4B6LA

Discovery of oral polo-like kinase (plk) inhibitors with enhanced selectivity profile using residue targeted drug design
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
281
structure length
281
Chain Sequence
LITDPRSGRTYLKGRLLGKGGFARCYEATDTETGSAYAVKVIPQSRVAKPHQREKILNEIELHRDLQHRHIVRFSHHFEDADNIYIFLELCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRGILHRDLKLGNFFITENMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGPEADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPRDRPSIDQILRHDFFTKGYTPDRLPISSCVTVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE PLK3
publication title Discovery of Oral Polo-Like Kinase (Plk) Inhibitors with Enhanced Selectivity Profile Using Residue Targeted Drug Design
rcsb
source organism Homo sapiens
total genus 92
structure length 281
sequence length 281
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4b6lA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4b6lA01
4U0IA 5C8KA 1JWHA 1FGIA 3RWQA 4AW5A 4E20A 2B9FA 3I1AA 1QMZA 3BE9A 2UZVA 1Q41A 4FTMA 2VTMA 4EH5A 1KOAA 2ETRA 2ITXA 2OFVA 3VRZA 5IG1A 3ZTXA 4C36A 4AW0A 2VTHA 3Q2MA 4DN5A 2W1ZA 3GT8A 4FTUA 5IQBA 2WMTA 3QRTA 4YSJA 1T45A 3CP9A 3C0HA 3FC1X 3V6SA 3PTGA 5HCZA 4CD0A 4HPUE 4FEQA 1YXUA 3CBLA 4KIPA 2OJIA 4ZK5A 4GIHA 4K1BA 3PPZA 3TV7A 3ULZA 2I0YA 3IW5A 1WMKA 3DTWA 2C3IB 2ERKA 4L6QA 4GFOA 4CKJA 1AQ1A 4X2NA 1IAHA 2WAJA 3KRJA 3EOCA 4AA5A 2BAQA 4YZMA 3O17A 4UWYA 4O22A 4QD6A 4AOJA 3UQGA 4GS6A 4NU1A 1LP4A 2J0JA 4WRGA 3EH9A 4C4JA 2VNWA 5CVFA 3TTJA 4EOMA 2BKZA 4FL1A 1WAKA 2WMVA 4OR5A 4AOTA 2XIXA 3PRFA 3QUPA 4A4XA 1YOLA 2KTYA 4I5HA 1IAJA 4JJRA 4YZCA 1PXKA 4AAAA 2PUPA 2OIQA 3KKVA 4HCUA 4EK4A 4PL3A 4FKQA 4BDAA 4HVHA 3CQEA 5AR2A 2QOIA 3U55A 2W4OA 2P55A 4HPTE 4FKTA 4FKWA 4O0XA 4U44A 1URCA 5IKWA 3TNHA 4DCEA 5CALA 5AP5A 4X3FC 2C0IA 4C37A 2EB2A 2F7ZE 2RIOA 1H01A 1Y8GA 4UYNA 4LQMA 5ACKA 1ZYCA 3GCQA 4L3PA 3T9IA 4PWNA 4L52A 5T3QA 3R7EA 4G17A 4C57A 3A7FA 1G3NA 2A27A 5BNJA 5M09A 4HGEA 4BFMA 4XEYA 2J51A 1ZWSA 3BCEA 2OI4X 3NYVA 5GIOE 2ZM3A 3ZLXA 3Q60A 4HZSA 2OZOA 2RFSA 3WOWA 3OY3A 3ANRA 2R3JA 1Q97A 3MW1A 4UN0C 5HNBA 3MPTA 5LMKC 3PE1A 2BCJA 2XJ0A 3ZSHA 3JR1A 3OCBA 3DQWA 4WRSA 2J5FA 2XRWA 3DKOA 4GG5A 3Q4TA 3SOAA 4E6AA 3EIDA 1QPEA 2JIUA 5B2KA 3FXXA 5KZIA 3SLSA 4LGGA 4XV1A 4GKHA 3RP9A 4I0RA 4FZ6A 3QHWA 4IBMA 3TJDA 1IR3A 4D0XA 3P9JA 3OW4A 3U9CA 2XJ2A 3D4QA 3SX9A 3OCTA 4FKGA 2X6DA 3C4WA 3GCSA 4XHKB 1B6CB 3DK7A 3KFAA 3DNEA 1JOWB 2R64A 4W4WA 3TNIA 3VUMA 1P2AA 3VS1A 3U6JA 2OBJA 5FXRA 5BVNA 3V5PA 4B6LA 2VTPA 2P2HA 1JKTA 4RJ3A 2RG6A 3AMYA 5L8KA 5HG7A 4DBNA 2GNIA 5HIBA 3PA5A 3CPCA 4DGGA 5EHLA 5EQYA 3R00A 2IZSA 3TTIA 4U9AA 5EYKA 4AACA 3EQRA 3FMKA 4HGTA 4NTTA 4XH6A 3GUBA 3BE2A 3OP5A 2IO6A 2O8YA 2CNVA 5HGIA 4ITJA 4EYMA 4HW7A 5J9YA 2Z7SA 1OBGA 2DWBA 2ZB0A 4L67A 5AA9A 3E8DA 4ZMFA 5KX8A 3MY5A 4UWCA 3QZHA 1M2PA 5FBNC 1OIYA 5CT0A 3NUNA 1BUHA 4EZ7A 2HY0A 3TUCA 3BGQA 5CXZA 2E9VA 2BDJA 2YJRA 3F5PA 3FMHA 5DPVA 3F5XA 4ERKA 4U40A 3EFKA 1BI7A 4O6LA 3TEIA 3LXNA 4NCTA 4RVMA 3L1SA 4FK6A 5IA5A 3AD6A 3DBEA 5E8UA 5EFQA 2A2AA 3HMPA 4PDSA 2IW8A 3LOKA 3KXHA 2XIZA 5G1XA 2ONLC 3BHYA 4B99A 2WOTA 4CV9A 2GDOA 4H1MA 4CYIA 2WEVA 3SRVA 3CLYA 4L46A 3S3IA 4F7JA 3F2RA 3OWJA 3A62A 4BCPA 4EQCA 1UA2A 2BR1A 2YCFA 3F7ZA 2AC3A 3F3UA 3R71A 5A4LA 3E93A 2JDTA 3GC8A 4L9IA 4QQCA 4O0TA 2IVUA 2WNTA 4LRKA 4QYEA 4D1SA 2XRUA 1OKZA 5GHVA 2XK9A 3A7IA 3R9NA 4O0WA 4G34A 1UWJA 4PDOA 3HV7A 2E9OA 3OWLA 5KBQA 3PWDA 3R8ZA 2X1NA 2ETKA 3QL8A 4KIKB 3ZXZA 4EK3A 1GZKA 3BU6A 5LMKA 3WF5A 3LFNA 4CEGA 5CVHA 3KF7A 4NEUA 4J52A 3N9XA 4JOAA 4PP9A 5F20A 4B7TA 4Z16A 4ZZNA 2WEIA 3QBNA 5K4IA 4Y85A 4FIFA 3QTWA 2YCRA 1ZOEA 5JFWA 5GZ9A 2Z8CA 3OT3A 5IU2A 4JAJA 5AV4A 3AG9A 5DNRA 3BV3A 1WBWA 3K3IA 3Q4CA 4F6UA 2EB3A 2Q0BA 4E4MA 2ITNA 3MFRA 4ITHA 1G8SA 3FLZA 4FKLA 3RPVA 2R3QA 4BZOA 4IDTA 1CKPA 3W10A 4LL0A 5CZIA 1H07A 4AT5A 3FQEA 2PZRA 2ZJWA 3LXKA 2GQSA 4QMUA 3DB8A 4RFYA 4RJ6A 4FSQA 4IC8A 3P1AA 4HGSA 5DIAA 4DT8A 5CAPA 2X8IA 3VNTA 2BPMA 5EYCA 4E73A 4GCJA 4BGQA 3E64A 5AV2A 4DEAA 4MWIA 5CI7A 2PUUA 3QCXA 3TG1A 4U81A 5C26A 4JG7A 4BY9E 2PHKA 1OL7A 4TWNA 5KHXA 4RLKA 1SNUA 4PX6A 3RGFA 3CEKA 3KF4A 4RA5A 5FEQA 1Q4LA 2GHGA 3FLNC 1F5QA 5F95A 3W16A 1VZOA 5IEVA 3EQFA 3H0YA 1Q8TA 4X21A 3P08A 3HRCA 5EYMA 4OLIA 2WTCA 2Q0NA 2J0IA 4ZZMA 1XBAA 5FDPA 2WMAA 5HLWA 2XCHA 3VS4A 3LMHA 4M0YA 3UVPA 4NH1A 2HW6A 2OF2A 4EHGA 3KCFA 3NIEA 3GOPA 5DEYA 2ERZE 4NWMA 4RQVA 1M2RA 4F63A 4OTQA 1W83A 5CEOA 4QO9A 4DG0E 3CIKA 2P4IA 4XV2A 5I9VA 3R0TA 1F0QA 5CWZA 4GK2A 4CMOA 4AG8A 5I9UA 1KE7A 2I0HA 3UIXA 1XQZA 4JX3A 4W4VA 4MEDA 4IVBA 2GNHA 3O0GA 2XCKA 4K77A 2ZV2A 1R78A 4U5JA 3SHEA 2GS2A 5HBJA 1QPJA 1YQJA 3OG7A 3DBCA 4FKSA 2UUEA 3R1NA 4R6VA 3GOKA 3LJ0A 3LCKA 4O7RA 3QAME 4G9CA 3PVUA 5DT4A 3VBVA 3IK3A 4USEA 3DPKA 2XB7A 4DTKA 1J7LA 4RWJA 3EWHA 4EHVA 5HD4A 4F7LA 4BCHA 2B0QA 3JVSA 2JBPA 2YM4A 3PVGA 3LKMA 3ET7A 3QLGA 4ZP5A 5EHYA 4K9YA 4RIXA 2BIKB 2XYUA 4AZTA 4C61A 5AP1A 1YXSA 4UZDA 3WYXA 5GZAA 4YP8A 2FGIA 4CZTA 3QGYA 1IA9A 3TZMA 3OS3A 5EYDA 1E1XA 4QNAA 4UXLA 3UODA 3TKIA 4U3ZA 3KXGA 1I09A 2C5VA 2UW6A 4JIAA 2ZDUA 2OU7A 3W2RA 2JDVA 3ORTA 4ASZA 