4B6LA

Discovery of oral polo-like kinase (plk) inhibitors with enhanced selectivity profile using residue targeted drug design
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
281
structure length
281
Chain Sequence
LITDPRSGRTYLKGRLLGKGGFARCYEATDTETGSAYAVKVIPQSRVAKPHQREKILNEIELHRDLQHRHIVRFSHHFEDADNIYIFLELCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRGILHRDLKLGNFFITENMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGPEADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPRDRPSIDQILRHDFFTKGYTPDRLPISSCVTVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE PLK3
publication title Discovery of Oral Polo-Like Kinase (Plk) Inhibitors with Enhanced Selectivity Profile Using Residue Targeted Drug Design
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 281
sequence length 281
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4b6lA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4b6lA01
4UWYA 2X4FA 4JVGA 3PY3A 3O8PA 5DBXA 3CJGA 3KU2A 4DT9A 3H0ZA 1JVPP 2XH5A 4XG8A 4FZ7A 4C3FA 1YXUA 2XBAA 2JEDA 2VO7A 2XCHA 4FTMA 3SQQA 4DGNA 3ZXTA 3LJ0A 4IXPA 3QHRA 2XEYA 3Q9YA 5F95A 4BZNA 2QOBA 2UZVA 4M15A 3D94A 3LOKA 4W4WA 5ITAA 3L8PA 2PULA 4RT7A 1H00A 4DEGA 3SOAA 5HTIA 2C5NA 3UOHA 2ZB1A 3COHA 4TL0A 4YTHA 3JYAA 4IE9A 4NU1A 4I0SA 4OTFA 2F2UA 4LGHA 4RIYB 4M13A 5JK3A 1M2QA 2JDSA 4ZTQA 3TL8A 4XCUA 2Q0BA 3SXRA 4CG8A 1UNLA 2VWIA 3DDPA 5FBOA 5EHLA 4MVFA 2RFSA 3F69A 4CEGA 3QWKA 3EQFA 4C35A 2B4SB 1P14A 1OMWA 3EOCA 1G5SA 2VX3A 3II5A 2X9EA 5FDXA 2OIBA 3QTUA 1B39A 2VV9A 4X2JA 2VAGA 3KY2A 2OZOA 3KREA 1VYWA 3BWJA 3BBWA 3H30A 4Q5EA 5J1WA 1ZY4A 3PIXA 3QC4A 4ENYA 3E8NA 3QXOA 3N4VA 4E7WA 2RGPA 3NPCA 3QLGA 2A27A 3D5VA 4R3RA 4D55A 3ORKA 3L8VA 5IDNA 4S31A 5ANOA 1KE7A 4WNMA 3MI9A 4OAVB 3MH0A 2RG6A 5HBEA 4XUFA 3AXWA 3V8WA 4Y46A 3RNIA 5HD4A 3ZC6A 1JPAA 1H08A 2GNIA 3FI8A 5DNRA 3MH1A 4PWNA 3BX5A 3IKAA 3BGPA 3S2PA 2GNJA 2Z7SA 3SRVA 1FVTA 2QO7A 5ANIA 4D2PA 4HW7A 4WRGA 3QWJA 4LL0A 1SVGA 5AR8A 4ACGA 4BCOA 3LQ3A 2YERA 3R63A 4BHNA 3GFEA 5L6PA 1APME 4KA3A 2BKKA 2HAKA 5HORA 5J1VA 5LVOA 4PTCA 4HGEA 3TN8A 3DXPA 3P4KA 4UY9A 3VS0A 4YTCA 4GK3A 4U8ZA 1YWVA 3ZSGA 4XG7A 1Q62A 3FLYA 2AC5A 4GVJA 3Q2MA 2J4ZA 4MBIA 4NIFB 5ICPA 3T9IA 3OEFX 4YNOA 3U55A 5ACBC 5JZJA 2QC6A 2XRUA 4YUQA 4ASEA 1UU8A 2A2AA 3GGFA 1HCLA 1R0EA 2BDJA 4FV7A 1R0PA 5AUUA 5M08A 1FGKA 5HQ0A 4Y72A 2OZAB 3R22A 5DRBA 5M4IA 3VNTA 4MWIA 2JAMA 4BB4A 4WBBB 4TYHB 1ZOEA 2R3QA 4HZSA 4S32A 4YZMA 5HLPA 3N4UA 5HTBA 1RQQA 4EI4A 2O2UA 3MB6A 3ATSA 4GFMA 2IZRA 3UG2A 3COMA 3GXLA 3U9NA 3PIYA 4RVMA 3B2WA 4QQJA 4I92A 4JG6A 2FSLX 4ZY6A 5JMSA 4DH7A 2VO6A 2WKMA 2YJRA 3EQDA 4EUUA 2FSMX 3A4PA 4RIOA 5FGKA 3ORXA 1OECA 4DEDA 3WF9A 2R4BA 3CC6A 3PYYA 3OCTA 2XIYA 4ANNA 4FKUA 3KULB 3I1AA 4IB3A 4IC7A 2OFUA 2DYLA 3QD3A 3RAKA 4XYFA 1YI6A 2XCKA 1O6LA 1MP8A 2WTJA 4PP9A 5CZIA 3ODZX 3R7UA 2OF4A 3ZLSA 1ZOHA 2ITWA 4G5JA 4HCUA 1OPLA 3BLHA 5FM2A 2ACXA 3FHIA 3OWPA 4FTTA 4FNXA 3VAPA 4BCGA 4NZWB 3V8SA 5LVLA 3UZPA 4IFGA 3FYKX 3HGKA 5FLFA 4RWKA 3BU6A 3EN7A 1UWHA 3OG7A 4U42A 2R2PA 5DOSA 1Q3WA 3VBQA 3ZTXA 3AG9A 4P2KA 5I9WA 3R9DA 4CKJA 3JS2A 4RIYA 3FZRA 3RCJA 3O2MA 4PMSA 4OBOA 1UV5A 4XBUA 1W98A 4K1BA 1ZWSA 4QTCA 1ZYJA 2FO0A 2OFVA 3W2PA 3B8QA 5GNKA 4G17A 2EU9A 2VTHA 3UO5A 3LFDA 4KB8A 4AWIA 2YM5A 2BAJA 4CRLA 2ZV7A 3CGOA 3BQRA 2PVNA 3VUMA 4CCUA 2ZM3A 4IAFA 4K33A 4NFNA 3D2IA 3AT4A 3F2AA 4EOLA 1FQ1B 4IZ5A 5E8UA 4OTDA 4D2SA 1URWA 3KN6A 1KV1A 2VWXA 4NW5A 5IF1A 2UW7A 2Z2WA 3LM0A 2ITOA 3VUGA 2UZOA 3W2OA 4Y5HA 4YJOA 4PMPA 4ZY5A 5JFXA 4BCHA 2YIQA 2X8DA 3F5UA 5ANEA 4IJ9A 2W4KA 2XJ2A 4NW6A 5ETCA 1IA8A 2C0TA 2XRWA 4A9SA 4EL9A 4QP2A 2ZDTA 2ZM1A 3DBEA 3UMWA 5LMKC 4I23A 3MFSA 1ZYDA 3MH3A 3AC4A 4GJ2A 2XIRA 1ZYCA 5BVEA 3EN6A 4AQCA 3O7LB 4FZFB 4AOJA 5AR7A 4Z9LA 2OXXA 3SD0A 4RX7A 5HX8A 2OLCA 3KRJA 4GG7A 4CQEA 3WZUA 2BIKB 3OWKA 5CVFA 5IA3A 2CGVA 4FT0A 2GNHA 2B9IA 3AC3A 5LJJA 5CEOA 3I4BA 3R7YA 4OAUC 3A7FA 4NM3A 3FKNA 4KKHA 4QYHA 4NIFA 3LMIA 1ZYLA 4MD9E 2XJ1A 4QMNA 2X7GA 2FB8A 5LMBA 4IX6A 5A46A 1YOJA 5CEMA 1BL6A 4Q5HA 4EHEA 2WHBA 1TQPA 1BL7A 2R0UA 3DDQA 3JY0A 1XBBA 3PSBA 2HK5A 2VUWA 4L9IA 4QD6A 4YP8A 1WVYA 2OZAA 2JAVA 3PJ1A 3TV4A 2NPQA 3PY1A 4QMOA 1MRUA 2UV2A 4B8MA 4TYHA 4CZYB 4RMZA 4DGOA 3I7BA 1CKJA 1OL7A 1U5RA 3ENHA 4YJVA 3ACKA 2J0JA 2GS7A 1VZOA 1Y6BA 4MXAA 4AGWA 2BZIB 2WQNA 4YZBA 1BMKA 3TV6A 3PWDA 4KKGA 4XG2A 5AADA 4JQEA 3ZC5A 5E8YA 5EQYA 4FV4A 1VEBA 4BI2A 4QMVA 4HVGA 4FVPA 1KOAA 4CCBA 2V5QA 4USFA 3V5PA 2B9JA 2YCQA 1P2AA 5DEYA 1WAKA 3QUPA 3P7BA 4NWMA 4MNEB 4CLIA 3W16A 3SAYA 3RMFA 3KULA 3RI1A 3WOWA 2CKOA 2JBOA 4AUAA 4XH6A 2OWBA 2W96B 3DNEA 3QKKA 3ATTA 3IW6A 4JX3A 3WE8A 4AFEA 3DV3A 3HUCA 4BCFA 4UN0C 5M09A 4UWCA 3EQCA 1V0BA 3IDCA 4O0WA 2J51A 4L44A 4S30A 4ZEGA 5JSMA 2IW9A 1XR1A 2YZAA 3G90X 3L8SA 3PPJA 4EBWA 4EQCA 2OBJA 2W99B 2NP8A 2C0IA 2E9OA 3UQFA 3FZTA 4YZNA 4U81A 3ZO1A 5C27A 4DHFA 3DQXA 1WBVA 4U7ZA 1V0OA 3DT1A 1K2PA 2UVXA 4QP9A 5J87A 5HGIA 3RBWA 3FZSA 3FL4A 3PY0A 3CTQA 5CSHA 5E90A 3VS2A 3NVKI 1LEZA 4C4FA 4L00A 4U97A 2W1HA 3N51A 2OG8A 1A48A 2R5TA 2VX0A 2V55A 3EQHA 4Y83A 2J0IA 2REIA 2X1NA 2C3KA 5KMOA 1O9UA 1U59A 4Y8DA 4E8AA 