5JFSA

Crystal structure of trka in complex with pf-00593174
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
305
structure length
277
Chain Sequence
MHHHHHHLVPRGSVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords High affinity nerve growth factor receptor
publication title The Discovery of a Potent, Selective, and Peripherally Restricted Pan-Trk Inhibitor (PF-06273340) for the Treatment of Pain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 85
structure length 277
sequence length 305
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5jfsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5jfsA01
4IC8A 4J8NA 3GOPA 2IW9A 3NNWA 2J5EA 5K9IA 4USFA 5CVFA 5AFVA 1OPJA 2R64A 5IA4A 5I9ZA 3UZPA 2IZSA 4CG9A 5J9YA 1UWHA 3RAHA 4JBQA 2PVLA 5FBOA 2HY0A 4FVPA 4Z9LA 5EW8A 3UC3A 2I0HA 2IW6A 2YCQA 4FKLA 4PDOA 3MJ1A 4MBJA 3UMXA 3F82A 3ROCA 2WGJA 3I0OA 3IS5A 4FKTA 2VGPA 3K54A 2B9FA 5AMNA 1Q8UA 5H8GA 4R7BA 4C3PA 5HICA 4JDKA 5BYYA 4IX5A 2OXDA 1AGWA 2WAJA 1BX6A 1G5SA 3QXOA 4UMRA 4X2NA 2B1PA 3SW4A 4F9BA 4EZ5A 1DAWA 3QTSA 1E1XA 2PVHA 4KD1A 3L9NA 4IFGA 1ZLTA 2XBJA 4A9YA 1WBVA 1YXTA 4TNBA 4BTFA 3FXZA 4DG3E 4X2GA 5J1VA 2FSOX 3ORPA 4JX3A 5CSHA 4I6FA 2UZLA 5KHXA 3UODA 2WMUA 4U0IA 5HVYA 4EWHA 3ZO2A 2QQ7A 3RAKA 4F7LA 2BKKA 2IVUA 3TNPC 3E8CA 4IAAA 3VVHA 4OAVB 3OCGA 4LRKA 4WG3A 3KXGA 4YZDA 1GIHA 3LXLA 5D1JA 4ZTRA 3R7IA 3QGYA 3S95A 3COKA 2VTTA 2VTRA 3RNIA 1PMUA 3QTWA 2CGWA 5IQHA 4HCVA 1S9JA 2E9UA 3TV6A 3SW7A 5CU4A 4OW8A 5M4CA 2C3IB 3QTIA 3GCQA 4N57A 4A9TA 2VTHA 3FMHA 4RIXB 4BCJA 4L67A 2AYPA 3QKKA 1Y57A 5H2UA 2ZV9A 3E88A 3E64A 2OK1A 4DCEA 4DC2A 5JQ8A 3OC1A 1YRPA 4BCHA 4Q5HA 4YHJA 3CPBA 3RKBA 3M42A 3WZKA 3LM5A 3KN6A 2WTCA 5M4UA 2YABA 4WNKA 2Z60A 3P08A 1KE6A 4FF8A 4EOIA 2GS7A 2WQNA 3AXWA 3ZZEA 5LVPA 1FVRA 1OBGA 2VTIA 2HXQA 3KMWA 3WZDA 4Y73A 3U6IA 1R0PA 4CGAA 3KK8A 5TOZA 3O96A 2GS2A 2WMBA 5T3QA 4D55A 3A99A 3P9JA 2BAJA 3DK3A 4O82A 4W4XA 4D2SA 3LQ8A 3DY7A 1HCKA 3FMNA 4I3ZA 3UVQA 3EQGA 3QWKA 3DK7A 3H9FA 3IECA 2UZDA 3QHRA 4O27B 4XG2A 4H3QA 4P2KA 4GT3A 3CGOA 4IZAA 4NCTC 3ZONA 3D5XA 4IWOA 1WMKA 2JFLA 4IAYA 3JVSA 3FMMA 3NZ0A 4L3JA 4PMMA 1YI6A 5HCYA 3FXWA 1OGUA 2H6DA 1MRUA 1OMWA 5L2WA 3FQHA 2BDFA 2IVSA 4IAFA 3NYOA 5IQGA 3I7BA 5L6WL 5HBEA 1M14A 1FMKA 4BDFA 2I6LA 2WFYA 2OIQA 3IW7A 5HX6A 4LI5A 3OP5A 3QLGA 1OPLA 2VTNA 3OWPA 4XG9A 1BKXA 5J7BA 1KV1A 4MWHA 1ZOEA 2QOCA 3HMOA 2XNPA 3CLYA 4DTBA 5CXZA 3HL7A 3ZLWA 3VF8A 4M67A 4OT5A 5L8KA 3AT2A 5AP7A 2HZNA 4E20A 5BMSA 3CCNA 2X7GA 4EBVA 3LMHA 2X2MA 5DE2A 4GRBA 1YVJA 2Y7JA 3R02A 1PXPA 5DWRA 1YQJA 5FLFA 5HO8A 3CY3A 3N4VA 2R7IA 5CVGA 4BCQA 1GNGA 1YWRA 3LFSA 2FSLX 4AZVA 4FNXA 2X9FA 3B8RA 4D4VA 4CFMA 4GKIA 3SHEA 3KXXA 3AG9A 4X3FA 5HI2A 4ANQA 3FLWA 4FV6A 3IOPA 2VV9A 3MVLA 4M97A 2BIKB 3JS2A 4RJ5A 4UYAA 3VS2A 3QL8A 3ZTXA 3Q6UA 4BVUA 3FJQE 3COHA 1H28A 1YHVA 2GHGA 4XMOA 3GCSA 2BKZA 3GU5A 2VTLA 2XS0A 5H8EA 2PZYA 4YJQA 4O7NA 4AGWA 3R0TA 4TNDA 2C6KA 5EM7A 4MXZA 4QMPA 4EUUA 2IZTA 2VRXA 1ZYLA 2ZB0A 2ITUA 2W1EA 2ITZA 3FC1X 3FY2A 3LFAA 1H26A 4FTNA 5KZIA 4BN1A 4D2RA 4A06A 5EQEA 1DM2A 5ANDA 2I1MA 3D7ZA 5D10A 5EW9A 3TTJA 4HNIA 2GNFA 4RSSA 5DT4A 4FA2A 3QD3A 4HVIA 2PE0A 2HENA 2C30A 4FZFB 3S4QA 3T8OA 5LMKA 4BGGA 4YBJA 1RQQA 5CU3A 4LOOA 4R8QA 1ZZLA 3OWKA 4AW1A 2ZDTA 3EN6A 5IH5A 4XRLA 2CMWA 3UOHA 4DT9A 4HVDA 3AMYA 3PVUA 1W7HA 2BDWA 2UV2A 2UZTA 4ID7A 3F2AA 1UU7A 2PUUA 3FQEA 1ZY4A 1WBWA 4GUBA 1VYZA 5IISA 4HVHA 2HELA 4G17A 4EOPA 4BY9E 2PE2A 2W4KA 3QZGA 3CTJA 1CTPE 3Q4TA 2YIRA 4QNYA 2ITVA 2X6EA 5HEZA 1PXNA 2VO6A 3N9XA 4AS0A 3HAMA 5KUPA 3RPYA 4FEQA 2R0UA 2B7AA 4DEHA 3QYWA 2ZV2A 3V8WA 4O7ZA 4PL3A 3ZLXA 3DBQA 3OG7A 4WBBB 5C26A 3ORNA 4GCJA 5DFPA 5CF8A 2W1ZA 3Q4CA 3T9TA 1ZOGA 3KXZA 2QU6A 4AF3A 4F1OA 1U54A 1REKA 5JRSA 3WF9A 3RNYA 4M0YA 2EWAA 3TNWA 2BVAA 2OI4X 3A8WA 3ZC6A 2XK8A 2PHKA 2I40A 3R9DA 4F0IA 2BTSA 4ACHA 5JQ5A 1VZOA 1H1RA 4DH3A 1HCLA 1LUFA 4RVMA 3VHKA 3GU6A 4GYIA 3QRIA 5CNOA 2WOUA 2X9EA 3LFDA 4ZY4A 3IQ7A 2VWZA 4TYEA 4AOJA 2X0GA 3QBNA 4BDBA 2B53A 4DH5A 1JWHA 4EORA 5AP1A 2IZUA 3KULA 3ALOA 4PQNA 4HGLA 3KGAA 4RC4A 2XEYA 3SA0A 5HZNA 2RL5A 2XF0A 1XH9A 4O0WA 4R1YA 5EOBA 1VR2A 4L53A 3ZH8A 2CJMA 2J90A 4J97A 3D94A 4V0GA 2DWBA 3FMJA 1ND4A 1PMNA 4DT8A 3RM7A 3TACA 3SRVB 4HW7A 3BE2A 4FV9A 5JGBA 5ITAA 3DGKA 4JDHA 3D5VA 3UTOA 1XR1A 3ELJA 4EH5A 3IGOA 4YC6A 2JDSA 5CASA 2PMLX 3MJ2A 4GIIA 4HZSA 4IWQA 4AN2A 2F7ZE 4NJ3A 4B9DA 4EOSA 1O9UA 2C6LA 2R3KA 2RG5A 3NUNA 3QRKA 4RIOA 4XEYA 4E6CA 4U80A 4OTGA 4EH3A 1WAKA 3BEGA 3SD0A 5AP6A 4RPVA 1GZNA 3HMMA 5DHJA 4BDAA 4ZLOA 2PYWA 4W8DA 1NVRA 5EHOA 2F7EE 3UYSA 4OBPA 5BNJA 2EXCX 2NRUA 2PVKA 2VX1A 3EQDA 2WMVA 3S2PA 5KMLA 2XRWA 4WBOA 5EHYA 4ZJJA 1PXMA 2OJ9A 2PVMA 3TIZA 3GU8A 3PP1A 3N51A 4O83A 1ZAOA 4MXYA 3RALA 3OCBA 1FGIA 4R1VA 4C0TA 1YI4A 5HBHA 3PZEA 4AP7A 2QODA 1IEPA 3NW6A 1ZOHA 1RE8A 3EYGA 3UO4A 4C2VA 4ALWA 2B54A 4C33A 3ZZWA 3GEQA 5FTOA 1W8CA 4CXAA 2WTDA 2X4ZA 4IVCA 3TG1A 4BKZA 4DEBA 5HBJA 3NUPA 2JITA 2E9VA 5M55A 2YJSA 4FV8A 1GIJA 4YLKA 3UOKA 3FLSA 5FP5A 2HYYA 3VBWA 2O5KA 2WPAA 4BDGA 5IA3A 1OPKA 4N0SA 5IUIA 5GINE 4OT6A 3LLTA 5EI2A 4AZWA 1JBPE 