5CAVA 5HIDA 1PXMA 3N4VA 4DFXE 1BL7A 2XK8A 3VS5A 2F9GA 4A9UA 5AX9A 4WBBB 3SAYA 2X9EA 2WTKB 3FMLA 3I79A 4FOBA 4IE9A 3DAEA 4RRVA 3VAPA 3WF8A 2W5AA 2C47A 5KKRC 5J1VA 3L8VA 5IPJA 5E1SA 3B2TA 2C5XA 3MB6A 3DS6A 5L6OA 2F49A 3QX4A 3A7JA 3WF7A 3KREA 3NWWA 4Y73A 4Y72A 2QO7A 5CSVA 1BKXA 3E63A 2J5EA 4IADA 4JDIA 4ZTQA 4CG8A 3A2CA 5CF6A 5BMMA 5IH6A 1QPCA 4ZTNA 3VUIA 4MXYA 2GMXA 4C7TA 3H0ZA 4DGMA 5A4EA 3F5GA 3FSFA 4TNBA 3LZBA 5DOSA 1OKWA 5BVWA 3QXPA 2BZKB 3W1FA 4EHEA 2W7XA 4GRBA 4OUCA 4QP7A 4UEUA 3ZU7A 2NRYA 2FH9A 4NTSA 4BTJA 3IW6A 2VTRA 3KGAA 3FLSA 4GH2A 2VAGA 4F6WA 5C27A 4O91A 5E8SA 4JQEA 3G6HA 3CXWA 3CKWA 5H2UA 4MQ1A 2I40A 4DFBA 1JSVA 4W4YA 4JQ7A 5LARA 4F6SA 4BTKA 3OD6X 5AR5A 2IZUA 3VW8A 1ZZ2A 1H08A 2C5YA 4R5YA 1YXXA 4Y8DA 4YHTA 5E8XA 3G51A 4J8MA 3NUXA 4BICA 2GFCA 3PJ8A 4NZWB 3TACA 4ACDA 4IAIA 4P2KA 4QMTA 2ITPA 3HL7A 3NLBA 3PG1A 3WZDA 3ZLWA 1LEZA 5C1QB 3ZSGA 4CQEA 2CSNA 4FSZA 4BF2A 4IH8A 4MKCA 3TNQB 4R8QA 3KRXA 3H3CA 2BHEA 5AWMA 3R7IA 5IQGA 2UW4A 5AMNA 2PK9A 4HCTA 4DYMA 1JLUE 3P5KA 3VUHA 1H00A 2JKMA 3IW4A 4FL3A 5I5ZA 3MVJA 4BHZA 1OITA 4F9BA 4J7BA 1QCFA 3REPA 4I5PA 4ZS4A 4I93A 5K5NA 2PE1A 4BIDA 4XCUA 2R3LA 2WMUA 2EUFB 3QQHA 3WZJA 4MNEA 5AR3A 4BZNA 5BVDA 4M7IA 4D0WA 2WHBA 3HP5A 1YHVA 3BHVA 5FM2A 4AXAA 2JFMA 3COKA 4O0SA 4AN9A 2YM5A 3C13A 3NNXA 1KV2A 2XNMA 1YRPA 5HCYA 4CQGA 5DBXA 2VRXA 2QKRA 3C4ZA 4FV7A 1PXNA 4RIWB 5ANIA 3VN9A 2BIYA 2PVYA 2X0GA 3LFBA 3AGMA 5AX3A 4AE9A 4ARKA 5A4TA 2UZUE 4BCKA 3OCSA 4F65A 4TWPA 4C58A 4IM0A 3G0EA 4I92A 1WBVA 4KUJA 3LAUA 1YXVA 3R2YA 3QTXA 4I6BA 4QMSA 1DAWA 3UYTA 3ANQA 2F7EE 3ZUVA 3D14A 3NW7A 5M4CA 5AAGA 4L3JA 4WUAA 2GNGA 3MY1A 4O7VA 3R2BA 2UZBA 2B9JA 3PIZA 3KC3A 5E8VA 5CU2A 4XOYA 5IMEA 5D41A 1S9IA 5FXSA 4AOIA 3BIZA 2XK4A 1S9JA 2YITA 2WU7A 3A4OX 4KS7A 2QG7A 4TW9A 3W2SA 1OPLA 3OF0A 2OJGA 5KMIA 2XH5A 3C1XA 3O8TA 2C0TA 5IQHA 2G9XA 3C9WA 3EQDA 2CLXA 3VS7A 1MRYA 2VWVA 2VTIA 3RI1A 4FV9A 3TT0A 3DCVA 3IGOA 4CSVA 2PZIA 4EOSA 5EI2A 2JLDA 4QYFA 3KVWA 1A48A 4XS2A 3L9MA 5M55A 3AT2A 2J4ZA 2R3KA 3KRRA 5ETCA 2LAVA 2F2CB 4G31A 3W2QA 1M14A 3RCJA 3SKCA 5A9UA 2P3GX 1TQPA 2Y7JA 5GJFA 4FT9A 5LWNA 4FZ7A 5DR9A 4KABA 2PYWA 1XBBA 2OG8A 4QYHA 3FC2A 4X2JA 4IC7A 3QFVA 1OL2A 4LRJA 3ZEWA 4P7EA 3IQ7A 3TNWA 3V5WA 4EH3A 4D9TA 2WB8A 3HLLA 4RWLA 4CFWA 2XBJA 4IZ5A 1ZOHA 3VW6A 2WD1A 1I44A 5KE0A 2OJFE 3P4KA 3BGZA 3PXFA 5EW9A 1PHKA 3AMBA 5L8LA 4Y83A 4MXOA 3VO3A 3PJ1A 5TR6A 5BUJA 2EU9A 4BBMA 5E90A 4MYGA 3PYYA 1SZMA 2WOUA 3CD3A 4FIHA 3G9LX 1RJBA 4XG2A 4LV8A 3RM7A 3EYGA 3LFSA 2VU3A 4AGWA 4J97A 2ZVAA 4AN3A 2XP2A 4CRLA 5HTIA 3BU3A 3SA0A 3R7VA 4F9YA 5AUWA 5KZ0A 3KK9A 3RK7A 3BGPA 2PVFA 2XK6A 2E2BA 2C69A 3OOMA 1SVEA 2QOHA 2PMNX 3VBWA 1ATPE 3DA6A 5DWRA 5EM6A 3UGCA 4H36A 3Q6UA 2YEXA 3EB0A 4WHZA 1JPAA 1E1VA 4RMZA 5EM5A 1REJA 1Z57A 2GHMA 4EC8A 2JKOA 1ZMWA 3NDMA 1UNHA 3A8XA 3H10A 2W1EA 4O0YA 3MB7A 3FMDA 2NP8A 2IVVA 3ZBXA 3UIBA 4CV8A 4QQ5A 1JKKA 5CX9A 3TM0A 3BYUA 3QTRA 4HVGA 5IA0A 1PW2A 2J0LA 1H28A 3GCPA 4BI2A 4FG8A 4QYGA 4U7ZA 4YTIA 4AA4A 2HOGA 1NXKA 4MVFA 1CSNA 5KO1A 5LMBA 3V8WA 1KUTA 4IDVA 4CRSA 1SVHA 4TN6A 4ZTHA 5KMJA 3ZEPA 2C5OA 3OEFX 2X7OA 3AD4A 3DKCA 4NW6A 3R8MA 4IVAA 4MXXA 3OROA 4LOPA 5IA3A 5JT2A 3OUKA 3A61A 1GIHA 1NVSA 2Z7RA 2X81A 3MPMA 3BLHA 4WD5A 3VJNA 4ALVA 3BYSA 3ITZA 4F64A 3BU5A 3QQKA 3TWJA 2BDWA 3MPAA 5H3QA 1YDTE 5CF4A 4CNHA 3ZO2A 4G16A 4ERWA 3KQ7A 2OH4A 2BILB 3QC4A 4DG3E 4OTDA 3PA4A 3KRLA 3QYZA 3W55A 4F1TA 3VC4A 4BTMA 4FV1A 1GZ8A 3BHUA 3MYGA 4MBJA 1MQ4A 2X8EA 5HX8A 4YBKA 2FYSA 4Q5HA 3CJGA 4HYUA 5I0BA 2X9FA 4EK5A 4FV2A 3V8SA 3F2NA 5CQWA 4GSBA 3L9PA 5FG8A 3IKAA 3PPKA 4C2VA 2PE0A 4GUEA 1L8TA 4X3FB 4EJNA 1CMKE 5HU3A 2DUVA 2HWOA 3HECA 2WFYA 4XBUA 1UVRA 3CS9A 1JBPE 4G6NA 4RJ4A 3VF9A 3ZC5A 4C8BA 4F9WA 3TDVA 4G6LA 2PVRA 4F09A 5C4KA 2C3LA 2JC6A 4I4FA 4M97A 3DNDA 5EG3A 5KMKA 5CYIA 5HVJA 5HEZA 5FTQA 4HVIA 2BKKA 4D4YA 5HIEA 1FVTA 5AP3A 4XBRA 3DT1A 2YDJA 5E8ZA 3Q9WA 4DBXA 1EH4A 5E9EA 1Y6AA 5C9CA 3Q96A 4K0YA 3RKBA 2DQ7X 3EN6A 2JFLA 5AV1A 4AGUA 4RC4A 4FIIA 3VUTA 4EOIA 4ANSA 2R3FA 5DLSA 5EM8A 3M1SA 4ZY4A 1W8CA 4KBAA 4KSQA 5CNNA 3F3TA 2JKKA 4DGOA 5B2LA 3PY3A 3I7CA 4KWPA 2HENA 4CG9A 4WA9A 2PULA 4FTNA 2OJJA 1A9UA 4S32A 3N51A 2VTJA 4L45A 3W8QA 4XJ0A 3NRMA 3OUNB 3PSCA 5D11A 1YWNA 2UZWE 2EWAA 2WO6A 2Z7LA 4IAFA 4FL2A 4DTBA 4EOJA 4ANQA 1FINA 3KMMA 3BBWA 3UOLA 4AGCA 4ZZOA 1P14A 5DI1A 1OPJA 3ALOA 4AE6A 2BTSA 4W9XA 3EQBA 3WZEA 4AFJA 3OMVA 4BCGA 4EH2A 2REIA 4RT7A 5GJGA 2C30A 2H96A 3QCQA 4I0SA 2VWIA 4BWKA 4DITA 5GJDA 3DK3A 1PJKA 3GBZA 4FSMA 4PNKA 3E8CA 4E3CA 4JDHA 4TYJA 4NSTA 5AIKA 2ACXA 2XK3A 3U8WA 3GFEA 4FSWA 4PPCA 1BLXA 1H1WA 2ZMCA 1PYEA 3LHJA 4YC3A 4BRXA 3NVMB 2R5TA 3UNKA 4FK3A 5LQFA 4LFIA 4NL0A 3E3PA 4L3LA 4ZTSA 2WTJA 4Z55A 5M56A 4C35A 3QU0A 4LRMA 3HA6A 4IAKA 3COHA 4OTHA 4RVKA 3T9TA 4D2WA 3MV5A 4ZJVA 4BDHA 1YDSE 1BL6A 3ORMA 1KSWA 1OB3A 5M51A 3M2WA 4V0GB 4JL9A 3FYJX 4UMQA 3ZUTA 2W1GA 3QUDA 3ZRMA 3DFCB 4HJOA 3PWYA 5ANGA 4V01A 3OFMA 2WTDA 4DINA 3NW5A 4PTEA 4NYEA 4FT3A 4QTEA 5HKMA 4DCAA 1APME 4GEOA 5I3RA 5TO8A 4W8EA 3R9OA 4QTAA 3E8EA 4X7QA 4M69A 4NCTC 3FZTA 1JNKA 4R1YA 3MH1A 2QR8A 3VWAA 3C4EA 1DAYA 4LOQA 4NJDA 4FMQA 2P33A 1H27A 