5JFSA

Crystal structure of trka in complex with pf-00593174
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
305
structure length
277
Chain Sequence
MHHHHHHLVPRGSVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords High affinity nerve growth factor receptor
publication title The Discovery of a Potent, Selective, and Peripherally Restricted Pan-Trk Inhibitor (PF-06273340) for the Treatment of Pain.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 277
sequence length 305
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5jfsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5jfsA01
5AJQA 3DAEA 4RVMA 3U6JA 5AUZA 4O84A 2BRHA 4XH6A 3P4KA 5CEOA 4JXFA 4IVAA 3QD2B 3ZZWA 4MBJA 4L7FA 4YSJA 2QCSA 4X3JA 4FICA 5DFPA 2P0CA 4G6OA 1IEPA 4OTIA 1I09A 1OKYA 5IH5A 4O22A 4RIYA 4ZZNA 4ANLA 3ZDIA 2HZIA 3LXLA 3DY7A 4C2VA 5IQAA 5JZJA 3PRIA 2ITZA 4QP6A 3VRZA 4DHFA 2PZPA 4FTAA 2YISA 5IQBA 1XBBA 1H1WA 1SVGA 3D7TA 4FNWA 1R1WA 5I9ZA 3ZUTA 3DAKA 3JXWA 3HMMA 4E93A 3FMLA 4KABA 5B2MA 1M2RA 4FNXA 4O83A 4KIOA 2Y4IC 5ANJA 3ATSA 4DT8A 4L7SA 2R64A 4NKSA 4CYIA 4OTFA 2YA9A 1BUHA 4HGSA 4IDVA 5C8KA 2H96A 4E7WA 2WMTA 3CIKA 5DMZA 2BRBA 2BMCA 4E5WA 4IDTA 4CGAA 4D2VA 3P1AA 2CPKE 3IW8A 3LJ2A 3KMWA 5AA8A 2Y9QA 2PU8A 5DVRA 5J79A 4L67A 2ZB1A 4RIWB 1YWVA 1Q61A 3SXRA 2X6DA 1DAYA 3BELA 4DLJA 2XMYA 4YTIA 3NAYA 5EG3A 3ZEPA 1DM2A 2H6DA 3KKVA 3RBWA 4BDAA 3T8OA 3GFEA 3NEWA 4IMYA 1YXXA 4LV5A 3S2PA 3SXFA 1NXKA 2ZMCA 4EHZA 2PHKA 4EK4A 4QTBA 5L2SA 3DLZA 5KO1A 4A07A 4PDOA 4HGTA 3FMHA 3EN7A 4B8LA 4FIEA 1OL1A 3EN5A 3ZLXA 3CJGA 4I0TA 4DCAA 2RFSA 3AC3A 3FMEA 3QALE 2JAMA 4BDCA 4RLKA 4D0XA 3Q9ZA 2IG7A 1HCKA 3TIYA 5IQEA 2DQ7X 4U42A 4EQUA 4HZRA 2W1GA 2VZ6A 4RRVA 1K9AA 1W84A 4U6RA 1UU9A 2YDJA 3DDQA 3ENMA 5AADA 5CVFA 3KRLA 5CS6A 1Q3WA 3EN9A 3KB7A 2E9NA 4GIIA 1UU7A 4XV1A 3TI1A 4PV0A 4ZJVA 2C6IA 3GCSA 1H1SA 3DPKA 3TEIA 3FMMA 2GS7A 4MX9A 4S30A 5GJGA 2ZM3A 4J8NA 2PZ5A 4M97A 4TNDA 3NUAA 3Q5ZA 1QPJA 3S0OA 3PE1A 2JFLA 3LLTA 4UXLA 3UGCA 2SRCA 3ORZA 4MBLA 4M0YA 4A7CA 4D0WA 2VWUA 3V51A 3W8QA 1XKKA 2JDVA 4NFMA 3E87A 4LOPA 4QMWA 4X3FA 5DEWA 3NCZA 2X81A 2XJ1A 4EOQA 2BFYA 3KK8A 2C1AA 4MTAA 4BIEA 4CLJA 3MY0A 2ZDUA 2BCJA 3NUYA 1BL6A 3IK3A 3CBLA 4JDIA 1YDSE 3HAMA 3TZ8A 3VVHA 1PXLA 4ITHA 3U51A 2QLQA 4YTHA 3P9JA 4OT5A 4QQ5A 1FMKA 2ONLA 3GU8A 4IX3A 4GK3A 3FKLA 1M52A 4JRVA 4R7HA 5D10A 5D7AA 3KRRA 4ZY6A 4I5PA 4DH3A 2WGJA 4MXOA 4RA5A 3ZO3A 4L52A 3UOLA 4AGCA 3TUDA 2YIWA 4AX8A 5KCVA 2FGIA 4C4HA 1OPJA 4JQEA 2R5TA 5KUPA 2XVDA 1REJA 4FBXA 1LEWA 3NGAA 2R3LA 2VTPA 3AD6A 1MRUA 4XG4A 4L46A 5BNJA 3PA4A 3O50A 4O7LA 5EOBA 4QPSA 3FQSA 3VQHA 1Y8YA 3LCOA 2XRWA 4FKSA 4FX3A 3GC0A 4U79A 2AYPA 2J0IA 3D5WA 3PJ3A 4ZTHA 5I9XA 4RQKA 3ZM9A 4JG8A 4AN3A 2WMXA 3F9NA 4PPAA 3U4WA 3OVVA 3PSDA 5JFVA 3ETAA 2WTWA 5IH4A 2PE2A 4J98A 3F3VA 1W82A 3UVPA 4DEBA 4RJ8A 3FZRA 2UVYA 3MJ1A 2PMIA 4FK6A 2XIXA 4AN9A 3BYMA 4OT6A 4QP1A 3ZRKA 1PJKA 4MWHA 5CSWA 1Q5KA 1UU3A 5HU3A 2F2UA 1G3NA 3PIZA 3ZLWA 3FXZA 5IH6A 3TUBA 2X0GA 4QP9A 5FD2A 3LFQA 3R71A 1PF8A 3VS3A 3ZFYA 5HVKA 4FT5A 5DG5A 3MFRA 4Y8DA 1QMZA 2WMRA 5K4JA 4FZAB 1YDTE 4IVBA 1JPAA 4MNEB 4BBFA 4BI2A 3MVMA 4CQGA 4WO5A 2WHBA 3PP0A 5KMJA 2GSFA 4CFWA 3B8RA 4A9TA 4QYEA 4WG3A 5HNGA 4AOIA 1H1RA 4F08A 3KL8A 4TYHB 4UWBA 4O38A 4YTCA 1G8AA 2B53A 4PTEA 4WUNA 2OI4X 3CJFA 3CP9A 3NNUA 3PJ1A 2VWXA 3O2MA 4WIHA 1OUKA 1ZMVA 2VGOA 3M2WA 3O96A 5L6PA 2EUFB 4O0UA 5E8XA 5HI2A 4ANNA 3DJ6A 2JC6A 4BDBA 1H0VA 3C50A 5J1VA 2WEVA 4BRXA 2JIUA 3FE3A 3DU8A 4G16A 2WTDA 4HCTA 3VAPA 4E3CA 4K0YA 2UW3A 3KRXA 3D94A 3Q96A 4E1ZA 3EB0A 5A54A 4H1JA 4NJ3A 1U46A 3OTVA 2XM8A 4O0WA 4O0TA 1H26A 4ASDA 5ANKA 5LWNA 4IIRA 3DK7A 5CSHA 1XBCA 5JZNA 3HP2A 4I5HA 3H4JA 3TUCA 4ITJA 4FV1A 4MXCA 5AM6A 3QU0A 4O0XA 5GJFA 1PXMA 2C5VA 4J1RA 4BWPA 1U59A 3I7BA 2OG8A 5AP2A 1YDRE 4NK9A 4C59A 4KIQA 3D7ZA 2C5OA 2G9XA 3DXNA 3NWWA 3Q9YA 4PDPA 1IASA 2P2IA 5HBEA 4E4LA 3TNQB 2YCSA 4OTWA 1PMEA 3RGFA 3Q3BA 2X8IA 4KBKA 4S34A 2YDIA 2FSLX 3UO6A 4AZWA 4AZTA 5EI8A 4FT3A 4O7ZA 3CCNA 4RJ3A 3R8MA 4F9WA 2CLQA 3A7GA 3NUXA 2PZRA 5HCYA 2IW9A 4E5BA 2PTKA 4O7NA 1P14A 5JGAA 3FQEA 2OFUA 5IA5A 3RPSA 3C0GA 1WBSA 2EXEA 3F3TA 2JBPA 2VTOA 3HV5A 5ANEA 4PPCA 4F4PA 2FYSA 2BHHA 4EH3A 4DG3E 2C0IA 2J0MB 2WZJA 4OBQA 5EYCA 3WIGA 4IW0A 4HVIA 3FMJA 4QYYA 4ZK5A 1XR1A 2W9ZB 4YZNA 4O0SA 3VBYA 4D4SA 4CMTA 5HZNA 2Q0BA 1AGWA 1OPKA 2BUJA 3EQRA 4KIKA 1P4OA 3R7GA 4LRJA 4C4JA 2BZKB 4CFUA 3L8PA 5GJDA 3UP7A 4Q2AA 5D11A 4BWXA 4GG7A 4ZEGA 4XP0A 2W4JA 4WNKA 3NW6A 2J0LA 5C26A 2WMSA 3TZ7A 5J1WA 3HRFA 3K2LA 4OBOA 1XJDA 4EK5A 3ZRMA 3EYGA 3H0YA 2ITVA 2IZUA 3ORMA 5KMOA 3SG9A 4AGWA 4FSQA 3IG7A 2QOQA 4HCVA 5J95A 2XKEA 3HV4A 2YAKA 2BILB 3QTWA 3NIEA 3FLQA 4QQCA 2IPXA 3TZMA 2QO9A 3PXFA 3POOA 4FV5A 4YJSA 1DAWA 4JLCA 2GCDA 5A9UA 5CASA 2J7TA 2XKFA 3FC1X 3TJCA 4YGAA 4XEYA 2YIRA 4I21A 4X2FA 5M44A 3UC3A 3CQEA 1E9HA 5LVMA 4AOTA 4G3CA 3UOJA 3EZRA 4FT7A 2A19B 4IB0A 5C27A 5JRSA 2BIYA 4HPTE 1W7HA 3UTOA 3ZOSA 3QTSA 5AUTA 3FL4A 4FZDB 5CAQA 5IUHA 3L9PA 1VJYA 2HYYA 3UODA 2F2CB 4HYHA 2XRUA 3KXXA 4QP2A 5JT2A 4FKPA 3IW6A 4GT4A 4BBMA 3QYWA 2WTCA 4L53A 3PPKA 4OLIA 