3LFBA 4Z7HA 5DR9A 3FKLA 4TYIA 4IQ6A 1H08A 4NYEA 3JUHA 2VTQA 3KQ7A 3PFQA 2JLDA 4IB5A 3HDNA 4IJPA 4O91A 4EOJA 3SXFA 4OTRA 4E6DA 1GIIA 4QMZA 3QA8A 5EM6A 4AU8A 4E4NA 4F1MA 3PLAE 2HAKA 2VWWA 4P5QA 3KXHA 4L44A 2XBAA 5AAEA 4HPUE 2VTOA 2KULA 3TWJA 3L8VA 1IRKA 2X7FA 1H1PA 3EIDA 3E3PA 1SVEA 4HYHA 4D2TA 3ZM9A 4S30A 1YOLA 2AC3A 4UXQA 2OLCA 3TIYA 4A4OA 2GTMA 5KBRA 5CAVA 2OSCA 4MQ2A 2XP2A 5E8VA 1WFCA 3W2CA 2HW7A 3KXMA 4IANA 4TT7A 1YKRA 1IAJA 2WQBA 3W8QA 1Y8YA 5KMJA 3LQ5A 3LMGA 3OWLA 1NXKA 4YSJA 3R22A 4NFMA 1YWNA 3MB7A 3C13A 4FKPA 4FG7A 1WBNA 2JD5A 4RA5A 5A46A 3RPSA 5C1QB 4KWPA 5HIEA 2E9NA 2C3KA 5KMIA 4DA5A 3II5A 3RPVA 1JOWB 4EK4A 2QO7A 3QQFA 3ACKA 2FUMA 2WTJA 4IIRA 4NM7A 2Y4IB 2XK9A 2XYNA 3A7IA 4FTJA 5FTQA 5F9EA 5BVEA 3AC1A 4ZS4A 1PW2A 3AGMA 3EQBA 4KIKA 4JS8A 3U54A 2VO0A 2WU6A 3ZS5A 2YAAA 4Z7GA 4RJ8A 4AAAA 2C5XA 5AIRA 4PNKA 4KKEA 1VYWA 3W10A 4WD5A 4WG5A 5IQAA 3FLYA 2X2LA 3PE1A 3MPAA 3L8SA 5GHVA 4FL3A 3F5UA 2QKRA 1B39A 5IEVA 4NTTA 3COMA 1Q61A 3LFEA 4M13A 3MN3A 3OW3A 3F7ZA 4TTHB 4Y5QA 2DYLA 4MEDA 5DG5A 3UP2A 5IEXA 4O0UA 3GFWA 1P4OA 3QFVA 4QPAA 4O7SA 2GU8A 5IZFA 4UBAA 3BQRA 4FKVA 4TN6A 3ENHA 5JGDA 4ZJIA 2BMCA 2OH0E 3QZHA 5C8KA 5HLWA 3KRRA 3DBDA 4YNOA 3H4JA 3ORMA 5AP3A 1KOAA 3ANRA 3RZBA 1JKLA 5E8TA 4K2RA 4PPBA 3JPVA 4L6QA 4C4IA 3MBLA 5L2IA 2IO6A 3FE3A 3FY0A 5AX9A 4XHKB 2YN8A 3ORTA 3DNEA 2C5NA 3SQQA 4EH8A 4EQUA 4S31A 3CD3A 3P78A 1ZMUA 1Q3DA 3A2CA 5FP6A 3TZ9A 4MF0A 2J51A 2G2FA 5C8MA 5CX9A 1BL7A 4R77A 4U79A 1XBBA 2YM4A 3BYUA 4GS6A 2P2HA 5DVRA 3PY0A 3G15A 4II5A 3TN8A 3F3VA 1JLUE 5AA8A 2P3GX 3ETAA 5EFQA 1NW1A 4FTQA 1OUYA 3WILA 2OKRA 3ENMA 3O8UA 2RFEA 3E87A 5HE3A 5I4NA 4L52A 2C6TA 2PU8A 2HXLA 3Q6WA 4C37A 3UNZA 3FI4A 4L7SA 4DG0E 4E8AA 2Y6OA 3RWQA 5FWKK 2C3JA 1JQHA 4Y85A 4ACGA 3C4ZA 2VWYA 3NSZA 3PA3A 3KKVA 4GU6A 4ORKA 1JAMA 4NJDA 3W2PA 5EYDA 1WBTA 2WMXA 4PPAA 3BWFA 1XH8A 4ANOA 3QAME 3Q9WA 3ZOSA 4P4CA 2ONLC 5GJGA 3DDPA 4XOYA 4DEDA 4Q5EA 3N4TA 1J91A 3EQFA 1BYGA 4J99A 4NW5A 2HWOA 3FPQA 4ZLZA 2VWIA 4BDHA 3BU6A 1Q8WA 3V5WA 1KE5A 1OIRA 5LCJA 4NU1A 5EYCA 2JDRA 1YXUA 1GY3A 1YOMA 4K1BA 5BX0A 4QYYA 4AW0A 3A60A 3UVRA 1KE8A 2BZKB 4E26A 3PJ2A 2UZOA 4F0GA 4CYJA 1M52A 3O7LB 2OJIA 4FKUA 3O8PA 5G1XA 2BZHB 4XP2A 1L3RE 3R1NA 4DGNA 2X1NA 2ZB1A 4E5AX 1PKGA 4NWMA 4V05A 3OF0A 1R0EA 4DF3A 5E1SA 4BDJA 4EH6A 4YJTA 4YJPA 2R5TA 4FVQA 2R3IA 3GC0A 4BCKA 3MA3A 5EH0A 4JJRA 3IDBA 5FRIA 4PWNA 2B9IA 1OI9A 1Y91A 3OCSA 3V01A 5J79A 2HCKA 5ETIA 5CSXA 5AIKA 5FXRA 3GGFA 3EHAA 3ZFMA 4FR4A 2YERA 4HYUA 4X3FB 4TWNA 1PJKA 4C4FA 2OZAA 3S0OA 4F70A 4O84A 4K6ZA 3E62A 2E9PA 4NM0A 5E8UA 2YHVA 4X2JA 4G9CA 2A19B 2FSMX 3COIA 4TWCA 4EL9A 1JKSA 2CN8A 2BUJA 4FV0A 4MCVA 1ZYDA 3ET7A 3CSVA 3PE2A 3UIXA 3EN7A 5A6OA 4G3CA 1VEBA 5HTCA 4OAUC 4RVTA 4R78A 2XA4A 4WSQA 1V0PA 3P7CA 3TI1A 3VQUA 3OBJA 3PVBA 1Q8YA 1LR4A 2PUIA 2YIWA 4TL0A 2YCFA 1P14A 1GAGA 1QL6A 4ITJA 4QP6A 4K9YA 2ZM1A 3ZO1A 5IQCA 5HD7A 1PXJA 4CFWA 5CEQA 3BIZA 3C1XA 4FNYA 4YJSA 5JRQA 3RJCA 4KBAA 2J2IB 4LUDA 1E1VA 4EC8A 2P55A 3KA0A 3KFAA 2PSQA 2YIYA 4XV1A 2Z7LA 4CQGA 4GUEA 4DH7A 3TUBA 5FD2A 3LCDA 3DQWA 4GU9A 2NP8A 4GT4A 4OTQA 5BMMA 3RTPA 5CF6A 4OUCA 2C69A 3BE9A 3CIKA 4QMSA 5LARA 5H8BA 3Q5ZA 4TY1A 4F0FA 3EN4A 4FIHA 1WVWA 4O96A 2QI8A 5M06A 2UVYA 3LJ1A 5K4IA 3A4OX 4NCTA 4C3FA 2XJ1A 3QHWA 4L01A 4BKJA 2BILB 2AC5A 4A4LA 1PY5A 3H0ZA 4ZMEA 3EQPA 3D15A 4QYGA 5F4NA 4I6HA 4OLIA 3UQCA 4RT7A 3SGCA 3I6WA 3U51A 4I24A 2ZDUA 3DFCB 2ZYBA 3IW6A 3M1SA 4FT9A 4WA9A 5ANIA 4CTCA 5L4QA 4F6WA 3EWHA 2CKPA 3P86A 4YZNA 4MKCA 2J9MA 4KSPA 4WNMA 5IU2A 5C01A 4F63A 1U54B 5IQIA 3U4WA 3QX2A 2R3GA 4J1RA 1M2RA 4E4LA 5IH6A 5ANOA 4O7TA 4PP7A 2OFVA 3NR9A 3ORZA 1H8FA 4IZ7A 3LM0A 4D4RA 4IDTA 3ODYX 5HVKA 2SRCA 2UZBA 3RVGA 4Z16A 2WB8A 3TV4A 1ZY5A 5KMNA 3RPOA 3BGPA 3RWPA 3C51A 5IDPA 2QOFA 1NA7A 3KRJA 3KULB 3L1SA 3H10A 3Q52A 4KBKA 5C8NA 4FTIA 3VUKA 4FTAA 3QGWA 4DE4A 4FOCA 3RP9A 3PDTA 3T9IA 4E7WA 5DMZA 5HVJA 4NM3A 4V0GB 4PV0A 4JT3A 3G6HA 4AOIA 3IDPA 2X39A 2XJ2A 5K5NA 3DCVA 3FZOA 2XCKA 3OOGA 2PVYA 3KEXA 3RPRA 1H25A 1Y8GA 2J0MB 2CKQA 3I81A 1QPJA 4H1JA 4QP9A 4ZJVA 2ITQA 4IM3A 2XK6A 3V8SA 4IE9A 5TKDA 1P5EA 4ZTHA 4ZXTA 3NUUA 5CAPA 2JDVA 4AA4A 3D14A 4YTIA 2X81A 1FVVA 3MY5A 3POZA 2YDIA 4CMUA 4KBCA 1XO2B 3F61A 4E6QA 5HU9A 1A48A 2O63A 4LM5A 3QC4A 2X8EA 5DLSA 5FDXA 4EK5A 4LYNA 3L9PA 3F6XA 4ALVA 4RX9A 4QTCA 2IN6A 3JXWA 4MX9A 3UG2A 2HW6A 5EYKA 3BHYA 4YUQA 2R3RA 3OD6X 4JNWA 5AX3A 3V5TA 4R3RA 4BF2A 3PJCA 4TYHA 2GFSA 4I4EA 2ACXA 4E5BA 3U55A 2Z7RA 4RFYA 4BGQA 2BHEA 2JFMA 4JAIA 4FZ7A 4C2WA 5ETCA 1NVSA 1OUKA 2QG7A 3DOGA 5CSVA 4ZSEA 4X6RA 3V6SA 1T45A 5HE2A 2CDZA 2R9SA 3MVMA 5ANKA 1CM8A 2Z7QA 3F69A 2WMSA 3A8XA 4RJ4A 4GG7A 1G3NA 3CY2A 4RLLA 5JGAA 4O86A 4ANNA 3AMAA 1FMOE 2WHBA 3LXNA 4MNEB 2LAVA 4WNOA 3ZMMA 5KCVA 1TQIA 5HCZA 3D2IA 4AW5A 4MNFA 3QKLA 2W9FB 3FC2A 1OVEA 3O8TA 4DYMA 4BTKA 1OKZA 4USDA 5L2TA 1SZMA 3NCGA 2PE1A 3D5WA 3E8DA 4XNEA 1YHWA 3QTUA 4FIGA 4JRVA 4DFLA 2ETKA 4XG8A 5HD4A 4TWOA 5CALA 5CSWA 3TZ8A 4RC3A 3CQWA 3UNJA 4APPA 4GVJA 5DR2A 2VX3A 5CNNA 3P1AA 5E92A 3MVHA 3E93A 4DEGA 5A4QA 1R3CA 4FODA 2YZLA 3ZFYA 4CEGA 3OW4A 4YURA 1XH4A 4FI1A 2IW8A 