3WIGA 1Y8YA 3Q6WA 4EHZA 5F4NA 4ZSAA 3U51A 4D4VA 2YDIA 3HUBA 3QQFA 4XG4A 4EYJA 2CN5A 5ANKA 3OC1A 5ANJA 4IW0A 5ANDA 5AAFA 1ZYJA 4OTWA 3PPJA 5BQ0A 3O7LB 4D2VA 4YBJA 4BCMA 5BMSA 1KE5A 2YZLA 4BVUA 2NPQA 4ANNA 3DBFA 2JIVA 3O50A 4FIJA 3KVXA 1XH9A 2QOOA 1PXIA 2C68A 2YDKA 3A99A 3I5NA 3K5UA 4RBLA 4YPSA 3UG2A 1DI9A 4BGHA 4YUQA 3NGAA 5BX0A 1V0OA 4NKSA 3V51A 5J8IA 2W4KA 3U4UA 2R3HA 3TKHA 3G0FA 4YSMA 3NUAA 1U5RA 2CJMA 4J95A 4USDA 3DFAA 3CTHA 3QD4A 5GNKA 5F9EA 4QT1A 3ZDIA 3VHEA 4FNWA 1XHAA 3EJ1A 1B39A 3QTSA 5D10A 5JEBA 2BRHA 2J90A 2R3RA 5EM7A 3PSDA 4ZS0A 3RZBA 4A4LA 3OOGA 1A06A 4BDFA 1ZY5A 2R2PA 2XA4A 4UXQA 4IHPA 5L2WA 2CNQA 2O2UA 2Z60A 2YIQA 3HMMA 4FV6A 3S95A 4XP2A 1MUOA 5EHOA 4FZAB 2O0UA 3FMMA 3TDWA 3LMGA 3MY0A 1YHSA 1PKGA 3ACKA 4FKOA 2H9VA 3GU8A 5CEKA 1PRYA 4ACMA 1JKSA 3HMOA 2XYNA 4TWCA 4BWPA 5M44A 2VX3A 2OLCA 5DG5A 4YJTA 3BPRA 2V55A 1OL5A 4XV9A 5HZNA 1GOLA 4JG6A 4OTIA 1E9HA 3IOKA 3HNGA 3IDCA 3IPHA 4E6CA 4NFNA 3FWQA 3LM0A 1PXPA 4FT7A 5DA3A 4D5KA 2XNGA 3MWUA 4U8ZA 2OZAA 3BYVA 4TYEA 1ZLTA 4FTRA 4XG3A 3S4QA 1TVOA 5ETIA 5EKOA 4W8DA 3SDJA 4AN2A 4EI4A 5AFVA 5CAOA 5BUEA 3F5UA 4CFNA 3HAMA 1Q99A 4KBCA 4FIGA 4R77A 3OTVA 1QPDA 2RF9A 4APCA 2QNJA 5DE2A 4DF3A 5T68A 2R7BA 1WBNA 3L9LA 4PV0A 3HMNA 4IJ9A 4HNFA 3PXYA 4RIYA 4RSSA 3FUPA 5DR2A 3OXIA 4OT5A 3ZO3A 4EOQA 3I7BA 2Y8OA 3I6UA 3SG9A 1OKYA 2JDOA 5F94A 4APPA 4EZ3A 3DK6A 5IZFA 2CKOA 3VBQA 5JK3A 2WQNA 3SXRA 3TJCA 4G5PA 4ZSGA 4LM5A 4FEUA 3SXFA 3V5JA 1ZYLA 3ERKA 3H4JA 2QONA 2V7AA 5H8BA 4A9SA 3HX4A 4GKIA 3LFEA 1ZARA 3R7OA 2YA9A 3D83A 3GENA 4R5SA 2C6LA 3DQXA 4BGGA 5ICPA 4XOZA 3WZUA 1PXOA 4TKSA 4EONA 2RG5A 2W5BA 4KB8A 2XKFA 3IECA 5DGZA 3RTPA 3QXOA 5I9ZA 2XF0A 3VQHA 5JKGA 4G2FA 2WMBA 3ENMA 2BALA 4K2RA 2E9PA 4B0GA 4DEIA 5BPYA 2RFNA 5FEDA 1X8BA 4O0UA 4R3CA 5HOAA 4O7LA 3HRBA 2B4SB 2G1TA 2UW3A 3Q9XA 3ELJA 3T3UA 3DJ5A 5CU6A 4XP3A 2EXMA 3LPBA 3H9RA 1V1KA 4AZSA 4FGBA 3DAKA 3TNPC 3HRFA 4LGHA 4D1ZA 1Q8UA 4YLKA 5A14A 4F7SA 4R1VA 1WVYA 5AP6A 1OIUA 3UZTA 3V04A 4KINA 4J98A 4KBKA 2YHVA 4RA4A 4XRJA 5KNJA 2PUNA 3UVRA 3I0OA 4LOOA 5KMOA 2H6DA 3BELA 3KXXA 3CC6A 3MBLA 5D1JA 4IEBA 2IZTA 3ROCA 5KKRB 2ZDTA 3D7ZA 3EYHA 4MBLA 3ZRLA 2PSQA 4CGAA 2WZJA 3KXZA 4L7SA 2PVNA 4QRCA 2WQMA 3RAIA 2Y4IC 2X4ZA 3R6XA 5AUVA 1KV1A 3S1HA 1FBNA 3N4UA 1BMKA 3R8UA 1KE9A 2JDRA 4EBVA 1AD5A 4D55A 1UV5A 3LCOA 3BZ3A 3QALE 1RDQE 1ZMVA 5CTPA 4EOKA 1XH7A 1ZYSA 2HZ4A 2OF4A 1FOTA 1NVRA 4G3FA 2X39A 4N0SA 3U87A 5AADA 2O3PA 2VNYA 1GZOA 3BEAA 3L8XA 2XEZA 4K8AA 2WMXA 3R73A 3HP2A 1ZRZA 4FG9A 4PPAA 4X2FA 4BDGA 4BCIA 1OVEA 4L8MA 2UZNA 3ALNA 1LUFA 1GIJA 2HXQA 2O65A 3AMAA 3LQ8A 4QMOA 3WZKA 1XR1A 4ANBA 4BYIA 2GTMA 3MSSA 4IQ6A 3MGYA 3CR0A 2CKEA 3MVLA 2BAKA 1UU3A 2IVSA 2QHNA 2UVXA 3QYWA 3D9VA 1YDRE 3O7LD 4MXCA 4BN1A 4RX9A 3EN5A 3I5ZA 3ZZWA 4UX9A 3ETAA 2QOLA 4FC0A 4O96A 3V8TA 3R1QA 5EQEA 3BYOA 3OZ6A 5AUYA 4A9YA 2W17A 4BCQA 3F69A 5AP2A 3HV5A 1PF8A 4BCNA 4E5BA 1OIQA 4KSPA 4JT3A 4D58A 5IEYA 4U6RA 5CZHA 3CGFA 5H8EA 2ETMA 4RWIA 5HG8A 3UP2A 2R0IA 5K9IA 2OXDA 3VULA 3CCNA 3A4PA 5AJQA 1K2PA 3BEGA 4GJ3A 4QMPA 3BWJA 4DH7A 2PVKA 2OFUA 3JPVA 4FSYA 4FYOA 4EH6A 2FSOX 4YJOA 3KMUA 4YC8A 4BYJA 3ZHPC 4QYYA 5CU3A 4YLLA 5T6KA 3MH3A 4PMSA 3BBTB 4WKQA 2W99B 3L8PA 5HBEA 5CU4A 3L8SA 1JQHA 5DN3A 5ETAA 1M7QA 1Q62A 2OJ9A 4IWDA 4O2ZA 2ZM4A 2UW0A 3NUSA 5CAUA 4FE2A 3ORZA 4CFVA 3ZOSA 3GC7A 3U4WA 1PXJA 3PIYA 2HZ0A 2NRUA 2QOKA 2YM8A 3O51A 3RINA 3QCSA 4BKJA 4I21A 5G6VA 4EORA 4MAOA 4G3GA 5DEWA 4IIRA 2VO0A 3GXLA 2CMWA 3QD2B 4YLJA 5CT7A 3RAHA 3ODYX 1DI8A 2OICA 4DEGA 4DGNA 1XJDA 4FV0A 5M53A 2G2FA 3D5XA 2BZJA 3SW4A 3FE3A 2W0JA 3T8OA 3LQ3A 3QZGA 3GU6A 4GT4A 4XX9A 5HESA 4QMQA 4GV1A 3HMIA 5CEPA 1U5QA 4G5JA 4HOKA 2GQGA 5IA1A 2PWLA 3EN4A 4FEWA 2BZHB 3WYYA 3U9NA 5D9HA 3GEQA 4YJPA 2O64A 5JZNA 2VUWA 3IGGA 2XKDA 3R04A 4A9TA 2R4BA 3CD8A 5CSWA 3FI3A 4HCVA 2ITQA 2YLEA 1PMUA 4PL5A 3ZFXA 1CKIA 2ITOA 5EI6A 1VYZA 2HWPA 3B8RA 1YI4A 5CI6A 4B8MA 1Q5KA 2BZIB 2EXCX 5HORA 4C4FA 1QL6A 5C03A 3NEWA 4FKUA 2H8HA 3ZO4A 3DV3A 4JRNA 4XG9A 4QMYA 3GC9A 5AR4A 4FKIA 4IACA 4QP1A 3U6IA 3AGLA 3F7WA 3EFWA 3OXZA 4NFMA 4TYHB 2EXEA 4MBIA 3IW7A 3KY2A 3ZO1A 1Q24A 3UQFA 2VTOA 4YNOA 3FKOA 1BI8A 4WNKA 2PU8A 3LXLA 5M57A 2CKQA 3QQUA 4K18A 2PPQA 5JGAA 4G3CA 2PE2A 4M15A 2VGPA 3D94A 3WE4A 4CVAA 4C4IA 5EDQA 3S0OA 2YISA 1NVQA 3CY3A 4MHAA 4WG3A 3QHRA 4CKRA 4DH5A 4N57A 3QZIA 4FV8A 2QOCA 4C3RA 4R7IA 2BRNA 4F70A 3RPOA 1UU8A 4GT3A 4YJVA 4JAIA 1NA7A 2YZAA 5FP6A 4BCOA 4S2ZA 4QMVA 5AV0A 3HVCA 1IRKA 4GK3A 1M17A 4QQJA 1U46A 2YIYA 4GT5A 3FYKX 5IQDA 4QQTA 3NVKI 5EI8A 2V62A 4C4GA 5L4QA 1B38A 2HYYA 5IH4A 4YHJA 4EQUA 2YAAA 2V7OA 3E5AA 3NW6A 3R7YA 2A1AB 3FDNA 2YCQA 4G6OA 4EH4A 1WVXA 3Q3BA 1TQIA 1W0XC 1UKIA 4EC9A 5E91A 3LCSA 5EK7A 3GB2A 2GSFA 5K5XA 2QURA 4IZAA 3FSKA 4WSYA 4IB3A 4AT3A 4AQCA 2YERA 3PVWA 3ZMMA 3K2LA 3D0EA 4RJ5A 5HG9A 2BMCA 3C4FA 3MTLA 4RFZA 1OZ1A 3F88A 4LV5A 4C2WA 4MD8E 3QUEA 3DB6A 1O6KA 4YR8A 2ITUA 4FT0A 3SQQA 4CXAA 5DYJA 1P4FA 3E92A 4G1WA 2KULA 2J50A 3QD3A 4O86A 4PMMA 1XH6A 4QPMA 3NUUA 1UWHA 2IJMA 2V0DA 1J1BA 2J7TA 2WMSA 3QKMA 1OM1A 4BDKA 3FPMA 5LXMA 3F2AA 4RQKA 4YZ9A 4ENYA 3O8UA 3JXWA 2JD5A 4FX3A 4TZRA 5EH0A 4UWBA 4EH8A 