3PIZA 4LUDA 3ITZA 2GQRA 2XB7A 2FUMA 4IJPA 5HTCA 4IIRA 3CBLA 4BIEA 5I5ZA 1BKXA 4HJOA 2GDOA 2C6IA 3ROYA 4FT3A 3H9OA 4RC4A 4QPAA 3WF8A 5EDRA 5J9YA 2ZMDA 5CSPA 4R6VA 5AMNA 1YWRA 3IS5A 4EORA 5EQEA 2FSTX 4G3GA 3TUDA 4IWPA 2WB8A 4RJ6A 4DTBA 2H96A 2W17A 3QUDA 3SVVA 4HVDA 4UV0A 1B38A 4BDAA 3CP9A 3HV6A 4M7IA 4WT6A 4E6QA 1Q8ZA 3KXHA 5IG1A 4FV2A 3R8PA 3GC7A 4CD0A 3BYMA 3PPKA 4U80A 4J97A 5KO1A 2ITQA 5KE0A 4ZS4A 4QNAA 4EHVA 3MY5A 2H6DA 1KE9A 4WNPA 5HE1A 1RE8A 5AIKA 2PPQA 4EWQA 4RVTA 2ETMA 2VTLA 2UZBA 3CQEA 3MTLA 5F9EA 3HNGA 3C7QA 4D4VA 4KSQA 4Z55A 1OBGA 3LJ1A 4NM5A 2W1EA 2HZIA 1BX6A 4R77A 3FLSA 4HCVA 3FC2A 4NKAA 3UNZA 4J8MA 4IEBA 3D7ZA 3TNHA 1G3NA 4V05A 5EG3A 2F49A 2NRYA 2GHMA 2X4ZA 3TJDA 5L2SA 1KE6A 2QR7A 3PDTA 3EKKA 3FMKA 5CWZA 3VRYA 2UZDA 3BE9A 2WMBA 3POZA 3IQ7A 3SA0A 4GKIA 4U5JA 1JQHA 5DVRA 1GAGA 2ZYBA 5JFVA 4FT5A 2A0CX 5M55A 3DTWA 2QOOA 3FZOA 3N9XA 5EDPA 2ITXA 2XK4A 3HRCA 3TV7A 3VW6A 5C4LA 2I0YA 2J7TA 4F70A 5AJQA 5FDPA 4ZJIA 3FBVA 3GCPA 2XYNA 3ELJA 4KNBA 1JKKA 4LM5A 4E93A 1BYGA 4N4SA 3BYOA 2QO9A 5FBNC 2UZLA 2ZMCA 3COKA 3F2NA 4XOYA 5CT7A 3C51A 4EEVA 4KUJA 2PU8A 4QMTA 2W4OA 2C30A 4YO6A 4LRMA 3LIJA 5IU2A 4G2FA 4RIWB 3BV3A 3NYVA 2BPMA 2NO3A 3AT2A 2LAVA 3NDMA 4ZSLA 2X39A 4CFVA 3G15A 2ITNA 5K0XA 3MY1A 2IPXA 3V5TA 3IK3A 4A7CA 4RA5A 4CT1A 2PHKA 1JBPE 5DEWA 4ZXTA 3CEKA 4L7FA 4QTBA 3IW4A 3ZMMA 3PPZA 5M56A 1JSUA 2VWBA 2ZB0A 4IM2A 5J8IA 4JJRA 3KXMA 4AU8A 4UMRA 3DAEA 4EONA 1Q3DA 3UQCA 3Q6UA 1ZMUA 4YMJA 3NEWA 5FD2A 2Z7QA 2KULA 2G01A 2EB2A 4I93A 4C36A 4DBNA 4F7JA 4ZMFA 5JKGA 1B6CB 5KZ0A 4JDIA 4UYNA 4EKKA 1ZOGA 4GMYA 3NLBA 4F9YA 3UGCA 2B7AA 4BN1A 2GNFA 2ITZA 1W0XC 4I5CA 3NRMA 4PRJA 1K3AA 1K9AA 5HX6A 4I5MA 4QMXA 3EB0A 3R7VA 4DN5A 3CGFA 2UW4A 4YJNA 5J5TA 4X0MA 3FL5A 1PYXA 3V04A 4NFMA 2C5OA 2Z8CA 5A4QA 5J9LA 4QOXA 4GYIA 5HU9A 4BF2A 2ETRA 3EZVA 4KAOA 3QA0A 4IX4A 4OBPA 1ZYSA 5DH3A 4BBMA 3U54A 2X6EA 3A8XA 3UOJA 2OICA 5EM6A 2Z7LA 4ZTNA 4MK0A 3LLAA 2GMXA 3OW4A 2GNLA 1YWNA 5TF9A 3FMJA 5CAUA 1ZY5A 2Z7RA 4FEVA 5CLPA 1E1VA 4Y95A 3WIGA 4C3RA 4FTCA 1OUKA 4RIXB 3AMYA 4QP3A 4FMQA 4LGDA 4YTFA 4YC6A 5K5XA 3CXWA 5IDPA 2BFXA 3TNWA 4FTOA 3LVPA 5HG5A 3TNIA 4WOVA 2YM3A 3DK6A 5HESA 4EH7A 2CGUA 4FZ6A 5IZFA 4CFMA 4O7VA 2PVYA 5L2IA 2PMOX 3SOCA 5KMNA 3VS4A 4BTJA 4MD8E 4X6RA 4XBRA 4GSBA 4PPAA 3ZUUA 4AZTA 5IQCA 2RIOA 3ALNA 2Y6OA 5FP5A 3VS1A 2HWPA 4EK4A 3K3IA 4FSQA 4EH8A 5KMJA 5HLNA 3NW7A 5I9ZA 4ANQA 5DYJA 3A4OX 2GSFA 4TNDA 2O65A 1H1PA 3EQPA 4LMNA 2QQ7A 4RWJA 4EZ7A 2J0LA 4FYNA 4FV1A 4H3BA 1NVQA 2I0VA 5H2UA 2YDJA 2VU3A 3QCSA 4GCJA 4O82A 5F4NA 4FX3A 5J95A 5BMMA 4C7TA 1NW1A 4UXQA 3MPAA 3JY9A 2JGZA 3ULZA 2PWLA 3OUNB 4DEHA 4QPMA 4O96A 4L67A 3P7AA 5CU6A 2UVYA 1JKSA 1R1WA 2W1CA 3PSCA 1SYKA 3MFTA 1GZOA 4TZRA 3AOXA 4XG9A 4I6QA 2UW0A 4GJ3A 4M0ZA 4GIHA 2V62A 4L68A 4BDBA 3DCVA 4JAJA 5CX9A 2R3JA 1PXNA 1R39A 3CY2A 4NM7A 4OT5A 5IEVA 2IO6A 3QUEA 3SG9A 3UIBA 1T46A 2VTNA 4JX7A 5D1JA 1CKIA 2F7ZE 3NW6A 3GC9A 3OOMA 3TTJA 5FTGA 2XNBA 2ZJWA 2VWVA 4RIWA 3PG3A 4IX5A 5H9BA 2O3PA 2XMYA 5JEBA 3LFBA 2Y6MA 1YI4A 1M7NA 2BHHA 3OMVA 4ZOGA 3PA3A 4J8NA 1WFCA 2IVTA 3AGLA 4CFFA 3DB6A 4UXLA 1YHSA 2OIDA 3FHRA 1OIYA 2B52A 4UYAA 3D5WA 1BUHA 4TN6A 4G16A 4AZFA 3IW8A 5H8GA 3FE3A 4HVSA 4H58A 3RINA 3T3UA 2DUVA 4QQCA 1OI9A 4G3DA 3UIUA 1U46A 2R7BA 3Q4CA 3QD2B 3WILA 5GINE 2OF2A 3K5UA 5HZNA 2QG7A 5BNJA 5HBHA 2F2CB 3HA6A 5HU3A 3AC1A 4KIKB 4MQ2A 5BYZA 2WEVA 2HY81 1YXVA 4RVLA 4BDHA 3C4XA 4FZDB 4W9WA 2WMQA 2X2KA 3DKGA 3LFQA 5LMKA 4C37A 5A4LA 1WBSA 3RPOA 4GU9A 3V51A 2QNJA 5DA3A 4ITJA 1UKIA 5LVPA 2GCDA 4DG2E 3GOPA 2BZKB 3GI3A 4CYJA 3MA6A 4BCKA 4BICA 2YIXA 5CAQA 5L8KA 4FL3A 2OIQA 4YTIA 4AW0A 4OT6A 5F20A 5HEZA 3ZZWA 3NX8A 4IVAA 3W18A 4MF1A 3UJGA 5JRQA 1Q4LA 3QCXA 4PTGA 4YZ9A 2P0CA 3SRVB 3A60A 4YSMA 1YDTE 3CPCA 4JR3A 4FL1A 5DT4A 4EK8A 4NL0A 5KMLA 4AZWA 3HMPA 2W1IA 3P79A 4ZTRA 3DY7A 4ANLA 4QP7A 2YAKA 4E3CA 4HCTA 4XRJA 1UU9A 3NIEA 3T8OA 2VWUA 5E7RA 1SNXA 4RX5A 4IDVA 3VBVA 4RIXA 5B2LA 2VTMA 5CU4A 2O63A 3QKMA 2J6MA 4YJSA 5KMMA 4HPUE 4O7LA 3OROA 5CEKA 4I6BA 2QR8A 5AX3A 5AWMA 5EKNA 5HBJA 3FI4A 4F9CA 4B8LA 1M2RA 4TYGA 1S9IA 2PUUA 1JOWB 4FKTA 3ZSHA 5M4UA 4HZRA 4JT3A 5DR6A 4RRVA 3ZFXA 5HVYA 5AM6A 4F0IA 4WNKA 3HEGA 4RJ5A 5HD7A 2GTMA 3TTIA 2YITA 4AX8A 3FYJX 5KHWA 1IASA 2P2IA 1HCKA 1MUOA 3KVWA 3QTZA 4NH1A 5HO6A 2IW8A 3Q04A 5A6OA 5K4IA 3G9LX 3MPTA 2R3OA 1ERKA 3RHKA 1Q99A 1OIQA 4C0TA 5AV3A 2AC3A 2OJJA 2VRXA 5HHWA 3LFNA 3VN9A 5IA5A 4QMWA 4R78A 4QMQA 3W8LA 3HLLA 5TT7A 3ZYAA 4II5A 4CV9A 5CQUA 4EJ7A 5AP7A 4CSVA 2W05A 3DOGA 3RK7A 3OW3A 4C02A 3OCBA 5CNOA 4ZTMA 3SW7A 2WMTA 3F82A 3RHXA 3NWWA 3G51A 1PW2A 3ANRA 3AQVA 2YABA 3DBQA 3UIXA 4QRCA 4ZS0A 3OTVA 4MQ1A 2BZHB 5B2MA 2XNEA 4FTJA 3GBZA 5EYCA 4E20A 5L2TA 4O7ZA 3BLRA 2JBPA 3MFRA 3Q4UA 3HKOA 2YCRA 3PXFA 4RQVA 1GIIA 5CU3A 3V3VA 3QTWA 3PJ8A 5TR6A 4HYHA 2XUUA 3A61A 4I21A 1IA9A 3R04A 1NVSA 3R73A 4ERKA 1Q97A 4JBPA 3F88A 2CKEA 3EJ1A 4M3QA 4IACA 4ONAA 4IC8A 1ND4A 4WSYA 5DT3A 1F3MC 3DK7A 2QHNA 5CAPA 4QYYA 3RTPA 3D15A 4GV1A 3VS3A 5CI6A 3FMLA 3BYSA 3KK8A 4B7TA 1E9HA 4E6CA 4X2FA 3HUBA 4R7BA 2PE2A 2RFEA 3POOA 3BQCA 5FG8A 4B0GA 4KIKA 1PXMA 4MH7A 3KK9A 3OT8A 3P86A 5HE0A 