2Y9QA

Crystal structure of human erk2 complexed with a mapk docking peptide
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
350
structure length
349
Chain Sequence
AGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 1
publication title Specificity of Linear Motifs that Bind to a Common Mitogen-Activated Protein Kinase Docking Groove.
pubmed doi rcsb
source organism Homo sapiens
total genus 120
structure length 349
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2y9qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2y9qA01
4JRVA 4L45A 5IQEA 2YACA 4GG7A 2W1DA 3P5KA 4CKJA 4GW8A 3MFTA 5I9WA 2GNFA 3NGAA 4OLIA 4RA5A 4RJ4A 4FTIA 3PG1A 3WYYA 4QP3A 3QCQA 4FBXA 4GIIA 4FTQA 4MTAA 4NJDA 4PTEA 5D1JA 4C34A 4KRDA 2UZOA 3DAJA 4NZWB 4LOPA 4E6DA 1L8TA 2JIVA 3JPVA 4XP0A 4ZSEA 3TNIA 2GTMA 4DH5A 3IW8A 1XBCA 5KKRB 2BDJA 4I23A 2A0CX 4XRLA 4J52A 3C4ZA 2FYSA 4OTDA 5C8MA 2G15A 3QFVA 4O0WA 3V8TA 3QL8A 4EZ5A 3KRWA 3TM0A 5JRQA 5B2MA 2WFYA 1KV2A 4TWOA 3EFJA 5IA0A 2W1CA 4CZUA 4F6WA 1TKIA 3EN9A 3OS3A 3E3BX 5AUZA 3DTCA 2BRGA 4ANOA 5HEZA 3IECA 3TNWA 3D9VA 3VC4A 4CVAA 4FEVA 3K3JA 3KA0A 1MRYA 4RSSA 4UV0A 4EL9A 4PX6A 5LWNA 4TRLA 2F9GA 2XEYA 3RAHA 3G0FA 3QD0A 4C2VA 4YGAA 4LRMA 5KMOA 2ITZA 3ZM4A 4BWXA 2Y0AA 5D9HA 4AQCA 3PJ2A 2UVZA 3CY3A 3HV3A 4BWKA 4PNIA 4IACA 4XG4A 4R6VA 2R3RA 4AA0A 1FGIA 5DEYA 2ITTA 4ACCA 5HORA 3LKMA 3D14A 3O8PA 4TNDA 4DEEA 3QKKA 5FRIA 4QP6A 4NKAA 5EKNA 5J9ZA 3ZUTA 5KMNA 3ETAA 2HENA 3PP1A 3Q4TA 4D58A 4FK6A 3EH9A 4XJ0A 3TTIA 1ZARA 3R6XA 4G3EA 4KSPA 4BC6A 2GQSA 4RGJA 4NH1A 4BCPA 2F2CB 3QHRA 4JBVA 4ASEA 1OL6A 4AZFA 1PKGA 2JITA 4BCMA 4TW9A 3OWKA 4GS6A 4AXAA 2H96A 3Q04A 4M13A 1PJKA 2XJ2A 3R63A 3G0EA 3QYWA 4FA2A 3NNUA 3OHTA 5CF5A 4DTKA 1UNGA 4O7LA 4EUUA 5FTGA 4DEBA 1Q97A 3DBQA 4JAJA 2X8IA 4RJ3A 1YWNA 2YCSA 1KOBA 3QQKA 3TL8A 3LHJA 4M97A 4UMUA 1TVOA 1UU7A 3R1NA 5FDXA 4U3ZA 5AP2A 3UOHA 3DQXA 4KBAA 4D2VA 3TDVA 2JAVA 4K77A 1SZMA 4NCTC 3W16A 3UQFA 3LFQA 3ORKA 5IG1A 3PLSA 1ZOGA 3MH2A 5EK7A 3HMIA 2PE2A 3NR9A 4CRLA 4LV8A 4HNIA 5AX3A 3DK3A 5DR6A 3GEQA 3F61A 4D2RA 4C0TA 4PTCA 5TOZA 3HAVA 4M0ZA 3ZRMA 4O7TA 2C3LA 2ITVA 3LXLA 1K3AA 3P9JA 5E1EA 5EDRA 5HVYA 4ITHA 5LVLA 3V51A 4C36A 1JQHA 3HRBA 5M4CA 5JK3A 4DEGA 2A19B 3QAME 3FSFA 4BZNA 4U97A 4MD9E 4M66A 2J90A 5BVEA 4EQCA 3P7AA 3QLGA 4NTSA 4FOBA 3VUDA 4I3ZA 3UDBA 2KULA 4E26A 2X81A 4NIFB 4NCTA 4BDDA 1B6CB 4FTKA 4FG7A 3TV7A 3DFCB 3MFUA 1Y91A 5L8JA 3ZC5A 4PQNA 3W10A 1R0EA 3PPZA 4BDCA 3TUDA 4M69B 2VTTA 4FTLA 3LCOA 3LCSA 5ANIA 3ZXZA 4D2SA 3BI6A 3JXWA 3GFEA 3BPRA 3IQ7A 3F7WA 3R7VA 4EZ3A 3E88A 1XH8A 3CIKA 3U6JA 1P4FA 2F2UA 4AGUA 4A9YA 2PU8A 4X2NA 2W5BA 3SW7A 2GS7A 4WOVA 2R3HA 2BZIB 3DBFA 2V22A 2XS0A 1A06A 3MPTA 1Y8GA 4QMOA 2IVSA 3H9FA 3PUPA 3EQCA 3PA4A 4GK3A 5A14A 1FQ1B 1J7LA 4AZTA 4G6NA 4GU9A 3SHEA 4M69A 2V5QA 3DFAA 3FSKA 3QYZA 4IX6A 5BUEA 3N9XA 3PVWA 4X2FA 2Z60A 4MH7A 2R64A 3D83A 3O96A 5HIBA 1A48A 3KU2A 4DITA 3SOAA 1G8AA 3A61A 2ZB0A 5HQ0A 2VZ6A 3WF9A 3ENMA 3KK8A 4AFEA 3U9NA 4FKOA 4DGMA 4MAOA 3AT3A 2YEXA 5BVWA 3MB6A 4OTGA 1S9IA 3D0EA 3RM7A 3WF6A 2WEVA 2YIRA 3IW5A 4RFZA 2YIQA 4DINA 3LLTA 3OXIA 4D2WA 3CKWA 1F0QA 4MXYA 4C3RA 2ZJWA 4R8QA 1Q99A 5T3QA 4ANNA 2VX3A 3EN4A 3UIUA 5T6KA 4MHAA 3O2MA 4L3LA 2H34A 4D1SA 5FXRA 2QOQA 3HUBA 2B55A 4FYNA 4NFMA 4O1OA 2REIA 4N6ZA 3FLQA 1KWPA 4JG6A 4M84A 5I9UA 1DI9A 4YP8A 4BCGA 3FL4A 3QGWA 2X2LA 3SV0A 4OBOA 4FTCA 3SLSA 4C62A 4IX4A 2WTDA 3GUBA 4PDYA 2FO0A 3FMDA 4CSVA 4JRNA 1JKSA 4LM5A 5IUHA 4CFWA 3ZLWA 4YO4A 3CLYA 1XKKA 3FLYA 2ZVAA 1UNLA 5DYJA 3TACA 3PJ1A 5CVHA 3C4XA 4F08A 4IZAA 5JGAA 3NYOA 4OAVB 1FMKA 2NNWB 2J6MA 4AE6A 5E92A 4QMPA 5EOBA 3F66A 3KULB 5A4TA 3S3IA 4IZ5A 3Q9YA 4M0YA 4AE9A 1O6YA 4PDSA 3FXWA 5AV4A 3RPYA 2W06A 2OJIA 3FLWA 4F0GA 3OEZA 3NVMB 4QPAA 5A4LA 2QD9A 4FV2A 3F5XA 3RZFA 2W0JA 4MD8E 2QQ7A 3TXOA 3VNTA 4FKVA 3D5VA 4Y95A 3LFFA 4NSTA 1P5EA 4U43A 5AR8A 4RFYA 3FHRA 3IK3A 1UWHA 2W9ZB 3BHUA 3IW4A 4PDPA 4U3YA 2Y4IC 3AC3A 4FKSA 3EZVA 3ZFXA 4BFMA 4CFMA 3QUDA 4I5CA 2CLXA 5EQEA 5IQCA 4O1PA 3MJ1A 3ZTXA 3UP7A 1M14A 2J9MA 1LR4A 1H0VA 2R4BA 2Y4IB 4IWPA 4AF3A 4YBJA 2ZV9A 4ZY4A 5HBHA 3NS9A 3V8WA 1S9JA 3VUKA 4YPSA 3VS3A 3FWQA 2B52A 4IHPA 3V8SA 4CFVA 3HRFA 3D5WA 3QRKA 4AZWA 3F3TA 3ATSA 3B2TA 4FNXA 3P08A 3DNEA 3TEIA 5H3QA 1APME 1FVTA 3EZRA 4YZDA 2C0OA 2VTMA 4I6FA 4RC4A 2JKMA 2PMOX 3FBVA 1OIUA 4V0GA 3HECA 3NYXA 5HGIA 3TI1A 2VTOA 5L2TA 2BILB 2G1TA 4DH3A 3HX4A 5IDPA 4D4RA 4QP8A 2UW3A 4X2GA 3QBNA 4R7IA 4E6CA 5J95A 4O86A 2EUFB 2P55A 2OICA 4F99A 5IA3A 2YN8A 3L9NA 5K4IA 2VWXA 3FXZA 3BWFA 3UOJA 4UMQA 5FEDA 2CGWA 2ACXA 4KIKA 3QALE 3EKKA 3PXFA 4BWPA 2I7QA 4Y83A 5IQHA 1P4OA 4MXOA 4C3PA 4FZAB 4I4EA 2NRYA 5KMMA 3D5UA 3C4EA 3KVXA 4OBQA 5CI6A 2R0IA 3DY7A 5L8LA 2CJMA 4EJNA 2F7ZE 5KE0A 3VWAA 3FKLA 5HTCA 2EXCX 2VAGA 1XH5A 5FBOA 1PXLA 4G1WA 4PMPA 2FUMA 3LFCA 4S32A 3GU6A 2YFXA 4U9AA 4E4NA 3A2CA 1KE6A 3QTSA 4IFGA 4O0TA 2R3JA 3FLNC 4KWPA 3LFAA 3EQBA 3RINA 1R78A 3WZDA 5L2SA 1GIJA 