3D2KA 2WMRA 1ZOGA 3O8PA 4UMUA 5LMAA 1IEPA 4AFEA 4AT4A 5J9LA 4WOVA 5DH3A 5DT0A 4L44A 5TOZA 4FR4A 5K0KA 4GW8A 4D5HA 5AAEA 1XH5A 2DYLA 3KN5A 4U3YA 4LUDA 3VBXA 4KIKA 1IG1A 4W9WA 4B4LA 4D2TA 4DH3A 4ZJJA 4KNBA 3QLFA 4FNXA 3MESA 3P78A 2G01A 4PDYA 3OTUA 3R28A 4ZTRA 3GQIA 2PVJA 5TE0A 3AT4A 3ZYAA 3FXZA 4EK8A 4TTHB 3DJ6A 4TWOA 4G9RA 5CQUA 3QTIA 5L2SA 4MD7E 3NNUA 2GS6A 2YABA 3ORKA 4NUSA 3SXSA 4HVSA 4F1MA 1H1SA 4JDJA 4YGAA 2X2MA 3AOXA 3T3VA 4Y95A 3EFLA 4M3QA 2LGCA 4TXCA 1H26A 4YTHA 4E8AA 3QQJA 4OTPA 4P5QA 4K11A 4F99A 4CCBA 4XNEA 1WZYA 4ASXA 4IX5A 1H0WA 2RGPA 4UALA 5HQ0A 4S34A 3MDYA 3UIUA 1WBSA 3C5IA 4A06A 2UZTA 3TUDA 1FQ1B 2F7XE 1OUKA 4IB5A 4JS8A 4Y5QA 3U54A 3BQCA 1M7NA 4BCJA 2C6DA 3P7CA 4BCFA 3CE3A 2IN6A 4Y5HA 3RAWA 3ZFYA 1RW8A 5JGBA 1YI6A 2R3MA 1H1QA 4UMRA 4UMPA 1ERKA 1YKRA 4XLVA 4YTCA 3G6GA 5CSPA 3W2CA 1VYWA 3KCKA 1UNLA 3NAYA 1ND4A 1R39A 2I6LA 4IVDA 5BVOA 3MH2A 4L43A 3KXMA 2XK7A 4GU9A 3A8WA 4QPAA 5JH6A 3H30A 3EHAA 2A0CX 4PF4A 3D7TB 4GFMA 3OBGA 1M2QA 5JRSA 4NKAA 3RVGA 3C4CA 3MFSA 3K3JA 2VWZA 4X0MA 2IVTA 3PJ2A 5L2IA 3DZQA 1O9UA 2QO2A 4O83A 2VX0A 2B55A 2C3KA 1U59A 4MWHA 4RZWA 4JQ8A 2JAMA 4M13A 5FRIA 3GU4A 4Q9SA 1H24A 4GU6A 2AC5A 3TV4A 4OT6A 4DEDA 3PRIA 3NX8A 4TYIA 2WELA 4BDDA 4BR3A 2I0EA 4MD9E 3B8QA 5FDXA 3ZDUA 2XNNA 4DAWA 4JR3A 4E1ZA 5IUHA 5LVNA 1CTPE 1JVPP 4IB1A 3RPYA 3UPXA 3UO6A 4C3PA 4DFYA 5FWKK 2HELA 5CASA 4O7YA 3FZRA 1YW2A 4AS0A 5CF5A 3R9RA 4DFUA 4JXFA 3PXRA 3NSZA 3CPBA 2OO8X 4FEVA 1T46A 3ZS5A 5ACBC 4M12A 2UZLA 2X7GA 3WILA 1STCE 3CSVA 2CCIA 3FMJA 2XNOA 3PXZA 2RFEA 3E8NA 3MJ1A 1UU9A 4YJRA 3VS3A 1W98A 3FY0A 5KMLA 1K3AA 1MRVA 4D2RA 2XIYA 3OT8A 1OBDA 1ZY4A 3FLYA 4BWXA 4L01A 5IISA 1W7HA 3G33A 3ZLSA 4O1PA 4PL4A 3EZVA 3OEZA 5TT7A 4ZLZA 4TNDA 3S00A 4AZFA 5EDRA 2VD5A 4U43A 2HK5A 2W5HA 2QODA 2JITA 3FZPA 4KAOA 5M4FA 3NCZA 3D5UA 4NK9A 4AGDA 3G15A 5HO7A 4FA2A 5EQPA 1WBPA 3SD0A 4FTAA 5CEMA 3RHXA 4H1JA 4YO6A 5HICA 3LFCA 2GU8A 4CTBA 3CY2A 3V5QA 4EBWA 2IG7A 3QX2A 1GY3A 4L42A 1RE8A 3LCDA 4WG5A 2BRGA 4DLIA 1OMWA 4UMTA 3LE6A 5LVMA 1YHWA 1KE6A 4EQMA 1J3HA 2WMWA 2XNPA 2BROA 1Q3WA 2QOBA 3FL4A 3LXPA 4IM3A 4YC6A 3UTOA 4N6ZA 4ZAUA 1VR2A 2BRBA 3I81A 4I6HA 4GYIA 2VTQA 2Z7QA 5AEPA 3F61A 4ASDA 5HTCA 4FVQA 4QP3A 2GHLA 5LVLA 1H25A 3IO7A 3QRJA 2YCSA 3QRIA 4RX7A 5L3AA 5JRQA 5FTGA 2W05A 4I5CA 5CY3A 4HNIA 4TYHA 5HLPA 3SGCA 2J6MA 4GJ2A 3VF8A 1AGWA 4ONAA 2RL5A 2O5KA 2XS0A 2B53A 3Q9YA 4L53A 4NIFB 4XG7A 3WE8A 2C6MA 4EH7A 4FVPA 4D4SA 2R3OA 3PP0A 2XUUA 3IDPA 5FGKA 5HO6A 5DR6A 4YURA 1P5EA 1CDKA 3W18A 2R3GA 4MX9A 2WQBA 1XBCA 5IMXA 1NW1A 1MRUA 4JRVA 4HZRA 4X3JA 3VS2A 4I22A 4YO4A 1JSUA 1UU7A 5J1WA 4K33A 4OW8A 2A19B 2GS7A 3VS6A 5C8NA 4A07A 2B9IA 3POOA 4QMLA 3ORXA 1HCLA 1Q61A 5FD2A 2BAJA 4CFUA 4D1XA 4EJ7A 3FLQA 2OWBA 3F9NA 4ANMA 1UNGA 3F66A 3W2OA 5B2MA 3O96A 4F9AA 3Q2JA 4DFZE 3FI8A 4DT9A 4F08A 3R1YA 3NYNA 4S33A 4O81A 4AZEA 3G9NA 3OWKA 5DFPA 5HE0A 2YIRA 3VQUA 4CZUA 4JBQA 3P7AA 4MCVA 2ESMA 4FF8A 2QCSA 2YLFA 4C4HA 2BFXA 3P79A 2YIXA 1JAMA 1TQMA 2C0OA 2OIBA 5D12A 2VWUA 3SW7A 4UYAA 3P7BA 4B9DA 2YIWA 2J0MB 4JDKA 4I0TA 3FAAA 3EFJA 2UW5A 3EQGA 5L6PA 1REKA 2ITTA 1YVJA 3RNYA 3CQWA 3G2FA 4IM2A 4PPBA 4PQNA 3DOGA 5C01A 4OBPA 3WIKA 4NM3A 4FTTA 2XM9A 1V0PA 1YXTA 5AM6A 3Q53A 3ORPA 3AD5A 4ENXA 4BL1A 5AA8A 1Z9XA 3O23A 4LUEA 4YZNA 3Q52A 2RKUA 4RIWA 5BVEA 5IUGA 2ITYA 2QG5A 2Y0AA 4FNZA 4XG6A 2CGXA 2B54A 4AWIA 5DRBA 2J9MA 4ZSLA 5CVGA 3RWPA 4RIOA 3LLTA 1URWA 1Q8ZA 2VO6A 4Z9LA 5AUTA 5LVOA 1YWVA 3HZTA 1KOBA 5HE1A 4ZLYA 5JGDA 4HVDA 5FP5A 3DU8A 3FZ1A 3ZFMA 1J1CA 4BKZA 4RJ7A 3V3VA 4C34A 5M07A 4FKPA 4YHFA 3UNZA 4U42A 2P0CA 3QZFA 2OXYA 2PVHA 3FJQE 3VIDA 5A4QA 2WTWA 2VN9A 3ATTA 5IUIA 2G15A 3DLSA 3MJ2A 4TRLA 4EOLA 3NPCA 3PJCA 5LVPA 3RM6A 2NO3A 3OWPA 3DBQA 4RVLA 3M11A 2W1DA 2OXXA 3EL8A 4XG8A 4ACGA 2OGVA 4RIXB 3H9OA 4FSTA 4EZ5A 2VWBA 1OPKA 1CM8A 3A7HA 3O71A 4JX7A 2C6EA 3DKGA 4JBPA 4MF0A 4R3RA 5IA4A 3QGWA 3N4TA 4TY1A 5KHWA 3UC4A 1SMHA 2OH0E 3UQCA 5GINE 4ZTLA 2W96B 2FA2A 5B0XA 3K5VA 3NNWA 5D7AA 2Y9QA 4I41A 3BI6A 4NW5A 5H8GA 2BVAA 2JAVA 2Y4IB 2IZRA 3PSBA 3TCPA 4PMPA 3ORIA 5CNOA 4DEBA 4EL9A 4F0FA 3S2PA 4YZBA 5KMMA 3UE4A 3DXPA 3F3WA 4AZVA 2VV9A 1GZNA 1R0PA 3TXOA 2GTNA 3D5WA 4C3FA 4IAYA 2XBAA 4Y46A 1NT2A 3POZA 4CMUA 4ZLOA 2C1AA 5J7HA 2SRCA 2W4JA 3M42A 2O63A 5HHWA 4JVGA 2QO9A 3QRUA 3R22A 4NM5A 4FKVA 3MIYA 4FEXA 4TT7A 2VWWA 3PG3A 3FI4A 2VX1A 3TV6A 3CJFA 1U54B 3VUDA 1L3RE 5JFSA 4KKEA 4OAVB 2WIHA 3D7TA 3FY2A 3R8LA 2YJSA 5J87A 1MQBA 2FUMA 4ZOGA 3LM5A 3LJ1A 4I94A 4ANOA 3LMIA 2UW9A 4Z3VA 2PMIA 3FQHA 4N6YA 2NNWB 3HAVA 4J96A 4PY1A 4UZHA 3HDMA 5BUIA 2HIWA 2GPHA 5ANEA 3UIMA 4E26A 3BKBA 4RX5A 4YU2A 4TPTA 1J91A 3PE2A 4KKHA 3W33A 2ZAZA 3CGOA 2ZYBA 2XIKA 2F4JA 4KD1A 5E1EA 2C6TA 4GMYA 4D2PA 2ZV8A 3NYXA 3VUKA 4PNIA 1YOJA 3PDTA 3QWJA 4KRDA 5BVKA 4BIEA 3V01A 2CPKE 3ULIA 2HZIA 4AA0A 4BKYA 4CFFA 4FTKA 4E7WA 3H9FA 4LI5A 2XM8A 3FZOA 3MIAA 3UO4A 1FGKA 4CZYB 5E8YA 4E4NA 4E4XA 1JKLA 4R7BA 3THBA 3KB7A 2QU5A 5HG5A 4KRCA 4CFXA 1OL6A 3I4BA 4MK0A 5A6OA 2I7QA 2Z02A 3FV8A 4FSNA 4IZYA 3NIZA 5ITAA 2OK1A 4XLIA 4YJNA 5CS6A 3SVVA 2CGUA 1H0VA 2WU6A 2ZM1A 3LIJA 2Z2WA 3W32A 3HV4A 4ITIA 4MNFA 2QVSE 4H39A 2DS1A 