4C57A 4J71A 5C8NA 2WEIA 2QKWB 5I9UA 4ASXA 5C9CA 3MIYA 5LVNA 2SRCA 1FOTA 3KF7A 1V0PA 2LGCA 3LMHA 3FC1X 2C5XA 3C4EA 3VBYA 3LQ5A 3ORLA 2CNVA 2PVLA 2BTSA 2PVHA 4EH4A 5JQ5A 5AR4A 3O50A 2G1TA 2WOTA 4FE2A 3OF0A 3QAME 3FLQA 4LV5A 4FKJA 3L8XA 4MXOA 3KF4A 4AN9A 5LWNA 2W5BA 2B9HA 3F7WA 4G9RA 4D5HA 5K9IA 1REJA 4WO5A 4PL3A 2VNYA 4H1MA 1KE8A 1QPJA 1FVRA 3NW5A 5I4NA 3FMEA 3L9PA 3QL8A 3NIZA 4D4YA 5HICA 2XK8A 2CKPA 4ARKA 4IMYA 3GC8A 4M8TA 2C3IB 5C8KA 4TTHB 3HMNA 2BCJA 3UTOA 4CKIA 4O6EA 2BTRA 2WIPA 5D11A 4AT3A 3E5AA 4UBAA 1J1CA 5KUPA 3SDJA 4LYNA 5AUZA 4O21A 4EOJA 3R9RA 3R1QA 5DT0A 3QQLA 5FEDA 4BCQA 2YIWA 1I09A 3DJ7A 4H05A 2CMWA 2I1MA 4A9TA 1DM2A 3R01A 2X7FA 3GU4A 3MH2A 4CXAA 3FUPA 3BIZA 4QP6A 3V8TA 4ASDA 4FOBA 3RK5A 5M53A 3O71A 5F94A 5DI1A 5CQWA 4QTDA 4O1OA 3KRLA 2F7XE 5AFVA 3FXZA 5EM8A 3FSFA 3C0IA 1Z57A 4W8EA 3OT3A 3R2YA 4EK5A 3DFCB 5JFSA 2JFLA 2R3KA 2YM6A 3DGKA 1H8FA 3MBLA 4HVIA 3H10A 2IZSA 4BCIA 4C2WA 4JR7A 4PQNA 3UPZA 1OUYA 4C62A 2FYSA 4R5YA 4D2VA 1H1SA 3O51A 5A9UA 2G15A 3BHYA 3CKXA 1UA2A 3KXGA 3PVBA 3LLTA 5AP6A 3RJCA 1PXJA 2C6KA 3WZKA 1ZARA 3MS9A 4GT3A 4KSPA 5M4CA 3MVJA 2PYWA 4FV3A 2G9XA 5AAFA 3QX2A 2R3FA 5AX9A 3UYTA 3OZ6A 3RZBA 4LGGA 2X8IA 4AW2A 4JS8A 4BKZA 1NA7A 2UW3A 3SHEA 4O83A 3S00A 1DAWA 5IA0A 2PZ5A 1YVJA 4ANOA 3QTXA 3BE2A 3LJ2A 3R28A 3PJCA 2OK1A 4OR5A 4XOZA 4DEAA 3KCFA 2BRHA 4FTLA 4QTAA 4D1XA 1Y6AA 5AEPA 1QMZA 3KGAA 4AA0A 4KBCA 5FEQA 2PVFA 3HRFA 3MDYA 4QMMA 4FTKA 2PZRA 3GP0A 1URCA 4MWHA 5EH0A 4ZTSA 3BI6A 2PZYA 4DFLA 4PTEA 4JQ8A 2AYPA 3R7IA 3WZEA 2OJGA 4QTEA 3E8CA 1U54B 1PMVA 2EWAA 4QYEA 3QTRA 3F7ZA 3EQBA 2JIVA 4I3ZA 2UW8A 3UQGA 4CT2A 5B0XA 4DH3A 5JH6A 3UVQA 2JDRA 3KMMA 3LMGA 3NSZA 2B9FA 2PVJA 1JKTA 4I4FA 4M68A 1OPKA 4DGMA 3C5IA 5EM7A 3KL8A 1Q5KA 3FQHA 3KMUA 1WVXA 4RJ3A 2BDWA 3T9TA 2GTNA 5IEXA 5IQFA 4O1PA 1OL6A 2WMAA 3F5GA 3V5JA 2CHLA 3GENA 1GJOA 4H1JA 4H3QA 4RGJA 4UB7A 2WMXA 2PZPA 2ZV8A 3FSKA 4YLKA 3E62A 3NNXA 4XLIA 3RKBA 3ZO3A 3GU5A 4RQKA 1OITA 3UODA 4XP3A 4GG5A 4L46A 3E3BX 4WNOA 4U6RA 5KCVA 4D58A 2A19B 5EI2A 4D1ZA 3RVGA 4FSWA 3GOKA 3MA3A 3MW1A 5E1SA 4DH1A 5E8XA 3AC5A 4GVAA 3UPXA 1H1RA 1J7IA 3VULA 1XKKA 3ORNA 2GNGA 4FICA 5IA4A 4EWHA 1WVWA 3DBDA 1IR3A 3HVCA 4FIIA 2V7OA 4MX9A 2WMWA 4D28A 4YLLA 3LCDA 2A1AB 3VQHA 3W55A 2J5FA 4R7HA 3CQWA 4IM0A 2BILB 3D7TB 4TRLA 4V04A 3AD5A 3L9LA 3TUCA 1OB3A 1W82A 3U87A 4C4IA 2O5KA 4W4XA 4D4RA 2Y9QA 2ZV9A 4DFZE 3ZM4A 1Z5MA 5A4TA 2YACA 5IQAA 4MCVA 5AR2A 1Y8YA 1I44A 1WMKA 3WARA 2C6OA 1FBNA 2CNUA 5HCZA 3QQKA 3EFWA 3FMDA 3Q5ZA 3EKNA 3KXZA 4NUSA 3LPBA 4FG9A 2R9SA 3R9OA 3FLZA 3GQIA 4EC8A 4YJQA 3FQSA 1OZ1A 1UU3A 3RAWA 4KABA 5K3YA 4BKYA 5E8SA 3RP9A 4FTRA 4AT4A 3BPRA 3LFSA 4OGRA 4AZSA 4ZY4A 2BUJA 3UVRA 2YCSA 1IG1A 1SMHA 4M0YA 2QOHA 3JUHA 4I6FA 3JXWA 5IQHA 3ALOA 4W9XA 2EVAA 1QL6A 3A8WA 3DKFA 5DHJA 3EQRA 3ZOSA 5GZAA 2E9UA 4I0TA 3Q9WA 4CGAA 3P9JA 3O8TA 5EW3A 4N57A 4P5ZA 3U8WA 1HOWA 1XH6A 5A6NA 2XJ0A 3AGMA 3LFCA 2QOLA 4TT7A 5HIBA 5A4CA 3D83A 5E8WA 3QYWA 3LFAA 2GQSA 1F5QA 2R3RA 1PXLA 3L9NA 3QZIA 2C6LA 3R21A 5CENA 3ZH8A 2OH0E 3FZPA 4GT4A 4ITIA 4Y5QA 3WF7A 4DINA 4XMOA 4JDJA 3JVRA 2RFDA 4FNWA 1PMNA 2E9PA 2HENA 4QMLA 3WE4A 3VUKA 4L7SA 1AQ1A 3I5NA 3LCSA 4K9YA 4BZOA 4Z16A 4IH8A 2RSVA 4JRVA 3VO3A 2C6MA 3BGZA 1YHVA 3W2RA 2OH4A 4DFXE 1ZMVA 4JG8A 2YM7A 3SG8A 1G8SA 5LCJA 3M1SA 2PVMA 4EZ5A 3IECA 3P08A 3IW5A 4FIGA 1U54A 1QCFA 2YJSA 3ACJA 4PDOA 3PTGA 5AP1A 5AP2A 1PRYA 3P5KA 2XNNA 3QQHA 4ZLOA 4FKLA 1J3HA 2RG5A 2ZM4A 3G0EA 2OI4X 1JSVA 4FV0A 5TE0A 4C3PA 2VTTA 4F9BA 3DZQA 5F1ZA 4YURA 3QX4A 3HRBA 4L8MA 3L9MA 2VGOA 4L42A 1M52A 3BRBA 2B1PA 4CFUA 3W2CA 3ORMA 1M14A 5EKOA 3PXZA 4BCPA 1KV2A 2YHVA 2BRNA 2VTAA 4AS0A 4EH3A 3SV0A 4GUBA 5E8TA 3PJ3A 3UO6A 3Q5IA 3QLFA 5D9HA 2VTJA 2EB3A 2HZ4A 4CZTA 3TWJA 1VJYA 3D5XA 5FP6A 3RAHA 5HOAA 4HOKA 4IB0A 3E87A 1OKWA 3GNIB 5CU0A 4D2TA 4A4OA 2VO0A 4G34A 4L3JA 2UZUE 1ZXEA 3ZFMA 3P7CA 3H0YA 3H9FA 4WG4A 3FDNA 4E4XA 2WTWA 3OBJA 5CTPA 3R8ZA 4N70A 4RJ4A 5CNNA 5GJDA 3K5VA 4FKPA 3GUBA 3ZXZA 4F9AA 4JI9A 3VS6A 2A4LA 2VTPA 3BHTA 4KIPA 1PMEA 2C47A 5AV0A 4E1ZA 4EYJA 4PMMA 3MYGA 5LVMA 4CFWA 4X6QC 3GU8A 5AIRA 4AZVA 1RW8A 1M2PA 4J96A 3U6JA 4DTAA 2I0EA 3D7TA 5E91A 1GIHA 1YRPA 5EYKA 1Y57A 3TZ7A 5BVOA 4IWQA 3KA0A 4O22A 4MXZA 5EDQA 2P33A 2XKCA 1BI7A 3CD3A 3IGOA 4ZK5A 4IX3A 4N6YA 5DMZA 2XNMA 1YDRE 2UW6A 1H1WA 2BRBA 4ZLZA 1FPUA 1IEPA 3EL8A 3WF6A 4QPSA 4IDTA 1ZAOA 3TIYA 5IUHA 4RFYA 4G5PA 5TKDA 3F3ZA 3R00A 4FV5A 2IZUA 3Q4TA 2QOQA 2YFXA 2QODA 4QP1A 4QP4A 4EC9A 1OPJA 3LKMA 4PUZA 5EM5A 2F7EE 3WIKA 3MIAA 4B4LA 1FMOE 1OKYA 4LRKA 1IRKA 1LR4A 1Q41A 3DFAA 4OW8A 3DKOA 3Q2JA 1PY5A 2I7QA 3KCKA 2QG5A 4X21A 4A9YA 4FTUA 4TXCA 3UNJA 3NNWA 3UOKA 4ACDA 2Z60A 3IDPA 4UALA 3ZM9A 2JDOA 3PXQA 3EFLA 5EOLA 3HAMA 5ACKA 1ZZLA 2C5YA 2WXVA 2C3JA 3R30A 1WBNA 1AD5A 3QBNA 4JL9A 1UNGA 4CQGA 1TVOA 3BHUA 3LZBA 4E26A 5AAEA 1J1BA 2HZ0A 4NKSA 4FV6A 4PP7A 4FSYA 1NXKA 5A3XA 1Y8GA 3OY1A 3REPA 4D1SA 5KX8A 2CCHA 3QF9A 3GT8A 3O0GA 4MXCA 3W8QA 5CANA 4O38A 4RX8A 3F3TA 4V0GA 4BDDA 4LI5A 5IKWA 4I6HA 4YNEA 4I94A 4KINA 2HY0A 4M14A 4Q9SA 4LG4A 5HCYA 3U4WA 3OUKA 4DH8A 4K6ZA 2ESMA 4KIQA 3QRUA 4CNHA 4FKVA 4BCMA 2UZEA 2OXYA 4GK2A 2GHGA 