4H39A 4QPMA 3DXNA 3R71A 4LGDA 5FTGA 4BR3A 1J1BA 2XKCA 4R5YA 3QWJA 4EH7A 4C36A 4EHVA 3F7WA 3KL8A 3ULIA 4C35A 2QO9A 4RVLA 4F9YA 5I9XA 3LFNA 3VRYA 4B0GA 2ERZE 4G5JA 4EOQA 4EK3A 3TV7A 4BDKA 4C7TA 4AT3A 2XYUA 3ZRMA 1XJDA 3H9RA 2YCRA 3VNTA 4C61A 1LPUA 4YO6A 4AOTA 3DTCA 3GUBA 4R7IA 3G33A 1IASA 3R04A 4L00A 1H24A 4DEAA 4R3PA 3AC5A 3SOCA 5E4HA 2F2CB 4X6QC 5A54A 1W0XC 2GDOA 4JX7A 2CLQA 1XKKA 3HX4A 4ALUA 5GZ8A 4E4XA 4G9RA 4W4WA 4CMTA 5D7AA 3VBYA 3NW7A 5E91A 3QXPA 1Q62A 4HNFA 5EM8A 1U5RA 3CTQA 4ZY6A 3SXRA 3G0EA 2O8YA 3UNKA 1I44A 2W1DA 3ORLA 3R9RA 4KIKB 4PTGA 3R8UA 1I09A 3U4UA 3QUPA 3F2RA 4RWLA 3H3CA 4GW8A 1YDRE 4M15A 3O50A 3WF6A 5L6PA 1MQBA 1R78A 1HOWA 2P2IA 2RSVA 3FXXA 1LP4A 4G16A 4KA3A 5EDQA 2ZJWA 5HHWA 3KCFA 3BLHA 3Q2MA 5LWMA 5IF1A 2NPQA 1FPUA 2WZJA 2Z2WA 2V7OA 4TXCA 3PJ3A 2YM5A 4JDJA 3R8ZA 3VBTA 3G51A 3ZUVA 3A7JA 2W9ZB 3E7VA 4FGRA 3HAVA 4K11A 3EB0A 1URWA 2FO0A 3KXNA 4YR8A 4ASEA 2QD9A 1JPAA 1TKIA 4QNAA 4C59A 2HWPA 2QU5A 3PXZA 5AV1A 5A4TA 3FZSA 2A4LA 1PYXA 3CBLA 4D1XA 2NNWB 3HV5A 4FV2A 1WCCA 1JNKA 3QLFA 2JIIA 4AFJA 3BEAA 1U4DA 3LW0A 4ANLA 2WMQA 1H0VA 4DGGA 4BTJA 5HG7A 4GG5A 4J98A 5A14A 2OH4A 3CR0A 4AFEA 3UPZA 3TDVA 4WKQA 4QP2A 3SV0A 4CFNA 2WXVA 5AR2A 2UW8A 4IB0A 3QX4A 5AUVA 3PWYA 2F9GA 2WEVA 2W1CA 5F1ZA 3OOMA 2GSFA 3FL5A 4JG8A 3R8PA 4AWIA 3WOWA 3OT8A 4M69A 4XV2A 4YNEA 4BCNA 2C6IA 2CGXA 5LCKA 3KF7A 3KVWA 4QTBA 5KBQA 4O7RA 3UZTA 4GKHA 1H1WA 1M7QA 4PX6A 3D4QA 4FV1A 5EW3A 5EYMA 4CZUA 2QOOA 3QQGA 4CLIA 4TZRA 4UZDA 3EL7A 5KMOA 4MAOA 3SXSA 4AE6A 4CSVA 1PKDA 1PXOA 4RWIA 4FEUA 5B7VA 2W05A 5HGIA 5F20A 4LUEA 4RIYA 5C03A 2H9VA 2BZJA 2XNGA 4EEVA 3WZJA 4FEWA 1ZMVA 4GK4A 4CFFA 3VC4A 1UU9A 4Y72A 4QP7A 5LOHA 2ITYA 1NT2A 3EKKA 3QD4A 2OGVA 3CC6A 3OUKA 4DBNA 5AUZA 4FSWA 3R21A 4D4SA 2W4JA 4UZHA 4M14A 4QQCA 3HGKA 5I9YA 3TZ7A 2W06A 4FV7A 1QPEA 4XLVA 4ITHA 4QMUA 4YTHA 3O0GA 3HA6A 4O0VA 4BC6A 4DGMA 4ZTMA 2WIPA 3QQJA 3EQIA 5EQYA 2BALA 3ZO3A 1Q41A 4M84A 3ZUTA 4MBIA 1A06A 3VUIA 2XK4A 1Q4LA 3EQRA 4PP9A 2OIBA 2PTKA 4QMMA 5CF5A 4RX8A 3F3TA 5HO7A 3QD0A 4FE2A 4FVRA 1YDSE 3OT3A 2OO8X 3MW1A 4TRLA 1Q97A 3R01A 3QCQA 4CMOA 3THBA 2CSNA 2QOHA 1FOTA 2EXMA 1KE7A 4JOAA 4KRCA 4F9WA 2WNTA 4QYFA 3E92A 4MBLA 5HIBA 3RHXA 4MD8E 1WBPA 2A2AA 3R83A 3PA4A 3NAYA 5C4LA 5KNJA 4FK6A 4AGDA 5FEQA 5LVMA 2CKEA 4OR5A 4RJ6A 4B8LA 5I3OA 5CANA 2W4OA 3RI1A 2OF2A 1H00A 4U43A 1ZXEA 1OL1A 2OZAB 2XIYA 4PMTA 5FG8A 5HG5A 2UZNA 4GK2A 5BVFA 3HLLA 2GQRA 2J7TA 4AGCA 4I0TA 4XCUA 3CS9A 4RZWA 1MP8A 4FT0A 2QOKA 4J7BA 5DBXA 4ZTNA 4IX4A 3QD2B 1WZYA 5AUTA 3KREA 2R0IA 2ZM3A 4YHTA 1JSUA 5DRDA 3V3VA 3ID6C 5DOSA 4F99A 4YO4A 3ZRLA 5CWZA 3PY1A 2PMOX 5IA5A 1OM1A 3V04A 1OIYA 3AC4A 4HGTA 2Y4PA 1Q3WA 5JN2A 3LE6A 1UVRA 2PVNA 3I1AA 5EQPA 3FMEA 3VW6A 4BZDA 4I94A 3C5UA 3O51A 4H3BA 2GCDA 3AC2A 5CQUA 3HV6A 5EI8A 2BIYA 1ZARA 1BI7A 2WIHA 2WO6A 3ZC5A 2XJ0A 4ASZA 3W2SA 4HPTE 4UMPA 3MH0A 3AC3A 2PMNX 4YJRA 2B4SB 5CAQA 3OXTA 4LOQA 2OF4A 3NUSA 1UV5A 3R1QA 4WHZA 1FINA 3ROYA 4C34A 4ERWA 4ZLYA 4JBOA 2PY3A 4FSUA 2ONLA 4BCFA 5DI1A 1KSWA 4U3ZA 4M12A 4YMJA 2CGVA 2ZV7A 4FZDB 4YJVA 3NUAA 4L68A 4U6RA 4IMYA 1W83A 3U8WA 4U41A 4DBXA 3LFCA 4MNEA 1PF8A 3PPKA 4FNWA 4DN5A 2XNMA 3FMLA 3MY0A 4PMSA 3V8TA 4GFOA 2QC6A 4G2FA 3FZ1A 3ODZX 2Z02A 1RW8A 4FX3A 4I92A 3NMUF 5GIOE 1OL2A 1OKYA 5FEDA 4AN9A 5KX8A 2R3LA 3OEZA 4PTCA 1BLXA 3C0IA 2WTWA 4I41A 5FQDC 4ZZNA 3OVVA 3V6RA 3PXYA 3A61A 2B55A 5M57A 2W96B 4IX6A 5ETFA 3VS6A 3UOJA 4JDIA 5AV0A 3R8LA 4DLIA 4RX7A 3KVXA 5BQ0A 5AWMA 1BUHA 3K2LA 3DLSA 4EOKA 4FMQA 3QCSA 4MVFA 4F65A 4QMVA 1J7UA 2UW9A 2FYSA 3EYHA 3MS9A 3UPXA 4QYEA 4CYIA 5CEPA 1OIQA 1W98A 4KAOA 4NSTA 4C3RA 4DFXE 3PRFA 3DJ7A 4LG4A 4EBWA 1OL6A 2WTKC 5AV4A 3SVVA 4IHPA 5M08A 4MXCA 2G01A 1FVTA 1OL5A 4PF4A 3G0FA 5AP2A 2CLXA 2EVAA 2QONA 3FL4A 2ITNA 1YXXA 3GT8A 5M56A 3W1FA 4O0SA 4BDIA 1QCFA 5ICPA 4RC2A 3R30A 3QALE 4XRJA 4IJ9A 5IQEA 3C7QA 3HECA 2LGCA 4FBXA 5CT0A 3WF8A 4CRSA 4S34A 2QHNA 3BGQA 3UMWA 3VS4A 2V62A 3PWDA 2HK5A 1O6YA 4BL1A 2PULA 3FBVA 3LCOA 5BVWA 5DNRA 4DFBA 2JBPA 5FM2A 1JKKA 1H01A 3EOCA 3W2QA 4YC8A 5TE0A 2C6MA 4D4YA 4CFVA 4U7ZA 2Y8OA 3HA8A 5JK3A 3NLBA 1H4LA 2C3LA 2YM6A 4QPSA 5HE1A 3GVUA 4JAJA 2WD1A 5EDPA 2R3QA 3QRUA 5AAGA 4N6ZA 3DS6A 3PSCA 3PIXA 2GNHA 4XG3A 5M4IA 4HGEA 4BRXA 1J3HA 4ZK5A 5HU3A 2UZUE 3FI2A 3HYHA 3R6XA 2GNLA 4GSBA 3UBDA 3VF9A 4EONA 5CF4A 4ZMFA 3RM6A 1IA9A 4BBEA 3TKHA 4E4MA 4EKLA 4TYHB 3TEIA 5A9UA 2BRNA 3NUYA 4EJNA 4O1PA 4O0XA 4U81A 4BI2A 4CFXA 1LEWA 3JY9A 3NUXA 4LGHA 4OTWA 4O6LA 3Q5IA 1B6CB 3TL8A 3TDWA 4XP0A 5F94A 3R8VA 3V5QA 3VN9A 4M7IA 5EHLA 4GJ3A 3KRXA 4ITIA 2QCSA 5HIDA 3IW4A 4Y46A 4UMUA 3MH2A 4BYIA 2YJRA 2BHHA 2IJMA 1KWPA 3DKGA 3E5AA 2EB2A 2R3PA 3GC8A 3Q96A 3FDNA 4S2ZA 3VUHA 3HMPA 1RDQE 5KO1A 4QMXA 3T3VA 3FEGA 4G3DA 4IAZA 5DA3A 3W16A 4BBMA 3DT1A 4YZBA 3OCTA 3GQIA 3FMKA 3QUEA 4FSMA 5AV3A 3FHRA 2ZAZA 5K3YA 2O2UA 4E73A 2UUEA 1LEZA 4U3YA 4J52A 2WOTA 3PA5A 3CE3A 3R7VA 5JZNA 2BRGA 3FZPA 3V51A 2J0IA 3GI3A 1Y6AA 2NRYA 3PIZA 5C4KA 3TKUA 3QF9A 2VNWA 1R1WA 1GZOA 2CKOA 4WRGA 3BKBA 3O23A 4MTAA 2VWXA 4ZZMA 4A07A 5K0XA 3U87A 3RAWA 4NUSA 2BPMA 1XBCA 2YIQA 3JY0A 4D5KA 4O21A 5CU0A 4P90A 