3WYXA

Crystal structure of human mps1 catalytic domain in complex with 6-((3-(cyanomethoxy)-4-(1-methyl-1h-pyrazol-4-yl)phenyl)amino)-2-(cyclohexylamino)nicotinonitrile
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
280
structure length
258
Chain Sequence
ECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPGTVNYMPPEAIKDMSISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title A unique hinge binder of extremely selective aminopyridine-based Mps1 (TTK) kinase inhibitors with cellular activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 73
structure length 258
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3wyxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3wyxA01
4IDTA 4IZYA 3OZ6A 3UOJA 3LKMA 4L3LA 4R5SA 1J7LA 3DPKA 5TE0A 1ND4A 5IISA 2R64A 2E9UA 4CFWA 4L53A 3PVUA 3E92A 3HV6A 3LIJA 4LUEA 1XBAA 2FSOX 1PRYA 4DT8A 2HELA 4AFJA 1OECA 2I1MA 5ANOA 4HZRA 1QPCA 2ACXA 2JFMA 4E5BA 4J71A 2BROA 3AC3A 3CEKA 3ZC6A 2WMUA 1JVPP 2OBJA 3QXOA 4QP9A 4S2ZA 4UEUA 3U87A 4AZFA 4X7QA 4R78A 2GNHA 3E7OA 1UKHA 3QQHA 3KVXA 4H3BA 3MESA 2BDWA 4LRJA 2R4BA 4AQCA 3IW7A 3F2AA 2VTRA 4RIXB 4BDHA 5AP1A 2QU6A 2WTVA 3II5A 5GJDA 2C5VA 2GQGA 5DT3A 3PVWA 3U4UA 4E73A 3GFWA 2R3RA 4U44A 2XJ1A 2G1TA 1SVHA 2PY3A 5AR4A 2G15A 1JLUE 3PG1A 4GH2A 1PYEA 4WT6A 5CF6A 4FUYA 3D5XA 2OJJA 4IVBA 4MXAA 4OAVB 3NIEA 1PMUA 3FUPA 4I0RA 4IAKA 3VJOA 4RFYA 2R2PA 3PY3A 4XLIA 1SNXA 3LFAA 2GNFA 2FUMA 5J5SA 1NA7A 5LQFA 3I7BA 3TT0A 4R8QA 3O7LB 4G3GA 4FNYA 4ZTQA 5C03A 3Q52A 4ZAUA 5A4LA 4L3JA 4ZK5A 4E4MA 4UWCA 3N4TA 4M69A 2XEZA 4JR7A 4WBBB 5C01A 1CTPE 3VQUA 4DH1A 5L6PA 3H0ZA 3WE8A 2VNWA 4C4GA 5BVFA 1KOBA 5E8YA 3W2QA 4F4PA 2PE0A 1XHAA 1OM1A 3JXWA 4GV1A 3EQFA 5EYCA 5IG1A 3UDBA 2W5BA 5ETCA 3FMDA 4ZJIA 3KN6A 3LM0A 4E20A 5LVPA 4E7WA 4ZY5A 3D83A 4ONAA 3WOWA 5JGDA 3BX5A 5HGIA 3DNDA 3AD6A 3LXLA 2H9VA 3R9OA 4DT9A 3I1AA 4KIPA 2X8IA 5JMSA 4I4EA 5LWMA 4BGGA 1MUOA 3SQQA 4HVGA 2C3LA 3ZRLA 4G31A 1H25A 2EXMA 2UZUE 2WMAA 4AG8A 3E8DA 4BDGA 2W4OA 2VAGA 2W1ZA 2Z7RA 2PK9A 2WHBA 5CS6A 4FEWA 4GT3A 2ZV9A 4FIIA 5J8IA 4G3CA 3GCQA 3TNIA 4BCPA 4QO9A 4EI4A 5TF9A 3UJGA 4Z7HA 4X2NA 3DY7A 3NCGA 3PLSA 3UVQA 4J97A 2R0UA 4KA3A 1Y6BA 4AZSA 2B4SB 3BIZA 3IDBA 4TYIA 4OTIA 3R7UA 3D14A 5IH6A 1ZRZA 2PUUA 2WFYA 3FMMA 4C38A 1PF8A 4I1ZA 2YCSA 4ID7A 2YWVA 4XOYA 2UZLA 4OW8A 1H00A 3DKGA 4W9XA 2VTPA 3ZSHA 3B2TA 1JKSA 4IVDA 4RLLA 2XK9A 2WOUA 5M4UA 2JFLA 3R9DA 3GBZA 3ORIA 1OBGA 2WEVA 4L3PA 2XYNA 4NEUA 3UIMA 1WZYA 2G01A 3JY9A 5GZAA 5CSPA 4MXZA 5JGBA 1JQHA 3OWPA 3RPSA 1PJKA 1PMEA 2PVKA 3EKNA 3FAAA 4IMYA 3R0TA 4JJRA 2YCRA 3TM0A 1ZYDA 4RZWA 2XYUA 2XUUA 1K3AA 4JG6A 2J7TA 3HUBA 4YPDA 3MVLA 3W8QA 4ZXTA 4XG8A 1JNKA 2J2IB 4RJ8A 3VUIA 2XCHA 4YR8A 2VO6A 2ZMDA 3IOKA 3PPZA 4LMUA 3VS4A 3HUCA 5JQ8A 1BLXA 4IB0A 3TI1A 4DG0E 4HGSA 4LUDA 3AG9A 1O6YA 3WBLA 1YXVA 2EUFB 2WOTA 3U8WA 3FZOA 3Q9XA 4O38A 4XV3A 3DKCA 3G51A 3QF9A 3QTRA 4YTHA 1F5QA 2DWBA 3UO6A 3E3PA 3EQHA 4L52A 1XO2B 5DNRA 4IIRA 5AP7A 1H4LA 5J9YA 1GIJA 2A4LA 4U0IA 3ROYA 4E26A 3POZA 2WMSA 3COIA 2QURA 4MWHA 4NW5A 5IQBA 2B9JA 2UZBA 3Q04A 4R3RA 5F95A 1R3CA 4FVQA 4Q5HA 2P4IA 4D4YA 4HGLA 4EH5A 1FVTA 4ZSGA 3CS9A 4PDSA 1G8SA 1YI6A 1E9HA 1ERKA 4CKIA 5IZFA 1PXMA 1P4FA 4FVRA 2CNQA 4CTBA 4JDHA 3C51A 1YRPA 4G16A 4GFOA 4C4JA 4RGJA 5EW9A 4D4SA 4YBKA 5IUGA 4FEXA 3R2YA 5LVNA 4GKHA 5F94A 3WZJA 1TVOA 3QUPA 3I6WA 3VAPA 4IWDA 4FSRA 1BL6A 2VWZA 2VTSA 3AXWA 3E7VA 4K33A 3DOGA 4BGQA 3GU7A 2ZB1A 3V8TA 3F7ZA 3PA4A 4C0TA 3OS3A 2X4FA 2UW0A 5CVGA 5E1EA 2YLFA 5HHWA 4EK6A 4ZMEA 3L1SA 1Q3DA 4ZTLA 3VN9A 3UO5A 4R5YA 4X3FA 3EIDA 3W10A 2NPQA 2ITVA 5CNNA 2JC6A 1URWA 4UB7A 4YLKA 1H01A 4FT9A 5H8EA 5BQ0A 2QD9A 1IAHA 4NK9A 4BHZA 2O65A 3IW5A 3KQ7A 1VJYA 3CGFA 4GJ2A 3FPQA 2O0UA 3L9NA 2ITZA 2BUJA 3BGQA 1OIRA 4MNEB 4QQCA 4LRKA 1P4OA 3QALE 4XBRA 4RLKA 5HX6A 3EZRA 4BCMA 3GCSA 4RX8A 2BZIB 3EL8A 3CXWA 4GU6A 1FBNA 5M4CA 5LVLA 3FMEA 3AOXA 4JQEA 1RJBA 4IH8A 4XG2A 4IM0A 4PUZA 2PUPA 5JFSA 3NYNA 4U7ZA 2VV9A 3BLRA 5CSVA 2HXLA 3V51A 2J4ZA 3QD2B 2PE2A 4FVPA 4UMRA 3QQGA 5E8ZA 4JL9A 2REIA 4EOPA 3OBGA 3OXTA 5AR8A 2R0IA 3RNIA 4EK5A 2BRHA 3M42A 4X6QC 1M7NA 1YXUA 3NUSA 4BWKA 1IA9A 3W2RA 4L44A 5J5TA 4BF2A 1YI4A 5FD2A 5A3XA 3HX4A 4LM5A 3V8SA 4EKKA 5M07A 3UMXA 2QNJA 4YJRA 3RHXA 3G9NA 1PXJA 3QZFA 4BCIA 2XIKA 5LMKA 3BYVA 3EN9A 1SVGA 3MTLA 4FG7A 1H28A 3ZRKA 3U9NA 4EHGA 3C13A 2PHKA 3VUHA 2WTKC 5J1WA 4YTCA 5HVKA 1NVRA 4FZ6A 3H4JA 5GJFA 2I0EA 1KV1A 1XKKA 3A2CA 1YW2A 4CFNA 3FI8A 3Q9YA 4OTDA 3VNTA 1OMWA 2WAJA 2QI8A 3FYKX 1Q8UA 3LFNA 1GZNA 4JX7A 4G5JA 4KINA 5IEYA 1M14A 2G2FA 2YCQA 3GEQA 5IMEA 3O2MA 4K1BA 3HRCA 4RX7A 5ACBC 4NTTA 2WMQA 2QOBA 3FLSA 4KS8A 5AM6A 1ZMVA 2C3JA 2E2BA 4I3ZA 4ZY6A 4D1XA 4EC9A 5A4CA 2YEXA 4KNBA 3BE2A 2ZMCA 2CKPA 4I6QA 2J5EA 2PPQA 3N9XA 5E1SA 3WZUA 3NVKI 4ZJVA 3I6UA 3ORPA 1JKTA 3H10A 4F70A 5C8KA 2C0IA 3NSZA 4FICA 3E63A 4Z9LA 5T3QA 4HCUA 3RWQA 5CXZA 3JVRA 3NGAA 4O7YA 3QCYA 5EDRA 5C27A 4R7BA 4U6RA 5BUJA 2F2CB 3CKWA 3BU5A 3PIXA 5C1QB 2R3JA 3EQIA 2WQEA 4FTJA 5E8WA 4D2SA 4ZMFA 4R3CA 1CKIA 3PXZA 1CM8A 1OIQA 3QKKA 3EYGA 2C6KA 3FI3A 3JS2A 4RIWA 3ALNA 3NR9A 5F20A 5L6WL 4FGBA 