3WYXA

Crystal structure of human mps1 catalytic domain in complex with 6-((3-(cyanomethoxy)-4-(1-methyl-1h-pyrazol-4-yl)phenyl)amino)-2-(cyclohexylamino)nicotinonitrile
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
280
structure length
258
Chain Sequence
ECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPGTVNYMPPEAIKDMSISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Dual specificity protein kinase TTK
publication title A unique hinge binder of extremely selective aminopyridine-based Mps1 (TTK) kinase inhibitors with cellular activity
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 258
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3wyxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3wyxA01
3R22A 4JOAA 3HMIA 1PMUA 4L6QA 2WGJA 2UV2A 4K11A 3QLGA 4YGAA 3LFFA 1Q4LA 1PYEA 5E9EA 1ZWSA 4KKHA 4L7FA 3U4UA 5JKGA 3DS6A 5C26A 2QC6A 1OUKA 4EK3A 3PE2A 2BILB 4W8EA 2YN8A 1OIYA 5AFVA 4O0XA 5LCJA 3F3WA 4FOBA 1IEPA 1ZZ2A 2QOOA 4K2RA 2WMUA 4C59A 4E4LA 3U6HA 3LE6A 3FQSA 1O6YA 4RVTA 5F9EA 5IQFA 5IPJA 3ORZA 3NVKI 3DTCA 2ITQA 4M14A 1XBBA 4JS8A 4QMWA 5A6NA 5JQ5A 2R3OA 2V22A 3BV2A 4QMUA 1YDTE 4C3PA 2PYWA 3PJ8A 4ZJIA 2VNYA 1I09A 4CFMA 4QMTA 5BUJA 1B39A 3Q2JA 4RLKA 4UALA 1YRPA 1TKIA 1CSNA 2AC3A 3AMYA 4U3YA 2PMNX 2CNUA 1VEBA 4UY9A 2OZAA 3TUCA 4LUEA 4U97A 4B7TA 3PZEA 4IAAA 3CGFA 4DCAA 4LOOA 5LWNA 1OZ1A 3EQIA 4NJDA 5FEEA 1ZYDA 3ZRKA 3C5IA 2GS6A 3C0HA 3KN5A 3TJDA 4Q2AA 4J97A 4OW8A 4EOOA 4IC8A 1E1XA 3EL7A 4XG9A 5H8EA 5DR2A 3R8LA 3VHEA 4BDJA 5HBJA 2CDZA 1FMOE 1UWJA 2EB3A 2R3PA 2VWZA 3VO3A 1MRVA 3BEGA 3II5A 4QO9A 3KULB 2XM8A 4CV9A 4EH9A 1H4LA 3VUDA 3M42A 3UQGA 2C5OA 4A4XA 4RVLA 3MS9A 3NEWA 3QX4A 3RKBA 4I0SA 2ETKA 5HE0A 5HVKA 3WILA 5IMXA 5LMAA 3F66A 2HIWA 4FKWA 4R5YA 4ZAUA 3OVVA 3PLAE 1Q3DA 5JMSA 4RG0A 2R3QA 4BCQA 2PZRA 2WMAA 3EIDA 1W8CA 1RQQA 1MP8A 2HY81 5EK7A 5BQ0A 3KQ7A 3V8TA 3BLRA 4L00A 4RC2A 4JX7A 4RT7A 4ZY6A 3PZHA 4FKUA 1OL5A 3LCDA 4IAYA 4O7LA 4MXYA 4WA9A 2C3KA 2RKUA 2G2HA 1XWSA 3BHVA 3C4CA 5DN3A 3JVSA 4USFA 4QNYA 5CANA 3G9NA 4DFUA 2JFLA 5A46A 3DQWA 1MQ4A 4O27B 4O0YA 3MWUA 1SMHA 4S33A 5M44A 4OAUC 2Q0BA 2FSLX 1Y91A 2ITUA 4IB1A 3LXPA 4QOXA 3MFTA 4P2KA 5CAVA 3N4UA 4QP9A 2OF2A 2YM4A 4C4EA 3KRLA 1URWA 4CEGA 4YJSA 1P14A 1ZOEA 4XG4A 3DXQA 1REJA 4F08A 5B7VA 4X2NA 2KULA 1NW1A 2X8IA 2W5AA 5AP0A 5AP3A 4C35A 3NYVA 4GCJA 4DFNA 2PUUA 4R1VA 5HNBA 3UIUA 4XCUA 2HXLA 4PPAA 3R21A 4Y73A 3RPRA 3TUBA 5IUIA 4IX3A 5B0XA 4G3CA 4IWOA 1T46A 4X21A 5EM6A 3SV0A 1LPUA 3T3VA 4BDBA 4DGLC 4O6LA 4E20A 5E90A 4FTAA 4CKJA 4J71A 3WI6A 4IFCA 2XNPA 4B0GA 4R6VA 4O21A 4APPA 4BDDA 4FZDB 4N6ZA 4TYHA 5L2TA 2E9PA 2HWOA 3CQEA 3QTRA 5ACKA 3OEFX 3ENMA 4YLJA 3QRJA 3F3ZA 5DHJA 3ZMMA 4KWPA 3EHAA 3R9NA 4EUTA 5IQDA 4BYJA 4IX4A 5AP7A 3FMMA 1YOJA 4WIHA 5HESA 3PP0A 1DAWA 4EH4A 4GU6A 5FWKK 3V01A 3FV8A 3Q4TA 2RFNA 3EN4A 2ERKA 3ZOSA 4PQNA 5IF1A 1W82A 5BVFA 4RSSA 5HZNA 4I21A 2H6DA 4UX9A 1J1CA 4KIOA 2VNWA 2X7FA 4EC9A 4HVSA 3N4TA 2X2KA 4JDIA 3N4VA 4CLIA 5CQWA 5K4JA 4NKAA 4CLJA 3FL5A 2ZV9A 3QC4A 3ZU7A 3S00A 3P08A 4ZIMA 3E5AA 4U43A 3ENHA 5HBEA 4AXAA 1PXOA 4IXPA 3R02A 5TR6A 5JEBA 3PXQA 4FT9A 4P5QA 4UYNA 5IMEA 2GS7A 4ZSLA 2UZUE 3FSFA 3HAVA 4OTDA 4E4XA 1ERKA 2RFEA 2CGUA 3QUEA 4V05A 4FIEA 3L8PA 1RJBA 1Q8TA 3DDQA 4RJ5A 3QQUA 2OLCA 4DTKA 4XLIA 3TUDA 5GJFA 2XYUA 4XNEA 4GT4A 4WT6A 5EFQA 3G2FA 1JKKA 4FSQA 4YLLA 5D1JA 4ZSJA 4D2VA 4KUJA 5BVDA 2WIHA 4RBLA 5ANJA 4F6WA 3PE1A 3DAEA 3PJ2A 5H8BA 3MDYA 5L4QA 2GNIA 4HCVA 4UZHA 4X3FB 4ANQA 2CCIA 4PF4A 3DNDA 4CRSA 3DKOA 3UO4A 1BMKA 4UZDA 4AF3A 2EWAA 5FD2A 3G6HA 4FV7A 5J9YA 1U54A 4B8LA 4B4LA 2X2MA 3ORKA 3MY5A 4TWCA 2IO6A 5CSWA 3CP9A 5ANEA 4G3EA 3ACJA 1REKA 1Y57A 2HYYA 3BQRA 4ZSEA 3C4ZA 3OROA 3HAMA 1KOBA 4FT0A 4HPTE 3R83A 3EJ1A 3QU0A 2B52A 3K54A 4XP3A 4EQMA 3VIDA 2EUFB 3OXZA 4A4LA 4D1ZA 2ZV2A 4N6YA 4XV3A 3UOHA 2PUIA 2OJFE 3PVWA 3U9CA 5HBHA 5JFVA 3TNHA 5BVOA 5AEPA 4JDHA 2VTRA 3R28A 2ZJWA 4F9YA 5DRDA 3C51A 3G9LX 1IG1A 3GT8A 4FT3A 4FTIA 5LMKC 4XG7A 4ARKA 1CKPA 4BIEA 1WBWA 4C61A 2PMOX 3VHKA 4BDGA 2WEIA 1DI8A 2HW6A 5HHWA 3AC8A 4CCUA 4NM3A 1Q24A 4G2FA 5EW3A 5AUYA 3VBVA 2R5TA 2Y7JA 5AUVA 4TZRA 1GIIA 4IVCA 4YLKA 4QMXA 4P90A 2VTLA 2VZ6A 3B8QA 3FI3A 4J8MA 2XA4A 5CU4A 3BI6A 3H0YA 3P4KA 4S2ZA 4CFFA 2BKKA 1KWPA 4OBOA 2CKQA 5CASA 3ACKA 3IECA 4DCEA 4MD8E 5CEKA 3TG1A 1WVWA 4QYEA 5EH0A 4B9DA 2QU5A 4IB3A 4I0RA 2YHVA 3IONA 3E3BX 3VQUA 5IEVA 4KB8A 2X6DA 1H28A 4X6QC 2VU3A 1P4OA 2VTHA 4C37A 4FNWA 2JDRA 5EDQA 5IU2A 4FV8A 4UV0A 4CKRA 3ZO3A 4AFEA 4ERWA 4QYHA 3QD2B 2YA9A 4ASZA 4BCKA 4A9RA 4LL5A 3KGAA 4FTKA 4DH5A 1H0WA 4MAOA 4B6LA 2RSVA 4YJQA 3OCGA 4JG7A 2OH0E 5HE1A 4YZDA 4A9TA 2ACXA 5B2LA 2C1AA 5CZHA 1WCCA 2UUEA 4BDHA 4FK6A 5A6OA 2XNNA 4XBRA 2I0YA 2CPKE 3IW8A 4C3FA 3PA4A 5JZNA 1PXIA 3QRTA 2VAGA 4FV6A 4TWPA 4G9RA 5KE0A 5AA9A 2W1ZA 1PHKA 3PXFA 2OSCA 4NT4A 1SNXA 2BIYA 4N70A 5GZAA 2F57A 5M4UA 3ZFMA 5DRBA 3PG3A 3EMGA 2BUJA 2OWBA 1Q61A 4W4WA 4USEA 4DF3A 3PIZA 3FAAA 3QA8A 2YM6A 1Q8YA 4EHEA 2XJ0A 3NX8A 5CSXA 2Y4PA 2J4ZA 3FZRA 4D4VA 2WQOA 4J52A 4DFZE 4IM0A 3DV3A 2PVYA 1ZY4A 2JC6A 3E8NA 2F4JA 4FSYA 4FTCA 4QP7A 4XG2A 2H96A 