTA 3LQ3A 3SQQA 4UXLA 5C8KA 5IEVA 3N4VA 3TZ9A 3MA3A 4ORKA 3QZHA 3A7IA 3SRVA 2Z02A 4Y5QA 3V5WA 5IA4A 3CR0A 4ZTHA 2C5VA 3I6UA 5AAGA 5GINE 2B7AA 4WRSA 3UE4A 2GS7A 2DQ7X 3EZVA 5EG3A 4RWLA 4ZP5A 5HD4A 2HZ4A 5JRQA 5M4FA 4NM5A 2BKKA 3L9NA 3TTIA 2AYPA 4QMYA 1Q5KA 5E8TA 2X6EA 2CKEA 5LCKA 2F7EE 4YTCA 3HNGA 1OZ1A 2P33A 3NYVA 2XJ0A 2FA2A 4JAIA 4U9AA 5DI1A 3SKCA 4FA2A 5AUZA 5JGBA 3RCDA 2PVMA 3F5XA 3PP1A 4GT5A 2J51A 1JOWB 2R3KA 4A9RA 2P0CA 4ZS4A 3MB7A 3K3JA 4DTBA 1JKLA 2ZM1A 2VTTA 4UWBA 5IF1A 3LZBA 3DFAA 3ZUTA 3RALA 3HL7A 2VGPA 5EK7A 1Y6BA 2J50A 3CJGA 4JDJA 5DIAA 3FV8A 4AA0A 3EN7A 4XG7A 4E5AX 3R1YA 5FP5A 5K0KA 3PSCA 4RT7A 4FNWA 3QC4A 1SMHA 4EHZA 4APCA 3WE4A 4YBKA 4QMZA 5CU2A 2H9VA 3QD4A 3HMMA 1UNGA 3QD2B 2PUPA 3QKLA 4RZWA 2OGVA 3CE3A 3TUDA 4UWYA 3R9NA 4MQ1A 2X39A 4U81A 3I1AA 4D2SA 4YHFA 5E8YA 4EYMA 5EM5A 4L45A 5I5ZA 2HIWA 2W96B 2RKUA 3GU8A 5AV0A 5HLPA 3GCPA 2VGOA 4RVKA 5DT0A 1MP8A 3DK7A 2WMVA 3QBNA 3ZONA 1CM8A 5A3XA 4XG6A 3AC4A 1M2QA 3MYGA 1X8BA 2UZBA 3UG2A 3PJ2A 4IQ6A 3QL8A 3V8TA 3LFFA 3EL7A 3NUAA 4QP4A 3FMEA 5KX8A 4LQMA 3ORIA 3P79A 4FTAA 3EN6A 3GENA 4MAOA 4R77A 2I0YA 1KE5A 3OP5A 2JEDA 4D55A 1A9UA 2PUNA 3RINA 4TL0A 3EB0A 3VNTA 3MPAA 4R3RA 4EKKA 2CLXA 2FB8A 4IWOA 5CAPA 3TJDA 5H9BA 2WTCA 3HUCA 4HPTE 4X3FC 4GJ2A 4AZSA 3G6GA 4RPVA 3CKXA 4BCKA 1FVVA 2OICA 4BN1A 4RIWB 4TNDA 3BZ3A 5C03A 2W1DA 5GZAA 3ODZX 1U59A 2PZPA 3EN4A 4JIAA 5DOSA 1CKPA 2J5FA 4FVRA 2CKQA 3POOA 1ZXEA 4X21A 3DAEA 4WKQA 4K9YA 4ZJJA 3W2CA 4IFCA 3NR9A 4CFWA 2VTJA 3O23A 4YJVA 4WOVA 4RZVA 5AP1A 4FKVA 5ACKA 3PXRA 3OEFX 4YJPA 4B9DA 3B8RA 3F66A 3THBA 3TG1A 1PF8A 1B38A 2XIYA 1OMWA 5JZJA 3PZHA 4I23A 4HVHA 3I79A 2C0TA 2XYUA 2X6DA 2Z7LA 4GK2A 4PPCA 4XG9A 2CNQA 5KZIA 3CS9A 4K77A 1TKIA 3KXXA 1J7UA 4A9TA 3ANQA 3Q4UA 3BV2A 4XH6A 3AD6A 4UMUA 1OUKA 4JG7A 4KIKA 3V5QA 3NUXA 5HESA 1R3CA 2VTMA 3FKOA 5CLPA 4EZ5A 3DBQA 5AJQA 2YITA 3JXWA 5M4CA 1YHVA 1OITA 2YWVA 3CQEA 5HCZA 5B2LA 5IEXA 5AFVA 3Q60A 2R9SA 3MY5A 3KRJA 4UMQA 2WTKB 5EQEA 5AADA 3S4QA 2KTYA 5CT0A 4EONA 3ZSHA 4JBPA 3K5VA 2E9OA 1JNKA 3IW7A 4GT4A 4IAFA 4R1YA 4AT4A 4C38A 3DKCA 3UYSA 4CFVA 2YJRA 3JVSA 3ACJA 4Q9ZA 2XIKA 3D15A 3RTPA 5JQ8A 1HOWA 5H8EA 4TWPA 3JVRA 3OY3A 2YDJA 2UZNA 4G3CA 5ANOA 4O0SA 3RAHA 4BF2A 5C8MA 5CAVA 5EHYA 2OI4X 4S31A 2JBPA 3PPZA 4X6QC 3RAIA 4B8LA 3LPBA 4BBMA 4GS6A 4JDKA 4DFXE 4GIHA 3RK9A 4WNKA 2BZKB 5DBXA 5L2QA 1KOAA 2AC3A 3G0EA 3LJ0A 3L9MA 3PY1A 2EXMA 4GUEA 4ZZMA 3KU2A 3LFEA 3SC1A 3Q4ZA 1PMVA 3FLNC 1LP4A 3VQUA 3NW5A 5A6NA 3HA8A 4FEWA 4MQ2A 1YXVA 5F4NA 3SV0A 4R1VA 4B4LA 3A8XA 3V51A 4G2FA 3BQRA 3F7WA 1Q8ZA 3EFLA 3BEAA 3QQUA 4XV2A 5HTCA 3L8PA 4RIXA 3DAJA 2W5AA 4FK3A 4GEOA 4W9WA 4QPMA 4FSYA 4YLJA 4TZRA 3G6HA 4FR4A 5K0XA 3QCYA 5DRBA 5FG8A 3N4TA 3DV3A 3MN3A 3JS2A 4O2PA 1P5EA 1PXNA 2OJGA 5AUYA 2WQBA 4ZLYA 3FZRA 3NUPA 4O7SA 4E4XA 3LW0A 4U45A 4USDA 4UV0A 3KB7A 3FKLA 5CU6A 4CFUA 3DJ6A 4QD6A 3LM5A 2R3MA 3CEKA 4X6RA 1ZY4A 2CDZA 2WMRA 4D0WA 4QYFA 4IAKA 3OTVA 4P2KA 3S95A 3MTLA 1OL1A 3KGAA 4BCHA 4E1ZA 3G9LX 3MPTA 4FSNA 1WZYA 2BAQA 1YQJA 3LIJA 2JFMA 2OF2A 3WZKA 2C5YA 3ORKA 4IM3A 2BDJA 3E93A 2OIDA 4AW0A 3O7LD 4E4MA 4E6CA 2YM8A 3EQBA 5HOAA 2PY3A 2QD9A 4K1BA 2PL0A 3TI1A 3ZRLA 3C4FA 2XNGA 4O91A 4DGMA 2GNIA 2OFUA 3U54A 2PVNA 2X8IA 5KE0A 3LE6A 3TIZA 3D5VA 3NAXA 5ICPA 3PSBA 4RC2A 5I3RA 3DZOA 3NIEA 4KBAA 1XH5A 5CXHA 2C30A 3QUPA 1F3MC 2F49A 3NIZA 3R2YA 4Q5EA 4BCGA 3B2TA 4PTCA 5HG9A 4E5BA 1CKJA 2CGUA 2CGWA 5I9ZA 4CMTA 4J95A 4H39A 3D83A 4I3ZA 2IG7A 2YCQA 5JZNA 2G2HA 4EOKA 3OT3A 4L52A 3R8PA 3N4UA 1YW2A 2IJMA 3QWKA 3Q5IA 3SOCA 3FZ1A 3COIA 3RPYA 4O0RA 4J52A 3K3IA 3R6XA 5TO8A 3U4UA 5M4UA 4LRMA 3R01A 5M55A 3RAKA 4NJ3A 3RGFA 4LV8A 3VS6A 5EFQA 4CKIA 4C3RA 4FYNA 4O1OA 2WMXA 3DJ7A 4AP7A 1G3NA 2GHGA 2I0EA 2AC5A 3EQCA 3H3CA 3NEWA 4EH7A 4F7SA 4FSTA 4OTFA 3RCJA 4CKJA 2E9UA 5ANJA 2ETKA 4AG8A 2H96A 2XRUA 2YM5A 5HO7A 3KULB 2Y0AA 2Z8CA 2UW7A 3MY0A 4WG3A 1PKDA 4P7EA 1JSTA 3R0TA 2XKDA 1MUOA 4UYAA 1SNXA 5EYCA 3JYAA 4X3FA 3IONA 2RSVA 1Q8TA 3UPZA 3FMMA 1OB3A 3KEXA 5AUVA 4FT5A 3TIYA 4U40A 1YI6A 1G5SA 2XP2A 3IGOA 3MH1A 1WVYA 5EW8A 3R00A 4DG3E 4IFGA 4U0IA 4XRLA 4NEUA 4HW7A 2OZAB 3W2PA 3E3BX 4KNBA 4UMTA 2VTOA 1SM2A 3DK3A 3MFTA 5BUIA 4F09A 5JN2A 1W8CA 3ZOSA 2W7XA 2WB8A 4BL1A 1MRYA 4NW5A 2YIQA 3Q53A 1IRKA 1Y6AA 1PHKA 4TY1A 3VUKA 5FEQA 1XWSA 3LLTA 4X3JA 4ZZOA 2VTSA 4IWPA 3T9IA 2UW9A 3KVWA 4DE4A 2GNFA 4Y5HA 5ETIA 3KXMA 3LFAA 2JD5A 2R0UA 2ZOQA 4FT3A 4MF1A 2R7BA 2W1FA 5IA0A 1GZ8A 4ASEA 2QKWB 2HZ0A 1UNLA 4FTKA 2OJFE 4Z7GA 3QZGA 3SXFA 2GQRA 5M07A 3QU0A 3R2BA 4O86A 4H3PA 3OEZA 1W7HA 2UZVA 4PP7A 4I5HA 3Q6WA 5BYZA 4LYNA 4JOAA 4DBNA 2OXDA 2W5HA 4F9YA 3U6IA 3V5JA 4BTJA 3PWDA 5EOLA 