3KXMA 4GSBA 1APME 3AD4A 3ODYX 4ZY4A 4ALUA 2BIKB 4F0FA 4WSYA 3ZRMA 4O7SA 1OL2A 4FKGA 4KIKB 3OW3A 4IAFA 5AUVA 4UY9A 3OXZA 5LARA 3KC3A 4CLIA 4UWBA 2OK1A 4XP2A 1FOTA 4PMMA 1Q4LA 4USDA 3WILA 4BTFA 4EL9A 3TIZA 3G33A 3QQJA 4AS0A 2YDKA 4FF8A 3Q5ZA 4CXAA 2CHLA 5I3RA 3GB2A 3Q5IA 4J1RA 4JDJA 4QNYA 5EM6A 3ZU7A 5BYYA 2R3NA 3EQCA 1BUHA 2YM3A 5KMNA 4I6HA 4O7TA 2Y6OA 5CXHA 1WBTA 3CJFA 3SKCA 2ITQA 4AZVA 3BBTB 4XS2A 3D15A 1PKGA 4PF4A 3VHEA 4EOQA 4TRLA 2R3HA 5CEKA 4EJ7A 2XH5A 5FP5A 3FL5A 4QOXA 3RMFA 4S34A 4JIKA 5CI7A 2GU8A 2OIDA 4O2ZA 3GXLA 3OWKA 4APCA 4XP0A 2OO8X 4D2WA 3O23A 3DXNA 3GCPA 2NP8A 3IPHA 3O8PA 3Q3BA 2XEYA 3E3BX 4WNOA 4BI0A 5HX8A 4V05A 1NY3A 4J96A 4JIAA 5EG3A 4ANBA 4D0WA 4DEEA 3TXOA 5AWMA 2BMCA 1Q41A 4IAIA 2C3KA 4JAJA 1Q8YA 4BCOA 4IW0A 3OT3A 4XOZA 3ZSGA 4AT5A 5JFWA 4CMUA 3MIYA 3PPJA 5BNJA 3NUAA 1JSUA 4IHPA 4F6UA 4IE9A 3O0GA 4EH8A 3FJQE 3U6IA 3B8RA 1OL1A 2C5OA 3QLFA 3R7VA 5IA4A 5IQHA 4M7IA 5I5ZA 4PDYA 3VVHA 3I4BA 3ZOSA 4HZSA 2PUNA 1JSVA 5E92A 3CSVA 3FZRA 2ETMA 3FY2A 1XJDA 3W16A 5CU2A 4A06A 2XBJA 1H24A 2JKQA 2RL5A 2WMTA 3F9NA 5HZNA 3QZGA 4FKSA 2VTIA 3TV7A 3BV2A 5LMBA 4KIOA 4I5PA 3M2WA 4V0GA 2IZUA 3RPYA 4IWQA 1CDKA 3MJ2A 5A4TA 4ERWA 5E7RA 3OXIA 3EQPA 1I44A 4TYHB 3MPMA 5DRDA 3FXZA 3WF5A 3IECA 2FA2A 3TV4A 2VWBA 3NMUF 5EM8A 4DH7A 1WBPA 3BHYA 3UOLA 4QP1A 4D5HA 5HTCA 4FNWA 4ENXA 3QTIA 4IADA 4B9DA 3MFRA 4BCGA 2R3GA 4NKAA 1OKZA 2R3KA 1M2QA 4LRMA 3AMAA 4P90A 3F69A 5AM7A 4HJOA 4J7BA 5HIEA 4YTIA 1NVQA 3P1AA 4XG4A 1PKDA 5J9ZA 4Z55A 3BQCA 1Q99A 5CU0A 4Z7GA 2QLQA 2GNJA 4JRVA 4LOPA 3ZO1A 4IC8A 5IPJA 3AT2A 3QTXA 1HCLA 4C3PA 3KXZA 2PZRA 5DLSA 4EWHA 4O0YA 5ANIA 4AN3A 4EK4A 2Y8OA 3R1SA 3NAXA 4YLJA 5AADA 2O63A 2ITPA 2OH4A 1LPUA 2GNIA 4FTRA 4FKRA 4FV1A 4LOQA 3HV4A 4D2TA 5KHWA 4YU2A 5M4FA 3LFDA 5EH0A 2OIQA 2BIYA 4BCFA 4AW1A 4QQJA 3UVRA 4ALWA 5BYLA 1GOLA 2XNPA 1A06A 3GENA 4I23A 2AC3A 5LMAA 3I5NA 3OOMA 3QUDA 3UQGA 3IW6A 2WU6A 5EYKA 4X21A 3D0EA 5L8JA 5A4EA 4Z3VA 2PTKA 2ZVAA 1IR3A 2GQRA 2UW7A 2WGJA 4L8MA 2FVDA 5HG7A 3R9NA 1U54A 3EFLA 4IB1A 4PPCA 2QU5A 4YJTA 1UKIA 3ERKA 2JKMA 5HICA 3KL8A 4TPTA 1GZOA 2IW8A 5CAOA 1W7HA 3Q4UA 3GNIB 1H1PA 4B4LA 5AX3A 4DFUA 3EMGA 4EOJA 2DS1A 3R2BA 4FE2A 5J9LA 4BDEA 2JDRA 4FTCA 2XK6A 3G0EA 3PFQA 4BKZA 2VTMA 4M84A 4C57A 4RVTA 2OGVA 3ZLSA 2Q83A 1UU9A 4I5HA 4UXLA 1OIUA 3KXXA 4CQEA 2FSMX 4ZTSA 4A9TA 2X8DA 3ORZA 4BTKA 3NNWA 4NM3A 3FHRA 4XG7A 4WG3A 3ZC5A 4ZTHA 1QPDA 3CTJA 1CMKE 4BFMA 2C6MA 3VS1A 3F2RA 3F66A 3F2NA 2EU9A 3DK6A 4QRCA 1GJOA 2QVSE 3EJ1A 4GKIA 2RSVA 4ZZMA 3F5UA 3D5VA 4AE6A 3P08A 3VF8A 4BWXA 4DGLC 3QCXA 2R3MA 2P3GX 2PVLA 4XH6A 4G9CA 1KE7A 4WNKA 2O8YA 1T46A 4AZTA 5L2QA 4X6RA 1FINA 4TXCA 4CZUA 5H8GA 4I0SA 3F5XA 3AGLA 1WBSA 2VZ6A 3A7GA 3CTQA 5CANA 2EXEA 2X7FA 4HPUE 4YZMA 1QCFA 5I4NA 2R3IA 1TKIA 3LFEA 3R9RA 3DFCB 1OPLA 1W8CA 1L8TA 4W8DA 4FTQA 1H0WA 4BDBA 3OMVA 3MPAA 4FTUA 4G5PA 4IJ9A 2QR7A 2YZAA 3OUKA 4Y8DA 5G6VA 4AGCA 2ESMA 3ZZEA 2OXDA 4QQ5A 1DAWA 3PJCA 4OBPA 4AN9A 2AYPA 3EQRA 4CV9A 3R9HA 5KMIA 4UMQA 4NIFB 4MHAA 2I0VA 3LJ0A 3ZBXA 4ZZOA 5B7VA 1XQZA 3DBCA 5CLPA 2QO9A 2UW4A 1T45A 3PYYA 3QKMA 3LCKA 4I94A 2FSLX 4QMWA 4KD1A 3PJ2A 4YNOA 2CNUA 2PZPA 3MVJA 2X2MA 4IAYA 5IA5A 3GT8A 4CKRA 1UA2A 4IM2A 3R7IA 4AA4A 4FSUA 4IXPA 4QTBA 4JBPA 3NX8A 3DJ5A 4ASZA 2NRYA 2WMWA 4Y95A 4D4VA 1H08A 4BCNA 5IEXA 5EM7A 3TJDA 5IMXA 4F6WA 4G6OA 5AV1A 3HA6A 4N70A 4XRJA 5CU6A 5L8KA 2P2IA 1WVXA 3FQSA 3PG3A 4YJVA 2XKCA 4TW9A 2XIZA 4C36A 5HNGA 4I5CA 3LZBA 5DYJA 5LMKC 4H05A 4AT3A 1CSNA 2OJ9A 3PXRA 4QYGA 4DEIA 3BU6A 3B8QA 5JT2A 4EH7A 4FBXA 3NIZA 3GC0A 3HMNA 5D41A 2RFNA 3MDYA 4BVUA 1BI7A 3R02A 2QKRA 4Q9SA 3P9JA 3O71A 4YJPA 2YM4A 2P55A 5FM3A 4AF3A 5I9ZA 4IQ6A 2R7BA 1SVEA 3HMPA 2V55A 4NT4A 3P79A 5AR5A 3CY3A 4NZWB 4NJDA 1ZLTA 4NCTA 3EWHA 4BCHA 1ZY4A 4LFIA 4DG3E 3PTGA 4Y72A 3ANRA 5FEDA 4G34A 2RF9A 2XM8A 4U80A 5HD7A 4B8LA 4TL0A 1ZZLA 4F63A 4HGTA 4E5AX 4OTGA 4BCQA 4FR4A 2WTWA 2Q0BA 3AT3A 3N4VA 3K5VA 2OZAA 4IBMA 2G9XA 3NUPA 4YC3A 4CSVA 4LGHA 3KRJA 4PMSA 5K9IA 3C5UA 4L7FA 3FMLA 4DFNA 3OY3A 2A0CX 3BHHA 3KXGA 3C4ZA 4FNZA 4GVJA 4IAAA 3JVSA 4PDPA 3UPZA 2VX0A 3R21A 4ZP5A 4AW5A 4BZNA 4L67A 4ANNA 4IX3A 3ZH8A 4EBWA 5JN2A 3E5AA 2YM7A 3TNPC 2BCJA 1F0QA 4M69B 5GHVA 2J6MA 3FLYA 3G2FA 3GCVA 3QFVA 3R1QA 4P4CA 4W8EA 4BYIA 4C4FA 2BDFA 3SGCA 1VR2A 2ZJWA 1YKRA 3TNHA 5CZHA 3FPMA 4PP7A 5EOLA 3HYHA 3DB6A 3ZSIA 2QCSA 5KBRA 4U79A 3G90X 4FKWA 2ITUA 3I7CA 4AN2A 3DK7A 3ATSA 3PE2A 5JFXA 2LGCA 3EYHA 3BGPA 3L8SA 3OC1A 4FTNA 4GW8A 2BILB 2F57A 4IWOA 4WRGA 4XV1A 4C02A 4F1MA 4LGDA 2NO3A 3NEWA 2X0GA 5EHOA 2RFEA 3WF8A 5L2TA 2VUWA 2IVTA 3L9PA 4CRSA 3RCJA 3MFTA 5DBXA 1WMKA 2JBOA 4O27B 2IJMA 3QRUA 4RVLA 4BIDA 2O5KA 4QMSA 1WBOA 3D7TB 4BTMA 3V8WA 5HU3A 4RWJA 4YUQA 2I0YA 4IX6A 3ZUUA 4FTAA 2OU7A 4F1TA 3FKLA 1IRKA 5IDPA 2Z7QA 4TZRA 5E8TA 3DBEA 5KHXA 5EYMA 3PSCA 2G2HA 3LFSA 5ETFA 5CWZA 1XH7A 4PTCA 1BI8A 2WMXA 3V3VA 3GQIA 3KK8A 1PXPA 1TQMA 3SOCA 4M97A 4DEGA 4DG2E 3L8VA 3IDCA 2GS6A 1MQ4A 2C6TA 3GOPA 2AC5A 2F7EE 3FZTA 3S2PA 4IACA 5ANEA 2GFCA 4YJUA 5E8SA 4CMTA 2CGWA 2EB2A 4L6QA 3UQCA 3FV8A 4GFMA 2VWXA 4NJ3A 5KBQA 2ONLA 5CEIA 4YURA 3TG1A 4JRNA 1XH6A 1UU7A 3GVUA 