4MCVA 4D1SA 4DEHA 4EH2A 3DBEA 1OL1A 4PX6A 2R3RA 2W99B 2CHLA 4OTQA 5HLWA 3MYGA 4FNZA 3OT3A 4L01A 4QMSA 3OP5A 3NNVA 5BVWA 4EQCA 4FEWA 5ANIA 4FTJA 4AW2A 5BPYA 4XG6A 1YI4A 3EQPA 1J7LA 1BL7A 3UG2A 3CQUA 2WU7A 2R7IA 2BHEA 2FUMA 4G16A 3IPHA 4K8AA 4WBBB 4XRLA 3LMHA 2OZOA 3UOLA 2QO7A 5A54A 3QUDA 4XMOA 2UW6A 5AR4A 5FTGA 3HP2A 3CKXA 3NNUA 3PXRA 4GSBA 4FL2A 2XYNA 4GU9A 4LRJA 5DBXA 5DE2A 3JR1A 1U46A 4FKRA 4DA5A 2XVDA 3UIBA 3LJ0A 3UNJA 2XK4A 2PZYA 4C4GA 1XH5A 4HYHA 4KIKB 3O17A 4FNYA 3RBWA 4BBFA 2QCSA 1L3RE 3GQIA 3QTUA 4D28A 3VJOA 4PL4A 5LWMA 4Y85A 1M7QA 2UVXA 2Z02A 3OUNB 4KIPA 3QL8A 4ZTMA 5FBNC 4RX8A 4EWHA 3V6RA 3PIXA 4L8MA 4JRVA 3VUHA 5IH6A 2ZM3A 5D7AA 2R4BA 3CY3A 4FX3A 5DH3A 4MX9A 1U59A 3U6JA 2R2PA 4RIOA 1IR3A 3NNWA 4GRBA 4BDIA 4YR8A 5JGDA 3WYYA 3W32A 4O7SA 4IMYA 5L2QA 4W8DA 3UPXA 5JT2A 5J1WA 2R64A 4YHTA 4GK2A 3BBTB 2XNBA 5AAFA 1ZOGA 4DGGA 3SX9A 5AP6A 5LVOA 2IPXA 4IHPA 4FE2A 2OIBA 4AE9A 4M3QA 4MXCA 1KE9A 5A4CA 3HRFA 5BYZA 4X3FA 5J5TA 1M2QA 2G9XA 5AV3A 5TF9A 3Q9ZA 4YZBA 2IVTA 3QQKA 5CAOA 4FTLA 1FGKA 1WMKA 3EFLA 4RGJA 1H1QA 2XZSA 4FICA 4XEYA 3U9NA 1Q62A 3E7OA 4CRLA 3I79A 2FYSA 4KBCA 3MY0A 3GENA 4ALUA 4EH7A 3EYGA 2UZTA 1TQMA 2P33A 2VGPA 2PE1A 2QOKA 3BLQA 3GEQA 2FO0A 3FLSA 4BL1A 4FZ6A 2W1CA 4R3PA 4FTRA 4NUSA 3BGPA 2CCHA 1WFCA 2V0DA 3DA6A 3AC3A 5JQ8A 1R39A 5ANOA 3UE4A 3GXLA 3B8RA 2VWWA 5G6VA 4E7WA 5F20A 4E5WA 3MJ1A 3U55A 2LAVA 2H34A 3FLWA 3QCXA 4D4SA 5M06A 4GVAA 3WZUA 4CFVA 4A9SA 3ZUVA 2RG6A 4AZFA 2A2AA 1OM1A 4F4PA 1SVHA 4FV5A 2CKEA 4FYNA 1WVYA 4Z55A 3E8EA 2WQBA 4XUFA 5DT0A 2QI8A 1SVEA 2XKFA 1VJYA 4U79A 4QMYA 2FSMX 4FTQA 4YP8A 3T8OA 2QVSE 3ZSGA 4AN3A 3HVCA 2FVDA 3T9IA 4FIFA 4AW0A 2BRBA 3ET7A 1PXNA 4L45A 4MBJA 4AQCA 2HCKA 3TIZA 3HUCA 3NUPA 4M15A 1FVTA 5IH5A 2H9VA 5C8NA 5CAQA 5EYDA 4XH6A 4XG3A 1HOWA 3MI9A 4WKQA 3PY3A 2WEVA 3M2WA 1K9AA 1G8SA 4FV3A 1IAJA 3T9TA 5IQIA 4RWJA 4CGAA 3Q2MA 5I9WA 1OIRA 4WO5A 3V5LA 4E73A 3GOKA 4KBKA 2G1TA 4E6AA 2JKMA 2ZMDA 3WF5A 2JDTA 2PULA 2F7EE 4ZZOA 5EQEA 3C1XA 3BEAA 5LOHA 3WYXA 3BHUA 4RZVA 2W96B 3BGZA 4AW1A 3LCSA 3KMWA 1PRYA 3F88A 3QTWA 4LOQA 4K6ZA 2FSOX 4MQ2A 5BNJA 2UVYA 3FZPA 2JKKA 4X6RA 5FDXA 4K0YA 3QCYA 4DEGA 3EQRA 3OS3A 3VBWA 5CEPA 1BLXA 3KU2A 2R3FA 3MH0A 3F9NA 5FBOA 3QZIA 3R7IA 3V5JA 1YWRA 4ZEGA 2IVSA 4ASDA 3UOKA 3A7IA 3UOJA 2CGXA 2JKQA 3Q4CA 3R2BA 4FVRA 3O7LB 1ND4A 1CM8A 2NP8A 2X0GA 3QHWA 3M11A 1K3AA 1H8FA 3QLFA 4M0ZA 2WMWA 2E9VA 2QURA 4IACA 4XBUA 3CS9A 2XKCA 3FMLA 3ZFXA 2R7BA 1V0BA 2XIYA 3QQLA 3T3UA 5I9XA 4U45A 2BMCA 4FA2A 2QQ7A 1IA9A 1DAYA 2OXYA 4LGDA 2B1PA 4LRKA 2W5HA 4ZSAA 4J53A 3S3IA 5LMKA 5H2UA 2WTCA 2ZDTA 2W1EA 3QC9A 1H1SA 5M55A 3R9RA 2ITTA 4EONA 3AMAA 5FG8A 3TDWA 4TN6A 3SQQA 3MH3A 2C1BA 2PY3A 3NUYA 2BAQA 2YLEA 5D10A 4EORA 4F1MA 4F9AA 5DGZA 2OU7A 5E8WA 2ONLC 3E64A 4QP8A 3OD6X 1EH4A 3GCVA 4M67A 4UYAA 3VBQA 4JQ7A 4S31A 3IK3A 5CVGA 3NCGA 3QCSA 4BICA 4FK3A 5HTCA 2FGIA 4JG8A 3TM0A 3Q5IA 4BKYA 2VUWA 3WF6A 4AZEA 5D12A 1M52A 2R3NA 5C03A 4BTKA 3BHTA 5HTIA 1KUTA 3HRBA 3AT3A 3NLBA 3SRVB 1E9HA 3ZO2A 4BRXA 4YC3A 2PL0A 4BBMA 1PXPA 3IGOA 4YBKA 2PUPA 1YKRA 3ORPA 5T68A 2EVAA 5I9UA 3OOMA 2XEZA 4QTDA 1XQZA 3NCZA 4RX5A 4IADA 5FEDA 4EOJA 3A60A 4Z16A 4FIJA 3DJ5A 4PDSA 5BUIA 4KSPA 3DKGA 4DE4A 4TY1A 3RTPA 1V1KA 1OKZA 3TZ8A 3CJFA 4HGTA 4RIYB 5E91A 3VS7A 1IA8A 4M8TA 3KXZA 3TTJA 2CKPA 3OBGA 3R7YA 2X4ZA 3EQBA 4UXQA 5EM8A 5FDPA 4WG4A 4KIKA 4GG7A 5A4LA 3ZDUA 4PP7A 4WUNA 3UYSA 2J6MA 3H9OA 1XH8A 3LVPA 3V51A 2J90A 4BZDA 2PUNA 5BUEA 4JVGA 4FV2A 4LUDA 4M13A 1WBNA 4U0IA 3VUMA 2HZ4A 4FSRA 2GSFA 3VAPA 3NMUF 2Z7LA 3UP2A 3ZZWA 2GNFA 4PWNA 4BCPA 5ITAA 2UW3A 3AXWA 4B99A 2PVNA 4LGGA 5AUXA 1GZKA 3U87A 5IUHA 3OF0A 3CPCA 3P9JA 5CWZA 4I23A 5I9VA 1GZOA 4ZTRA 3VUGA 4CZUA 2OJJA 3HV4A 4O6EA 3QKLA 2GNHA 1ZYSA 4G6NA 4XJ0A 4YTFA 3ZO1A 2GTMA 2OICA 3LAUA 4FKTA 3R7GA 5EKOA 4L3PA 5AUUA 3ULZA 1H00A 3JY0A 5CF4A 3EKNA 2P0CA 3D2IA 3GOPA 3AC1A 1CTPE 3QZHA 2QKWB 4GJ2A 4PPBA 2B55A 2EB2A 2X1NA 3RINA 4R77A 2OFVA 2JIVA 3IGGA 4BCMA 1WVXA 4G3FA 3KCFA 3ZHPC 3DJ6A 4H1JA 2BKZA 4EHVA 3P1AA 4GT5A 2QHMA 4QMOA 4CCBA 2OO8X 5FGKA 5E8VA 5GHVA 5JRQA 4ERKA 4TYEA 3HDMA 4L3LA 3SXFA 5IEXA 5DVRA 3UDBA 4I5PA 2OFUA 1TVOA 4M12A 3LZBA 4CZYB 1LP4A 3NYNA 4TRLA 4F63A 5HGIA 3JPVA 4D1XA 4U44A 2C3IB 2JITA 3EKKA 3DBQA 2ZOQA 4FSZA 3KRRA 5A14A 4YJVA 5HIEA 1L8TA 3QWJA 1OBGA 5CT0A 3FC2A 3S95A 2ZB0A 3L9MA 4NW6A 2BR1A 2VTAA 4ZTLA 3O8TA 4BWKA 1ZYJA 2XNEA 4F0IA 3V6SA 3F5UA 3TNWA 4EOQA 3FJQE 4DG0E 2OF4A 2C0IA 2HOGA 4RA4A 5EM7A 4ACMA 2RF9A 4D9UA 4O7YA 1R1WA 2Y9QA 4GK3A 2QD9A 4G34A 4AA0A 3QA0A 2J0IA 3QXPA 5EQPA 4DG3E 4V0GB 5EW8A 4G17A 2CJMA 5CVHA 3D14A 4E6DA 4NM7A 1JSTA 4YU2A 3EH9A 3Q6WA 2ZV8A 3GC7A 3R9HA 3MFRA 4E8AA 3R30A 4E4MA 2PPQA 3TACA 2Z60A 4PDPA 4OT5A 4JAJA 5CSHA 5I3OA 5KHWA 3HNGA 3W33A 4C0TA 5ACBC 3QKMA 1TQPA 5DFPA 5KO1A 4IIRA 3JY9A 4IDTA 1UU7A 2XK6A 2Y6OA 3F61A 2VTSA 4JNWA 4G9CA 3TKIA 2JGZA 4M84A 2JD5A 5HE2A 5EDPA 4JAIA 3A7JA 3V5PA 3LJ1A 4EKKA 2IN6A 4DBNA 4JXFA 2J0LA 4FKVA 2C6KA 4YSJA 5GNKA 3F2RA 4J96A 4QYGA 5E8UA 2J5EA 5DLSA 1YWVA 1KE5A 2UZBA 4AUAA 3ROYA 4I20A 4IZ7A 4AZVA 3FI8A 1H1WA 4D0XA 2ITVA 3VRZA 1J7UA 4AW5A 3SXRA 1YHWA 1WAKA 2R3JA 