3FI4A 4L9IA 4NKSA 4G3GA 2XJ0A 4UWCA 1JSVA 4XG3A 5LJJA 3L1SA 1W83A 4DFYA 4WNMA 3TKIA 5AV1A 3ZXTA 2HW6A 3C0GA 5JMSA 3LE6A 2O2UA 1G8SA 5F4NA 2QHNA 5J7HA 3SVVA 2VO7A 3R00A 3CEKA 3FQHA 4UALA 3HUCA 2IVTA 5E1SA 4RIYB 1ZMVA 2OF2A 3FJQE 1FVVA 4A06A 4UY9A 5DPVA 3OXZA 3DT1A 2AYPA 5G1XA 4NJ3A 4EI4A 4PNKA 3POZA 4FEQA 2CNVA 3KK9A 5FDPA 3QXPA 3IW6A 4U41A 1REJA 3CP9A 1NVSA 4J1RA 1WVXA 2UV2A 4HCVA 3COKA 5FD2A 5K5NA 5LMBA 2QONA 3PRIA 2O63A 4BHZA 3Q53A 2BVAA 4KKEA 3PVUA 2ZB1A 5ETCA 3PG3A 3Q3BA 4YHFA 3WILA 1SNUA 3CY2A 4E4LA 4FT9A 4HGEA 2HZ4A 4D0XA 4ASXA 4YR8A 4BB4A 4RIYA 5BYZA 1CTPE 4B8MA 2QNJA 3FY0A 4ZLZA 4YJNA 4A4LA 3EQHA 4AA4A 1TQPA 4YZ9A 3COHA 3PWDA 4MNEA 4WKQA 2BR1A 3E64A 4QNYA 5AX9A 4U44A 5J9LA 4IM2A 4OTRA 2JAMA 2X7OA 5J5SA 5IQGA 1WCCA 3KRJA 2VD5A 3D7TB 2QOOA 1PMUA 4JQ7A 1ZYLA 3FPMA 5DOSA 3VS6A 4A4XA 5FWKK 5DT4A 5IKWA 2W96B 4JI9A 4P2KA 5EYCA 1OIRA 3E8CA 2R2PA 4IAFA 2VWIA 2WMQA 4FT0A 4DGLC 5DG5A 4RLKA 4G3CA 5DLSA 2RFEA 2XIKA 3MBLA 4I4FA 4MEDA 4YLLA 5HTIA 3AC1A 4HPTE 3C7QA 1FVRA 4IDTA 3IDPA 2BRNA 2X2MA 3F82A 5FXSA 3VBXA 5BPYA 2J5EA 3PRFA 3U55A 2OO8X 3REPA 4EH3A 4DYMA 3MY0A 5C9CA 2PMLX 3O0GA 5IH4A 3JR1A 2G2IA 2UZBA 3G33A 2BRMA 4FZDB 2J4ZA 3HV6A 1U5RA 4KAOA 4MF1A 4ONAA 4U42A 1OL7A 4W9XA 4RWLA 4CD0A 3Q9ZA 4IAIA 2F7XE 5AAFA 5KX8A 5ANKA 4DFUA 1V0BA 4FR4A 3NW7A 1CKPA 3R04A 3KEXA 4Y73A 5LMKC 2IZTA 4PMTA 2ZM1A 4J53A 5EM7A 2E9UA 4M7IA 4DLJA 3EYGA 3IOKA 5CSPA 4AAAA 2X1NA 3QKMA 4K2RA 4KA3A 2HAKA 3FC2A 2OZAB 4FL2A 4KD1A 4ZTNA 5J87A 4ZXTA 5GIOE 3U4WA 4EKKA 3RK9A 4IC8A 4YC8A 1YXUA 3C4CA 3QQGA 1IRKA 4CV8A 3IKAA 2ETKA 4UWYA 1VR2A 3R1YA 4YC6A 1PXPA 3DKOA 3QC4A 3ODYX 5AM7A 3PY0A 3WE8A 4BRXA 3V6RA 3BGQA 4V05A 1U4DA 4MNFA 3NUSA 4FZ7A 3ZMMA 2WMBA 4FYOA 5FTQA 5LMKA 4DGGA 2GNJA 1H8FA 1YXSA 2XK3A 4GT5A 4I6BA 3SG8A 3ORMA 2WQNA 4ZEGA 4MK0A 2ITNA 5KMIA 4R78A 3R8ZA 5CU6A 3QTUA 2XCKA 2PL0A 3MVMA 4IXPA 5M56A 2W1EA 4XG8A 2PK9A 2UZLA 4JG7A 3LQ8A 3M11A 1YDTE 3IO7A 5HICA 2PY3A 3OFMA 3OT3A 5HHWA 4UB7A 3V01A 4BI1A 4I0SA 2YDIA 2QOKA 2PVJA 2YJSA 3K5UA 3FDNA 3NUNA 3QUPA 4XG2A 3V04A 2JDTA 3BGPA 4ITIA 2BHHA 4QPSA 3IG7A 2UZUE 5HIEA 3C4WA 3GCQA 3GU7A 4NW6A 4U79A 4B0GA 4QP9A 4ZMFA 2PVYA 3MS9A 4TYGA 3HMOA 4O2ZA 2G2HA 3EIDA 3Q60A 1G3NA 3TG1A 4G6LA 5M4UA 3VBQA 3VN9A 3F2RA 2RFDA 4I93A 4DCAA 4FV6A 2DUVA 2CCIA 2OU7A 3AGMA 3MSSA 4L44A 4UZHA 3UQGA 5IMXA 1H01A 1OZ1A 4CKIA 3EMGA 2W4JA 4UYNA 2H9VA 3AC2A 1Q3WA 1OL1A 3PLAE 2HCKA 2OH0E 4MQ1A 5IDNA 5CX9A 4TY1A 2B9IA 4U5JA 3P7BA 4AN2A 1OKVA 3UBDA 3KRLA 4DG0E 1OUKA 1ZWSA 2X6EA 3FUPA 5IA4A 4BL1A 4IM0A 1GIIA 2V0DA 4FV9A 4KIOA 5A3XA 4PPBA 2F49A 2C6TA 2ITWA 3MVJA 4CCUA 3R2YA 4HVIA 3NW5A 1URCA 1FOTA 3C13A 3RWQA 3DK7A 5ACBC 1PY5A 4LOQA 3FLZA 4R77A 2WMAA 2IO6A 2PVLA 3U6IA 3EN7A 2R7IA 3IPHA 4WHZA 1NT2A 4FSTA 4A4OA 4Q9ZA 4BGGA 4FIGA 3CQWA 5I5ZA 5D12A 3HA6A 4U7ZA 3UPZA 4QQCA 2O65A 3LW0A 4EH2A 2VO0A 4IJ9A 5HZNA 3SGCA 1W0XC 2QR8A 3I5NA 5CALA 1CM8A 1W8CA 4ZAUA 2E9PA 1QPDA 3ZHPC 3H0YA 5HLPA 4USFA 3MV5A 4EHGA 3OW3A 5KMLA 4EBVA 4C33A 2HIWA 2YZAA 2BALA 5AM6A 1AQ1A 3FC1X 3ZZEA 2VTQA 3KXXA 5H8BA 4E4MA 1GAGA 1YHSA 3KB7A 2Z2WA 2GMXA 3OCGA 4ZIMA 4J8MA 4JVGA 1OIQA 3TWJA 5AUUA 3HMNA 1Y8YA 2W4OA 4YJOA 1J1BA 2W17A 4P7EA 2WHBA 3FXXA 3HVCA 3ZCLA 2VTNA 4R3PA 5K9IA 2RSVA 5JH6A 5M09A 3PDTA 1H1QA 2Z8CA 3PZHA 4FV0A 4D0WA 4JX3A 4X2KA 3W2PA 4H3QA 3VBYA 1IA8A 4FV3A 4R5SA 4CYIA 4D55A 3R73A 4O7RA 2Q0BA 3VAPA 4RIXA 3ANQA 2ITXA 1SVGA 4PRJA 4QMYA 3GT8A 1UNHA 1XH7A 3F2AA 4C8BA 3IONA 2CGVA 3E7VA 3O8TA 4E3CA 2PUPA 5ACKA 4D5KA 5HE0A 3TNHA 4E8AA 4PP7A 3G9LX 3DS6A 4HYSA 5DH3A 3VQUA 3D5XA 4WSQA 3ZLYA 2QG7A 2VWUA 3ATTA 5EHLA 3UP2A 3V5LA 4I5HA 4FV7A 5EHOA 1GZOA 2J50A 3GP0A 5E8ZA 3W8QA 2PUIA 4O96A 4ZJIA 2XRWA 2RF9A 5AMNA 2EB2A 3HNGA 2C1AA 4W8EA 4ACDA 1SMHA 4ACHA 3D4QA 3Q5IA 4G16A 4QMZA 4NYEA 3KC3A 2BIKB 2BZJA 3Q4CA 5JGDA 3A7JA 1J1CA 4WG4A 2ETRA 4YSMA 4ANQA 5J1WA 3GENA 4J8NA 5LARA 1M7NA 4EBWA 3PWYA 3LJ1A 3PPJA 4O83A 4QYFA 3RAIA 3SQQA 4O7WA 3KMWA 4G6OA 4FT7A 4CQEA 3QTIA 4ZTLA 1M7QA 2RL5A 5JKGA 3GB2A 4ZMEA 5F94A 3CPBA 1L3RE 4KBKA 4DFXE 3DCVA 3RNIA 2PTKA 5CT0A 5GZ9A 5L6WL 3R9HA 4CLIA 3ZLXA 3QUEA 3E8DA 4L7FA 1R0PA 5F9EA 5B2KA 3CKXA 4JG8A 1Q8YA 2V62A 4N70A 2OH4A 3MWUA 2AC3A 3BV3A 2J0IA 5CSHA 1BI7A 4I94A 5CAPA 2Q0NA 4K8AA 5HIDA 1Z9XA 2PVHA 4WIHA 4AT4A 3NIEA 4G31A 3QGYA 4O21A 4F9AA 2B7AA 2RKUA 4D5HA 3ZU7A 1WMKA 5M08A 5DR9A 2C5OA 3GOKA 4QTAA 3ZDUA 4DEAA 4O0VA 3H30A 2QU6A 2VX1A 2J0KA 3FKNA 3I1AA 4IH8A 4YZCA 5CYIA 2J0LA 5A4QA 3UOLA 3AC5A 3ZO4A 3OWLA 4YJSA 4CGAA 3NSZA 3H10A 4QQ5A 3ORXA 5LMAA 4RX8A 4W4VA 4M12A 4EORA 2WXVA 4MXCA 4EYJA 2YZLA 4AOIA 2BTSA 4DT8A 2R3KA 3DKCA 2WNTA 4XCUA 4E5WA 4EZ7A 4S34A 4YSJA 2OSCA 5JFVA 3O50A 1T46A 4O0SA 3UODA 4E93A 5BUIA 3GU4A 4PUZA 1UV5A 3HZTA 4FSWA 4DT9A 2QKWB 4ZS0A 3WF5A 5AIRA 1WBNA 3LFEA 5B2LA 2X39A 5TKDA 5A54A 5AV3A 1Y6BA 3BU3A 3CS9A 4TT7A 1JAMA 2GHMA 5HX8A 3CGFA 3DB8A 2HZNA 5CAVA 3VBVA 4IZYA 1H4LA 3DK6A 3T9IA 3VJOA 2W05A 1QPEA 2OG8A 3DKFA 2VU3A 