4JOAA 2C5VA 4F6WA 1SNUA 3M2WA 3DLZA 2XZSA 4XV1A 4CYIA 1PXPA 1CDKA 2QI8A 3BGQA 4HYUA 1YXSA 3R8UA 2NNWB 4JNWA 1YDSE 2QOIA 4DFBA 2I40A 4XX9A 2XKEA 4U40A 3SW4A 2C3LA 4DTKA 4Z7HA 3S95A 3CQUA 1YI3A 2UZNA 5GHVA 3DK3A 4MKCA 1RJBA 2VTSA 3MJ2A 3IDBA 4U45A 3EL7A 3KB7A 4ZMEA 4RWIA 4I1ZA 2YLFA 4XNEA 4I22A 2WMSA 5HI2A 4AOTA 1KUTA 4CZUA 3O23A 4YZDA 3ZFYA 2R3MA 4O27B 5DPVA 4EOQA 2CGWA 3P1AA 4BGHA 5EFQA 3CY3A 3QTIA 3LXPA 5M57A 2CKQA 3H9RA 5G1XA 4JBVA 2WFYA 4GFOA 2FH9A 2XIXA 2QLQA 3DNDA 5M44A 4QO9A 3KRXA 3VUIA 4P4CA 5I9YA 4JIAA 3I7CA 4XJ0A 5HO8A 4G6OA 4E5AX 4FIEA 4Q2AA 2J9MA 3ZO2A 3IW7A 3QGWA 4TWNA 1YOMA 3RALA 1IAHA 4FBXA 5KZIA 2JFMA 1DAYA 5IMXA 5L8LA 3A7JA 4D9UA 4QQTA 4QQ5A 5C1QB 3OC1A 3TEIA 4ORKA 4I5HA 4PDPA 4KRCA 5FTOA 5EK7A 4L52A 1KSWA 5FEEA 3QA8A 2WO6A 5EI6A 3ORZA 2VO3A 4UMTA 1XHAA 3ZSIA 2J2IB 2HIWA 4J7BA 3ULIA 3F66A 3MN3A 2AUHA 2W7XA 4JDHA 3JPVA 3R9HA 2ZOQA 3QZHA 3Q6WA 2DQ7X 2VTRA 2H9VA 2QOCA 3R7GA 5EYDA 4FT7A 3GCSA 4F09A 5B7VA 2JKKA 4JLCA 2WNTA 5FWKK 2ERZE 4U0IA 4AZEA 2EXEA 2YM4A 4YJUA 4MBJA 4CMTA 2XNOA 4WRSA 4R1VA 4U41A 1PJKA 5BVKA 4ZAUA 3SX9A 3C13A 3NYNA 5BYYA 2HCKA 4J53A 4WHZA 5KMIA 4QP8A 3E8EA 3ORPA 2Y4PA 3KQ7A 3S4QA 2IVVA 3TI1A 4FKOA 4ID7A 4RC3A 2XKFA 3IGGA 2YDIA 2R64A 3DAKA 1V1KA 2QOFA 4JRNA 2BMCA 2X2MA 2O64A 2IG7A 4L43A 4FR4A 3BYUA 3G6GA 4WD5A 5K0KA 2B55A 1YW2A 5KBQA 4AGUA 3PVUA 3ZUTA 4EYMA 4O7RA 3E64A 3Q52A 4DT8A 5M07A 4GS6A 5EQPA 1XH8A 1LEWA 5KNJA 2UW5A 4AW5A 1OIRA 2C68A 3A7GA 4TKSA 2JIUA 3OWLA 3QC9A 1CTPE 3TG1A 3OEZA 4ZTLA 4FEXA 5H8BA 4D9TA 3VUDA 4FEUA 5A14A 3G33A 5HE3A 3CTJA 4FSZA 5CF6A 4BCJA 2XKDA 4CMOA 4C8BA 2X81A 4W4YA 4YBJA 3KEXA 3KFAA 4O84A 4XG3A 3QQGA 4FSUA 1XO2B 4YJTA 4BL1A 2BR1A 4FYOA 4RC2A 4XV3A 3V5WA 3NAXA 4AW1A 5AV4A 3F3WA 3VS5A 3CKWA 3RWQA 2IWIA 4O2ZA 2W1GA 3RZFA 4MBLA 4CKRA 2E9VA 3TACA 4A9RA 3ANQA 3BU3A 5D10A 3NAYA 4RSSA 1H01A 3AC8A 3TNQB 1F0QA 4RWLA 3A2CA 1Q61A 2HXQA 4ACHA 5M51A 4IBMA 2W5AA 1UNHA 1H4LA 3ZCLA 5IQGA 3QD4A 2VTQA 2UUEA 5CVHA 3ZZEA 3F3VA 1WCCA 4FUYA 5H3QA 2WTVA 2Q83A 4F9WA 3DLSA 2PTKA 4K77A 2G2HA 1NY3A 4BWXA 3S0OA 4QMSA 2QHMA 2R3GA 3C4WA 3GCQA 1NVRA 2IVUA 4RZVA 3W33A 3HMMA 2R3PA 4FVRA 4BDCA 5KMKA 3LAUA 3RM6A 2VWZA 3DJ5A 3VBTA 4E4NA 5DFPA 1LPUA 3BKBA 3GEQA 3MVHA 4QNYA 3OCSA 4G9CA 5HNGA 4CRSA 1OBDA 2X8EA 3KMWA 5ANGA 5D7VA 3Q9ZA 2HELA 1UWJA 1XBAA 3SLSA 2XEZA 2WAJA 3D5UA 2QURA 4RZWA 1FMKA 4JG7A 4BDGA 3KN5A 4EHGA 5BPYA 5JGAA 5BYLA 1TKIA 5CY3A 4L53A 4RG0A 1JAMA 2PMIA 4D2WA 3AMAA 3HZTA 4L3LA 2VGPA 4ENXA 4GT5A 2QO2A 4O0UA 4EH2A 5I9XA 1PHKA 2BZJA 1H26A 3QHWA 4IZYA 4RVKA 3VC4A 4AF3A 4EJNA 5L8JA 2WQMA 5I3RA 4EKLA 4XV9A 1S9JA 4TWCA 3NUPA 4X2NA 3LFFA 3RPVA 5EW8A 3OY3A 3ORIA 4IB5A 4L3PA 4ASZA 2OSCA 3R8MA 2BVAA 3IOPA 3VIDA 2DS1A 1ZRZA 3OOGA 4KD1A 4AACA 4YPDA 4EOMA 2HW6A 4BCNA 2IW6A 2BRMA 2X9FA 3IONA 3Q32A 5AA8A 5K4JA 1PKDA 1LP4A 2JIIA 4J98A 4KS8A 4BTKA 2GQGA 3Q9XA 4AXAA 3OHTA 4JBOA 3ZDIA 4BWPA 4NEUA 3VJNA 4D0XA 5AM7A 4EH5A 4FIHA 2GS2A 3OBGA 3CE3A 1JWHA 3A62A 1EH4A 4X2KA 4R8QA 2PMLX 5CVGA 4K18A 4S34A 4C33A 5JFWA 3EFKA 2WQOA 5IH4A 5HVJA 3UYSA 4EOPA 4TWOA 1XH5A 2OKRA 3LXNA 2WOUA 3UE4A 1PXKA 3U6IA 2PE1A 3PA5A 5DIAA 4E73A 3PRIA 4BHZA 3UP2A 4PY1A 4R3CA 4EHZA 3B2TA 4M67A 2XK6A 4HYIA 4AN3A 2XIZA 3PFQA 3D2KA 3FV8A 4KBKA 2XVDA 1REKA 2XM8A 5BUEA 4S33A 4DFNA 2BHEA 4BDFA 4LMUA 4LOOA 4XS2A 3R83A 3WI6A 2PL0A 2XK9A 3GCVA 3TZ8A 5JN2A 1J7LA 3FY0A 1FINA 2J5EA 2YM8A 3EMGA 1UVRA 4PL4A 4XG4A 3JVSA 1W7HA 3FJQE 3WZJA 4C4JA 4BRXA 3I0OA 4O6LA 2BALA 2BAKA 2ZAZA 4NJ3A 4AA5A 3CPBA 5HLWA 4FZAB 2XM9A 4EK6A 3ROCA 4BKJA 1H28A 1LUFA 3PRFA 4CVAA 3DS6A 4A4LA 3CSVA 2O0UA 3QYZA 4GW8A 4FTQA 4S2ZA 3SXSA 4QMUA 4FG8A 5CT0A 4LOQA 4DAWA 3DJ6A 3QGYA 5LOHA 4AFJA 1CSNA 3TKIA 3BYVA 4QYFA 3BLQA 2ONLC 4M97A 5AP4A 3F6XA 2JDTA 1ZLTA 2XYUA 3HP2A 4V01A 3HP5A 3A7IA 3I81A 3QRJA 2GPHA 4JQ7A 5T68A 3QQJA 2BKZA 4FKRA 5CF4A 3ZDUA 4BTFA 3QRIA 4XG6A 1Q24A 3C5UA 5HVKA 3TZ9A 3R1NA 3TNPC 3EIDA 3WYXA 5L2WA 4BBFA 4OUCA 2G2FA 1PYEA 3H4JA 2RL5A 2NRUA 2RF9A 4J52A 2JITA 2VD5A 4EH6A 2QLUA 1Q8YA 2W1ZA 2W9ZB 4RA4A 3TKHA 2OW3A 5HNBA 4X3FC 3MSSA 4P5QA 4GFGA 3IOKA 4HNIA 4IZAA 4YHTA 4BDKA 1WBPA 2CCIA 3UIMA 3QRKA 4C58A 4MNFA 5HG9A 4CFXA 4UX9A 4AGDA 3ZRMA 4C61A 4FC0A 3ZHPC 3OXZA 4I20A 3W32A 2EXMA 1OIUA 4LQMA 2FVDA 2JKMA 1OL5A 1R78A 4YHFA 3VUTA 4E6DA 2Y8OA 1ZMWA 4F99A 5CU2A 3QCQA 2VX1A 3R71A 5IUIA 5AP5A 5C26A 5KKRC 4O86A 1OKZA 3GB2A 3O17A 3OTUA 4MF0A 3WBLA 4AA4A 4CTCA 3ZEWA 4EOSA 4UMQA 3TJCA 3UOLA 3TT0A 4BWKA 2V22A 5FXQA 5IA2A 4MAOA 4NSTA 5L6OA 4YPSA 4DEEA 4F0FA 5JGBA 3NNUA 1W84A 3FI2A 4F1TA 4F1MA 4FNZA 4WUNA 2ITYA 2PMNX 1SZMA 3FY2A 3WZDA 4LOPA 4FG7A 3R0TA 1GOLA 4FSMA 5ANKA 2PVRA 3EH9A 4XLVA 2F9GA 3MTFA 1TQIA 2W5HA 4WUAA 4F08A 1YQJA 3FEGA 2UW9A 2YCFA 3I60A 2YLEA 3TZMA 3ENMA 4UEUA 2WZJA 1ATPE 3QU0A 2WQEA 3FKLA 4LV8A 2QU5A 4ZIMA 4FK6A 4U9AA 5L4QA 3ZBFA 4USDA 5CSVA 3W2QA 2WTCA 2BAQA 2DWBA 3HYHA 3CIKA 3U4UA 2VWWA 5GJGA 3MJ1A 3C0HA 4BYJA 4GIIA 3JR1A 1WBWA 5AAGA 2X0GA 3DB8A 4ZSGA 4NM0A 3EQGA 3BEGA 5CEPA 3PJ2A 2JD5A 4J1RA 2HWOA 3ODYX 4QT1A 3VBWA 2E2BA 2WTDA 5IH5A 4O0YA 3VRZA 3BELA 4IVDA 3LFEA 4ZTHA 4F65A 4C59A 5HNIX 4BFMA 1GZ8A 3N4TA 4I5PA 1UU7A 3FMHA 