3FE3A 3P23A 3LJ2A 2YM5A 3W2OA 4G6LA 4KINA 4BWXA 5IDPA 2ITOA 3KA0A 5AV2A 5HEZA 4ACDA 5AM6A 3K5UA 2YM3A 3L8VA 3W2QA 1NVSA 2HK5A 4DAWA 2WXVA 4IC7A 1NXKA 4IX6A 2YIQA 3GBZA 2QOBA 4BDCA 3CGOA 4X2GA 3D0EA 2JIIA 4RVMA 3LFDA 2NNWB 1Y6AA 1NY3A 2BDJA 4ZLZA 3KXXA 3WZKA 4BI2A 5CF8A 4ITIA 2DQ7X 5LVNA 2VO0A 4WHZA 5IH4A 3Q4ZA 5L6PA 1LR4A 2WTDA 4XP2A 4FGRA 3VQHA 4U40A 4MHAA 1GZ8A 3VS2A 3U54A 2XNGA 3DAJA 3R7EA 4QP4A 4F1OA 4E1ZA 2BTRA 4WD5A 2QR8A 3QXOA 3DKFA 3FLZA 4TYIA 3C4XA 5HNGA 4BKJA 4UMUA 4Z3VA 3QGWA 3SRVA 4CG9A 3Q9YA 4NCTA 1P4FA 2EXCX 4UMRA 5KMJA 5HCYA 4RX7A 4FUXA 4QTBA 4Y8DA 3NUUA 4FEXA 3H10A 3FSKA 3UZPA 5M4IA 4F7SA 1ZYLA 4NEUA 4MXOA 3PJ1A 3PSBA 3NUXA 4UMQA 3LLTA 2VTMA 4OT6A 3ZBFA 3RGFA 4BR3A 3GU4A 4G31A 4WRGA 3RAWA 3UZTA 4MTAA 4RIYA 4F6UA 5IQCA 2R3MA 4IVBA 2HY0A 4G5PA 4DITA 3KCKA 5AM7A 2P3GX 3FUPA 3OXTA 3SW4A 3DNEA 3SOAA 1PMVA 5CU3A 1PXKA 5HO6A 5AWMA 1ZMUA 1JVPP 3GGFA 4AGUA 2B9FA 4RJ7A 4ZTSA 1OECA 5HTBA 4I4EA 1H1RA 4N0SA 4LFIA 4YC8A 3QQJA 4C4FA 3OWPA 4C02A 3QAME 3ZONA 3PWYA 2P55A 1UNGA 3AD4A 3PA3A 3L8XA 1O6LA 4FC0A 2DUVA 4A9YA 3R01A 3C4EA 3FMEA 2ZYBA 4D5HA 2PZIA 4I92A 2AUHA 3DTWA 4NW5A 5IA3A 3PPZA 4DH1A 3HMOA 3ATTA 3A61A 1YI6A 4EHZA 3BIZA 2GQSA 5EI6A 4X3FC 2ONLA 3ZRLA 4LV8A 5FEQA 3EB0A 1OBDA 3H9RA 4GUBA 3C4WA 4YMJA 3A8XA 1KSWA 3F82A 5M56A 1Q3WA 4AZWA 2IZRA 3QWKA 3RMFA 3L1SA 3TN8A 3CQWA 2X9FA 2ETMA 4JLCA 1URCA 3A4OX 3QTSA 5E7RA 5HO8A 4AAAA 2C68A 4C4JA 3PYYA 3OW3A 5EHYA 5HD7A 4IM2A 2BDWA 4I6BA 2UW5A 3ODZX 4Q5EA 1O6KA 2XNMA 3HMMA 3MVJA 4LV5A 4GK4A 3UTOA 2C69A 3NW6A 3DJ7A 5FP6A 4R8QA 4BCGA 4WNKA 4FF8A 5EQYA 4OTPA 2DYLA 4JDKA 1UVRA 3PLSA 4FI1A 3VUTA 5FM3A 5IQHA 2HWPA 4IJPA 4O1OA 4L42A 4DC2A 3OY3A 2R3IA 2YDKA 4TXCA 3QUPA 3D5XA 5J5SA 4L9IA 2KTYA 3VN9A 5TKDA 4CT1A 4TWNA 1BUHA 3K2LA 3ZUUA 4ACHA 4FV0A 4QT1A 4EC8A 3RHKA 2O8YA 4KD1A 4A9UA 4FG9A 4O7RA 3D5WA 3R0TA 2W1HA 2XIKA 5DR9A 4I93A 5AP4A 2RG5A 4O96A 5BMMA 4MK0A 3P5KA 3PUPA 2BRHA 3SG8A 4FSNA 3A62A 3PXYA 3Q53A 4P5ZA 3HX4A 3FKLA 2F7ZE 3ZCLA 4GS6A 4JBQA 4Q9SA 2VTIA 3SHEA 1Z5MA 1OKWA 2X7OA 2ITWA 2QR7A 4NIFB 4D55A 4EH8A 2PVJA 5M4FA 1ZXEA 4Y95A 4V0GA 5BX0A 3Q3BA 2XEYA 1LEZA 3FYKX 4IAFA 3RK9A 4YUQA 3SVVA 5AIRA 4TWOA 2J50A 4IBMA 1BX6A 4KRDA 3Q60A 4G3GA 1YDRE 3K3JA 2WOTA 3LM5A 4G1WA 4KKEA 4NWMA 5L2WA 2FA2A 5D41A 4WNPA 5KKRB 4QQJA 4R7BA 2W7XA 2YIRA 3JS2A 2PVHA 3FMJA 1FPUA 3RNIA 3ZXZA 3F69A 2C5VA 4FSTA 2O63A 4AACA 4HW7A 3F6XA 5KZ0A 3EN9A 5AUZA 1B6CB 2G2IA 4QP6A 3EZVA 3TL8A 4WBOA 3ZS5A 3Q52A 4RPVA 5CAUA 2VRXA 3RI1A 3O8PA 4O7ZA 4R3RA 2YIWA 4QD6A 4O81A 3PPJA 1U5QA 5AP5A 3UIXA 3Q96A 4FKPA 3FBVA 1DS5A 3M1SA 3AG9A 5F95A 4RJ6A 4XLVA 5AR5A 2O0UA 5FQDC 5AMNA 3I7CA 5LVLA 3DBFA 4JG6A 5K0KA 3KEXA 4YPSA 2BZKB 2E9UA 3KULA 4JBVA 4EBVA 2XBAA 4F9CA 2HW7A 4ONAA 3EOCA 2OXXA 3ROCA 2P2IA 2IG7A 1O9UA 5ETFA 2J7TA 3VULA 3QYWA 3CBLA 2A4LA 4HVIA 1FVVA 3QCQA 1V0PA 3FMHA 3UPZA 4AX8A 1H0VA 1WBOA 2X4FA 4F70A 1R78A 4PUZA 4Y5HA 2GFCA 5CF6A 3FQEA 3F7WA 4MXAA 3QYZA 4IDVA 1JOWB 1QL6A 3KN6A 3HV7A 4OTRA 4RJ3A 3BWFA 2A27A 3DXPA 4FKOA 2UZEA 4JX3A 4FG7A 4NTSA 2PWLA 3BWJA 3GC9A 2W17A 1W0XC 2C5XA 4HNFA 4D2WA 3EL8A 2E2BA 3UQFA 3B2WA 5LCKA 4QP3A 4BHZA 1GNGA 3ZYAA 4KNBA 1BYGA 4PMTA 2CKOA 2VN9A 3FLNC 1OIQA 2CSNA 4IANA 4CFNA 4M69B 5KHXA 3I0OA 4GT3A 1ZARA 4DLJA 5JN2A 5EYKA 4KS7A 4EI4A 2PE0A 5HCXA 5BMSA 5HVYA 1UV5A 4ZTQA 1SNUA 3GU8A 4J98A 3V04A 4W9XA 3BKBA 3CD3A 1OL7A 2GNJA 3E7VA 4PL3A 5LVMA 2XIXA 4ZMFA 4LQMA 2F7XE 4FOCA 3W18A 3MJ2A 2B54A 5TOZA 3NNXA 4RQKA 4YBJA 4GYIA 1VYWA 3PY0A 3N51A 1KE8A 2RIOA 4ITJA 2BALA 3ZM4A 3UJGA 1Z57A 2PZ5A 3VW6A 5HIBA 2YJSA 5J7BA 5JFWA 3IS5A 4GG5A 4QMLA 2HELA 2C0TA 5GINE 4XHKB 4HZSA 2GCDA 2WU6A 3LMGA 4X2JA 3U4WA 3UO6A 4BDEA 2QG5A 2WD1A 3FMKA 4FIGA 4MYGA 2WTIA 4ANBA 1A48A 3HEGA 4H39A 5EOLA 5HKMA 2YIYA 3KK8A 5A3XA 2WMRA 4TYJA 5B2KA 1CDKA 5JFXA 4PDOA 5L6OA 3QQHA 3WF7A 4WSQA 1BI8A 3BU6A 3G0EA 4BGQA 4KA3A 1GY3A 2G15A 4YNEA 2GMXA 3OBJA 4J95A 4X0MA 3I6UA 3LLAA 4KS8A 1ZMVA 3A99A 3RHXA 3HZTA 5E8TA 1FOTA 2GHLA 5M08A 3KY2A 2QLQA 4EOMA 2WMQA 3I5NA 3TZMA 4X2FA 1QPJA 3C4FA 2BRGA 5M51A 1OUYA 3FLYA 4PY1A 5EM5A 4FZ7A 1WBTA 2BZHB 1OKYA 1PJKA 3H9FA 4AZTA 3JVRA 2W4KA 3MPAA 2ZAZA 3KMMA 2C30A 3QX2A 4RFYA 2Z7RA 5AIKA 4HJOA 4IB5A 2A0CX 4D2RA 2X6EA 3C9WA 2X9EA 1ZMWA 4APCA 4F7JA 3FQHA 3ZM9A 1APME 3RAIA 3E93A 1OPLA 4LMUA 3LPBA 4WRSA 4C58A 4MXZA 2XCHA 3OZ6A 2ZVAA 4FSUA 2R3GA 1QPCA 2B9IA 2VX1A 4MEDA 3AC2A 4Y46A 3FY0A 3LQ3A 3PSDA 2WNTA 4IZAA 3O2MA 3AT4A 4B8MA 4CNHA 4GKIA 4BZOA 3P7CA 3QTZA 2ZM4A 3UQCA 2OJGA 3CTJA 3U6IA 4CXAA 3PPKA 3R1NA 1W83A 3D7TB 3VWAA 3IOPA 3AD5A 5JGAA 3NGAA 2DS1A 5CF5A 3PXKA 4F7LA 1XH9A 4BCHA 2I1MA 4MXXA 3MTLA 2YDIA 2O3PA 3COKA 3JUHA 4FKLA 2V7AA 4NZWB 3ZLWA 2GQRA 3IDBA 5DT4A 1DM2A 1HCKA 1CMKE 3HV3A 3TJCA 3EWHA 3AOXA 3R8UA 4FT5A 3KREA 2V62A 1F0QA 1S9JA 3UO5A 4DGNA 2NPQA 3O51A 5I3RA 4BN1A 4XOZA 4DGOA 4E3CA 4FGBA 4YTIA 4UWCA 3R7UA 1YWNA 2C3LA 3R1QA 4FZFB 3QZFA 5DMZA 4IWDA 1MQBA 1FQ1B 4FEVA 3LXNA 4J99A 5HD4A 5AJQA 5H9BA 2XB7A 3LCKA 4IVAA 1UU9A 3RVGA 5D9HA 4I5CA 2R3HA 3AC4A 5CU2A 3OTUA 1YXUA 2BROA 3I81A 3KXNA 5LJJA 3AGMA 5CEMA 3LFBA 2ERZE 2ITPA 2GPHA 5DI1A 5L3AA 4QYFA 3G33A 