3CPCA 4JLCA 4BI1A 4RQKA 1PXLA 3GB2A 2OW3A 4YC3A 5EM5A 4ZY5A 1CKIA 3D9VA 3UP7A 3BYMA 3NCZA 4F7JA 3UC4A 3I79A 2BRHA 4I0SA 3A7GA 4EHGA 4YTCA 5J8IA 5AR7A 2GS6A 4LMUA 2UVZA 1SYKA 2W17A 3TM0A 4V01A 1O6KA 1J7IA 3PPZA 5A3XA 4IZ5A 3VUTA 4AW2A 3RCDA 3DBEA 2O3PA 4LRJA 4FTLA 1G8AA 2V55A 4PNIA 2WEIA 4BHNA 2YLFA 3EZRA 4Q9ZA 3LJ0A 1QPCA 3HEGA 4XJ0A 3P0MA 4LL5A 5M07A 4NFNA 2XIRA 2XB7A 4KKGA 4BTMA 3FWQA 1IA8A 3GNIB 2F4JA 3HRFA 5E8SA 5I5ZA 4JG7A 2GHMA 4RQVA 4BZNA 5EI6A 2G2HA 4BYJA 2PPQA 5IKWA 3BV2A 5HKMA 3ZHPC 1V1KA 3F5PA 3FZRA 3VBQA 3ZBXA 3QC9A 3FLZA 3I7CA 4FSYA 4YU2A 3TNIA 3MYGA 4Z55A 4J95A 4GV1A 4GJ2A 4S32A 4WO5A 2GNGA 4D28A 3UJGA 2GFCA 5AA9A 1REJA 2YM7A 1NVQA 5G6VA 2W1GA 1APME 2RKUA 4AZEA 1JSTA 2RFSA 5ANJA 2C0OA 3KF4A 1UKHA 1MRVA 4ERKA 4NZWB 4FL2A 4C62A 4XX9A 5CAOA 1TQPA 5IMEA 3W8LA 4ANMA 1ZZ2A 3OY1A 3E63A 3NAXA 4AE9A 2OJGA 3MIYA 4U40A 3R8MA 2Z7SA 4KKHA 3R7GA 4AZFA 4P7EA 4C38A 1BI8A 4QT1A 4XYFA 5L3AA 4I5HA 1O6LA 4YSMA 5CEKA 3LXPA 4BIEA 3QTXA 4TKSA 4BCPA 5EOLA 5DRBA 4MF1A 3B2TA 3P7AA 4O7WA 5JMSA 1Q8ZA 3B8QA 5IDNA 4BDDA 2VO3A 3BLRA 3E8NA 4CRLA 3FYKX 4ZTSA 4EZ7A 3SLSA 2VD5A 4RVKA 5AP5A 3VUMA 2OFUA 5EK7A 3E7OA 3H0YA 2V22A 3UO6A 3BELA 4J96A 3ZU7A 1UNHA 3S1HA 3MFRA 2ETRA 3PIYA 4XUFA 5IMXA 4ZP5A 5GJFA 3TT0A 4M69B 4AXAA 4KSQA 1K9AA 2XM8A 3DU8A 1G8SA 3LLAA 3MESA 5I9UA 4XV9A 4CT1A 4QQTA 2JEDA 3RK7A 2XRUA 5BYLA 4LQMA 2WMAA 3OWJA 3WZUA 2PZIA 3LKMA 3PP0A 5BUEA 2UW6A 5K5XA 3WYXA 3LIJA 2JKKA 3MTFA 4GH2A 2VTJA 1Q8TA 3EN5A 4FKSA 2FA2A 3E8EA 4KABA 4YBKA 4EQMA 4F9AA 4J8MA 5AUUA 3BPRA 5IUHA 3ZEWA 2PZ5A 1V0BA 3GCPA 3VUGA 3QRJA 3QQLA 2WTIA 4CKJA 3HV7A 3A7FA 4PUZA 3BBTB 4RIYB 1PHKA 3PRIA 4QOXA 1A9UA 3Q9XA 3R1YA 3DB6A 3DNDA 4AG8A 3K5VA 5DN3A 2YZAA 5M51A 4ZTLA 2OXXA 3F3ZA 4RA4A 1BL6A 4Y5HA 3RGFA 5D41A 3ZBFA 2XIKA 4FIIA 4M68A 2CNQA 4WNPA 5DT3A 2BDJA 4C4GA 2HIWA 2W99B 5DIAA 1Q5KA 2P0CA 3IDCA 3DBFA 4U8ZA 3UIMA 2OU7A 4EYJA 3HUCA 4FV3A 4G1WA 3HRBA 2W7XA 3OHTA 4HZRA 3UYTA 2J5FA 3I4BA 2DUVA 1STCE 4B99A 2VTPA 1BMKA 2P4IA 2J4ZA 2RG6A 3ZLYA 2HZIA 4F08A 2I0EA 3O7LD 2C6EA 4LMNA 4O38A 3KMMA 3OTVA 2BAKA 3ORXA 2CNVA 3AOXA 5GIPE 3C4CA 3NW5A 4FNZA 3Q4ZA 5DR6A 3VS0A 5TO8A 4BCIA 2QG5A 3AT4A 4FIEA 4YLLA 5AUXA 3N4UA 2ZOQA 2PVJA 2R7BA 2YM3A 5CU2A 3IGGA 4DITA 5CEMA 3JR1A 4MXOA 2XM9A 4O0RA 4DFZE 3Q2JA 3RAIA 4ZS0A 4JI9A 2QVSE 3VS3A 2XKDA 3HP2A 4FZ6A 4E93A 5TF9A 4IH8A 3QU0A 1OITA 3VRZA 5CZHA 2R3HA 1W84A 4K18A 5AJQA 4ZOGA 5I0BA 4H58A 3K5UA 3CJGA 3UQGA 3ORKA 2UW0A 2UW4A 5CENA 4KNBA 4QP4A 2OWBA 3NX8A 3QKMA 4J53A 2R2PA 3DB8A 2V5QA 2OBJA 4CT2A 4EUTA 3DBCA 3DXPA 2AUHA 3W32A 3D0EA 4ZSJA 3ZRKA 5DGZA 3BHVA 3GCUA 4WG4A 4XOZA 4EH4A 4FL1A 2QLUA 4QQ5A 4XBRA 5HG8A 3IPHA 4RWJA 4IM0A 1JSVA 2GTNA 3PLSA 4R6VA 4U9AA 2H34A 1CKJA 4IX3A 3JVRA 3F88A 1H0WA 2R3MA 3DDQA 1DI9A 2C1AA 2F49A 1PMVA 3AD6A 4FUXA 4C57A 2B9HA 5E7RA 5J87A 4DINA 4YHFA 3NVKI 4DEIA 4LGGA 3EL8A 4IACA 5AM7A 4NKAA 4YP8A 5J95A 4FKRA 3MB6A 4YGAA 4X3JA 3V5PA 1OZ1A 3VHEA 2B0QA 3LFQA 3H30A 1SNXA 3G9LX 3Q60A 3RK5A 4W4YA 4AZSA 3LFFA 4OTDA 2Q83A 5BYZA 4JL9A 5KZ0A 5D11A 1PYEA 1ZYSA 2R3NA 3F5GA 3K3IA 5KE0A 4ASDA 5J5TA 5DEWA 4EOLA 4NT4A 3HDMA 2XNEA 3FI3A 3UE4A 3OXIA 3C0GA 2IVTA 4CZYB 2CCIA 2QOIA 3D7TA 4F09A 2OZOA 2JDTA 2YA9A 4IM2A 4U45A 3DTWA 1UNGA 3DKOA 3I60A 4FKQA 4UX9A 2ITWA 3UG1A 3PXQA 4O2PA 2UZVA 1IAHA 1WBSA 3FI8A 3BYVA 4NIFA 2IWIA 2R3JA 3OXZA 2G9XA 2R3OA 3MI9A 4R7HA 5T6KA 3BU3A 4QD6A 2JIUA 4JQEA 3CP9A 2NO3A 4O2ZA 3TUCA 3WARA 3WYYA 4FEVA 4OTFA 5K0KA 1SVHA 1WVXA 3MSSA 2XEZA 5HCXA 2JKOA 3R7UA 3SG8A 3ZXTA 4JIKA 5AEPA 4JBPA 5HESA 3RCJA 3K3JA 4FTRA 5HLNA 3MV5A 1MUOA 1WBOA 3CGFA 5KMKA 5HORA 2QOLA 5CEIA 4H36A 2WQEA 3JYAA 4QYHA 3LCTA 2X2KA 2C0TA 4FV5A 2C0IA 2F7XE 3R00A 4PL4A 3D83A 1ZYCA 5HNIX 1F5QA 4F7SA 3O2MA 3PXRA 3GQLA 3GOKA 1Q99A 4I23A 4I21A 2VO7A 1E9HA 1OIUA 3FLNC 2IZRA 4AUAA 4FTUA 4KRDA 3FV8A 4I1ZA 3UIUA 2GQSA 3BRBA 4C02A 2XUUA 4DHFA 4YJOA 1MQ4A 3BHUA 5LVOA 4QMWA 4W8EA 2ZV8A 3DPKA 3FYJX 4RJ7A 4H1MA 3DXQA 3AD4A 4G5PA 4PDPA 4ZIMA 3VJNA 5FUTA 5KKRC 3BU5A 4DTAA 3A7HA 3EMGA 3ZDIA 4CV9A 2RFNA 5LMAA 4EK6A 4HYSA 3Q9ZA 4D9TA 3P79A 4CG8A 2VWUA 4LV8A 3WI6A 3L8PA 4CFUA 2BTRA 2ITOA 2QKWB 3ZSIA 3RK9A 1KUTA 5HO6A 5IPJA 3E3BX 2BFYA 3QQKA 4D1ZA 2VTMA 2C5OA 5H3QA 1Z9XA 2VWBA 2VWVA 4C8BA 3TJDA 3HRCA 3PXKA 3C9WA 3WIGA 1KOBA 3KN5A 1XHAA 3R2YA 5CY3A 1YDTE 2ZM4A 2UZWE 4XG6A 4YTFA 5J9ZA 3DQXA 3VULA 4X2FA 1OKVA 2G1TA 2Y9QA 3VBVA 2XZSA 1IG1A 2G15A 3PJ8A 3I0QA 3OY3A 4HCTA 4LL0A 4RX5A 4KS7A 5CSPA 2CCHA 1CMKE 2C5YA 5E9EA 2PVFA 4XH6A 3D5UA 3F9NA 4S33A 4D0WA 4JQ8A 2CGUA 3DLZA 4M0ZA 3NRMA 1YHSA 3MWUA 5AR8A 5BVOA 4DFNA 3UIBA 2WTVA 5LXMA 5IA0A 2YLEA 2VTSA 1U59A 2WELA 4O0TA 2Q0NA 5TR6A 2E2BA 3VJOA 4BWPA 4KS8A 5M44A 4KUJA 3U9CA 5HQ0A 4ONAA 5L2QA 3W18A 3VWAA 2WU7A 4FKGA 4JBVA 2CPKE 1GJOA 4C4HA 5HX8A 1WVYA 5CU6A 4PRJA 4EOOA 2BCJA 3KRWA 4RIWA 2J0JA 4IVAA 4D1SA 2WQOA 3V5LA 2KTYA 3FSKA 3NYNA 3R1SA 4GIHA 2W0JA 4G6LA 1KV2A 1OB3A 2FGIA 2X7OA 3NEWA 3VUDA 2UW3A 3WE4A 1ATPE 3GCVA 5E8ZA 4F7NA 4CV8A 4WIHA 4XS2A 3TZMA 4ZZOA 4FKWA 1FBNA 4WUAA 2PVRA 3EH9A 2PZRA 2RIOA 3L8XA 3MFTA 4ZSAA 2QHMA 2HZ0A 2W1HA 4NEUA 4UV0A 5FXSA 3Q53A 