4Y73A 4IWOA 4U9AA 5EHLA 2WMWA 1VYWA 3EIDA 3C0IA 2J0KA 4X2NA 4E4XA 5AFVA 5DWRA 3MVJA 4IB5A 4N0SA 3BE2A 3G90X 3BGZA 2OKRA 4ZSJA 4DGMA 4RBLA 4CCUA 3C13A 3AXWA 5DT3A 4MXAA 3TXOA 3P23A 1H24A 5IUIA 4JBPA 2WAJA 3BEGA 5AP1A 3RHKA 3VO3A 3PUPA 2C0TA 3ORIA 1OIYA 3P86A 1YXUA 5HNIX 1OIRA 3CD3A 4EUTA 3UBDA 5EQYA 3QTXA 2AC3A 4DFLA 3TIZA 4FA2A 2I7QA 5CNOA 1ZY5A 4FKTA 3ZLSA 5LMKC 3PY3A 4U7ZA 4AGDA 4W4VA 3FMKA 4PTCA 2Q83A 5ETAA 3AT2A 3R7UA 1OUYA 2YDKA 4BGQA 3HMOA 5LCKA 1ZARA 2NRYA 4IWDA 3WE8A 3FI4A 4TZRA 3WYYA 2Z7SA 5H8BA 3KCFA 4RX5A 4IAIA 3OC1A 3QFVA 5HE3A 5CF5A 1J7IA 2PVYA 3DCVA 3BRBA 3R9DA 3BLHA 2IZTA 3KGAA 4X3FC 2W4OA 1YWNA 3FMNA 2XKCA 1Y57A 4D2WA 3JS2A 3DXQA 4YJVA 1QPEA 2WTIA 2VO0A 4EKKA 4MAOA 2OXYA 3MV5A 5E8VA 5IKWA 5JGBA 4EONA 2E9UA 3AC5A 2JKOA 3SOCA 1GAGA 4IAYA 4CZUA 4U40A 3MIAA 1H07A 4FTUA 2PUUA 3ZO4A 4FZ7A 5BVEA 5HCXA 4FG7A 4D58A 3PRFA 3LLAA 3DKOA 4FTJA 4NUSA 3HZTA 4D1SA 5C4KA 3RAKA 2RKUA 3ZSIA 3Q04A 4LYNA 4LL5A 4FEWA 2J9MA 3AT4A 4O7VA 2W1ZA 5AP7A 3GFWA 4AAAA 2IZRA 4ZLYA 4X2JA 2XIZA 3GENA 4QMPA 3ZEWA 2W1DA 3E93A 1OZ1A 3MVHA 1X8BA 5GNKA 5HKMA 4C7TA 1H27A 5CF6A 2OK1A 1JKKA 3MH1A 5C9CA 5EK7A 1Q8UA 2QOLA 4FEUA 2HXQA 2O63A 3HEGA 3ZRLA 1JBPE 2XJ0A 5HX6A 4DFBA 5HEZA 4BKYA 3NLBA 1DS5A 2BTSA 1PRYA 3EQPA 1K3AA 4ACMA 4BN1A 3ID6C 4ZMFA 5BVKA 3D7TB 2PUNA 1YI3A 1KOBA 4JBOA 3FY0A 2JIIA 2JFMA 1W0XC 3FQHA 3GQLA 4E4NA 5TE0A 3V6SA 4RMZA 3WZDA 3MH0A 3NNWA 5CNNA 5FQDC 4EK3A 1R0EA 3BYVA 2YM6A 5E8ZA 1H1QA 3FLSA 4ZS0A 4FTCA 3R8PA 2BDJA 3CY3A 4AA5A 4UN0C 3TG1A 3R22A 3BHVA 2PK9A 4R5YA 2X1NA 3BYOA 2NRUA 5J87A 2ZMDA 4KSQA 4DG0E 4OW8A 5IA4A 2B9HA 2XM9A 4GK4A 4RQVA 3V04A 4Z7HA 4J8MA 3WE4A 2R9SA 5KX8A 2P4IA 4DEDA 4PTGA 5ANGA 4AOJA 3N4UA 5HTBA 3MY5A 2C1BA 2C6MA 2WMBA 3D5UA 4RJ6A 5CEKA 5CXZA 4D4VA 3QWJA 4R3CA 3CQUA 1FVRA 2WTJA 2FSMX 3R2BA 5FWKK 2ZYBA 4G3DA 2FVDA 1W8CA 3ODZX 4N4SA 3ZO2A 1V0PA 4FL2A 4JL9A 2ZDTA 1Q8ZA 5KE0A 3WYXA 1ZXEA 5GIPE 1V0OA 4KA3A 4MVFA 5DIAA 3E8NA 3FBVA 3LFCA 3IDCA 2VGPA 5CU4A 3VBVA 2W0JA 4IB1A 5EW8A 2BVAA 4C4FA 5HVYA 5J5SA 3PXZA 5AR3A 5EDQA 4CT1A 4DBXA 4DT9A 2QD9A 4PL4A 5ACKA 1M7QA 3FSFA 4R1YA 3IDPA 5M55A 3REPA 2X9EA 4E26A 3DFCB 3HGKA 4BC6A 4ERWA 5A4QA 4C3PA 5CZIA 4N6YA 4FR4A 3OOMA 4C62A 2I0YA 3PXRA 4LUDA 4W9XA 5ANIA 3MFTA 1YHSA 4DG2E 4EWQA 5AUYA 1QCFA 2UZNA 5FM2A 4QP3A 1ZY4A 4MXYA 4FF8A 2VWZA 5J9LA 3PZEA 3S4QA 5DYJA 4IVCA 4E6CA 3P08A 4XOYA 3RCJA 4RWJA 1R78A 5JMSA 2X8DA 3DOGA 3ERKA 3R0TA 3D5VA 5KMKA 3E8EA 2GHMA 4JIKA 3DJ7A 3QZIA 3VC4A 4BHNA 3PXKA 1XH9A 3VBXA 2XK6A 3W16A 4FOCA 2ZV7A 5AWMA 3R9HA 4Y85A 3FPMA 1G8SA 4H3BA 3KF4A 4IJ9A 3V5TA 3SLSA 5IA1A 4V0GA 1T45A 4QO9A 3W2OA 3VUIA 4GV1A 2OSCA 3GEQA 1J91A 4ONAA 2VO3A 3FAAA 5KNJA 4I3ZA 2GHLA 4NT4A 1PHKA 2CSNA 3OXIA 4GFOA 4DH1A 4LMUA 4CXAA 2F7ZE 2Z7RA 1W83A 3CR0A 5GZ9A 4BCFA 4GKIA 5HCZA 3LIJA 5BPYA 3RZFA 3F7WA 4M68A 4RIXA 5CXHA 2I0VA 5LVLA 4FC0A 3F7ZA 2ZJWA 5HLNA 3UYTA 4MCVA 3UIBA 2BAJA 2RIOA 2XBAA 4XOZA 3QL8A 2ERKA 4ZOGA 2QOHA 4O0RA 2W17A 3NUNA 4EOLA 3F88A 3MA3A 2VO7A 4C02A 2OLCA 3V6RA 2KTYA 1WBTA 4TXCA 4USFA 2WU7A 3E3PA 4YNOA 4AN2A 5DNRA 5AX3A 5GIOE 2Y8OA 3JVRA 2YZLA 3QUPA 5D1JA 3Q6UA 4F6SA 5HQ0A 3TM0A 2WOUA 4EI4A 4F1OA 4I6BA 2VWYA 5BMSA 4I0RA 5J9YA 2QG7A 3QCXA 2R2PA 4XG7A 5LWMA 2JKMA 2ZM1A 3E7VA 3D4QA 5DEYA 3R9NA 5JEBA 3OWKA 4BKJA 5JRQA 3C5UA 2XK8A 5HD4A 2I0HA 4JIAA 3QXOA 5EM6A 5T3QA 2CN8A 3UIUA 2O64A 3AMAA 1FBNA 1Q8WA 3HMIA 4XG8A 4O21A 4EHVA 3CEKA 5EHOA 1S9IA 4YJOA 4USEA 5J8IA 4JAJA 3COMA 4PQNA 3TKHA 2BR1A 2NNWB 1KV2A 3LMIA 4NL0A 3HKOA 3VIDA 4O7YA 3R6XA 5AV1A 3D15A 3KRWA 3UG1A 4R6VA 3P7CA 4ANMA 3GB2A 1BMKA 4R8QA 4D4YA 1ZYCA 3CSVA 1JOWB 5L2TA 4N70A 3DLSA 4QMSA 3BPRA 1P5EA 1ZYSA 5EYKA 1TQPA 2I40A 4IM0A 3QUEA 3K5VA 1OITA 2PVNA 4E4MA 4DA5A 2FUMA 3LPBA 2RL5A 4CT2A 4IJPA 1NT2A 4CFVA 4ZY4A 3EL8A 4KKGA 4X2GA 5CZHA 3ULZA 5DHJA 1KUTA 3PVWA 2JAVA 3UG2A 4JRNA 2IW6A 5IQDA 4FKGA 4MHAA 3EN4A 5JH6A 4JDJA 4RWIA 3RM6A 3QBNA 2WKMA 2RFNA 4FV6A 3IKAA 2QOCA 3QZFA 3DKCA 3IPHA 4MYGA 1WMKA 4WG5A 4RFMA 4YP8A 5ICPA 2PMNX 5T6KA 1P4FA 1PW2A 3KULA 3HECA 4NWMA 4FKOA 5CU0A 4IH8A 4TW9A 1CKIA 1IRKA 3GBZA 3SX9A 2I0EA 4ZSEA 1R39A 4DTKA 4E6DA 3BHTA 3KC3A 1XQZA 4GCJA 5E1SA 2GDOA 2OIBA 2XEZA 4GVJA 4L43A 3PSBA 2OJFE 4XP3A 3FLNC 4KINA 4FTIA 4RVTA 3ZSGA 3EMGA 3N4VA 4FZFB 5HE2A 2YHVA 3QRUA 3UE4A 4ZS4A 2OZAB 4WT6A 4GYGA 2QHNA 4FV4A 4YUQA 3UQCA 5M07A 2B9IA 4MQ1A 4I41A 2ITYA 2QO2A 3PE2A 4R3RA 4EQMA 2XB7A 2YFXA 2PSQA 5E91A 2ITXA 1Q99A 3IW4A 2VRXA 3VBTA 4I0SA 5JFSA 1BX6A 1YW2A 5EKOA 3W2CA 4FTLA 2R3QA 3HRCA 4A9YA 4FEQA 3QGWA 1PYXA 4NKAA 4BL1A 5EW9A 3CLYA 4C58A 4MD9E 1L8TA 4RLLA 3A61A 4AW1A 3R1YA 4IAAA 4CKRA 4AS0A 2I1MA 4EH6A 3GXLA 2ETRA 4PUZA 5JKGA 4MF1A 4JR7A 2YCQA 3FHIA 3EYHA 5H8EA 1NW1A 4AGUA 2BKKA 5I4NA 1H0WA 3BI6A 3JR1A 1Q3DA 3LMGA 4R77A 4MK0A 5CF4A 3HUCA 4UALA 5AP6A 2WIHA 1XH7A 1WBNA 3MA6A 4GIHA 3UQGA 4TYGA 3TWJA 3I81A 3NSZA 4IWPA 1OECA 2X9FA 2NP8A 2QOIA 3PY1A 3IECA 1CTPE 2ZVAA 4YO6A 5IQHA 3T3UA 5HNBA 3AOXA 4FIHA 3D5XA 4XRJA 3LKMA 5E4HA 3D0EA 1JNKA 4FV0A 2WTKC 2VV9A 2DWBA 2CKQA 3PG3A 3H9OA 5HO7A 3DFAA 3OXZA 4Z16A 2NPQA 1H4LA 2FA2A 4IM3A 4QPAA 3SG8A 4K2RA 2JD5A 