4OTWA 3MV5A 5KMLA 3R9DA 2F9GA 1YOMA 3BE2A 2XKDA 3BYUA 3NWWA 5HNIX 1Y6BA 3REPA 1B38A 3DU8A 3R6XA 4H58A 3RWPA 3ULIA 3ZLYA 5AR8A 3CPBA 1CKIA 2G2FA 3D5UA 4R5SA 3DK3A 4AWIA 3ZBXA 2RGPA 4XV2A 5CNOA 5C4LA 4RLLA 4FZAB 3KKVA 4QMZA 5CU6A 2VTTA 4GH2A 2Y4IB 3NUSA 3F3TA 4QMVA 1BI7A 2OJ9A 2UW7A 5CTPA 3CIKA 4OTHA 1GIHA 4PMMA 5EYCA 4I4FA 4O38A 1FVRA 5FRIA 2YFXA 4RC4A 4XV1A 3NIZA 5FTQA 3EFJA 1GOLA 4S34A 3UP7A 3E3PA 3FZOA 4HYUA 4UXLA 3R7VA 4L67A 2C6DA 2XF0A 3SAYA 3A8WA 3MN3A 4OBPA 3OT8A 4K18A 4DH3A 4A4OA 3KC3A 3WZEA 4F1TA 2IWIA 4NCTC 5E8ZA 3VBTA 2FSTX 3S4QA 4TL0A 3TV7A 4O7TA 3RZFA 4O86A 2ZV7A 4W4YA 2QOLA 3PVGA 1Q41A 1WBVA 1H1PA 1NVRA 4AE6A 4EOSA 2C6OA 4F7NA 2VTQA 3UZRA 2OW3A 2UVZA 3EN5A 3W2SA 4RJ4A 4EK5A 3I1AA 4YTCA 1ZY5A 2YISA 2JDVA 4M69A 3IW7A 3JXWA 3ZFYA 4KABA 3FZTA 4U81A 5HCZA 2C5YA 4YJTA 3FHRA 4JL9A 3BRBA 4BKZA 3LFCA 4CMOA 2W4JA 2IZSA 3NRMA 2GU8A 2IW9A 3FZSA 4DFLA 3RJCA 3MFUA 2R9SA 4DEDA 5I9ZA 3Q9WA 4M66A 5DIAA 5DOSA 1V0OA 4TW9A 3QD4A 3Q32A 4C38A 2BCJA 3S0OA 2Q83A 2QO9A 2YAKA 2YABA 4H1MA 3EFWA 5C27A 2RFDA 4FTOA 3RZBA 3IW4A 2XBJA 1YHVA 3P0MA 1YDSE 5T6KA 3QTQA 3ORIA 2VWVA 4NM5A 1UU3A 3TNIA 3LFAA 1OL6A 2BFYA 4PTCA 3FXZA 3DQXA 4IWQA 4PDYA 5F4NA 4NFMA 5J79A 1I44A 2W1DA 4FTTA 4DLIA 4ZY4A 3B2TA 1M2PA 4QMQA 2XNOA 3HKOA 4EZ3A 3MIAA 3HLLA 1NA7A 3NYXA 3F7ZA 3GCPA 4DEEA 1W84A 3EQFA 4MF0A 3LFEA 3E62A 4L53A 3R8ZA 5JSMA 3F3VA 2YM7A 3UG1A 4HVDA 5CENA 3QHRA 3D94A 2RL5A 3NUNA 1M17A 5CY3A 3DGKA 5A4QA 3TEIA 2HXQA 4CKIA 3ORTA 3PSCA 4HYSA 3U51A 3WARA 1JWHA 4HGEA 2OBJA 3QQFA 4ZLYA 4IAIA 3BHYA 4IJ9A 5FLFA 3MW1A 5A9UA 5F1ZA 2R0UA 5J87A 5BVEA 3MA6A 4V01A 3KVXA 3VRYA 4O2PA 5DEYA 1SVGA 1PMEA 4U9AA 1Y8YA 3LCTA 4MKCA 3FDNA 1LUFA 3PVBA 3ORMA 3UC3A 2C6IA 3G0FA 1T45A 2XIRA 4GMYA 3W2RA 1JAMA 2WMSA 2QO2A 4FV9A 4IEBA 2WAJA 4E26A 5BYYA 1R0EA 3C50A 5ETIA 4O82A 3PXZA 2WMXA 3W1FA 5AR3A 4M68A 4U6RA 1SZMA 3LHJA 4F09A 4FEUA 4OR5A 3H4JA 3WE8A 4GL9A 4O22A 3ALNA 4OBQA 4F64A 3EZRA 4QTEA 2W1GA 5DWRA 3Q6UA 4FTNA 2JKOA 2X81A 4CFWA 3GP0A 1UA2A 3ID6C 4I6FA 5K3YA 3NSZA 4Y5QA 3MIYA 4ZLOA 3OXIA 3HUBA 2XKEA 4CMUA 4F0GA 5J9LA 3WF8A 5IUGA 2J5FA 2F2UA 4YZ9A 5KMIA 4CSVA 5HX8A 3FHIA 4XP0A 1U4DA 4IE9A 4RIWB 4MNEB 4YZMA 4ZOGA 3K5VA 1KOAA 3E88A 2I40A 4BCFA 2XK3A 4GFOA 4U42A 3OCSA 1H25A 4IVDA 2YACA 3VW8A 2QONA 3ZEWA 3DK6A 2OGVA 3GFWA 5HE3A 4D5KA 3ORLA 4FVQA 3Q5ZA 4BCNA 3U8WA 1PYXA 3OCBA 3ZC5A 1ZOHA 2I6LA 4TKSA 4ID7A 2JFMA 3MFSA 2NO3A 2QNJA 1MRUA 4BHNA 3AQVA 3CLYA 4DTAA 4HGLA 1G8AA 4BGHA 4LYNA 2QOHA 5HIDA 4D9TA 3BCEA 5BVNA 2Y0AA 2YERA 4FODA 1Z9XA 3I6WA 4HYIA 4K33A 4PTGA 4ASXA 5I5ZA 3WBLA 5CAPA 3RPVA 4USDA 1UNLA 2OI4X 3EN6A 3OWLA 3CE3A 1R3CA 4FKGA 4JQ8A 5GZ8A 2B0QA 4MD7E 2Z8CA 3OHTA 3COHA 4BI0A 3O50A 3BLHA 2XK8A 3C0GA 1UWHA 1OB3A 5FM2A 4EQUA 3R63A 3P86A 3NUAA 4JIAA 2HZNA 2JAMA 4DBXA 5I0BA 3P7BA 4N57A 5E4HA 3GU5A 4W4VA 5AV4A 4XYFA 5CS6A 3MBLA 4O1PA 4NH1A 3EN7A 4NFNA 3HMNA 3THBA 1G3NA 3KL8A 4I3ZA 3VBYA 2WMVA 2ZMCA 2ITNA 3DAKA 3ANQA 4GFMA 2PVKA 3QD3A 2BRMA 1Q8WA 3CR0A 3RM7A 4D4RA 4HCTA 4JQEA 2CLQA 1PXLA 5GZ9A 4ANMA 4GYGA 5IG1A 4FIIA 4UN0C 2J0KA 4EH3A 4FEQA 4O7WA 3ZRMA 4FR4A 1NT2A 3O71A 5E8XA 4JDJA 4AA4A 3V3VA 3H0ZA 4EZ7A 4AS0A 4RWKA 5CU0A 3RCJA 5CALA 1PY5A 3TWJA 4D2PA 3SC1A 3ZSIA 3QKKA 3RK5A 4QTCA 3ZC6A 1XH6A 5CI6A 3KFAA 4O84A 4E5BA 3UMWA 4PTEA 5C9CA 3CTHA 5DNRA 3K3IA 1W7HA 2J2IB 1ATPE 2BTSA 4R78A 3GQLA 4XV9A 2JEDA 2F49A 1U54B 4IW0A 4K77A 5D11A 5EI8A 3FPQA 3KMUA 3TI1A 2UZVA 2Y6MA 5J8IA 3D15A 2QG7A 3LFNA 5FUTA 3LIJA 3R1YA 1JSVA 2CGWA 4IZYA 4C4IA 4L7SA 2B9JA 3TDVA 2X2LA 4WSYA 3HA6A 5KBRA 4ZS4A 4CFXA 4YC6A 2I0EA 1QPDA 4DHFA 5K9IA 1K2PA 5CXHA 2ZDUA 5AV0A 5K4IA 3QTIA 2CN5A 4H05A 4LG4A 3DFAA 3SXSA 3VBXA 1NVQA 4BDFA 3VS3A 3UGCA 4AT3A 3VS1A 4IZ5A 5TE0A 4Y72A 4NTTA 4GKHA 2NRUA 5L8LA 1FMKA 4QNAA 5K5XA 3PG1A 4D2TA 2YCFA 4BFMA 2VWXA 3OUKA 1AGWA 2WTWA 3D2KA 3VS6A 1STCE 4CZTA 1YW2A 4I5HA 4JBOA 5HVJA 4ALWA 4DEIA 3WF9A 4C2VA 4PRJA 3IW5A 3G51A 4ZY5A 4JRNA 3LM0A 4FIHA 5EDRA 3HA8A 3QBNA 4CYJA 2OG8A 1KV2A 4RIXB 4EWQA 2B53A 2PMIA 4JBPA 1AD5A 1IRKA 2XH5A 4AT5A 5TT7A 1F3MC 3MH1A 4AN2A 2VX3A 3O7LD 4BBEA 4L44A 4CMTA 3H3CA 4EHGA 5L2SA 3W8QA 4BTMA 3ORNA 4WOVA 5AP1A 3LQ8A 3TKHA 2GQGA 1OVEA 2WZJA 3OG7A 4J8NA 5DEWA 1OL2A 3KXGA 3MESA 3CC6A 3POZA 5LXMA 4BTJA 5AADA 1F5QA 5HLPA 2W5BA 2XM9A 3DXNA 5EG3A 3V5QA 4BVUA 3GU6A 4KBAA 4EOLA 2C0OA 4LOPA 5HICA 4O2ZA 3DB6A 4CFUA 4CQEA 4PMSA 5ANDA 5IA4A 5CXZA 2HENA 4I0TA 3C7QA 5JK3A 1UNHA 3NW5A 4TYGA 3UODA 2OXDA 2UW0A 2XJ2A 3NYOA 3TTIA 4DEBA 4L3JA 3MY1A 3TZ7A 1H07A 4YJPA 5GIPE 2E9NA 4MVFA 5IA1A 4UWYA 4AP7A 3IO7A 3OEZA 1AQ1A 3SW7A 4C8BA 3EQCA 3I4BA 2I7QA 4KSQA 3A2CA 5ICPA 3DLSA 3R8VA 1XHAA 4MNFA 5FXQA 3QD0A 3QRUA 3GCUA 5KMMA 5KKRC 2C47A 1M2RA 3R71A 3O96A 5KX8A 4DGMA 3GFEA 5DT3A 4RIWA 4X2KA 3ETAA 4H3PA 4MNEA 1PF8A 2QOIA 3FLQA 3KRXA 4IAKA 5EW9A 1JSUA 3L8SA 4RZWA 5AX9A 4BF2A 5J9ZA 5IQBA 1IASA 2ZB1A 3V8WA 3FMDA 4H36A 2C5NA 5IKWA 2QOCA 3FI4A 3WE4A 4Z7HA 1PKDA 3KF4A 3PDTA 4ZTNA 4UEUA 4ANSA 1U5RA 1XBCA 3I0QA 2YCRA 3QZGA 4PL5A 4FUYA 5DPVA 1GJOA 2VTNA 3VVHA 2WQNA 5EOBA 2PVLA 3IW6A 3OTVA 3DFCB 3AD6A 1KE7A 2W4OA 4EJ7A 2WO6A 2PZPA 3NS9A 4MD9E 4RRVA 