3FZOA 2Y7JA 1AQ1A 1H1QA 3FWQA 4QP6A 4RC4A 4P5ZA 3HV5A 5DRDA 3PXFA 5CQWA 4EK5A 4G34A 4QO9A 5EHOA 2PE0A 2F2CB 1LEZA 3SX9A 4EH6A 1SYKA 4YJOA 4ARKA 1Q8YA 4NCTC 4C7TA 3DCVA 4D28A 2B53A 4ZTMA 5IA1A 5KMJA 4NFMA 4XG8A 3SGCA 4BY9E 2DUVA 3RZFA 4PUZA 3DB8A 1CTPE 2WAJA 4E26A 3SXRA 4WNMA 3QRUA 2X4ZA 3BYOA 3ZEPA 2WHBA 3DKFA 4TN6A 3FZPA 5KMNA 3FYJX 2O0UA 3NNVA 2DWBA 1FOTA 3FHRA 1H1SA 3P08A 3MESA 3HMOA 4BCJA 3RVGA 3PP0A 2A0CX 3EOCA 4WSQA 3TJCA 5I9XA 4QQTA 4GYGA 3W2OA 3UPXA 1S9IA 3SRVB 2E9VA 2OJIA 3PE1A 4X2KA 4O7LA 1OIUA 1PXPA 1Q97A 1WVXA 4ZTNA 4Q9SA 4TYJA 3RAWA 3R7VA 5E8ZA 4AWIA 4AXAA 5A4EA 4AGUA 3CKWA 2O5KA 3HA6A 2E9NA 5IQHA 4IX4A 1Y8GA 2WELA 4IAIA 1ERKA 1Q3DA 2J6MA 2IPXA 5A4TA 4KS7A 3R9RA 5BYYA 2C5XA 5DT4A 4IW0A 4FC0A 4FV6A 4IDVA 3VS4A 3WYYA 4FL1A 2B1PA 2Y4IB 4IWDA 4YPSA 3E8EA 4F0FA 4FEUA 4I0SA 2C6MA 3A4OX 3UYTA 3WBLA 4YZMA 3ZSIA 2IVUA 4NL0A 4O0TA 3UQGA 4ZSGA 1XJDA 4F9WA 1UV5A 2V62A 5ANEA 4IX5A 3VJOA 5I0BA 3MVJA 4CT1A 1OI9A 4C4HA 3KFAA 2WTVA 3OUNB 3PWYA 4QMNA 2XS0A 4DN5A 2W4OA 3W2RA 2PUUA 4AZTA 4FL3A 2J4ZA 4OTWA 4JRVA 4G31A 5CAQA 5DPVA 5AP2A 1J7IA 2BILB 3NZ0A 4WUAA 5A54A 3TM0A 2A19B 2OWBA 5IU2A 4DEGA 3C1XA 4N57A 3QCQA 4BIDA 1NY3A 3QTRA 2W4JA 2YN8A 3AC1A 1RW8A 3EQGA 3VO3A 4IVBA 3BU6A 4CFNA 4FSWA 5FLFA 5HCYA 3HRFA 3ZU7A 3ZDIA 2QU5A 4PV0A 4RQKA 1U5RA 3TACA 1CDKA 3P9JA 3GU7A 3MPMA 4LUEA 4RX9A 2R64A 5IUIA 1RE8A 4D2WA 3MI9A 3A7GA 2QHNA 3GU4A 5HTIA 1ND4A 5EDPA 2QURA 4AUAA 3G2FA 4OTQA 3AC2A 1M7NA 3GC7A 5G6VA 3WF5A 2NO3A 4G3EA 3HP5A 4XX9A 3FEGA 2O65A 4HGSA 3ORTA 4DGNA 3QTXA 4LOPA 3ZFXA 2WO6A 5H8BA 4PTGA 4MX9A 2VZ6A 3F3WA 4FVPA 5GZ8A 5CWZA 5JFXA 4W4VA 3QXOA 4OUCA 2ZMCA 1FPUA 5IUGA 3PA5A 4FKGA 4GKIA 3FMLA 4J97A 3MW1A 5J5SA 5KHXA 5ETAA 4G6LA 4MNFA 5KCVA 4RX8A 4CT2A 5AR4A 4QP1A 4BBEA 4QNAA 3W8LA 5BVOA 2OXYA 1MRVA 2UZLA 4FF8A 3E64A 3NUSA 3QYWA 5CEOA 3W55A 1UWHA 4DEBA 2GDOA 3R73A 3Q96A 4RG0A 3WARA 3AT3A 3QTSA 4BBFA 4BICA 5AP3A 1KWPA 4D5KA 5E9EA 3SLSA 2ZJWA 3MIYA 4XV9A 4TYHA 2VX0A 1NW1A 3FY2A 3KY2A 1OL5A 3QC9A 2GNHA 1IASA 5FTOA 4CZTA 2ZDTA 3AXWA 5TE0A 5BX0A 5M53A 4C8BA 1XKKA 3H9OA 4KA3A 4OLIA 2BMCA 2YM6A 2ZB0A 1IAHA 2PWLA 4ZJIA 4F6WA 3S0OA 4AACA 4DGLC 2W05A 3COHA 4PWNA 2J0KA 3BWJA 3BGZA 4AFJA 3NVMB 4YZBA 4CG9A 4Z55A 3PIYA 4DH1A 4FSQA 3LCDA 4N4SA 3KN6A 3FXZA 1OUYA 2PZIA 3HVCA 4O0YA 3R8MA 4FKLA 1Q62A 5HG8A 4QP7A 4ZZNA 2O8YA 3GU6A 5HO8A 3ZUUA 4YHJA 4ERKA 3FI8A 3R8LA 2IVVA 1XO2B 4AU8A 4ZJVA 3SVVA 4XG2A 1OGUA 2PU8A 1W0XC 3U8WA 3TDVA 4G3FA 4O21A 3NGAA 2FUMA 2W1GA 2R3GA 5CX9A 2NPQA 3VBQA 3MWUA 2X9EA 3U51A 3M1SA 3SHEA 5KUPA 5F9EA 3SW4A 2XMYA 5HQ0A 4KD1A 5DH3A 1MQ4A 1BL7A 5DYJA 4J99A 4DFYA 5J79A 2J0MB 4YTHA 2X2KA 3BU3A 3FBVA 2HW6A 4EZ3A 2EXEA 3BU5A 4IB0A 2IO6A 2R2PA 3MFRA 3O7LB 4W9XA 5ANIA 1NXKA 1IA8A 2WQMA 4FSZA 4YJQA 5AIRA 2C6EA 3BE9A 4GFMA 5IH5A 3MFSA 3R9DA 3UNZA 4QQCA 5EYDA 4BCQA 4BIBA 4D2RA 4JNWA 4CVAA 2PMIA 2GNGA 4JXFA 1R39A 4ERWA 4F6UA 3MS9A 5DN3A 2Y6OA 3LFDA 2Q83A 2UZUE 4I21A 4LMNA 2BZHB 3CXWA 3PSDA 3PY3A 4GIIA 3R83A 3W18A 3WF8A 5A9UA 4J1RA 4A9UA 3S00A 3ZO3A 4ACCA 3GI3A 3EH9A 1VJYA 4NCTA 4CGAA 2JDOA 3VUDA 5A4LA 4G5PA 4NUSA 3MA6A 3MVLA 3O96A 4AAAA 4IX3A 4FZ6A 4QP3A 4WSYA 4C0TA 3FL4A 3BKBA 4C62A 3UNKA 2QG5A 4G3GA 4F0IA 4BR3A 4XP2A 3V5TA 3Q2JA 4FL2A 4K8AA 4O22A 2JBOA 4OTRA 4BDDA 2WEVA 3IOKA 5HU9A 3LJ1A 2HCKA 1F0QA 2XNPA 4NK9A 4ALUA 3VUHA 4QPAA 3DPKA 4JDHA 4QOXA 3RBWA 5AR7A 4HJOA 4L44A 4YNEA 4CV9A 3M42A 4NJDA 4TYEA 4BDBA 2UZWE 4FG9A 2B54A 1WBVA 3FMJA 4LGGA 3LXNA 4FKSA 5HU3A 2X8DA 3DFCB 5IA3A 3F82A 3HYHA 5HBHA 2ZMDA 3ENHA 3DTCA 3VJNA 4FEVA 3HRCA 3RPRA 4AE6A 5KMOA 3PDTA 2FSMX 3GXLA 3HLLA 3OS3A 5K9IA 3O71A 4C3FA 4YO4A 4EOLA 2PULA 2ZV7A 1QPDA 3ZBXA 5HLWA 1G8SA 2OXXA 3CLYA 2B0QA 4ZTRA 2YJSA 3VW8A 3K5UA 2XZSA 3ERKA 4O96A 4FTQA 4BCOA 2VTRA 3RK5A 4L68A 3ZCLA 5DHJA 4C02A 5AUUA 4FNZA 5CQUA 4RIOA 4RX5A 2XYNA 4D1ZA 1WBNA 2PZ5A 4HGTA 4EJ7A 2EVAA 4MK0A 2QOBA 4HYSA 5CASA 3I7CA 4EC8A 1E1XA 3H30A 5BUJA 3LFQA 3OHTA 4R7HA 3PYYA 3BYUA 4D4VA 4ANOA 3DDPA 4QMVA 4AT3A 4CNHA 4L6QA 1BI7A 2F2UA 2C4GA 3CBLA 3L9LA 4C2WA 3ACKA 4TNBA 2JIUA 5HTBA 5C4KA 5CEQA 4YR8A 3TNHA 5IQCA 2PE1A 4RA4A 2OJ9A 2RG6A 4FIHA 4FKJA 4USFA 5J87A 4YLKA 3V01A 4V0GA 4C4GA 1R0PA 3CTHA 2WNTA 3G33A 3LOKA 5D11A 5GJDA 5GZ9A 4ZK5A 4BHZA 3H10A 2B9HA 3BLRA 1OKWA 3R7YA 2SRCA 4CFXA 3NX8A 4MNEB 5C01A 5AA8A 2W1EA 5EW9A 2F57A 3MV5A 1O6YA 1OPJA 5CU4A 3AOXA 4X2JA 2ACXA 4ZLOA 1BLXA 1KE6A 3C50A 5A6OA 1KUTA 3C5UA 2PMOX 4FIFA 4YTFA 3K54A 4BTFA 3FXXA 3C5IA 3H9RA 5DR2A 5L8KA 3OW3A 4LOQA 2IVTA 5FWKK 2I6LA 4FE2A 1WBSA 1O6KA 1UVRA 2J5EA 3FL5A 1V0PA 5CI6A 2I0VA 5CSPA 4G17A 1H4LA 3BHTA 4ZSEA 4F4PA 5TKDA 3AMAA 2C6LA 2PUIA 3KQ7A 4MKCA 