5T6KA 3QZFA 3MGYA 4NK9A 4J95A 1JLUE 2ITPA 2JKOA 3LW0A 3OWJA 4H36A 1OGUA 1H25A 3LCOA 5D12A 3QXPA 3R1YA 3VHKA 2XK3A 3DAJA 3Q3BA 3HDNA 2OO8X 3KRRA 5T3QA 3Q4ZA 3ZO4A 4MD7E 3UVPA 4DH5A 4HGLA 4AN2A 2C6DA 2CDZA 2O8YA 3OD6X 4GUEA 4IWOA 3UDBA 2C1BA 4FTNA 4GH2A 5BMSA 2QVSE 4ZSAA 4A06A 3VW8A 2WMRA 2WGJA 4NCTC 4OTRA 4DGGA 3F5PA 2CJMA 4XRLA 3BWFA 2ZV2A 3LHJA 3F2RA 4A4XA 3U9CA 4O7TA 3TKUA 4Y85A 1FVVA 5AP0A 3VVHA 4UZHA 4BI0A 3QTQA 5FQDC 3TXOA 3KC3A 4YBKA 1STCE 1O6YA 1PMUA 4R7IA 4DITA 2FGIA 3FMMA 3KXXA 3PVGA 1XJDA 3U6HA 2CN5A 1VYZA 4CMUA 4F63A 2PUNA 5IUGA 3HAVA 3OFMA 4N0SA 4MXXA 4RBLA 3L1SA 3PZEA 4PV0A 3CCNA 3TDWA 2XBJA 4IAIA 3V01A 4FEWA 5LXMA 2XNPA 3BHVA 4CFNA 3V6RA 5LCKA 4AE6A 3NUAA 3OP5A 2Y4IC 4O0SA 1RDQE 3CS9A 3NYXA 2ZVAA 3MFUA 4OTIA 2C6EA 3VF9A 3ZLXA 3FWQA 5FXRA 3R6XA 3ZLYA 4W8DA 4KRDA 4LFIA 4WBOA 2CSNA 3EHAA 1WZYA 3TIZA 3M42A 1P4FA 1NT2A 4FIJA 2Y0AA 5HO7A 4CLJA 1Q8WA 2W4JA 1M7QA 4F0GA 4F6SA 5CF5A 4FNYA 4IHPA 1QPCA 3UNKA 4DLIA 3P78A 3CTHA 2RKUA 1H0WA 2PUPA 4M84A 5CXZA 5ETIA 5BQ0A 4WSQA 4UZDA 4F1OA 2IJMA 5KHXA 2C1AA 4WG3A 3ORTA 4P90A 2CN8A 3GU6A 2XP2A 1SVHA 4HGSA 3UZTA 3DXQA 4C4GA 3NGAA 1PF8A 3OS3A 2XK7A 5L3AA 4BR3A 4PMTA 3QCYA 3RGFA 4C4HA 2C6TA 3FAAA 3ZRLA 4APPA 3E7OA 2QD9A 4DCEA 5JGDA 3R2BA 4MHAA 3PP1A 3Q60A 5HG7A 4KBAA 4BIBA 3T3VA 4R3PA 4DBXA 5DE2A 5CSXA 4HVHA 4H3PA 1U5QA 1CM8A 4XV2A 4L01A 4UMPA 3G5DA 4C34A 3I6WA 5J7HA 3E8DA 4QYGA 4BGGA 4FI1A 4PL5A 1IAJA 3M11A 5JQ8A 2VTIA 1A06A 4EQMA 3SC1A 3UC4A 3UG1A 4CTBA 2X6DA 4QMYA 2EXCX 3LCKA 2BIYA 4V0GB 2CLXA 2F4JA 5E8ZA 3EN5A 2J0MB 4AE9A 1PKGA 4DEBA 2WQBA 4E5BA 4OBQA 4FL2A 4IVBA 5L2QA 4LL5A 4TYJA 3O7LD 4O7YA 4EOKA 4D5KA 2P55A 3LQ8A 1YOLA 2C0OA 2UZWE 3DBFA 3E93A 5IA1A 2WD1A 3FXXA 3LE6A 4O7WA 4BBEA 5CS6A 2F57A 2GHLA 4JAIA 3QQUA 2YAAA 3KXNA 4YR8A 3WYYA 4TYEA 2V7AA 4BYIA 1H27A 3RPRA 2R3NA 4M12A 3ZBXA 1Z9XA 4ZZMA 4FSNA 4BVUA 3GU7A 4DYMA 3THBA 4GKHA 3R9NA 4RJ8A 3W2SA 2X7OA 4X3FB 3PLSA 4K0YA 4N6ZA 4R1YA 4EK3A 5J79A 4TNBA 2WMVA 3QTSA 5ANDA 3CLYA 4DA5A 1DI8A 5BVNA 5CEQA 3RM7A 5L6WL 1MRVA 2B0QA 4RLLA 4GRBA 3EZRA 4PF4A 2I0HA 4FIFA 3W1FA 1SM2A 4OTPA 1BI8A 4I24A 3UC3A 2PE0A 2PUIA 4A07A 3NUSA 3G9NA 2C69A 1JKLA 3ET7A 4CG9A 4ZZNA 2ITUA 4BY9E 4DLJA 3FQEA 2WELA 3HV7A 2VWYA 5CZHA 5KKRB 2WTIA 2Q0NA 3TM0A 4DCAA 4IAKA 2WIHA 3MVMA 2VNWA 4FKQA 3PSDA 4Y73A 1J7UA 4O91A 2CLQA 3BEAA 3IPHA 4OTGA 4BGQA 3NZ0A 3NUUA 5AA9A 1WBOA 4RX9A 2HYYA 1KWPA 3LM5A 4YJRA 2QKRA 4FKWA 4EQUA 2W9FB 3GVUA 2HW7A 3PP0A 3D9VA 3LXLA 5AUVA 1YHWA 5HE2A 3VF8A 5CALA 2GFSA 3EYGA 3F5XA 5LWMA 3PLAE 4AT5A 4GU6A 3SKCA 1L3RE 2PY3A 1X8BA 5E4HA 3AT3A 3HMOA 4FKGA 4XEYA 5AUXA 4U44A 3MY0A 5HKMA 3EN9A 2BFYA 3RK9A 3ZS5A 4IB1A 3UP7A 2B54A 3V6SA 3E3PA 4PX6A 5CF8A 4R5SA 5CI7A 4EOOA 3FI3A 3QFVA 3HV5A 4FT9A 4W4VA 5J9ZA 4MXYA 2WTKC 2J90A 4QMZA 3A7HA 4NYEA 5CAVA 3EYHA 2VZ6A 3PA4A 4YZCA 4B6LA 3A99A 5EOBA 4BZDA 2E9NA 1H0VA 3W10A 2KTYA 5I9VA 2GU8A 2QONA 4OTWA 3DBCA 2G2IA 5H8EA 3R8LA 4RLKA 3F3UA 4NT4A 3NUXA 3EQIA 3VS7A 1O6KA 4KWPA 1L8TA 4ACMA 4B99A 3F9NA 3R02A 4FVQA 1CKPA 1M17A 1JSTA 1H07A 2WPAA 5IH6A 3MESA 1WBTA 4FTIA 5DLSA 1W8CA 3AD4A 2BRGA 4MYGA 5BX0A 5GIOE 4IFCA 3F61A 4IADA 2YA9A 4MEDA 1TQMA 4HYSA 4NTTA 4TPTA 3U51A 4F6UA 4GK4A 5CAOA 4YO4A 4L45A 2C4GA 3RWPA 3DQWA 3QALE 1PXOA 5B2KA 5A54A 3ZONA 4USEA 3R1SA 4FGBA 4P7EA 4HPTE 4K11A 4AGCA 3UMXA 2YWPA 2CPKE 2YISA 4ZP5A 2ITTA 4AOIA 4BI1A 3DXNA 4C4EA 3G2FA 4MNEA 4OTHA 3ZEPA 5HIEA 4ZZOA 2CNQA 4GYGA 1DS5A 2ONLA 3QKLA 3BZ3A 3LXKA 4G1WA 4NTSA 2PK9A 4TW9A 4DC2A 5HG8A 4FKIA 3BCEA 3BBTB 2I6LA 5E8VA 5DR9A 4WG5A 4PPBA 2X2LA 1P5EA 4D4SA 2H34A 1W83A 2WU7A 4I0RA 3PXRA 3PXYA 2W0JA 4ZSJA 4F7NA 5GZ8A 2YWVA 4WIHA 4C2VA 5AUYA 2W1FA 3KRWA 3GFWA 4JXFA 5ETFA 3H3CA 5FXSA 2EUFB 2GS6A 3C4ZA 3ZUVA 4EBVA 4RFZA 3TDVA 4IAYA 2H8HA 2WMUA 2JLDA 5FM3A 3NCZA 5E1EA 4X3FA 1R3CA 2JKQA 4NJDA 4ALUA 1Q8TA 2GFCA 3NVMB 5C01A 3K3JA 4YHJA 4PNKA 4WA9A 3MWUA 4ACCA 4E6AA 3UZRA 2PSQA 2Y4IB 4M69B 2UZTA 1XH7A 3CD8A 5K5NA 5ANJA 4EOIA 4E4MA 2P3GX 4K2RA 5EHOA 3I0QA 1GNGA 3HV3A 4YU2A 4I41A 3DU8A 2XA4A 3VJOA 4M66A 3HX4A 3E7VA 2OGVA 5CYIA 3UO4A 3G6HA 3VWAA 5E9EA 2QU6A 4X2GA 4WKQA 3NUNA 4F7SA 4EH9A 4DEIA 1YXTA 3ZLWA 4RJ7A 4CV8A 4G31A 3COIA 1A9UA 3KVXA 5C03A 3DA6A 2YZLA 4FF8A 5DGZA 4C38A 5A4EA 1GZNA 4EZ3A 5CSWA 2CGXA 2YDKA 4U43A 5BVDA 5AR5A 5HIDA 1H24A 3RCDA 4IAAA 2R3LA 3MPMA 4FV9A 5DG5A 4RFMA 1GZKA 3QZGA 4G6NA 4H39A 4DG3E 5IQDA 3RNYA 3FMNA 3OVVA 3GQLA 5AP3A 1QPDA 3ZRKA 4DGLC 5IQBA 1JNKA 4ITHA 4O0RA 4IWDA 5DRDA 3R7EA 1XWSA 3CR0A 3HA8A 3OCGA 4AP7A 5DWRA 2ETKA 4BDIA 1U4DA 2OJFE 4YJPA 4B9DA 3VQUA 4DFYA 4FGRA 2VTOA 4FODA 5BUIA 4BIDA 4FV8A 3HMIA 3S3IA 4BC6A 3NUYA 1OM1A 3BV2A 3SGCA 4PPCA 4E4LA 1QPEA 2HXLA 4GEOA 1OKVA 4KS7A 4TWPA 1KE5A 3P23A 3IG7A 2YIYA 1XH4A 2OJIA 3NNVA 4L6QA 5IEYA 5J7BA 3FLWA 3DTCA 4X3JA 1H1QA 2WU6A 3DPKA 1PXIA 4G3EA 4YLJA 1Y91A 2B53A 4G3CA 4DFUA 3RPYA 4FTAA 3O8UA 5BUJA 3I5ZA 3PXKA 1T45A 3FKOA 3I79A 5IMEA 5AR3A 3TCPA 4JDKA 2XF0A 5TOZA 5I0BA 4U3ZA 2OU7A 4UWBA 1XBCA 5EYMA 5JT2A 3G0FA 2ERKA 1OVEA 3MV5A 4IANA 4X7QA 2PZIA 3K54A 4IQ6A 2J0KA 5CEIA 3QQFA 3Q96A 4ZSEA 4APCA 3IO7A 1YKRA 4KKEA 1VR2A 5EHYA 5KBRA 4YC8A 5M06A 1UKHA 4O0VA 