3LXLA 3OWJA 4H3BA 3VF9A 3ZXTA 1UKHA 4OTGA 4DINA 4EH6A 4HZRA 1PMNA 3I5ZA 5CSPA 2PE2A 2ITXA 4QQTA 1GIJA 3HV6A 2C6MA 3VC4A 4I41A 4BYIA 3AMBA 3SOCA 4E6QA 3PP1A 4NKSA 5J95A 3S2PA 3LMIA 4E6CA 4O0RA 1YOLA 2I0HA 4KKGA 4QPMA 3L9PA 2VWYA 4QMMA 5CSVA 3FY2A 4A07A 4YO4A 5KCVA 1XO2B 4GW8A 3PA5A 4ZZNA 4ZXTA 4OAVB 3ZTXA 1OIUA 1J3HA 4IH8A 5G1XA 3BGQA 3DZQA 4YZNA 3BV3A 3ZEPA 2BRNA 2PTKA 4BIDA 2O64A 3GU7A 5EHOA 4RVKA 4CD0A 3RCDA 3VS4A 3OW4A 1Y8GA 2WMBA 3E87A 4RC3A 3NPCA 1ZZLA 3SD0A 3TKUA 5M07A 3FL4A 4I94A 4ANLA 4V04A 3G90X 3D5VA 4C33A 1OI9A 3BYVA 3RPOA 3OCTA 5DG5A 4YTHA 4ACGA 2QLUA 3TZ9A 5BYLA 3F3UA 4MWIA 2CN8A 2QU6A 4XRJA 2F2CB 5C4KA 3CY2A 1RW8A 2IZUA 2XK7A 3SA0A 3F2NA 4GEOA 4QMPA 4R7HA 4ZP5A 4C62A 4BTFA 4IM3A 2VD5A 3GC0A 5KMOA 1Q8UA 2HZ0A 3SG9A 1FBNA 3PY1A 3FXXA 3SDJA 5HG8A 4P7EA 4DFYA 2GDOA 2P2HA 2YM8A 5DR6A 3ZH8A 3GVUA 4CG8A 4EL9A 2X8EA 3R73A 2XRWA 3GUBA 2GTNA 3KXHA 2XJ1A 3D83A 3O8UA 4L43A 3VNTA 3FKOA 1A9UA 2UZNA 3PJCA 2VTPA 3NR9A 4YZCA 4Y83A 3F2AA 5KZIA 4DFBA 5EI2A 1Q97A 4U5JA 2YCQA 3VS0A 1H08A 2QOQA 3PRIA 3N9XA 3PTGA 4HGSA 2Z7SA 2UW9A 2ITZA 4GV1A 3QRKA 5L2IA 3G6GA 2OH4A 3RNYA 5HLNA 2J9MA 2C6LA 3MSSA 4O0SA 2YLFA 3MPTA 5HG9A 2VGOA 2QOFA 3EQGA 3CD8A 3FZ1A 2V7OA 3R00A 5JGBA 2XP2A 5AUTA 5JZJA 3D9VA 2O65A 4OLIA 3AGLA 5AX3A 2C6EA 5FXRA 4FL1A 3ITZA 2YWVA 2R3LA 2UZDA 3D4QA 4C4HA 1WZYA 2ZM1A 5KNJA 4FBXA 1MUOA 4DTBA 3RK7A 4EK4A 2FB8A 4QMNA 5B2MA 1YXXA 5A4EA 3GCQA 2Z7QA 4MBLA 2YZLA 4C3RA 4MWHA 3LXKA 3E8DA 2IVUA 4I5MA 5I4NA 1W98A 3CSVA 3DB8A 1P2AA 3GC8A 5CEIA 2W06A 4ENXA 4U41A 1ZLTA 3PVUA 4XG8A 2GS2A 3C5UA 4QYYA 4YJOA 1BL6A 4LGHA 1JQHA 4F9WA 1VYZA 2JDOA 5L8JA 4ALVA 4FSMA 4RIXA 4BWPA 4I6HA 4LM5A 2WELA 3WIKA 4J1RA 3R8MA 1WBPA 5CQUA 1JPAA 2WB8A 3NAYA 5AUWA 3RPSA 1PKGA 4IX5A 4QQ5A 3BYSA 3KXMA 1H01A 2CGVA 4U7ZA 5HU9A 2BDFA 4EOPA 4FYOA 3O23A 4U80A 4ZSGA 1VR2A 2H8HA 4CQGA 4CTBA 4JR7A 5ETCA 4ZK5A 4EUUA 3QRIA 5CX9A 4TNBA 4GUEA 4PP9A 4G3DA 3RALA 5ETAA 1SM2A 3BYOA 3PJ3A 4OTFA 3H30A 3ODYX 4PNKA 1M7NA 3A7HA 2YEXA 3BU3A 4F0FA 2ITYA 3TT0A 5KMNA 2YCSA 1ZRZA 4YPDA 2V55A 3F5GA 5AP2A 3Q04A 3FC1X 2WKMA 3R04A 1YQJA 2YZAA 3ZLXA 5M09A 4G6OA 5FP5A 4DG2E 4RA5A 4TT7A 2X7GA 3PIYA 3DPKA 3KB7A 4UWBA 4C7TA 4ITHA 5CEQA 3QF9A 4CTCA 4D4YA 4I6QA 4WUAA 4DT9A 4FKJA 4FMQA 2Y8OA 4FT7A 3A4PA 4AOJA 4K9YA 2SRCA 3UC4A 3QQGA 4RFZA 5LMBA 3UBDA 4YJRA 3TCPA 2DWBA 3BX5A 2PVMA 3KRJA 4BB4A 2VX0A 3NDMA 3CEKA 4YO6A 2PSQA 4FKIA 4ZS0A 3RP9A 3CKWA 1TQIA 4AGCA 5CT7A 3DDPA 3UNZA 4AOIA 4BCJA 4EBWA 3GNIB 4MH7A 4FKQA 1JLUE 1OGUA 2VO3A 3LFQA 1ZYCA 4FTUA 2GNGA 2VO6A 1PW2A 3EQHA 3G5DA 3IG7A 4I22A 3MVMA 3ERKA 3W55A 4Q5HA 3R9OA 4BCIA 5H3QA 4C34A 4HOKA 2BPMA 1JBPE 1ZAOA 2J51A 3JYAA 4RQVA 3ELJA 3UMXA 3HRCA 3OMVA 4QRCA 2YITA 3MA3A 4DH8A 2OK1A 5HG7A 3COMA 4YHJA 5KMKA 4N4SA 2OIDA 1FINA 1VZOA 4YURA 2PVRA 3ZLSA 3P78A 1YHSA 4Q9ZA 4TTHB 4ZMEA 5L8KA 3ATSA 2Y4IC 3EFKA 5HQ0A 3TV6A 3C0IA 4ZJVA 4AU8A 2UZOA 3BYMA 3IOKA 4BDAA 3MB6A 1PXMA 4WNMA 4NIFA 1Q8ZA 2R0IA 2C3JA 3SKCA 4RJ8A 3MTFA 4M0YA 3TV4A 2XMYA 1GZNA 3ALOA 4O83A 4DN5A 3HV5A 1S9IA 1XH4A 4O0WA 4D0WA 4H3QA 3LCOA 5E8SA 2UZLA 4MBIA 4P4CA 4IFGA 4R7IA 5CEOA 5I9YA 5JFSA 4BZNA 4CT2A 4LL0A 3LQ5A 1Q99A 3WOWA 4DT8A 3MGYA 5AAEA 4OTIA 2AYPA 5AR7A 4QP2A 3L9LA 3F5PA 4K1BA 4JI9A 1SYKA 4O0VA 4WG3A 3NZ0A 1X8BA 4DFXE 4FG8A 4HNIA 1YI3A 4AGDA 4EOKA 1WBSA 2ETRA 2B4SB 2UW4A 5D7VA 3DBDA 3Q4UA 2VO7A 3FYJX 4YJUA 4YSMA 2JBPA 3DLZA 1KE6A 5IA5A 4HVGA 1OPKA 4DEAA 3W10A 3P7AA 5K5NA 2BVAA 4UMPA 4DYMA 4L52A 4S30A 4ANOA 2J0MB 1YXTA 1P5EA 3UIMA 4O91A 1XJDA 3PWDA 4AA5A 4KRCA 4ACCA 5J1VA 1G5SA 3HECA 2YWPA 3O0GA 5AAGA 1JKTA 3FWQA 5E1EA 4O0TA 5CLPA 2YDJA 4GJ3A 4HPUE 2E9OA 5IEYA 2IW8A 1OITA 2R3KA 5FXSA 2WMTA 5IA0A 3NIEA 4I1ZA 3RAHA 3TNPC 4TPTA 4W4XA 5K0XA 5M53A 4J7BA 3NVMB 3A7GA 3DKCA 4AFJA 4EK6A 2A1AB 3NW7A 2WQEA 3Q9XA 2O5KA 3R7OA 4RFMA 3VUKA 4AG8A 4NL0A 3ZO4A 5H8GA 3OC1A 2P4IA 4RWIA 5IISA 3UVRA 3IKAA 5HG5A 5JRSA 4ORKA 4RMZA 2W9ZB 3CXWA 5BVKA 4AOTA 5ANKA 1IAHA 1UKIA 3VS5A 1A06A 4XS2A 5CVFA 4RWLA 3TXOA 2YJRA 1GAGA 3E92A 4TNDA 5HU3A 2Z2WA 3BELA 4ASEA 3OFMA 5AA8A 2JDSA 4FL3A 4BDKA 4EZ5A 1LEWA 3V5WA 2NRYA 2PU8A 2VWUA 5E8YA 3QGYA 4CYIA 3E63A 4ZJJA 3DZOA 2HZIA 3LW0A 1OMWA 1KV1A 2BIKB 2J0JA 3BE9A 3F5XA 4BI1A 4EH5A 2WPAA 4MQ1A 3EYHA 3MVLA 4X7QA 3LKMA 2LGCA 2W0JA 3GCSA 1OPJA 2XRUA 5KBQA 2W1FA 4A06A 1RE8A 2EU9A 4UBAA 1PXJA 5LARA 2WFYA 1XR1A 4II5A 4IQ6A 4NU1A 4LI5A 5C01A 4F9BA 5J7HA 3UVQA 5ANGA 3VJNA 4PNIA 2CLXA 3DK7A 4LMNA 1JKSA 4JJRA 4QQCA 5L6WL 2QODA 4JR3A 3CJGA 4NSTA 1E1VA 4PMPA 5GIOE 2FH9A 2PHKA 2PMLX 5EHLA 2I0VA 2OZAB 1BKXA 4GVJA 3BU5A 4EEVA 4XOYA 3FKNA 2JAVA 3CTQA 3WZJA 4O7VA 2PVFA 2BAJA 4YHFA 2B9HA 4MF1A 2GFSA 2BHHA 4E93A 3OOGA 3DOGA 5LQFA 3HP5A 1UU8A 4GIIA 3OWKA 4IWPA 4X3JA 4BCOA 5IQAA 4YJNA 1J7IA 3ZDIA 1FGIA 5E92A 3RPYA 3TIYA 3DY7A 2CNVA 2WTKC 3RAKA 4BY9E 3SGCA 4PV0A 3R2YA 5E1SA 4PPCA 4IAZA 2W9FB 3RWQA 3QALE 4OGRA 2AC5A 5TO8A 2JBOA 3POOA 1QMZA 4G5JA 5IQGA 4NJ3A 1QCFA 2IZTA 3R1SA 4AN9A 5IDNA 2W05A 3IDPA 2EXMA 3KK9A 4F6SA 2WTJA 3IDCA 4KIQA 4XX9A 2CMWA 2A19B 3NAXA 4NK9A 2VV9A 2G01A 2GHGA 3RM6A 4F99A 2UZWE 4FSWA 1J91A 4FV1A 5DA3A 5C1QB 4RX9A 5IA2A 