3VBWA 5B2KA 5IKWA 4CQGA 4DEEA 3IDCA 3DS6A 4Y95A 4GUBA 4ASXA 3KMMA 2X1NA 3QXPA 1ATPE 5ANKA 3F2AA 4BFMA 2WQOA 4V01A 5HX8A 4X3FB 5E8UA 4ID7A 4GFOA 2YZLA 5E90A 4M66A 3DJ5A 5EDRA 3D5UA 1TQPA 4CZYB 3IDPA 5CAUA 2JKMA 4D9TA 3GVUA 4ZMEA 3HV7A 3GCVA 5AP0A 5JT2A 2PZRA 2W0JA 3CGOA 5LWMA 4C58A 3RM7A 4EQMA 3T3UA 2XF0A 4EL9A 1M14A 4F9AA 3U6JA 2XKEA 1PYEA 5B0XA 3HMPA 2PK9A 3VWAA 3LLAA 4FX3A 4IXPA 2YAKA 3LQ5A 4JL9A 3IK3A 4LI5A 4O0VA 5EH0A 3ZMMA 5L6PA 3SW7A 2O63A 5CU3A 4M15A 4A06A 2YM4A 2RL5A 3VBXA 5KKRB 3VIDA 3NYXA 2OLCA 5F95A 4FICA 1E1VA 3RPVA 4AOIA 5GIOE 4EOOA 5FD2A 2G2IA 3DK6A 3D7TA 4YC6A 2QOHA 4YLLA 3LVPA 3FLYA 4KSPA 5T3QA 4CLJA 2BHEA 4PP9A 1ZRZA 4I6QA 1H28A 4IWQA 1ZYCA 3E63A 1NVSA 4DH7A 4UY9A 5C9CA 4I4FA 2XNBA 1APME 3A8WA 2GNJA 2C0OA 2ITQA 3A62A 3EQHA 1DS5A 4L3PA 5J1WA 3QA8A 1K3AA 2B52A 2Y4PA 4ZXTA 3R71A 2RGPA 3ZLYA 1SZMA 2PVLA 2W99B 3NRMA 3QRJA 5HEZA 2AUHA 3TV6A 3WZEA 3ZSGA 4ZSAA 1PXKA 3AMBA 3FC1X 3ZRKA 3C13A 4LRJA 3AC3A 3QD3A 4EK3A 2ZV9A 3OW4A 5HG7A 3UOJA 3DBEA 2YIXA 3DDQA 5AMNA 5C4LA 5ANGA 3T3VA 3PJ8A 2ZV8A 3ANRA 3FUPA 4U44A 4ZAUA 5ITAA 3C0HA 1AGWA 2G01A 5AV2A 5HCXA 4PDPA 3FI2A 3TTJA 1P4OA 4DBXA 4L42A 1U54B 2A4LA 3LXLA 3FLSA 4AF3A 4QMWA 4M12A 4AE9A 2LGCA 3ENMA 5AAEA 2R3IA 1TVOA 5EYKA 3BYSA 4EZ7A 4C4FA 3HEGA 4E93A 4G1WA 5BVDA 3RI1A 3IDBA 4EH9A 2XK6A 2QOLA 4EBVA 3OWKA 1KSWA 5DFPA 2EXCX 2R4BA 3VUMA 5AA9A 1Y8YA 3A2CA 5EM8A 3ZZWA 4EHGA 2R3HA 1SVGA 2BHHA 2B55A 2ZV2A 3I0OA 5AV3A 4MVFA 4HPUE 1FINA 2VWBA 2W17A 4O6EA 5FRIA 3COMA 1DM2A 4K0YA 4E6AA 1FVTA 3PJCA 4CLIA 5AR3A 1BMKA 4D58A 5A14A 2OU7A 3KKVA 1U5QA 3FDNA 4ZY4A 5BVFA 4JR7A 4AGWA 2DYLA 2WEIA 1FBNA 5LVLA 4U79A 5FXSA 5IQFA 3IECA 2ITUA 5E8XA 4DGOA 4U41A 4FZDB 4JLCA 2BTRA 4FKRA 2YA9A 4BI0A 5EM7A 3FKNA 2ITVA 4D0XA 5AUXA 4OTHA 2BAKA 2ESMA 4QYGA 4OTIA 5F20A 3NCGA 3QQHA 4UMPA 3CPBA 3F9NA 5HBEA 4UZHA 3ZXTA 3QALE 3NPCA 2PPQA 3KXHA 4CG8A 3I4BA 5AX3A 3TWJA 3H9FA 4V04A 4K18A 2BRBA 5DT3A 3EJ1A 3I60A 3W2SA 2YEXA 2R3LA 3HX4A 3SOAA 4EUUA 5CALA 3DXQA 1Q8WA 2BFYA 4AN2A 2UZDA 4UBAA 3Q9WA 5E8SA 3ORMA 3VRZA 2RFDA 4O7YA 5HX6A 3C0IA 4UYNA 4Y83A 3P1AA 4FV1A 3UQCA 4O7TA 3F2RA 3CTJA 4EH8A 5C1QB 4FKIA 4M68A 5IZFA 3FE3A 4I0RA 5CF5A 5J8IA 4FBXA 4USEA 3AD5A 4GH2A 2GHMA 4I6BA 4XNEA 2ITXA 4JR3A 3NVKI 4RGJA 4EK8A 1PMNA 3FMDA 4D4YA 3UIXA 2W1IA 2UW0A 3F69A 4FTLA 1FMOE 4ALVA 2I7QA 1T45A 2PVKA 4NKSA 5LMKC 2X81A 3BHHA 4JQ7A 4KIQA 5CANA 4MF0A 3GB2A 1O6LA 2YERA 3P4KA 4JIKA 5CI7A 4DCEA 3UQFA 3NMUF 2ERZE 2R3RA 4LM5A 2C3KA 5AR5A 3TEIA 3LKMA 4GFGA 4AZEA 4FT0A 1F5QA 3KL8A 2VX3A 5HI2A 4O6LA 4DT8A 3L8SA 4JDIA 1OBGA 4O27B 3CD3A 2EUFB 3BBTB 5M56A 1H01A 2C6IA 3RMFA 3UBDA 5IQEA 3F61A 4PY1A 4YZ9A 5CTPA 4BDJA 1J91A 4QRCA 3PLSA 4EHEA 3OBJA 4ENXA 5DR6A 1YXXA 3E88A 2QHMA 2HW7A 4HYUA 3E5AA 4FKWA 4GSBA 4FIJA 2GHLA 3NUUA 4GG5A 4O0WA 1BX6A 4NW6A 1ZMVA 2OW3A 5AM7A 4TYHB 3HDNA 5CU0A 3QKKA 3RNIA 5BUEA 5A4CA 3EWHA 4MD7E 4F70A 3M11A 3F3UA 4K11A 1A48A 2QLQA 4RIYA 5HE1A 5C27A 4O7WA 2F7XE 2QNJA 5JSMA 5HIBA 4RVLA 2OH4A 2JC6A 3ZO4A 4PL4A 4FIIA 3GCSA 1Q99A 4RSSA 2GSFA 3UO6A 3D0EA 2PYWA 5LOHA 3BYVA 3KK9A 2FSTX 3BHVA 3QUDA 5IA2A 1ZYJA 1PYXA 2QLUA 2UVYA 5J9LA 5EW3A 4UX9A 1J3HA 4AZVA 4XBRA 4F9BA 4F65A 2PMNX 2YISA 3KXGA 4FKOA 2CLQA 5T6KA 3OMVA 4AGCA 4O84A 4LL5A 4G16A 4RC3A 2IVSA 2OH0E 5TR6A 5JKGA 2VO0A 3KVXA 3N51A 2WZJA 5AWMA 3KRWA 5TOZA 1Z5MA 2WTWA 3MB6A 4FKTA 3FYKX 2CSNA 3HMIA 5M08A 3EKKA 2XIRA 2VN9A 1UKHA 3G5DA 3EYGA 2C6OA 3QTZA 1J1BA 3O2MA 2Z7SA 3WZJA 3FQEA 4F64A 4AX8A 3R1NA 2Z60A 4FV3A 5H2UA 4YJRA 5L2TA 2J90A 3TKIA 2C47A 5EKOA 2KULA 3OF0A 4O38A 2LAVA 4TW9A 3QUEA 4R3PA 5DA3A 4A4XA 4FSUA 2BCJA 5E1SA 5LVOA 2UVXA 4DA5A 4FGRA 3QA0A 4FV2A 2GFCA 1OKYA 3E8DA 4LFIA 4AZFA 3AGMA 3QCSA 4S30A 4XYFA 4FGBA 4BCMA 4AS0A 5JEBA 1GY3A 4QNYA 1GZNA 4NH1A 4AW5A 4EK6A 4GU6A 1YDSE 4L3LA 4DFZE 3TZ8A 5H8GA 4BWXA 5HORA 2QOIA 2WMAA 3PUPA 4ACGA 2PE2A 2CKPA 5LVNA 1JBPE 4X7QA 1S9JA 1WBOA 4C37A 3OXIA 4PPBA 1W98A 4ZIMA 2YDKA 1V1KA 2HYYA 4M97A 2Z2WA 3RWQA 3F3ZA 3FLQA 2QG7A 3CIKA 4L00A 3RNYA 2IZRA 3BLHA 4JS8A 2BRNA 3VF9A 4F1OA 2BTSA 4GK4A 5CZIA 4AT5A 5EQYA 1XBAA 2BIKB 5K5NA 1STCE 4FTOA 4XRJA 1VZOA 3QZIA 4KWPA 4LRKA 5CSHA 3FSFA 4QPSA 4E6DA 2QI8A 3TUBA 3A7FA 3F5GA 2WIPA 3BE2A 2JDRA 4DTKA 2YHVA 4FKQA 4FTMA 4RJ3A 4DFBA 2X0GA 3EKNA 4QTBA 2QOKA 2IZTA 4YSMA 2QOQA 3R7GA 3QLFA 3W16A 3MFUA 3VBTA 4PNKA 3ETAA 5M44A 4NIFB 4FK6A 4M69B 3C4ZA 4EH3A 1H24A 4DGGA 3GQLA 3LXPA 3OFMA 3PXKA 3VUIA 4YURA 4AFEA 4ASZA 5GJGA 1VR2A 2WQEA 5AAFA 3PFQA 4XLIA 2VUWA 2WU7A 3Q04A 3MY1A 3C7QA 4CQEA 2ZM3A 3LQ8A 4C35A 3EYHA 5LMBA 3BHYA 1PRYA 3UP7A 3P78A 2EB3A 4IC8A 2IZUA 3EN9A 4F7NA 4PL5A 5CZHA 4A9SA 3VQHA 3MGYA 1DI9A 4OBOA 