4I20A 4IWOA 4I92A 4PL5A 2IW9A 2G2FA 5HNIX 3U4UA 3HMMA 2R9SA 4R1VA 3V5JA 4BN1A 3FHIA 4TN6A 4UMRA 2BDWA 4C4GA 1AGWA 4XG6A 3Q6UA 3BZ3A 3O8UA 4BDEA 5HI2A 1DAYA 3UMWA 5BNJA 3C9WA 4HZRA 4FKRA 1PXIA 4KS7A 3WZKA 5GNKA 2Q83A 1W98A 4F64A 3ZM9A 5DR2A 5HG7A 4A9UA 4EOKA 1GIHA 1H1RA 3H9OA 3ORLA 4JNWA 3DDQA 4MWIA 4B8LA 4OTWA 1YWRA 2CLQA 5BX0A 4GK4A 2JKKA 2PHKA 3K2LA 3PXYA 1IG1A 2CSNA 4IWQA 2NPQA 4EOJA 2QOHA 4YJTA 5GINE 4JT3A 3LJ0A 4KINA 3PVBA 3HKOA 2AC5A 2V7OA 2YIWA 3R02A 3UG1A 4TYIA 5B0XA 2NP8A 3F3UA 2PZRA 4NUSA 1BYGA 3WBLA 1I09A 4MD7E 4BZDA 3BYOA 4C4HA 3QZFA 3RCJA 5H8EA 4USDA 1I44A 5A6NA 5M4FA 5EQPA 5F1ZA 5J7BA 2FSTX 4BTFA 3E7OA 5JRSA 2ITUA 5E8WA 3GQIA 3ZRKA 4FKQA 4OTPA 1VZOA 2EU9A 4FNWA 4W9WA 2IG7A 4ZSLA 3S2PA 3UNJA 5T68A 1GY3A 3A7HA 4PV0A 5I0BA 2UW4A 1OUYA 5AAGA 2GFSA 3QQLA 4FG8A 3RHKA 4UMPA 4MXZA 4UX9A 4RFMA 3EN6A 2YWVA 2UVXA 4IVDA 5BYLA 2X6DA 4I24A 5CQUA 3LLAA 3NYVA 2WMSA 4UBAA 4WO5A 3HAMA 1Q8WA 2XCHA 3UTOA 3PJ3A 4M14A 2WB8A 1OIYA 3I7BA 3TZMA 4Q2AA 4DTAA 2RG6A 3QQUA 4N0SA 5JT2A 4GYIA 4L42A 4BCQA 5ITAA 4YHJA 2H6DA 1U54A 5JFXA 4HVSA 3QQHA 5ANEA 2YCQA 3FMHA 2VRXA 3QHWA 3U51A 5EM6A 3O7LB 3A8WA 4I6HA 2XRUA 3KVWA 3AD4A 5AR2A 2ZMCA 3D2IA 2QR7A 4O7ZA 3FMKA 4F4PA 3C5UA 5KMKA 3LCDA 4FKLA 2OF4A 2EVAA 2JIIA 4N4SA 1OECA 4QT1A 1H1SA 3BEAA 4X21A 4BTJA 4IB0A 3ANRA 3FMJA 4FTTA 5CZIA 3E8EA 2E2BA 3R7IA 2X9FA 1XH9A 4HYHA 1H08A 4RX5A 3UO5A 3DDPA 4D1ZA 1OKWA 4FKTA 3I6WA 4L6QA 4CFXA 5EKOA 5EI8A 3QCXA 3QD2B 4GK2A 4DFNA 4RZWA 4DEDA 3W2QA 3BWJA 3QTZA 1NVRA 2VO3A 2ONLC 5GJFA 3EFLA 4IEBA 1B38A 3RP9A 4DLIA 5M44A 2QURA 2BUJA 3GXLA 3Q32A 3KXGA 4PF4A 3ALOA 3QD4A 1QPCA 3UO6A 3HV4A 3RCDA 2RGPA 2ITYA 3NWWA 4IWDA 2WQEA 4FSUA 1Y57A 2G01A 5LVNA 3E93A 5AADA 2YM7A 4PWNA 2HWPA 4EK4A 1WBWA 4YJQA 2XKFA 4C61A 3F9NA 4X6QC 4FL1A 5L2WA 4CG8A 2YDKA 4H3PA 5E8YA 3KRXA 3PA3A 1BKXA 3S95A 4HJOA 4IM3A 5KBRA 4O84A 1CSNA 4APCA 3RZBA 4ARKA 4GKIA 2WZJA 4FKPA 5HD7A 5C03A 5FXQA 2ZMDA 2B0QA 2JD5A 2WIHA 2ZAZA 3PPKA 5IZFA 3HP5A 4LUDA 4XV3A 4YHTA 3UG2A 4EH9A 3FI8A 2UUEA 4E1ZA 2W9FB 2IPXA 2XYNA 3F3ZA 4C3FA 5KMJA 4F65A 4G34A 3FZRA 3NZ0A 4WSYA 3PXRA 2A27A 4TXCA 1JPAA 2YWPA 4ID7A 3LPBA 5CQWA 5HU9A 3RAWA 3D7ZA 3DLZA 2ERKA 4GFGA 4MBIA 5IA5A 4EH6A 3EL7A 4KRCA 4L46A 1PXJA 3TNPC 1OITA 5I3RA 2QKRA 1ZYSA 3HDMA 4FTNA 4F9CA 2X9EA 4I0RA 3E92A 4PMSA 4LRKA 3GC7A 3ORPA 4DGOA 2R3NA 3VS5A 4QQJA 4E6QA 3RPVA 4ZJVA 2W7XA 4Y5QA 2WEIA 5D10A 4LV5A 5EI6A 1UU8A 1OL5A 5TT7A 4D2TA 4ZJJA 3RPRA 4AWIA 4V0GB 3GCVA 1YQJA 4QQTA 3VF9A 4F09A 2C6LA 4FGRA 4YUQA 3ZBXA 3NUPA 3R28A 3ALNA 2F57A 4FTUA 3UC4A 3G51A 5IPJA 2Z7SA 3VUIA 2CMWA 5HCYA 5I9ZA 3H4JA 5AA8A 3NAYA 3OD6X 4FOCA 4UXQA 3AMAA 3A4PA 4KIKB 1GZKA 2O8YA 3BHVA 3ROCA 3LIJA 4U40A 5CSXA 4XV2A 4H3BA 2WMWA 4QYYA 3LVPA 4EUTA 3ZBFA 2C6KA 3BHTA 4PPCA 4GL9A 3F5UA 4RVMA 5FGKA 2JBOA 2UW8A 3RI1A 3P4KA 1YI3A 2VWVA 2YM5A 3WZJA 5L2QA 3QF9A 3G6GA 5ANOA 4IDVA 2BAJA 4Y46A 3TT0A 4E5AX 3VJNA 3MA3A 4V01A 2X4FA 1Q8TA 2CKQA 2R3OA 4CMOA 5K5XA 2QO9A 4QP1A 2W5AA 3HL7A 4RA4A 3BLQA 4WD5A 4MF0A 4LFIA 3R9NA 5GZAA 2JIUA 4II5A 3T9TA 4ZSGA 3QZIA 2HXLA 3E3PA 4OBPA 1UVRA 5DGZA 5LOHA 5ICPA 5IUIA 4RIWA 4U0IA 4FSZA 4IAAA 3QTRA 1BL7A 4B9DA 2WTJA 4PL4A 3NCZA 1UU3A 5DHJA 3G9NA 5GZ8A 2JDSA 2VWZA 2XKEA 4KSQA 5ANJA 3DXNA 3LFSA 3Q2JA 1M2RA 4ERWA 4OGRA 5DMZA 5HX6A 2IZUA 4ACGA 3AT2A 1PMVA 2Y6MA 2FSMX 4ANBA 4NM5A 5CZHA 3BELA 3KXHA 4QD6A 4EK5A 3MFSA 2SRCA 5HO8A 3TJCA 3DJ6A 4OT5A 3OTUA 4OUCA 1KE5A 5ETFA 3KXZA 5JGBA 2HOGA 4EOMA 2B54A 3OOMA 3QTXA 4EJ7A 3TZ9A 2RG5A 3EKNA 4JXFA 4YJPA 3ZEPA 4EQUA 1W82A 4RC2A 2ZV2A 4XEYA 2FSOX 3TUBA 2XK8A 3VS4A 3OBGA 4XHKB 3GCSA 3Q9XA 4FIHA 4MX9A 4GYGA 2C30A 3OT8A 4AACA 3W2OA 3FEGA 1JNKA 3A62A 5AP5A 4MCVA 3O23A 1ZYJA 1RE8A 4NFNA 2XKCA 1R1WA 2FH9A 5JN2A 3LAUA 4LQMA 4MNEB 5JQ8A 2OFVA 3QTWA 5AUVA 5M06A 3N51A 1GJOA 1CKIA 1WBVA 1YHVA 3EQPA 3PJ8A 4IZ7A 5EH0A 3UYSA 3ZEWA 4DFZE 4FEWA 3S00A 4O0UA 3KN6A 5HE2A 4Y85A 4AW5A 2X4ZA 5CLPA 4XMOA 5H8GA 5HNGA 2VTSA 3OXTA 4AG8A 5CXZA 4NL0A 4IVCA 3OMVA 4AOJA 2C6IA 2OKRA 2V7AA 3GU8A 2XNOA 3L9PA 3ACKA 3FPQA 3OROA 1JSUA 4Z3VA 4FKGA 5IEYA 2XNGA 3MGYA 2W4KA 2QLUA 2X7FA 3BGZA 3LCTA 4LMUA 4EKLA 3AC8A 1H00A 3HEGA 4F1OA 2AUHA 4L43A 3KMMA 4H58A 5A6OA 4WG3A 1FMOE 1UU9A 1YDRE 1Z57A 2CGXA 1ZRZA 2IN6A 2X8EA 3ZO1A 4X0MA 3DV3A 3JS2A 4FNZA 4B99A 4CNHA 4C37A 3CJGA 1VYWA 2E9NA 2YAAA 3UNZA 1DM2A 4JJRA 3P23A 4QMMA 4U81A 3OOGA 5M53A 5CEPA 1BLXA 2QODA 4XBUA 5KO1A 4O7VA 4QMUA 4BI0A 2GNHA 3CXWA 3QWJA 4QPMA 2HY81 2OJJA 4F7LA 4NK9A 2BHEA 3BLRA 4FSRA 4HCTA 4L3JA 4UEUA 1E1XA 1E9HA 1IEPA 2FVDA 3KL8A 3I0QA 4C2WA 2OWBA 3IOPA 3OY1A 4FTMA 3RMFA 2H8HA 4CFUA 5TF9A 2PULA 3F3VA 4BTKA 3I5ZA 4EK8A 1VYZA 1GZ8A 5CAOA 5IQIA 3KF4A 4S33A 1ZOEA 4AT5A 4L52A 3CD3A 4DBNA 4FIIA 3EYHA 2XIYA 5C01A 3UZRA 1YOJA 2BRHA 3BCEA 3FZOA 3R7EA 2CN5A 4NM0A 5K3YA 3TN8A 4Z9LA 2VGPA 4WNOA 4QMQA 4H1JA 3DBCA 4PL3A 2F7EE 3ZO2A 3WF7A 5J79A 4EH5A 4CT1A 4U8ZA 1VEBA 5DN3A 5GHVA 3MB7A 2QI8A 4F6SA 3AD6A 2WGJA 1WFCA 3QX2A 