2BZIB 3DBCA 4EYJA 3W2CA 3LFSA 2PK9A 5HI2A 2BFXA 3FI2A 3VF8A 4EYMA 4F65A 5EKNA 3FPMA 3TNQB 3IQ7A 3AT2A 3D7ZA 1H26A 2IVVA 5A4TA 2VTOA 5JH6A 5CNNA 5DYJA 4L46A 1JNKA 4FVPA 5FTOA 3G15A 4U3ZA 4BIBA 2YAAA 4ANNA 2REIA 3P79A 5CI7A 3R8PA 4M7IA 3BZ3A 3BHHA 1HCLA 3EQDA 4ZTHA 3W2PA 4BGGA 2QKRA 1H24A 4C57A 3UNKA 4FTMA 4I24A 2X8DA 2VWIA 1CKJA 2YIXA 5GJDA 3S1HA 3KF7A 3FEGA 2QHNA 4AZSA 4BC6A 4YNOA 5CYIA 5LVPA 2CNQA 5T3QA 4NYEA 3FMNA 4GFGA 2XUUA 2JIUA 1YXVA 3PFQA 5IZFA 2VTJA 5KUPA 3D7TA 4FNXA 5AV1A 4R1YA 3BPRA 4UMTA 2HAKA 3GB2A 4IB0A 3WZDA 3FXWA 4CVAA 3VUIA 2WTKB 2IJMA 4U8ZA 4UB7A 4Z9LA 5HOAA 4HVHA 3HYHA 2OJIA 4EOIA 5C8KA 2C4GA 2XCKA 4ZZMA 1Q5KA 3LOKA 4JT3A 5M57A 1XH7A 4W9WA 1XBAA 3KRWA 3MPMA 2X39A 5AR2A 5GJGA 3KVWA 4KAOA 2BAKA 1H27A 2OIQA 1JKLA 2XS0A 3UYTA 4EKLA 3AC5A 1M14A 2B7AA 3A7FA 3DCVA 3HL7A 3QTXA 3MH2A 4NM0A 4TYHB 4Z7GA 1QPEA 4D58A 5HO7A 1YVJA 3HDNA 4OUCA 2C6TA 2WQMA 3L9NA 3UVPA 4CV8A 3E8CA 3ORXA 4WG5A 1RDQE 4HCUA 3HGKA 4C36A 2O2UA 2V5QA 4E5AX 3PRFA 4QPAA 4O7NA 2XK9A 4QP1A 4EJNA 5C8MA 4AGWA 2OKRA 3BQCA 4O0UA 3V5TA 2W1IA 3ZUTA 3ZZEA 2EXEA 3HMPA 5EYMA 5CZIA 2WTVA 4A7CA 2XIZA 4JIKA 4E4NA 5F94A 4AT4A 5HX6A 2UW8A 4L68A 4ENYA 2WIPA 5M4CA 3CCNA 3QFVA 3DT1A 2BZJA 4R3CA 1OKVA 4FKSA 4S32A 5IQEA 4WNOA 3W16A 4DH7A 1R0PA 4LRMA 3I7BA 1J1BA 2JLDA 4GIHA 3WIGA 1MRYA 2WOUA 4C2WA 1XKKA 4QTAA 3BBWA 3V8SA 3ANRA 3I60A 4QPSA 3SLSA 5HORA 2GNLA 3COIA 1YXSA 3C13A 3MB7A 3ZSHA 4EK8A 2ESMA 3OY1A 4M97A 1DI9A 2RFSA 2IW6A 2WHBA 4D2SA 3GI3A 3MVHA 2Q0NA 4FV4A 3W8LA 2GHMA 2VWBA
chains in the Genus database with same CATH superfamily
3R22A 4JOAA 3HMIA 1PMUA 4L6QA 2WGJA 2UV2A 4K11A 3QLGA 4YGAA 3LFFA 1Q4LA 1PYEA 5E9EA 1ZWSA 4KKHA 4L7FA 3U4UA 5JKGA 3DS6A 5C26A 2NYAA 2QC6A 1OUKA 4EK3A 3PE2A 2BILB 4W8EA 2YN8A 1OIYA 5AFVA 4O0XA 5LCJA 3F3WA 4FOBA 1IEPA 1ZZ2A 2QOOA 4K2RA 2WMUA 4C59A 4E4LA 3U6HA 3LE6A 3FQSA 1O6YA 4RVTA 5F9EA 5IQFA 5IPJA 3ORZA 3NVKI 3DTCA 2ITQA 4M14A 1XBBA 4JS8A 4QMWA 5A6NA 5JQ5A 2R3OA 2V22A 3BV2A 4QMUA 1YDTE 4C3PA 2PYWA 3PJ8A 4ZJIA 2VNYA 1I09A 4CFMA 4QMTA 5BUJA 1B39A 3Q2JA 4RLKA 4UALA 1YRPA 1TKIA 1CSNA 2AC3A 3AMYA 4U3YA 2PMNX 2CNUA 1VEBA 4UY9A 2OZAA 3TUCA 4LUEA 4U97A 4B7TA 3PZEA 4IAAA 3CGFA 4DCAA 4LOOA 5LWNA 1OZ1A 3EQIA 4NJDA 5FEEA 1ZYDA 3ZRKA 3C5IA 2GS6A 3C0HA 3KN5A 3TJDA 4Q2AA 4J97A 4OW8A 4LDTA 4EOOA 4IC8A 1E1XA 3EL7A 4XG9A 5H8EA 5DR2A 3R8LA 3VHEA 4BDJA 5HBJA 2CDZA 1FMOE 1UWJA 2EB3A 2R3PA 2VWZA 3VO3A 1MRVA 3BEGA 3II5A 4QO9A 3KULB 2XM8A 4CV9A 4EH9A 1H4LA 3VUDA 3M42A 3UQGA 2C5OA 4A4XA 4RVLA 3MS9A 3NEWA 3QX4A 3RKBA 4I0SA 2ETKA 5HE0A 5HVKA 3WILA 5IMXA 5LMAA 3F66A 2HIWA 4FKWA 4R5YA 4ZAUA 3OVVA 3PLAE 1Q3DA 5JMSA 4RG0A 2R3QA 4BCQA 2PZRA 2WMAA 3EIDA 1W8CA 1RQQA 1MP8A 2HY81 5EK7A 5BQ0A 3KQ7A 3V8TA 3BLRA 4L00A 4RC2A 4JX7A 4RT7A 4ZY6A 3PZHA 4FKUA 1OL5A 3LCDA 4IAYA 4O7LA 4MXYA 4WA9A 2C3KA 2RKUA 2G2HA 1XWSA 3BHVA 3C4CA 5DN3A 3JVSA 4USFA 4QNYA 5CANA 3G9NA 4DFUA 2JFLA 5A46A 3DQWA 1MQ4A 4O27B 4O0YA 3MWUA 1SMHA 4S33A 5M44A 4OAUC 2Q0BA 2FSLX 1Y91A 2ITUA 4IB1A 3LXPA 2X0PA 4QOXA 3MFTA 4P2KA 5CAVA 3N4UA 4QP9A 2OF2A 2YM4A 4C4EA 3KRLA 1URWA 4CEGA 4YJSA 1P14A 1ZOEA 4XG4A 3DXQA 1REJA 4F08A 5B7VA 4X2NA 2KULA 1NW1A 2X8IA 2W5AA 5AP0A 5AP3A 4C35A 3NYVA 4GCJA 4DFNA 2PUUA 4R1VA 5HNBA 3UIUA 4XCUA 2HXLA 4PPAA 3R21A 4Y73A 3RPRA 3TUBA 3AKLA 5IUIA 4IX3A 5B0XA 4G3CA 3W0NA 4IWOA 1T46A 4X21A 5EM6A 3SV0A 1LPUA 3T3VA 4BDBA 4DGLC 4O6LA 4E20A 5E90A 4FTAA 4CKJA 4J71A 3WI6A 4IFCA 2XNPA 4B0GA 4R6VA 4O21A 4APPA 4BDDA 4FZDB 4N6ZA 4TYHA 5L2TA 2E9PA 2HWOA 3CQEA 3QTRA 5ACKA 3OEFX 3ENMA 4YLJA 3QRJA 3F3ZA 5DHJA 2IEWA 4KWPA 3ZMMA 3EHAA 3R9NA 4EUTA 5IQDA 4BYJA 4IX4A 5AP7A 3FMMA 1YOJA 4WIHA 5HESA 3PP0A 1DAWA 4EH4A 4GU6A 5FWKK 3V01A 3FV8A 3Q4TA 2RFNA 3EN4A 2ERKA 3W0RA 3ZOSA 4PQNA 5IF1A 1W82A 1XMLA 5BVFA 4RSSA 5HZNA 4I21A 2H6DA 4UX9A 1J1CA 4KIOA 2VNWA 2X7FA 4EC9A 4HVSA 3N4TA 2X2KA 4JDIA 3N4VA 4CLIA 5CQWA 5K4JA 4NKAA 4CLJA 3FL5A 2ZV9A 3QC4A 3ZU7A 3S00A 3P08A 4ZIMA 3E5AA 4U43A 3ENHA 5HBEA 4AXAA 1PXOA 4IXPA 3R02A 5TR6A 5JEBA 3PXQA 4FT9A 4P5QA 4UYNA 5IMEA 2GS7A 4ZSLA 2UZUE 3FSFA 3HAVA 4OTDA 4E4XA 1ERKA 2RFEA 2CGUA 3QUEA 4V05A 4FIEA 3L8PA 1RJBA 1Q8TA 3DDQA 4RJ5A 3QQUA 2OLCA 4DTKA 4XLIA 3TUDA 5GJFA 2XYUA 4XNEA 4GT4A 4WT6A 5EFQA 3G2FA 1JKKA 4FSQA 4YLLA 5D1JA 4ZSJA 4D2VA 4KUJA 5BVDA 2WIHA 4RBLA 5ANJA 4F6WA 3PE1A 3DAEA 3PJ2A 5H8BA 3MDYA 5L4QA 2GNIA 4HCVA 4UZHA 4X3FB 4ANQA 2CCIA 4PF4A 3DNDA 4CRSA 3DKOA 3UO4A 1BMKA 4UZDA 4AF3A 2EWAA 5FD2A 3G6HA 4FV7A 5J9YA 1U54A 4B8LA 4B4LA 4DDIA 2X2MA 3ORKA 3MY5A 4TWCA 2IO6A 5CSWA 3CP9A 5ANEA 4G3EA 3ACJA 1REKA 1Y57A 2HYYA 3BQRA 4ZSEA 3C4ZA 3OROA 3HAMA 1KOBA 4FT0A 4HPTE 3R83A 3EJ1A 3QU0A 2B52A 3K54A 4XP3A 4EQMA 3VIDA 2EUFB 3OXZA 4A4LA 4D1ZA 2ZV2A 4N6YA 4XV3A 3UOHA 2PUIA 2OJFE 3PVWA 3U9CA 5HBHA 5JFVA 3TNHA 5BVOA 5AEPA 4JDHA 2VTRA 3R28A 2ZJWA 4F9YA 5DRDA 3C51A 1W2CA 1IG1A 3G9LX 3GT8A 4FT3A 4FTIA 5LMKC 4XG7A 4ARKA 1CKPA 4BIEA 1WBWA 4C61A 2PMOX 3VHKA 4BDGA 2WEIA 1DI8A 2HW6A 5HHWA 3AC8A 4CCUA 4NM3A 1Q24A 4G2FA 5EW3A 5AUYA 3VBVA 2R5TA 2Y7JA 5AUVA 4TZRA 1GIIA 4IVCA 4YLKA 4QMXA 4P90A 2VTLA 2VZ6A 3B8QA 3FI3A 4J8MA 2XA4A 5CU4A 3BI6A 3H0YA 