3UP2A 3CGFA 3OWPA 3PJ3A 2JIVA 4RA5A 3R02A 3P7CA 1Q41A 2GQSA 1BKXA 5A46A 4ZEGA 2G2FA 4RIWA 2VO6A 3TCPA 4XV1A 4JG8A 4N70A 3R28A 3WILA 4GKHA 4OW8A 5D9HA 4R3CA 4M7IA 5KBQA 5BYLA 3PPJA 3R9HA 3RWPA 4D1XA 4BWPA 2YLFA 3TDWA 2JDSA 2VNYA 2WOUA 2QCSA 1OL6A 3E3PA 4R5SA 1GZOA 5C26A 3QTUA 4O82A 4K2RA 5D1JA 1JSVA 4CFFA 4WRGA 4HNIA 1YOMA 3SD0A 2OBJA 1OECA 3O0GA 3RHKA 4JJRA 3KCFA 4IAAA 5EHLA 5LMKA 5K5XA 1H08A 5M57A 3RP9A 4AW2A 1Z9XA 2H8HA 4B6LA 4EK4A 2YDIA 4PMSA 3ZLXA 3KK8A 4G5JA 4ZY5A 4JI9A 2PHKA 4MXYA 5KNJA 3AMYA 2WMSA 4NM3A 4B0GA 1V0OA 3FPMA 2BR1A 3RPSA 4GRBA 3DNEA 3TKHA 5FXRA 5FDXA 2BZJA 4AA5A 3KC3A 4C36A 3FSKA 3P86A 4H05A 2Y8OA 4O0XA 4OR5A 3MVMA 3NDMA 4IACA 4PQNA 2X7OA 1OIRA 2VRXA 1ZLTA 5LARA 2QU6A 3IPHA 4DTAA 3ELJA 4RLKA 3GFEA 3ZRMA 3MH3A 3U55A 3ZH8A 5DNRA 4YZCA 4GV1A 4TWOA 4OT6A 3EQDA 4PF4A 2ONLC 3E7OA 4FODA 5L2IA 4IX6A 1T46A 2CCHA 3PLAE 2JFLA 2JKQA 3EHAA 3TL8A 4XOZA 1M7QA 2VU3A 5KMIA 3KREA 3VHEA 4ANNA 1JQHA 1NVRA 3D14A 5CY3A 3ALNA 3C4CA 4QMXA 2HENA 4FZAB 5E92A 4S34A 4D4RA 4Z7HA 5IQAA 4NSTA 4PX6A 1WCCA 4TWCA 3ZO1A 5FTGA 3QGWA 4YMJA 4QP2A 4XS2A 4J7BA 4HYIA 1PKGA 4TT7A 4YTIA 3UMXA 4BC6A 3S1HA 4O81A 4R78A 3PE2A 4MWIA 4ANQA 5IPJA 1WFCA 4J53A 4IZYA 4YHTA 1YDTE 4TRLA 5CYIA 4ZSLA 3QCXA 2X8EA 2YABA 2GNLA 3BEGA 4BB4A 2P55A 2VAGA 3TNWA 4E4NA 5DGZA 2XCHA 4DFNA 2RF9A 3GC8A 5JRSA 4L7FA 4FSRA 4KIPA 2WQNA 4Z16A 2F9GA 3VUGA 4CKRA 4NTSA 3Q4CA 2J0LA 3N9XA 3ET7A 4WG4A 2BVAA 3R7UA 4DYMA 4ZTLA 4JG6A 5CEPA 1SVEA 3L8XA 3B2WA 4I41A 2EWAA 3VHKA 4MXAA 3F5UA 5DVRA 1YXUA 3NNXA 3DAKA 4UZDA 2Y4IC 4IADA 2GTMA 4IBMA 2YM3A 2FGIA 2HK5A 3ZM9A 4FIEA 3OCGA 4EWHA 5IH6A 3DNDA 4IJPA 4E4LA 2WTDA 3A4PA 5E4HA 4JRNA 2YCSA 1FVRA 3ULZA 3CQUA 3I7BA 4QMMA 4BYIA 3PA4A 3LHJA 2VTLA 4BRXA 1XQZA 3R63A 3A7HA 3DBDA 5D41A 3NNWA 1V0BA 3VS1A 4L9IA 4YNOA 4XG4A 1ZYDA 2C6KA 3TV4A 3LFNA 5EI2A 2A27A 3W32A 4OBQA 4BDFA 4KUJA 2XK3A 4BZOA 4D5HA 5FTQA 4MXXA 4CTBA 2PVYA 3VBYA 3U4WA 5HNIX 5J9YA 3ZO2A 1R0EA 5JK3A 2XH5A 4BYJA 4HVIA 2WMQA 5C8NA 2GPHA 4EOIA 3IS5A 5GHVA 2QO7A 4L7SA 3CY2A 1UU3A 1Z57A 4NKAA 5AX9A 5I9UA 3RM6A 2VO7A 2XNOA 1NT2A 4R7BA 3WE8A 2WMBA 4F0GA 3ZBFA 4PDYA 3VRYA 1UU9A 3CQWA 2XK7A 3C51A 4D2PA 4KIKB 4CRLA 5KZ0A 3TN8A 2QODA 3ZEWA 2CGVA 1J1CA 3FC2A 4GJ3A 3Q2MA 1WBPA 4GYIA 3Q9ZA 3L9PA 2G9XA 3GT8A 5IH4A 4CZUA 2IW8A 1ZOHA 4ALWA 4G9CA 4N6YA 4Y73A 3R1QA 3OCTA 3O8TA 4IM0A 3BELA 5FM2A 1WMKA 3JPVA 2HWPA 2V55A 4FOBA 4P90A 4TTHB 3V04A 2OK1A 4FZ7A 5B2MA 1ZOEA 1GIIA 4U6RA 5FGKA 5CNOA 4EH4A 1H0VA 5HVKA 1G8AA 3FLWA 3BBWA 3HV3A 4WHZA 3LAUA 4BZDA 3D2KA 3GOPA 2HZNA 3DLZA 4IZ5A 4TPTA 4AW1A 4QTDA 4EOPA 1GOLA 4IJ9A 1YI4A 5J1VA 3T9TA 5AV4A 1ZWSA 2J7TA 3UDBA 5L4QA 2VTPA 3GU5A 2R3NA 5TT7A 2XJ2A 1CMKE 4NM7A 3VS3A 4FG8A 4FSMA 4FI1A 2FSOX 4FV7A 1GIJA 1IEPA 4YC3A 3UG1A 5JMSA 1SNUA 3Q52A 4DT9A 3ZYAA 4G6NA 3TNQB 4D2TA 1H1RA 2ZM4A 2XIXA 1BYGA 2VTIA 4FTNA 3EQFA 2BAJA 5HE2A 5ACBC 3OCBA 3HZTA 4KINA 3T8OA 4ANMA 2HY0A 3IKAA 4ITIA 4XMOA 3RJCA 2XRWA 3OVVA 4IAYA 4M67A 1QCFA 2RFEA 4R7IA 2XCKA 4RIXB 4CFMA 2XBAA 4HOKA 4HCVA 4FZFB 3H0ZA 3IOPA 1KV1A 4QYHA 5KMMA 3UC4A 3UGCA 1H25A 3ZFYA 4YSJA 4IVAA 4AOTA 5FBNC 4CMOA 3P5KA 4BCPA 3C4WA 3MDYA 3DTWA 4FG7A 4EH5A 3Q6UA 4C3PA 1JLUE 3E7VA 3G90X 4U8ZA 3KF4A 5KMKA 1OKVA 2YAAA 4DH3A 4KS8A 3QYZA 2OO8X 4PL3A 2X2MA 2OG8A 3UO5A 3SG8A 2G1TA 1B39A 2VTNA 1RJBA 4F7LA 4HZSA 3CC6A 4EI4A 4QMOA 4G6OA 1EH4A 1ZARA 2YM7A 4IB1A 4L01A 4DINA 4DG0E 5IG1A 2E2BA 1IAJA 1LEWA 3FMNA 3RZBA 2XK8A 5F94A 4UEUA 3W2QA 3QHWA 5M06A 3V5LA 1FGIA 3O51A 4FTTA 3VBVA 3KRXA 3G9NA 4EWQA 5BMMA 4DEAA 3ZC6A 3IW5A 1K2PA 3JY9A 3CP9A 2JKOA 3EMGA 2ONLA 4IC7A 4JQEA 3VULA 4BDCA 1HCKA 4D9UA 3ATTA 3U9CA 1IA9A 4KSQA 1ZAOA 3GQIA 4BVUA 2VWXA 2F4JA 4BCIA 4M84A 4AA4A 4KKHA 4BCFA 4ZTQA 2OFVA 2PVFA 3R21A 4FV4A 3P7BA 2CN5A 1UU8A 2ZYBA 3EQIA 5FEDA 3WF9A 3PXYA 2YZAA 4GU9A 5M51A 1OIQA 1A06A 3DBCA 4H36A 4ANLA 2QKRA 4NFNA 5EYMA 4YP8A 4A4OA 5I9YA 1M2PA 4D4SA 3W10A 5LVMA 3QQJA 1VYZA 3BI6A 1GJOA 4R5YA 2R7IA 4XLVA 5HVJA 3VUTA 2PZYA 5EQPA 3ZM4A 3KF7A 5JH6A 1PXIA 3ZHPC 4E73A 4IZ7A 1DAWA 3LM0A 4AQCA 3NYNA 5L6OA 2BRMA 1YDRE 5E91A 4RJ6A 4CD0A 4I6HA 5ETCA 4CTCA 2QR7A 4QP9A 1GZKA 4QP8A 3DB6A 5KHWA 3HAVA 5FQDC 3D9VA 2BRGA 2NRYA 1BL6A 4IANA 3OD6X 3QX2A 4FTCA 2XK9A 1FMKA 4BHNA 4DH5A 2CMWA 3GBZA 5KO1A 4O7NA 3AC8A 3EFJA 1H07A 5HIDA 3LMHA 4LV5A 2QONA 4XP3A 1U46A 4IB5A 4TYGA 4NWMA 5G1XA 4DITA 4EKLA 3G0FA 4ZMFA 1BUHA 4XUFA 4ZSJA 4ZY6A 5DWRA 2ITWA 3GCUA 3OBGA 2GS6A 4JBVA 4D1SA 2YIRA 1QL6A 3TXOA 4Z3VA 1KE8A 2PVRA 4FOCA 2ETMA 2YFXA 3OXZA 2XA4A 4BKYA 1GAGA 4GK3A 2C69A 5A4QA 3PVWA 5M09A 3D5XA 3PJ1A 5D7AA 1IR3A 1YHSA 2BZIB 3BGPA 2B9IA 3DKGA 1P14A 3WF7A 4G9RA 2XM8A 2VTHA 