1B38A 3R9OA 4ACHA 3AMBA 3ZXZA 4FKVA 4FV9A 4JI9A 1XH4A 1M17A 4TN6A 4XP2A 5FP6A 3HNGA 4FKQA 2O2UA 5FRIA 3ANRA 4E20A 2C6OA 2OXDA 5A3XA 1Q24A 2X6EA 3PYYA 4EOIA 2REIA 3LCTA 4FG8A 3EFJA 4QMNA 2WPAA 4O81A 3KK9A 3Q9XA 5LMKA 3F5GA 1UKIA 4BIBA 4ZTSA 2PYWA 2VAGA 3FKNA 1U5RA 2FO0A 1CM8A 2UW0A 4O6LA 2HY0A 3L8XA 1Q97A 3CTHA 5BMMA 5EYMA 5L8KA 2B0QA 2OF4A 1H08A 3IOPA 1GZOA 2RGPA 3BQRA 3AD4A 3VHEA 4I4FA 3OY1A 4B99A 2UZBA 3AQVA 4F1TA 5AA9A 4EH9A 3BIZA 3P7BA 3NZ0A 3BV3A 3A4OX 5EOLA 3GI3A 1XO2B 4S2ZA 4PMPA 5KMLA 3UP2A 4BDFA 4TPTA 2WFYA 2JBOA 2A2AA 2R3IA 3R04A 4F99A 4MD8E 5JGDA 4CTCA 1B39A 1ZMUA 3HDMA 3OUKA 5LCJA 4QMZA 4RSSA 4D9TA 4RC2A 5HLPA 4PDSA 3UNJA 1FVTA 1JSTA 5GZAA 3G15A 3F2AA 3DK3A 3FXXA 2OIQA 4LQMA 2GTMA 5FBNC 4RVKA 4BTKA 2GNHA 2GQRA 2ITUA 4OAVB 2I6LA 4CKJA 1ZOGA 5BVOA 2RFEA 4ARKA 4EQCA 4F09A 2XEYA 5IZFA 5L6WL 5AR7A 3MB6A 2V22A 1MQ4A 5AUUA 4YMJA 3MVLA 3BZ3A 3NAXA 4HCUA 2JGZA 5CWZA 3VUHA 4CV9A 5FTGA 1CSNA 2ZV8A 4AG8A 1SNUA 4TYEA 4HGEA 3QTUA 4G17A 3WI6A 1JWHA 1KE6A 2GTNA 3QZGA 3KN6A 5HOAA 3I6WA 3P0MA 3UNKA 2UZLA 2IO6A 3QWKA 4JX3A 4DBNA 2UZVA 1UWJA 2OBJA 3MB7A 3BX5A 4EEVA 5AUWA 4BTFA 1AD5A 4KRCA 3WF6A 3OROA 4ZSAA 3L9MA 3PJ8A 3AT3A 3GU5A 3JYAA 4DEEA 3U8WA 4CYJA 2YIXA 4M69A 4ALVA 4NIFB 5GINE 3I0OA 4M66A 4FTMA 5CU3A 3UZPA 3FY2A 3EWHA 2W5HA 1FGIA 3H0ZA 5M51A 4MKCA 4ZTQA 4PRJA 5H2UA 3SQQA 3WF7A 1LUFA 2IVVA 3KU2A 2GQSA 4XBUA 5F95A 5M06A 5AIRA 4CV8A 4FSYA 4RVLA 5FXRA 3AG9A 4XV9A 1H25A 4ZP5A 3VF8A 2YITA 3G0EA 4YZMA 2GNGA 1UNHA 3GOKA 3Q52A 3KY2A 4EH5A 3QCYA 1PXNA 3AD5A 3GVUA 3F5PA 3Q4CA 1GZ8A 4IAZA 4J71A 5KZ0A 3VS0A 2JKKA 3V5WA 4EHEA 2W05A 3A8WA 3OEZA 4W8DA 4YTFA 4BCPA 1LPUA 4L8MA 3I6UA 2G2FA 4TWOA 3VS5A 3BEAA 4K11A 4D1ZA 5HBJA 1FMOE 4I6QA 2B4SB 5HIBA 3COKA 1MRVA 4ZTMA 2Q0NA 4NU1A 4HVHA 5HE0A 2P3GX 2WQEA 5LXMA 3MGYA 3ALNA 2HZ4A 4RJ5A 3OW4A 4AW2A 4V05A 3F5UA 4W4XA 5LMAA 5KKRC 2J50A 2G15A 4OTGA 4KUJA 3HA8A 4FIIA 4IAKA 4CRSA 3EZVA 4ACGA 4G1WA 3UQFA 3EH9A 1GOLA 5HGIA 2R3OA 4B0GA 5CAUA 1PXJA 3F3WA 2HIWA 4FG9A 3RPOA 3GNIB 3LM5A 1PMVA 2IN6A 4BYJA 5J7HA 3V8WA 1UNLA 2WNTA 4UZDA 4CG8A 1PXOA 4V01A 4I4EA 3UIMA 5AR2A 3C4EA 3DV3A 3II5A 5A4EA 3BE9A 4FIJA 5K3YA 4LRKA 4QT1A 3O7LB 4PNKA 4IXPA 5J5TA 4GRBA 3BKBA 3DTCA 3C1XA 3BU5A 4Q9ZA 3ZC6A 4PPBA 5IF1A 2VN9A 3COIA 3PLAE 5B7VA 3MY1A 4NW5A 3ACJA 5CANA 2UW6A 3OT8A 2R0UA 2VTNA 1QL6A 3EL7A 4NFNA 5E1EA 3O23A 5FUTA 3A7JA 4DYMA 5CAOA 4EWHA 3G6HA 5IEVA 4EJNA 5HVJA 4D2RA 4I5MA 4DC2A 1S9JA 3RHXA 3C0HA 1HCLA 3QQLA 3VULA 2YJSA 4OBPA 4IVDA 1ZMWA 2W1IA 3QX2A 1OBGA 3ROYA 4BDDA 2O5KA 4J99A 4ZLOA 2QOFA 3F61A 3VJNA 2C0OA 2UW9A 3DBQA 3D2KA 4AFJA 4ANOA 3V5PA 2O0UA 4OTHA 3PFQA 3PP1A 4P2KA 3QTZA 4TY1A 4YPDA 3N4TA 1CKJA 3E88A 3R01A 5EDRA 2GNLA 3AC8A 2PE0A 2VTAA 4GU9A 2V7OA 3C5IA 3NNXA 2C3JA 2WOTA 4M13A 3FYKX 1R0PA 4QP7A 1F0QA 4FV3A 5IDNA 4AQCA 1WBVA 3RK7A 2YABA 4RIOA 1GJOA 2Y6OA 2CKPA 5IG1A 3SRVB 2XH5A 4WSYA 5AP3A 4YZDA 4MH7A 1BL7A 2UVZA 4D2SA 5BUJA 3I5NA 4IC8A 1YHWA 3QA0A 1DI9A 2CGXA 4YR8A 5DR2A 4IADA 5DRBA 4JQ8A 4PF4A 1WAKA 2PVJA 4GVAA 4M84A 3P5KA 2VUWA 3W1FA 1OVEA 5DLSA 2YACA 4XYFA 4O7SA 4PMMA 2VTQA 5M09A 1VR2A 4RGJA 3AC4A 5FEDA 2QKWB 3ORTA 4CMUA 4ZTNA 5GHVA 3G0FA 5ETIA 3AGLA 5AR8A 3ZMMA 5AR5A 4RIWA 5D12A 4FKUA 4IB3A 3QQHA 4L3LA 3UOHA 3NR9A 2QODA 4H58A 4D1XA 3UPZA 4RC4A 3DDPA 4IZYA 2F57A 1RQQA 2IW8A 2BZHB 3OT3A 3Q60A 4DH7A 1YXSA 2QR7A 2YZAA 4Q5EA 5EM8A 4DGNA 2CNVA 5LOHA 3NUPA 4C37A 3CPCA 4D5HA 4NTTA 3NDMA 4QYGA 1A48A 2UZEA 4FUXA 4WSQA 1A06A 2GNJA 2W5AA 4DEIA 5F9EA 2PUIA 4D2PA 1ZZ2A 4NZWB 3FDNA 3E8CA 1UU8A 2XK9A 2R3FA 3R7YA 4EKLA 3MW1A 5IA2A 4XG9A 3FZOA 4C4EA 2VX0A 4OTRA 3LJ1A 5KHXA 2Y4PA 2XNMA 3MFSA 4JR3A 3DAJA 4G3FA 2ITPA 2VNWA 4L3PA 4ZTLA 3QKKA 3VS2A 2XK7A 3HP5A 2WU6A 4HNFA 5DI1A 3KN5A 3K5UA 2X7FA 4WKQA 4Y5QA 5KMMA 5GZ8A 4ZZMA 2R3MA 2XIKA 5K0KA 4O7TA 4EK6A 2ACXA 2Z7LA 3NYVA 4TNBA 4HGLA 3PWYA 5CALA 1M14A 2R4BA 4EBWA 4XUFA 5BX0A 5KBQA 3S3IA 3FI3A 3PPZA 4BCGA 3HVCA 1NVSA 3BU3A 4NTSA 4XG2A 4DE4A 2V5QA 2O8YA 3MYGA 4D5KA 4M67A 4DFNA 5HORA 4CRLA 3TACA 3O0GA 2BIKB 5ACBC 4ASZA 3LFAA 2J6MA 4H3QA 4DCEA 4YZ9A 1A9UA 4C36A 4GSBA 4C61A 2J2IB 2C5YA 3R00A 5AUVA 2BTRA 3RP9A 5AUXA 3I1AA 3ZUVA 4EZ5A 4GS6A 4OGRA 1SVHA 3QD3A 2XJ2A 4XHKB 5L8JA 4RFZA 4E8AA 3CS9A 4RX9A 1ZOHA 3K3JA 2QU5A 4FGBA 3MJ2A 4XLVA 3THBA 5IU2A 5I3RA 3TV4A 3V5JA 3OBGA 1WVWA 1U54B 4TWPA 4CSVA 1PKDA 5L8LA 1IAHA 3LFSA 4U3YA 4LOOA 5KBRA 4UEUA 5DA3A 2B52A 3MDYA 2UW8A 4O1OA 3U9CA 5A4TA 5BYLA 1WBWA 2C6KA 4O27B 4TWCA 5BVWA 5BUIA 4XS2A 4AZVA 3WOWA 4BICA 4EOKA 4QMLA 2ITNA 2OF2A 3CQWA 3QQKA 2HENA 4IX6A 2WB8A 2CNUA 4RIYB 1K2PA 3KXHA 4IBMA 4U80A 4F70A 1J7LA 4BDGA 1Y91A 1NA7A 4ID7A 4CKIA 1OB3A 4F64A 4RWKA 3GT8A 4KNBA 4LGGA 3ZU7A 1F3MC 2A4LA 2J0JA 3R7IA 2EB2A 2ZM4A 4U45A 3DS6A 3ZUUA 2QNJA 2BDFA 1J7UA 3OFMA 2VWVA 5HTCA 3HV6A 5HBHA 3QRKA 4QYHA 4FSNA 4AF3A 2BROA 4EOPA 3RMFA 4FKIA 1O6YA 4AACA 2J5FA 5ETCA 4IX4A 3G2FA 1OMWA 5IQGA 4TTHB 5CVGA 4LMNA 4EC9A 2BRMA 3I7CA 2W1CA 4EZ7A 2GFSA 3MTLA 1FGKA 3P78A 1ZYDA 1B6CB 1H28A 3OP5A 4Q5HA 5J7BA 5IUGA 4TYHA 2RG5A 3S1HA 4EH7A 3MI9A 3MPAA 3NIZA 4P90A 4RWLA 1KV1A 4O96A 2PVKA 1I44A 3QTRA 