3P4KA 4S2ZA 4CFFA 2BKKA 1KWPA 4OBOA 2CKQA 5CASA 3ACKA 3IECA 4DCEA 4MD8E 5CEKA 3TG1A 1WVWA 4QYEA 5EH0A 4B9DA 2QU5A 4IB3A 4I0RA 2YHVA 3IONA 3E3BX 3VQUA 5IEVA 4KB8A 2X6DA 1H28A 4X6QC 2VU3A 1P4OA 2VTHA 4C37A 4FNWA 2JDRA 5EDQA 5IU2A 4FV8A 4UV0A 4CKRA 3ZO3A 4AFEA 1XMMA 4ERWA 4QYHA 3QD2B 2YA9A 4ASZA 4BCKA 4A9RA 4LL5A 3KGAA 4FTKA 4DH5A 1H0WA 4MAOA 3W0OA 4B6LA 2RSVA 4YJQA 5BV3A 3OCGA 4JG7A 2OH0E 5HE1A 4YZDA 4A9TA 2ACXA 5B2LA 2C1AA 5CZHA 1WCCA 2UUEA 4BDHA 4FK6A 5A6OA 2XNNA 4XBRA 2I0YA 2CPKE 3IW8A 4C3FA 3PA4A 5JZNA 1PXIA 3QRTA 4AXFA 2VAGA 4FV6A 4TWPA 4G9RA 5KE0A 5AA9A 2W1ZA 1PHKA 3PXFA 2OSCA 4NT4A 1SNXA 2BIYA 4N70A 5GZAA 2F57A 5M4UA 3ZFMA 5DRBA 3PG3A 3EMGA 2BUJA 2OWBA 1Q61A 4W4WA 4USEA 4DF3A 3PIZA 3FAAA 3QA8A 2YM6A 1Q8YA 4EHEA 2XJ0A 3NX8A 5CSXA 2Y4PA 2J4ZA 3FZRA 4D4VA 2WQOA 4J52A 4DFZE 4IM0A 3DV3A 2PVYA 1ZY4A 2JC6A 3E8NA 2F4JA 4FSYA 4FTCA 4QP7A 4XG2A 2H96A 4MCVA 4D1SA 4DEHA 4EH2A 3DBEA 1OL1A 4PX6A 2R3RA 2W99B 2CHLA 4OTQA 5HLWA 3MYGA 4FNZA 3OT3A 4L01A 4QMSA 3O5AA 3OP5A 3NNVA 5BVWA 4EQCA 4FEWA 5ANIA 4FTJA 4AW2A 5BPYA 4XG6A 1YI4A 3EQPA 1J7LA 1BL7A 3UG2A 3CQUA 2WU7A 2R7IA 2BHEA 2FUMA 4G16A 3IPHA 4K8AA 4WBBB 4XRLA 3LMHA 2OZOA 3UOLA 2QO7A 5A54A 3TMOA 3QUDA 4XMOA 2UW6A 5AR4A 5FTGA 3HP2A 3CKXA 3NNUA 3PXRA 4GSBA 4FL2A 2XYNA 4GU9A 4LRJA 5DBXA 5DE2A 3JR1A 1U46A 4FKRA 4DA5A 2XVDA 3UIBA 3LJ0A 3UNJA 2XK4A 2PZYA 4C4GA 1XH5A 4HYHA 4KIKB 3O17A 4FNYA 3RBWA 4BBFA 2QCSA 1L3RE 3GQIA 3QTUA 4D28A 3VJOA 4PL4A 5LWMA 4Y85A 1M7QA 2UVXA 2Z02A 3OUNB 4KIPA 3QL8A 4ZTMA 5FBNC 4RX8A 4EWHA 3V6RA 3PIXA 4L8MA 4JRVA 3VUHA 5IH6A 2ZM3A 5D7AA 2R4BA 3CY3A 4FX3A 5DH3A 4MX9A 1U59A 3U6JA 2R2PA 4RIOA 1IR3A 3NNWA 4GRBA 4BDIA 4YR8A 5JGDA 3WYYA 3W32A 4O7SA 4IMYA 5L2QA 4W8DA 3UPXA 5JT2A 5J1WA 2R64A 4YHTA 4GK2A 3BBTB 2XNBA 5AAFA 1ZOGA 4DGGA 3SX9A 5AP6A 5LVOA 2IPXA 4IHPA 4FE2A 2OIBA 4AE9A 4M3QA 4MXCA 1KE9A 5A4CA 3HRFA 5BYZA 4X3FA 5J5TA 1M2QA 2G9XA 5AV3A 5TF9A 3Q9ZA 4YZBA 2IVTA 3QQKA 5CAOA 4FTLA 1FGKA 1WMKA 3EFLA 4RGJA 1H1QA 2XZSA 4FICA 4XEYA 3U9NA 1Q62A 3E7OA 4CRLA 3I79A 2FYSA 4KBCA 3MY0A 3GENA 4ALUA 4EH7A 3EYGA 2UZTA 1TQMA 2P33A 2VGPA 2PE1A 2QOKA 3BLQA 3GEQA 2FO0A 3FLSA 4BL1A 4FZ6A 2W1CA 4R3PA 4FTRA 4NUSA 3BGPA 2CCHA 1WFCA 2V0DA 3DA6A 3AC3A 5JQ8A 1R39A 5ANOA 3UE4A 3GXLA 4O4EA 3B8RA 2VWWA 5G6VA 4E7WA 5F20A 4E5WA 3MJ1A 3U55A 2LAVA 2H34A 3FLWA 3QCXA 4D4SA 5M06A 4GVAA 3WZUA 4CFVA 4A9SA 3ZUVA 2RG6A 4AZFA 2A2AA 1OM1A 4F4PA 1SVHA 4FV5A 2CKEA 4FYNA 1WVYA 4Z55A 3E8EA 2WQBA 4XUFA 5DT0A 2QI8A 1SVEA 2XKFA 1VJYA 4U79A 4QMYA 2FSMX 4FTQA 4YP8A 3T8OA 2QVSE 3ZSGA 4AN3A 4DDGA 3HVCA 3KIOC 2FVDA 3T9IA 4FIFA 4AW0A 2BRBA 3ET7A 1PXNA 4L45A 4MBJA 4AQCA 2HCKA 3TIZA 3HUCA 3NUPA 4M15A 1FVTA 5IH5A 2H9VA 5C8NA 5CAQA 5EYDA 4XH6A 4XG3A 1HOWA 2X0QA 3MI9A 4WKQA 3PY3A 2WEVA 3M2WA 1K9AA 1G8SA 4FV3A 1IAJA 4QDVA 3T9TA 5IQIA 4RWJA 4CGAA 3Q2MA 5I9WA 1OIRA 4WO5A 3V5LA 4E73A 3GOKA 4KBKA 2G1TA 4E6AA 2JKMA 2ZMDA 3WF5A 2JDTA 2PULA 2F7EE 4ZZOA 5EQEA 3C1XA 3BEAA 5LOHA 3WYXA 3BHUA 4LV7A 4RZVA 2W96B 3BGZA 4AW1A 3LCSA 3KMWA 1PRYA 3F88A 3QTWA 4LOQA 4K6ZA 2FSOX 4MQ2A 5BNJA 2UVYA 3FZPA 2JKKA 4X6RA 5FDXA 4K0YA 3QCYA 4DEGA 3EQRA 3OS3A 3VBWA 5CEPA 1BLXA 3KU2A 2R3FA 3MH0A 3F9NA 5FBOA 3QZIA 3R7IA 3V5JA 1YWRA 4ZEGA 2IVSA 4ASDA 3UOKA 3A7IA 3UOJA 2CGXA 2JKQA 3Q4CA 3R2BA 4FVRA 3O7LB 1ND4A 1CM8A 2NP8A 2X0GA 3QHWA 3M11A 1K3AA 1H8FA 3QLFA 4M0ZA 2WMWA 2E9VA 2QURA 4IACA 4XBUA 3CS9A 2XKCA 3FMLA 3ZFXA 2R7BA 1V0BA 2XIYA 3QQLA 3T3UA 5I9XA 4U45A 2BMCA 4FA2A 2QQ7A 1IA9A 3PFYA 1DAYA 2OXYA 4LGDA 2B1PA 4LRKA 2W5HA 4ZSAA 4J53A 3S3IA 5LMKA 5H2UA 2WTCA 2ZDTA 2W1EA 3QC9A 1H1SA 5M55A 3R9RA 2ITTA 4EONA 3AMAA 5FG8A 3TDWA 4TN6A 3SQQA 3MH3A 2C1BA 2PY3A 3NUYA 2BAQA 2YLEA 5D10A 4EORA 4F1MA 4F9AA 5DGZA 2OU7A 5E8WA 2ONLC 3E64A 4QP8A 3OD6X 1EH4A 3GCVA 4M67A 4UYAA 3VBQA 4JQ7A 4S31A 3IK3A 5CVGA 3NCGA 3QCSA 4BICA 4FK3A 5HTCA 2FGIA 4JG8A 3TM0A 3Q5IA 4BKYA 2VUWA 3WF6A 4AZEA 5D12A 1M52A 2R3NA 5C03A 4BTKA 3BHTA 5HTIA 1KUTA 3UDSA 3HRBA 3AT3A 3NLBA 3SRVB 1E9HA 3ZO2A 4BRXA 4YC3A 2PL0A 4BBMA 1PXPA 3IGOA 4YBKA 2PUPA 1YKRA 3ORPA 5T68A 2EVAA 5I9UA 3OOMA 2XEZA 4QTDA 1XQZA 3NCZA 4RX5A 4IADA 5FEDA 4EOJA 3A60A 4Z16A 4FIJA 4I6LA 3DJ5A 4PDSA 5BUIA 4KSPA 3DKGA 4DE4A 4TY1A 3RTPA 1V1KA 1OKZA 3TZ8A 3CJFA 4HGTA 4RIYB 5E91A 3VS7A 1IA8A 4M8TA 3KXZA 3TTJA 2CKPA 3OBGA 3R7YA 2X4ZA 3EQBA 4UXQA 5EM8A 5FDPA 4WG4A 4KIKA 4GG7A 5A4LA 3ZDUA 4PP7A 4WUNA 3UYSA 2J6MA 3H9OA 1XH8A 3LVPA 3V51A 2J90A 4BZDA 2PUNA 5BUEA 4JVGA 4FV2A 4LUDA 4M13A 1WBNA 4U0IA 3VUMA 2HZ4A 4FSRA 2GSFA 3VAPA 3NMUF 2Z7LA 3UP2A 3ZZWA 2GNFA 4PWNA 4BCPA 5ITAA 2UW3A 3AXWA 4B99A 2PVNA 4LGGA 5AUXA 1GZKA 3U87A 5IUHA 3OF0A 3CPCA 3P9JA 5CWZA 4I23A 5I9VA 1GZOA 4ZTRA 3VUGA 4CZUA 2OJJA 3HV4A 4O6EA 3QKLA 2GNHA 1ZYSA 4G6NA 4XJ0A 4YTFA 3ZO1A 2GTMA 2OICA 3LAUA 4FKTA 3R7GA 5EKOA 4L3PA 5AUUA 3ULZA 1H00A 3JY0A 5CF4A 3EKNA 2P0CA 3D2IA 3GOPA 3AC1A 1CTPE 3QZHA 2QKWB 4GJ2A 4PPBA 2B55A 2EB2A 2X1NA 3RINA 4R77A 2OFVA 2JIVA 3IGGA 4BCMA 1WVXA 4G3FA 3KCFA 3ZHPC 3BL7A 3DJ6A 4H1JA 2BKZA 4EHVA 3P1AA 4GT5A 2QHMA 4QMOA 4CCBA 2OO8X 5FGKA 5E8VA 5GHVA 5JRQA 4ERKA 4TYEA 3HDMA 4L3LA 3SXFA 5IEXA 5DVRA 3UDBA 4I5PA 