3NAXA 4QP6A 3NUPA 3HKOA 4I20A 4X6RA 3CTJA 3O2MA 3IDBA 4LMUA 3GI3A 4MNEB 5CENA 4DG2E 4YNEA 3C50A 3EMGA 1WBTA 3PIXA 4F1OA 2PZPA 1FPUA 5A6NA 3QTQA 5HBHA 3PZEA 4LG4A 3MN3A 4B8LA 4FSUA 4XUFA 2BTRA 5F1ZA 4IWOA 5AIRA 2BFYA 3EQCA 4X2GA 3C0GA 4FKRA 5I9WA 4AX8A 1P4OA 3HA8A 2CCHA 1H8FA 2ITVA 3L9NA 5HVYA 2VO7A 4X3FA 4O7ZA 4FYNA 2CLQA 3UJGA 5CLPA 4O0VA 5A46A 2CGVA 5FLFA 5K3YA 5KMNA 4FTIA 3UP7A 2H34A 3FPQA 5DT3A 3VJOA 2XNEA 1OGUA 2JKQA 2UW7A 4KS8A 4DFLA 1ZZLA 3C5UA 4KA3A 4L68A 3ZLYA 2JBOA 1FMOE 1G5SA 4S30A 4J71A 4BBEA 4O2PA 4GYGA 4U80A 5HI2A 5CEIA 2JDSA 3GFWA 4M66A 1H4LA 4K6ZA 2OKRA 4KKGA 2ZV7A 4WIHA 5ETFA 3QTZA 5L8JA 3SC1A 3F82A 3I60A 2QLUA 4NIFA 3RK9A 4ALUA 3R7UA 4HYIA 3RNIA 4FI1A 3ZH8A 4KIQA 4Q9ZA 4DC2A 3R63A 4O84A 4DH1A 3QD0A 3ENHA 4DHFA 4IX3A 1Q8YA 4PMTA 3ZM9A 3FEGA 2V5QA 3OXTA 5AUXA 4FGRA 3RMFA 3KA0A 4FTLA 2HZNA 4O7SA 3QRKA 4DGLC 2WKMA 2W1FA 4ORKA 4DEHA 4ZSJA 1SM2A 5IF1A 2AYPA 5EW3A 3E7OA 4LMNA 2XMYA 3PLSA 3Q04A 1DM2A 4FV4A 5LCJA 2YWVA 2C6KA 4BB4A 2W1HA 1V0BA 3E62A 2VTSA 2C4GA 4AP7A 1PMNA 3UBDA 3UNJA 4AW1A 2W9ZB 4H3PA 1OKVA 2XEYA 3FBVA 3OHTA 3R01A 2R9SA 4E5AX 3W2PA 5JFXA 5BYYA 3KRWA 4FIEA 3GNIB 5M4IA 4WNMA 1IASA 4GG7A 3F3ZA 5H9BA 2QKWB 3I0QA 5K0XA 3E87A 4C62A 5J9ZA 2ZB1A 3ATSA 4OAUC 1LR4A 3IS5A 2I0VA 3LW0A 4ALWA 3BRBA 2WMQA 5E4HA 2X7FA 1O6YA 3FI2A 3DAJA 4HYSA 5E92A 4F0IA 3A60A 2OIDA 4BI1A 4EWQA 2R3IA 3MVMA 3R8PA 4ZXTA 4I5MA 4V0GA 4GVAA 1GAGA 4I24A 2CDZA 4F9CA 4QTDA 4BBFA 4CTCA 3R9HA 4R3PA 5HU9A 4JBVA 3JY0A 3LQ5A 5AP7A 2XVDA 3R9DA 5J7BA 4YJSA 3RALA 3BWFA 3EKNA 1XWSA 2ONLA 4ACHA 2QQ7A 4I6FA 4USFA 3QQLA 5CU0A 3PY0A 3DLZA 3TZ9A 5IQFA 3G90X 4FV5A 4PP7A 4MQ2A 3EL7A 5I3OA 2CHLA 2UV2A 2YM3A 4KIOA 5J95A 3QWKA 4JR7A 3TL8A 2J0KA 1LEWA 2Q83A 4WT6A 4IX6A 4DTAA 5EW8A 4D9UA 3COIA 2XZSA 5FM3A 3NNVA 1LPUA 3PZHA 3GP0A 4QMXA 4C33A 4FUYA 3BV2A 2PL0A 4HGLA 4YZDA 3UMWA 4IAAA 1WFCA 4BHNA 4YPDA 3UG1A 5A4CA 3ROYA 2FVDA 4RWKA 4E4LA 3DDQA 3CTQA 2BRMA 3IONA 1M52A 4J99A 4QOXA 3AC5A 4M68A 2CNUA 4OBQA 3NUYA 3MA6A 4UY9A 3DBDA 1WCCA 5DRDA 2VO3A 4N70A 3BQRA 4ID7A 5B7VA 4GIIA 4C0TA 5A3XA 4OBOA 2F57A 4QMWA 5AM7A 1PY5A 3U6HA 2QHMA 2JIIA 2VWXA 3HV3A 2P2IA 3NYOA 3D5VA 3AC3A 2V22A 3ZM4A 5CANA 1TKIA 2J2IB 4I23A 3V6RA 5KCVA 3D15A 4G3DA 3NCGA 1OIRA 3PFQA 1SVGA 4P90A 4FOCA 4JNWA 2C6IA 4DH8A 5GIPE 1Z5MA 4BDBA 3C0IA 3LCTA 4M0ZA 3D2IA 2QD9A 2X6EA 4N4SA 2IPXA 4JBOA 4FTCA 4LL5A 3TZ7A 4BZDA 5IH5A 1OI9A 4C02A 2PZ5A 5IQCA 1VJYA 5AR7A 2R7IA 2ZMDA 4OTFA 2GCDA 4WBOA 3JY9A 2XKCA 2IW9A 4QP2A 3PA3A 5IQIA 4EUTA 4R78A 4E6QA 4CMTA 2YAKA 2HAKA 3DXQA 3EN9A 1FVVA 4JIKA 4X6QC 5ANOA 3JYAA 3KULB 5I9YA 2XIRA 3HDNA 4UBAA 3DJ7A 4IB0A 2C5NA 4D2SA 5HLNA 3BLQA 1U54A 1IA8A 1WBOA 2WQEA 4S31A 4XRLA 2Y4PA 3EQIA 3QCYA 4E5WA 4FG7A 3RAKA 4FUXA 3ZONA 3PXQA 3R8VA 4FZFB 4YJQA 2PUIA 3KK8A 4X2KA 5KUPA 2WXVA 4OGRA 1NY3A 4OTGA 4F7NA 4FTJA 3AQVA 5AR8A 2PTKA 4ZJIA 1FVRA 4YMJA 5EDPA 3TIYA 4L00A 1R3CA 4QP8A 1ZMUA 3P23A 4O7NA 3NMUF 3MS9A 2GNLA 2W1CA 3AT3A 3QTUA 4UB7A 3WF9A 4C4EA 2VGOA 3OCGA 4XV3A 2VZ6A 3R1SA 1ZXEA 4H58A 3DDPA 3UOJA 5HE2A 4OTRA 2EVAA 3BLRA 3TIZA 3UZPA 2I1MA 4U41A 5E7RA 3LFFA 3Q4ZA 4Q5EA 3W8LA 3WARA 5HO8A 2BDFA 4ZIMA 4C59A 5J5TA 3ZC6A 3CQUA 3UC3A 5I9XA 3LLAA 4RZVA 3K54A 4EOPA 4IMYA 3OBJA 4EWHA 3AXWA 3Q9ZA 3ZCLA 1RQQA 4O6EA 2PZYA 4P4CA 5CXHA 3WF6A 3MA3A 4CLIA 4BDJA 3F6XA 4QTCA 3P86A 3C4XA 3ZUUA 4E93A 2ITZA 4IFGA 4CT2A 2CKPA 4DA5A 4BI0A 2GQRA 1W82A 3BHTA 5AP4A 4BTFA 5CF8A 3AC8A 3FXWA 2QU6A 1F3MC 2QC6A 1GIIA 2UZOA 5CEQA 4MXAA 4A9RA 3RK5A 2PVMA 1KE8A 5EKNA 4NJ3A 2CN8A 4PTCA 2UW8A 1GJOA 4BDIA 3UOKA 3BYMA 3BX5A 4ZY5A 5CSXA 3WBLA 3GU7A 4XYFA 3GCVA 2Y6OA 3FKLA 3NS9A 2VTNA 4UV0A 4AW2A 2GFSA 3P0MA 4DE4A 3I6WA 1R0EA 4IWPA 3SG8A 3II5A 2FSLX 4NT4A 4XMOA 3ZBFA 3DGKA 4G3EA 4ANLA 3VBTA 3R30A 1ZAOA 2RFDA 4M69B 4W4XA 4O38A 2XKEA 4WO5A 4DEEA 2VTTA 4WNPA 4YJUA 2W9FB 3UYSA 1MP8A 3EZRA 1W84A 4O7WA 2QR7A 1DS5A 3MI9A 2QOFA 3DY7A 3RZFA 1Q8WA 2FB8A 3LFDA 5FXQA 2HCKA 4O1OA 4CCUA 4ZTMA 1GNGA 5JN2A 4MXZA 5A54A 2OSCA 4IANA 4RLLA 1YI3A 2E9NA 1SNXA 2FSTX 2WTKC 3QKKA 3SV0A 3ZSIA 2VWYA 3FMNA 4LYNA 5JFVA 4J53A 4I4EA 5CAQA 3R21A 3ORLA 4P5ZA 4NM0A 4FT5A 4IWQA 4QP4A 3UMXA 3CKXA 3QC9A 2GNFA 4F4PA 5IDPA 4J1RA 5HE3A 4GL9A 5TF9A 4NM7A 3ZRKA 4F0GA 3IG7A 3UOHA 4L7FA 4QMZA 4GUBA 4O82A 3Q4UA 5GZ8A 1YWRA 2WQOA 4IFCA 5HNGA 3WI6A 4BDCA 3PLAE 4AF3A 5LOHA 3JVRA 5JQ8A 5CSHA 3A7GA 2B1PA 5IQAA 3PXKA 2OW3A 3FMEA 4HYHA 2C1BA 4FTQA 4U97A 5FTOA 2GNJA 3TI1A 2X2LA 2YN8A 2FO0A 3MFTA 3Q32A 4CKIA 4EOOA 3NR9A 1FMKA 2ZOQA 3FLWA 5BVFA 1HCKA 4I1ZA 4PUZA 5I4NA 3PUPA 2HW7A 3UO5A 3ID6C 5IQEA 4TL0A 4QTBA 3LJ2A 2R0UA 4RPVA 4FSRA 5FEEA 3E3BX 3C51A 5FQDC 4PRJA 2XNBA 4FODA 1PKDA 1Y57A 4AU8A 5FUTA 4MH7A 2WIPA 4WNOA 4I3ZA 1J7UA 4ZEGA 3RJCA 2UVZA 4JLCA 2UVYA 3GVUA 3PVBA 2WPAA 3PY1A 4EH9A 5DHJA 5LJJA 3F3VA 3MTFA 2G2IA 3KXNA 4CYJA 1Y91A 3AC4A 4H3BA 5LCKA 2X4FA 4Z7HA 4IX4A 1BYGA 1K9AA 3R02A 4H3QA 3G5DA 4IXPA 4M84A 1H1RA 2OZAB 3RBWA 3UVQA 4BDEA 4EKKA 2B52A 3AC2A 1Q3DA 2AUHA 3OY1A 5EOLA 3TZ8A 4I6QA 4CT1A 5JMSA 2PMLX 1KWPA 4GVJA 3IOPA 4JI9A 3RPSA 4O7TA 2IWIA 5KBRA 3AC1A 3EN7A 3KN6A 4WSQA 1H1PA 2R3NA 2B7AA 2IW6A 3GQLA 4CFMA 1HOWA 1XO2B 4RGJA 