3W2CA 4BDKA 1SVEA 3RALA 4RT7A 1O6KA 4C58A 2BIYA 1UKHA 3M42A 4IVBA 2DQ7X 1PF8A 4XOYA 3UOKA 3B8RA 4MQ2A 4EOLA 5HOAA 2GPHA 4LG4A 2QOIA 4MKCA 2UZNA 3VHKA 5F20A 3DJ7A 3NRMA 4G9CA 5K4JA 3OVVA 5EW8A 4AP7A 3KCKA 3AT4A 3GU5A 5DT0A 4FVRA 4O22A 2ITOA 3E62A 3LZBA 1PXMA 1XH4A 5DI1A 4D2PA 3FZPA 3P79A 3DPKA 4W8DA 3TZ8A 3VRZA 1R3CA 2B9JA 3ZUVA 3H0ZA 4BYJA 2WTIA 5E9EA 2C3JA 2EXMA 4LUEA 3OC1A 3V5PA 2RFNA 3GOPA 3OBJA 4GCJA 4K18A 3R22A 2Y6OA 4QNAA 4YC3A 4IX3A 5CNNA 4RWKA 5HE1A 5DBXA 3ZFYA 2BKZA 3COMA 3S0OA 3RNYA 2I1MA 4RJ5A 4K33A 2UW5A 3BYMA 3LCKA 4F7JA 2XK7A 4BKYA 3ELJA 3VBWA 4JBOA 4QMSA 4WBOA 3SG9A 3EQFA 4DE4A 4FV5A 5DRBA 4WT6A 2BAQA 5AP4A 5CAQA 4H39A 4Y5HA 4YTHA 1XR1A 4WRGA 2Z7QA 2DYLA 3I0OA 4DHFA 2GHLA 3A7FA 1KE7A 2W5HA 3LJ2A 3CQUA 4I41A 4XG9A 1Y6AA 3RGFA 5AP3A 5JZNA 4TYJA 2WKMA 1U46A 3EQGA 4G9RA 3NDMA 2ITPA 2R3FA 2YA9A 5AP1A 4F1MA 1NVQA 4EONA 1YVJA 4H36A 5AR5A 3NIZA 4BIBA 4CFNA 5KHWA 3V5WA 3OCTA 3PXQA 3R30A 4YNOA 5G6VA 5EW9A 3U8WA 4LOOA 3MPAA 1Q5KA 2W1HA 2C3IB 4IBMA 3Q4ZA 4O82A 2PZYA 3OCBA 5CAUA 3RBWA 4BYIA 2IJMA 4KKHA 4CRSA 4FTAA 3RTPA 2JKQA 3KXMA 4GJ2A 4K11A 1YXTA 4CTCA 2BCJA 3PZEA 3EOCA 4U80A 2XYUA 3L8VA 4FVQA 3DJ5A 3RVGA 3M2WA 2EB3A 4ALWA 5DVRA 2X2KA 5IISA 4S2ZA 4EHZA 4HCUA 5EQYA 4XNEA 3E63A 3OWPA 4M67A 4JDHA 1LEZA 4X3FC 3ZUUA 3DLSA 3HA8A 5C26A 3WIKA 3SD0A 1TQIA 3DBDA 3MTLA 4BF2A 4R1YA 4LL5A 3RJCA 4IB3A 4QMTA 4G3FA 4J7BA 2A4LA 2RFSA 2Y4PA 4W4XA 4X3FB 4PDOA 3OTVA 5KNJA 4DBXA 1PYXA 4CLJA 3DKGA 5FP5A 5A4EA 2C47A 5J1VA 4OR5A 4RBLA 4BVUA 5AUTA 3JY0A 2CKEA 4DG2E 4RIXB 1YWVA 4CKRA 3DXPA 3LM5A 5CSWA 5AUWA 2C5NA 3FMEA 3U87A 5FBNC 4C35A 2NO3A 4ASDA 2PPQA 3W55A 4FT5A 2VTPA 4HYIA 1JKKA 3PY3A 2WQMA 5EDQA 1PYEA 3NYNA 2GCDA 3CTJA 3LXPA 4QMVA 1V0OA 2XIXA 4IAYA 4JAIA 3C50A 1ZMWA 2XNPA 4X3FA 4FUYA 4X3JA 3BHYA 1IA9A 3G6HA 4J95A 5DFPA 2PVRA 1YOMA 3JVSA 3KF7A 4G2FA 1OKZA 3F88A 4CZTA 3R21A 3L9MA 1MP8A 2WPAA 3RK7A 1H27A 2C5VA 4FTOA 3NUAA 4MYGA 2VN9A 2ZDUA 3F2NA 3MDYA 4RQVA 4ZK5A 4A9SA 5TO8A 4ZTMA 2KTYA 4ZY6A 4BR3A 5AP7A 3GC8A 4LL0A 2PVFA 4RC3A 2WTKC 4FG9A 2XZSA 4ENYA 3P78A 5KKRC 3AC4A 3PSDA 1GZNA 3ZOSA 3PY1A 1OVEA 2YISA 4HVHA 4ZLOA 2C5XA 2PE0A 2WTKB 3VIDA 5CF4A 1MRUA 3PTGA 4AUAA 4F70A 4USEA 1MQ4A 2OBJA 5HLNA 1W84A 1JVPP 2QVSE 4TNBA 2WMUA 4IX5A 4QTCA 2ZV7A 4XS2A 5HVJA 4GVAA 3P7CA 4AOTA 4WA9A 2PYWA 4FVPA 2E9OA 4IE9A 5EI2A 2CGUA 1B39A 5C8NA 4C4FA 4YJRA 5DRDA 4MWHA 5HTBA 4E5BA 3FMMA 2UZVA 5TR6A 3VULA 5IQDA 3DQWA 3R0TA 4QMLA 4WG5A 3R8VA 3NVKI 3MTFA 1RW8A 4BDHA 4QO9A 2XIRA 5HKMA 3LMHA 2ITQA 2UZEA 4B4LA 3VVHA 3VRYA 4JQEA 1NW1A 1KE8A 1ZY4A 3TNQB 3G2FA 3PVGA 3QA0A 5HO7A 4J96A 2C4GA 3E5AA 3FE3A 4B7TA 5BVFA 3PE2A 2O3PA 4HGLA 3LMIA 4IAZA 4RJ8A 4I0TA 3G5DA 4KB8A 3VW6A 1KV1A 1H1WA 4KIQA 3BKBA 4J71A 5HG9A 2UW6A 2VX0A 5CF6A 5GJGA 3BQCA 3LMGA 5AUXA 4EWQA 3W1FA 5E7RA 3WZUA 2XF0A 3DBEA 3CD8A 2XIZA 3ZC6A 1OGUA 3QD3A 4EOSA 1RJBA 4HPUE 4Y8DA 4IANA 5CXHA 3FMLA 2CNUA 1OKYA 4RX9A 2C5YA 2HW7A 3IDCA 3A99A 4FIFA 4B6LA 3ODZX 3VBTA 3Q52A 4FI1A 5CVFA 2GU8A 5IA1A 5DT3A 2OFUA 3Q6WA 4QP2A 2C6DA 3FYJX 3TDWA 2CCHA 4O38A 4IQ6A 3GQLA 4JR7A 4AFJA 1J91A 5FG8A 5FM2A 4DH1A 4O7SA 2OJGA 1Q41A 2C0IA 2R3LA 3VW8A 4ANMA 3QTQA 3VS0A 3FZ1A 3MI9A 4AA5A 4AS0A 4E7WA 4JLCA 1PXNA 4AGCA 2R3QA 5A4CA 3DXQA 5HLWA 4BDIA 2PWLA 4AZEA 4ERKA 3ORNA 5LVPA 3ZRLA 4TWPA 4Z7HA 1J3HA 3VUTA 3NW6A 1F3MC 3WOWA 4BKJA 2PVMA 2QHMA 3QRTA 4FV1A 1V0PA 2J2IB 5BVNA 3V5QA 1HCKA 4TZRA 5M4IA 4UYAA 4FX3A 4JDKA 2Y8OA 2PVNA 4HGSA 2ZM3A 3BEGA 3CPCA 3D2KA 3NUYA 3MIYA 4FMQA 5AEPA 1Q61A 5IUGA 2XEZA 4C4EA 3MYGA 2JDVA 3CGOA 3F5PA 3MH0A 4FICA 4YLJA 1T45A 4XLIA 5CU2A 4L3PA 3AD5A 2JBPA 4QYGA 5D7AA 5HE3A 3Q2MA 4BCOA 3W2SA 3EN5A 3P86A 4F9YA 4JOAA 4LGDA 4EC9A 2VO6A 1WBSA 4RWJA 4C57A 3FLSA 2QOLA 2OIQA 4XH6A 4V04A 4YZMA 3UZPA 2OJ9A 4ANLA 4AU8A 4CMTA 3R9RA 3R8UA 4Z55A 4BBMA 3ZSIA 1U59A 4NU1A 2HY0A 2IZRA 5KZ0A 4UWBA 5DA3A 3WYXA 2B9HA 3Q96A 1STCE 3Q5ZA 3RK5A 2WD1A 3BHHA 4FF8A 1IAJA 3BQRA 4CTBA 4NM3A 1QCFA 4PP9A 2YCFA 2G9XA 2GS2A 3AXWA 2W99B 5DEWA 3L9LA 4HVDA 3DGKA 2ETMA 4A9TA 4ZSJA 3ZSHA 5C4KA 3QLFA 1PMNA 2UZDA 1F5QA 2PZIA 3I60A 1ZLTA 3NAXA 3MESA 2PVKA 3R2BA 4JDJA 1PKDA 4RZVA 4QMNA 3IGGA 2XUUA 3GI3A 4I1ZA 4FZ6A 5KHXA 4TPTA 3KCFA 3RPOA 4ORKA 5A9UA 2QOBA 5FEQA 5HBJA 5KUPA 3MVHA 3UGCA 3JVRA 4CG9A 3CTHA 5BMSA 4O91A 3SXRA 2HXQA 4I5PA 1JKLA 4FKIA 4HOKA 4I6QA 4LMNA 4TTHB 5FTOA 5CEOA 3GGFA 1OPJA 3I7CA 1DAWA 1Q8ZA 2J5FA 2W1FA 2XP2A 5AJQA 5EG3A 2HK5A 4RIOA 4GG5A 2XNMA 4R3CA 2XVDA 4AN3A 4DG3E 3O7LD 1W7HA 4O0YA 3T8OA 3QWKA 4A07A 4MBLA 5DE2A 3D94A 1WBPA 3C4FA 1FGKA 2WO6A 3L8SA 2WMRA 4HYUA 4P90A 5FUTA 4QOXA 5DNRA 4C4JA 5EYMA 4JDIA 4GSBA 5HCXA 3A7IA 3FZSA 2XKDA 4FODA 4L8MA 5HESA 1ZAOA 3QRIA 1U54B 3VUHA 2B1PA 4YBKA 1WBOA 5FM3A 3BV2A 4L00A 4BTMA 1M17A 5CTPA 3W18A 1IR3A 3DAKA 3ET7A 3EQDA 4DFBA 3UZTA 2GQRA 4BDBA 2VNWA 4KABA 3NX8A 4EOQA 5CWZA 5EM5A 2Z02A 1YI4A 4IB5A 5BVKA 1JKTA 2YM6A 2OW3A 1KSWA 4L68A 3OZ6A 2VGOA 2HZIA 5CU3A 4WNPA 4FT3A 2R5TA 3UC3A 