4ITIA 4FEVA 4ZJJA 5JFXA 3OXTA 4NM5A 3BHYA 3NCGA 4DN5A 4F65A 4ZAUA 5L6OA 2XUUA 3C4ZA 4G9CA 4BZNA 3T3VA 3KXMA 3LM0A 3GC9A 3TNPC 3FI2A 3VWAA 4E73A 4ORKA 4BCOA 3FZ1A 3EFLA 2P33A 3R2YA 5DGZA 4B6LA 5LVNA 3SW7A 1AQ1A 3UJGA 3FYJX 4C57A 3UYSA 4DGOA 4L45A 3GUBA 4CNHA 5DE2A 5CSPA 4GEOA 4UZHA 4ASEA 4FYNA 5AV0A 1CKPA 3F2NA 3ZONA 4P5ZA 5CAPA 5H3QA 4DH8A 3MTFA 4BCJA 1FVVA 1KE7A 5FM3A 3UO4A 5A6NA 2W1HA 3NW7A 4FNYA 5JQ5A 3BBWA 4PL3A 3QQJA 3FZPA 4R7IA 3QXPA 4ZJIA 2C69A 3OS3A 4XMOA 3EFWA 3QRIA 2VTLA 4KWPA 5M4FA 3BHHA 4QMXA 2E2BA 4ANSA 2WQMA 4B4LA 4GUBA 4GFMA 4UWYA 3MPTA 5G1XA 3ODYX 4X3FB 4EL9A 2XK3A 2J51A 5CI7A 5DRDA 4Q9SA 1FOTA 3CXWA 4B8MA 1Y6AA 5DR6A 2BRGA 1OIQA 3KVXA 4YLKA 2YM5A 1LP4A 4QMQA 5L2WA 2HAKA 4EOMA 5EHYA 3PVBA 4O82A 1FPUA 4QNAA 2PVLA 3EHAA 4AZFA 4B7TA 2G2IA 4X7QA 4BDEA 5CF8A 1SZMA 3E64A 2JDSA 3CPBA 5BUEA 5BVFA 1YXTA 5DT4A 5E8TA 4QPMA 3QUDA 2AC5A 1BI7A 1JKLA 2YIQA 3ZBXA 3EFKA 3VW6A 4S32A 2YLFA 3R63A 1DI8A 4JNWA 3PG1A 4W4WA 1XH5A 3EJ1A 2QURA 1MRYA 4IX5A 4RA4A 4GT5A 4FV7A 4D28A 1PKGA 3HV3A 4AE9A 3ZS5A 3U6HA 2VTMA 3DTWA 5FP5A 4XRLA 5L2QA 5JN2A 2Y6MA 1KWPA 3KRJA 4WOVA 1Y6BA 4GFGA 3A60A 3PDTA 2EXMA 3M11A 4LRMA 2VU3A 4O2ZA 5EM5A 4BZOA 3HYHA 2QOKA 2XYNA 3F5XA 3JVSA 4U44A 4O7WA 2JDTA 2XNGA 3Q6WA 4DGLC 4EOJA 3VRYA 3NVKI 1ATPE 4O0VA 2LGCA 3U54A 2OJGA 4RX7A 4AE6A 4FT0A 4A4OA 3R30A 4LM5A 4XNEA 1GIIA 4C4GA 2C5XA 2R3HA 4M69B 4UMQA 3IONA 4AT3A 5CQWA 3UVQA 2B54A 1SM2A 2XCKA 3B8QA 3VJOA 2X8EA 4DEGA 3FJQE 5EDPA 3BLQA 3QTQA 4RZVA 2R3RA 1F5QA 5FGKA 5HIDA 3HL7A 3FZSA 5L4QA 1CDKA 4FZ6A 3VF9A 3VBWA 4PP7A 5AR4A 5DOSA 3LQ5A 2OIDA 4YJQA 5E92A 3EQHA 2CGUA 3PJ2A 3SGCA 2C3IB 4ZIMA 3ITZA 3NYOA 1M2PA 4NJDA 3KREA 5CTPA 3BBTB 1IA8A 2W4KA 4BKZA 5IMEA 3MN3A 4FV2A 1G5SA 2YEXA 2ITTA 4FVPA 4ZY5A 3OWJA 2Z7QA 1YWRA 4FSTA 4CG9A 2X4FA 4FTRA 4O1PA 1IG1A 2WMUA 3GCVA 1GY3A 5G6VA 3PA5A 3EOCA 3W2RA 4EH2A 4DH5A 4WNPA 5EKNA 5CAVA 2UW5A 3GP0A 4WRGA 4PY1A 3S95A 3FI8A 4IM2A 2C68A 3OCSA 3DBEA 4JVGA 3ORPA 5I5ZA 3CE3A 5D9HA 3OEFX 1JKTA 3C9WA 3UNZA 3F69A 4MXXA 1H00A 2W99B 1WVXA 3KMMA 4XCUA 3R7OA 4C35A 4UMRA 2H9VA 5AEPA 3OCTA 3EQGA 4IAFA 4ERKA 4N57A 3KEXA 3QZHA 2EWAA 4GUEA 5FDPA 3VN9A 1ZZLA 4FYOA 1Q41A 3DKGA 3H30A 3DNEA 3E3BX 3LFNA 4G34A 4NSTA 4QMUA 3RINA 4QQTA 2B9JA 2NO3A 2WMQA 4I22A 3POZA 2PL0A 3E8DA 3FL5A 3MESA 3NNVA 4YJTA 2C4GA 5F1ZA 5TO8A 3MWUA 5ANOA 4RT7A 4ZTRA 3LW0A 4NH1A 3FV8A 4OUCA 4F63A 5DR9A 5HLWA 4Y5HA 5LARA 2BZJA 2ERZE 4R1VA 3Q2JA 1ERKA 5HIEA 3UZRA 4JDKA 4QTEA 5C1QB 1YVJA 1W98A 4GMYA 4WG4A 3T9TA 4BTMA 2UUEA 3CTQA 4Y72A 3R83A 1RE8A 3P79A 2PUPA 3LCKA 2Y0AA 1YOMA 3RI1A 4AW5A 3A2CA 1BYGA 1NVRA 3QLGA 5I9UA 3OOGA 4HNIA 2B1PA 5B2KA 4H3PA 2OO8X 5IISA 3LFFA 2C3KA 2GQGA 3R1NA 4BDJA 4WD5A 1V0BA 3BWFA 5BYYA 2B9FA 3ZZEA 4FMQA 5TT7A 4PL5A 2F7EE 3PSCA 3NVMB 1YHVA 2PY3A 4HOKA 3TNHA 3TKUA 4BCQA 1KE5A 4Z55A 2VTIA 1GIJA 4PNIA 2BFXA 1OM1A 2G1TA 4K6ZA 3NS9A 4DF3A 2ZAZA 1M2QA 4KIKB 2PZIA 4FGRA 4S31A 1ZLTA 4IHPA 4W9WA 2UZWE 4I93A 4EORA 4E6QA 4EYMA 2X39A 3CY2A 3IGGA 4AXAA 5AV3A 1ZYLA 3GU4A 3SXSA 4OTQA 2XNOA 4BVUA 2GHGA 2OGVA 2PVFA 2VWIA 3LQ8A 5K4IA 1SYKA 5IEXA 2QI8A 3UO5A 3FUPA 4NYEA 3P7AA 2XF0A 3HUBA 2E9OA 3O8TA 3LMHA 2HK5A 5IQCA 2HWPA 4KBCA 4BGHA 4PMTA 5AAGA 4AFEA 3MS9A 4ZSLA 3W2PA 3G9LX 4ENYA 2G2HA 3DQXA 4YLLA 5FDXA 5AMNA 2CN5A 4DEHA 1YOJA 2UVXA 2XKDA 3BV2A 5M4CA 2GFCA 2EVAA 2Z8CA 3OTUA 4L42A 5HE1A 3UOKA 2YIYA 2W7XA 4XLIA 3VUDA 1Q62A 2VTJA 2WIPA 4L01A 4IFGA 4FE2A 4Z9LA 4BBEA 2H8HA 4F1MA 3R8VA 3TL8A 1ZOEA 4RJ7A 3QA8A 5IDPA 4WHZA 3VW8A 4FVRA 3NUSA 4H39A 5AM7A 3W2QA 3VUGA 2DS1A 3UC4A 4JQ7A 4FIGA 4FL1A 4L44A 3U9NA 3NMUF 1RW8A 4KRDA 4QP8A 1BI8A 1YI4A 4U97A 3V8SA 4AA4A 2RFDA 5AV4A 4YC8A 4BHZA 1H1PA 3QC4A 3R73A 4JDHA 4I5CA 2WO6A 1VYZA 3OMVA 5HD7A 2CJMA 3ORKA 4K77A 4EH8A 4M14A 4I6HA 2GNIA 3CTJA 1KSWA 4FTOA 3PXYA 3TTIA 3K3IA 3OHTA 4F6UA 4F7NA 5AV2A 4AA0A 2X2LA 2H34A 4Y83A 4RJ4A 1QPCA 3KFAA 3W8LA 4BCHA 3ENHA 3QD4A 4MD7E 2V55A 3LE6A 2OH4A 3VNTA 3DKFA 5IA3A 5K5XA 5CYIA 3SC1A 5IMXA 3C7QA 2BDWA 1SVEA 3LFDA 4ASXA 2VWWA 4OTDA 4XG6A 3FXWA 3RK9A 4U0IA 4WBOA 4UYNA 1Q8YA 4DFXE 5CT7A 2JIVA 5M56A 3NUUA 4LGDA 3E92A 3TNWA 2JKQA 3MIYA 3SVVA 3E5AA 5M53A 2W1EA 4AT4A 2UZDA 4J53A 4BZDA 5M57A 3BCEA 4NW6A 3MH2A 5HICA 3T9IA 2BALA 5AAEA 3GOPA 4DTBA 4W8EA 5EM7A 3WZKA 3QCQA 2JDOA 3PA3A 2CGVA 3PLSA 4I92A 4GU6A 3PIYA 3UMXA 4IANA 2EB3A 2UV2A 4IZ5A 3EKNA 3OG7A 4FVQA 2ZOQA 3RAHA 3JY0A 5CLPA 3LVPA 3MFUA 2RSVA 4XV2A 2FH9A 4HZSA 4YC6A 4C33A 4IZ7A 4TKSA 4AWIA 3LCDA 2HZ0A 3R8UA 3L9NA 4PP9A 2GNFA 4N6ZA 5CEIA 2Y4IB 1M7NA 3EKKA 1Z57A 2VWBA 3FLWA 4USDA 4FOBA 5A6OA 2XNNA 4XG3A 3O8PA 2F4JA 4G2FA 4QNYA 4CTBA 3K54A 3ANQA 4MQ2A 2YAAA 4M0ZA 5CSVA 5AP0A 4YHJA 4BCIA 3KCKA 4CFFA 4Y95A 2X7GA 1JSUA 2BRNA 3QC9A 1XHAA 1IR3A 4O6EA 2QR8A 3Q32A 4TT7A 2PWLA 3DJ5A 3UVRA 4GK2A 3AC1A 3KF7A 4G6NA 2XS0A 4P5QA 5C01A 2QO7A 3D83A 4FI1A 2HY81 4WUAA 3RPRA 3DZOA 3DBDA 3AGMA 3R02A 2QONA 3QKLA 1NY3A 2DYLA 4KKEA 4EC8A 3BWJA 5FEQA 2XK4A 5HG7A 3E62A 2YCRA 4TYIA 2OWBA 3DB8A 3ATTA 2WTKB 1XH6A 3GCPA 3QF9A 5ANDA 3BGQA 2QOBA 4IC7A 1E1VA 4F0IA 4M3QA 2C6LA 3LXPA 4NCTC 4C38A 3R7EA 4KS8A 4FTTA 5DH3A 4GG5A 