2QI8A 4RIYB 3V5LA 3VBYA 4EK6A 5HNIX 3DZOA 2WTVA 4FTOA 4PTGA 5M4UA 4D28A 3EKKA 2FSMX 2W06A 5BYLA 1J7IA 3R83A 1WVWA 5JSMA 1XKKA 1PMVA 4AUAA 1U4DA 3B2WA 1YOMA 3DXNA 1OECA 3KEXA 2YACA 4BC6A 2HXLA 2R3PA 2B9HA 1OL1A 3HV6A 4R7HA 4ACCA 2VTAA 3SRVB 2QLQA 3LFAA 4PDPA 5AUUA 3NZ0A 2C3JA 5FBOA 3VUGA 1R1WA 2E9UA 2JGZA 4WUNA 3OVVA 4Z7GA 4YTFA 3COMA 4RG0A 4IVCA 4FNYA 4RC2A 4QPSA 3LFQA 5AP0A 2JEDA 4RFMA 2PMOX 3HEGA 4FV3A 3KL8A 4M8TA 4QP9A 2YM6A 2W1IA 3FQSA 1PMEA 3PJ3A 1VEBA 5DVRA 3GC0A 5J5SA 2F2UA 1XH8A 4FZDB 5IA2A 4ASEA 5M06A 4DFNA 2CGWA 5L2QA 3GGFA 5AUZA 4E6DA 2PY3A 4U45A 3FHIA 3HUCA 4J8NA 1PXLA 3RPRA 4O21A 3FKNA 2WGJA 3ZZEA 4FBXA 3QA0A 4TYGA 3Q5IA 5E8WA 3ZXTA 3TUBA 2YWPA 3ODZX 2G2HA 4U79A 3TN8A 5D7VA 5E8TA 4A7CA 5HX6A 5J79A 4WG4A 3C7QA 5TKDA 3GCUA 4FKJA 3VS0A 5L6WL 4FVRA 3HGKA 3BHHA 3ACJA 3UDBA 1JSTA 5EOBA 2X8DA 3KULA 3OW3A 2BUJA 4BIBA 3MH0A 1PYXA 1SYKA 3VVHA 2ZV9A 3IW8A 2WTIA 2YM7A 3EQHA 4FICA 3KU2A 4RJ8A 3VRYA 4RVTA 2UZDA 3MVHA 2HY81 4ZSEA 5IDNA 4Q2AA 4JG8A 5DMZA 4GK4A 4QMNA 2PVLA 4QNYA 5HD7A 3UZRA 3QF9A 5BYZA 2RSVA 4M67A 2ITWA 4QMMA 3ORNA 5JZJA 3UPZA 3RCDA 4IAZA 3JUHA 2X2KA 5C8MA 3TKUA 4ZY6A 2VTLA 3E7VA 3E88A 4EUUA 4II5A 4MTAA 4O0RA 5IEXA 5K4JA 4O27B 5C4LA 4M14A 4XP0A 3SOCA 2A4LA 3FZSA 4AZWA 3EQPA 3MFUA 1OUYA 1Y6BA 1O6LA 2UZEA 1BX6A 4V04A 1ZYDA 2XJ1A 5HVKA 3GU5A 5L2TA 4RX8A 3LVPA 4H05A 2QOQA 4V05A 3FL5A 4RC3A 3VHKA 4LGDA 3DTCA 1UKHA 2Y6MA 4C38A 4IZ7A 3QA8A 4DLJA 5HTBA 5HCXA 4MF1A 1XH4A 3RHKA 3FHRA 3QQGA 3DKFA 4GFGA 3JS2A 5M08A 4D4RA 5JQ5A 5LWMA 3Q5ZA 3R7GA 3QKLA 4CLJA 1G8AA 5AV3A 3KMWA 3HYHA 2C6OA 4IJPA 4EEVA 1CKJA 2YFXA 4ZMEA 4EKLA 2BHHA 3PP1A 3V5TA 4A4OA
chains in the Genus database with same CATH superfamily
4U0IA 5C8KA 1JWHA 1FGIA 3RWQA 4AW5A 4E20A 2B9FA 3I1AA 1QMZA 3BE9A 2UZVA 1Q41A 4FTMA 2VTMA 4EH5A 1KOAA 2ETRA 2ITXA 2OFVA 3VRZA 5IG1A 3ZTXA 4C36A 4AW0A 2VTHA 3Q2MA 4DN5A 2W1ZA 3GT8A 4FTUA 5IQBA 2WMTA 3QRTA 4YSJA 1T45A 3CP9A 3C0HA 3FC1X 3V6SA 4AXDA 3PTGA 5HCZA 4CD0A 4HPUE 4FEQA 1YXUA 3CBLA 4KIPA 2OJIA 4ZK5A 4GIHA 4K1BA 3PPZA 3TV7A 3ULZA 2I0YA 3IW5A 1WMKA 3DTWA 2C3IB 2ERKA 4L6QA 4GFOA 4CKJA 1AQ1A 4X2NA 1IAHA 2WAJA 3KRJA 3EOCA 4AA5A 2BAQA 4YZMA 3O17A 4UWYA 4O22A 4QD6A 4AOJA 3UQGA 4GS6A 4NU1A 1LP4A 2J0JA 4WRGA 3EH9A 4C4JA 2IEWA 2VNWA 5CVFA 3TTJA 4EOMA 2BKZA 4FL1A 1WAKA 2WMVA 4OR5A 4AOTA 2XIXA 3PRFA 3QUPA 4A4XA 1YOLA 2KTYA 4I5HA 1IAJA 4JJRA 4YZCA 1PXKA 4AAAA 2PUPA 2OIQA 3KKVA 4HCUA 4EK4A 4PL3A 4FKQA 4BDAA 4HVHA 3CQEA 5AR2A 2QOIA 3U55A 2W4OA 2P55A 4HPTE 4FKTA 4FKWA 4O0XA 4U44A 1URCA 5IKWA 3TNHA 4DCEA 5CALA 5AP5A 4X3FC 2C0IA 4C37A 2EB2A 2F7ZE 2RIOA 1H01A 1Y8GA 4UYNA 4LQMA 5ACKA 1ZYCA 3GCQA 4L3PA 3T9IA 4PWNA 4L52A 5T3QA 3R7EA 3W0RA 4G17A 4C57A 3A7FA 1G3NA 2A27A 5BNJA 5M09A 4HGEA 4BFMA 4XEYA 2J51A 1ZWSA 3BCEA 2OI4X 3NYVA 5GIOE 2ZM3A 3ZLXA 3Q60A 4HZSA 2OZOA 2RFSA 3WOWA 3OY3A 3ANRA 2R3JA 1Q97A 3MW1A 4UN0C 5HNBA 3MPTA 5LMKC 3PE1A 2BCJA 2XJ0A 3ZSHA 3JR1A 3OCBA 3DQWA 4WRSA 2J5FA 2XRWA 3DKOA 4GG5A 3Q4TA 3SOAA 4E6AA 3EIDA 1QPEA 2JIUA 5B2KA 3FXXA 5KZIA 3SLSA 4LGGA 4XV1A 4GKHA 3RP9A 4I0RA 4FZ6A 3QHWA 4IBMA 3TJDA 1IR3A 4D0XA 3P9JA 3OW4A 3U9CA 2XJ2A 3D4QA 3SX9A 3OCTA 4FKGA 2X6DA 3C4WA 3GCSA 4XHKB 1B6CB 3DK7A 3KFAA 3DNEA 1JOWB 2R64A 4W4WA 3TNIA 3VUMA 1P2AA 3VS1A 3U6JA 2OBJA 5FXRA 5BVNA 3V5PA 4B6LA 2VTPA 2P2HA 1JKTA 4RJ3A 2RG6A 3AMYA 5L8KA 5HG7A 4DBNA 2GNIA 5HIBA 3PA5A 3CPCA 4DGGA 5EHLA 5EQYA 3R00A 2IZSA 3TTIA 4U9AA 5EYKA 4AACA 3EQRA 3FMKA 4HGTA 4NTTA 4XH6A 3NFFB 4MUQA 3GUBA 3BE2A 3OP5A 2IO6A 2O8YA 2CNVA 5HGIA 4ITJA 4EYMA 4HW7A 5J9YA 2Z7SA 1OBGA 2DWBA 2ZB0A 4L67A 3UDSA 5AA9A 3E8DA 4ZMFA 5KX8A 3MY5A 4UWCA 3QZHA 1M2PA 5FBNC 1OIYA 5CT0A 3NUNA 1BUHA 4EZ7A 2HY0A 3TUCA 3BGQA 5CXZA 2E9VA 2BDJA 2YJRA 3F5PA 3FMHA 5DPVA 3F5XA 4ERKA 4U40A 3EFKA 1BI7A 4O6LA 3TEIA 3LXNA 4NCTA 4RVMA 3L1SA 4FK6A 5IA5A 3AD6A 3DBEA 5E8UA 5EFQA 2A2AA 3HMPA 4PDSA 2IW8A 3LOKA 3KXHA 2XIZA 5G1XA 2ONLC 3BHYA 4B99A 2WOTA 4CV9A 2GDOA 4H1MA 4CYIA 2WEVA 3SRVA 3CLYA 4L46A 3S3IA 4F7JA 3F2RA 3OWJA 3A62A 4BCPA 4EQCA 1UA2A 2BR1A 2YCFA 3F7ZA 2AC3A 3F3UA 4AXFA 3R71A 5A4LA 3E93A 2JDTA 3GC8A 4L9IA 4QQCA 4O0TA 2IVUA 2WNTA 4LRKA 4QYEA 4D1SA 2XRUA 1OKZA 5GHVA 2XK9A 3A7IA 3R9NA 4O0WA 4G34A 1UWJA 4PDOA 3HV7A 2E9OA 3OWLA 5KBQA 3PWDA 3R8ZA 2X1NA 4FJVA 2ETKA 3QL8A 4KIKB 3ZXZA 4EK3A 1GZKA 3BU6A 5LMKA 3WF5A 3LFNA 4CEGA 5CVHA 3KF7A 4NEUA 4J52A 3N9XA 4JOAA 4PP9A 5F20A 4B7TA 4Z16A 4ZZNA 2WEIA 3QBNA 5K4IA 4Y85A 4FIFA 3QTWA 2YCRA 1ZOEA 5JFWA 5GZ9A 2Z8CA 3OT3A 5IU2A 4JAJA 5AV4A 3AG9A 5DNRA 3BV3A 1WBWA 3K3IA 3Q4CA 4F6UA 2EB3A 2Q0BA 4E4MA 2ITNA 3MFRA 4ITHA 1G8SA 3FLZA 4FKLA 3RPVA 2R3QA 4O4DA 4BZOA 4IDTA 1CKPA 3W10A 4LL0A 5CZIA 1H07A 4AT5A 3FQEA 2PZRA 2ZJWA 3LXKA 2GQSA 4QMUA 3DB8A 4RFYA 4RJ6A 4FSQA 4IC8A 3P1AA 4HGSA 5DIAA 4DT8A 4FRFA 5CAPA 2X8IA 3VNTA 2BPMA 5EYCA 4E73A 4GCJA 4BGQA 4BJJB 3E64A 5AV2A 4DEAA 4MWIA 5CI7A 2PUUA 3QCXA 3TG1A 4U81A 5C26A 4JG7A 1VLRA 4BY9E 2PHKA 1OL7A 4TWNA 5KHXA 4RLKA 1SNUA 4PX6A 3RGFA 3CEKA 3KF4A 4RA5A 5FEQA 1Q4LA 2GHGA 3FLNC 1F5QA 5F95A 3W16A 1VZOA 5IEVA 3EQFA 3H0YA 1Q8TA 4X21A 3P08A 3HRCA 5EYMA 4OLIA 2WTCA 2Q0NA 2J0IA 4ZZMA 1XBAA 5FDPA 2WMAA 5HLWA 