4EH9A 3FZPA 3FMNA 4XHKB 3UZTA 3DA6A 3KFAA 3EFJA 3DDQA 4BICA 5B2KA 1MRVA 3NYVA 3OP5A 2OF4A 4CVAA 3QWKA 4ZS0A 4G6LA 5AV2A 4O6LA 3E93A 5DFPA 3IK3A 3RM6A 4FZFB 2GHMA 5FXSA 2XIYA 3GU4A 4FZ7A 4EUUA 5DVRA 4F7LA 4RRVA 4IJPA 3OBJA 3W2PA 2W9ZB 1YDSE 4FL1A 4O1OA 3W55A 1IAJA 2XK4A 1P2AA 4MEDA 2X7OA 4EONA 3MFSA 2V7AA 4C4HA 2WMVA 3QBNA 3V6SA 4G1WA 5CSWA 4Q5EA 3MH1A 5A4QA 1G3NA 4IZ7A 1Y8YA 5CEMA 5FTGA 4JQ7A 4BDJA 4M0YA 2GCDA 2UW3A 5G1XA 1GIHA 2C6EA 2CPKE 2P0CA 3V5JA 2BFXA 2VTLA 3QWJA 3VUTA 1OBDA 2WTCA 4H1MA 5IQEA 4ZS4A 3CC6A 3CQWA 1DI9A 4V04A 4S32A 4DN5A 1W82A 3C7QA 3MBLA 2PZIA 1A9UA 5CU4A 2X39A 5DGZA 3OEZA 5FWKK 2BZJA 1XH9A 4A9YA 4QPAA 3MWUA 4FSTA 5M55A 2ETRA 2QOQA 2GQSA 4GIIA 1OPJA 2BHHA 2WD1A 4R3PA 4ZJJA 2ZV2A 3CPBA 5TR6A 3RBWA 4HYSA 3M1SA 3A61A 3LOKA 3UNZA 4EC8A 3DGKA 3A7JA 4RJ7A 5HO7A 4C59A 4PMPA 3O8TA 3OHTA 3QHWA 3JYAA 3LFQA 1OITA 3R83A 2W9FB 4RIXA 3MN3A 1GY3A 3UC4A 1MRYA 3FL4A 4RVKA 3HVCA 3FKOA 4RIOA 4O81A 3EH9A 1R78A 5DR6A 3HP5A 5AR3A 2WTDA 3HKOA 3TZ7A 4MF0A 4F99A 5JZJA 3ZXTA 2WQNA 1Q3WA 5LWNA 2OJFE 3HV5A 3KMMA 3MV5A 2J5FA 4O0TA 4O7WA 3BQRA 4I22A 2IVSA 4ASDA 2HW7A 4PL4A 4LQMA 3VS5A 3VS7A 1YHSA 4PMTA 3V04A 4MAOA 3T9IA 2VD5A 4U41A 3BCEA 3WIKA 5LVMA 3K54A 3KCFA 2F49A 4W4YA 3I60A 2GTNA 3ORXA 2A2AA 4XG3A 5CI6A 3IONA 3AC2A 5DH3A 2QKWB 4CCUA 2F2UA 3CGOA 4EK8A 4F1OA 1K9AA 5K4JA 2GHGA 3R22A 2Y9QA 4K9YA 3R7GA 4BKJA 4E6CA 1PMNA 3H30A 2W06A 5E8UA 5HG9A 4MTAA 5HIBA 4MXCA 2YZLA 3HLLA 3F61A 4DEBA 5CVHA 4DFLA 3QC9A 5D9HA 3BEAA 5HBHA 4EWQA 1H1WA 1VZOA 1ATPE 5LOHA 3DBQA 4JQ8A 2YM8A 4TYJA 3UYSA 4AX8A 3FLNC 4YMJA 2V5QA 3WIGA 1H26A 3OY1A 2GHLA 5GNKA 3S4QA 2BRNA 5HI2A 4WIHA 4ZLZA 1FQ1B 3G6GA 4UYNA 5CQUA 4C37A 2ZOQA 1ZAOA 2CGUA 4BYJA 3T9TA 1Q24A 1H07A 2C5YA 4AE9A 4CYIA 5HORA 3PP1A 5A54A 2Z2WA 4FV7A 2YM6A 4P5ZA 2BHEA 3TIYA 2WQOA 2HENA 2PZYA 3QRTA 4QP4A 3HNGA 4EH2A 2ITTA 3LQ8A 4XG6A 5AV0A 1GNGA 3A8WA 3LXPA 4GUEA 1O9UA 5I3OA 3NWWA 3PVBA 2PVNA 4WUAA 2FGIA 3HA8A 5KMKA 5DR9A 4GCJA 5J7BA 1ZYSA 5HBEA 5AA9A 4CTCA 1JKLA 3UGCA 4HPTE 3DLZA 1F3MC 4WO5A 3P5KA 2VO7A 2OG8A 5ANKA 3PSDA 3QUEA 2XM9A 4X3JA 3C1XA 3S1HA 2JKKA 3O96A 4FKQA 1E1XA 4CNHA 3ZONA 3NNUA 4FSQA 4O84A 4GJ3A 4E93A 5AJQA 1V0BA 4M8TA 3TACA 2CN5A 3IW4A 3QX4A 4EHZA 5FP6A 4GK3A 3SAYA 4EH4A 3TZ9A 2VTHA 2XP2A 4P7EA 4X2JA 3MVMA 5CVFA 5E8VA 2C6DA 3OF0A 3CTHA 2LAVA 4DBNA 2ZYBA 3ZLWA 2C1BA 2PVHA 3UIXA 4LV8A 3OVVA 4YZCA 3VJNA 1NVSA 4GG5A 2IVVA 5CSXA 5A14A 4FIGA 4ANSA 3BV3A 4JBVA 3FC1X 4D1SA 3F3WA 1QPEA 4QP2A 4ZTRA 4DHFA 5IA1A 3MW1A 3VF9A 5HE0A 4GL9A 4UALA 5AUXA 4R1YA 2PUIA 2JD5A 4OTHA 2UZEA 1R39A 4U43A 4EORA 3G0FA 2YITA 4ANOA 4BDKA 1U5RA 2O64A 4FKTA 4M68A 4FG8A 3KULB 3Q6WA 1YQJA 3BYUA 4FEUA 2C6OA 1FGKA 4G9RA 1ZY5A 3SD0A 3E8CA 2W7XA 3OG7A 3RVGA 2OICA 3ZBFA 4TYGA 4L45A 3TDWA 2W4KA 2ETKA 3MA6A 3DDPA 2JDOA 4FKLA 2GNGA 4NFNA 4TN6A 3FXWA 3UNKA 3S3IA 1YWNA 5KX8A 3R71A 3GUBA 4AA0A 3VUMA 3ORLA 3PIYA 4DF3A 5E8XA 3W33A 4OGRA 2YLEA 4IVAA 4CZTA 5DN3A 4F0GA 3KF4A 5AIKA 5EFQA 4H3PA 5FXQA 1OKVA 4MD8E 3LM5A 3D94A 1KUTA 2BFYA 3I79A 4MBIA 3R04A 4CFMA 5DHJA 3ZEWA 4MF1A 1YOJA 2W1GA 2FO0A 3OT8A 3DJ6A 4ZEGA 3DBFA 3QU0A 3TKHA 5TO8A 4MD7E 4OAUC 1DM2A 4BGHA 4U3ZA 2QOHA 4OTRA 2H96A 3NCZA 2UW6A 1MP8A 3O51A 3DQWA 3C4WA 4GU9A 5EDQA 3VRZA 3E88A 3CY2A 2HY81 1A48A 4OT6A 5CAVA 2WIHA 3C9WA 4MNEA 5KNJA 4BDDA 2VRXA 2F9GA 2VTQA 5CTPA 2R9SA 4YHFA 5GZ8A 4FTOA 5JH6A 3KVWA 2WQBA 4FT5A 4K6ZA 1KWPA 4BDFA 4V0GB 4MQ1A 3LFFA 3BI6A 4NM7A 3U54A 4FSWA 1YDTE 2HYYA 2QOLA 4USFA 1H8FA 2JLDA 4WSQA 4FL2A 4KIQA 3QA0A 4YJSA 3UPXA 4PNIA 4APPA 4BCKA 2Y4IC 2UVZA 5EI2A 5C8NA 2XCKA 3WARA 3HMIA 3WYXA 3FE3A 4O91A 2J0MB 4FT7A 4HNFA 2HZIA 2JIIA 3ORTA 4C33A 4N57A 5FEEA 3LXNA 3F3VA 4U81A 4PPBA 5EI8A 4I21A 3BU3A 4M67A 2PWLA 3IS5A 3VBQA 3RAKA 4RA4A 3TN8A 3S00A 3P7BA 5AA8A 1Q8WA 3ALOA 3NUUA 3V5LA 4BR3A 4FTLA 4XNEA 3KA0A 4FV4A 4QYEA 3KXHA 4GIHA 4DH3A 5BX0A 4GK2A 2EWAA 3T3VA 1YOLA 3UP2A 3A8XA 5K0KA 1GAGA 4FKPA 5KMJA 2VO3A 5BUIA 2BAKA 1TQIA 2CJMA 2X9FA 1ZOEA 4EHVA 2A1AB 3JR1A 5HNIX 3R1NA 4QTEA 4FK6A 4BHNA 1OUKA 4DCEA 5D1JA 2JIVA 4RQKA 3MI9A 5JGAA 4EOLA 3NLBA 2QOCA 4N0SA 2H8HA 3N51A 5EKNA 5EQPA 3IW8A 2BKKA 2ONLC 2QOOA 3FHIA 3ZLYA 4XRLA 3VBXA 2ZM4A 5AX9A 4ITJA 5M06A 4XG9A 3HDNA 3Q96A 1MRUA 3BYOA 3DCVA 5TOZA 1VYWA 2W0JA 2GSFA 3EN5A 3HDMA 5FEQA 3FLWA 5ANJA 5C4LA 5CF4A 2C6IA 5JK3A 3COMA 5L2IA 5DWRA 2X7GA 5EHYA 4O0VA 5HE3A 5IH5A 2QOKA 1QMZA 4JNWA 3LFBA 2R3OA 4WRSA 2YABA 4D2PA 3BWFA 4KAOA 4DFYA 4DFXE 2HIWA 3LFCA 1ZOHA 3OUNB 2HWPA 3PPKA 4KIKA 4C34A 3P4KA 2YFXA 2VX1A 4BBEA 3D5WA 2GPHA 3PJ8A 2GNLA 3W1FA 5F1ZA 3HRFA 2PZ5A 3IG7A 4FV8A 4NM5A 3UP7A 1J3HA 2I0HA 5FG8A 4F7SA 4YNEA 3VS2A 3ENMA 4RIYB 4DEAA 5HBJA 1K2PA 3QXPA 1OL6A 5DOSA 5AR7A 2JKOA 2BALA 4D1ZA 5ETIA 3POOA 2QOIA 4IFGA 2QO2A 2Z60A 3DU8A 4I6FA 4LI5A 4MXYA 4R7HA 5JZNA 3SXFA 2IPXA 2V7OA 2BKZA 5F4NA 4AACA 3GQLA 3QTQA 2OJGA 2GMXA 2YIYA 4N6YA 3DXQA 3W32A 5E9EA 3KY2A 1AD5A 2XRWA 3OROA 3GU5A 5KUPA 4F7NA 4DA5A 1UNHA 1URCA 2OW3A 2PVFA 4A4OA 1W83A 3E62A 4JVGA 2GS2A 4RT7A 3ZFMA 2YERA 4WBOA 3OTVA 3SW7A 5D12A 5BVKA 1EH4A 4CD0A 3R7OA 2C3IB 5L2WA 4QYYA 5HLNA 4CCBA 1OZ1A 5C26A 4LL0A 3Q2MA 