2VX1A 4LL0A 2XNEA 1YQJA 3AMYA 3W2SA 2X2KA 4JX7A 2EU9A 1Z9XA 4GT3A 1O9UA 4JBQA 3DXPA 1LEZA 3L1SA 4CZYB 4CZTA 3ZCLA 4XX9A 1V1KA 3VS6A 2W96B 2P2HA 4EZ3A 4RG0A 3U6IA 2XIYA 2CMWA 2AUHA 2YM8A 4G5JA 4WBBB 5EH0A 2C3LA 4G6LA 4KB8A 4K9YA 4YJPA 4KAOA 1R3CA 3G9NA 4JS8A 4DGGA 5KMIA 2O65A 4AU8A 4BY9E 2CLXA 5HG9A 2WEIA 1URWA 4GJ3A 4BIDA 4PMSA 3IDBA 4KBAA 1GZNA 4FSUA 3ZFXA 1YOLA 3DNDA 2LAVA 5EQEA 5I9WA 5IQFA 1PMUA 2YCFA 3ZDUA 4BF2A 4YBJA 2IJMA 5CU2A 3PPJA 4LV8A 3C4CA 4QTDA 3WF5A 4C3FA 3BU6A 3HX4A 5CEMA 1LR4A 5EI6A 1YKRA 2R3KA 3Q9WA 5E8YA 1EH4A 2BHEA 4QQJA 3A99A 3ZM4A 3FHRA 3WBLA 5IA0A 3RTPA 2R0IA 4ZZOA 5BVDA 4D55A 2ITOA 4HJOA 1PY5A 1GNGA 1J1BA 2P55A 4I24A 4MEDA 3RNYA 1XWSA 1CMKE 4PX6A 5C8NA 1APME 3N51A 4BI0A 3O8UA 3DBFA 5F20A 2WXVA 3JPVA 3WZUA 4L68A 2FB8A 4APCA 2XNBA 1XBAA 5LVPA 3RPVA 3CGFA 2PMLX 2IZSA 5C03A 3KXGA 5D41A 4OTPA 2OZAA 2XNPA 5FLFA 5BYZA 1J1CA 1UA2A 3V5QA 3WF9A 4JBVA 5FTOA 4K18A 1OIUA 2YJRA 5CT0A 4CFXA 4CFNA 3JUHA 3QHRA 4M12A 4B9DA 3GU6A 3C51A 3HA6A 5HX8A 2PZYA 4UMPA 5AIKA 4V0GB 4BFMA 2J90A 2HWOA 3TNIA 4CLIA 3Q4ZA 1BLXA 1VZOA 3I0QA 3PY0A 3EN6A 3HRBA 4I94A 4ACCA 4C3RA 3Q2MA 2C30A 3I4BA 4NM7A 4CQEA 4FSZA 3CKXA 1WCCA 3PVGA 4LOQA 3VUKA 4ACDA 2QKRA 5JSMA 4YZCA 2ZB0A 4YJRA 4WNMA 4BDKA 4EOSA 3R9RA 4DTAA 4RPVA 4X0MA 2BAQA 2IWIA 2X2MA 3PJCA 4FKJA 4FSRA 4FTKA 2CGWA 4QTCA 4RIXB 4TWNA 3W32A 2QHMA 1VEBA 2ITQA 1H8FA 2V62A 3FPQA 5AAFA 3MH3A 3RAWA 2R7IA 3D14A 1KE8A 2VO6A 4X21A 5H8GA 5L2IA 4YU2A 5C4LA 1J3HA 4ANQA 3R1QA 4XV3A 3H3CA 1PYEA 3VUMA 4DFYA 2GMXA 3CGOA 2HELA 3C4FA 4A06A 5HTIA 3KXNA 4LFIA 3OCGA 3PWDA 4IEBA 2C6EA 3CC6A 4KIPA 3RK5A 4M15A 2XP2A 4WNOA 2UW7A 4YSMA 4ZSGA 2G01A 3TCPA 5KZIA 4AT5A 5A46A 4U81A 3SV0A 4RFYA 3W33A 3SD0A 4I1ZA 2HCKA 3UPXA 3O71A 2ETKA 5JQ8A 2PMOX 3RM7A 4HYUA 3TV7A 1L3RE 3VUTA 4FKRA 3ZTXA 4H1MA 4JAIA 1T46A 5KKRB 2GU8A 4U43A 3VS4A 3U4UA 4FK3A 3HMNA 4FEXA 3BYUA 3DA6A 1ZYJA 4I23A 4QRCA 4X2KA 4DLIA 2YM7A 5LJJA 3LCSA 5KMNA 1Q8TA 3LFEA 2WQBA 3VS1A 5IEYA 4QMMA 5AX9A 4GKHA 3TDWA 3ORXA 1Q4LA 4ZXTA 2IVTA 4W4YA 3ZFMA 3BQCA 3WF8A 1UNGA 4UY9A 5J9ZA 5HHWA 2W9FB 5E9EA 3R28A 3R7VA 2R3GA 3TKIA 4TL0A 1TQIA 3PXQA 4IACA 4JG7A 4QP4A 3PZHA 1ZRZA 3NYXA 5JFWA 2OJJA 3LXKA 4LUEA 3UIXA 2FSOX 5IPJA 3QKMA 3U55A 2XCHA 4DEAA 3OWPA 2VNYA 1OL2A 4FSWA 4BTJA 4GYIA 2PVRA 1Z5MA 3W10A 2RF9A 4KS7A 5K5NA 5FG8A 2QVSE 5CENA 3R1SA 3SAYA 4GH2A 4PDYA 4BCNA 4CFMA 3COHA 5A14A 5M4IA 4JT3A 4NM0A 4F9CA 1GZKA 5I9VA 3O51A 2F7XE 5CU6A 4FIFA 2GS6A 2A1AB 3QGYA 5CVHA 3QHWA 4K33A 4LGHA 3EQBA 1Y8GA 5FTQA 4CD0A 3M42A 4O91A 1OBDA 3B2WA 2PPQA 1PXKA 1UV5A 3OZ6A 2YWVA 4IZAA 1MUOA 3F3ZA 3F66A 4A9SA 4G5PA 3KULB 3I79A 5H9BA 1SMHA 3E7OA 3SA0A 4C2WA 2WELA 5JK3A 4L3JA 5M08A 3EQIA 2PULA 3WZEA 4Z7GA 2VTHA 4X6RA 3AC2A 3BLRA 2A0CX 4DITA 5BVNA 3JY9A 3Q53A 5K0XA 2UZUE 4C34A 4QYFA 4JOAA 3LOKA 3U87A 5TKDA 4OAUC 4JJRA 3DBCA 4D2TA 4YNEA 3L8SA 3RALA 4EH4A 4GJ2A 2CNQA 3Q4TA 3FWQA 3V01A 2ONLC 4U41A 5FEEA 5CEQA 4AUAA 2FSTX 1WFCA 4A4LA 3RNIA 4D4RA 3DQWA 1E1XA 3DGKA 4MWIA 2XZSA 3R8ZA 4IQ6A 3ZC5A 2QG5A 5E8WA 4AZEA 3RWQA 5EYDA 4ALWA 4BDIA 3QAME 2QOOA 1REKA 4KKHA 4TRLA 4U5JA 4ENXA 4AZSA 4NIFA 4FTNA 2QQ7A 3BGPA 4K1BA 4XBRA 3LQ3A 1WBOA 3ZH8A 5TF9A 1IAJA 3G5DA 3RVGA 4II5A 1GIHA 3RAIA 4YC3A 3TTJA 2R3JA 3FC2A 5F4NA 1TKIA 2HZNA 1IA9A 3NX8A 4MNEA 5HESA 1XH8A 4QMYA 3WZJA 4U3ZA 3MBLA 4FV8A 4GL9A 5FXSA 3TZ9A 2X4ZA 3DT1A 3KMUA 5EI2A 5ETFA 5A4LA 3OD6X 2HW7A 3TN8A 2QC6A 3WILA 3IW5A 3A7IA 2R3NA 2RG6A 2CDZA 3RPYA 4EHGA 3ALOA 2Z02A 4Y46A 3SW4A 3HV7A 2ZV9A 1P2AA 3FLZA 1KOAA 4P7EA 3TV6A 4I20A 3ROCA 4CCBA 2WMVA 2VTSA 3GCUA 3ZXTA 1TVOA 1OI9A 2EXCX 3EQFA 1YI6A 3KA0A 4UMTA 3IOKA 4E6AA 4F9BA 1OGUA 1OL6A 1WZYA 2C5NA 4R7BA 2IVUA 3QRTA 4AP7A 2E9PA 3V8TA 5HO6A 3DZQA 3VBQA 4ALUA 3GC8A 5BQ0A 4F9YA 4NEUA 3CKWA 4YHFA 4C8BA 2VTTA 2JEDA 4QD6A 5B0XA 1URCA 3RJCA 4EJ7A 2WQOA 3ULIA 3QQGA 1OKVA 1WVYA 3VS7A 3N9XA 3ZO1A 2OU7A 2J5EA 4YLJA 3E63A 4F7LA 2XBJA 4O86A 3ZSHA 4MXZA 1FINA 1TQMA 2WD1A 4K8AA 3IW7A 2ITWA 5LVOA 3TDVA 3FZTA 5A4CA 3I5ZA 5EW3A 4QOXA 4G31A 1ND4A 2CCIA 4HVGA 1UKHA 2VX3A 4FKLA 3MSSA 3OBJA 5HU9A 2JDRA 5D7VA 4M7IA 3H9FA 2OXXA 3I60A 4J97A 4IWQA 4L6QA 4F6WA 3OCBA 3PTGA 5I3OA 4EUUA 3IQ7A 4R3PA 2ZV2A 1H01A 4MNFA 4G3GA 4J52A 2C6TA 3OWLA 2PE1A 2V0DA 3C4XA 4O7RA 2X7OA 2IVSA 3LZBA 3OY3A 4L00A 4UBAA 3VHKA 3CD8A 4CVAA 3SDJA 1FQ1B 5CEPA 4P4CA 3FLYA 2VTRA 3FSKA 3IGOA 2UW4A 4FUYA 1ZWSA 3ACKA 4QTAA 4EK8A 4V04A 3S00A 3ZBFA 2PVMA 4OR5A 4J95A 4AW0A 2A27A 3W55A 1HOWA 2CKEA 2O3PA 2OJIA 1O6KA 5CQUA 4YBKA 4BCMA 2HW6A 3HAVA 2OFVA 2B55A 3EQDA 5B2LA 5DPVA 3QRJA 1UWHA 3RWPA 5DT0A 3SOAA 3NYNA 4GW8A 4YHTA 3QYZA 4HVSA 3SRVA 2BKZA 3O7LD 3R21A 5C8MA 3V3VA 1MP8A 3QCSA 1QPDA 3LXNA 2W06A 5HO8A 4MF0A 4KSPA 4RC3A 5HG5A 3Q5IA 3TT0A 1JSVA 5L3AA 3A62A 3IO7A 3QLFA 3QQUA 4UXQA 3HLLA 3G51A 3UZTA 1JAMA 5TOZA 5TR6A 4BCKA 3RCDA 3ZLYA 2OJ9A 2W5BA 4FKWA 1PXPA 2CKOA 4KD1A 3FEGA 4R5SA 3MPMA 4H05A 4E5AX 2XYUA 5CX9A 4YO4A 1SNXA 3SKCA 4EBVA 5IQIA 5CI6A 5K9IA 5DBXA 4F0GA 5AP5A 2YN8A 3EQCA 1YXVA 4FL3A 4IE9A 4NCTA 3D2IA 2JITA 2YLEA 4FODA 4RX8A 3IS5A 3OW3A 4WA9A 5E90A 3H9RA 5DN3A 2Y7JA 3A8XA 3ORNA 3NPCA 