2XCHA 3VS4A 3LMHA 4M0YA 3UVPA 4NH1A 2HW6A 2OF2A 4EHGA 3KCFA 3NIEA 3GOPA 5DEYA 2ERZE 4NWMA 4RQVA 1M2RA 4F63A 4OTQA 1W83A 5CEOA 4QO9A 4DG0E 3CIKA 2P4IA 4XV2A 5I9VA 3R0TA 1F0QA 5CWZA 4GK2A 4CMOA 4AG8A 2XARA 5I9UA 1KE7A 2I0HA 3UIXA 1XQZA 4JX3A 4W4VA 4MEDA 4IVBA 2GNHA 3O0GA 2XCKA 4K77A 2ZV2A 1R78A 4U5JA 3SHEA 2GS2A 5HBJA 1QPJA 1YQJA 3OG7A 3DBCA 4FKSA 2UUEA 3R1NA 4R6VA 3GOKA 3LJ0A 3LCKA 4O7RA 3QAME 4G9CA 3PVUA 3BL7A 5DT4A 3VBVA 3IK3A 4USEA 3DPKA 2XB7A 4DTKA 1J7LA 4RWJA 3EWHA 4EHVA 5HD4A 4F7LA 4BCHA 2B0QA 3JVSA 2JBPA 2YM4A 3PVGA 3LKMA 3ET7A 3QLGA 4ZP5A 5EHYA 4K9YA 4RIXA 2BIKB 2XYUA 4AZTA 4C61A 5AP1A 1YXSA 4UZDA 3WYXA 5GZAA 4YP8A 2FGIA 4CZTA 3QGYA 1IA9A 3TZMA 3OS3A 5EYDA 1E1XA 4QNAA 4UXLA 3UODA 3TKIA 4U3ZA 3KXGA 1I09A 2C5VA 2UW6A 4JIAA 4I6LA 2ZDUA 2OU7A 3W2RA 2JDVA 3ORTA 4ASZA 5CAVA 5HIDA 1PXMA 3N4VA 4DFXE 1BL7A 2XK8A 3VS5A 2F9GA 4A9UA 5AX9A 4WBBB 3SAYA 2X9EA 2WTKB 3FMLA 3I79A 4FOBA 4IE9A 3DAEA 4RRVA 3VAPA 3WF8A 2W5AA 2C47A 5KKRC 5J1VA 3L8VA 5IPJA 5E1SA 3B2TA 2C5XA 3MB6A 3DS6A 5L6OA 2F49A 3TYKA 3QX4A 3A7JA 3WF7A 3KREA 3NWWA 4Y73A 4Y72A 2QO7A 5CSVA 1BKXA 3E63A 2J5EA 4IADA 4JDIA 4ZTQA 4CG8A 3A2CA 5CF6A 5BMMA 5IH6A 1QPCA 4ZTNA 3VUIA 4MXYA 2GMXA 4C7TA 3H0ZA 4DGMA 5A4EA 3F5GA 3FSFA 4TNBA 3LZBA 5DOSA 1OKWA 5BVWA 3QXPA 2BZKB 3W1FA 4EHEA 2W7XA 4GRBA 4OUCA 4QP7A 4UEUA 3ZU7A 2NRYA 2FH9A 4NTSA 4BTJA 3IW6A 2VTRA 3KGAA 3FLSA 4GH2A 2VAGA 4F6WA 5C27A 4O91A 5E8SA 4JQEA 3G6HA 3CXWA 3CKWA 5H2UA 4MQ1A 2I40A 4DFBA 1JSVA 4W4YA 4JQ7A 5LARA 4F6SA 4BTKA 3OD6X 5AR5A 2IZUA 3VW8A 1ZZ2A 1H08A 2C5YA 4R5YA 1YXXA 4Y8DA 4YHTA 5E8XA 3G51A 4J8MA 3NUXA 4BICA 2GFCA 3PJ8A 4NZWB 3TACA 4ACDA 4IAIA 4P2KA 4QMTA 2ITPA 3HL7A 3NLBA 3PG1A 3WZDA 3ZLWA 1LEZA 5C1QB 3ZSGA 4CQEA 2CSNA 4FSZA 4BF2A 4IH8A 4MKCA 3TNQB 4R8QA 3KRXA 3H3CA 2BHEA 5AWMA 3R7IA 5IQGA 2UW4A 5AMNA 2PK9A 4HCTA 4DYMA 1JLUE 3P5KA 3VUHA 1H00A 2JKMA 3IW4A 4FL3A 5I5ZA 3MVJA 4BHZA 1OITA 4F9BA 4J7BA 1QCFA 3REPA 4I5PA 4ZS4A 4I93A 5K5NA 2PE1A 4BIDA 4XCUA 2R3LA 2WMUA 2EUFB 3QQHA 3WZJA 4MNEA 5AR3A 4BZNA 5BVDA 4M7IA 4D0WA 2WHBA 3HP5A 1YHVA 3BHVA 5FM2A 4AXAA 2JFMA 3COKA 4O0SA 4AN9A 2YM5A 3C13A 3NNXA 1KV2A 2XNMA 1YRPA 5HCYA 4CQGA 5DBXA 2VRXA 2QKRA 3C4ZA 4FV7A 1PXNA 4RIWB 5ANIA 3VN9A 2BIYA 2PVYA 2X0GA 3LFBA 3AGMA 5AX3A 4AE9A 4ARKA 5A4TA 2UZUE 4BCKA 3OCSA 4F65A 4TWPA 4C58A 4IM0A 3G0EA 4I92A 1WBVA 4KUJA 3LAUA 1YXVA 3R2YA 3QTXA 4I6BA 4QMSA 1DAWA 3UYTA 3ANQA 2F7EE 3ZUVA 3D14A 3NW7A 5M4CA 5AAGA 4L3JA 4WUAA 2GNGA 3MY1A 4O7VA 3R2BA 2UZBA 2B9JA 3PIZA 3KC3A 5E8VA 5CU2A 4XOYA 5IMEA 5D41A 1S9IA 5FXSA 4AOIA 3BIZA 2XK4A 1S9JA 2YITA 2WU7A 3A4OX 4KS7A 2QG7A 4TW9A 3W2SA 1OPLA 3OF0A 2OJGA 5KMIA 2XH5A 3C1XA 3O8TA 2C0TA 5IQHA 3BL9A 2G9XA 3C9WA 3EQDA 2CLXA 3VS7A 1MRYA 2VWVA 2VTIA 3RI1A 4FV9A 3TT0A 3DCVA 3IGOA 4CSVA 2PZIA 4EOSA 5EI2A 2JLDA 4QYFA 3KVWA 1A48A 4XS2A 3L9MA 5M55A 3AT2A 2J4ZA 2R3KA 3KRRA 5ETCA 2LAVA 2F2CB 4G31A 3W2QA 1M14A 3RCJA 4AAYA 3SKCA 5A9UA 2P3GX 1TQPA 2Y7JA 5GJFA 1ST4A 4FT9A 4O4BB 4FZ7A 5DR9A 4KABA 5LWNA 2PYWA 1XBBA 2OG8A 4QYHA 3FC2A 4X2JA 4IC7A 3QFVA 1OL2A 4LRJA 3ZEWA 4P7EA 3IQ7A 3TNWA 3V5WA 4EH3A 4D9TA 2WB8A 3HLLA 4RWLA 4CFWA 3PFYA 2XBJA 4IZ5A 1ZOHA 3VW6A 2WD1A 1I44A 5KE0A 2OJFE 3P4KA 3BGZA 3PXFA 5EW9A 1PHKA 3AMBA 5L8LA 4Y83A 4MXOA 3VO3A 3PJ1A 5TR6A 5BUJA 2EU9A 4BBMA 5E90A 4MYGA 3PYYA 1SZMA 2WOUA 3CD3A 4FIHA 3G9LX 1RJBA 4XG2A 4LV8A 3RM7A 3EYGA 3LFSA 2VU3A 4AGWA 4J97A 2ZVAA 4AN3A 2XP2A 4CRLA 5HTIA 3BU3A 3SA0A 3R7VA 4F9YA 5AUWA 5KZ0A 3KK9A 3RK7A 3BGPA 2PVFA 2XK6A 2E2BA 2C69A 3OOMA 1SVEA 2QOHA 2PMNX 3VBWA 1ATPE 3DA6A 5DWRA 5EM6A 3UGCA 4H36A 3Q6UA 2YEXA 3EB0A 4WHZA 1JPAA 1E1VA 4RMZA 5EM5A 1REJA 1Z57A 2GHMA 4EC8A 2JKOA 1ZMWA 3NDMA 3PUFC 1UNHA 3A8XA 4DHIB 3H10A 2W1EA 4O0YA 3MB7A 3FMDA 2NP8A 2IVVA 3ZBXA 3UIBA 4CV8A 4QQ5A 1JKKA 5CX9A 3TM0A 3BYUA 3QTRA 4HVGA 5IA0A 1PW2A 2J0LA 1H28A 3GCPA 4BI2A 4FG8A 4QYGA 4U7ZA 4YTIA 4AA4A 2HOGA 1NXKA 4MVFA 1CSNA 5KO1A 5LMBA 3V8WA 1KUTA 4IDVA 4CRSA 1SVHA 4TN6A 4ZTHA 5KMJA 3ZEPA 2C5OA 3OEFX 2X7OA 3AD4A 3DKCA 4NW6A 3R8MA 4IVAA 4MXXA 3OROA 4LOPA 5IA3A 5JT2A 3OUKA 3A61A 1GIHA 1NVSA 2Z7RA 2X81A 3MPMA 3BLHA 4WD5A 3VJNA 4ALVA 3BYSA 3ITZA 4F64A 3BU5A 3QQKA 3TWJA 2BDWA 3MPAA 5H3QA 1YDTE 5CF4A 4CNHA 3ZO2A 4G16A 4ERWA 3KQ7A 3NFGB 2OH4A 2BILB 3QC4A 4DG3E 4OTDA 3PA4A 3KRLA 3QYZA 3W55A 4F1TA 3VC4A 4BTMA 4FV1A 1GZ8A 3BHUA 3MYGA 4MBJA 1MQ4A 2X8EA 5HX8A 4YBKA 2FYSA 4Q5HA 3CJGA 4HYUA 5I0BA 2X9FA 4EK5A 4FV2A 3V8SA 3F2NA 5CQWA 4GSBA 3L9PA 5FG8A 3IKAA 3PPKA 4C2VA 2PE0A 4GUEA 1L8TA 4X3FB 4EJNA 1CMKE 5HU3A 2DUVA 2HWOA 3HECA 2WFYA 4XBUA 1UVRA 3CS9A 1JBPE 4G6NA 4RJ4A 3VF9A 3ZC5A 4C8BA 4F9WA 3TDVA 4G6LA 2PVRA 4F09A 5C4KA 2C3LA 2JC6A 4I4FA 4M97A 3DNDA 5EG3A 5KMKA 5CYIA 5HVJA 5HEZA 5FTQA 4HVIA 2BKKA 4D4YA 5HIEA 1FVTA 5AP3A 1W2DA 4XBRA 3DT1A 2YDJA 5E8ZA 3Q9WA 1W2CA 4DBXA 1EH4A 5E9EA 1Y6AA 5C9CA 3Q96A 4K0YA 3RKBA 2DQ7X 3EN6A 2JFLA 5AV1A 4AGUA 4RC4A 4FIIA 3VUTA 4EOIA 4ANSA 2R3FA 5DLSA 5EM8A 3M1SA 4ZY4A 1W8CA 4KBAA 4KSQA 5CNNA 3F3TA 2JKKA 4DGOA 5B2LA 3PY3A 3I7CA 4KWPA 2HENA 4CG9A 4WA9A 2PULA 4FTNA 2OJJA 1A9UA 4S32A 3N51A 2VTJA 4L45A 3W8QA 4XJ0A 3NRMA 3OUNB 3PSCA 5D11A 1YWNA 2UZWE 2EWAA 