1R1WA 3ELJA 4PV0A 4L46A 4EYJA 2AUHA 3EKKA 3KGAA 1SM2A 2C47A 3QKLA 1SZMA 3FKNA 5IQIA 2QODA 3RWPA 5HEZA 1Z57A 3QRKA 5BMMA 3QZIA 2B7AA 4G3DA 5DG5A 3FMHA 3C50A 2VX3A 2WELA 3BYSA 3QD4A 4FK3A 4O2PA 3WYYA 2C30A 4I41A 3FMKA 4ZSEA 3QZHA 5EW8A 3PLAE 2YIXA 2XNGA 4DFZE 3EOCA 3HP2A 3L8PA 4YO4A 5GIPE 5FM2A 3MA3A 4DEDA 2QONA 3IGOA 4F65A 2HWOA 3RTPA 2VTAA 4I4FA 1XH4A 3SHEA 4YO6A 4XUFA 5AR2A 2RIOA 3BYMA 3NW7A 3KREA 4RC2A 2ZV7A 4FNXA 5GJGA 2HW6A 1H0VA 4PP9A 2X4ZA 4WOVA 5M53A 4UWYA 3P0MA 4E5WA 5ITAA 2XJ2A 4MVFA 1R0PA 3FYJX 4J8NA 4RC3A 4NTSA 4Y85A 3TNQB 5I0BA 5IQFA 1YWVA 3FI4A 3GC9A 3MSSA 4MNFA 5FXRA 3H9RA 2PYWA 4QTCA 2CDZA 1U46A 3CE3A 3TCPA 4C62A 4C3RA 2XF0A 5DI1A 1RQQA 2J9MA 2R3LA 3GFEA 4I24A 4Z16A 4TYHA 3FBVA 2ZM3A 2WKMA 4XYFA 1Q62A 4F9AA 4PNKA 4M12A 4OBOA 3PP0A 4W9WA 1RE8A 1FMKA 3BLHA 3QLGA 3R73A 3A4PA 5FQDC 3P23A 3RALA 2IG7A 3UZRA 4WUNA 1LEZA 4RWKA 5B0XA 3MVHA 4RQVA 3PZHA 2XK8A 2WTKB 5L2SA 4JDIA 2OFUA 4H39A 4K2RA 5J95A 1PXLA 2YA9A 4EOOA 3UQFA 5FBNC 3KRRA 3CJGA 2C4GA 3BRBA 3C4XA 3EN6A 2WMBA 1FVVA 3R8LA 3ZEPA 3U6HA 4GYIA 3IKAA 1V0OA 4RWIA 5HVJA 1GIIA 1CKPA 2ZB0A 4O82A 4KKHA 4QNAA 4QMZA 4DAWA 3VIDA 3L9MA 4YJQA 4UMTA 3EN7A 3FSFA 3ZFXA 4TKSA 2HZ0A 2VTJA 3ET7A 1ZXEA 3MS9A 4DCAA 3UNJA 4OTPA 4X3FC 3WZEA 3ULIA 4KSQA 4B0GA 4L9IA 2XIXA 2OFVA 3QL8A 3ZM4A 3PXQA 2E9VA 3FMJA 3UMWA 4CLJA 2C1AA 2CN8A 4GG7A 4ZSJA 2YHVA 3VO3A 4ZZNA 3HMOA 3EB0A 3QAME 5AV3A 4E6DA 3DZQA 3RCDA 4UYAA 3VW6A 3CP9A 5D10A 3MTFA 1KE8A 3OFMA 4F7JA 3UODA 2OIBA 3A7IA 4FV9A 2WPAA 2OZAB 3SDJA 3PE1A 4XEYA 4I6BA 4FSZA 4M66A 3HL7A 4Y5HA 5AV4A 4PPAA 1STCE 2J50A 3D2IA 4BZDA 1WVWA 3RHKA 4X2GA 4BDAA 3KXNA 4W4XA 4S30A 3PA5A 1UNGA 5HKMA 3Q2JA 5LCJA 3H9FA 3JUHA 3U51A 4FKOA 5KMLA 2Q0NA 2JAVA 5K5NA 3DLSA 3ACKA 4V01A 5AUYA 1WBWA 3QQFA 4RG0A 4AXAA 4KSPA 2Y4IB 2YWPA 2GS7A 3MY0A 3ZDUA 5KKRC 4NYEA 1FGIA 3E8EA 5L3AA 2PMNX 4PWNA 3RJCA 1YI3A 4PQNA 5CZIA 2R3FA 4QP7A 4B99A 4G3FA 4FI1A 4AGDA 5ETAA 4XX9A 4FMQA 2Y7JA 4CMOA 3C5IA 1OKYA 2VNYA 3TTJA 5CAQA 3P7AA 3UG1A 4LG4A 3QYWA 4YSMA 3S95A 3ODZX 4JT3A 5I9UA 3SX9A 2XNEA 4F08A 2IN6A 3D5UA 3IOPA 3NUYA 3ZUVA 4AA5A 4DTBA 4QYFA 3FY0A 3ITZA 4C8BA 4TWOA 3M11A 3BEGA 2OXXA 4W4VA 4FSNA 1WFCA 4TTHB 4EQUA 4X2KA 3KU2A 3HAMA 4CT1A 2XNBA 1KE5A 1W0XC 4YLLA 3LMIA 5AEPA 4FC0A 5CT7A 3LLTA 1M7QA 2ITOA 2BTRA 4YBJA 4DH5A 5AAEA 4LYNA 3EL7A 4C35A 2VN9A 3QTUA 5ANGA 4F6SA 3DB8A 4MCVA 1ZYCA 2Y0AA 4PY1A 5FTOA 2CGVA 2WQMA 4AZEA 3V6RA 4CV8A 4UXQA 2QR8A 1IEPA 4RVMA 2BAQA 4FT0A 4U40A 3K3IA 2WIPA 3ZXZA 4H58A 3DTCA 5FRIA 3NPCA 3T8OA 2PU8A 2XS0A 4FUXA 5BYZA 4QMPA 3SXRA 1UVRA 1JPAA 4R7IA 5IA2A 4F64A 2PMOX 1U59A 3ZS5A 4E4LA 1I09A 4LV5A 4YGAA 3BWJA 3O17A 3JY0A 4HVDA 2ERZE 5T6KA 4A4LA 1ZWSA 3QC4A 4TNDA 1UWJA 1BKXA 4GT4A 4QP8A 1Z5MA 4D2RA 3C0HA 4IDVA 5D7VA 3QQUA 1REJA 3OWJA 4QP3A 3RM7A 4BIEA 2ZV8A 2VGOA 3PXFA 4R6VA 3VRYA 3DK3A 1QL6A 4N6ZA 3RP9A 3LCTA 5H2UA 4RJ5A 5CF5A 2QG5A 4FIFA 2XNMA 5LVOA 2XKDA 4RX9A 2XVDA 2V22A 4ACCA 2CNVA 3QCSA 1E1VA 2B54A 1G5SA 5CENA 3KRXA 5IDNA 3TEIA 4FT3A 3R8MA 4NWMA 4FL3A 5EDPA 1WAKA 2Y4PA 2EVAA 3V5PA 3T3UA 3VBVA 2JDSA 4QMLA 3ATTA 3HV3A 4WHZA 3EZVA 1DS5A 1UU8A 2YDJA 4YZ9A 1AQ1A 3QRIA 4EKLA 1S9JA 3U4WA 4ZSAA 3R6XA 3TDVA 4DTAA 4FX3A 5KZIA 4KUJA 3TKUA 4D5KA 2HCKA 4GFGA 4AOTA 4ASEA 3NVMB 3NRMA 3Q9WA 1PHKA 3MY1A 1H27A 4TY1A 1X8BA 1PW2A 3KN5A 3PJ1A 3Q4CA 3R8PA 1GZKA 1IASA 2DYLA 2C6LA 3PY1A 3CBLA 4KRDA 4CG9A 1Z9XA 5DRBA 5GIOE 4BTJA 3LVPA 3NYOA 3W2OA 3NYXA 5IUIA 4JDKA 3EQGA 4P2KA 2XK7A 1L3RE 4NH1A 4L7SA 4PDOA 4RWLA 3VS3A 3EN4A 4ANLA 4B8MA 4D9TA 2XIRA 4MKCA 4UX9A 3MY5A 1J7UA 3QGYA 3ORNA 4ZTMA 5HTBA 4UZDA 4YC8A 2OZOA 4RX5A 5AUUA 1YWRA 3DAEA 3QGWA 3UO4A 3LMHA 4TT7A 5CU3A 5AFVA 1KE9A 3SRVA 4WNMA 3LQ3A 4ORKA 3ZCLA 4A4XA 4EH3A 3WE4A 4RJ4A 2WTJA 4FYNA 3FLQA 4HYHA 2IW9A 4TWNA 4QMYA 3R7EA 4DFBA 4IM3A 2IZSA 1P5EA 2ERKA 5M57A 1M2PA 4OBQA 2CCIA 3HECA 1YOMA 4QMXA 4C4IA 1SYKA 3NUNA 3THBA 1OL5A 2W05A 3D2KA 4TWPA 3BZ3A 4IZ5A 3B2WA 2I6LA 3SW4A 5HCYA 2Z7SA 2UZVA 1JAMA 4FIHA 3NUXA 3KRWA 4G17A 5H9BA 1BYGA 3L9LA 3VBWA 3DAJA 3LHJA 5HOAA 1M17A 3VS0A 5AUWA 4BWPA 3U55A 1LEWA 3MB7A 3KF7A 3CIKA 5DMZA 2W1IA 3D7ZA 3FXXA 4RMZA 3RAIA 3BELA 5K5XA 3AGMA 2YJRA 2IWIA 1FPUA 3KKVA 1IA8A 3CR0A 3CQEA 4KB8A 2X2LA 1NW1A 3FLZA 2BAJA 4R1VA 4TYEA 4BC6A 4K8AA 5I9WA 3I81A 5M44A 3K5UA 2UZNA 2RG5A 3IO7A 3DNEA 4QT1A 3HV7A 3PRFA 3PWYA 1JBPE 1YVJA 2IW6A 4JR3A 4IAZA 4EOKA 3ZZWA 1KV2A 3D7TA 2OXYA 2CLQA 3TWJA 4HOKA 4ITIA 2E9OA 5D11A 4NL0A 2XNOA 4CFUA 5JRSA 2Z7LA 4MD9E 2J0JA 2JDVA 4EQCA 4MX9A 4FV2A 5A9UA 2Z8CA 2BPMA 5BVEA 3LMGA 4JG7A 4X3FB 2BDJA 5CEQA 3PIZA 3KB7A 2PE1A 2YM5A 4MQ2A 4BI2A 4L01A 4C4EA 4CFXA 1REKA 2J51A 2UVXA 4ALVA 3Q6UA 2F7ZE 4O6EA 4BDCA 4EZ5A 4PX6A 5T68A 5IF1A 2HOGA 5FUTA 4ERKA 2WXVA 3DT1A 3V5WA 4D2VA 4FTIA 4XMOA 1R0EA 1LP4A 4NM0A 4YSJA 3RINA 3RPOA 2NRUA 4TWCA 2CKOA 3ZO4A 4OTWA 2J0LA 5TKDA 1H1SA 1YHWA 4FSMA 2A19B 3F6XA 4H1JA 3SXSA 4L42A 4AP7A 2JAMA 5L6OA 3O50A 2ZDUA 1JWHA 3DTWA 1W84A 3FI2A 4AFEA 4EBVA 5I9VA 3SV0A 3QHRA 4FV3A 4NUSA 3FZSA 4K77A 5K3YA 1ZZ2A 4HGEA 4DGOA 2QHNA 3WF9A 4DGMA 4RJ6A 1YDRE 3AC5A 3MFUA 5EQYA 5A6OA 4AW0A 4O22A 2CKEA 4LL5A 4ZOGA 3A4OX 2BTSA 