2CHLA 5CSXA 4QMTA 2R3PA 5CY3A 5FBOA 1BKXA 4YJNA 4J7BA 4J96A 2HOGA 4RZWA 3GC7A 3ZHPC 2W1FA 3PIXA 2KULA 2YWPA 3L8VA 4L9IA 1JLUE 3HMPA 2V7AA 2OICA 2WQNA 3LFBA 3Q4UA 4UWCA 4F9AA 2DUVA 1KE9A 4A9UA 3KVWA 2GS2A 2F9GA 4O2PA 2UZTA 4S33A 5AP4A 2GPHA 4DFUA 1OPLA 4LG4A 2Z60A 1U4DA 2OH0E 2BZIB 2YM3A 4FNZA 4CMOA 2PVHA 4NM3A 5KHWA 3C4WA 5LMBA 3ET7A 3F82A 4G3EA 3M1SA 5T68A 2YERA 3V5LA 4BYIA 4FSMA 3UMWA 4C4IA 2ESMA 1OL7A 1WBPA 2XA4A 5E8UA 3RZBA 1JVPP 4XJ0A 2BAKA 2WTVA 5I9YA 4U8ZA 1YRPA 2R7BA 1STCE 2OZOA 5ITAA 3KQ7A 2UZOA 5F94A 3SHEA 5LQFA 3R8LA 4Z3VA 2WMAA 5M4UA 2BPMA 3OUNB 3F6XA 4R78A 4ZMEA 3HDNA 3DB6A 2HXLA 4PWNA 4MBIA 3ZYAA 2J4ZA 4UV0A 3A7HA 3LHJA 3LJ0A 3QQFA 3OF0A 4JG6A 4QMOA 4YJUA 1ZAOA 2QLUA 3F2RA 1OKZA 2CCHA 4I6FA 4C0TA 4IFCA 3A7FA 4UYAA 2C6DA 3FKOA 4ANBA 3ORLA 4DFZE 3D9VA 2JLDA 4H36A 4M8TA 3RKBA 2OW3A 3PVUA 3F3UA 5HG8A 3GGFA 4A9RA 4APPA 3DK6A 4QMVA 5E7RA 1PMNA 4FTQA 3FMDA 5EQPA 3BHUA 3TJDA 2VD5A 5FXQA 3O17A 4ZLZA 4FT9A 4UB7A 2E9VA 2C47A 4HYIA 4WRSA 4O0YA 3GU7A 3NRMA 3NW5A 1JQHA 4YZBA 3LAUA 1RJBA 3VQUA 4YPSA 3L9LA 3UDBA 1OL5A 2Z2WA 1O6LA 1UVRA 1RDQE 3G33A 1U5QA 3QTIA 4HPUE 4LI5A 4TYJA 3W18A 4EYJA 4F7SA 3B2TA 4X6QC 2XIRA 4BGGA 4CEGA 3BYSA 4A4XA 4UMUA 4UX9A 4D9UA 3G6GA 4DAWA 3WIKA 4BI1A 4DINA 2B7AA 1JKSA 4EOOA 4YURA 3GQIA 3QD0A 4G9RA 4BR3A 4F7JA 1PXIA 4BB4A 3KXZA 4F0FA 2QU6A 1OKWA 3WARA 2YM4A 3ELJA 4HW7A 1U54A 5I0BA 4HYSA 2ETMA 5EFQA 3QX4A 3A4PA 3H10A 1NVQA 2F49A 4BDHA 4HVDA 5E8SA 4BWKA 3GCQA 1MQBA
chains in the Genus database with same CATH superfamily
5AJQA 3DAEA 4RVMA 3U6JA 5AUZA 4O84A 2BRHA 4XH6A 3P4KA 5CEOA 4JXFA 4IVAA 3QD2B 3ZZWA 4MBJA 4L7FA 4YSJA 2QCSA 4X3JA 4FICA 5DFPA 2P0CA 4G6OA 1IEPA 4OTIA 1I09A 1OKYA 5IH5A 4O22A 4RIYA 4ZZNA 4ANLA 3ZDIA 2HZIA 3LXLA 3DY7A 4C2VA 5IQAA 5JZJA 3PRIA 2ITZA 4QP6A 3VRZA 4DHFA 2PZPA 4FTAA 2YISA 5IQBA 1XBBA 1H1WA 1SVGA 3D7TA 4FNWA 1R1WA 5I9ZA 3ZUTA 3DAKA 3PUFC 3JXWA 3HMMA 4E93A 3FMLA 4KABA 5B2MA 1M2RA 4FNXA 4O83A 4KIOA 2Y4IC 5ANJA 3ATSA 4DT8A 4L7SA 2R64A 4NKSA 4CYIA 4OTFA 2YA9A 1BUHA 4HGSA 4IDVA 5C8KA 2H96A 4E7WA 2WMTA 3CIKA 5DMZA 2BRBA 2BMCA 4E5WA 4IDTA 4CGAA 4D2VA 3P1AA 2CPKE 4AXDA 3IW8A 3LJ2A 3KMWA 5AA8A 2Y9QA 2PU8A 5DVRA 5J79A 4L67A 2ZB1A 4RIWB 1YWVA 1Q61A 3SXRA 2X6DA 1DAYA 3BELA 4DLJA 2XMYA 4YTIA 3NAYA 5EG3A 3ZEPA 1DM2A 2H6DA 3KKVA 3RBWA 4BDAA 3T8OA 3GFEA 3NEWA 4IMYA 1YXXA 4LV5A 3S2PA 3SXFA 1NXKA 2ZMCA 4EHZA 2PHKA 4EK4A 4QTBA 5L2SA 3DLZA 5KO1A 4A07A 4PDOA 4HGTA 3FMHA 3EN7A 4B8LA 3BL9A 4FIEA 1OL1A 3EN5A 3ZLXA 3CJGA 4I0TA 4DCAA 2RFSA 3AC3A 3FMEA 3QALE 2JAMA 4BDCA 4RLKA 4D0XA 3Q9ZA 2IG7A 1HCKA 3TIYA 5IQEA 2DQ7X 4U42A 4EQUA 4HZRA 2W1GA 2VZ6A 4RRVA 1K9AA 1W84A 4U6RA 1UU9A 2YDJA 3DDQA 3ENMA 5AADA 5CVFA 3KRLA 5CS6A 1Q3WA 3EN9A 3KB7A 2E9NA 4GIIA 1UU7A 4XV1A 3TI1A 4PV0A 4ZJVA 2C6IA 3GCSA 1H1SA 3DPKA 3TEIA 1OGYA 3FMMA 2GS7A 4MX9A 4S30A 5GJGA 2ZM3A 4J8NA 2PZ5A 4M97A 4TNDA 3NUAA 2X0QA 3Q5ZA 1QPJA 3S0OA 3PE1A 2JFLA 3LLTA 4UXLA 3UGCA 2SRCA 3ORZA 4MBLA 4M0YA 4A7CA 4D0WA 2VWUA 3V51A 3W8QA 1XKKA 2JDVA 4NFMA 3E87A 4LOPA 4QMWA 4X3FA 5DEWA 3NCZA 2X81A 2XJ1A 4EOQA 2BFYA 3KK8A 2C1AA 4MTAA 4BIEA 4CLJA 3MY0A 2ZDUA 2BCJA 3NUYA 1BL6A 3IK3A 3CBLA 4JDIA 1YDSE 3HAMA 3TZ8A 3VVHA 1PXLA 4ITHA 3U51A 2QLQA 4YTHA 3P9JA 4OT5A 4QQ5A 1FMKA 2ONLA 3GU8A 4IX3A 4GK3A 3FKLA 1M52A 4JRVA 4R7HA 5D10A 4QEBA 5D7AA 3KRRA 4ZY6A 4I5PA 4DH3A 2WGJA 4MXOA 4RA5A 3ZO3A 4L52A 3UOLA 4AGCA 3TUDA 2YIWA 4AX8A 5KCVA 2FGIA 4C4HA 1OPJA 4JQEA 2R5TA 5KUPA 2XVDA 1REJA 4FBXA 1LEWA 3NGAA 2R3LA 2VTPA 3AD6A 1MRUA 4XG4A 4L46A 5BNJA 3PA4A 3O50A 4O7LA 5EOBA 4QPSA 3FQSA 3VQHA 1Y8YA 3LCOA 2XRWA 4FKSA 4FX3A 3GC0A 4U79A 3NFFB 2AYPA 2J0IA 3D5WA 3PJ3A 4ZTHA 5I9XA 2XAOA 4RQKA 3ZM9A 4JG8A 4AN3A 2WMXA 3F9NA 4PPAA 3U4WA 3OVVA 3PSDA 5JFVA 3ETAA 2WTWA 5IH4A 2PE2A 1G8JA 4J98A 3F3VA 1W82A 3UVPA 4DEBA 4RJ8A 3FZRA 2UVYA 3MJ1A 2PMIA 4FK6A 4O4BB 2XIXA 4AN9A 3BYMA 4OT6A 4QP1A 3ZRKA 1PJKA 4MWHA 5CSWA 1Q5KA 1UU3A 5HU3A 2F2UA 1G3NA 3PIZA 3ZLWA 3FXZA 5IH6A 3TUBA 2X0GA 4QP9A 5FD2A 3LFQA 3R71A 1PF8A 3VS3A 3ZFYA 5HVKA 4FT5A 5DG5A 3MFRA 4Y8DA 1QMZA 2WMRA 5K4JA 4FZAB 1YDTE 4IVBA 1JPAA 4MNEB 4BBFA 4BI2A 3MVMA 4CQGA 4WO5A 2WHBA 3PP0A 5KMJA 2GSFA 4CFWA 3B8RA 4A9TA 4QYEA 4WG3A 5HNGA 4AOIA 1H1RA 4F08A 3ML1A 3KL8A 4TYHB 4UWBA 4O38A 4YTCA 1G8AA 2B53A 4PTEA 4WUNA 2OI4X 3CJFA 3CP9A 3NNUA 3PJ1A 2VWXA 3O2MA 4WIHA 1OUKA 1ZMVA 2VGOA 3M2WA 3O96A 5L6PA 2EUFB 4O0UA 5E8XA 5HI2A 4ANNA 1ST4A 3DJ6A 2JC6A 4BDBA 1H0VA 3C50A 5J1VA 2WEVA 4BRXA 2JIUA 3FE3A 3DU8A 4G16A 2WTDA 4HCTA 3VAPA 4E3CA 4K0YA 2UW3A 3KRXA 3D94A 3Q96A 4E1ZA 3EB0A 5A54A 4H1JA 4NJ3A 1U46A 3OTVA 2XM8A 4O0WA 4O0TA 1H26A 4ASDA 5ANKA 5LWNA 4IIRA 3DK7A 5CSHA 1XBCA 5JZNA 3HP2A 4I5HA 3H4JA 3TUCA 2XANA 4ITJA 4FV1A 4MXCA 5AM6A 3QU0A 4O0XA 5GJFA 1PXMA 2C5VA 4J1RA 4BWPA 1U59A 3I7BA 2OG8A 1XMLA 5AP2A 1YDRE 4NK9A 4C59A 4KIQA 3D7ZA 2C5OA 2G9XA 3DXNA 3NWWA 3Q9YA 4PDPA 1IASA 2P2IA 5HBEA 4E4LA 3TNQB 2YCSA 4OTWA 1PMEA 3RGFA 3Q3BA 2X8IA 4KBKA 4S34A 2YDIA 2FSLX 3UO6A 4AZWA 4AZTA 3BL7A 5EI8A 4FT3A 4O7ZA 3CCNA 4RJ3A 3R8MA 4F9WA 2CLQA 3A7GA 3NUXA 2PZRA 5HCYA 2IW9A 4E5BA 2PTKA 4O7NA 1P14A 5JGAA 3FQEA 