2WO6A 2Z7LA 4IAFA 4FL2A 4DTBA 4EOJA 4ANQA 1FINA 3KMMA 3BBWA 3UOLA 4AGCA 4ZZOA 1P14A 5DI1A 1OPJA 3ALOA 4AE6A 2BTSA 4W9XA 3EQBA 3WZEA 4AFJA 3OMVA 4BCGA 4EH2A 2REIA 4RT7A 5GJGA 2C30A 2H96A 3QCQA 4I0SA 2VWIA 4BWKA 4DITA 5GJDA 3DK3A 1PJKA 3GBZA 4FSMA 4PNKA 3E8CA 4E3CA 4JDHA 4TYJA 4NSTA 5AIKA 2ACXA 2XK3A 3U8WA 3GFEA 4FSWA 4PPCA 1BLXA 1H1WA 2ZMCA 1PYEA 3LHJA 4YC3A 4BRXA 3NVMB 2R5TA 3UNKA 4FK3A 5LQFA 4LFIA 1TZDA 4NL0A 3E3PA 4L3LA 4ZTSA 2WTJA 4Z55A 5M56A 4C35A 3QU0A 4LRMA 3HA6A 4IAKA 3COHA 4OTHA 4RVKA 3T9TA 4D2WA 3MV5A 4ZJVA 4BDHA 1YDSE 1BL6A 3ORMA 1KSWA 1OB3A 5M51A 3M2WA 4V0GB 4JL9A 3FYJX 4UMQA 3ZUTA 2W1GA 3QUDA 3ZRMA 3DFCB 4HJOA 3PWYA 5ANGA 4V01A 3OFMA 2WTDA 4DINA 3NW5A 4PTEA 4NYEA 4FT3A 4QTEA 5HKMA 4DCAA 4DHZA 1APME 4GEOA 5I3RA 5TO8A 4W8EA 3R9OA 4QTAA 3E8EA 4X7QA 4M69A 4NCTC 3FZTA 1JNKA 4R1YA 3MH1A 2QR8A 3VWAA 3C4EA 1DAYA 4LOQA 4NJDA 4FMQA 2P33A 1H27A 3WIGA 1Y8YA 3Q6WA 4EHZA 5F4NA 4ZSAA 3U51A 4D4VA 2YDIA 3HUBA 3QQFA 4XG4A 4EYJA 2CN5A 5ANKA 3OC1A 5ANJA 4IW0A 5ANDA 5AAFA 1ZYJA 4OTWA 3PPJA 5BQ0A 3O7LB 4O4FA 4D2VA 4YBJA 4BCMA 5BMSA 1KE5A 2YZLA 4BVUA 2NPQA 4ANNA 3DBFA 2JIVA 3O50A 4FIJA 3KVXA 1XH9A 2QOOA 1PXIA 2C68A 2YDKA 3A99A 3I5NA 3K5UA 4RBLA 4YPSA 3UG2A 1DI9A 4BGHA 4YUQA 3NGAA 5BX0A 1V0OA 4NKSA 3V51A 5J8IA 2W4KA 3U4UA 2R3HA 3TKHA 3G0FA 4YSMA 3NUAA 1U5RA 2CJMA 4J95A 4USDA 3DFAA 3CTHA 3QD4A 5GNKA 5F9EA 4QT1A 3ZDIA 3VHEA 4FNWA 1XHAA 3EJ1A 1B39A 3QTSA 5D10A 5JEBA 2BRHA 2J90A 2R3RA 5EM7A 3PSDA 4ZS0A 3RZBA 4A4LA 3OOGA 1A06A 4BDFA 1ZY5A 2R2PA 2XA4A 4UXQA 4IHPA 5L2WA 2CNQA 2O2UA 2Z60A 2YIQA 3HMMA 4FV6A 3S95A 4XP2A 4QDEA 1MUOA 5EHOA 4FZAB 2O0UA 3FMMA 3TDWA 3LMGA 3MY0A 1YHSA 1PKGA 3ACKA 4FKOA 2H9VA 3GU8A 5CEKA 1PRYA 4ACMA 1JKSA 3HMOA 2XYNA 4TWCA 4BWPA 5M44A 2VX3A 2OLCA 5DG5A 1XMMA 4YJTA 3BPRA 2V55A 1OL5A 4XV9A 5HZNA 1GOLA 4JG6A 4OTIA 1E9HA 3IOKA 3HNGA 3IDCA 3IPHA 4E6CA 4NFNA 3FWQA 3LM0A 1PXPA 4FT7A 5DA3A 4D5KA 2XNGA 3MWUA 4U8ZA 2OZAA 3BYVA 4TYEA 1ZLTA 4FTRA 4XG3A 3S4QA 1TVOA 5ETIA 5EKOA 4W8DA 3SDJA 4AN2A 4EI4A 5AFVA 5CAOA 5BUEA 3F5UA 4CFNA 3HAMA 1Q99A 4KBCA 4FIGA 4R77A 3OTVA 1QPDA 2RF9A 4APCA 2QNJA 5DE2A 4DF3A 5T68A 2R7BA 1WBNA 3L9LA 4PV0A 3HMNA 4IJ9A 4HNFA 3PXYA 4RIYA 4RSSA 3FUPA 5DR2A 3OXIA 4OT5A 3ZO3A 4EOQA 3I7BA 2Y8OA 3I6UA 3SG9A 1OKYA 2JDOA 5F94A 4APPA 4EZ3A 3DK6A 5IZFA 2CKOA 3VBQA 5JK3A 2WQNA 3SXRA 3TJCA 4G5PA 4ZSGA 2NYAA 4LM5A 4FEUA 3SXFA 3V5JA 1ZYLA 3ERKA 3H4JA 2QONA 2V7AA 5H8BA 4A9SA 3HX4A 4GKIA 3LFEA 1ZARA 3R7OA 2YA9A 3D83A 3GENA 4R5SA 2C6LA 3DQXA 4BGGA 5ICPA 4XOZA 3WZUA 1PXOA 4TKSA 4EONA 2RG5A 2W5BA 4KB8A 2XKFA 3IECA 5DGZA 3RTPA 3QXOA 5I9ZA 2XF0A 3VQHA 5JKGA 4G2FA 2WMBA 3ENMA 2BALA 4K2RA 2E9PA 4B0GA 4DEIA 5BPYA 2RFNA 5FEDA 1X8BA 4O0UA 4R3CA 5HOAA 4O7LA 3HRBA 3BLAA 2B4SB 2G1TA 2UW3A 3Q9XA 3ELJA 3T3UA 3DJ5A 5CU6A 4XP3A 2EXMA 3LPBA 3H9RA 1V1KA 4AZSA 4FGBA 3DAKA 3TNPC 3HRFA 4LGHA 4D1ZA 1Q8UA 4YLKA 5A14A 4F7SA 4R1VA 1WVYA 5AP6A 1OIUA 3UZTA 3V04A 4KINA 4J98A 4KBKA 2YHVA 4RA4A 4XRJA 5KNJA 2PUNA 3UVRA 3I0OA 4LOOA 5KMOA 2H6DA 3BELA 3KXXA 3CC6A 3MBLA 5D1JA 4IEBA 2IZTA 3ROCA 5KKRB 2ZDTA 3D7ZA 3EYHA 4MBLA 3ZRLA 2PSQA 4CGAA 2WZJA 3KXZA 4L7SA 2PVNA 4QRCA 2WQMA 3RAIA 2Y4IC 2X4ZA 3R6XA 5AUVA 1KV1A 3S1HA 1FBNA 3N4UA 1BMKA 3R8UA 1KE9A 2JDRA 4EBVA 1AD5A 4D55A 1UV5A 3LCOA 3BZ3A 3QALE 1RDQE 1ZMVA 5CTPA 4EOKA 1XH7A 1ZYSA 2HZ4A 2OF4A 1FOTA 1NVRA 4G3FA 2X39A 4N0SA 3U87A 5AADA 2O3PA 2VNYA 1GZOA 3BEAA 3L8XA 2XEZA 4K8AA 2WMXA 3R73A 3HP2A 1ZRZA 4FG9A 4PPAA 4X2FA 4BDGA 4BCIA 1G8KA 1OVEA 4L8MA 2UZNA 3ALNA 1LUFA 1GIJA 2HXQA 2O65A 3AMAA 3LQ8A 4QMOA 3WZKA 1XR1A 4ANBA 4BYIA 2GTMA 3MSSA 4IQ6A 3MGYA 2CKEA 3CR0A 3MVLA 2BAKA 1UU3A 2IVSA 2QHNA 2UVXA 3QYWA 3D9VA 1YDRE 3O7LD 4MXCA 4BN1A 4RX9A 3EN5A 3I5ZA 3ZZWA 4UX9A 3ETAA 2QOLA 4FC0A 4O96A 3V8TA 3R1QA 5EQEA 3BYOA 3OZ6A 5AUYA 4A9YA 2W17A 4BCQA 3F69A 5AP2A 3HV5A 1PF8A 4BCNA 4E5BA 1OIQA 4KSPA 4JT3A 4D58A 5IEYA 4U6RA 5CZHA 3CGFA 5H8EA 2ETMA 4RWIA 5HG8A 3UP2A 2R0IA 5K9IA 2OXDA 3VULA 3CCNA 3A4PA 5AJQA 1K2PA 3BEGA 4GJ3A 4QMPA 3BWJA 4DH7A 2PVKA 2OFUA 3JPVA 4FSYA 4FYOA 4EH6A 2FSOX 4YJOA 3KMUA 4YC8A 4BYJA 3ZHPC 4QYYA 5CU3A 4YLLA 5T6KA 3MH3A 4PMSA 3BBTB 4WKQA 2W99B 3L8PA 5HBEA 5CU4A 3L8SA 1JQHA 5DN3A 5ETAA 1M7QA 1Q62A 2OJ9A 4IWDA 4O2ZA 2ZM4A 2UW0A 3NUSA 5CAUA 4FE2A 3ORZA 4CFVA 3ZOSA 3GC7A 3U4WA 1PXJA 3PIYA 2HZ0A 2NRUA 2QOKA 2YM8A 3O51A 3RINA 3QCSA 4BKJA 4I21A 5G6VA 4EORA 4MAOA 4G3GA 5DEWA 4IIRA 2VO0A 3GXLA 2CMWA 3QD2B 4YLJA 5CT7A 4QDVA 3RAHA 3ODYX 1DI8A 2OICA 4DEGA 4DGNA 1XJDA 4FV0A 5M53A 4JMQA 2G2FA 3D5XA 2BZJA 3SW4A 3FE3A 2W0JA 3T8OA 3LQ3A 3QZGA 3GU6A 4GT4A 4XX9A 5HESA 4QMQA 4GV1A 3HMIA 5CEPA 1U5QA 4G5JA 4HOKA 2GQGA 5IA1A 2PWLA 3EN4A 4FEWA 2BZHB 3WYYA 3U9NA 5D9HA 3GEQA 4YJPA 1TFFA 2O64A 5JZNA 2VUWA 3IGGA 2XKDA 3R04A 4A9TA 2R4BA 3CD8A 5CSWA 3FI3A 4HCVA 2ITQA 2YLEA 1PMUA 4PL5A 3ZFXA 1CKIA 2ITOA 5EI6A 1VYZA 2HWPA 3B8RA 1YI4A 5CI6A 4B8MA 1Q5KA 2BZIB 2EXCX 5HORA 4C4FA 1QL6A 5C03A 3NEWA 4FKUA 2H8HA 3ZO4A 3DV3A 4JRNA 4XG9A 4QMYA 3GC9A 5AR4A 4FKIA 4IACA 4QP1A 3U6IA 3AGLA 3F7WA 3EFWA 3OXZA 4NFMA 4TYHB 2EXEA 4MBIA 3IW7A 3KY2A 3ZO1A 1Q24A 3UQFA 2VTOA 4YNOA 3FKOA 1BI8A 4WNKA 2PU8A 3LXLA 5M57A