3OCGA 3VULA 3NNVA 2A27A 1M52A 5BPYA 4AW2A 4C3FA 5KKRB 2X6DA 2VWVA 3FEGA 1ZARA 3I0OA 5AAGA 4JS8A 3HMMA 4IANA 4JI9A 4M3QA 5JEBA 4R77A 1V1KA 5DIAA 2RFDA 3W2SA 1DI8A 4M15A 4EUTA 4DC2A 1KSWA 1J91A 4E3CA 1NT2A 1B38A 4XV9A 1PY5A 5EK7A 4YHTA 1PXOA 3RPRA 2W96B 3UYTA 5CALA 1FMOE 1DAYA 4NW6A 2W5AA 4QMUA 4AWIA 4F9YA 4KKEA 4O0WA 1PMVA 4C61A 4CG8A 4F9WA 4JG8A 4FKJA 4LOOA 4GEOA 4FZAB 3EFKA 4JAIA 3OCBA 4YZNA 4ARKA 4Y73A 2JBPA 4U3YA 4EOSA 2IZTA 1PXKA 2YIQA 3I5ZA 4DH8A 5BVOA 2B0QA 4FSYA 2CMWA 3BPRA 5BMSA 4J99A 4MWIA 3Q4TA 4QMTA 5BVDA 5M51A 2HAKA 2YIWA 3LCDA 4YPSA 2QC6A 4KBAA 3QCQA 2Z02A 3R8UA 3LCSA 4BN1A 5CEOA 3G6HA 5M56A 2XA4A 5M09A 3HGKA 3ZUTA 4RIWB 4A07A 1NXKA 5IQCA 3OTUA 4K18A 4OLIA 3UOKA 4MXOA 4F9CA 4E4XA 4C2VA 3G5DA 3NW6A 3WF6A 2OI4X 3ORMA 3A62A 4J52A 4HVIA 3BKBA 4DINA 4J53A 4FA2A 4AGWA 2E9NA 3N4UA 1BL7A 4O7ZA 4FTMA 3MH2A 4QMQA 3LJ1A 3E64A 3REPA 2XRUA 5CY3A 4RZVA 4GYGA 2ITYA 3RZBA 4CFFA 2XKEA 3R63A 2QG7A 5CAPA 2W1HA 2B55A 2PSQA 4NSTA 1KE6A 2XMYA 3RAHA 2XK3A 5LXMA 2J90A 3QD0A 4MK0A 3CD3A 4YHJA 4C58A 4ZSLA 4U42A 4E6QA 3R1YA 3ZLXA 4IX5A 4H36A 4M0ZA 4RA5A 2CGXA 5J87A 2W1FA 3MGYA 3R7YA 3UIUA 5E4HA 4YJOA 1Y6AA 2J0KA 3A7HA 3DV3A 4UMUA 2RKUA 3Q32A 3TNWA 1AGWA 4UBAA 2W17A 3P7CA 2KTYA 4UMPA 5K4IA 2NNWB 1YXTA 5AP2A 4ACMA 2VTOA 3C4CA 3QTZA 5AUTA 2J0IA 5AP0A 4DLJA 1B6CB 3KRLA 4AZWA 5L4QA 5FGKA 4L00A 4MYGA 3RI1A 5IQGA 4PTEA 5B2MA 4IVCA 4IB5A 4NCTC 2DQ7X 3AMYA 4I92A 5KCVA 3TUCA 4A9UA 1KOAA 4EJNA 3D4QA 3ID6C 1OL7A 3F3UA 3ZMMA 1G8AA 3ZHPC 4YTFA 3HAVA 3Q9ZA 4P5QA 3WI6A 3VC4A 1OB3A 3NZ0A 4XLVA 5AMNA 1RDQE 4JXFA 4YP8A 4EHEA 5CASA 3EHAA 3FSKA 3VBYA 3IDPA 5CAUA 4ITHA 3EFWA 2R3QA 4J95A 4WNPA 1WCCA 5IA3A 2HZNA 4CEGA 3G9LX 5M4IA 4X0MA 5IQAA 4IX4A 3MB6A 3R01A 5CSHA 4H3QA 1OUYA 3VW8A 5HG8A 1XBCA 4DYMA 5HTIA 4D28A 3D9VA 2P33A 2IVUA 3BHUA 4HYUA 2PMIA 1OI9A 3FC2A 4PTGA 2W4JA 3NAYA 4RBLA 5GZ9A 5AAFA 3RGFA 5ANDA 4A9RA 5DR2A 3CD8A 3QQKA 4DGNA 4BY9E 5AP3A 4AUAA 1ZYJA 4Q2AA 3LPBA 4UV0A 4Y46A 3CLYA 4KBCA 5CEPA 3Q4ZA 1H1RA 4I5MA 4FIJA 4KRCA 4OTFA 3LXKA 5D7AA 4OUCA 2X6EA 5DEYA 5EM5A 3UC3A 2WEIA 2VWIA 3GI3A 2RGPA 5CYIA 1Q97A 4O7VA 5CF8A 5ICPA 4KABA 5HNBA 2W1CA 4AAAA 2X81A 3COKA 3MYGA 1XR1A 2VWWA 5FLFA 5IQDA 1LUFA 3AD5A 3DZOA 4FEQA 1UNLA 2WNTA 3DAKA 4L68A 3BLQA 3ANQA 5EOBA 4ZLOA 4O96A 3TUBA 3R28A 3DJ7A 3DQXA 3QTWA 4K11A 3AC4A 4LGGA 2B53A 4W4WA 4D0XA 2PMLX 3KULA 3OEFX 2GFSA 4UZHA 3VHKA 5JKGA 4FOBA 1JKKA 4RSSA 2UUEA 2VWYA 4B7TA 1VYZA 4OTQA 5LCKA 5L8LA 5C4KA 4KWPA 4NKSA 3A7FA 1ZYLA 3FZ1A 4XBUA 2O2UA 4G2FA 3BHVA 3GGFA 4FV0A 4FV5A 3KMWA 4XV2A 4F0IA 5I9XA 4O86A 3RZFA 2WZJA 2W1EA 4FTTA 1FVRA 1WBVA 4FV6A 4BRXA 4JBQA 3EQDA 3H0YA 4ZLYA 1TQPA 1OGUA 4QMMA 2XZSA 2BZHB 4C7TA 5J7HA 3F88A 4A7CA 5FBOA 4EOMA 5B2LA 2OH0E 2PL0A 3CKXA 3GOKA 5AUZA 3GCUA 1OIYA 3IGGA 3LAUA 4LMNA 4D55A 3RAWA 1Q8TA 3DBDA 4BKYA 3KMUA 1ZMUA 2FB8A 3BGZA 4G6NA 4JBOA 1IG1A 4HNIA 4O0XA 4ACHA 2R7IA 3QD3A 3PDTA 1UV5A 5E90A 4E8AA 2W99B 4GUBA 5AP4A 1U54B 2C69A 3C4EA 3V01A 4CQGA 4HW7A 1O6KA 4IFCA 4JLCA 2OWBA 4HYIA 3WF7A 2V62A 5TT7A 4AOIA 2R3PA 4PRJA 3F5PA 4YC6A 3KK9A 3TTIA 3U9CA 4OR5A 2UW5A 1Q5KA 5C8MA 3SLSA 2Y6MA 3R30A 4S33A 5HO8A 4RFZA 3R8VA 2FSTX 4OT5A 3CCNA 5CNOA 5E91A 3R00A 3AQVA 3L8XA 5KZ0A 1V0PA 5HVYA 2HK5A 4NU1A 4QPMA 5HCZA 2UVYA 3PY0A 2C5NA 5DT4A 2ZAZA 2JIUA 1J1BA 3F7WA 3MIAA 2UZWE 3TZMA 2BRGA 4O7LA 1U5QA 3FQEA 4YZDA 4BZOA 2VGPA 3ZFYA 4O0RA 5EKOA 2UZDA 3SG9A 3OW4A 3SA0A 4Y5QA 2ZM1A 2QO7A 1JOWB 5A6NA 2BRMA 3DKOA 2OKRA 2X1NA 4RPVA 3DS6A 5F9EA 4EEVA 4MH7A 2H34A 4PL3A 1O6LA 4L43A 5KMMA 5EQEA 3W8LA 3F5GA 2C0TA 4GT5A 3P78A 5AIRA 4DE4A 2OLCA 2UV2A 1HCKA 3RKBA 4USEA 2ZDTA 3AC8A 3I0QA 4XJ0A 2YJSA 2PVRA 2I40A 1M2RA 4J98A 2IZRA 1PXNA 2YACA 5HD4A 3O8UA 3MH3A 3HRBA 4WG5A 5FDPA 4GMYA 5KMOA 2X9EA 4O7RA 2UZTA 4O0SA 3PWDA 5CX9A 3BHTA 4BBMA 4CRLA 2W5HA 3R8ZA 3UG2A 4MBLA 3K2LA 4XCUA 4QTDA 2RFSA 4U9AA 3COHA 5DE2A 5DA3A 4MXXA 4WKQA 3W18A 2W1DA 4D58A 4QQTA 2VTTA 3PJ3A 3ROCA 3ACJA 4X2FA 5JQ5A 3H9OA 4EOIA 3JPVA 3H3CA 4NFMA 3NNXA 3OCSA 5ACKA 5FDXA 3LW0A 4IZAA 3HZTA 3GP0A 3UIBA 4ACGA 2GDOA 5A46A 4QTAA 3UVPA 3RK9A 1HOWA 4AU8A 3OWLA 5HE2A 5KE0A 3OD6X 2BZKB 4I93A 2RG6A 4O0UA 2UZOA 3F82A 3W2CA 4E1ZA 3LJ2A 5IUHA 4FEVA 4WD5A 4JOAA 2O3PA 2OJIA 3GC8A 4K0YA 3LLAA 3GU6A 5DPVA 3UE4A 4FYOA 4U5JA 4AT4A 3G15A 2PVYA 3FQHA 1OVEA 1UWHA 2P2HA 1GZ8A 4O1PA 2DUVA 3WZKA 2G2IA 4FZDB 3OCTA 2BR1A 4I20A 5HCXA 4CFVA 3MPTA 2B1PA 3LE6A 4RJ3A 3NDMA 5GINE 4BIBA 2QOFA 1W98A 4FODA 4QMOA 4HCTA 1Q61A 4RIYA 5J1VA 2HY0A 4DEHA 3UOHA 3ORKA 3OOGA 2B52A 4IWPA 3TKIA 4O7NA 3DKFA 4DLIA 2VWUA 4FKUA 5EI6A 5HQ0A 3VWAA 3AMBA 4II5A 4KS7A 4QMVA 4QPSA 2XNNA 4UN0C 4YJNA 5IA0A 3KCKA 2OSCA 5DT0A 5IKWA 3TV6A 3UZPA 3E8NA 4BBFA 2BRBA 4A9SA 1PYXA 4DBXA 3CQUA 3F3TA 2EXCX 2X2KA 2WTIA 3NS9A 4Q9ZA 5HIDA 2GTMA 2XB7A 3PZEA 1U4DA 4FG9A 4CYJA 4FIEA 4ANQA 5KO1A 2OF2A 3C0IA 3ETAA 3FWQA 1PXIA 1XH8A 1XH5A 3QA8A 4YZBA 4HVHA 4B6LA 4BL1A 1WBNA 3CPCA 3TUDA 5CQWA 4U45A 5JSMA 3C4FA 4KBKA 4RC4A 2QHMA 2CCHA 1H1QA 1SNUA 3IQ7A 2VTNA 2XBAA 2PULA 3PSBA 4WG4A 5H3QA 2SRCA 3P86A 2WB8A 2X8EA 2E9PA 5M08A 3AT4A 3PXKA 5K0XA 5I9YA 1Y57A 3VBTA 4DITA 3GU8A 2PVMA 