4A4LA 5DR9A 4F1MA 3BPRA 4P4CA 1QMZA 3DT1A 2V5QA 2X4FA 2VO3A 4XCUA 3CJFA 4EH2A 3NSZA 2R3QA 2VX1A 2J0JA 3CCNA 3OUKA 5AUWA 3ZUVA 2XNEA 2WXVA 2VV9A 2FYSA 2YACA 4C4EA 3OG7A 3ZLSA 5HG5A 3IGGA 1Q24A 4Y85A 4YJUA 3UVPA 3LMIA 1ZYSA 3QRKA 3WIGA 5DE2A 5HHWA 3RPOA 2IW9A 3EZRA 2WTIA 4H1MA 4X2NA 4UXQA 3C4EA 4CCBA 5KMLA 4RJ8A 3OWLA 2CN8A 3QFVA 2PMLX 3TZMA 5FUTA 4AGDA 4I5MA 3R9OA 2VWZA 2QO9A 3F2NA 5E1EA 4C33A 4MXZA 4RVMA 3QD0A 4RVTA 4F1TA 3QQFA 1GIHA 2P3GX 4OGRA 3WZUA 1W83A 3R8ZA 2UVZA 3A60A 1JVPP 3GOKA 4CEGA 4FMQA 3VN9A 2RIOA 2ZVAA 4B99A 4C2VA 4S32A 3A99A 5IQGA 3D7ZA 1M17A 4XJ0A 4JVGA 3QRTA 1PJKA 3VW6A 1NA7A 4F99A 3ATSA 2Y6MA 5J5TA 3PTGA 4RRVA 3VS0A 1VYWA 2Z7QA 4IIRA 3ZC5A 4CYIA 4KKEA 4Z9LA 2GQGA 3JR1A 4MTAA 4Q2AA 1YOLA 5DG5A 3PRFA 3IQ7A 5I3OA 4F08A 3KRRA 1XBCA 4XBUA 4PMPA 5CEMA 2CHLA 3NWWA 3P23A 5FP6A 4L43A 2V0DA 2C3IB 4KRCA 2CPKE 5CF8A 3ALOA 3COKA 3MIAA 4BGGA 3TZ7A 2CJMA 4B7TA 4OAUC 4J71A 4RFYA 5I9VA 2RFSA 3FMKA 2R3FA 1MQBA 3OTUA 4EJNA 1E9HA 3NAYA 4U3ZA 2P2HA 2VNWA 4FEXA 3JY0A 1JKTA 2C68A 3S2PA 3PPKA 3V5PA 5KKRC 1XBBA 4XHKB 2XK4A 1ZMUA 5J95A 4QMQA 3R7OA 4RJ7A 4ANBA 3D2IA 4DEDA 1K9AA 2B9FA 2OZOA 3EFWA 5EDQA 2CNUA 1I09A 4FEQA 1P2AA 3I0QA 3MH2A 3NS9A 4IMYA 2A1AB 2W1ZA 4M0ZA 3SXSA 2P4IA 4RQVA 4MHAA 2HXLA 3FZTA 4RX7A 4O2ZA 4YGAA 2Y9QA 5HE0A 1UU7A 5HBJA 3ROYA 2ITPA 3C9WA 4JX7A 5LXMA 4ACHA 5IQBA 4FV0A 3R1SA 2EB2A 4A07A 1P4FA 1JKKA 3DLSA 4NM0A 5HNBA 4GCJA 3HV6A 4BI1A 1XR1A 5HLNA 2XEYA 2C1AA 2W4KA 2W1CA 4NU1A 4IB3A 2R5TA 5GJFA 3U9NA 4HNFA 1JKSA 1KE9A 2HZIA 4JT3A 1L3RE 2YCRA 1YOJA 3W1FA 5CNNA 2Z7RA 1PXLA 1PXOA 3AQVA 4PMMA 3VC4A 4FV5A 4TXCA 5AUTA 4LUDA 1LPUA 3PIZA 2R3PA 2GS2A 2V7OA 4LG4A 4R8QA 4W4YA 4BTMA 4L67A 3LCOA 2VTQA 4DLIA 4DCAA 2FO0A 1ZZ2A 3EQRA 4U5JA 2G15A 3R8VA 3WOWA 2WMUA 2C0IA 2QC6A 3P7AA 1M52A 2JGZA 5L6WL 1Y91A 4TKSA 4JQ8A 2QQ7A 2X7GA 4IZAA 5CSVA 4EQUA 1PMUA 4D2VA 4OBPA 3TUCA 3POZA 3Q32A 4L8MA 4AN3A 4W4WA 3UODA 4IM2A 4MD9E 1OIYA 3F3TA 3QX4A 4CV8A 4FV9A 1YXTA 1WBWA 1PMEA 3E62A 5HKMA 1VEBA 3BWFA 3CSVA 4I1ZA 4BDEA 2WTKC 4KRDA 4EOJA 5DEWA 2JAVA 2BROA 5M4IA 3OROA 1IG1A 4M14A 3UO4A 4TWNA 1AD5A 3FQHA 3OZ6A 4UB7A 2VWIA 3I5ZA 4KKGA 5FM3A 3GC9A 4EYJA 4WUNA 4ENYA 2C5NA 3AG9A 5EI8A 4U43A 4WBOA 5K4JA 4JX3A 5AEPA 4FTJA 3UJGA 2WMTA 3VF8A 4QMUA 2BFXA 1TQMA 2VD5A 3PXQA 2Q0NA 3FQSA 3QGYA 5E8VA 2R3JA 3NYOA 4K6ZA 3QZFA 2WD1A 2I0HA 4C4JA 5CVGA 3FAAA 4C57A 2ETRA 5HD7A 3R04A 3BQCA 4H1JA 1B6CB 2WU6A 3MTFA 2IW6A 4I4EA 3IG7A 5CF6A 2GCDA 2XNMA 4PNIA 4DFUA 3F88A 3QKMA 4QT1A 4RLLA 4WBBB 4WG5A 4IAZA 3F6XA 2XKCA 2QOCA 4OTPA 5F1ZA 5CS6A 4FIGA 5T68A 3KMWA 5AP4A 5JGAA 3BRBA 1WBTA 5BVEA 1YWRA 1W84A 2XBJA 4E5WA 3DKOA 3MJ2A 4I94A 2UW5A 1URCA 4IEBA 4XEYA 4BDHA 4C4IA 4B8MA 4OTDA 3II5A 2DS1A 1UWJA 3H0YA 3KMUA 4MNEA 4C34A 2UZEA 2VWWA 4FNYA 1QPJA 2J9MA 3LCKA 4RFZA 3BIZA 4J8NA 2HOGA 2R0IA 3D5WA 4OTGA 4BTKA 4EOMA 4QTAA 4F7JA 5I4NA 1XH7A 5AP5A 5D10A 4HCTA 3G51A 4GL9A 1MRUA 3REPA 3W33A 3UIUA 3SG9A 3PRIA 1Q61A 3JUHA 3L1SA 3LMGA 4YBJA 3QQGA 4FVQA 3I81A 2W9FB 2W1HA 3UOKA 3HECA 4YUQA 4NZWB 4QQJA 5K3YA 4I93A 3QHRA 2HELA 4U7ZA 4PDOA 4H58A 3O50A 4YZNA 4E7WA 1H1PA 3OWJA 3VS5A 3NLBA 4EBWA 5HZNA 4P5QA 1FQ1B 2WPAA 3AT4A 3FZSA 4IVDA 1R78A 4YZDA 2FH9A 2GU8A 5JFVA 3MJ1A 3EL8A 3ZXZA 3DZQA 4LOOA 5LQFA 3SA0A 2YIYA 4KB8A 5AP6A 3WYXA 4GMYA 4I6FA 4RWKA 4DHFA 2JKKA 4NT4A 1BI8A 5IEYA 1H26A 1Q8UA 2UZOA 3W8QA 5FDPA 2XNNA 3ZDUA 3LFCA 2IN6A 5LWNA 5L2WA 3V3VA 4DG2E 4EOSA 4R6VA 1YHWA 3F3VA 4ZS0A 4APPA 4HCUA 4CMUA 1YWVA 1OVEA 3FY0A 1OM1A 3HRBA 4QQ5A 2XKFA 3S3IA 2JAMA 3A7JA 4QMSA 4OT5A 4AOJA 4I5PA 4F63A 1H00A 3OT8A 4S33A 4O1PA 3BGQA 2F7ZE 1O9UA 3BYMA 5AR8A 4U80A 1CKIA 4IH8A 4RBLA 3TNPC 5CAOA 5GNKA 3EQPA 4J96A 1GNGA 3BLQA 2CGXA 3F5PA 3GFWA 1UNHA 2RG5A 2UV2A 3KXZA 4LGHA 2ZAZA 5EKNA 2J2IB 4W8DA 2XIZA 3O17A 5CT7A 4AN9A 4CSVA 2ITOA 2ERKA 4FUXA 5CVHA 5HGIA 5K4IA 3DBFA 3UIBA 3GP0A 5EM6A 3WIKA 5HIEA 1YRPA 3ORNA 2XB7A 3RHXA 3IW8A 4ITJA 5I9WA 1H0WA 4Y46A 5IQDA 2UW4A 3ORLA 4NTTA 2IZSA 3ZS5A 4UN0C 5CSXA 4PDSA 3R8UA 4FKPA 3OCSA 4PTEA 1ZYLA 2BALA 1TQIA 1M2RA 4FT7A 4EQCA 2QOOA 4DLJA 2H6DA 4H3BA 5IDNA 2QO2A 2OSCA 1KV2A 3QTQA 3CTQA 1H1WA 3HDMA 5DLSA 4V0GB 4ASDA 4ZOGA 3D4QA 4GG7A 4G3DA 4O0UA 2PVHA 1XHAA 3H4JA 3TV7A 3QQLA 3Q9YA 1UA2A 3PVGA 2REIA 4E6QA 4HVGA 4E20A 5CEIA 3TKUA 4O7ZA 1ZZLA 4WT6A 4YC8A 3OOGA 3LCSA 4BDAA 1JSUA 4O83A 4BKZA 2C6TA 2NP8A 2OIQA 5B7VA 1Q3WA 1U54A 5IISA 3HP2A 5AV1A 3QLGA 5H3QA 2H34A 5LMAA 4C61A 5BMSA 1YI3A 2QVSE 3PVUA 4MYGA 3OY1A 5BNJA 5FXQA 1XH8A 3P0MA 2HWOA 4OAVB 3LJ2A 4YPDA 4BDIA 4KBCA 2JDVA 4GW8A 4K33A 4QYYA 5BVWA 2I40A 4HGLA 4RJ4A 3DY7A 4QMLA 5BPYA 4LGDA 4PPAA 5HO6A 1DI8A 2OJJA 3O8UA 4XP0A 5DMZA 2HY81 3QF9A 3UVRA 3QTWA 5E7RA 4QMTA 4NYEA 1QPEA 3WZDA 5AM6A 3UZTA 3M2WA 1J7LA 2BPMA