4BFMA 3OBGA 3U6JA 3UZRA 3NPCA 4IBMA 3MY1A 3AT3A 2XKFA 4I5CA 4Y83A 2ITXA 3PJ1A 3CJFA 3TKIA 3V5JA 3W2OA 4F6SA 5IEYA 5CS6A 4FUYA 5BPYA 1UNLA 4G31A 4I0RA 5CT7A 5HOAA 4BCGA 2BZIB 2QURA 4MXAA 4D5HA 1P2AA 5C27A 5DT0A 3VQHA 3ATTA 3QCYA 3SKCA 2PK9A 4GVAA 2Y4IC 5KHWA 3BHHA 3PG1A 4WUNA 2FH9A 4GFGA 1U46A 1GZKA 2GQGA 3BWJA 4IAIA 3TNHA 4AZTA 5J7HA 3TUDA 5AV2A 4APCA 3GP0A 4IVBA 5E8XA 2X8DA 3VS1A 5M09A 3KY2A 3B2WA 3F66A 3R9OA 1PXKA 4JQ7A 3FHIA 2WMRA 5GZ9A 5C9CA 3GBZA 1YOJA 2ETMA 3OUNB 4ANSA 1B38A 3P5KA 3P4KA 5CYIA 3QRTA 3DZQA 1ERKA 4I6QA 5CXHA 3M2WA 3VAPA 1H27A 4DFYA 3AC8A 3MA6A 4QP3A 2XMYA 3TCPA 3DV3A 2C6OA 1Z5MA 4A4XA 4CQEA 5IUGA 5JFSA 3KCKA 4IB1A 5I9VA 5AR5A 4UMQA 2J0KA 3HV3A 4O7YA 3F2NA 2R4BA 3QQUA 4M3QA 4B4LA 5FBNC 2CNUA 2W5AA 3AD5A 2C1BA 2FVDA 3MFSA 4M8TA 3O17A 3WF5A 1X8BA 2REIA 3DZOA 1SVGA 4I4FA 1XQZA 4K0YA 4LV5A 3WE8A 4BDCA 4FGBA 3EFLA 3F5XA 3RBWA 3BYOA 4IWPA 3PXFA 4U5JA 4X21A 5KMMA 4K77A 3HP5A 5AUWA 2ZVAA 2XK3A 4EJ7A 4OTPA 4MQ1A 3MFUA 2PWLA 2PMIA 2HOGA 2YFXA 2QR8A 3FLQA 2O65A 3PVWA 4QTAA 3TNQB 4MYGA 5JZJA 3ZUUA 4CCUA 2F2UA 1QMZA 4IZYA 3R63A 2YISA 4YLJA 4NL0A 3U9NA 4GMYA 4ACMA 5IA2A 2OXYA 3EKNA 4PPCA 1RJBA 4RFZA 4KIOA 5CI6A 5EG3A 3QTRA 2ITTA 4TW9A 4AA0A 3DFAA 2XH5A 4D9UA 5J5SA 4CKRA 5BUJA 3MVJA 4W9XA 4EKKA 3ZLSA 3IK3A 4FSRA 4OGRA 3CEKA 1AQ1A 1M17A 4HCUA 3FQSA 3LXKA 4LFIA 4R5SA 4IADA 2YWPA 3VIDA 4L43A 3C5IA 3FUPA 4U97A 1OECA 4BCMA 3FPMA 4JG6A 3REPA 1TQMA 2UZEA 3EQCA 4H3PA 5JSMA 2B52A 3DKFA 3QZFA 5FXQA 1YWVA 1MRYA 5TT7A 4JRNA 4HVGA 4MK0A 3WF7A 5AP4A 2IG7A 2Z8CA 4E1ZA 5AUYA 4OTHA 4AQCA 3KMUA 4WOVA 3C50A 2EUFB 5D12A 3UDBA 1H1SA 2GHLA 4DEEA 4N6YA 4FTMA 4O7VA 3PYYA 4O22A 4NTSA 5KKRB 5B2LA 3LCSA 4ZSGA 3EJ1A 3DAEA 3H9OA 4DFUA 3NWWA 5ETAA 3ATSA 2OJFE 1FGKA 2OIDA 4E6AA 4O7LA 4K33A 4BZOA 4PTEA 5AM6A 1CDKA 4AT5A 3LMIA 1CKPA 4FKJA 4GL9A 3Q4UA 5EKOA 5F95A 2GNJA 4B7TA 2JDOA 5BVDA 4F9CA 3MPTA 2BRMA 3M11A 4ACCA 4YPDA 4CKIA 5IG1A 3ZCLA 1XH5A 3NNVA 2XKEA 3DJ5A 2PUPA 3LCKA 4L8MA 3PVGA 2XNBA 4IXPA 4LOPA 1M2QA 3FMDA 2V0DA 3Q32A 5ACKA 5AR3A 2OJJA 2PZPA 2XVDA 3RZFA 2QNJA 4OBQA 1PMEA 4C4EA 5CQWA 4UWYA 1GZ8A 4XLIA 4CNHA 4Z3VA 4IC7A 5BVKA 4D58A 3RINA 1OL7A 4UEUA 4X3FC 2OG8A 3ULZA 4BDEA 5IQFA 3O71A 3ZSHA 1SM2A 4D2VA 4UWCA 3HMNA 4FTOA 4OBOA 3SOAA 3NNUA 4M66A 4FZAB 3VS7A 5LVNA 3IW5A 2HY81 3R2BA 4X2KA 5M4FA 3DAJA 4FTTA 3TJCA 4V04A 3FAAA 3PG3A 5FM3A 4IDVA 4YZMA 2C5VA 3BLQA 2QOBA 4IW0A 3SDJA 4BBFA 4RIXA 1UU8A 3G90X 3L9LA 5E8WA 4BWXA 2QR7A 4HVSA 3ZFXA 1SMHA 1UU3A 3BX5A 3I5NA 3LHJA 4L46A 5H9BA 4OTIA 2YAKA 5L6OA 1ZRZA 1P4FA 4RGJA 2O64A 3GC7A 4CCBA 2A27A 2FB8A 3OFMA 1DAYA 4I22A 4KIQA 3NYVA 4FT7A 1OBDA 2IPXA 5DH3A 2W5HA 5AAFA 4EK8A 1J7LA 3R73A 4E3CA 5HTIA 2XIZA 3QA0A 5LMKC 4FEXA 4AT4A 4XG7A 4L45A 3PSDA 1UKIA 4GEOA 2YACA 1FQ1B 1F3MC 3I6UA 3MGYA 4KIPA 4EWQA 1K3AA 2BR1A 3A62A 5A4EA 4UY9A 2RGPA 3LVPA 5LJJA 4A9SA 4PL5A 4DGLC 4QP1A 4C4JA 2R3FA 4JR3A 5B0XA 3OMVA 4W4VA 4F4PA 2CHLA 3MH1A 2Y6MA 2JIVA 5M53A 4FKIA 5A4CA 3FZTA 3HV4A 2GPHA 2GNIA 4YZCA 4QO9A 3BGZA 1NY3A 3ERKA 4QMTA 4U42A 4BICA 5JH6A 3ALNA 2C47A 2X6DA 3EN9A 3D7TB 3UOLA 4F1TA 2J6MA 3P7BA 4R3CA 5CVHA 2EU9A 5T68A 3CKWA 4PDSA 4G3EA 4D2WA 3BHTA 3R9HA 3IOKA 3UVPA 4BI0A 1XH6A 1Z57A 5B2MA 2YWVA 4NIFB 4H05A 3PTGA 3GU7A 3ORIA 3BV3A 4C58A 5AADA 5LMBA 2C6DA 4MWIA 4E5WA 4O1OA 2A1AB 2DQ7X 3POOA 3Q04A 4L42A 4QMYA 4UWBA 3IW8A 3S00A 5GJDA 1M2PA 3DK6A 3T3UA 4QTEA 4JR7A 5DEYA 3ZSGA 2VU3A 4CVAA 3MDYA 4QTDA 2WQMA 4NW6A 4L3LA 4YJNA 3GENA 2VN9A 4EHEA 3MH3A 3SX9A 4RBLA 4DH1A 5I3RA 4N4SA 4DH8A 3PUPA 4B6LA 1VJYA 2YDJA 4P5ZA 3TXOA 5JFVA 2VNYA 4NK9A 1H1QA 2ERKA 3AQVA 4N70A 5K4JA 2RF9A 1CSNA 3GFEA 5ANGA 3C4EA 4HGSA 4XV3A 1YW2A 4ENYA 5HNBA 2P33A 4JIAA 5JFWA 2VX0A 2FSTX 2JC6A 2VGOA 3EZVA 4FICA 4L7FA 4QMLA 4FTCA 3F3UA 4I20A 3W2RA 5LQFA 5DPVA 5CI7A 2BRBA 4GFMA 3HNGA 4MD9E 2H8HA 4G6OA 4UYNA 1XWSA 5HE0A 3ANQA 4DG2E 5HG9A 4LRMA 4YJUA 5L8LA 3VS5A 3PPJA 5ANEA 3F3WA 4ZEGA 3SG9A 2YM8A 3D2KA 4FG8A 1YXSA 3VBXA 4AACA 3AGLA 2XK7A 3U6HA 5CZIA 4FIFA 3WIKA 4BKYA 4HYIA 1EH4A 3PSBA 1YXVA 3CTHA 4QQJA 3IO7A 2IVVA 4IAKA 4FK3A 5E1EA 4FT3A 2JKQA 3Q9YA 5BVNA 4FT5A 2O0UA 3BYSA 2XNOA 4G3FA 4JVGA 3ZYAA 4BHZA 2WKMA 3LJ2A 2W1FA 4UN0C 4CD0A 2GMXA 3KC3A 5LVLA 4BWKA 4FSTA 5CEOA 3UQFA 4RZVA 1F0QA 4I6BA 4RFMA 2Q0BA 2YITA 4G34A 3R7OA 1URCA 3SAYA 2ZMCA 1UWJA 4ZTQA 4HJOA 5E8YA 4A9UA 4L9IA 4X7QA 4FC0A 3HUBA 5L8JA 4D2PA 3LOKA 2UW5A 3GU4A 2YCSA 2YDKA 1DS5A 4EOMA 3NS9A 1DI8A 5A4LA 4AA5A 3FSFA 3NIZA 4FSQA 5EDRA 4EC9A 2E9OA 2ZMDA 3NDMA 3OROA 4BCOA 3IONA 3ZM4A 4MD7E 1S9IA 1SNUA 3EFJA 3Q3BA 1PRYA 3BI6A 3R7EA 2QOQA 2WMWA 4I5PA 4RRVA 5D7VA 2UVXA 1T46A 4RLKA 3DJ6A 1TVOA 3R9NA 1K2PA 4IB3A 3QUDA 2VUWA 2JGZA 4FYOA 3CXWA 5FGKA 4U44A 3DA6A 4MHAA 5HTBA 2UW7A 1ZYJA 2JKMA 2C4GA 3SC1A 1PXIA 1M7NA 3C4FA 4Q9SA 3LZBA 5FEEA 3R28A 4DTKA 2C68A 2QLQA 2XIXA 5JFXA 3AMBA 3G9NA 4QMOA 4RIWB 3ZEPA 5FDPA 4WRSA 4Q2AA 5CLPA 4FTKA 3MPMA 4K8AA 4BIDA 4ENXA 2CN5A 2I0YA 4YPSA 2J0LA 2B9JA 3KU2A 2W1IA 4ASXA 4EH2A 4ZAUA 4ZSLA 4PDYA 4FYNA 2VZ6A 3C0HA 4G3GA 4EYMA 3CD8A 4XG4A 3A4PA 4IWDA 1QPDA 4I93A 4MXXA 4QP8A 4UB7A 4CTBA 2I7QA 3FKNA 4KB8A 5IA1A 2WTKB 