2ITNA 5JFVA 4S31A 2CLXA 5HG5A 3TL8A 5HE1A 4F09A 2B9HA 2F7XE 3RK7A 3VUKA 4TNBA 5HU9A 4BI1A 3HEGA 4AOJA 1ZOGA 4XP3A 4FTKA 1S9IA 1P14A 1XWSA 3PUPA 3S0OA 3BBWA 3V5TA 4D9UA 1LR4A 3ZO3A 2CSNA 4F9BA 1Q8ZA 2JDTA 3PRIA 4HCVA 4J8MA 3SOAA 3UTOA 3VUDA 4BDIA 2BVAA 4MBJA 4Y83A 2VU3A 4IB3A 4QMNA 2XJ0A 5HO6A 4RFMA 4EK3A 2QLUA 1YXXA 5DEWA 4E6AA 3ZYAA 1BX6A 4M14A 3PXYA 4O21A 4ENYA 1SMHA 3VS6A 2FH9A 1Y8GA 4EZ7A 5EW3A 4HVSA 5EYDA 5EHLA 3DXPA 5C9CA 4CKJA 1Y91A 2JEDA 3NW5A 3GC7A 5FTQA 4EZ3A 1OPKA 2ITXA 4GK4A 4ZIMA 3TJCA 4I0TA 4CT2A 2FYSA 4ACDA 1UU3A 1YHVA 2YCFA 5BVWA 2UW9A 4ZTNA 2YN8A 3SVVA 2YIRA 3Q60A 3LCOA 3A60A 3F3ZA 4U8ZA 3RNYA 3U6JA 3DFAA 1RW8A 4G3EA 3FDNA 1QPJA 1VEBA 3MH0A 4WA9A 2EB3A 3C0GA 4QD6A 2JITA 5HESA 5HLPA 3UBDA 3RK5A 5LJJA 4FGRA 4DGGA 5HLWA 4O83A 3K3JA 4IC7A 4GVAA 5JRQA 3QYZA 5AP5A 3QX2A 2YAKA 3ZDIA 2YISA 2B9FA 4FKVA 4QYHA 5BUEA 2I7QA 1MQBA 2XKFA 4IEBA 4QP6A 2V0DA 3WZDA 3O7LD 3QQLA 3VQHA 4GRBA 3PVGA 4ANMA 2R5TA 5H8BA 2B9IA 5IU2A 1ZMWA 2KULA 3A99A 2PVJA 3E87A 2HZ4A 4EQMA 3QRJA 4CZYB 4U97A 3ZO2A 4FKIA 5CT0A 1B39A 2WMRA 2C0OA 3SRVB 3MJ1A 4NIFA 4EYMA 3BE9A 2WO6A 3V5QA 5J79A 2YDIA 2VO0A 1J7IA 4JX3A 5BVNA 3ENHA 1WVYA 4BB4A 4M13A 2UW8A 4EH6A 5IH4A 1OKWA 4KKGA 3ZM9A 4CGAA 1YXSA 2HXQA 2YAAA 1XBBA 3AC1A 2C68A 3KEXA 3QTSA 1BMKA 4FOCA 4N4SA 1CKJA 2F4JA 2H6DA 2QQ7A 2WU7A 3LQ5A 3ULZA 4AGUA 4BCJA 3RPVA 4GS6A 2JGZA 1J1CA 3Q53A 5IEVA 4D4RA 2IO6A 3VUGA 4C2WA 5AP6A 3ZTXA 2C5XA 4ASXA 3PA3A 4DTKA 1JSTA 3TZ8A 3EQBA 4E4NA 3SG8A 4PL5A 2CKQA 2ITWA 3SC1A
chains in the Genus database with same CATH superfamily
4IDTA 4IZYA 3OZ6A 3UOJA 3LKMA 4L3LA 4R5SA 1J7LA 3DPKA 5TE0A 1ND4A 5IISA 2R64A 2E9UA 4CFWA 4L53A 3PVUA 4AXCA 3E92A 3HV6A 3LIJA 4LUEA 1XBAA 2FSOX 1PRYA 4DT8A 2HELA 4AFJA 1OECA 3O5AA 2I1MA 5ANOA 4HZRA 1QPCA 2ACXA 2JFMA 4E5BA 4J71A 2BROA 3AC3A 3CEKA 3ZC6A 2WMUA 1JVPP 2OBJA 3QXOA 4QP9A 4S2ZA 4UEUA 3U87A 4AZFA 4X7QA 4R78A 2GNHA 3E7OA 1UKHA 3QQHA 3KVXA 4H3BA 3MESA 2BDWA 4LRJA 2R4BA 4AQCA 3IW7A 3F2AA 2VTRA 4RIXB 4BDHA 5AP1A 2QU6A 2WTVA 3II5A 5GJDA 2C5VA 2GQGA 5DT3A 3PVWA 3U4UA 4E73A 3GFWA 2R3RA 4U44A 2XJ1A 2G1TA 1SVHA 3W0MA 2PY3A 5AR4A 2G15A 1JLUE 3PG1A 4GH2A 1PYEA 4WT6A 5CF6A 4FUYA 3D5XA 2OJJA 4IVBA 4MXAA 2XALA 4OAVB 3NIEA 1PMUA 3FUPA 4I0RA 4IAKA 3VJOA 4RFYA 2R2PA 3PY3A 4JMQA 4XLIA 1SNXA 3LFAA 2GNFA 2FUMA 5J5SA 1NA7A 5LQFA 3I7BA 3TT0A 4R8QA 3O7LB 4G3GA 4FNYA 4ZTQA 5C03A 3Q52A 4ZAUA 5A4LA 1XMMA 1G8KA 4L3JA 4ZK5A 4E4MA 4UWCA 3N4TA 4M69A 2XEZA 4JR7A 4WBBB 5C01A 1CTPE 3VQUA 4DH1A 5L6PA 3H0ZA 3WE8A 2VNWA 4C4GA 5BVFA 1KOBA 5E8YA 3W2QA 4F4PA 2PE0A 1XHAA 1OM1A 3JXWA 4GV1A 3EQFA 5EYCA 5IG1A 3UDBA 2W5BA 5ETCA 3FMDA 4ZJIA 3KN6A 3LM0A 4E20A 5LVPA 4E7WA 4ZY5A 3D83A 4ONAA 3WOWA 5JGDA 3BX5A 5HGIA 3DNDA 3AD6A 3LXLA 2H9VA 3R9OA 4DT9A 3I1AA 4KIPA 2X8IA 5JMSA 4I4EA 5LWMA 4BGGA 1MUOA 3SQQA 4HVGA 2C3LA 3ZRLA 4G31A 1H25A 2EXMA 2UZUE 2WMAA 4AG8A 3E8DA 4BDGA 2W4OA 2VAGA 2W1ZA 2Z7RA 2PK9A 2WHBA 5CS6A 4FEWA 4GT3A 2ZV9A 4FIIA 5J8IA 4G3CA 3GCQA 3TNIA 4BCPA 4QO9A 4EI4A 5TF9A 3UJGA 4Z7HA 4X2NA 3DY7A 3NCGA 3PLSA 3UVQA 4J97A 2R0UA 4KA3A 1Y6BA 4AZSA 2B4SB 3BIZA 3IDBA 4TYIA 4OTIA 3R7UA 3D14A 5IH6A 1ZRZA 2PUUA 2WFYA 3FMMA 4C38A 1PF8A 4I1ZA 2YCSA 4ID7A 2YWVA 4XOYA 2UZLA 4OW8A 1H00A 3DKGA 4W9XA 2VTPA 3ZSHA 3B2TA 1JKSA 4IVDA 4RLLA 2XK9A 2WOUA 5M4UA 2JFLA 3R9DA 3GBZA 3ORIA 1OBGA 2WEVA 4L3PA 2XYNA 4NEUA 3UIMA 1WZYA 2G01A 3JY9A 5GZAA 5CSPA 4MXZA 5JGBA 1JQHA 3OWPA 3RPSA 1PJKA 1PMEA 2PVKA 3EKNA 3FAAA 4IMYA 3R0TA 4JJRA 2YCRA 3TM0A 1ZYDA 4RZWA 2XYUA 2XUUA 1K3AA 4JG6A 2J7TA 3HUBA 4YPDA 3MVLA 3W8QA 4ZXTA 4XG8A 1JNKA 2J2IB 4RJ8A 3VUIA 2XCHA 4YR8A 2VO6A 2ZMDA 3IOKA 3PPZA 4LMUA 3VS4A 3HUCA 5JQ8A 1BLXA 4IB0A 3TI1A 4DG0E 4HGSA 4LUDA 3AG9A 1O6YA 3WBLA 1YXVA 2EUFB 2WOTA 3U8WA 3FZOA 3Q9XA 4O38A 4XV3A 3DKCA 3G51A 3QF9A 3QTRA 4YTHA 1F5QA 2DWBA 3UO6A 3E3PA 3EQHA 4L52A 1XO2B 5DNRA 4IIRA 5AP7A 1H4LA 5J9YA 1GIJA 2A4LA 4U0IA 3ROYA 4E26A 3POZA 2WMSA 3COIA 2QURA 4MWHA 4NW5A 5IQBA 2B9JA 2UZBA 3Q04A 4R3RA 5F95A 1R3CA 4FVQA 4Q5HA 2P4IA 4D4YA 4HGLA 4EH5A 1FVTA 4ZSGA 3CS9A 4PDSA 1G8SA 1YI6A 1E9HA 1ERKA 4CKIA 5IZFA 1PXMA 1P4FA 4FVRA 2CNQA 4CTBA 4JDHA 3C51A 1YRPA 4G16A 4GFOA 4C4JA 4RGJA 1W2DA 5EW9A 4YBKA 4D4SA 5IUGA 4FEXA 3R2YA 5LVNA 4GKHA 5F94A 3WZJA 1TVOA 3QUPA 3I6WA 3VAPA 4IWDA 4FSRA 1BL6A 2VWZA 2VTSA 3AXWA 3E7VA 4K33A 3DOGA 4BGQA 3GU7A 2ZB1A 3V8TA 3F7ZA 3PA4A 4C0TA 3OS3A 2X4FA 2UW0A 5CVGA 5E1EA 2YLFA 5HHWA 4EK6A 4ZMEA 3L1SA 1Q3DA 4ZTLA 3VN9A 3UO5A 4R5YA 4X3FA 3EIDA 3W10A 2NPQA 2ITVA 5CNNA 2JC6A 1URWA 4UB7A 4YLKA 1H01A 4FT9A 5H8EA 5BQ0A 2QD9A 1IAHA 4NK9A 4BHZA 2O65A 3IW5A 3KQ7A 1VJYA 3CGFA 4GJ2A 3FPQA 2O0UA 3L9NA 2ITZA 2BUJA 3BGQA 1OIRA 4MNEB 4QQCA 4LRKA 1P4OA 5BV3A 3QALE 4XBRA 4RLKA 5HX6A 3EZRA 4BCMA 3GCSA 4RX8A 2BZIB 3EL8A 3CXWA 4GU6A 1FBNA 5M4CA 5LVLA 3FMEA 3AOXA 4JQEA 1RJBA 4IH8A 4XG2A 4IM0A 4PUZA 2PUPA 5JFSA 3NYNA 4U7ZA 2VV9A 3BLRA 5CSVA 2HXLA 3V51A 2J4ZA 3QD2B 2PE2A 4FVPA 4UMRA 3QQGA 5E8ZA 4JL9A 2REIA 4EOPA 3OBGA 3OXTA 5AR8A 2R0IA 3RNIA 4EK5A 2BRHA 3M42A 4X6QC 1M7NA 1YXUA 3NUSA 4BWKA 1IA9A 3W2RA 4L44A 5J5TA 4BF2A 1YI4A 5FD2A 5A3XA 3HX4A 4LM5A 3V8SA 4EKKA 