3R83A 3WF8A 4BZOA 5IA2A 4NT4A 4CMUA 3BLHA 2EWAA 4QTDA 3R8PA 1H1PA 4X6RA 5ETAA 1M52A 4R3RA 5E8UA 3PXZA 3ULIA 3ZH8A 1GNGA 1QL6A 1YW2A 4NIFA 1DS5A 3ROYA 5EW3A 4L7SA 4EK6A 3C1XA 4FL3A 4FEXA 3SOCA 1CKJA 1P2AA 4RQKA 2YLEA 5D41A 1NY3A 1CMKE 4LGGA 5AWMA 1KUTA 3F69A 3CSVA 4IW0A 3AGLA 1H26A 2J0JA 5CASA 5M51A 3R8MA 1J7UA 4FEUA 3I81A 4GVJA 4XYFA 4EOIA 5KCVA 5CEMA 5HO6A 2ZYBA 4GUEA 4X7QA 1OBGA 5GJDA 4M8TA 3LFBA 2YIXA 1FPUA 1LP4A 4RG0A 2VTIA 1QPJA 5E8XA 4I5MA 1WVYA 3RM6A 3O51A 3ZFMA 5JQ5A 2XK6A 3EL8A 3QX4A 2BZHB 4JS8A 5EFQA 2P2IA 5A46A 5IQFA 2I0YA 5C27A 5E90A 5FQDC 3R1SA 2JEDA 3CR0A 3AMYA 2XNNA 3RKBA 5AP6A 3VS7A 4GFOA 4XG7A 2XA4A 4BCFA 4E4XA 4AZSA 1ERKA 1AD5A 3NNVA 3HRCA 4FSYA 3KKVA 2W1GA 4NM7A 5B7VA 5IU2A 5BYYA 3OF0A 1YRPA 4ZTRA 3SKCA 4PPAA 5HVKA 4F7SA 4ZTQA 3EHAA 4ZLYA 2UW7A 4WRSA 3GFWA 4F9WA 4FSQA 3KREA 1UWJA 4BBFA 4JQ8A 5CVGA 5E91A 1OMWA 1P14A 5AV2A 4XV1A 5CSVA 4BHNA 1PMEA 4OAUC 3FL5A 2HELA 4MBJA 5EYKA 3PYYA 4ASZA 1GOLA 5LQFA 3U6HA 3Q9WA 1WVWA 2ONLA 5IQBA 4GV1A 1OB3A 3R7YA 3GBZA 4F1TA 4R7BA 2O5KA 4EEVA 2C3KA 2WAJA 3B8QA 2UZWE 4GT4A 4XP3A 5J8IA 1YI6A 1MRVA 2BZKB 3A4OX 3E87A 4D4VA 1R39A 1WZYA 3F7ZA 2CNQA 2FGIA 2V55A 3N4VA 3UQCA 4OT6A 5EM8A 1SVHA 4FUXA 1Q4LA 1H07A 2B4SB 3FV8A 3UJGA 4CZYB 5AR3A 5LVOA 1X8BA 2I0EA 5I9VA 2I0HA 5BMMA 3CJFA 3QCSA 4GFMA 4FV8A 2HWOA 5CI7A 1XH6A 4WBBB 3EB0A 3JY9A 3T3VA 4F0FA 3T3UA 2R3GA 1PHKA 3KXNA 2A2AA 2WU7A 4O7YA 4FK3A 4AN9A 4N6YA 2GS6A 4RJ7A 2C6OA 1TQMA 3EFWA 5IEXA 4FTRA 3TTJA 5I9XA 4R7HA 3OW4A 3UIXA 3ZLSA 1XHAA 3V6SA 4EHVA 3F6XA 3KULA 4ALUA 4FIJA 3SX9A 4JL9A 2F4JA 5HCZA 1WBTA 3R7OA 3MN3A 5L6OA 4QMXA 4TYHB 2HZ0A 2BFYA 4Q5EA 4GMYA 4W4YA 2LGCA 2Y9QA 4HW7A 2ZV8A 3F3WA 1Q3DA 4MXAA 1NA7A 2WOUA 4TWCA 3SRVB 4AX8A 5BQ0A 2GTNA 2VTLA 4K0YA 5IH6A 3A7GA 4D9UA 1Q8UA 2OXYA 1H25A 5E8TA 2FSLX 4OTIA 2XM8A 2JC6A 1UA2A 3QZGA 3SW4A 4XLVA 4RIWB 1O9UA 1J7IA 4GKHA 4OTHA 3TCPA 2OIBA 3ORTA 4JX7A 4PMMA 4CV9A 3MPMA 4QYHA 5CEQA 5M55A 4F7NA 3UVPA 3FZTA 1XO2B 2B9FA 4R5YA 4RVLA 4BBEA 4CYJA 5AFVA 3LOKA 3MFRA 4TYHA 4FNYA 4KIPA 2YHVA 5L4QA 4IFCA 4FC0A 5CENA 3SRVA 1YXXA 4QP4A 4O7NA 4WNKA 4Z7GA 2P0CA 4FIEA 4YMJA 2WMXA 4NWMA 4L67A 4BY9E 3ITZA 2XJ1A 3HGKA 3HMPA 5AIKA 2BROA 3GVUA 4FZFB 4K9YA 4YZNA 1CDKA 3VO3A 4E6AA 4O0RA 3POOA 1ZZLA 1URWA 3K54A 4RLLA 4RPVA 3W2RA 3W32A 2BMCA 4BI2A 3G15A 5EOLA 4S31A 4EOPA 4F63A 3JYAA 1U5QA 4I21A 4Y72A 4TKSA 3N4TA 3THBA 3BE9A 4EWHA 4F9BA 3KFAA 4LYNA 5DWRA 2CPKE 4DAWA 2QO2A 4QMWA 3MW1A 4O0XA 3BE2A 3CC6A 4BDFA 3QCYA 3QA8A 3HLLA 1M2PA 5CNOA 2X8DA 2W1ZA 4OTQA 2J7TA 4ITJA 4K6ZA 3NNWA 3KMUA 5H9BA 3WARA 4DH7A 5GIPE 1PW2A 3H9RA 2R3MA 4GEOA 3I6UA 1FINA 4HGTA 4U6RA 3IW7A 1SM2A 3FQEA 4IC7A 4TYEA 2PE1A 2VWBA 2O64A 4P4CA 4M68A 4DEIA 3GCPA 2WQOA 4P5ZA 3M1SA 2XNBA 4A9RA 4QYEA 4EK3A 2XMYA 3UO4A 2OGVA 2CDZA 2BFXA 3VS2A 5M57A 1OBDA 2IW6A 2PUUA 2ZM4A 3ERKA 3UVRA 4EHEA 1JOWB 2JDRA 5DIAA 4UN0C 1YDSE 4GH2A 4BGQA 1MUOA 4Q9SA 3UNKA 3AQVA 4PY1A 3FI3A 3PIZA 2UW0A 2PUNA 2PZPA 4E20A 3V3VA 3L8XA 3A60A 3UVQA 3MH3A 4KBCA 2YABA 3NUXA 5C8KA 3DB6A 2FA2A 3QRJA 4FTJA 5LCKA 1OI9A 1REKA 2J51A 3FY2A 3Q4UA 4AZVA 4BDGA 4D1XA 5CEIA 3ZO3A 1KE9A 2XM9A 3MY1A 4K1BA 4NEUA 3PA5A 2OXXA 3UPXA 4EQMA 5IEVA 1JLUE 1YHWA 3DNDA 4YJVA 3SXSA 1YXVA 3MIAA 3QZHA 1VJYA 3AOXA 4IVAA 5EHYA 3QQFA 4CEGA 2XBAA 4XOZA 4BCJA 3BYUA 4GT3A 4BDJA 4CXAA 2C6EA 2HYYA 1A9UA 4D4SA 4D4YA 3KQ7A 3BRBA 1ND4A 4CQGA 3QKLA 3PSBA 4ZOGA 4RX7A 2IVVA 3GCUA 2CHLA 4TWNA 2XBJA 2W1IA 4GU6A 4A7CA 4RVKA 2OZOA 2R3PA 4RJ6A 3EWHA 4ZZOA 2BKKA 2PMIA 4AGWA 1BMKA 2GHGA 2VTHA 4BCKA 4EOOA 2YERA 4JBQA 3UE4A 3ZDIA 3HP2A 5HG8A 4ZP5A 1Z5MA 1ZYCA 4FE2A 2GSFA 3QU0A 4J97A 4L01A 2XB7A 2P2HA 4FSMA 1XJDA 3I4BA 4BGHA 3II5A 4JR3A 2WELA 3SDJA 2YLFA 3ENHA 5CU4A 2ESMA 4OTFA 3QXOA 3V5TA 4I22A 1BUHA 1BI8A 4O6EA 1SYKA 4ZY5A 3ID6C 4C38A 1IAHA 4P5QA 3CE3A 4IAKA 5HG5A 3BU5A 2GQGA 4EYMA 4GJ3A 2VV9A 2C0TA 2WTVA 2X7GA 5FEEA 3VS1A 2ERZE 3PP0A 1E1VA 3D7TA 4IMYA 4BICA 3VUMA 1QMZA 3WIGA 3VQHA 4AT3A 4AW0A 3FKOA 3UIBA 4O6LA 5D7VA 4YTCA 2OJFE 3AG9A 4AGDA 4APPA 1OL2A 2GDOA 1BX6A 1EH4A 4DN5A 5L6PA 4H05A 3NCGA 4FKUA 2RIOA 3DZOA 3I79A 2NRUA 3U54A 5AA9A 2XH5A 4BDAA 3UMXA 3QQJA 4ZTHA 5HU3A 1IASA 2GFCA 3BX5A 3HV7A 3NUUA 4MVFA 5EYDA 4ZSAA 3LFNA 3R71A 5C1QB 4D28A 3ZONA 3BYVA 3ORZA 4BCIA 3PSCA 3R9OA 1LEWA 4HZSA 4KS8A 2PZ5A 1JWHA 1UKIA 3VHEA 1RDQE 4YPDA 3CTQA 3R7UA 1K9AA 1O6LA 4LRJA 3C5IA 2QOFA 1XWSA 3FMNA 5HD4A 5I9YA 5L2IA 3OP5A 2VNYA 2QOCA 4IADA 4C02A 2C68A 1LPUA 4BIEA 5KBQA 4YTFA 4QP7A 4XUFA 3SXFA 2R7BA 3O71A 4QTEA 3F5GA 2XK4A 3KN5A 1RQQA 2WOTA 3TV4A 4DTBA 4DC2A 4QTBA 4H1MA 2YM8A 3LXKA 5K0KA 2OI4X 3DU8A 4LGHA 4IJPA 5I3OA 3R9DA 1XBAA 5CT7A 3ZYAA 4ACMA 3A8XA 3S4QA 3DZQA 5ETIA 2OZAA 2WMVA 3KY2A 3L8PA 2BTRA 3JUHA 4YZBA 5FLFA 5CEKA 5J5TA 1OPLA 4GIHA 4GRBA 3K3IA 3DOGA 3LXNA 4NTTA 2PMNX 4O2PA 5LWMA 2YM4A 4QRCA 5E4HA 4C7TA 4U45A 2BRBA 1ZMUA 2WMTA 3OCSA 5JFSA 2OK1A 3NPCA 2C69A 4UMTA 1ZZ2A 3P1AA 3OG7A 1ZY5A 3DA6A 3IS5A 3TIYA 5L8KA 2DWBA 