4NM5A 4A7CA 2I0VA 4RG0A 1R39A 2ITPA 3EQHA 3KK9A 4PY1A 3NVMB 3BBWA 5JEBA 4GK3A 4KINA 4WSYA 4PMPA 4BIBA 4O81A 2VTAA 3SRVA 4QMNA 4DCAA 4NH1A 1ZWSA 4TWPA 4BGHA 4USEA 3QYZA 1ZMWA 3UGCA 5JKGA 5JT2A 3CQEA 3G5DA 3GC9A 2Y0AA 5B2KA 4J71A 4QRCA 1AD5A 3TTIA 3LAUA 1Q24A 4ACDA 4DAWA 2X8IA 3WZEA 3HVCA 3QCXA 3LPBA 4Y95A 3WBLA 2HZ4A 3DAKA 4Y8DA 2DS1A 4O0YA 3ITZA 3UO5A 2J50A 2EXEA 1V0OA 3KB7A 1H07A 2ESMA 1U5QA 2X4FA 3CQUA 4X0MA 4XP3A 3RMFA 2H96A 3S3IA 3W33A 5GZAA 1JVPP 4XBUA 3OTUA 3FKOA 2WMTA 3PZHA 4F6UA 4RWKA 5IQBA 4HOKA 4UALA 4FKOA 5A6NA 1YI3A 5AP0A 4ANBA 4TPTA 5J1WA 2BROA 3NYXA 4RMZA 3MIAA 4F64A 2G2IA 3HKOA 5I9WA 1W82A 2PUNA 2OICA 4AGUA 3RHKA 5IQDA 3C4WA 5ACBC 3NGAA 4IFCA 3PY3A 1XBAA 4FG9A 3L9MA 5DYJA 1UA2A 3OEFX 4WT6A 2JAVA 4B8MA 4EHZA 5BUIA 3ZXZA 3QTZA 4JXFA 4EI4A 1Y6BA 2VAGA 4GT5A 5CTPA 2EB3A 3QTQA 4AN3A 3G6GA 2YEXA 3CKXA 3GXLA 4FV4A 4DGOA 4FOBA 3DKCA 4QMQA 5IH4A 3BQCA 2XCHA 3W55A 4AX8A 3NNXA 4CZTA 2QO2A 3EFKA 2F57A 3ZDUA 5LWNA 3IG7A 2YIXA 5D9HA 1KE9A 3VO3A 1GOLA 2BAQA 4EZ3A 4RJ3A 4L3PA 2W5BA 4EQCA 1OKWA 3EFWA 5GNKA 2A0CX 4FSNA 4O6EA 1L8TA 4EH9A 3MTLA 3P23A 3R7YA 5HLPA 2V7AA 1JKTA 2XNNA 4D0XA 4A9RA 3LQ3A 3HZTA 1XH7A 4TYJA 4UMTA 4TYGA 4MH7A 3IKAA 4W9WA 3KRLA 4UXLA 1IR3A 3BCEA 2JBOA 4ARKA 3QZIA 5E90A 2BFXA 5EKNA 1J1CA 3NIEA 4IVDA 3C4XA 3HMIA 3ACJA 4GYGA 4IEBA 5L2SA 3BZ3A 5AR4A 3ZO4A 3OS3A 3OZ6A 2PL0A 3I5ZA 4NKSA 3VW8A 5CAUA 3QQHA 4BB4A 4DLJA 3G2FA 4G6NA 2JAMA 4I5MA 5HNGA 2RFDA 5J9LA 4CLJA 4FIJA 4FSZA 4YZ9A
chains in the Genus database with same CATH superfamily
4IC8A 4J8NA 3GOPA 2IW9A 3NNWA 2J5EA 5K9IA 4USFA 5CVFA 5AFVA 1OPJA 2R64A 5IA4A 5I9ZA 3UZPA 2IZSA 4CG9A 5J9YA 1UWHA 3RAHA 4JBQA 2PVLA 5FBOA 2HY0A 4FVPA 4Z9LA 5EW8A 3UC3A 2I0HA 2IW6A 2YCQA 4FKLA 4PDOA 3MJ1A 4MBJA 3UMXA 3F82A 3ROCA 2WGJA 3I0OA 3IS5A 4FKTA 2VGPA 3K54A 2B9FA 5AMNA 1Q8UA 5H8GA 4R7BA 4C3PA 5HICA 4JDKA 5BYYA 4IX5A 2OXDA 1AGWA 2WAJA 1BX6A 1G5SA 3QXOA 4UMRA 1XMLA 4X2NA 2B1PA 3SW4A 4F9BA 4EZ5A 1DAWA 3QTSA 1E1XA 2PVHA 4KD1A 3L9NA 4IFGA 1ZLTA 2XBJA 4A9YA 1WBVA 1YXTA 4TNBA 4BTFA 3FXZA 4DG3E 4X2GA 5J1VA 2FSOX 3ORPA 4JX3A 5CSHA 4I6FA 2UZLA 5KHXA 3UODA 2WMUA 4U0IA 5HVYA 4EWHA 3ZO2A 2QQ7A 3RAKA 4F7LA 2BKKA 2IVUA 3TNPC 3E8CA 4IAAA 3VVHA 4OAVB 3OCGA 4LRKA 4WG3A 3KXGA 4YZDA 1GIHA 3LXLA 5D1JA 4ZTRA 3R7IA 3QGYA 3S95A 3COKA 2VTTA 2VTRA 3RNIA 1PMUA 3QTWA 2CGWA 5IQHA 4HCVA 1S9JA 2E9UA 3TV6A 3SW7A 5CU4A 4OW8A 5M4CA 2C3IB 3QTIA 3GCQA 4N57A 4A9TA 2VTHA 3FMHA 4RIXB 4BCJA 4L67A 2AYPA 3QKKA 1Y57A 5H2UA 2ZV9A 3E88A 3E64A 2OK1A 4DCEA 4DC2A 5JQ8A 3OC1A 1YRPA 4BCHA 4Q5HA 4YHJA 3CPBA 3RKBA 3M42A 3WZKA 3LM5A 3KN6A 2WTCA 5M4UA 2YABA 4WNKA 2Z60A 3P08A 1KE6A 4FF8A 4EOIA 2GS7A 2WQNA 3AXWA 3ZZEA 5LVPA 1FVRA 1OBGA 2VTIA 2HXQA 3KMWA 3WZDA 4Y73A 3U6IA 1R0PA 4CGAA 3KK8A 5TOZA 3O96A 2GS2A 2WMBA 5T3QA 4D55A 3A99A 3P9JA 2BAJA 3DK3A 4O82A 4W4XA 4D2SA 3LQ8A 3DY7A 1HCKA 3FMNA 4I3ZA 3UVQA 3EQGA 3QWKA 4O4BB 3DK7A 3H9FA 3IECA 2UZDA 3QHRA 4O27B 4XG2A 4H3QA 4P2KA 4GT3A 3CGOA 4IZAA 4NCTC 3ZONA 3D5XA 4IWOA 1WMKA 2JFLA 4IAYA 3JVSA 3FMMA 3NZ0A 4L3JA 4PMMA 1YI6A 5HCYA 3FXWA 1OGUA 2H6DA 1MRUA 1OMWA 5L2WA 3FQHA 2BDFA 2IVSA 4IAFA 3NYOA 5IQGA 3I7BA 5L6WL 5HBEA 1M14A 1FMKA 4BDFA 4DHIB 2I6LA 2WFYA 2OIQA 3IW7A 5HX6A 4LI5A 3OP5A 3QLGA 1VLRA 1OPLA 2VTNA 3OWPA 4XG9A 1BKXA 5J7BA 1KV1A 4MWHA 1ZOEA 2QOCA 3HMOA 2XNPA 3CLYA 4DTBA 5CXZA 3HL7A 3ZLWA 3VF8A 4M67A 4OT5A 5L8KA 3AT2A 5AP7A 2HZNA 1G8JA 4E20A 5BMSA 3CCNA 2X7GA 4EBVA 3LMHA 2X2MA 5DE2A 4GRBA 1YVJA 2Y7JA 3R02A 1PXPA 5DWRA 1YQJA 5FLFA 5HO8A 3CY3A 3N4VA 2R7IA 5CVGA 4BCQA 1GNGA 1YWRA 3LFSA 2FSLX 4AZVA 4FNXA 4AQKA 2X9FA 3B8RA 4D4VA 4CFMA 4GKIA 3SHEA 3KXXA 3AG9A 4X3FA 5HI2A 4ANQA 4AXFA 3FLWA 4FV6A 3IOPA 2VV9A 3MVLA 4M97A 2BIKB 3JS2A 4RJ5A 4UYAA 3VS2A 3QL8A 3ZTXA 3Q6UA 4BVUA 3FJQE 3COHA 1H28A 1YHVA 2GHGA 4XMOA 3GCSA 2BKZA 3GU5A 2VTLA 2XS0A 5H8EA 2PZYA 4YJQA 4O7NA 4AGWA 3R0TA 4TNDA 2C6KA 5EM7A 4MXZA 4QMPA 4EUUA 2IZTA 2VRXA 1ZYLA 2ZB0A 2ITUA 2W1EA 2ITZA 3FC1X 3FY2A 3LFAA 1H26A 4FTNA 5KZIA 4BN1A 4D2RA 4A06A 5EQEA 1DM2A 5ANDA 2I1MA 3D7ZA 5D10A 5EW9A 3TTJA 4HNIA 3W0QA 2GNFA 4RSSA 5DT4A 4FA2A 3QD3A 4HVIA 2PE0A 2HENA 2C30A 4FZFB 3S4QA 3T8OA 5LMKA 4BGGA 4YBJA 1RQQA 5CU3A 4LOOA 4R8QA 1ZZLA 3OWKA 4AW1A 2ZDTA 3EN6A 5IH5A 4XRLA 2CMWA 3UOHA 4DT9A 4HVDA 3AMYA 3PVUA 1W7HA 2BDWA 2UV2A 2UZTA 4ID7A 3F2AA 1UU7A 2PUUA 3FQEA 1ZY4A 1WBWA 4GUBA 1VYZA 5IISA 4HVHA 2HELA 4G17A 4EOPA 4BY9E 2PE2A 2W4KA 3QZGA 3CTJA 1CTPE 3Q4TA 2YIRA 4QNYA 2ITVA 2X6EA 5HEZA 1PXNA 2VO6A 3N9XA 4AS0A 3HAMA 5KUPA 3RPYA 4FEQA 2R0UA 2B7AA 4DEHA 3QYWA 2ZV2A 3V8WA 4O7ZA 4PL3A 3ZLXA 3DBQA 3OG7A 4WBBB 5C26A 3ORNA 4GCJA 5DFPA 5CF8A 2W1ZA 3Q4CA 3T9TA 1ZOGA 3KXZA 2QU6A 4AF3A 4F1OA 1U54A 1REKA 5JRSA 3WF9A 3RNYA 4M0YA 2EWAA 3TNWA 2BVAA 2OI4X 3A8WA 3ML1A 3ZC6A 2XK8A 2PHKA 2I40A 3R9DA 4F0IA 2BTSA 4ACHA 5JQ5A 1VZOA 1H1RA 4DH3A 1HCLA 1LUFA 4RVMA 3VHKA 3GU6A 4GYIA 3QRIA 5CNOA 2WOUA 2X9EA 3LFDA 4ZY4A 3IQ7A 2VWZA 4TYEA 4AOJA 2X0GA 3QBNA 4BDBA 2B53A 4DH5A 1JWHA 4EORA 5AP1A 2IZUA 3KULA 3ALOA 4PQNA 4HGLA 3KGAA 3TMOA 4RC4A 2XEYA 3SA0A 5HZNA 2RL5A 2XF0A 1XH9A 4O0WA 4R1YA 5EOBA 1VR2A 4L53A 