chains in the Genus database with same CATH superfamily
2PTKA 4ITHA 4KBKA 3BX5A 4AZWA 2YLEA 4CCUA 4U3YA 3LFSA 4MCVA 2XM9A 5HNGA 4IHPA 3V8WA 4FTUA 2X2LA 3BCEA 1RQQA 3ID6C 4HGEA 1WAKA 2A2AA 2XVDA 3MBLA 4GT3A 5BVKA 1REJA 3LXKA 4X0MA 2CKOA 3V6RA 2BIYA 1H8FA 4PMTA 4FT9A 2GFSA 3I5NA 2GMXA 3ORPA 2XANA 2UW8A 3IW6A 3KRLA 4J8MA 4CRSA 4F6SA 3PFYA 4W4XA 2ITYA 3DQWA 4RJ5A 3R22A 3Q5ZA 3ORZA 4DF3A 2B4SB 4MH7A 3AD4A 2XUUA 4BCNA 4BGQA 1OPLA 2W5BA 4MBLA 3B8QA 4CYJA 1UKIA 5CEKA 3IO7A 3SAYA 3MSSA 3ZTXA 4XV3A 4U97A 4HVDA 5LJJA 2C5OA 4E3CA 3PZEA 1ZMWA 2UZTA 3E92A 4V05A 3ROCA 3UMWA 2VTAA 4WD5A 3QAME 4II5A 3ORXA 3PVBA 4WNOA 3MVHA 3UOLA 5IMEA 2QR8A 4I24A 4M13A 3UVQA 4EORA 4MXOA 2FVDA 3HV4A 3D7TB 3OXTA 4FYOA 3V6SA 5J7HA 4BZNA 2ITTA 3QTIA 3PIXA 4WNPA 3UC3A 4W8EA 2RFNA 4YJTA 4Y8DA 5IA5A 5CENA 3CY3A 1RDQE 5CF4A 4M3QA 3OC1A 2NNWB 2O64A 1XH9A 3E87A 4MD8E 4EEVA 3BLAA 4XG3A 5LVPA 4DEHA 4DH8A 4MEDA 4ZLZA 4X2GA 2WFYA 5J9ZA 3NFGB 5TF9A 3EFKA 2O2UA 2PVJA 1FGKA 5EOBA 4YU2A 2WIHA 3UTOA 4BWKA 3UZRA 4I0TA 2VWVA 4MBIA 3RK7A 4FTRA 4DFLA 3NNUA 4I5CA 3HKOA 4FKUA 3VS2A 4L53A 3DQXA 4L3JA 3GEQA 5BVNA 4O7VA 5IMXA 4FNXA 4ONAA 3ODYX 1XH4A 3C0GA 4BIEA 3F7ZA 4EHVA 2WOTA 2ITNA 5L2SA 2HXQA 2WGJA 1OKZA 2WTJA 3UNJA 3V8SA 5L3AA 1ZY5A 2UW6A 1Y57A 1JAMA 2QOFA 3SDJA 1JPAA 1OL2A 1QPCA 4I20A 4A7CA 2Q0BA 4DEIA 4ACDA 3GC0A 5LCJA 3QQKA 2XEZA 3D94A 3QRIA 4HYHA 4N0SA 3U6HA 2IWIA 1YKRA 3NCZA 4N6ZA 4DC2A 3KCKA 4QTEA 3FI3A 5AIKA 1HCLA 2OIBA 3C4XA 2JIIA 4XOYA 2XJ1A 4KABA 4A9YA 5D12A 4EC9A 4YJNA 4JBOA 3VVHA 5HE3A 2J0IA 3K2LA 4CXAA 4TYIA 4JBQA 2BUJA 3EIDA 3KXNA 4WO5A 1URWA 3DOGA 3EN5A 4RWJA 2VWUA 3FMHA 2R3OA 4X2FA 1YWNA 3ITZA 1NVQA 5JFWA 2ITZA 3R7IA 2BDWA 4LL0A 1Q4LA 4ACMA 2CNVA 1YVJA 5HVYA 2V22A 3UIMA 3HGKA 5D7VA 3E8NA 3FLZA 4PRJA 3FI4A 4EOQA 5ANDA 3CD8A 3DU8A 2YCFA 1OBDA 2ZB1A 3BHUA 1L8TA 1OL7A 3HAMA 3Q9XA 4QYEA 4ZTSA 4YO6A 5IDPA 5JGDA 4IDTA 1XH6A 1CSNA 5GIPE 5E8WA 3AGLA 3QWJA 3L8VA 1REKA 4WIHA 4ANSA 3KULA 3NUYA 1JWHA 3OOMA 2EU9A 4J98A 2X7FA 3TT0A 4UMRA 4GVJA 3BL9A 4HZRA 5KBRA 2O3PA 2WMWA 3PG3A 3BV3A 3GGFA 1PXMA 4H3QA 2B9JA 4BGHA 4HVSA 1KE7A 3R30A 2WKMA 4L46A 5EI6A 5IUHA 1LUFA 4RFMA 3ZLWA 3FPQA 4JAJA 4BI2A 2C1BA 3LCTA 2P2IA 3KA0A 3DGKA 3WI6A 1G8JA 4IVCA 2C3JA 4QMPA 3GCQA 2W06A 1PW2A 3FXWA 3ULIA 2OZAA 3WF6A 5AR2A 1PXJA 1W82A 3A61A 3DXNA 4S2ZA 4UWCA 5DEYA 4MBJA 4IE9A 3AC5A 2CCIA 4BKJA 5CVFA 5JFSA 4QTCA 5ETFA 3ZFMA 1PY5A 2PSQA 2BRHA 3NW6A 5AP7A 4EUTA 2X9FA 2E9PA 5HICA 5CXZA 3VAPA 3IW4A 2FSLX 2JLDA 3GUBA 3UOHA 3HUBA 1WVWA 3AKJA 4KIOA 4AQKA 3PG1A 2JITA 5BQ0A 3LFBA 2BDFA 4KAOA 4FV8A 2V7AA 5FEEA 2YIWA 2BKZA 5JQ5A 3E8CA 5J7BA 4Y72A 4I92A 4RMZA 2YWPA 3Q3BA 2NRUA 2OF4A 4M8TA 1KOBA 3AT2A 4Q5HA 5FBOA 4M0YA 2VWYA 2UUEA 3DA6A 2OKRA 2I1MA 4I22A 3PA3A 5IQIA 1I44A 3RKBA 3ZZEA 3FJQE 4MWHA 4LMUA 4O7RA 3FHIA 4U42A 4NIFA 3PY0A 4M69A 4UALA 3HMNA 3MH0A 3Q4TA 4C59A 3NW7A 4WA9A 5L8LA 4FTIA 3UZPA 2ZDUA 1H27A 3I6WA 2HAKA 4RIYB 3KN5A 4DDIA 4FUYA 3DXPA 4GVAA 3NUNA 4F9CA 1OPKA 1ZOGA 1U4DA 1SVHA 2C6DA 3O8PA 4BDGA 3CPCA 2C3LA 2W9ZB 5CSWA 5L8JA 3U87A 3VS7A 3R7EA 4BDKA 1TFFA 3TNIA 1DAYA 4E8AA 4MXCA 1YXSA 2GTNA 1LR4A 3G15A 3GNIB 2UW3A 4DAWA 3PXZA 4YJSA 4RWIA 1R1WA 2JDTA 3LQ3A 3SQQA 4UXLA 5C8KA 5IEVA 3N4VA 3TZ9A 3MA3A 4ORKA 3QZHA 3A7IA 4AXCA 3SRVA 2Z02A 4Y5QA 3V5WA 5IA4A 3CR0A 4ZTHA 2C5VA 3I6UA 5AAGA 5GINE 2B7AA 4WRSA 3UE4A 2GS7A 2DQ7X 3EZVA 5EG3A 4RWLA 4ZP5A 5HD4A 2HZ4A 5JRQA 5M4FA 4NM5A 2BKKA 3L9NA 3TTIA 2AYPA 4QMYA 4QEBA 1Q5KA 5E8TA 2X6EA 2CKEA 5LCKA 2F7EE 4YTCA 3HNGA 1OZ1A 2P33A 3NYVA 2XJ0A 2FA2A 4JAIA 4U9AA 5DI1A 3SKCA 4FA2A 5AUZA 5JGBA 3RCDA 2PVMA 3F5XA 3PP1A 4GT5A 2J51A 1JOWB 2R3KA 4A9RA 2P0CA 4ZS4A 3MB7A 3K3JA 4DTBA 1JKLA 2ZM1A 2VTTA 4UWBA 5IF1A 3LZBA 3DFAA 3ZUTA 3RALA 3HL7A 2VGPA 5EK7A 1Y6BA 2J50A 3CJGA 4JDJA 5DIAA 3FV8A 4AA0A 3EN7A 4XG7A 4E5AX 3R1YA 5FP5A 5K0KA 3PSCA 4RT7A 4FNWA 3QC4A 1SMHA 4EHZA 4APCA 3WE4A 4YBKA 4QMZA 5CU2A 2H9VA 3QD4A 3HMMA 1UNGA 3QD2B 2PUPA 3QKLA 4RZWA 2OGVA 3CE3A 3TUDA 4UWYA 3R9NA 4MQ1A 2X39A 4U81A 3I1AA 4D2SA 4YHFA 5E8YA 4EYMA 5EM5A 4L45A 5I5ZA 2HIWA 2W96B 2RKUA 3GU8A 5AV0A 5HLPA 3GCPA 2VGOA 4RVKA 5DT0A 3TYKA 1MP8A 3DK7A 2WMVA 3QBNA 3ZONA 1CM8A 5A3XA 4XG6A 3AC4A 1M2QA 3MYGA 1X8BA 2UZBA 3UG2A 3PJ2A 4IQ6A 3QL8A 3V8TA 3LFFA 3EL7A 3NUAA 4QP4A 3FMEA 5KX8A 4LQMA 3ORIA 3P79A 4FTAA 3EN6A 3GENA 4MAOA 4R77A 2I0YA 1KE5A 3OP5A 2JEDA 4D55A 1A9UA 2PUNA 3RINA 4TL0A 3EB0A 3VNTA 3MPAA 4R3RA 4EKKA 2CLXA 2FB8A 4IWOA 5CAPA 3TJDA 5H9BA 2WTCA 3HUCA 4HPTE 4X3FC 4GJ2A 4AZSA 3G6GA 4RPVA 3CKXA 4BCKA 1FVVA 2OICA 4BN1A 4RIWB 2NYAA 