4BIDA 5AAEA 2O0UA 2JGZA 5BVOA 1SNXA 4AW2A 3ACJA 2BAKA 4G5PA 2XNEA 3HV5A 3FYKX 1NXKA 2YJRA 2IVUA 3QRUA 3O17A 4FV4A 4J98A 3W33A 4AW1A 4BCNA 4DF3A 2LAVA 2ZOQA 2WTWA 1JSTA 3WE4A 4BCHA 4G3DA 2PSQA 3SAYA 3N4UA 3UYTA 3TZ7A 5F95A 4EC8A 2JDOA 4NW5A 3H3CA 2WU6A 3GC0A 3PE1A 1H28A 4D9TA 3MVLA 3LM0A 4FSNA 2C6MA 2QCSA 2YCRA 3R7GA 1WAKA 2JKOA 3CQEA 3KGAA 2QLQA 3NNXA 3TV6A 4EH7A 5BVDA 5IMEA 5AR4A 5LXMA 4O81A 3KRRA 3BYSA 3IGOA 3P0MA 2P3GX 3S1HA 2GNLA 3RWPA 2I6LA 2OXDA 4Q5HA 5JEBA 4O27B 4IIRA 4E73A 5K0XA 4JBPA 3BU6A 1FBNA 4HVGA 5I4NA 1JBPE 1G5SA 5ANGA 3RPSA 5CU0A 2Y7JA 1V1KA 3NLBA 2P4IA 1XQZA 2QO7A 2P33A 3FAAA 4XV9A 3BIZA 4ZZNA 2A1AB 3GC9A 1PXKA 4G17A 4KUJA 2UW9A 3K5VA 3ORIA 5LCJA 3C0IA 4MXXA 4RRVA 3OEFX 2VTRA 3C51A 4KKGA 3RHXA 3PIYA 2I40A 5AP0A 5HBEA 4ZZMA 3TIZA 4DFLA 2C1BA 3LFDA 4EH4A 3TKHA 4S30A 3WZEA 4FGBA 1H24A 1HOWA 2GNIA 4DCEA 1ZYDA 3PXKA 3ZZWA 3NMUF 4X2JA 4C4IA 2QG5A 2WIPA 2QC6A 1BL6A 4GUBA 2OIDA 4RWIA 5IF1A 2R0UA 3G90X 5JSMA 5JZJA 3PIXA 5D11A 4ZTSA 3U9CA 3WI6A 1K2PA 4FKJA 5E8VA 5CF8A 3TUCA 3PFQA 2JFLA 2WQBA 2J0MB 3R01A 3W8LA 1ZXEA 3SC1A 3CBLA 2EXEA 2YITA 2VUWA 4JIAA 4WUAA 2VWWA 2QU5A 1MQBA 4F6UA 4YURA 2JFMA 4UXLA 4ZS4A 5JFWA 4PTGA 5EDPA 4DGNA 5H2UA 3BBWA 3FI2A 4IB1A 5ANDA 3TKUA 2FB8A 2UVYA 3MA6A 3NEWA 4DA5A 1PXOA 5AR7A 4ENXA 3GNIB 5HNBA 4CCBA 1ATPE 4EH8A 2YAKA 4Z16A 2VWYA 5L3AA 3CCNA 2WTCA 2IWIA 3VUGA 2Z7LA 2BDFA 3SA0A 2BPMA 4N57A 3COIA 4CFFA 3TJDA 1OPKA 3OUKA 4J99A 2IZSA 1XBBA 4YLKA 3ZSGA 1PRYA 4DH8A 2ZDTA 4YNEA 4FKWA 2YDJA 4G5JA 1HCLA 4M15A 4RVTA 3C0HA 4XX9A 2R3IA 4ANSA 2X0GA 3HDNA 2DS1A 3EFKA 3MH1A 1YKRA 2VTAA 3E8NA 3PJCA 3QC9A 4UZDA 3RAKA 5M07A 4W4WA 1LUFA 4JIKA 4YO6A 4HNFA 4TL0A 2E9VA 4WUNA 2YM3A 4DEHA 2CKPA 3MJ2A 5C4LA 3DTWA 2CN8A 3EQIA 3ZS5A 3IDBA 3OUNB 4L53A 5IQAA 2B53A 3D15A 5IH5A 4XP2A 5J9YA 1M2QA 1Q62A 5KZIA 3OWJA 3R8LA 4XBRA 3UIMA 5CY3A 3VF8A 5BUJA 5CANA 4LI5A 3ULZA 4YU2A 3EQRA 3HYHA 4F0IA 2CKOA 5E8SA 4XRJA 2OLCA 2GNGA 4KNBA 2IW8A 1DI8A 3EJ1A 1ZOHA 5LVMA 2UZTA 3B2WA 2YIYA 1OM1A 3BBTB 3OY3A 4ALVA 4OW8A 4RMZA 2Z7RA 3AMBA 4C59A 2JLDA 1Q24A 5AV0A 4CT2A 5AUYA 3LQ3A 3MY5A 4YTIA 3FQSA 1H0WA 1KOAA 2I0VA 4M3QA 5CS6A 1YOLA 3LQ5A 5TE0A 5FP6A 4YJUA 2XK9A 4BKZA 3DAEA 3R1QA 2VTJA
chains in the Genus database with same CATH superfamily
4JRVA 4L45A 5IQEA 2YACA 4GG7A 2W1DA 3P5KA 4CKJA 4GW8A 3MFTA 5I9WA 2GNFA 3NGAA 4OLIA 4RA5A 4RJ4A 4FTIA 3PG1A 3WYYA 4QP3A 3QCQA 4FBXA 4GIIA 4FTQA 4MTAA 4NJDA 4PTEA 5D1JA 4C34A 4KRDA 3VONA 2UZOA 3DAJA 4NZWB 4LOPA 4E6DA 1L8TA 2JIVA 3JPVA 4XP0A 4ZSEA 3TNIA 2GTMA 4DH5A 3IW8A 1XBCA 5KKRB 2BDJA 4I23A 2A0CX 4XRLA 4J52A 3C4ZA 2FYSA 4OTDA 5C8MA 2G15A 3QFVA 4O0WA 3V8TA 3QL8A 4EZ5A 3KRWA 3TM0A 5JRQA 5B2MA 2WFYA 1KV2A 4TWOA 3EFJA 5IA0A 2W1CA 4CZUA 4F6WA 1TKIA 3EN9A 3OS3A 3E3BX 5AUZA 3DTCA 2BRGA 4ANOA 5HEZA 3IECA 3TNWA 3D9VA 3VC4A 4CVAA 4FEVA 3K3JA 3KA0A 1MRYA 4RSSA 4UV0A 4EL9A 4PX6A 5LWNA 4TRLA 2F9GA 2XEYA 3RAHA 3G0FA 1ST0A 3QD0A 4C2VA 4YGAA 4LRMA 5KMOA 2ITZA 3ZM4A 4BWXA 2Y0AA 5D9HA 4AQCA 3PJ2A 2UVZA 3CY3A 3HV3A 4BWKA 4PNIA 4IACA 4XG4A 4R6VA 2R3RA 4AA0A 1FGIA 5DEYA 2ITTA 4ACCA 5HORA 3LKMA 3D14A 3O8PA 4TNDA 4DEEA 3QKKA 5FRIA 4QP6A 4NKAA 5EKNA 5J9ZA 3ZUTA 5KMNA 3ETAA 2HENA 3PP1A 3Q4TA 4D58A 4FK6A 3EH9A 4XJ0A 3TTIA 1ZARA 3R6XA 4G3EA 4KSPA 4BC6A 2GQSA 4RGJA 4NH1A 4BCPA 2F2CB 3QHRA 4JBVA 4ASEA 1OL6A 4AZFA 1PKGA 2JITA 4BCMA 4TW9A 3OWKA 4GS6A 4AXAA 2H96A 3Q04A 4M13A 1PJKA 2XJ2A 3R63A 3G0EA 3QYWA 4FA2A 3NNUA 3OHTA 5CF5A 4DTKA 1UNGA 4O7LA 4EUUA 5FTGA 4DEBA 1Q97A 3DBQA 4JAJA 2X8IA 4RJ3A 1YWNA 2YCSA 1KOBA 3QQKA 3TL8A 3LHJA 4M97A 4UMUA 1TVOA 1UU7A 3R1NA 5FDXA 4U3ZA 5AP2A 3UOHA 3DQXA 4KBAA 4D2VA 3TDVA 2JAVA 4K77A 1SZMA 4NCTC 3W16A 3UQFA 3LFQA 3ORKA 5IG1A 3PLSA 1ZOGA 3MH2A 5EK7A 3HMIA 2PE2A 3NR9A 4CRLA 4LV8A 4HNIA 2AEGA 5AX3A 3DK3A 5DR6A 3GEQA 3F61A 4D2RA 4C0TA 4PTCA 5TOZA 3HAVA 4M0ZA 3ZRMA 4O7TA 2C3LA 2ITVA 3LXLA 1K3AA 3P9JA 5E1EA 5EDRA 5HVYA 4ITHA 5LVLA 3V51A 4C36A 1JQHA 3HRBA 5M4CA 5JK3A 4DEGA 2A19B 3QAME 3FSFA 4BZNA 4U97A 4MD9E 4M66A 2J90A 5BVEA 4EQCA 3P7AA 3QLGA 4NTSA 4FOBA 3VUDA 4I3ZA 3UDBA 2KULA 4E26A 2X81A 4NIFB 4NCTA 4BDDA 1B6CB 4FTKA 4FG7A 3TV7A 3DFCB 3MFUA 4O4FA 1Y91A 5L8JA 3ZC5A 4PQNA 3W10A 1R0EA 3PPZA 4BDCA 3TUDA 4M69B 2VTTA 4FTLA 4AXDA 3LCOA 3LCSA 5ANIA 3ZXZA 4D2SA 3BI6A 3JXWA 3GFEA 3BPRA 3IQ7A 3F7WA 3R7VA 4EZ3A 3E88A 1XH8A 3CIKA 3U6JA 1P4FA 2F2UA 4AGUA 4A9YA 2PU8A 4X2NA 2W5BA 3SW7A 2GS7A 4WOVA 2R3HA 2BZIB 3DBFA 2V22A 2XS0A 1A06A 3MPTA 1Y8GA 4QMOA 2IVSA 3H9FA 3PUPA 3EQCA 3PA4A 4GK3A 5A14A 1FQ1B 1J7LA 4AZTA 4G6NA 4GU9A 3SHEA 4M69A 2V5QA 3DFAA 3FSKA 3QYZA 4IX6A 5BUEA 3N9XA 3PVWA 4X2FA 2Z60A 4MH7A 2R64A 3D83A 3O96A 5HIBA 1A48A 3KU2A 4DITA 3SOAA 1G8AA 3A61A 2ZB0A 5HQ0A 2VZ6A 3WF9A 3ENMA 3KK8A 4AFEA 3U9NA 4FKOA 4DGMA 4MAOA 3AT3A 2YEXA 5BVWA 3MB6A 4OTGA 1S9IA 3D0EA 3RM7A 3WF6A 2WEVA 2YIRA 3IW5A 4RFZA 2YIQA 4DINA 3LLTA 3OXIA 4D2WA 3CKWA 1F0QA 4MXYA 4C3RA 2ZJWA 4R8QA 1Q99A 5T3QA 4ANNA 2VX3A 3EN4A 