3P0MA 5CXHA 4FK3A 2YIRA 4F7LA 4DG0E 2Y7JA 4ALWA 5CASA 3AD6A 4NCTA 3C9WA 4G3FA 3ZU7A 2JC6A 2W06A 3E63A 3FPMA 1KOBA 4O2PA 4U3YA 3FPQA 1CMKE 4XP0A 5DR2A 3ID6C 4PDYA 3OXTA 1P4OA 3HV4A 3QD0A 3PUPA 5GIPE 4FUXA 4ZJJA 4Q9ZA 3E92A 5AUTA 4FEQA 3AMBA 3I6UA 3Q53A 5JRSA 5FRIA 1OL2A 3C0GA 4TYIA 5HCXA 2QOKA 5EI8A 5BVFA 4MTAA 5LQFA 2OXDA 3PE1A 4J99A 4ZJVA 3EN4A 3NMUF 4AAAA 4D0WA 4JBQA 2P4IA 5JZNA 4OLIA 3E88A 4IW0A 2XS0A 5DN3A 2XNGA 1XH9A 3VUHA 3DKCA 3D0EA 3O96A 2VN9A 4TY1A 4ANMA 2J50A 1ZZ2A 2YN8A 3B8RA 2R3HA 1FGIA 3GCUA 4O7SA 2OJ9A 3GC0A 4ZLYA 1AGWA 2FSOX 4I4EA 1GIJA 3HDMA 2HZNA 3EWHA 3NYOA 3V5QA 4M69A 5TO8A 5BVWA 5D7AA 4ANBA 2QCSA 4E5WA 5IQEA 5FUTA 4IZ7A 3R8VA 5AUWA 3NS9A 3DZOA 4U79A 2ITVA 4XHKB 2BROA 4ALVA 5E92A 4BTMA 4D2RA 4BDJA 2XIKA 2BDFA 3NR9A 3C4FA 3K2LA 5FTQA 4FSTA 4RPVA 4A9UA 3AC2A 2UVZA 3NCGA 2WTKB 3OXIA 4O0TA 3SXFA 4UMUA 4KIOA 4JIKA 4Z3VA 3D14A 5LMAA 4IVCA 5IISA 3S1HA 3KKVA 3WF5A 5G6VA 3PG1A 3C50A 3HECA 5AV1A 3FZ1A 3UBDA 5EW9A 4DE4A 3ETAA 4FSRA 3BU5A 5AV2A 4IAZA 4ANSA 3RPSA 1DI9A 3TUBA 1E1XA 3HL7A 4O0XA 3PZHA 5IPJA 3MVLA 4EUTA 5D41A 2V0DA 3VBXA 5LARA 4HGTA 2YEXA 1XQZA 5J5SA 4F4PA 1OL1A 4ERWA 3VHEA 3BHHA 4IM3A 5C4KA 1YXXA 2IVSA 4FA2A 4Z7GA 5IQIA 4BDEA 2R7IA 4LRJA 4PDSA 4AG8A 3CJFA 4FOCA 3D4QA 2R0IA 4G6LA 2RFNA 4PNIA 4YC3A 3C1XA 1J91A 4QMPA 1MQ4A 5I3OA 4LUEA 1BLXA 1GY3A 4YGAA 3C4CA 3FLNC 4F64A 4YSJA 1MRYA 2W1DA 5M4FA 3QRTA 3RAIA 1Q8UA 2P2HA 1SVEA 5GJFA 4XP2A 3R7OA 4K8AA 3ERKA 3LCTA 3MB7A 2HOGA 3PE2A 2IZTA 5C8MA 3EFJA 2Z02A 2JDVA 2PVKA 4DF3A 1G8AA 3FXWA 2IN6A 3V5LA 2FA2A 4FKSA 3PWYA 4O7NA 4OTQA 5ETAA 5GZ9A 2ZDUA 4O81A 3PVWA 1MQBA 4GL9A 4HNFA 2R3IA
chains in the Genus database with same CATH superfamily
4UWYA 2X4FA 4JVGA 3PY3A 3O8PA 5DBXA 3CJGA 3KU2A 4DT9A 3H0ZA 1JVPP 2XH5A 4XG8A 4FZ7A 4C3FA 1YXUA 2XBAA 2JEDA 2VO7A 2XCHA 4FTMA 3SQQA 4DGNA 3UDTA 3ZXTA 3LJ0A 4IXPA 3QHRA 2XEYA 3Q9YA 5F95A 4BZNA 2QOBA 2UZVA 4M15A 3D94A 3LOKA 4W4WA 5ITAA 3L8PA 2PULA 4RT7A 1H00A 4DEGA 3SOAA 5HTIA 2C5NA 3UOHA 2ZB1A 3COHA 4TL0A 4YTHA 3JYAA 4IE9A 4NU1A 4I0SA 4OTFA 2F2UA 4LGHA 4RIYB 4M13A 5JK3A 1M2QA 2JDSA 4ZTQA 3TL8A 4XCUA 2Q0BA 3SXRA 4CG8A 1UNLA 2VWIA 3DDPA 5FBOA 5EHLA 4MVFA 2RFSA 3F69A 4CEGA 3QWKA 3EQFA 4C35A 2B4SB 1P14A 1OMWA 3EOCA 1G5SA 2VX3A 3II5A 2X9EA 5FDXA 2OIBA 3QTUA 1B39A 2VV9A 4X2JA 2VAGA 3KY2A 2OZOA 3KREA 1VYWA 3BWJA 3BBWA 3H30A 4Q5EA 5J1WA 1ZY4A 3PIXA 3QC4A 4ENYA 3E8NA 3QXOA 3N4VA 4E7WA 2RGPA 3NPCA 3QLGA 2A27A 3D5VA 4R3RA 4D55A 3ORKA 3L8VA 5IDNA 4S31A 5ANOA 1KE7A 4WNMA 3MI9A 4OAVB 3MH0A 2RG6A 5HBEA 4XUFA 3AXWA 3V8WA 4Y46A 3RNIA 5HD4A 3ZC6A 1JPAA 1H08A 2GNIA 3FI8A 5DNRA 3MH1A 4PWNA 3BX5A 3IKAA 3BGPA 3S2PA 2GNJA 2Z7SA 3SRVA 1FVTA 2QO7A 5ANIA 4D2PA 4HW7A 4WRGA 3QWJA 4LL0A 1SVGA 5AR8A 4ACGA 4BCOA 3LQ3A 2YERA 3R63A 4BHNA 3GFEA 5L6PA 1APME 4KA3A 2BKKA 1W2FA 2HAKA 5HORA 5J1VA 5LVOA 4PTCA 4HGEA 3TN8A 3DXPA 3P4KA 4UY9A 3VS0A 4YTCA 4GK3A 4U8ZA 1YWVA 3ZSGA 4XG7A 1Q62A 3FLYA 2AC5A 4GVJA 3Q2MA 2J4ZA 4MBIA 4NIFB 5ICPA 3T9IA 3OEFX 4YNOA 3U55A 5ACBC 5JZJA 2QC6A 2XRUA 4YUQA 4ASEA 1UU8A 2A2AA 3GGFA 1HCLA 1R0EA 2BDJA 4FV7A 1R0PA 5AUUA 5M08A 1FGKA 5HQ0A 4Y72A 2OZAB 3R22A 5DRBA 5M4IA 3VNTA 4MWIA 2JAMA 4BB4A 4WBBB 4TYHB 1ZOEA 2R3QA 4HZSA 4S32A 4YZMA 5HLPA 3N4UA 5HTBA 1RQQA 4EI4A 2O2UA 3MB6A 3ATSA 4GFMA 2IZRA 3UG2A 3COMA 3GXLA 3U9NA 3PIYA 4RVMA 3B2WA 4QQJA 4I92A 4JG6A 2FSLX 4ZY6A 5JMSA 4DH7A 2VO6A 2WKMA 2YJRA 3EQDA 4EUUA 2FSMX 3A4PA 4RIOA 4O4CA 5FGKA 3ORXA 1OECA 4DEDA 3WF9A 2R4BA 3CC6A 3PYYA 3OCTA 2XIYA 4ANNA 4FKUA 3KULB 3I1AA 4IB3A 4IC7A 2OFUA 2DYLA 3QD3A 3RAKA 4XYFA 4JMQA 1YI6A 2XCKA 1O6LA 1MP8A 2WTJA 4PP9A 5CZIA 3ODZX 3R7UA 2OF4A 3ZLSA 1ZOHA 2ITWA 4G5JA 4HCUA 1OPLA 3BLHA 5FM2A 2ACXA 3FHIA 3OWPA 4FTTA 4FNXA 3VAPA 4BCGA 4NZWB 3V8SA 5LVLA 3UZPA 4IFGA 4DDGA 3FYKX 3HGKA 5FLFA 4RWKA 3BU6A 3EN7A 1UWHA 3OG7A 4U42A 2R2PA 5DOSA 1Q3WA 3VBQA 3ZTXA 3AG9A 4P2KA 5I9WA 3R9DA 4CKJA 3JS2A 4RIYA 3FZRA 3RCJA 3O2MA 4PMSA 4OBOA 1UV5A 4XBUA 1W98A 4K1BA 1ZWSA 4QTCA 1ZYJA 2FO0A 2OFVA 3W2PA 3B8QA 5GNKA 4G17A 2EU9A 2VTHA 3UO5A 3LFDA 3AKKA 4KB8A 4AWIA 2YM5A 2BAJA 4CRLA 2ZV7A 3CGOA 3BQRA 2PVNA 3VUMA 4CCUA 2ZM3A 4IAFA 4K33A 4NFNA 3D2IA 3AT4A 3F2AA 4EOLA 1FQ1B 4IZ5A 5E8UA 4OTDA 4D2SA 1URWA 3KN6A 1KV1A 2VWXA 4NW5A 5IF1A 2UW7A 2Z2WA 3LM0A 2ITOA 3VUGA 2UZOA 3W2OA 4Y5HA 4YJOA 4PMPA 4ZY5A 5JFXA 4BCHA 2YIQA 2X8DA 3F5UA 5ANEA 4IJ9A 2W4KA 2XJ2A 4NW6A 5ETCA 1IA8A 2C0TA 2XRWA 4A9SA 4EL9A 4QP2A 2ZDTA 2ZM1A 3DBEA 3UMWA 5LMKC 4I23A 3MFSA 5BV3A 1ZYDA 3MH3A 3AC4A 4GJ2A 2XIRA 1ZYCA 5BVEA 3EN6A 4AQCA 3O7LB 4FZFB 4AOJA 5AR7A 4Z9LA 2OXXA 3SD0A 4RX7A 5HX8A 2OLCA 3KRJA 4DHZA 4GG7A 4CQEA 3WZUA 2BIKB 3OWKA 5CVFA 5IA3A 2CGVA 4FT0A 2GNHA 2B9IA 3AC3A 5LJJA 5CEOA 3I4BA 3R7YA 4OAUC 3A7FA 4NM3A 3FKNA 4KKHA 4QYHA 4NIFA 3LMIA 1ZYLA 4MD9E 2XJ1A 4QMNA 2X7GA 2FB8A 5LMBA 4IX6A 5A46A 1YOJA 5CEMA 1BL6A 4Q5HA 4EHEA 2WHBA 1TQPA 1BL7A 2R0UA 3DDQA 3JY0A 1XBBA 3PSBA 2HK5A 2VUWA 4L9IA 4QD6A 4YP8A 1WVYA 2OZAA 2JAVA 3PJ1A 3TV4A 2NPQA 3PY1A 4QMOA 1MRUA 2UV2A 4B8MA 4TYHA 4CZYB 4RMZA 4DGOA 3I7BA 1CKJA 1OL7A 1U5RA 3ENHA 4YJVA 3ACKA 1W2CA 2J0JA 2GS7A 1VZOA 1Y6BA 4MXAA 4AGWA 2BZIB 2WQNA 4YZBA 