3ZH8A 2CJMA 2J90A 4J97A 3D94A 4V0GA 2DWBA 3FMJA 1ND4A 1PMNA 4DT8A 3RM7A 3TACA 3SRVB 4HW7A 3BE2A 4FV9A 5JGBA 1OGYA 5ITAA 3DGKA 4JDHA 3D5VA 3UTOA 1XR1A 3ELJA 4EH5A 3IGOA 4YC6A 2JDSA 5CASA 2PMLX 3MJ2A 4GIIA 4HZSA 4IWQA 4AN2A 2F7ZE 4NJ3A 4B9DA 4EOSA 1O9UA 2C6LA 2R3KA 2RG5A 3NUNA 3QRKA 4RIOA 4XEYA 4E6CA 4U80A 4OTGA 4EH3A 1WAKA 3BEGA 3SD0A 5AP6A 4RPVA 1GZNA 3HMMA 5DHJA 4BDAA 4ZLOA 2PYWA 4W8DA 1NVRA 5EHOA 2F7EE 3UYSA 4OBPA 5BNJA 2EXCX 2NRUA 2PVKA 2VX1A 3EQDA 2WMVA 3S2PA 5KMLA 2XRWA 4WBOA 5EHYA 4ZJJA 1PXMA 2OJ9A 2PVMA 3TIZA 3GU8A 3PP1A 3N51A 4O83A 1ZAOA 4MXYA 3RALA 3OCBA 1FGIA 4R1VA 4C0TA 1YI4A 5HBHA 3PZEA 4AP7A 2QODA 1IEPA 3NW6A 1ZOHA 1RE8A 3EYGA 3UO4A 4C2VA 4ALWA 2B54A 4C33A 3ZZWA 3GEQA 5FTOA 1W8CA 4CXAA 2WTDA 2X4ZA 4IVCA 3TG1A 4BKZA 4DEBA 5HBJA 3NUPA 2JITA 2E9VA 5M55A 2YJSA 4FV8A 1GIJA 4YLKA 3UOKA 3FLSA 5FP5A 2HYYA 3VBWA 2O5KA 2WPAA 4BDGA 5IA3A 1OPKA 4N0SA 5IUIA 5GINE 4OT6A 3LLTA 5EI2A 4AZWA 1JBPE 3LFBA 4Z7HA 5DR9A 3FKLA 4TYIA 4IQ6A 1H08A 4NYEA 3JUHA 2VTQA 3KQ7A 3PFQA 2JLDA 4IB5A 3HDNA 4IJPA 4O91A 4EOJA 3SXFA 4OTRA 4E6DA 1GIIA 4QMZA 3QA8A 5EM6A 4AU8A 4E4NA 4F1MA 3PLAE 2HAKA 2VWWA 4P5QA 3KXHA 4L44A 2XBAA 5AAEA 4HPUE 2VTOA 2KULA 3TWJA 3L8VA 1IRKA 2X7FA 1H1PA 3EIDA 3E3PA 1SVEA 4HYHA 4D2TA 3ZM9A 4S30A 1YOLA 2AC3A 4UXQA 2OLCA 3TIYA 4A4OA 2GTMA 5KBRA 5CAVA 2OSCA 4MQ2A 2XP2A 5E8VA 1WFCA 3W2CA 2HW7A 3KXMA 4IANA 4TT7A 1YKRA 2IEWA 1IAJA 2WQBA 3W8QA 1Y8YA 5KMJA 3LQ5A 3LMGA 3OWLA 1NXKA 4YSJA 3R22A 4NFMA 1YWNA 3MB7A 3C13A 4FKPA 4FG7A 1WBNA 2JD5A 4RA5A 5A46A 3RPSA 5C1QB 4KWPA 5HIEA 2E9NA 2C3KA 5KMIA 4DA5A 3II5A 3RPVA 1JOWB 4EK4A 2QO7A 3QQFA 3ACKA 2FUMA 2WTJA 4IIRA 4NM7A 2Y4IB 2XK9A 2XYNA 3A7IA 4FTJA 5FTQA 5F9EA 5BVEA 3AC1A 4ZS4A 1PW2A 3AGMA 3EQBA 2AEGA 4KIKA 4JS8A 3U54A 2VO0A 2WU6A 3ZS5A 2YAAA 4Z7GA 4RJ8A 4AAAA 2C5XA 5AIRA 4PNKA 4KKEA 1VYWA 3W10A 4WD5A 4WG5A 5IQAA 3FLYA 2X2LA 3PE1A 3MPAA 3L8SA 5GHVA 4FL3A 3F5UA 2QKRA 1B39A 5IEVA 4NTTA 3COMA 1Q61A 3LFEA 2IF8A 3MN3A 3OW3A 3F7ZA 4M13A 4TTHB 2DYLA 4MEDA 4Y5QA 5DG5A 5IEXA 4O0UA 3GFWA 1P4OA 3QFVA 4QPAA 4O7SA 2GU8A 5IZFA 4UBAA 3BQRA 4FKVA 4TN6A 3ENHA 5JGDA 4ZJIA 2BMCA 2OH0E 3QZHA 5C8KA 5HLWA 3KRRA 3DBDA 4YNOA 3H4JA 3ORMA 5AP3A 1KOAA 3ANRA 3RZBA 1JKLA 5E8TA 4K2RA 4PPBA 3JPVA 4L6QA 4C4IA 3MBLA 5L2IA 2IO6A 3FE3A 3FY0A 5AX9A 4XHKB 2YN8A 3ORTA 3DNEA 2C5NA 3SQQA 4EH8A 4EQUA 4S31A 3CD3A 3P78A 1ZMUA 1Q3DA 3A2CA 5FP6A 3TZ9A 4MF0A 2J51A 2G2FA 5C8MA 5CX9A 1BL7A 4R77A 4U79A 1XBBA 2YM4A 3BYUA 4GS6A 2P2HA 5DVRA 3PY0A 3G15A 4II5A 3TN8A 3F3VA 1JLUE 5AA8A 2P3GX 3ETAA 5EFQA 1NW1A 4FTQA 1OUYA 3WILA 2OKRA 3ENMA 3O8UA 2RFEA 3E87A 5HE3A 5I4NA 4L52A 2C6TA 2PU8A 2HXLA 3Q6WA 4C37A 3UNZA 3FI4A 4L7SA 4DG0E 4E8AA 2Y6OA 3RWQA 5FWKK 2C3JA 1JQHA 4Y85A 4ACGA 3C4ZA 2VWYA 3NSZA 3PA3A 3KKVA 4GU6A 4ORKA 1JAMA 4NJDA 3W2PA 5EYDA 1WBTA 2WMXA 4PPAA 3BWFA 1XH8A 4ANOA 3QAME 3Q9WA 3ZOSA 4P4CA 2ONLC 5GJGA 3DDPA 4XOYA 4DEDA 4Q5EA 3N4TA 1J91A 3EQFA 1BYGA 4J99A 4NW5A 2HWOA 3FPQA 4ZLZA 2VWIA 4BDHA 3BU6A 1Q8WA 3V5WA 1KE5A 1OIRA 5LCJA 4NU1A 5EYCA 2JDRA 1YXUA 1GY3A 1YOMA 4K1BA 5BX0A 4QYYA 4AW0A 3A60A 3UVRA 1KE8A 2BZKB 4E26A 3PJ2A 2UZOA 4F0GA 4CYJA 1M52A 3O7LB 2OJIA 4FKUA 3O8PA 5G1XA 2BZHB 4XP2A 1L3RE 3R1NA 4DGNA 2X1NA 2ZB1A 4E5AX 1PKGA 4NWMA 4V05A 3OF0A 1R0EA 4DF3A 5E1SA 4BDJA 4EH6A 4YJTA 4YJPA 2R5TA 4FVQA 2R3IA 3GC0A 4BCKA 3MA3A 5EH0A 4JJRA 3IDBA 5FRIA 4PWNA 2B9IA 1OI9A 1Y91A 3OCSA 3V01A 5J79A 2HCKA 5ETIA 5CSXA 5AIKA 5FXRA 3GGFA 3EHAA 3ZFMA 4FR4A 2YERA 4HYUA 4X3FB 4TWNA 1PJKA 4C4FA 2OZAA 3S0OA 4F70A 4O84A 4K6ZA 3E62A 2E9PA 4NM0A 5E8UA 2YHVA 4X2JA 4G9CA 2A19B 2FSMX 3COIA 4TWCA 4EL9A 1JKSA 2CN8A 2BUJA 4FV0A 4MCVA 1ZYDA 3ET7A 3CSVA 3PE2A 3UIXA 3EN7A 5A6OA 4G3CA 1VEBA 5HTCA 4OAUC 4RVTA 4R78A 2XA4A 4WSQA 1V0PA 3P7CA 3TI1A 3VQUA 3OBJA 4F78A 3PVBA 1Q8YA 1LR4A 2PUIA 2YIWA 4TL0A 2YCFA 1P14A 1GAGA 1QL6A 4ITJA 4QP6A 4K9YA 2ZM1A 3ZO1A 5IQCA 5HD7A 1PXJA 4CFWA 5CEQA 3BIZA 3BL9A 3C1XA 4FNYA 4O4DA 4YJSA 5JRQA 3RJCA 4KBAA 2J2IB 4LUDA 1E1VA 4EC8A 2P55A 3KA0A 3KFAA 2PSQA 2YIYA 4XV1A 2Z7LA 4CQGA 4GUEA 4DH7A 3TUBA 5FD2A 3LCDA 3DQWA 4GU9A 2NP8A 4GT4A 4FRFA 4OTQA 5BMMA 3RTPA 5CF6A 4OUCA 2C69A 3BE9A 3CIKA 4QMSA 5LARA 5H8BA 3Q5ZA 4TY1A 4F0FA 3EN4A 4FIHA 1WVWA 4O96A 2QI8A 5M06A 2UVYA 3LJ1A 5K4IA 3A4OX 4NCTA 4C3FA 2XJ1A 3QHWA 4L01A 4BKJA 2BILB 2AC5A 4A4LA 1PY5A 3AKKA 3H0ZA 4ZMEA 3EQPA 3D15A 4QYGA 5F4NA 4I6HA 4OLIA 3UQCA 4RT7A 3SGCA 3I6WA 3U51A 4I24A 2ZDUA 3DFCB 2ZYBA 3IW6A 3M1SA 4FT9A 4WA9A 5ANIA 4CTCA 5L4QA 4F6WA 3EWHA 2CKPA 4LV7A 3P86A 4YZNA 4MKCA 2J9MA 4KSPA 4WNMA 5IU2A 5C01A 4F63A 1U54B 5IQIA 3U4WA 3QX2A 2R3GA 4J1RA 1M2RA 4E4LA 5IH6A 5ANOA 4O7TA 4PP7A 2OFVA 3NR9A 3ORZA 1H8FA 4IZ7A 3LM0A 4D4RA 4IDTA 3ODYX 5HVKA 2SRCA 2UZBA 3RVGA 4Z16A 2WB8A 3TV4A 1ZY5A 5KMNA 3RPOA 3BGPA 3RWPA 3C51A 5IDPA 2QOFA 1NA7A 3KRJA 3KULB 3L1SA 3H10A 3Q52A 4KBKA 5C8NA 4FTIA 3VUKA 4FTAA 3QGWA 4DE4A 4FOCA 3RP9A 3PDTA 3T9IA 4E7WA 5DMZA 5HVJA 4NM3A 4V0GB 4PV0A 4JT3A 3G6HA 4AOIA 3IDPA 2X39A 2XJ2A 5K5NA 3DCVA 3FZOA 2XCKA 3OOGA 2PVYA 3KEXA 3RPRA 1H25A 1Y8GA 2J0MB 2CKQA 3I81A 1QPJA 4H1JA 4QP9A 4ZJVA 2ITQA 4IM3A 2XK6A 3V8SA 4IE9A 