2OFUA 5IA5A 3RPSA 3C0GA 1WBSA 2EXEA 3F3TA 2JBPA 2VTOA 3HV5A 5ANEA 4PPCA 4F4PA 2FYSA 2BHHA 4EH3A 4DG3E 2C0IA 2J0MB 2WZJA 4OBQA 5EYCA 3WIGA 4IW0A 4HVIA 3FMJA 4QYYA 4ZK5A 1XR1A 2W9ZB 4YZNA 4O0SA 3VBYA 4D4SA 4CMTA 5HZNA 2Q0BA 1AGWA 1OPKA 2BUJA 3EQRA 4KIKA 1P4OA 3R7GA 4LRJA 4C4JA 2BZKB 4CFUA 3L8PA 5GJDA 3UP7A 4Q2AA 5D11A 4BWXA 4GG7A 4ZEGA 4XP0A 2W4JA 4WNKA 3NW6A 2J0LA 5C26A 2WMSA 3TZ7A 5J1WA 3HRFA 3K2LA 4OBOA 1XJDA 4EK5A 3ZRMA 3EYGA 3H0YA 2ITVA 2IZUA 3ORMA 5KMOA 3SG9A 4AGWA 4FSQA 3IG7A 2QOQA 4HCVA 5J95A 2XKEA 3HV4A 2YAKA 2BILB 3QTWA 3NIEA 3FLQA 4QQCA 2IPXA 3TZMA 2QO9A 3PXFA 3POOA 4FV5A 4YJSA 1DAWA 4JLCA 2GCDA 5A9UA 5CASA 2J7TA 2XKFA 3FC1X 3TJCA 4YGAA 4XEYA 2YIRA 4I21A 4X2FA 5M44A 3UC3A 3CQEA 1E9HA 5LVMA 4AOTA 4G3CA 3UOJA 3EZRA 4FT7A 2A19B 4IB0A 5C27A 5JRSA 2BIYA 4HPTE 1W7HA 3UTOA 3ZOSA 3QTSA 5AUTA 3FL4A 4FZDB 5CAQA 5IUHA 3L9PA 1VJYA 2HYYA 3UODA 2F2CB 4HYHA 2XRUA 3KXXA 4QP2A 5JT2A 4FKPA 3IW6A 4GT4A 4BBMA 3QYWA 2WTCA 4L53A 3PPKA 4AAYA 4OLIA 4Y73A 4IWOA 4U9AA 5EHLA 2WMWA 1VYWA 3EIDA 3C0IA 2J0KA 4X2NA 4E4XA 5AFVA 5DWRA 3MVJA 4IB5A 4N0SA 3BE2A 3G90X 3BGZA 2OKRA 4ZSJA 4DGMA 4RBLA 4CCUA 3C13A 3AXWA 5DT3A 4MXAA 3TXOA 3P23A 1H24A 5IUIA 4JBPA 2WAJA 3BEGA 5AP1A 3RHKA 3VO3A 3PUPA 2C0TA 3ORIA 1OIYA 3P86A 1YXUA 5HNIX 1OIRA 3CD3A 4EUTA 3UBDA 5EQYA 3QTXA 2AC3A 4DFLA 3TIZA 4FA2A 2I7QA 5CNOA 1ZY5A 4FKTA 3ZLSA 5LMKC 3PY3A 4U7ZA 4AGDA 4W4VA 3FMKA 4PTCA 2Q83A 5ETAA 3AT2A 3R7UA 1OUYA 2YDKA 4BGQA 3HMOA 5LCKA 1ZARA 2NRYA 4IWDA 3WE8A 3FI4A 4TZRA 3WYYA 2Z7SA 5H8BA 3KCFA 4RX5A 4IAIA 3OC1A 3QFVA 5HE3A 5CF5A 1J7IA 2PVYA 3DCVA 3BRBA 3R9DA 3BLHA 4O4EA 2IZTA 3KGAA 4X3FC 2W4OA 1YWNA 3W0SA 3FMNA 2XKCA 1Y57A 4D2WA 3JS2A 3DXQA 4YJVA 1QPEA 2WTIA 2VO0A 4EKKA 4MAOA 2OXYA 3MV5A 5E8VA 5IKWA 5JGBA 4EONA 2E9UA 3AC5A 2JKOA 3SOCA 1GAGA 4IAYA 4CZUA 4U40A 3MIAA 1H07A 4FTUA 2PUUA 3ZO4A 4FZ7A 5BVEA 5HCXA 4FG7A 4D58A 3PRFA 3LLAA 3DKOA 4FTJA 4NUSA 3HZTA 4D1SA 5C4KA 3RAKA 2RKUA 3ZSIA 3Q04A 4LYNA 4LL5A 4FEWA 2J9MA 3AT4A 1TFFA 4O7VA 2W1ZA 5AP7A 3GFWA 4AAAA 2IZRA 4ZLYA 4X2JA 2XIZA 3GENA 4QMPA 3ZEWA 2W1DA 3E93A 1OZ1A 3MVHA 1X8BA 5GNKA 5HKMA 4C7TA 1H27A 5CF6A 2OK1A 1JKKA 3MH1A 5C9CA 5EK7A 1Q8UA 2QOLA 4FEUA 2HXQA 2O63A 3HEGA 3ZRLA 1JBPE 2XJ0A 5HX6A 4DFBA 5HEZA 4BKYA 3NLBA 1DS5A 2BTSA 1PRYA 3EQPA 1K3AA 4ACMA 4BN1A 3ID6C 4ZMFA 5BVKA 3D7TB 2PUNA 1YI3A 1KOBA 4JBOA 3FY0A 2JIIA 2JFMA 1W0XC 3FQHA 3GQLA 4E4NA 5TE0A 3V6SA 4RMZA 3WZDA 3MH0A 3NNWA 5CNNA 5FQDC 4EK3A 1R0EA 3BYVA 2YM6A 5E8ZA 1H1QA 3FLSA 4ZS0A 4FTCA 3R8PA 2BDJA 3CY3A 4AA5A 4UN0C 3TG1A 3R22A 3BHVA 2PK9A 4R5YA 2X1NA 3BYOA 2NRUA 5J87A 2ZMDA 4KSQA 4DG0E 4OW8A 5IA4A 2B9HA 2XM9A 4GK4A 4RQVA 3V04A 4Z7HA 4J8MA 3WE4A 2R9SA 5KX8A 2P4IA 4DEDA 4PTGA 5ANGA 4AOJA 3N4UA 5HTBA 3MY5A 2C1BA 2C6MA 2WMBA 3D5UA 4RJ6A 5CEKA 5CXZA 4D4VA 3QWJA 4R3CA 3CQUA 1FVRA 2WTJA 2FSMX 3R2BA 5FWKK 2ZYBA 4G3DA 2FVDA 1W8CA 3ODZX 4N4SA 3ZO2A 1V0PA 4FL2A 4JL9A 2ZDTA 1Q8ZA 5KE0A 3WYXA 1ZXEA 5GIPE 1V0OA 4KA3A 4MVFA 5DIAA 3E8NA 3FBVA 3LFCA 3IDCA 2VGPA 5CU4A 3VBVA 2W0JA 4IB1A 5EW8A 2BVAA 4C4FA 5HVYA 5J5SA 3PXZA 5AR3A 5EDQA 4CT1A 4DBXA 4DT9A 2QD9A 4PL4A 5ACKA 1M7QA 3FSFA 4R1YA 3IDPA 1ST0A 5M55A 3REPA 2X9EA 4E26A 3DFCB 4JMQA 3HGKA 4BC6A 4ERWA 5A4QA 4C3PA 5CZIA 4N6YA 4FR4A 3OOMA 4C62A 2I0YA 3PXRA 4LUDA 4W9XA 5ANIA 3MFTA 1YHSA 4DG2E 4EWQA 5AUYA 1QCFA 2UZNA 5FM2A 4QP3A 1ZY4A 4MXYA 4FF8A 2VWZA 5J9LA 3PZEA 3S4QA 5DYJA 4IVCA 4E6CA 3P08A 4XOYA 3RCJA 4RWJA 1R78A 5JMSA 2X8DA 3DOGA 3ERKA 3R0TA 3D5VA 5KMKA 3E8EA 2GHMA 4JIKA 3DJ7A 3QZIA 3VC4A 4BHNA 3PXKA 1XH9A 3VBXA 2XK6A 3W16A 4FOCA 2ZV7A 5AWMA 3R9HA 4Y85A 3FPMA 1G8SA 4H3BA 3KF4A 4IJ9A 3V5TA 3SLSA 5IA1A 4V0GA 1T45A 4QO9A 3W2OA 3VUIA 4GV1A 2OSCA 3GEQA 1J91A 4ONAA 2VO3A 3FAAA 5KNJA 4I3ZA 2GHLA 4NT4A 1PHKA 2CSNA 3OXIA 4GFOA 4DH1A 4LMUA 4CXAA 2F7ZE 2Z7RA 1W83A 3CR0A 5GZ9A 4BCFA 4GKIA 5HCZA 3LIJA 5BPYA 3RZFA 3F7WA 4M68A 4RIXA 5CXHA 2I0VA 5LVLA 4FC0A 3F7ZA 2ZJWA 5HLNA 3UYTA 4MCVA 3UIBA 2BAJA 2RIOA 2XBAA 4XOZA 3QL8A 2ERKA 4ZOGA 2QOHA 4O0RA 2W17A 3NUNA 4EOLA 3F88A 3MA3A 2VO7A 4C02A 2OLCA 3V6RA 2KTYA 1WBTA 4TXCA 4USFA 2WU7A 3E3PA 4YNOA 4AN2A 5DNRA 4DHIB 5AX3A 5GIOE 2Y8OA 3JVRA 2YZLA 3QUPA 5D1JA 3Q6UA 4F6SA 5HQ0A 3TM0A 2WOUA 4EI4A 4F1OA 4I6BA 2VWYA 5BMSA 4I0RA 5J9YA 2QG7A 3QCXA 2R2PA 4XG7A 5LWMA 2JKMA 2ZM1A 4DHZA 3E7VA 3D4QA 5DEYA 3R9NA 5JEBA 3OWKA 4BKJA 5JRQA 3C5UA 2XK8A 5HD4A 2I0HA 4JIAA 3QXOA 5EM6A 5T3QA 2CN8A 3UIUA 2O64A 3AMAA 1FBNA 1Q8WA 3HMIA 4XG8A 4O21A 4EHVA 3CEKA 5EHOA 1S9IA 4YJOA 4USEA 5J8IA 4JAJA 3COMA 4PQNA 3TKHA 2BR1A 2NNWB 1KV2A 3LMIA 4NL0A 3HKOA 3VIDA 4O7YA 3R6XA 5AV1A 3D15A 3KRWA 3UG1A 4R6VA 3P7CA 4ANMA 3GB2A 1BMKA 4R8QA 4D4YA 1ZYCA 3CSVA 1JOWB 5L2TA 4N70A 3DLSA 4BJJA 4QMSA 3BPRA 1P5EA 1ZYSA 5EYKA 1TQPA 2I40A 4IM0A 3QUEA 3K5VA 1OITA 2PVNA 4E4MA 4DA5A 2FUMA 3LPBA 2RL5A 4CT2A 4IJPA 1NT2A 4CFVA 4ZY4A 3EL8A 4KKGA 4X2GA 5CZHA 3ULZA 5DHJA 1KUTA 3PVWA 2JAVA 3UG2A 4JRNA 2IW6A 5IQDA 4FKGA 4MHAA 3EN4A 5JH6A 1XMMA 4JDJA 4RWIA 3RM6A 3QBNA 2WKMA 2RFNA 4FV6A 3IKAA 2QOCA 3QZFA 3DKCA 3IPHA 4MYGA 1WMKA 4WG5A 4RFMA 4YP8A 5ICPA 2PMNX 5T6KA 1P4FA 1PW2A 3KULA 3W0RA 3HECA 