2OFUA 1TVOA 4M12A 3LZBA 4CZYB 1LP4A 3NYNA 4TRLA 4F63A 5HGIA 3JPVA 4D1XA 4U44A 2C3IB 2JITA 3EKKA 3DBQA 2ZOQA 4FSZA 3KRRA 5A14A 4YJVA 5HIEA 1G8JA 1L8TA 3QWJA 1OBGA 5CT0A 3FC2A 3S95A 2ZB0A 3L9MA 4NW6A 2BR1A 2VTAA 4ZTLA 3O8TA 4BWKA 1ZYJA 2XNEA 4F0IA 3V6SA 3F5UA 3TNWA 4EOQA 3FJQE 4DG0E 2OF4A 2C0IA 2HOGA 4RA4A 5EM7A 4ACMA 2RF9A 4D9UA 4O7YA 1R1WA 2Y9QA 4GK3A 2QD9A 4G34A 4AA0A 3QA0A 2IF8A 2J0IA 3QXPA 5EQPA 4DG3E 4V0GB 5EW8A 4G17A 2CJMA 5CVHA 3D14A 4E6DA 4NM7A 1JSTA 4YU2A 3EH9A 3Q6WA 2ZV8A 3GC7A 3R9HA 3MFRA 4E8AA 3R30A 4E4MA 2PPQA 3TACA 2Z60A 4PDPA 4OT5A 4JAJA 5CSHA 5I3OA 5KHWA 3HNGA 3W33A 4C0TA 5ACBC 3QKMA 1TQPA 5DFPA 5KO1A 4IIRA 3JY9A 4IDTA 1UU7A 2XK6A 2Y6OA 3F61A 2VTSA 4JNWA 4G9CA 3TKIA 2JGZA 4M84A 2JD5A 5HE2A 5EDPA 4JAIA 3A7JA 3V5PA 3LJ1A 4EKKA 2IN6A 4DBNA 4JXFA 2J0LA 4FKVA 2C6KA 4YSJA 5GNKA 3F2RA 4J96A 4QYGA 5E8UA 2J5EA 5DLSA 1YWVA 1KE5A 2UZBA 4AUAA 2XALA 3ROYA 4I20A 4IZ7A 4AZVA 3FI8A 1H1WA 4D0XA 2ITVA 3VRZA 1J7UA 4AW5A 3SXRA 1YHWA 1WAKA 2R3JA 3FE3A 3P23A 3LJ2A 2YM5A 3W2OA 4G6LA 4KINA 4BWXA 5IDPA 2ITOA 3KA0A 5AV2A 5HEZA 4ACDA 5AM6A 3K5UA 2YM3A 3L8VA 3W2QA 1NVSA 2HK5A 4DAWA 2WXVA 4IC7A 1NXKA 4IX6A 2YIQA 3GBZA 2QOBA 4BDCA 3CGOA 4X2GA 3D0EA 2JIIA 4RVMA 3LFDA 2NNWB 1Y6AA 1NY3A 2BDJA 4ZLZA 3KXXA 3WZKA 4BI2A 5CF8A 4ITIA 2DQ7X 5LVNA 2VO0A 4WHZA 5IH4A 3Q4ZA 5L6PA 1LR4A 2WTDA 4XP2A 4FGRA 3VQHA 4U40A 4MHAA 1GZ8A 3VS2A 3U54A 2XNGA 3DAJA 3R7EA 4QP4A 4F1OA 4E1ZA 2BTRA 4WD5A 2QR8A 3QXOA 3DKFA 3FLZA 4TYIA 3C4XA 5HNGA 4BKJA 4UMUA 4Z3VA 3QGWA 3SRVA 4CG9A 3Q9YA 4NCTA 1P4FA 2EXCX 4UMRA 5KMJA 5HCYA 4RX7A 4FUXA 4QTBA 4Y8DA 3NUUA 4FEXA 3H10A 2ZFYA 3FSKA 3UZPA 5M4IA 4F7SA 1ZYLA 4NEUA 4MXOA 3PJ1A 3PSBA 3NUXA 4UMQA 3TYKA 3LLTA 2VTMA 4OT6A 3ZBFA 3RGFA 4BR3A 3GU4A 4G31A 4WRGA 3RAWA 3UZTA 4MTAA 4RIYA 4F6UA 5IQCA 2R3MA 4IVBA 2HY0A 4G5PA 4DITA 4QDEA 3KCKA 5AM7A 2P3GX 3FUPA 3OXTA 3SW4A 3DNEA 3SOAA 1PMVA 5CU3A 1PXKA 5HO6A 5AWMA 1ZMUA 1JVPP 3GGFA 4AGUA 2B9FA 4RJ7A 4ZTSA 1OECA 5HTBA 4I4EA 1H1RA 4N0SA 4LFIA 4YC8A 3QQJA 4C4FA 3OWPA 4C02A 3QAME 3ZONA 3PWYA 2P55A 1UNGA 3AD4A 3PA3A 3L8XA 1O6LA 4FC0A 2DUVA 4A9YA 3R01A 3C4EA 3FMEA 2ZYBA 4D5HA 2PZIA 4I92A 2AUHA 3DTWA 4NW5A 5IA3A 3PPZA 3UDZA 4DH1A 3HMOA 3ATTA 3A61A 1YI6A 4EHZA 3BIZA 2GQSA 5EI6A 4X3FC 2ONLA 3ZRLA 4LV8A 5FEQA 3EB0A 1OBDA 3H9RA 4GUBA 3C4WA 4YMJA 3A8XA 1KSWA 3F82A 5M56A 1Q3WA 4AZWA 2IZRA 3QWKA 3RMFA 3L1SA 3TN8A 3CQWA 2X9FA 2ETMA 4JLCA 1URCA 3A4OX 3QTSA 5E7RA 5HO8A 4AAAA 2C68A 4C4JA 3PYYA 3OW3A 5EHYA 5HD7A 4IM2A 3UDTA 2X0OA 2BDWA 4I6BA 2UW5A 3ODZX 4Q5EA 1O6KA 2XNMA 3HMMA 3MVJA 4LV5A 4GK4A 3UTOA 2C69A 3NW6A 3DJ7A 5FP6A 4R8QA 4BCGA 4WNKA 4FF8A 5EQYA 4OTPA 1TZDA 2DYLA 4JDKA 1UVRA 3PLSA 4FI1A 3VUTA 5FM3A 5IQHA 2HWPA 4IJPA 4O1OA 4L42A 4DC2A 3OY3A 2R3IA 2YDKA 4TXCA 3QUPA 3D5XA 5J5SA 4L9IA 2KTYA 3VN9A 5TKDA 4CT1A 4TWNA 1BUHA 3K2LA 3ZUUA 4ACHA 4FV0A 4QT1A 4EC8A 3RHKA 2O8YA 4KD1A 4A9UA 4FG9A 4O7RA 3D5WA 3R0TA 2W1HA 2XIKA 5DR9A 4I93A 5AP4A 2RG5A 4O96A 5BMMA 4MK0A 4FJVA 3P5KA 3PUPA 2BRHA 3SG8A 4FSNA 3A62A 3PXYA 3Q53A 4P5ZA 3HX4A 3FKLA 2F7ZE 3ZCLA 4GS6A 4JBQA 4Q9SA 2VTIA 3SHEA 1Z5MA 1OKWA 2X7OA 2ITWA 2QR7A 4NIFB 4D55A 4EH8A 2PVJA 5M4FA 1ZXEA 4Y95A 4V0GA 5BX0A 3Q3BA 2XEYA 1LEZA 3FYKX 4IAFA 3RK9A 4YUQA 3SVVA 5AIRA 4TWOA 2J50A 4IBMA 1BX6A 4KRDA 3Q60A 4G3GA 1YDRE 3K3JA 2WOTA 3LM5A 4G1WA 4KKEA 4NWMA 5L2WA 2FA2A 5D41A 4WNPA 5KKRB 4QQJA 4R7BA 2W7XA 2YIRA 3JS2A 2PVHA 3FMJA 1FPUA 3RNIA 3ZXZA 3F69A 2C5VA 4FSTA 2O63A 4AACA 4HW7A 3F6XA 5KZ0A 3EN9A 5AUZA 4JMQA 1B6CB 2G2IA 4QP6A 3EZVA 3TL8A 4WBOA 3ZS5A 3Q52A 4RPVA 5CAUA 2VRXA 3RI1A 3O8PA 4O7ZA 4R3RA 2YIWA 4QD6A 4O81A 3PPJA 1U5QA 5AP5A 3UIXA 3Q96A 4FKPA 3FBVA 1DS5A 3M1SA 3AG9A 5F95A 4RJ6A 4XLVA 5AR5A 2O0UA 5FQDC 5AMNA 3I7CA 4O4FA 5LVLA 4AQKA 3DBFA 4JG6A 5K0KA 3KEXA 4YPSA 2BZKB 2E9UA 3KULA 4JBVA 4EBVA 2XBAA 4F9CA 2HW7A 4ONAA 3EOCA 2OXXA 3ROCA 2P2IA 1TFFA 2IG7A 1O9UA 5ETFA 2J7TA 3VULA 3QYWA 3CBLA 2A4LA 4HVIA 1FVVA 3QCQA 1V0PA 3FMHA 3UPZA 4AX8A 1H0VA 1WBOA 2X4FA 4F70A 1R78A 4PUZA 4Y5HA 2GFCA 5CF6A 3FQEA 3F7WA 4MXAA 3QYZA 4IDVA 1JOWB 1QL6A 3KN6A 3HV7A 4OTRA 4RJ3A 3BWFA 2A27A 3DXPA 4FKOA 4BJJB 2UZEA 4JX3A 4FG7A 4NTSA 2PWLA 3BWJA 3GC9A 2W17A 1W0XC 2C5XA 4HNFA 4D2WA 3EL8A 2E2BA 3UQFA 3B2WA 5LCKA 4QP3A 4BHZA 1GNGA 3ZYAA 4KNBA 1BYGA 4PMTA 2CKOA 2VN9A 3FLNC 1OIQA 2CSNA 4IANA 4CFNA 4M69B 5KHXA 3I0OA 4GT3A 1ZARA 4DLJA 5JN2A 5EYKA 4KS7A 4EI4A 2PE0A 5HCXA 5BMSA 5HVYA 1UV5A 4ZTQA 1SNUA 3GU8A 4J98A 3V04A 3PUFC 4W9XA 3BKBA 3CD3A 1OL7A 2GNJA 3E7VA 4PL3A 5LVMA 2XIXA 4ZMFA 4LQMA 2F7XE 4FOCA 3W18A 3MJ2A 2B54A 5TOZA 3NNXA 4RQKA 4YBJA 4GYIA 1VYWA 3PY0A 3N51A 1KE8A 2RIOA 4ITJA 2BALA 3ZM4A 3UJGA 1Z57A 2PZ5A 3VW6A 5HIBA 2YJSA 5J7BA 5JFWA 3IS5A 4GG5A 4QMLA 2HELA 2C0TA 5GINE 4XHKB 4HZSA 2GCDA 2WU6A 3LMGA 4X2JA 3U4WA 3UO6A 4BDEA 2QG5A 2WD1A 3FMKA 4FIGA 4MYGA 2WTIA 4ANBA 1A48A 3HEGA 4H39A 5EOLA 5HKMA 2YIYA 3KK8A 5A3XA 3P5JC 2WMRA 4TYJA 5B2KA 1CDKA 5JFXA 4PDOA 5L6OA 3QQHA 3WF7A 4WSQA 1BI8A 3BU6A 3G0EA 4BGQA 4KA3A 1GY3A 2G15A 4YNEA 2GMXA 3OBJA 4J95A 3ML1A 4X0MA 3I6UA 3LLAA 4KS8A 1ZMVA 3A99A 3RHXA 3HZTA 5E8TA 1FOTA 2GHLA 5M08A 3KY2A 2QLQA 4EOMA 2WMQA 3I