4TNDA 3BZ3A 5C03A 2W1DA 5GZAA 3ODZX 1U59A 2PZPA 3EN4A 4JIAA 5DOSA 1CKPA 2J5FA 4FVRA 2CKQA 3POOA 1ZXEA 4X21A 3DAEA 4WKQA 4K9YA 4ZJJA 3W2CA 4IFCA 3NR9A 4CFWA 2VTJA 3O23A 4YJVA 4WOVA 4RZVA 5AP1A 4FKVA 5ACKA 3PXRA 3OEFX 4YJPA 4B9DA 3B8RA 3F66A 3THBA 3TG1A 1PF8A 1B38A 2XIYA 1OMWA 5JZJA 3PZHA 4I23A 4HVHA 3I79A 2C0TA 2XYUA 2X6DA 2Z7LA 4GK2A 4PPCA 4XG9A 2CNQA 5KZIA 3CS9A 4K77A 1TKIA 3KXXA 1J7UA 4A9TA 3ANQA 3Q4UA 3BV2A 4XH6A 3AD6A 4UMUA 1OUKA 4JG7A 4KIKA 3V5QA 3NUXA 5HESA 1R3CA 2VTMA 3FKOA 5CLPA 4EZ5A 3DBQA 5AJQA 2YITA 3JXWA 5M4CA 1YHVA 1OITA 2YWVA 3CQEA 5HCZA 5B2LA 5IEXA 5AFVA 3Q60A 2R9SA 3MY5A 3KRJA 4UMQA 2WTKB 5EQEA 5AADA 3S4QA 2KTYA 5CT0A 4EONA 3ZSHA 4JBPA 3K5VA 2E9OA 1JNKA 3IW7A 4GT4A 4IAFA 4R1YA 4AT4A 4C38A 3DKCA 3UYSA 4CFVA 2YJRA 3JVSA 3ACJA 4Q9ZA 2XIKA 2X0PA 3D15A 3RTPA 5JQ8A 1HOWA 5H8EA 4TWPA 3JVRA 3OY3A 2YDJA 2UZNA 4G3CA 5ANOA 4O0SA 3RAHA 4BF2A 5C8MA 5CAVA 5EHYA 2OI4X 4S31A 2JBPA 3PPZA 4X6QC 3RAIA 4B8LA 3LPBA 4BBMA 4GS6A 4JDKA 4DFXE 4GIHA 3RK9A 4WNKA 2BZKB 5DBXA 5L2QA 1KOAA 2AC3A 3G0EA 3LJ0A 3L9MA 3PY1A 2EXMA 4GUEA 4ZZMA 3KU2A 4O4DA 3LFEA 3SC1A 3Q4ZA 1PMVA 3FLNC 1LP4A 3VQUA 3NW5A 5A6NA 3HA8A 4FEWA 4MQ2A 1YXVA 5F4NA 3SV0A 4R1VA 4B4LA 3A8XA 3V51A 4G2FA 3BQRA 3F7WA 1Q8ZA 3EFLA 3BEAA 3QQUA 4XV2A 5HTCA 3L8PA 4RIXA 3DAJA 2W5AA 4FK3A 4GEOA 4W9WA 4QPMA 4FSYA 4YLJA 4TZRA 3G6HA 4FR4A 5K0XA 3QCYA 5DRBA 5FG8A 3N4TA 3DV3A 3MN3A 3JS2A 4O2PA 1P5EA 1PXNA 2OJGA 5AUYA 2WQBA 4ZLYA 3FZRA 3NUPA 4O7SA 4E4XA 3LW0A 4U45A 4USDA 4UV0A 3KB7A 3FKLA 5CU6A 4CFUA 3DJ6A 4QD6A 3LM5A 2R3MA 3CEKA 4X6RA 1ZY4A 2CDZA 2WMRA 4D0WA 4QYFA 4IAKA 3OTVA 4P2KA 3S95A 3MTLA 1OL1A 3KGAA 4BCHA 4E1ZA 3G9LX 3MPTA 4FSNA 1WZYA 2BAQA 1YQJA 3LIJA 2JFMA 2OF2A 3WZKA 2C5YA 3ORKA 4IM3A 2BDJA 3E93A 2OIDA 3P5JC 4AW0A 3O7LD 4E4MA 4E6CA 2YM8A 3EQBA 5HOAA 2PY3A 2QD9A 4K1BA 2PL0A 3TI1A 3ZRLA 3C4FA 2XNGA 4O91A 4DGMA 2GNIA 2OFUA 3U54A 2PVNA 2X8IA 5KE0A 3LE6A 3TIZA 3D5VA 3NAXA 5ICPA 3PSBA 4RC2A 5I3RA 3DZOA 3NIEA 4KBAA 1XH5A 5CXHA 2C30A 3QUPA 1F3MC 2F49A 3NIZA 3R2YA 4Q5EA 4BCGA 3B2TA 4PTCA 5HG9A 4E5BA 1CKJA 2CGUA 2CGWA 1OGYA 5I9ZA 4CMTA 4J95A 2A98A 4H39A 3D83A 4I3ZA 2IG7A 2YCQA 5JZNA 2G2HA 4EOKA 3OT3A 4L52A 3R8PA 3N4UA 1YW2A 2IJMA 3QWKA 3Q5IA 3SOCA 3FZ1A 3COIA 3RPYA 4O0RA 4J52A 2IF8A 3K3IA 3R6XA 5TO8A 3U4UA 5M4UA 4LRMA 3R01A 5M55A 3RAKA 4NJ3A 3RGFA 4LV8A 3VS6A 5EFQA 4CKIA 4C3RA 4FYNA 4O1OA 2WMXA 3DJ7A 4AP7A 1G3NA 2GHGA 2I0EA 2AC5A 3EQCA 3H3CA 3NEWA 4EH7A 4F7SA 4FSTA 4OTFA 3RCJA 4CKJA 2E9UA 5ANJA 2ETKA 4AG8A 2H96A 2XRUA 2YM5A 5HO7A 3KULB 2Y0AA 2Z8CA 2UW7A 3MY0A 4WG3A 1PKDA 4P7EA 1JSTA 3R0TA 2XKDA 1MUOA 4UYAA 1SNXA 5EYCA 3JYAA 4X3FA 3IONA 2RSVA 1Q8TA 3UPZA 3FMMA 1OB3A 3KEXA 5AUVA 4FT5A 3TIYA 4U40A 1YI6A 1G5SA 2XP2A 3IGOA 3MH1A 1WVYA 5EW8A 3R00A 4DG3E 4IFGA 4U0IA 4XRLA 4NEUA 4HW7A 2OZAB 3W2PA 3E3BX 4KNBA 4UMTA 2VTOA 1SM2A 3DK3A 3MFTA 5BUIA 4F09A 5JN2A 1W8CA 3ZOSA 2W7XA 2WB8A 4BL1A 1MRYA 4NW5A 2YIQA 3Q53A 1IRKA 1Y6AA 1PHKA 4TY1A 3VUKA 5FEQA 1XWSA 3LLTA 4X3JA 4ZZOA 2VTSA 4IWPA 3T9IA 2UW9A 3KVWA 4DE4A 2GNFA 4Y5HA 2X0QA 5ETIA 3KXMA 3LFAA 2JD5A 2R0UA 2ZOQA 4FT3A 4MF1A 2R7BA 2W1FA 5IA0A 1GZ8A 4ASEA 2QKWB 2HZ0A 1UNLA 4FTKA 2OJFE 4Z7GA 3QZGA 3SXFA 2GQRA 5M07A 3QU0A 3R2BA 4AXEA 4O86A 4H3PA 3OEZA 1W7HA 2UZVA 4PP7A 4I5HA 3Q6WA 5BYZA 4LYNA 4JOAA 4DBNA 2OXDA 2W5HA 4F9YA 3U6IA 3V5JA 4BTJA 3PWDA 5EOLA 3FZOA 2Y7JA 1AQ1A 1H1QA 3FWQA 4QP6A 4RC4A 4P5ZA 3HV5A 5DRDA 3PXFA 5CQWA 4EK5A 4G34A 4QO9A 5EHOA 2PE0A 2F2CB 1LEZA 3SX9A 4EH6A 1SYKA 4YJOA 4ARKA 1Q8YA 4NCTC 4C7TA 3DCVA 4D28A 2B53A 4ZTMA 5IA1A 5KMJA 4NFMA 4XG8A 3SGCA 4BY9E 2DUVA 2XARA 3RZFA 4PUZA 3DB8A 1CTPE 2WAJA 4E26A 3SXRA 4WNMA 3QRUA 2X4ZA 3BYOA 3ZEPA 2WHBA 3DKFA 4TN6A 3FZPA 5KMNA 3FYJX 4DHZA 2O0UA 3NNVA 2DWBA 1FOTA 3FHRA 1H1SA 3P08A 3MESA 3HMOA 4BCJA 3RVGA 3PP0A 2A0CX 3EOCA 4WSQA 3TJCA 5I9XA 4QQTA 4GYGA 3W2OA 3UPXA 1S9IA 3SRVB 3UDZA 2E9VA 2OJIA 3PE1A 4X2KA 4O7LA 1OIUA 1PXPA 1Q97A 1WVXA 4ZTNA 4Q9SA 4TYJA 3RAWA 3R7VA 5E8ZA 4AWIA 4AXAA 5A4EA 4AGUA 3CKWA 2O5KA 3HA6A 2E9NA 5IQHA 4IX4A 1Y8GA 2WELA 4IAIA 1ERKA 1Q3DA 2J6MA 2IPXA 5A4TA 4KS7A 3R9RA 5BYYA 2C5XA 5DT4A 4O4EA 4IW0A 4FC0A 4FV6A 4IDVA 3VS4A 3WYYA 4FL1A 2B1PA 2Y4IB 4IWDA 4YPSA 3E8EA 4F0FA 4FEUA 4I0SA 2C6MA 3A4OX 3UYTA 3WBLA 4YZMA 3ZSIA 2IVUA 4NL0A 4O0TA 3UQGA 4ZSGA 1XJDA 4F9WA 1UV5A 2V62A 5ANEA 4IX5A 3VJOA 5I0BA 3MVJA 4CT1A 1W2CA 1OI9A 4C4HA 3KFAA 2WTVA 3OUNB 3PWYA 4QMNA 2XS0A 4DN5A 2W4OA 3W2RA 2PUUA 4AZTA 4FL3A 2J4ZA 4OTWA 4JRVA 4G31A 5CAQA 5DPVA 5AP2A 1J7IA 2BILB 3NZ0A 4WUAA 5A54A 3TM0A 2A19B 2OWBA 5IU2A 4DEGA 3C1XA 4N57A 3QCQA 4BIDA 1NY3A 3QTRA 2W4JA 2YN8A 3AC1A 1RW8A 3EQGA 3VO3A 4IVBA 3BU6A 4CFNA 