3P5JC 5M07A 3UMXA 2QNJA 4YJRA 3RHXA 3G9NA 1PXJA 3QZFA 4BCIA 2XIKA 5LMKA 3BYVA 3EN9A 1SVGA 3MTLA 4FG7A 1H28A 3ZRKA 3U9NA 4EHGA 3C13A 2PHKA 3VUHA 2WTKC 5J1WA 4YTCA 5HVKA 1W2CA 1NVRA 4FZ6A 3H4JA 5GJFA 2I0EA 1KV1A 1XKKA 3A2CA 1YW2A 4CFNA 3FI8A 3Q9YA 4OTDA 3VNTA 1OMWA 2WAJA 2QI8A 3FYKX 1Q8UA 3LFNA 1GZNA 4JX7A 4G5JA 4KINA 5IEYA 1M14A 2G2FA 2YCQA 3GEQA 5IMEA 3O2MA 4K1BA 3HRCA 4RX7A 5ACBC 4NTTA 2WMQA 2QOBA 3FLSA 4KS8A 5AM6A 1ZMVA 2C3JA 2E2BA 4I3ZA 4ZY6A 4D1XA 4EC9A 5A4CA 2YEXA 4KNBA 3BE2A 2ZMCA 2CKPA 4I6QA 2J5EA 2PPQA 3N9XA 5E1SA 3WZUA 3NVKI 4ZJVA 3I6UA 3ORPA 1JKTA 3H10A 4F70A 5C8KA 2C0IA 3NSZA 4FICA 3E63A 4Z9LA 5T3QA 4HCUA 3RWQA 5CXZA 3JVRA 3NGAA 3AKLA 4I6LA 3QCYA 5EDRA 5C27A 4O7YA 4R7BA 4U6RA 5BUJA 2F2CB 3CKWA 3BU5A 3PIXA 5C1QB 2R3JA 3EQIA 2WQEA 4FTJA 5E8WA 4D2SA 4ZMFA 4R3CA 1CKIA 3PXZA 1CM8A 1OIQA 3QKKA 3EYGA 2C6KA 3FI3A 3JS2A 4RIWA 3ALNA 3NR9A 5F20A 5L6WL 4FGBA 3KXMA 4GSBA 1APME 3AD4A 3W0PA 3ODYX 1W2FA 4ZY4A 4ALUA 2BIKB 4F0FA 4WSYA 3ZRMA 4O7SA 1OL2A 4FKGA 4KIKB 3OW3A 4IAFA 5AUVA 4UY9A 3OXZA 5LARA 3KC3A 4CLIA 4UWBA 2OK1A 4XP2A 1FOTA 4PMMA 1Q4LA 4USDA 3WILA 4BTFA 4EL9A 3TIZA 3G33A 3QQJA 4AS0A 2YDKA 4FF8A 3Q5ZA 4CXAA 2CHLA 5I3RA 3GB2A 3Q5IA 4J1RA 4JDJA 4QNYA 5EM6A 3ZU7A 5BYYA 2R3NA 3EQCA 1BUHA 2YM3A 5KMNA 4I6HA 4O7TA 2Y6OA 5CXHA 1WBTA 4O4CA 3CJFA 3SKCA 2ITQA 4AZVA 3BBTB 4XS2A 3D15A 1PKGA 4PF4A 3VHEA 4EOQA 4TRLA 2R3HA 5CEKA 4EJ7A 2XH5A 5FP5A 3FL5A 4QOXA 3RMFA 4S34A 4JIKA 5CI7A 2GU8A 2OIDA 4O2ZA 3GXLA 3OWKA 4APCA 4XP0A 2OO8X 4D2WA 3O23A 3DXNA 3GCPA 2NP8A 3IPHA 3O8PA 3Q3BA 2XEYA 3E3BX 4WNOA 4BI0A 5HX8A 4V05A 1NY3A 4J96A 4JIAA 5EG3A 4ANBA 4D0WA 4DEEA 3TXOA 5AWMA 2BMCA 1Q41A 4IAIA 2C3KA 4JAJA 1Q8YA 4BCOA 4IW0A 3OT3A 4XOZA 3ZSGA 4AT5A 5JFWA 4CMUA 3MIYA 3PPJA 5BNJA 3NUAA 1JSUA 4IHPA 4F6UA 4IE9A 3O0GA 4EH8A 3FJQE 3U6IA 3B8RA 1OL1A 2C5OA 3QLFA 3R7VA 5IA4A 5IQHA 4M7IA 5I5ZA 4PDYA 3VVHA 3I4BA 3ZOSA 4HZSA 2PUNA 1JSVA 5E92A 3CSVA 3W0OA 3FZRA 2ETMA 3FY2A 1XJDA 3W16A 5CU2A 4A06A 2XBJA 1H24A 2JKQA 2RL5A 2WMTA 3F9NA 5HZNA 3QZGA 4FKSA 2VTIA 3TV7A 3BV2A 5LMBA 4KIOA 4I5PA 3M2WA 4V0GA 2IZUA 3RPYA 4IWQA 1CDKA 3MJ2A 5A4TA 4ERWA 5E7RA 3OXIA 3EQPA 4LV7A 1I44A 4TYHB 3MPMA 5DRDA 3FXZA 3WF5A 3IECA 2FA2A 3TV4A 2VWBA 3NMUF 5EM8A 4DH7A 1WBPA 3BHYA 3UOLA 4QP1A 4D5HA 5HTCA 4FNWA 4ENXA 3QTIA 4IADA 4B9DA 3MFRA 4BCGA 2R3GA 4NKAA 1OKZA 2R3KA 1M2QA 4LRMA 3UDSA 3AMAA 4P90A 3F69A 5AM7A 4HJOA 4J7BA 5HIEA 4YTIA 1NVQA 3P1AA 4XG4A 1PKDA 5J9ZA 4Z55A 3BQCA 1Q99A 5CU0A 4Z7GA 2QLQA 2GNJA 4JRVA 4LOPA 3ZO1A 4IC8A 5IPJA 3AT2A 3QTXA 1HCLA 4C3PA 3KXZA 2PZRA 5DLSA 4EWHA 4O0YA 5ANIA 4AN3A 4EK4A 2Y8OA 3R1SA 3NAXA 4YLJA 5AADA 2O63A 2ITPA 2OH4A 1LPUA 2GNIA 4FTRA 4FKRA 4FV1A 4LOQA 3HV4A 4D2TA 5KHWA 4YU2A 5M4FA 3LFDA 5EH0A 2OIQA 2BIYA 4BCFA 4AW1A 4QQJA 3UVRA 4ALWA 5BYLA 4CGAA 1GOLA 2XNPA 1A06A 3GENA 4I23A 2AC3A 5LMAA 3I5NA 3OOMA 3QUDA 3UQGA 3IW6A 2WU6A 5EYKA 4X21A 3D0EA 5L8JA 5A4EA 4Z3VA 2PTKA 2ZVAA 1IR3A 2GQRA 2UW7A 2WGJA 4L8MA 2FVDA 5HG7A 3R9NA 1U54A 3EFLA 4IB1A 4PPCA 2QU5A 4YJTA 1UKIA 3ERKA 2JKMA 5HICA 3KL8A 4TPTA 1GZOA 2IW8A 5CAOA 1W7HA 3Q4UA 3GNIB 1H1PA 4B4LA 5AX3A 4DFUA 3EMGA 4EOJA 2DS1A 3R2BA 4FE2A 5J9LA 4BDEA 2JDRA 4FTCA 2XK6A 3G0EA 3PFQA 4BKZA 2VTMA 4M84A 4C57A 4RVTA 2OGVA 3ZLSA 2Q83A 1UU9A 4I5HA 4UXLA 1OIUA 3KXXA 4CQEA 2FSMX 4ZTSA 4A9TA 2X8DA 3ORZA 4BTKA 3NNWA 4NM3A 3FHRA 4XG7A 4WG3A 3ZC5A 4ZTHA 1QPDA 2X0OA 1CMKE 3CTJA 2C6MA 4BFMA 3VS1A 3F2RA 3F66A 3F2NA 2EU9A 3DK6A 4QRCA 1GJOA 2QVSE 3EJ1A 4GKIA 2RSVA 4ZZMA 3F5UA 3D5VA 4AE6A 3P08A 3VF8A 4BWXA 4DGLC 3QCXA 2R3MA 2P3GX 2PVLA 4XH6A 3BL7A 4G9CA 1KE7A 4WNKA 2O8YA 1T46A 4AZTA 5L2QA 4X6RA 1FINA 4TXCA 4CZUA 5H8GA 4I0SA 3F5XA 3AGLA 1WBSA 2VZ6A 3A7GA 2XANA 3CTQA 5CANA 2EXEA 2X7FA 4HPUE 4YZMA 1QCFA 5I4NA 2R3IA 1TKIA 3LFEA 3R9RA 3DFCB 1OPLA 1W8CA 1L8TA 4W8DA 4FTQA 1H0WA 4BDBA 3OMVA 3MPAA 4FTUA 4G5PA 4IJ9A 2QR7A 2YZAA 3OUKA 4Y8DA 5G6VA 4AGCA 2ESMA 3ZZEA 2OXDA 4QQ5A 1DAWA 2AQXA 3PJCA 4OBPA 4AN9A 2AYPA 3EQRA 4CV9A 3R9HA 5KMIA 4UMQA 4NIFB 4MHAA 2I0VA 3LJ0A 3ZBXA 4ZZOA 5B7VA 1XQZA 1TZDA 3DBCA 5CLPA 2QO9A 2UW4A 1T45A 3PYYA 3QKMA 3LCKA 4I94A 2FSLX 4QMWA 4KD1A 3PJ2A 4YNOA 2CNUA 2PZPA 3MVJA 2X2MA 4IAYA 5IA5A 3GT8A 4CKRA 1UA2A 4IM2A 3R7IA 4AA4A 4FSUA 4IXPA 4QTBA 4JBPA 3NX8A 3DJ5A 4ASZA 2NRYA 2WMWA 4Y95A 4D4VA 1H08A 4BCNA 5IEXA 5EM7A 3TJDA 5IMXA 4F6WA 4G6OA 5AV1A 3HA6A 4N70A 4XRJA 5CU6A 5L8KA 2P2IA 1WVXA 3FQSA 3PG3A 4YJVA 2XKCA 4TW9A 2XIZA 4C36A 5HNGA 4I5CA 3LZBA 5DYJA 5LMKC 4H05A 4AT3A 1CSNA 2OJ9A 3PXRA 4QYGA 4DEIA 3BU6A 3B8QA 3ML1A 5JT2A 4EH7A 4FBXA 3NIZA 3GC0A 3HMNA 5D41A 2RFNA 3MDYA 4BVUA 1BI7A 3R02A 2QKRA 4Q9SA 3P9JA 3O71A 4YJPA 2YM4A 2P55A 5FM3A 4AF3A 5I9ZA 4IQ6A 2R7BA 1SVEA 3HMPA 2V55A 4NT4A 3P79A 5AR5A 3CY3A 4NZWB 4NJDA 1ZLTA 3TYKA 4NCTA 3EWHA 4BCHA 1ZY4A 4LFIA 4LDTA 4DG3E 3PTGA 4Y72A 3ANRA 5FEDA 4G34A 2RF9A 2A98A 2XM8A 4U80A 5HD7A 4B8LA 4TL0A 1ZZLA 4QEBA 4F63A 4HGTA 4E5AX 4OTGA 4BCQA 4FR4A 4AAYA 2WTWA 2Q0BA 3AT3A 3N4VA 3K5VA 2OZAA 4IBMA 2G9XA 3NUPA 4YC3A 4CSVA 4LGHA 3KRJA 4PMSA 5K9IA 3C5UA 4L7FA 3FMLA 4DFNA 3OY3A 2A0CX 3BHHA 3KXGA 3C4ZA 4FNZA 4GVJA 4IAAA 3JVSA 4PDPA 3UPZA 