1BMKA 3TV6A 3PWDA 4KKGA 4XG2A 5AADA 4JQEA 3ZC5A 5E8YA 5EQYA 4FV4A 1VEBA 4BI2A 4QMVA 4HVGA 4FVPA 1KOAA 4CCBA 2V5QA 4USFA 3V5PA 2B9JA 2YCQA 1P2AA 5DEYA 1WAKA 3QUPA 3P7BA 4NWMA 4MNEB 4CLIA 3W16A 3SAYA 3RMFA 3KULA 3RI1A 3WOWA 2CKOA 2JBOA 4AUAA 4XH6A 2OWBA 2W96B 3DNEA 3QKKA 3ATTA 3IW6A 4JX3A 3WE8A 4AFEA 3DV3A 3HUCA 4BCFA 4UN0C 5M09A 4UWCA 3EQCA 1V0BA 3IDCA 4O0WA 2J51A 4L44A 4S30A 4ZEGA 5JSMA 2IW9A 1XR1A 2YZAA 3G90X 3L8SA 3PPJA 4EBWA 4EQCA 2OBJA 2W99B 2NP8A 2C0IA 2E9OA 3UQFA 3FZTA 4YZNA 4U81A 3ZO1A 3W0OA 5C27A 4DHFA 3DQXA 1WBVA 4U7ZA 1V0OA 3DT1A 1K2PA 2UVXA 4QP9A 5J87A 3TMOA 5HGIA 3RBWA 3FZSA 3FL4A 3PY0A 3CTQA 5CSHA 5E90A 3VS2A 3NVKI 1LEZA 4C4FA 4L00A 4U97A 2W1HA 3N51A 2OG8A 1A48A 2R5TA 2VX0A 2V55A 3EQHA 4Y83A 2J0IA 2REIA 2X1NA 2C3KA 5KMOA 1O9UA 1U59A 4Y8DA 4E8AA 3PIZA 4LUDA 3ITZA 2GQRA 2XB7A 2FUMA 4IJPA 5HTCA 4IIRA 3CBLA 4BIEA 5I5ZA 1BKXA 4HJOA 2GDOA 2C6IA 3ROYA 4FT3A 3H9OA 4RC4A 4QPAA 3WF8A 5EDRA 5J9YA 2ZMDA 5CSPA 4R6VA 5AMNA 1YWRA 3IS5A 4EORA 5EQEA 2FSTX 4G3GA 3TUDA 4IWPA 2WB8A 4RJ6A 4DTBA 2H96A 2W17A 3QUDA 3SVVA 4HVDA 4UV0A 1B38A 4BDAA 3CP9A 3HV6A 4M7IA 4WT6A 4E6QA 1Q8ZA 3KXHA 4QEBA 5IG1A 4FV2A 3R8PA 3GC7A 4CD0A 3BYMA 3PPKA 4U80A 4J97A 5KO1A 2ITQA 5KE0A 4ZS4A 4QNAA 4EHVA 2XALA 3MY5A 2H6DA 1KE9A 4WNPA 5HE1A 1RE8A 5AIKA 2PPQA 4EWQA 4RVTA 2ETMA 2VTLA 2UZBA 3CQEA 3MTLA 5F9EA 3HNGA 3C7QA 4D4VA 4KSQA 4Z55A 1OBGA 3LJ1A 4NM5A 2W1EA 2HZIA 1BX6A 4R77A 3FLSA 4HCVA 3FC2A 4NKAA 3UNZA 4J8MA 4IEBA 3D7ZA 3TNHA 1G3NA 4V05A 5EG3A 2F49A 2NRYA 2GHMA 2X4ZA 3TJDA 5L2SA 1KE6A 2QR7A 3PDTA 3EKKA 3FMKA 5CWZA 3VRYA 2UZDA 3BE9A 2WMBA 3POZA 3IQ7A 3SA0A 4GKIA 4U5JA 1JQHA 5DVRA 1GAGA 2ZYBA 5JFVA 4FT5A 2A0CX 5M55A 3DTWA 2QOOA 3FZOA 3N9XA 5EDPA 2ITXA 2XK4A 3HRCA 3TV7A 3VW6A 5C4LA 2I0YA 2J7TA 4F70A 5AJQA 5FDPA 4ZJIA 3FBVA 3GCPA 2XYNA 3ELJA 4KNBA 1JKKA 4LM5A 4E93A 1BYGA 4N4SA 3BYOA 2QO9A 5FBNC 2UZLA 2ZMCA 3COKA 3F2NA 4XOYA 5CT7A 3C51A 4EEVA 4KUJA 2PU8A 4QMTA 2W4OA 2C30A 4YO6A 4LRMA 3LIJA 5IU2A 4G2FA 4RIWB 3BV3A 3NYVA 2BPMA 2NO3A 3AT2A 2LAVA 3NDMA 4ZSLA 2X39A 4CFVA 3G15A 2ITNA 5K0XA 3MY1A 2IPXA 3V5TA 3IK3A 4A7CA 4RA5A 4CT1A 2PHKA 1JBPE 5DEWA 4ZXTA 3CEKA 4L7FA 4QTBA 3IW4A 3ZMMA 3PPZA 5M56A 1JSUA 2VWBA 2ZB0A 4IM2A 5J8IA 4JJRA 3KXMA 4AU8A 4UMRA 3DAEA 4EONA 1Q3DA 3UQCA 3Q6UA 1OGYA 1ZMUA 4YMJA 3NEWA 5FD2A 2Z7QA 2KULA 2G01A 2EB2A 4I93A 4C36A 4DBNA 4F7JA 4ZMFA 5JKGA 1B6CB 5KZ0A 4JDIA 4UYNA 4EKKA 1ZOGA 4GMYA 3NLBA 4F9YA 3UGCA 2B7AA 4BN1A 2GNFA 3BLAA 2ITZA 1W0XC 3KIOC 4I5CA 3NRMA 4PRJA 1K3AA 1K9AA 5HX6A 4I5MA 4QMXA 3EB0A 3R7VA 4DN5A 3CGFA 2UW4A 4YJNA 5J5TA 4X0MA 3FL5A 1PYXA 3V04A 4NFMA 2C5OA 2Z8CA 5A4QA 5J9LA 4QOXA 4GYIA 5HU9A 4BF2A 2ETRA 3EZVA 4KAOA 3QA0A 4IX4A 4OBPA 4MUQA 1ZYSA 5DH3A 4BBMA 3U54A 2X6EA 3A8XA 3UOJA 2OICA 5EM6A 2Z7LA 4ZTNA 4MK0A 3LLAA 2GMXA 3OW4A 2GNLA 1YWNA 5TF9A 3FMJA 5CAUA 1ZY5A 2Z7RA 4FEVA 5CLPA 1E1VA 4Y95A 3WIGA 4C3RA 4FTCA 1OUKA 4RIXB 3AMYA 4QP3A 4FMQA 4LGDA 4YTFA 4YC6A 5K5XA 3CXWA 5IDPA 2BFXA 3TNWA 4FTOA 3LVPA 5HG5A 3TNIA 4WOVA 2YM3A 3DK6A 5HESA 4EH7A 2CGUA 4FZ6A 2XARA 5IZFA 4CFMA 4O7VA 2PVYA 5L2IA 2PMOX 3SOCA 5KMNA 3VS4A 4BTJA 4MD8E 4X6RA 4XBRA 4GSBA 4BJJB 4PPAA 3ZUUA 4AZTA 5IQCA 2RIOA 3ALNA 2Y6OA 5FP5A 3VS1A 2HWPA 4EK4A 3K3IA 4FSQA 4EH8A 5KMJA 5HLNA 3NW7A 5I9ZA 4ANQA 5DYJA 3A4OX 2GSFA 4TNDA 3UDZA 2O65A 4FJVA 1H1PA 3EQPA 4LMNA 2QQ7A 4RWJA 4EZ7A 2J0LA 4FYNA 4FV1A 4H3BA 1NVQA 2I0VA 5H2UA 2YDJA 2VU3A 3QCSA 4GCJA 4O82A 5F4NA 4FX3A 5J95A 5BMMA 2AEGA 4C7TA 1NW1A 4UXQA 3MPAA 3JY9A 2JGZA 3ULZA 2PWLA 3OUNB 4DEHA 4QPMA 4O96A 4L67A 3P7AA 5CU6A 2UVYA 1JKSA 1R1WA 2W1CA 3PSCA 1SYKA 3MFTA 1GZOA 2IF8A 3AOXA 4TZRA 4I6QA 4XG9A 2UW0A 4GJ3A 4M0ZA 4GIHA 2V62A 4L68A 4BDBA 3DCVA 4JAJA 5CX9A 2R3JA 1PXNA 1R39A 3CY2A 4NM7A 4OT5A 5IEVA 2IO6A 3QUEA 3SG9A 3UIBA 1T46A 2VTNA 4JX7A 5D1JA 1CKIA 2F7ZE 3NW6A 3GC9A 3OOMA 3TTJA 5FTGA 2XNBA 2ZJWA 2VWVA 4RIWA 3PG3A 4IX5A 5H9BA 2O3PA 2XMYA 5JEBA 3LFBA 2Y6MA 1YI4A 1M7NA 2BHHA 3OMVA 4ZOGA 3PA3A 4J8NA 1WFCA 2IVTA 3AGLA 4CFFA 3DB6A 4UXLA 1YHSA 2OIDA 3FHRA 1OIYA 2B52A 4UYAA 3D5WA 1BUHA 4TN6A 4G16A 4AZFA 3IW8A 5H8GA 3FE3A 4HVSA 4H58A 3RINA 3T3UA 2DUVA 4QQCA 1OI9A 4G3DA 3UIUA 1U46A 2R7BA 3Q4CA 3QD2B 3WILA 5GINE 2OF2A 3K5UA 5HZNA 2QG7A 5BNJA 5HBHA 2F2CB 3HA6A 5HU3A 3AC1A 4KIKB 4MQ2A 5BYZA 2WEVA 2HY81 1YXVA 4RVLA 4BDHA 3C4XA 4FZDB 4W9WA 2WMQA 2X2KA 3DKGA 3LFQA 5LMKA 4C37A 2X0OA 5A4LA 1WBSA 3RPOA 4GU9A 3V51A 2QNJA 5DA3A 4ITJA 1UKIA 5LVPA 2GCDA 4DG2E 3GOPA 2BZKB 3GI3A 4CYJA 3MA6A 4BCKA 4BICA 2YIXA 5CAQA 4AXCA 5L8KA 4FL3A 2OIQA 4YTIA 4AW0A 4OT6A 5F20A 5HEZA 3ZZWA 3NX8A 4IVAA 3W18A 4MF1A 3UJGA 5JRQA 1Q4LA 3QCXA 4O4DA 4PTGA 4YZ9A 2P0CA 3SRVB 3A60A 4YSMA 1YDTE 3CPCA 4JR3A 4FL1A 5DT4A 4EK8A 1XMLA 4AXFA 4NL0A 5KMLA 4AZWA 3HMPA 2W1IA 3P79A 4ZTRA 3DY7A 4ANLA 4QP7A 2YAKA 4E3CA 4HCTA 4XRJA 1UU9A 3NIEA 3T8OA 2VWUA 5E7RA 1SNXA 4RX5A 4IDVA 3VBVA 4RIXA 5B2LA 2VTMA 5CU4A 2O63A 3QKMA 2J6MA 4YJSA 5KMMA 4HPUE 4O7LA 3OROA 5CEKA 4I6BA 2QR8A 1ST0A 5AX3A 5AWMA 5EKNA 5HBJA 3FI4A 4F9CA 4B8LA 1M2RA 4TYGA 1S9IA 2PUUA 1JOWB 4FKTA 3ZSHA 5M4UA 4HZRA 4JT3A 5DR6A 4BJJA 4FRFA 4RRVA 3ZFXA 5HVYA 5AM6A 4F0IA 4WNKA 3HEGA 4RJ5A 5HD7A 