3UIUA 5T6KA 4MHAA 3O2MA 4L3LA 2H34A 4D1SA 5FXRA 2QOQA 3HUBA 2B55A 4FYNA 4NFMA 4O1OA 2REIA 4N6ZA 3FLQA 1KWPA 4JG6A 4M84A 5I9UA 1DI9A 4YP8A 4BCGA 3FL4A 3QGWA 2X2LA 3SV0A 4OBOA 4FTCA 3SLSA 4C62A 4IX4A 2WTDA 3GUBA 4PDYA 2FO0A 3FMDA 4CSVA 4JRNA 1JKSA 4LM5A 5IUHA 4CFWA 3ZLWA 4YO4A 1W2CA 3CLYA 1XKKA 3FLYA 2ZVAA 1UNLA 5DYJA 3TACA 3PJ1A 5CVHA 3C4XA 4F08A 4IZAA 5JGAA 3NYOA 4OAVB 1FMKA 2NNWB 2IEWA 2J6MA 4AE6A 5E92A 4QMPA 5EOBA 3F66A 3KULB 5A4TA 3S3IA 4IZ5A 3Q9YA 4M0YA 4AE9A 1O6YA 4PDSA 3FXWA 5AV4A 3RPYA 2W06A 2OJIA 3FLWA 4F0GA 3OEZA 3NVMB 4QPAA 5A4LA 2QD9A 4FV2A 3F5XA 3RZFA 2W0JA 4MD8E 2QQ7A 3TXOA 3VNTA 4FKVA 3D5VA 4Y95A 3LFFA 4NSTA 1P5EA 4U43A 5AR8A 4RFYA 3FHRA 3IK3A 1UWHA 2W9ZB 3BHUA 3IW4A 4PDPA 4U3YA 2Y4IC 3AC3A 4FKSA 3EZVA 3ZFXA 4BFMA 4CFMA 3QUDA 4I5CA 2CLXA 5EQEA 5IQCA 4O1PA 3MJ1A 3ZTXA 3UP7A 1M14A 2J9MA 1LR4A 1H0VA 2R4BA 2Y4IB 4IWPA 4AF3A 4BJJA 4YBJA 2ZV9A 4ZY4A 5HBHA 3NS9A 3V8WA 1S9JA 3VUKA 4YPSA 3VS3A 3FWQA 2B52A 4IHPA 3V8SA 4CFVA 3HRFA 3D5WA 3QRKA 4AZWA 3F3TA 3ATSA 3B2TA 4FNXA 3P08A 3DNEA 3TEIA 5H3QA 1APME 1FVTA 3EZRA 4YZDA 2C0OA 2VTMA 4I6FA 4RC4A 2JKMA 2PMOX 3FBVA 1OIUA 4V0GA 3HECA 3NYXA 5HGIA 3TI1A 2VTOA 5L2TA 2BILB 2G1TA 4DH3A 3HX4A 5IDPA 4D4RA 4QP8A 2UW3A 4X2GA 3QBNA 4R7IA 4E6CA 5J95A 4O86A 2EUFB 2P55A 2OICA 4F99A 5IA3A 2YN8A 3L9NA 5K4IA 2VWXA 3FXZA 3BWFA 3UOJA 4UMQA 5FEDA 2CGWA 2ACXA 4KIKA 3QALE 3EKKA 3PXFA 4BWPA 2I7QA 4Y83A 5IQHA 1P4OA 4MXOA 4C3PA 4FZAB 4I4EA 2NRYA 5KMMA 3D5UA 3C4EA 3KVXA 4OBQA 5CI6A 2R0IA 3DY7A 5L8LA 2CJMA 4EJNA 2F7ZE 5KE0A 3VWAA 3FKLA 5HTCA 2EXCX 2VAGA 1XH5A 5FBOA 1PXLA 4G1WA 4PMPA 2FUMA 3LFCA 4S32A 3GU6A 2YFXA 4U9AA 4E4NA 3A2CA 1KE6A 3QTSA 4IFGA 4O0TA 2R3JA 3FLNC 4KWPA 3LFAA 3EQBA 3RINA 1R78A 3WZDA 5L2SA 1GIJA 3FI4A 4L9IA 4NKSA 4G3GA 2XJ0A 4UWCA 1JSVA 4XG3A 5LJJA 3L1SA 1W83A 4DFYA 4WNMA 3TKIA 5AV1A 3ZXTA 2HW6A 4QEBA 3C0GA 5JMSA 3LE6A 2O2UA 1G8SA 5F4NA 2QHNA 5J7HA 3SVVA 2VO7A 3R00A 3CEKA 3FQHA 4UALA 3HUCA 2IVTA 5E1SA 4RIYB 1ZMVA 2OF2A 3FJQE 1FVVA 4A06A 4UY9A 5DPVA 2NYAA 3OXZA 3DT1A 2AYPA 5G1XA 4NJ3A 4EI4A 4PNKA 3POZA 4FEQA 2CNVA 3KK9A 5FDPA 3QXPA 1OGYA 3IW6A 4U41A 1REJA 3CP9A 1NVSA 4J1RA 1WVXA 2UV2A 4HCVA 3COKA 5FD2A 5K5NA 5LMBA 2QONA 3PRIA 2O63A 4BHZA 3Q53A 2BVAA 4KKEA 3PVUA 2ZB1A 5ETCA 3PG3A 3Q3BA 4YHFA 3WILA 1SNUA 3CY2A 4E4LA 4FT9A 4HGEA 2HZ4A 4D0XA 4ASXA 4YR8A 4BB4A 4RIYA 5BYZA 1CTPE 4B8MA 2QNJA 3FY0A 4O4CA 4ZLZA 4YJNA 4A4LA 3EQHA 4AA4A 1TQPA 4YZ9A 3COHA 3PWDA 4MNEA 4DHJA 4WKQA 2BR1A 3E64A 4QNYA 5AX9A 4U44A 5J9LA 4IM2A 4OTRA 2JAMA 2X7OA 5J5SA 5IQGA 1WCCA 3KRJA 2VD5A 3D7TB 2QOOA 1PMUA 4JQ7A 1ZYLA 3FPMA 5DOSA 3VS6A 4A4XA 5FWKK 5DT4A 5IKWA 2W96B 4JI9A 4P2KA 5EYCA 1OIRA 3W0QA 3E8CA 2R2PA 4IAFA 2VWIA 2WMQA 4FT0A 4DGLC 5DG5A 4RLKA 4G3CA 5DLSA 2RFEA 2XIKA 3MBLA 4I4FA 4MEDA 4YLLA 5HTIA 3AC1A 4HPTE 3C7QA 1FVRA 4IDTA 3IDPA 2BRNA 2X2MA 3F82A 5FXSA 3VBXA 5BPYA 2J5EA 3PRFA 3U55A 2OO8X 3REPA 2XANA 4EH3A 4DYMA 3MY0A 5C9CA 2PMLX 3O0GA 5IH4A 3JR1A 2G2IA 4DHZA 2UZBA 3G33A 2BRMA 4FZDB 2J4ZA 3HV6A 1U5RA 4KAOA 4MF1A 4ONAA 4U42A 1OL7A 4W9XA 4RWLA 4CD0A 3Q9ZA 4IAIA 2F7XE 5AAFA 5KX8A 5ANKA 4DFUA 1V0BA 4FR4A 3NW7A 1CKPA 3R04A 3KEXA 4Y73A 5LMKC 2IZTA 4PMTA 2ZM1A 4J53A 5EM7A 2E9UA 4M7IA 4DLJA 3EYGA 3IOKA 5CSPA 4AAAA 2X1NA 3QKMA 4K2RA 4KA3A 2HAKA 3FC2A 2OZAB 4FL2A 4KD1A 4ZTNA 5J87A 4ZXTA 5GIOE 3U4WA 4EKKA 3RK9A 4IC8A 4YC8A 1YXUA 3C4CA 3QQGA 1IRKA 4CV8A 3IKAA 2ETKA 4UWYA 1VR2A 3R1YA 4YC6A 3BL9A 1PXPA 3DKOA 3QC4A 3ODYX 5BV3A 5AM7A 3PY0A 3WE8A 4BRXA 3V6RA 3BGQA 4V05A 1U4DA 4MNFA 3NUSA 4FZ7A 3ZMMA 2WMBA 4FYOA 5FTQA 5LMKA 4DGGA 2GNJA 1H8FA 1YXSA 2XK3A 4GT5A 4I6BA 4I6LA 3ORMA 3SG8A 2WQNA 4ZEGA 4MK0A 2ITNA 5KMIA 4R78A 3R8ZA 5CU6A 3QTUA 2XCKA 2PL0A 3MVMA 4IXPA 5M56A 2W1EA 4XG8A 2PK9A 2UZLA 4JG7A 3LQ8A 3M11A 1YDTE 3IO7A 5HICA 2PY3A 3OFMA 3OT3A 5HHWA 4UB7A 3V01A 4BI1A 4I0SA 2YDIA 2QOKA 2PVJA 2YJSA 3K5UA 3FDNA 3NUNA 3QUPA 4XG2A 3V04A 2JDTA 3BGPA 4ITIA 2BHHA 4QPSA 3IG7A 2UZUE 5HIEA 3C4WA 3GCQA 3GU7A 4NW6A 4U79A 4B0GA 2X0QA 4QP9A 4ZMFA 2PVYA 3MS9A 4TYGA 3HMOA 4O2ZA 2G2HA 3EIDA 3Q60A 1G3NA 3TG1A 4G6LA 5M4UA 3VBQA 3VN9A 3F2RA 2RFDA 4I93A 4DCAA 4FV6A 2DUVA 2CCIA 2OU7A 3AGMA 3MSSA 4L44A 4UZHA 3UQGA 5IMXA 1H01A 1OZ1A 4CKIA 3EMGA 3W0OA 2W4JA 4UYNA 2H9VA 3AC2A 1Q3WA 1OL1A 3PLAE 2HCKA 2OH0E 4MQ1A 5IDNA 5CX9A 4TY1A 2B9IA 4U5JA 3P7BA 4AN2A 1OKVA 3UBDA 3KRLA 4DG0E 1OUKA 1ZWSA 2X6EA 3FUPA 5IA4A 4BL1A 4IM0A 1GIIA 2V0DA 4FV9A 4KIOA 5A3XA 4PPBA 2F49A 2C6TA 2ITWA 3MVJA 4CCUA 3R2YA 4HVIA 4FJVA 3NW5A 1URCA 1FOTA 3C13A 3RWQA 3DK7A 5ACBC 1PY5A 4LOQA 3FLZA 4R77A 2WMAA 2IO6A 2PVLA 3U6IA 3EN7A 2R7IA 3IPHA 4WHZA 1NT2A 4FSTA 4A4OA 4Q9ZA 4BGGA 4FIGA 3CQWA 5I5ZA 5D12A 3HA6A 4U7ZA 3UPZA 4QQCA 2O65A 3LW0A 4EH2A 2VO0A 4IJ9A 5HZNA 3SGCA 1W0XC 2QR8A 3I5NA 5CALA 1CM8A 1W8CA 4ZAUA 2E9PA 1QPDA 3ZHPC 3H0YA 5HLPA 4USFA 3MV5A 3UDZA 4EHGA 3OW3A 5KMLA 4EBVA 4C33A 2HIWA 2YZAA 2BALA 5AM6A 1AQ1A 3FC1X 3ZZEA 2VTQA 3KXXA 5H8BA 4E4MA 1GAGA 1YHSA 3KB7A 2Z2WA 