4FSWA 5FLFA 5HCYA 3HRFA 3ZU7A 3ZDIA 2QU5A 4PV0A 4RQKA 4DHJA 1U5RA 3TACA 1CDKA 3P9JA 3GU7A 3MPMA 4LUEA 4RX9A 2R64A 5IUIA 1RE8A 4D2WA 3MI9A 3A7GA 2QHNA 3GU4A 5HTIA 1ND4A 5EDPA 2QURA 4AUAA 3G2FA 4OTQA 3AC2A 1M7NA 3GC7A 5G6VA 3WF5A 2NO3A 4G3EA 3HP5A 4XX9A 3FEGA 2O65A 4HGSA 3ORTA 4DGNA 3QTXA 4LOPA 3ZFXA 2WO6A 5H8BA 4PTGA 4MX9A 3W0PA 2VZ6A 3F3WA 4FVPA 5GZ8A 5CWZA 5JFXA 4W4VA 3QXOA 4OUCA 3UDTA 2ZMCA 1FPUA 5IUGA 3PA5A 4FKGA 4GKIA 3FMLA 4J97A 3MW1A 5J5SA 5KHXA 5ETAA 4G6LA 4MNFA 5KCVA 4RX8A 4CT2A 5AR4A 4QP1A 4BBEA 4QNAA 3W8LA 5BVOA 2OXYA 1MRVA 2UZLA 4FF8A 3E64A 3NUSA 3QYWA 5CEOA 3W55A 1UWHA 4DEBA 2GDOA 3R73A 3Q96A 4RG0A 3WARA 3AT3A 3QTSA 4BBFA 4BICA 5AP3A 1KWPA 4D5KA 5E9EA 3SLSA 2ZJWA 3MIYA 4XV9A 4TYHA 2VX0A 1NW1A 3FY2A 3KY2A 1OL5A 3QC9A 2GNHA 1IASA 4O4CA 5FTOA 4CZTA 2ZDTA 3AXWA 5TE0A 5BX0A 5M53A 4C8BA 1XKKA 3H9OA 4KA3A 4OLIA 2BMCA 2YM6A 2ZB0A 1IAHA 2PWLA 4ZJIA 4F6WA 3S0OA 4AACA 4DGLC 2W05A 3COHA 4PWNA 2J0KA 3BWJA 3BGZA 4AFJA 3NVMB 4YZBA 4CG9A 4Z55A 3PIYA 4DH1A 4FSQA 3LCDA 4N4SA 3KN6A 3FXZA 1OUYA 2PZIA 3HVCA 4O0YA 3R8MA 4FKLA 3KIOC 1Q62A 1ST0A 5HG8A 4QP7A 4ZZNA 2O8YA 3GU6A 5HO8A 3ZUUA 4YHJA 4ERKA 3FI8A 3R8LA 2IVVA 1XO2B 4AU8A 4ZJVA 3SVVA 4XG2A 1OGUA 2PU8A 1W0XC 3U8WA 3TDVA 4G3FA 4O21A 3NGAA 2FUMA 2W1GA 2R3GA 5CX9A 2NPQA 3VBQA 3MWUA 2X9EA 3U51A 3M1SA 3SHEA 5KUPA 5F9EA 3SW4A 2XMYA 5HQ0A 4KD1A 5DH3A 1XMLA 1MQ4A 1BL7A 5DYJA 4J99A 4DFYA 5J79A 2J0MB 4YTHA 2X2KA 3BU3A 3FBVA 2HW6A 4EZ3A 2EXEA 4AAYA 3BU5A 4IB0A 2IO6A 2R2PA 3MFRA 3O7LB 4W9XA 5ANIA 1NXKA 1IA8A 2WQMA 4FSZA 4YJQA 5AIRA 2C6EA 3BE9A 4GFMA 5IH5A 3O5AA 3MFSA 3R9DA 3UNZA 4QQCA 5EYDA 4BCQA 4BIBA 4D2RA 4JNWA 4CVAA 2PMIA 2GNGA 4JXFA 1R39A 4ERWA 4F6UA 3MS9A 5DN3A 2Y6OA 3LFDA 2Q83A 2UZUE 4I21A 4LMNA 2BZHB 3CXWA 3PSDA 3PY3A 4GIIA 3R83A 3W18A 2AEGA 3WF8A 5A9UA 4J1RA 4A9UA 3S00A 3ZO3A 4ACCA 3GI3A 3EH9A 1VJYA 4NCTA 4CGAA 2JDOA 3VUDA 5A4LA 3TMOA 4G5PA 4NUSA 3MA6A 3MVLA 3O96A 4AAAA 4IX3A 2AQXA 4FZ6A 4QP3A 4WSYA 3FL4A 4C0TA 3W0QA 3BKBA 4C62A 3UNKA 2QG5A 4G3GA 4F0IA 4BR3A 4XP2A 3V5TA 3Q2JA 4FL2A 4K8AA 4O22A 2JBOA 4OTRA 4BDDA 2WEVA 3IOKA 5HU9A 3LJ1A 2HCKA 1F0QA 2XNPA 4NK9A 4ALUA 3VUHA 4QPAA 3DPKA 4JDHA 4QOXA 3RBWA 5AR7A 4HJOA 4L44A 4YNEA 4CV9A 3M42A 4NJDA 4O4FA 4TYEA 2UZWE 4BDBA 4FG9A 2B54A 1WBVA 3FMJA 4LGGA 3LXNA 4FKSA 5HU3A 2X8DA 3DFCB 5IA3A 3F82A 3HYHA 5HBHA 2ZMDA 3ENHA 3DTCA 3VJNA 4FEVA 3HRCA 3RPRA 4AE6A 5KMOA 3PDTA 4F78A 2FSMX 3GXLA 3HLLA 3OS3A 5K9IA 3O71A 4C3FA 4YO4A 4EOLA 2PULA 2ZV7A 1QPDA 3ZBXA 5HLWA 1G8SA 2OXXA 3CLYA 2B0QA 4ZTRA 2YJSA 3VW8A 3K5UA 2XZSA 3ERKA 4O96A 4FTQA 4BCOA 2VTRA 3RK5A 4L68A 3ZCLA 5DHJA 4C02A 5AUUA 4FNZA 5CQUA 4RIOA 4RX5A 2XYNA 4D1ZA 1WBNA 2PZ5A 4HGTA 4EJ7A 2EVAA 4MK0A 2QOBA 4HYSA 5CASA 3I7CA 4EC8A 1E1XA 3H30A 5BUJA 3LFQA 3OHTA 4R7HA 3PYYA 3BYUA 4D4VA 4ANOA 3DDPA 4QMVA 4AT3A 4CNHA 4L6QA 1BI7A 2F2UA 2C4GA 3CBLA 3L9LA 4C2WA 3ACKA 4TNBA 2JIUA 5HTBA 5C4KA 5CEQA 4YR8A 3TNHA 5IQCA 2PE1A 4RA4A 2OJ9A 2RG6A 4FIHA 4FKJA 4USFA 5J87A 4YLKA 3V01A 4V0GA 4C4GA 1R0PA 3CTHA 2WNTA 3G33A 3LOKA 5D11A 5GJDA 5GZ9A 4ZK5A 4BHZA 3H10A 2B9HA 3BLRA 1OKWA 3R7YA 2SRCA 4CFXA 3NX8A 4LDTA 4MNEB 5C01A 5AA8A 2W1EA 5EW9A 2F57A 3MV5A 1O6YA 1OPJA 5CU4A 3AOXA 4X2JA 2ACXA 4ZLOA 1BLXA 1KE6A 3C50A 5A6OA 1KUTA 3C5UA 2PMOX 4FIFA 4YTFA 3K54A 4BTFA 3FXXA 3C5IA 3H9RA 5DR2A 5L8KA 3OW3A 4LOQA 2IVTA 5FWKK 2I6LA 4FE2A 1WBSA 1O6KA 1UVRA 2J5EA 3FL5A 1V0PA 5CI6A 2I0VA 3W0OA 5CSPA 4G17A 1H4LA 3BHTA 4ZSEA 4F4PA 5TKDA 3AMAA 2C6LA 2PUIA 3KQ7A 4MKCA 3VBWA 5B2KA 5IKWA 4CQGA 4DEEA 3IDCA 3DS6A 4Y95A 4GUBA 4ASXA 3KMMA 2X1NA 3QXPA 1ATPE 5ANKA 3F2AA 4BFMA 2WQOA 4V01A 5HX8A 4X3FB 5E8UA 4ID7A 4GFOA 2YZLA 5E90A 4M66A 3DJ5A 5EDRA 3D5UA 1TQPA 4CZYB 3IDPA 5CAUA 2JKMA 4D9TA 3GVUA 4ZMEA 3HV7A 3GCVA 5AP0A 5JT2A 2PZRA 2W0JA 3CGOA 5LWMA 4C58A 3RM7A 4EQMA 3T3UA 2XF0A 4EL9A 1M14A 4F9AA 3U6JA 2XKEA 1PYEA 5B0XA 3HMPA 2PK9A 3VWAA 3LLAA 4FX3A 4IXPA 2YAKA 3LQ5A 4JL9A 3IK3A 4LI5A 4O0VA 5EH0A 3ZMMA 5L6PA 3SW7A 2O63A 5CU3A 4M15A 4A06A 2YM4A 2RL5A 3VBXA 5KKRB 3VIDA 3NYXA 2OLCA 5F95A 4FICA 1E1VA 3RPVA 4AOIA 5GIOE 4EOOA 5FD2A 3W0MA 2G2IA 3DK6A 3D7TA 4YC6A 2QOHA 4YLLA 3LVPA 3FLYA 4KSPA 5T3QA 4CLJA 2BHEA 4PP9A 1ZRZA 4I6QA 1H28A 4IWQA 1ZYCA 3E63A 1NVSA 4DH7A 4UY9A 5C9CA 4I4FA 2XNBA 1APME 3A8WA 2GNJA 2C0OA 2ITQA 3A62A 3EQHA 1DS5A 4L3PA 5J1WA 3QA8A 1K3AA 2B52A 2Y4PA 4ZXTA 3R71A 2RGPA 3ZLYA 1SZMA 2PVLA 2W99B 3NRMA 3QRJA 5HEZA 2AUHA 3TV6A 3WZEA 3ZSGA 4ZSAA 1PXKA 3AMBA 3FC1X 3ZRKA 3C13A 4LRJA 3AC3A 3QD3A 4EK3A 2ZV9A 3OW4A 5HG7A 3UOJA 3DBEA 2YIXA 3DDQA 5AMNA 5C4LA 5ANGA 3T3VA 3PJ8A 2ZV8A 3ANRA 3FUPA 4U44A 4ZAUA 5ITAA 3C0HA 1AGWA 2G01A 5AV2A 5HCXA 4QDVA 4PDPA