2GTMA 3TTIA 2YITA 4AX8A 3FYJX 5KHWA 1IASA 2P2IA 1HCKA 1MUOA 3KVWA 3QTZA 4NH1A 5HO6A 2IW8A 3Q04A 5A6OA 5K4IA 3G9LX 3MPTA 2R3OA 1ERKA 3RHKA 1Q99A 1OIQA 4C0TA 5AV3A 4DHIB 2AC3A 2OJJA 2VRXA 5HHWA 3LFNA 3VN9A 5IA5A 4QMWA 4R78A 4QMQA 3W8LA 3HLLA 5TT7A 3ZYAA 4II5A 4CV9A 5CQUA 4EJ7A 5AP7A 4CSVA 2W05A 3DOGA 3RK7A 3OW3A 4C02A 3OCBA 5CNOA 4ZTMA 3SW7A 2WMTA 3F82A 3RHXA 3NWWA 3G51A 1PW2A 3ANRA 3AQVA 2YABA 3DBQA 3UIXA 4QRCA 4ZS0A 3OTVA 4MQ1A 2BZHB 5B2MA 2XNEA 4FTJA 3GBZA 5EYCA 4E20A 5L2TA 4O7ZA 3BLRA 2JBPA 3MFRA 3Q4UA 3HKOA 2YCRA 3PXFA 4RQVA 1GIIA 5CU3A 3V3VA 3TYKA 3QTWA 3PJ8A 5TR6A 4HYHA 2XUUA 3A61A 4I21A 1IA9A 3R04A 1NVSA 1W2DA 3R73A 4ERKA 1Q97A 4JBPA 3F88A 2CKEA 3EJ1A 4M3QA 4IACA 4ONAA 4IC8A 1ND4A 4WSYA 5DT3A 1F3MC 3DK7A 2QHNA 5CAPA 4QYYA 3RTPA 3D15A 4GV1A 3VS3A 5CI6A 3FMLA 3BYSA 3KK8A 4B7TA 1E9HA 4E6CA 4X2FA 3HUBA 4R7BA 2PE2A 2RFEA 3POOA 3BQCA 5FG8A 4B0GA 4KIKA 1PXMA 4MH7A 3KK9A 3OT8A 3P86A 5HE0A 4C57A 4J71A 5C8NA 2WEIA 2QKWB 5I9UA 4ASXA 5C9CA 3MIYA 5LVNA 2SRCA 1FOTA 3KF7A 1V0PA 2LGCA 4QDEA 3LMHA 3FC1X 2C5XA 3C4EA 3VBYA 3LQ5A 3ORLA 2CNVA 2PVLA 2BTSA 2PVHA 4EH4A 5JQ5A 5AR4A 3O50A 2G1TA 2WOTA 4FE2A 3OF0A 3QAME 3FLQA 4LV5A 4FKJA 3L8XA 4MXOA 3KF4A 4AN9A 5LWNA 2W5BA 2B9HA 3F7WA 4G9RA 4D5HA 5K9IA 1REJA 4WO5A 4PL3A 2VNYA 4H1MA 1KE8A 1QPJA 1FVRA 3NW5A 5I4NA 3FMEA 4AQKA 3L9PA 3QL8A 3NIZA 4D4YA 5HICA 2XK8A 2CKPA 4ARKA 4IMYA 3GC8A 4M8TA 2C3IB 5C8KA 4TTHB 3HMNA 2BCJA 3UTOA 4CKIA 4O6EA 2BTRA 2WIPA 5D11A 4AT3A 3E5AA 4UBAA 1J1CA 5KUPA 3SDJA 4LYNA 5AUZA 4O21A 4EOJA 3R9RA 3R1QA 5DT0A 3QQLA 5FEDA 4BCQA 2YIWA 1I09A 3DJ7A 4H05A 2CMWA 2I1MA 4A9TA 1DM2A 3R01A 2X7FA 3GU4A 3MH2A 4CXAA 3FUPA 3BIZA 4QP6A 3V8TA 4ASDA 4FOBA 3RK5A 5M53A 3O71A 5F94A 5DI1A 5CQWA 4QTDA 4O1OA 3KRLA 2F7XE 5AFVA 3FXZA 5EM8A 3FSFA 3C0IA 1Z57A 4W8EA 3OT3A 3R2YA 4EK5A 3DFCB 5JFSA 2JFLA 2R3KA 2YM6A 3DGKA 1H8FA 3MBLA 4HVIA 3H10A 2IZSA 4BCIA 4C2WA 3W0MA 4JR7A 4PQNA 3UPZA 1OUYA 4C62A 2FYSA 4R5YA 4D2VA 1H1SA 3O51A 5A9UA 2G15A 3BHYA 3CKXA 1UA2A 3KXGA 3PVBA 1VLRA 3LLTA 5AP6A 3RJCA 1PXJA 2C6KA 3WZKA 1ZARA 3MS9A 4GT3A 4KSPA 5M4CA 3MVJA 2PYWA 4FV3A 2G9XA 5AAFA 3QX2A 2R3FA 5AX9A 3UYTA 3OZ6A 3RZBA 4LGGA 2X8IA 4AW2A 4JS8A 4BKZA 1NA7A 2UW3A 3SHEA 4O83A 3S00A 1DAWA 5IA0A 2PZ5A 1YVJA 4ANOA 3QTXA 3BE2A 3LJ2A 3R28A 3PJCA 2OK1A 4OR5A 4XOZA 4DEAA 2A98A 3KCFA 2BRHA 4FTLA 4QTAA 4D1XA 1Y6AA 5AEPA 1QMZA 3KGAA 4AA0A 4KBCA 5FEQA 2PVFA 3HRFA 3MDYA 4QMMA 4FTKA 2PZRA 3GP0A 1URCA 4MWHA 5EH0A 4ZTSA 3BI6A 2PZYA 4DFLA 4PTEA 4JQ8A 2AYPA 3R7IA 3WZEA 4DDIA 2OJGA 4QTEA 1TZDA 3E8CA 1U54B 1PMVA 2EWAA 4QYEA 3QTRA 3F7ZA 3EQBA 2JIVA 4I3ZA 2UW8A 3UQGA 4CT2A 5B0XA 4DH3A 5JH6A 3UVQA 2JDRA 3KMMA 3LMGA 3NSZA 2B9FA 2PVJA 1JKTA 4I4FA 4M68A 1OPKA 4DGMA 3C5IA 5EM7A 3KL8A 1Q5KA 3FQHA 3KMUA 1WVXA 4RJ3A 1ST4A 2BDWA 3T9TA 2GTNA 5IEXA 5IQFA 4O1PA 1OL6A 2WMAA 3F5GA 2IEWA 3V5JA 2CHLA 4DHJA 3GENA 1GJOA 4H1JA 4H3QA 4RGJA 4UB7A 2WMXA 2PZPA 2ZV8A 3FSKA 4YLKA 3E62A 3NNXA 4XLIA 3RKBA 3ZO3A 3GU5A 4RQKA 1OITA 3UODA 4XP3A 4GG5A 4L46A 3E3BX 4WNOA 4U6RA 5KCVA 4D58A 2A19B 5EI2A 4D1ZA 4LV7A 3RVGA 4FSWA 3GOKA 3MA3A 3MW1A 5E1SA 4DH1A 5E8XA 3AC5A 4GVAA 3UPXA 1H1RA 1J7IA 3VULA 1XKKA 3ORNA 2GNGA 4FICA 5IA4A 4EWHA 1WVWA 3DBDA 1IR3A 3HVCA 4FIIA 2V7OA 4MX9A 2WMWA 4D28A 4YLLA 3LCDA 2A1AB 3VQHA 3W55A 3NFGB 2J5FA 4R7HA 3CQWA 4IM0A 2BILB 3D7TB 4TRLA 4V04A 3AD5A 3L9LA 3TUCA 1OB3A 1W82A 3U87A 4C4IA 2O5KA 4W4XA 4D4RA 2Y9QA 2ZV9A 4DFZE 3ZM4A 1Z5MA 5A4TA 2YACA 5IQAA 4MCVA 5AR2A 1Y8YA 1I44A 1WMKA 3WARA 2C6OA 1FBNA 2CNUA 5HCZA 3QQKA 3EFWA 3FMDA 3Q5ZA 3EKNA 3KXZA 4NUSA 3LPBA 4FG9A 2R9SA 3R9OA 3FLZA 3GQIA 4EC8A 4YJQA 3FQSA 1OZ1A 1UU3A 3RAWA 4KABA 5K3YA 4BKYA 5E8SA 3RP9A 4FTRA 4AT4A 3BPRA 3LFSA 4OGRA 4AZSA 4ZY4A 2BUJA 3UVRA 2YCSA 1IG1A 1SMHA 4M0YA 2QOHA 3JUHA 4I6FA 3JXWA 5IQHA 3ALOA 4W9XA 2EVAA 1QL6A 3A8WA 3DKFA 5DHJA 3EQRA 3ZOSA 5GZAA 2E9UA 4I0TA 3Q9WA 4CGAA 3P9JA 3O8TA 5EW3A 4N57A 4P5ZA 3U8WA 1HOWA 1XH6A 5A6NA 2XJ0A 3AGMA 3LFCA 2QOLA 4TT7A 5HIBA 5A4CA 3D83A 5E8WA 3QYWA 3LFAA 2GQSA 1F5QA 2R3RA 1PXLA 3L9NA 3QZIA 2C6LA 3R21A 5CENA 3ZH8A 2OH0E 3FZPA 4GT4A 4ITIA 4Y5QA 3WF7A 4DINA 4XMOA 4JDJA 3JVRA 2RFDA 4FNWA 1PMNA 2E9PA 2HENA 4QMLA 3WE4A 3VUKA 3O5AA 4L7SA 1AQ1A 3I5NA 3LCSA 4K9YA 4BZOA 4Z16A 1G8JA 4IH8A 2RSVA 4JRVA 3VO3A 2C6MA 3BGZA 1YHVA 3W2RA 2OH4A 4DFXE 1ZMVA 4JG8A 2YM7A 3SG8A 1G8SA 5LCJA 3M1SA 2PVMA 4EZ5A 3IECA 3P08A 3IW5A 4FIGA 1U54A 1QCFA 2YJSA 3ACJA 4PDOA 3PTGA 5AP1A 5AP2A 1PRYA 3P5KA 2XNNA 3QQHA 4ZLOA 4FKLA 1J3HA 2RG5A 2ZM4A 3G0EA 2OI4X 1JSVA 4FV0A 5TE0A 4C3PA 2VTTA 4F9BA 3DZQA 5F1ZA 4YURA 3W0RA 3QX4A 3HRBA 4L8MA 3L9MA 2VGOA 4L42A 1M52A 3BRBA 2B1PA 4CFUA 3W2CA 3ORMA 1M14A 5EKOA 3PXZA 4BCPA 1KV2A 2YHVA 2BRNA 2VTAA 4AS0A 4EH3A 3SV0A 4GUBA 5E8TA 3PJ3A 3UO6A 3Q5IA 3QLFA 5D9HA 2VTJA 2EB3A 2HZ4A 4CZTA 3TWJA 1VJYA 3D5XA 5FP6A 3RAHA 5HOAA 4HOKA 4IB0A 3E87A 1OKWA 3GNIB 5CU0A 4D2TA 4A4OA 3W0SA 2VO0A 4G34A 4L3JA 2UZUE 1ZXEA 3ZFMA 3P7CA 3H0YA 3H9FA 4WG4A 3FDNA 4E4XA 2WTWA 3OBJA 5CTPA 3R8ZA 4N70A 4RJ4A 5CNNA 5GJDA 3K5VA 4FKPA 3GUBA 3ZXZA 4F9AA 4JI9A 3VS6A 2A4LA 2VTPA 3BHTA 4KIPA 1PMEA 2C47A 5AV0A 4E1ZA 4EYJA 4PMMA 3MYGA 5LVMA 4CFWA 4X6QC