5TKDA 1P5EA 4ZTHA 4ZXTA 3NUUA 5CAPA 2JDVA 4AA4A 3D14A 4YTIA 2X81A 1FVVA 3MY5A 3POZA 2YDIA 4CMUA 4KBCA 1XO2B 3F61A 4E6QA 5HU9A 1A48A 2O63A 4LM5A 3QC4A 2X8EA 5DLSA 5FDXA 4EK5A 4LYNA 3L9PA 3F6XA 4ALVA 4RX9A 4QTCA 2IN6A 3JXWA 4MX9A 3UG2A 2HW6A 5EYKA 3BHYA 4YUQA 2R3RA 3OD6X 4JNWA 5AX3A 3V5TA 4R3RA 4BF2A 3PJCA 4TYHA 2GFSA 4I4EA 2ACXA 4E5BA 3U55A 2Z7RA 4BJJA 4RFYA 4BGQA 2BHEA 2JFMA 4JAIA 4FZ7A 4C2WA 5ETCA 1NVSA 1OUKA 2QG7A 3DOGA 5CSVA 4ZSEA 4X6RA 3V6SA 1T45A 5HE2A 4JMQA 2CDZA 2R9SA 3MVMA 5ANKA 1CM8A 2Z7QA 3F69A 2WMSA 3A8XA 4RJ4A 4GG7A 1G3NA 3CY2A 4RLLA 5JGAA 4O86A 4ANNA 3AMAA 1FMOE 2WHBA 3LXNA 4MNEB 2LAVA 4WNOA 3ZMMA 5KCVA 1TQIA 5HCZA 3D2IA 4AW5A 4MNFA 3QKLA 2W9FB 3FC2A 1OVEA 3UP2A 3O8TA 4DYMA 4BTKA 1OKZA 4USDA 5L2TA 3BLAA 1SZMA 3NCGA 2PE1A 3D5WA 3E8DA 4XNEA 1YHWA 3QTUA 4FIGA 4JRVA 4DFLA 2ETKA 4XG8A 5HD4A 4TWOA 5CALA 5CSWA 3TZ8A 4RC3A 3CQWA 3UNJA 4APPA 4GVJA 5DR2A 2VX3A 5CNNA 3P1AA 5E92A 3MVHA 3E93A 4DEGA 5A4QA 1R3CA 4FODA 2YZLA 3ZFYA 4CEGA 3OW4A 4YURA 1XH4A 4FI1A 2IW8A 4H39A 4QPMA 3DXNA 3R71A 4LGDA 5FTGA 4BR3A 1J1BA 2XKCA 4R5YA 3QWJA 4EH7A 4C36A 4QEBA 4EHVA 3F7WA 3KL8A 3ULIA 4C35A 2QO9A 4RVLA 4F9YA 5I9XA 3LFNA 3VRYA 4B0GA 2ERZE 4G5JA 4EOQA 4EK3A 3TV7A 4BDKA 4C7TA 4AT3A 2XYUA 3ZRMA 1XJDA 3H9RA 2YCRA 3VNTA 4C61A 1LPUA 4YO6A 4AOTA 3DTCA 3GUBA 4R7IA 3G33A 1IASA 3R04A 4L00A 1H24A 4DEAA 4R3PA 3AC5A 3SOCA 5E4HA 2F2CB 4X6QC 5A54A 1W0XC 2GDOA 4JX7A 2CLQA 1XKKA 3HX4A 4ALUA 5GZ8A 4E4XA 4G9RA 4W4WA 4CMTA 5D7AA 3VBYA 3NW7A 5E91A 3QXPA 1Q62A 4HNFA 5EM8A 1U5RA 3CTQA 4ZY6A 3SXRA 3G0EA 2O8YA 3UNKA 1I44A 2W1DA 3ORLA 3R9RA 4KIKB 3VONA 4PTGA 2A98A 3R8UA 1I09A 3U4UA 3QUPA 3F2RA 4RWLA 3H3CA 4GW8A 1YDRE 4M15A 3O50A 3WF6A 5L6PA 1MQBA 1R78A 1HOWA 2P2IA 2RSVA 3FXXA 1LP4A 4G16A 4KA3A 5EDQA 2ZJWA 5HHWA 3KCFA 3BLHA 3Q2MA 5LWMA 5IF1A 2NPQA 1FPUA 2WZJA 1W2FA 2V7OA 2Z2WA 4TXCA 3PJ3A 2YM5A 4JDJA 3R8ZA 3VBTA 3G51A 3ZUVA 3A7JA 2W9ZB 3E7VA 4FGRA 3HAVA 4K11A 3EB0A 1URWA 2FO0A 3KXNA 4YR8A 4ASEA 2QD9A 1JPAA 1TKIA 4QNAA 4C59A 2HWPA 2QU5A 3PXZA 5AV1A 5A4TA 3FZSA 2A4LA 1PYXA 3CBLA 4D1XA 2NNWB 4DHZA 3HV5A 4FV2A 1WCCA 1JNKA 3QLFA 2JIIA 4O4FA 3BEAA 4AFJA 1U4DA 3LW0A 4ANLA 2WMQA 1H0VA 4DGGA 4BTJA 5HG7A 4GG5A 4J98A 5A14A 2OH4A 3CR0A 4AFEA 3UPZA 3TDVA 4WKQA 4QP2A 3SV0A 4CFNA 2WXVA 5AR2A 2UW8A 4IB0A 3QX4A 5AUVA 3PWYA 2F9GA 2WEVA 2W1CA 5F1ZA 3OOMA 2GSFA 3FL5A 4JG8A 3R8PA 4AWIA 3WOWA 3OT8A 4M69A 4XV2A 4YNEA 4BCNA 2C6IA 2CGXA 5LCKA 3KF7A 3KVWA 4QTBA 5KBQA 4O7RA 3UZTA 4GKHA 1H1WA 1M7QA 4PX6A 3D4QA 4FV1A 5EW3A 5EYMA 4CZUA 2QOOA 3QQGA 4CLIA 4TZRA 4UZDA 3EL7A 5KMOA 4MAOA 3SXSA 4AE6A 4CSVA 1PKDA 1PXOA 4RWIA 3AKJA 4FEUA 5B7VA 2W05A 5HGIA 5F20A 4LUEA 4RIYA 5C03A 2H9VA 2BZJA 2XNGA 4EEVA 3WZJA 4FEWA 3UDSA 1ZMVA 4GK4A 4CFFA 3VC4A 1UU9A 4Y72A 4QP7A 5LOHA 2ITYA 1NT2A 3EKKA 3QD4A 2OGVA 3CC6A 3OUKA 4DBNA 5AUZA 4FSWA 3R21A 4D4SA 2W4JA 4UZHA 4M14A 4QQCA 3HGKA 5I9YA 3TZ7A 2W06A 4FV7A 1QPEA 4XLVA 4ITHA 4QMUA 4YTHA 3O0GA 3HA6A 4O0VA 4BC6A 4DGMA 4ZTMA 2WIPA 3QQJA 3EQIA 5EQYA 2BALA 3ZO3A 1Q41A 4M84A 3ZUTA 2XALA 4MBIA 1A06A 3VUIA 2XK4A 1Q4LA 3EQRA 4PP9A 2OIBA 2PTKA 4QMMA 3W0SA 5CF5A 4RX8A 3F3TA 5HO7A 3QD0A 4FE2A 4FVRA 1YDSE 3OT3A 2XAMA 2OO8X 3MW1A 4TRLA 1Q97A 3R01A 3QCQA 4CMOA 3THBA 2CSNA 4DDGA 2QOHA 1FOTA 2EXMA 1KE7A 4JOAA 4KRCA 4F9WA 2WNTA 4QYFA 3E92A 4MBLA 5HIBA 3RHXA 4MD8E 1WBPA 2A2AA 3R83A 3PA4A 3NAYA 3W0PA 5C4LA 5KNJA 4FK6A 4AGDA 5FEQA 5LVMA 2CKEA 4OR5A 4RJ6A 4B8LA 5I3OA 5CANA 2W4OA 3RI1A 2OF2A 1H00A 4U43A 1ZXEA 1OL1A 2OZAB 2XIYA 4PMTA 5FG8A 5HG5A 2UZNA 4GK2A 5BVFA 3HLLA 2GQRA 2J7TA 4AGCA 4I0TA 4XCUA 3CS9A 4RZWA 1MP8A 4FT0A 2QOKA 4J7BA 5DBXA 4ZTNA 4IX4A 3QD2B 1WZYA 5AUTA 3KREA 2R0IA 2ZM3A 4YHTA 1JSUA 3W0MA 5DRDA 3V3VA 3ID6C 5DOSA 4F99A 4YO4A 3ZRLA 5CWZA 3PY1A 2PMOX 5IA5A 1OM1A 3V04A 1OIYA 3AC4A 4HGTA 2Y4PA 1Q3WA 5JN2A 3LE6A 1UVRA 2PVNA 3I1AA 5EQPA 3FMEA 3VW6A 4BZDA 4I94A 3C5UA 3O51A 4H3BA 2GCDA 3AC2A 5CQUA 3HV6A 5EI8A 2BIYA 1ZARA 1BI7A 2WIHA 2WO6A 3ZC5A 2XJ0A 4ASZA 3W2SA 4HPTE 4UMPA 3MH0A 3AC3A 2PMNX 4YJRA 2B4SB 5CAQA 3OXTA 4LOQA 2OF4A 3NUSA 1UV5A 3R1QA 4WHZA 1FINA 3ROYA 4C34A 4ERWA 4ZLYA 4JBOA 2PY3A 4FSUA 2ONLA 4BCFA 5DI1A 1KSWA 4U3ZA 4M12A 4YMJA 2CGVA 2ZV7A 4FZDB 4YJVA 3NUAA 4L68A 4U6RA 4IMYA 1W83A 3U8WA 4U41A 4DBXA 3LFCA 4MNEA 1PF8A 3PPKA 4FNWA 4DN5A 2XNMA 3FMLA 3MY0A 4PMSA 3V8TA 4GFOA 2QC6A 4G2FA 3FZ1A 3ODZX 2Z02A 1RW8A 4FX3A 4I92A 3NMUF 5GIOE 1OL2A 1OKYA 5FEDA 4AN9A 5KX8A 2R3LA 3OEZA 4PTCA 1BLXA 3C0IA 2WTWA 4I41A 5FQDC 4ZZNA 3OVVA 3V6RA 3PXYA 3A61A 2B55A 1W2CA 2W96B 4IX6A 5ETFA 5M57A 3VS6A 3UOJA 4JDIA 5AV0A 3R8LA 4DLIA 4RX7A 3KVXA 5BQ0A 5AWMA 1BUHA 3K2LA 3DLSA 4EOKA 4FMQA 3QCSA 4MVFA 4F65A 4QMVA 1J7UA 2UW9A 2FYSA 3EYHA 3MS9A 3UPXA 4QYEA 4CYIA 5CEPA 1OIQA 1W98A 4KAOA 4NSTA 4C3RA 4DFXE 3PRFA 3DJ7A 4LG4A 4EBWA 1OL6A 2WTKC 5AV4A 3SVVA 4IHPA 5M08A 4MXCA 2G01A 1FVTA 1OL5A 4PF4A 3G0FA 5AP2A 2CLXA 2EVAA 4DHJA 2QONA 3FL4A 2ITNA 1YXXA 3GT8A 5M56A 3W1FA 4O0SA 4BDIA 1QCFA 5ICPA 4RC2A 3R30A 3QALE 4XRJA 4IJ9A 5IQEA 3C7QA 3HECA 2LGCA 4FBXA 5CT0A 3WF8A 1TFFA 1W2DA 4CRSA 4S34A 2QHNA 3BGQA 3UMWA 3VS4A 2V62A 3PFYA 3PWDA 2HK5A 1O6YA <