4NWMA 4FKOA 5CU0A 4IH8A 4TW9A 1CKIA 1IRKA 3GBZA 3SX9A 2I0EA 4ZSEA 1R39A 4DTKA 4E6DA 3BHTA 3KC3A 1XQZA 4GCJA 5E1SA 2GDOA 2OIBA 2XEZA 4GVJA 4L43A 3PSBA 2OJFE 4XP3A 3FLNC 4KINA 4FTIA 4RVTA 3ZSGA 3EMGA 3N4VA 4FZFB 5HE2A 2YHVA 3QRUA 3UE4A 4ZS4A 2OZAB 4WT6A 4GYGA 2QHNA 4FV4A 4YUQA 3UQCA 5M07A 2B9IA 4MQ1A 4I41A 2ITYA 2QO2A 3PE2A 4R3RA 4EQMA 3AKJA 2XB7A 2YFXA 2PSQA 5E91A 2ITXA 1Q99A 3IW4A 2VRXA 3VBTA 4I0SA 5JFSA 1BX6A 1YW2A 5EKOA 3W2CA 4FTLA 2R3QA 3HRCA 4A9YA 4FEQA 3QGWA 1PYXA 4NKAA 4BL1A 5EW9A 3CLYA 4C58A 4MD9E 1L8TA 4RLLA 3A61A 4AW1A 3R1YA 4IAAA 4CKRA 4AS0A 2I1MA 4EH6A 3GXLA 2ETRA 4PUZA 5JKGA 4MF1A 4JR7A 2YCQA 3FHIA 3EYHA 5H8EA 1NW1A 4AGUA 2BKKA 5I4NA 1H0WA 3BI6A 3JR1A 1Q3DA 3LMGA 4R77A 4MK0A 5CF4A 3HUCA 4UALA 5AP6A 2WIHA 1XH7A 1WBNA 3MA6A 4GIHA 3UQGA 4TYGA 3TWJA 3I81A 3NSZA 4IWPA 1OECA 2X9FA 2NP8A 2QOIA 3PY1A 3IECA 1CTPE 2ZVAA 4YO6A 3UDZA 3T3UA 5IQHA 5HNBA 3AOXA 4FIHA 3D5XA 4XRJA 3LKMA 5E4HA 3D0EA 1JNKA 4FV0A 2WTKC 2VV9A 2DWBA 2CKQA 3PG3A 3H9OA 5HO7A 3DFAA 3OXZA 4Z16A 2NPQA 1H4LA 2FA2A 4IM3A 4QPAA 3SG8A 4K2RA 2JD5A 1B38A 3R9OA 4ACHA 3AMBA 3ZXZA 4FKVA 4FV9A 4JI9A 1XH4A 1M17A 4TN6A 4XP2A 5FP6A 3HNGA 4FKQA 2O2UA 5FRIA 3ANRA 4E20A 2C6OA 2OXDA 5A3XA 1Q24A 2X6EA 3PYYA 4EOIA 2REIA 3LCTA 4FG8A 3EFJA 4QMNA 2WPAA 4O81A 3KK9A 3Q9XA 5LMKA 3F5GA 1UKIA 4BIBA 4ZTSA 2PYWA 2VAGA 3FKNA 1U5RA 2FO0A 1CM8A 2UW0A 4O6LA 2HY0A 3L8XA 1Q97A 3CTHA 5BMMA 5EYMA 5L8KA 2B0QA 2OF4A 1H08A 3IOPA 1GZOA 2RGPA 3BQRA 3AD4A 3VHEA 4I4FA 3OY1A 4B99A 2UZBA 3AQVA 4F1TA 5AA9A 4EH9A 3BIZA 3P7BA 3NZ0A 3BV3A 3A4OX 5EOLA 3GI3A 1XO2B 4S2ZA 4PMPA 5KMLA 3UP2A 4BDFA 4TPTA 2WFYA 2JBOA 2A2AA 2R3IA 3R04A 4F99A 4MD8E 5JGDA 4CTCA 1B39A 1ZMUA 3HDMA 3OUKA 5LCJA 4QMZA 4RSSA 4D9TA 4RC2A 5HLPA 4PDSA 3UNJA 1FVTA 1JSTA 5GZAA 3G15A 3F2AA 3DK3A 3FXXA 2OIQA 4LQMA 2GTMA 5FBNC 4RVKA 4BTKA 2GNHA 2GQRA 2ITUA 4OAVB 2I6LA 4CKJA 1ZOGA 5BVOA 2RFEA 4ARKA 4EQCA 4F09A 2XEYA 5IZFA 5L6WL 5AR7A 3MB6A 2V22A 1MQ4A 5AUUA 4YMJA 3MVLA 3BZ3A 3NAXA 4HCUA 2JGZA 5CWZA 3VUHA 4CV9A 5FTGA 1CSNA 2ZV8A 4AG8A 1SNUA 4TYEA 4HGEA 3QTUA 4G17A 3WI6A 1JWHA 1KE6A 2GTNA 3QZGA 3KN6A 5HOAA 3I6WA 3P0MA 3UNKA 2UZLA 2IO6A 3QWKA 4JX3A 4DBNA 2UZVA 1UWJA 2OBJA 3MB7A 3BX5A 4EEVA 5AUWA 4BTFA 1AD5A 4KRCA 3WF6A 3OROA 4ZSAA 3L9MA 3PJ8A 3AT3A 3GU5A 3JYAA 4DEEA 3U8WA 4CYJA 2YIXA 4M69A 4ALVA 4NIFB 5GINE 3I0OA 4M66A 4FTMA 5CU3A 3UZPA 3FY2A 3EWHA 2W5HA 1FGIA 3H0ZA 5M51A 4MKCA 4ZTQA 4PRJA 5H2UA 3SQQA 3WF7A 1LUFA 2IVVA 3KU2A 2GQSA 4XBUA 5F95A 5M06A 5AIRA 4CV8A 3KIOC 4FSYA 4RVLA 5FXRA 3AG9A 4XV9A 1H25A 4ZP5A 3VF8A 2YITA 3G0EA 4YZMA 2GNGA 1UNHA 3GOKA 3Q52A 3KY2A 4EH5A 3QCYA 1PXNA 3AD5A 3GVUA 3F5PA 3Q4CA 1GZ8A 4IAZA 4J71A 5KZ0A 3VS0A 2JKKA 3V5WA 4EHEA 2W05A 3A8WA 3OEZA 4W8DA 4YTFA 4BCPA 1LPUA 4L8MA 3I6UA 2G2FA 4TWOA 3VS5A 3BEAA 4K11A 4D1ZA 5HBJA 1FMOE 4I6QA 2B4SB 5HIBA 3COKA 1MRVA 4ZTMA 2Q0NA 4NU1A 4HVHA 5HE0A 2P3GX 2WQEA 5LXMA 3MGYA 3ALNA 2HZ4A 4RJ5A 3OW4A 4AW2A 4V05A 3F5UA 4W4XA 5LMAA 5KKRC 2J50A 2G15A 4OTGA 4KUJA 3HA8A 4FIIA 4IAKA 4CRSA 3EZVA 4ACGA 4G1WA 3UQFA 3EH9A 1GOLA 5HGIA 2R3OA 4B0GA 5CAUA 1PXJA 3F3WA 2HIWA 4FG9A 3RPOA 3GNIB 3LM5A 1PMVA 2IN6A 4BYJA 5J7HA 3V8WA 2CKOA 1UNLA 2WNTA 4UZDA 4CG8A 1PXOA 4V01A 4I4EA 3UIMA 5AR2A 4LDTA 3C4EA 3DV3A 3II5A 5A4EA 3BE9A 4FIJA 5K3YA 4LRKA 4QT1A 3O7LB 4PNKA 4IXPA 5J5TA 4GRBA 3BKBA 3DTCA 3C1XA 3BU5A 4Q9ZA 3ZC6A 4PPBA 5IF1A 2VN9A 3COIA 3PLAE 5B7VA 3MY1A 4NW5A 3ACJA 5CANA 2UW6A 3OT8A 2R0UA 2VTNA 1QL6A 3EL7A 4NFNA 5E1EA 3O23A 5FUTA 3A7JA 4DYMA 5CAOA 4EWHA 3G6HA 5IEVA 4EJNA 5HVJA 4D2RA 4I5MA 4DC2A 1S9JA 3RHXA 3C0HA 1HCLA 3QQLA 3VULA 2YJSA 4OBPA 4IVDA 1ZMWA 2W1IA 3QX2A 1OBGA 3ROYA 4BDDA 2O5KA 4J99A 4ZLOA 4O4CA 2QOFA 3F61A 3VJNA 2C0OA 2UW9A 3DBQA 3D2KA 4AFJA 4ANOA 3V5PA 3W0NA 2O0UA 4OTHA 3PFQA 3PP1A 4P2KA 3QTZA 4TY1A 4YPDA 3N4TA 1CKJA 3E88A 3R01A 5EDRA 2GNLA 3AC8A 2PE0A 2VTAA 4GU9A 2V7OA 3C5IA 3NNXA 2C3JA 2WOTA 4M13A 3FYKX 1R0PA 4QP7A 1F0QA 4FV3A 5IDNA 4AQCA 1WBVA 3RK7A 2YABA 4RIOA 1GJOA 2Y6OA 2CKPA 5IG1A 3SRVB 2XH5A 4WSYA 5AP3A 4YZDA 3W0QA 4MH7A 1BL7A 2UVZA 4D2SA 5BUJA 3I5NA 4IC8A 1YHWA 3QA0A 1DI9A 2CGXA 1TZDA 4YR8A 5DR2A 4IADA 4AXFA 5DRBA 4JQ8A 4PF4A 1WAKA 2PVJA 4GVAA 4M84A 3P5KA 2VUWA 3W1FA 1OVEA 5DLSA 4FJVA 2YACA 4XYFA 4O7SA 4PMMA 2VTQA 5M09A 1VR2A 4RGJA 3AC4A 2XALA 5FEDA 2QKWB 3ORTA 4CMUA 4ZTNA 5GHVA 3G0FA 5ETIA 3AGLA 5AR8A 3ZMMA 5AR5A 4RIWA 5D12A 4FKUA 4IB3A 3QQHA 4L3LA 3UOHA 3NR9A 2QODA 4H58A 4D1XA 3UPZA 4DDIA 4RC4A 3DDPA 5BV3A 4IZYA 2F57A 1RQQA 2IW8A 2BZHB 3OT3A 3Q60A 4DH7A 1YXSA 2QR7A 2YZAA 4Q5EA 5EM8A 4DGNA 2CNVA 5LOHA 3NUPA 4C37A 3CPCA 4D5HA 4NTTA 3NDMA 4QYGA 1A48A 2UZEA 4FUXA 4WSQA 1A06A 2GNJA 2W5AA 4DEIA 5F9EA 2PUIA 4D2PA 1ZZ2A 4NZWB 3FDNA 3E8CA 1UU8A 2XK9A 2R3FA 3R7YA 4EKLA 3MW1A 5IA2A 4XG9A 3FZOA 4C4EA 2VX0A 4OTRA 3LJ1A 5KHXA 2Y4PA 2XNMA 3MFSA 4JR3A 3DAJA 4G3FA 2ITPA 2VNWA 4L3PA 4ZTLA 2NYAA 3QKKA 3VS2A 2XK7A 3HP5A 2WU6A 4HNFA 5DI1A 3KN5A 3K5UA 2X7FA 4WKQA 4Y5QA 5KMMA 5GZ8A 4ZZMA 2R3MA 1G8KA 2XIKA 5K0KA 4O7TA 4EK6A 2ACXA 2Z7LA 3NYVA 4TNBA 4HGLA 3PWYA 5CALA 4DDGA 1M14A 2R4BA 4EBWA 1VLRA 4XUFA 5BX0A 5KBQA 3S3IA 3FI3A 3PPZA 4BCGA