2VX0A 3R21A 4ZP5A 4AW5A 4BZNA 4L67A 4ANNA 4IX3A 3ZH8A 4EBWA 5JN2A 3E5AA 2YM7A 3TNPC 2BCJA 1F0QA 4M69B 5GHVA 2J6MA 3FLYA 3G2FA 3GCVA 3QFVA 3R1QA 4P4CA 4W8EA 4BYIA 4C4FA 2BDFA 3SGCA 1VR2A 2ZJWA 1YKRA 3TNHA 5CZHA 3FPMA 4PP7A 5EOLA 3HYHA 3DB6A 3ZSIA 2QCSA 5KBRA 4U79A 3G90X 4FKWA 2ITUA 3I7CA 4AN2A 3DK7A 3ATSA 3PE2A 5JFXA 2LGCA 3EYHA 3BGPA 3L8SA 3OC1A 4FTNA 4GW8A 2BILB 2F57A 4IWOA 4WRGA 4XV1A 4C02A 4F1MA 4LGDA 2NO3A 3NEWA 2X0GA 5EHOA 2RFEA 3WF8A 5L2TA 2VUWA 2IVTA 3L9PA 4CRSA 3RCJA 3MFTA 5DBXA 1WMKA 2JBOA 4O27B 2IJMA 3QRUA 4RVLA 4BIDA 2O5KA 4QMSA 1WBOA 3D7TB 4BTMA 3V8WA 5HU3A 4RWJA 4YUQA 2I0YA 4IX6A 3ZUUA 4FTAA 2OU7A 4F1TA 3FKLA 1IRKA 5IDPA 2Z7QA 4TZRA 5E8TA 3DBEA 5KHXA 5EYMA 3PSCA 2G2HA 3LFSA 5ETFA 5CWZA 1XH7A 4PTCA 1BI8A 2WMXA 3V3VA 3GQIA 3KK8A 1PXPA 1TQMA 3SOCA 4M97A 4DEGA 4DG2E 3L8VA 3IDCA 2GS6A 3PUFC 1MQ4A 2C6TA 3GOPA 2AC5A 2F7EE 3FZTA 3S2PA 4IACA 5ANEA 2GFCA 4YJUA 5E8SA 4CMTA 2CGWA 2EB2A 4L6QA 3UQCA 3FV8A 4GFMA 2VWXA 4NJ3A 5KBQA 2ONLA 5CEIA 4YURA 3TG1A 1XMLA 4JRNA 1XH6A 1UU7A 3GVUA 4EH9A 3FZPA 3FMNA 4XHKB 3UZTA 3DA6A 3KFAA 3EFJA 3DDQA 4BICA 5B2KA 1MRVA 3NYVA 3OP5A 2OF4A 4CVAA 3QWKA 4ZS0A 4G6LA 5AV2A 4O6LA 3E93A 5DFPA 3IK3A 3RM6A 4FRFA 4FZFB 2GHMA 5FXSA 2XIYA 3GU4A 4FZ7A 4EUUA 5DVRA 4DHZA 4F7LA 4RRVA 4IJPA 3OBJA 3W2PA 2W9ZB 1YDSE 4FL1A 4O1OA 3W55A 1IAJA 2XK4A 1P2AA 4MEDA 2X7OA 4EONA 3MFSA 2V7AA 4C4HA 2WMVA 3QBNA 3V6SA 4G1WA 5CSWA 4Q5EA 3MH1A 5A4QA 1G3NA 4IZ7A 1Y8YA 5CEMA 5FTGA 4JQ7A 4BDJA 4M0YA 3UDTA 2GCDA 2UW3A 5G1XA 1GIHA 2C6EA 2CPKE 2P0CA 3V5JA 2BFXA 2VTLA 3QWJA 3VUTA 1OBDA 2WTCA 4H1MA 5IQEA 4ZS4A 3CC6A 3CQWA 1DI9A 4V04A 4S32A 4DN5A 1W82A 3C7QA 3MBLA 2PZIA 1A9UA 5CU4A 2X39A 5DGZA 3OEZA 5FWKK 2BZJA 1XH9A 4A9YA 4QPAA 3MWUA 4FSTA 5M55A 2ETRA 2QOQA 2GQSA 4GIIA 1OPJA 2BHHA 2WD1A 4R3PA 4ZJJA 2ZV2A 3CPBA 5TR6A 3RBWA 4HYSA 3M1SA 4AXEA 3A61A 3LOKA 3UNZA 4EC8A 3DGKA 3A7JA 4RJ7A 5HO7A 4C59A 4PMPA 3O8TA 3OHTA 3QHWA 3JYAA 3LFQA 1OITA 3R83A 2W9FB 4RIXA 3MN3A 1GY3A 3UC4A 1MRYA 3FL4A 4RVKA 3HVCA 3FKOA 4RIOA 4O81A 3EH9A 1R78A 5DR6A 3HP5A 5AR3A 2WTDA 3HKOA 3TZ7A 4MF0A 4F99A 5JZJA 3ZXTA 2WQNA 1Q3WA 5LWNA 2OJFE 3HV5A 3KMMA 3MV5A 2J5FA 4O0TA 4O7WA 3BQRA 4I22A 2IVSA 4ASDA 2HW7A 4PL4A 4LQMA 3VS5A 3VS7A 1YHSA 4PMTA 3V04A 4MAOA 3T9IA 2VD5A 4U41A 3BCEA 3WIKA 5LVMA 3K54A 3KCFA 2F49A 4W4YA 3I60A 2GTNA 3ORXA 2A2AA 4XG3A 5CI6A 3IONA 3AC2A 5DH3A 2QKWB 4CCUA 2F2UA 3CGOA 4EK8A 4F1OA 1K9AA 5K4JA 2GHGA 3R22A 2Y9QA 4K9YA 3R7GA 4BKJA 4E6CA 1PMNA 3H30A 2W06A 5E8UA 5HG9A 4MTAA 5HIBA 4MXCA 2YZLA 3HLLA 3F61A 4DEBA 5CVHA 4DFLA 3QC9A 5D9HA 3BEAA 5HBHA 4EWQA 1H1WA 1VZOA 1ATPE 5LOHA 3DBQA 4JQ8A 2YM8A 4TYJA 3UYSA 4AX8A 3FLNC 4YMJA 2V5QA 3WIGA 1H26A 3OY1A 2GHLA 5GNKA 3S4QA 2BRNA 5HI2A 3TMOA 4WIHA 4ZLZA 1FQ1B 3G6GA 4UYNA 5CQUA 4C37A 2ZOQA 1ZAOA 2CGUA 4BYJA 3T9TA 1Q24A 1H07A 2C5YA 4AE9A 4CYIA 5HORA 3PP1A 5A54A 2Z2WA 4FV7A 2YM6A 4P5ZA 2BHEA 3TIYA 1G8JA 2WQOA 2HENA 2PZYA 3QRTA 4QP4A 3HNGA 4EH2A 2ITTA 3LQ8A 4XG6A 5AV0A 1GNGA 3A8WA 3UDZA 3LXPA 4GUEA 1O9UA 5I3OA 3NWWA 3PVBA 2PVNA 4WUAA 2FGIA 3HA8A 5KMKA 5DR9A 4GCJA 5J7BA 1ZYSA 5HBEA 5AA9A 4CTCA 1JKLA 3UGCA 4HPTE 3DLZA 1F3MC 4WO5A 3P5KA 2VO7A 4AQKA 2OG8A 5ANKA 3PSDA 3QUEA 2XM9A 4X3JA 3C1XA 3S1HA 2JKKA 3O96A 4FKQA 1E1XA 4CNHA 3ZONA 3NNUA 4FSQA 4O84A 4GJ3A 4E93A 5AJQA 1V0BA 4M8TA 3TACA 2CN5A 3IW4A 3QX4A 4EHZA 5FP6A 4GK3A 3SAYA 4EH4A 3TZ9A 2VTHA 2XP2A 4P7EA 4X2JA 3MVMA 5CVFA 5E8VA 2C6DA 3OF0A 3CTHA 2LAVA 4DBNA 2ZYBA 3ZLWA 2C1BA 2PVHA 3UIXA 4LV8A 3OVVA 4YZCA 3VJNA 1NVSA 4GG5A 2IVVA 5CSXA 5A14A 4FIGA 4ANSA 3BV3A 4JBVA 3FC1X 4D1SA 3F3WA 1QPEA 4QP2A 4ZTRA 4DHFA 5IA1A 3MW1A 3VF9A 5HE0A 4GL9A 4UALA 5AUXA 4R1YA 2PUIA 2JD5A 4OTHA 2UZEA 1R39A 4U43A 4EORA 3G0FA 2YITA 4ANOA 4BDKA 1U5RA 2O64A 4FKTA 4M68A 4FG8A 3KULB 3Q6WA 1YQJA 3BYUA 4FEUA 2C6OA 1FGKA 4G9RA 1ZY5A 3SD0A 3E8CA 2W7XA 3OG7A 3RVGA 2OICA 3ZBFA 4TYGA 4L45A 3TDWA 2W4KA 2ETKA 3MA6A 3DDPA 2JDOA 4FKLA 2GNGA 4NFNA 4TN6A 3FXWA 3UNKA 3S3IA 1YWNA 5KX8A 3R71A 3GUBA 4AA0A 3VUMA 3ORLA 3PIYA 4DF3A 5E8XA 3W33A 4OGRA 2YLEA 4IVAA 4CZTA 5DN3A 4F0GA 3KF4A 5AIKA 5EFQA 4H3PA 5FXQA 1OKVA 4MD8E 3LM5A 3D94A 1KUTA 2BFYA 3I79A 4MBIA 3R04A 4CFMA 5DHJA 3ZEWA 4MF1A 1YOJA 2W1GA 2FO0A 3OT8A 3DJ6A 4ZEGA 3DBFA 3QU0A 3TKHA 5TO8A 4MD7E 4OAUC 1DM2A 4BGHA 4U3ZA 2QOHA 4OTRA 2H96A 3NCZA 2UW6A 1MP8A 3O51A 3DQWA 3C4WA 4GU9A 5EDQA 3VRZA 3E88A 3CY2A 2HY81 1A48A 4OT6A 5CAVA 2WIHA 3C9WA 4MNEA 5KNJA 4BDDA 2VRXA 2F9GA 2VTQA 5CTPA 2R9SA 4YHFA 5GZ8A 4FTOA 5JH6A 3KVWA 2WQBA 2X0PA 4FT5A 1KWPA 4K6ZA 4V0GB 4MQ1A 3LFFA 3BI6A 4NM7A 4BDFA 3U54A 4FSWA 1YDTE 2HYYA 2QOLA 4USFA 1H8FA 2JLDA 4WSQA 4FL2A 4KIQA 3QA0A 4YJSA 3UPXA 3PFYA 4PNIA 4APPA 1OGYA 4BCKA 2Y4IC 2UVZA 5EI2A 5C8NA 2XCKA 3WARA 3HMIA 3WYXA 3FE3A 4O91A 2J0MB 4FT7A 4HNFA 2HZIA 2JIIA 3ORTA 4C33A 4N57A 5FEEA 3LXNA 3F3VA 4U81A 4PPBA 5EI8A 4I21A 3NFGB 3BU3A 4M67A 2PWLA 3IS5A 3VBQA 3RAKA 4RA4A 3TN8A 3S00A 3P7BA 5AA8A 1Q8WA 3ALOA 3NUUA 3V5LA 4BR3A 4FTLA 4XNEA 3KA0A 4FV4A 4QYEA 3KXHA 4GIHA 4DH3A 5BX0A 4GK2A 2EWAA 3T3VA 1YOLA 3UP2A 3A8XA 5K0KA 1GAGA 4FKPA 5KMJA 2VO3A 5BUIA 2BAKA 1TQIA 2CJMA 2X9FA 1ZOEA 4EHVA 2A1AB 4BJJB