2GMXA 3OCGA 4ZIMA 4J8MA 4JVGA 1OIQA 3TWJA 5AUUA 3HMNA 1Y8YA 2W4OA 4YJOA 1J1BA 2W17A 4P7EA 2WHBA 3FXXA 4FRFA 3HVCA 3ZCLA 2VTNA 3W0SA 4R3PA 5K9IA 2RSVA 5JH6A 5M09A 3PDTA 1H1QA 2Z8CA 3PZHA 4FV0A 4D0WA 4JX3A 4X2KA 3W2PA 4H3QA 3VBYA 1IA8A 4FV3A 4R5SA 4CYIA 4D55A 3R73A 4O7RA 2Q0BA 3VAPA 4RIXA 3ANQA 2ITXA 1SVGA 4PRJA 4QMYA 3GT8A 1UNHA 1XH7A 3F2AA 4C8BA 3IONA 2CGVA 3E7VA 3O8TA 4E3CA 2PUPA 5ACKA 4D5KA 5HE0A 3TNHA 4E8AA 4PP7A 3G9LX 3DS6A 4HYSA 5DH3A 3VQUA 3D5XA 4WSQA 3ZLYA 2QG7A 2VWUA 3ATTA 5EHLA 3UP2A 3V5LA 4I5HA 4FV7A 5EHOA 1GZOA 2J50A 3GP0A 5E8ZA 3W8QA 2PUIA 4O96A 4ZJIA 2XRWA 2RF9A 5AMNA 2EB2A 3HNGA 2C1AA 4W8EA 4ACDA 1SMHA 4ACHA 3D4QA 3Q5IA 4G16A 4QMZA 4NYEA 3KC3A 2BIKB 2BZJA 3Q4CA 5JGDA 3A7JA 1J1CA 3NFGB 4WG4A 2ETRA 4YSMA 4ANQA 5J1WA 3GENA 4J8NA 5LARA 1M7NA 4EBWA 3PWYA 3LJ1A 3PPJA 4O83A 4QYFA 3RAIA 3SQQA 4O7WA 3KMWA 4G6OA 4FT7A 4CQEA 3QTIA 4ZTLA 1M7QA 2RL5A 5JKGA 3GB2A 4ZMEA 5F94A 3CPBA 1L3RE 4KBKA 4DFXE 3DCVA 3RNIA 2PTKA 5CT0A 5GZ9A 5L6WL 3R9HA 4CLIA 3ZLXA 3QUEA 3E8DA 4L7FA 1R0PA 5F9EA 5B2KA 3CKXA 4JG8A 1Q8YA 2V62A 4N70A 2OH4A 3MWUA 2AC3A 3BV3A 2J0IA 5CSHA 1BI7A 4I94A 5CAPA 2Q0NA 4K8AA 5HIDA 1Z9XA 2PVHA 4WIHA 4AT4A 3NIEA 4G31A 3QGYA 4O21A 4F9AA 1XMLA 2B7AA 2RKUA 4D5HA 3P5JC 3ZU7A 1WMKA 5M08A 5DR9A 2C5OA 3GOKA 4QTAA 3ZDUA 4DEAA 4O0VA 3H30A 2QU6A 2VX1A 2J0KA 3FKNA 3I1AA 4IH8A 4YZCA 5CYIA 2J0LA 5A4QA 3UOLA 3AC5A 3ZO4A 3OWLA 4YJSA 4CGAA 3NSZA 3H10A 4QQ5A 4AXCA 3ORXA 5LMAA 4RX8A 4W4VA 4M12A 4EORA 2WXVA 4MXCA 4EYJA 2YZLA 4AOIA 2BTSA 4DT8A 3BL7A 2R3KA 3DKCA 2WNTA 4XCUA 4E5WA 4EZ7A 4S34A 4YSJA 2OSCA 5JFVA 2XAOA 3O50A 1T46A 4O0SA 3UODA 4E93A 5BUIA 3GU4A 4PUZA 1UV5A 3HZTA 4FSWA 4DT9A 1ST4A 2QKWB 4ZS0A 3WF5A 5AIRA 1WBNA 3LFEA 5B2LA 2X39A 5TKDA 5A54A 5AV3A 1Y6BA 3BU3A 3CS9A 4TT7A 1JAMA 2GHMA 5HX8A 3CGFA 3DB8A 2HZNA 5CAVA 3VBVA 4IZYA 1H4LA 3DK6A 3T9IA 3VJOA 2W05A 1QPEA 2OG8A 3DKFA 2VU3A 4I20A 4IWOA 4I92A 4PL5A 2IW9A 2G2FA 5HNIX 2X0OA 3U4UA 3HMMA 2R9SA 4R1VA 3V5JA 4BN1A 3FHIA 4TN6A 4UMRA 2BDWA 4C4GA 1AGWA 4XG6A 3Q6UA 3BZ3A 3O8UA 4BDEA 5HI2A 1DAYA 3UMWA 5BNJA 3C9WA 4HZRA 4FKRA 1PXIA 4KS7A 3WZKA 4AXFA 5GNKA 2Q83A 1W98A 4F64A 3ZM9A 5DR2A 5HG7A 4A9UA 4EOKA 1GIHA 1H1RA 3H9OA 3ORLA 4JNWA 3DDQA 4MWIA 4B8LA 4OTWA 3BLAA 1YWRA 4F78A 2CLQA 5BX0A 4GK4A 2JKKA 2PHKA 3K2LA 3PXYA 1IG1A 2CSNA 4IWQA 2NPQA 4EOJA 2QOHA 4YJTA 5GINE 4JT3A 3LJ0A 4KINA 3PVBA 3HKOA 2AC5A 2V7OA 2YIWA 3R02A 3UG1A 4TYIA 5B0XA 2NP8A 3F3UA 2PZRA 4NUSA 1BYGA 3WBLA 1I09A 4MD7E 4BZDA 3BYOA 4C4HA 3QZFA 3RCJA 5H8EA 4USDA 1I44A 5A6NA 5M4FA 5EQPA 5F1ZA 5J7BA 2FSTX 4BTFA 3E7OA 5JRSA 2ITUA 5E8WA 3GQIA 3ZRKA 4FKQA 4OTPA 1VZOA 2EU9A 4FNWA 4W9WA 2IG7A 4ZSLA 3S2PA 3UNJA 5T68A 1GY3A 3A7HA 4PV0A 5I0BA 2UW4A 1OUYA 5AAGA 2GFSA 3QQLA 4FG8A 3RHKA 4UMPA 4MXZA 4UX9A 4O4BB 4RFMA 3EN6A 2YWVA 2UVXA 4IVDA 5BYLA 2X6DA 4I24A 5CQUA 3LLAA 3NYVA 2WMSA 4UBAA 4WO5A 3HAMA 1Q8WA 2XCHA 3UTOA 3PJ3A 4M14A 2WB8A 1OIYA 3I7BA 3TZMA 4Q2AA 4MUQA 4DTAA 2RG6A 3QQUA 4N0SA 5JT2A 4GYIA 4L42A 4BCQA 5ITAA 4YHJA 2H6DA 1U54A 5JFXA 4HVSA 3QQHA 5ANEA 2YCQA 3FMHA 2VRXA 3QHWA 3U51A 5EM6A 3O7LB 3A8WA 4I6HA 2XRUA 3KVWA 3AD4A 5AR2A 2ZMCA 3D2IA 2QR7A 4O7ZA 3FMKA 4F4PA 3C5UA 5KMKA 3LCDA 4FKLA 2OF4A 2EVAA 2JIIA 4N4SA 1OECA 4QT1A 1H1SA 2XALA 3BEAA 4X21A 4BTJA 4IB0A 3ANRA 3FMJA 4FTTA 5CZIA 3E8EA 2E2BA 3R7IA 2X9FA 1XH9A 4HYHA 1H08A 4RX5A 3UO5A 3DDPA 4D1ZA 1OKWA 4FKTA 3I6WA 4L6QA 4CFXA 5EKOA 5EI8A 3QCXA 3QD2B 4GK2A 4DFNA 4RZWA 4DEDA 3W2QA 3BWJA 3QTZA 1NVRA 2VO3A 2ONLC 5GJFA 3EFLA 4IEBA 1B38A 3RP9A 4DLIA 5M44A 2QURA 2BUJA 3GXLA 3Q32A 3KXGA 4PF4A 3ALOA 3QD4A 1QPCA 3UO6A 3HV4A 3RCDA 2RGPA 2ITYA 3NWWA 4IWDA 2WQEA 4FSUA 1Y57A 2G01A 5LVNA 3E93A 5AADA 2YM7A 4PWNA 2HWPA 4EK4A 1WBWA 4YJQA 2XKFA 4C61A 3F9NA 4X6QC 4FL1A 5L2WA 4CG8A 2YDKA 4H3PA 5E8YA 3KRXA 3PA3A 1BKXA 3S95A 4HJOA 4IM3A 5KBRA 4O84A 1CSNA 4APCA 3RZBA 4ARKA 4GKIA 2WZJA 4FKPA 5HD7A 5C03A 5FXQA 2ZMDA 2B0QA 2JD5A 2WIHA 2ZAZA 3PPKA 5IZFA 3HP5A 4LUDA 4XV3A 4YHTA 3UG2A 4EH9A 3FI8A 2UUEA 4E1ZA 2W9FB 2IPXA 2XYNA 3F3ZA 4C3FA 5KMJA 4F65A 4G34A 3FZRA 3NZ0A 4WSYA 3PXRA 2A27A 4TXCA 1JPAA 2YWPA 4ID7A 3LPBA 5CQWA 5HU9A 3RAWA 3D7ZA 4BJJB 3DLZA 2ERKA 4GFGA 4MBIA 5IA5A 4EH6A 3EL7A 4KRCA 4L46A 1PXJA 3TNPC 1OITA 5I3RA 2QKRA 1ZYSA 3HDMA 4FTNA 4F9CA 2X9EA 4I0RA 3E92A 4PMSA 4LRKA 3GC7A 3ORPA 4DGOA 2R3NA 3VS5A 4QQJA 4E6QA 3RPVA 4ZJVA 2W7XA 4Y5QA 2WEIA 5D10A 4LV5A 5EI6A 1UU8A 1OL5A 5TT7A 4D2TA 4ZJJA 3RPRA 4AWIA 4V0GB 3GCVA 1YQJA 4QQTA 3VF9A 4F09A 2C6LA 4FGRA 4YUQA 3ZBXA 3NUPA 3R28A 3ALNA 2F57A 4FTUA 3UC4A 3G51A 5IPJA 2Z7SA 3VUIA 2CMWA 5HCYA 5I9ZA 3H4JA 5AA8A 3NAYA 3OD6X 4FOCA 4UXQA 3AMAA 3A4PA 4KIKB 1GZKA 2O8YA 3BHVA 3ROCA 3LIJA 4U40A 5CSXA 4XV2A 4H3BA 2WMWA 4QYYA 3LVPA 4EUTA 3ZBFA 2C6KA 3BHTA 4PPCA 4GL9A 3F5UA 4RVMA 5FGKA 2JBOA 2UW8A 3RI1A 3P4KA 1YI3A 2VWVA 2YM5A 3WZJA 5L2QA 3QF9A 3G6GA 5ANOA 4IDVA 2BAJA 4Y46A 3TT0A 4E5AX 3VJNA 3MA3A 4V01A 2X4FA 1Q8TA 2CKQA 2R3OA 4CMOA 5K5XA 2QO9A 4QP1A 2W5AA 3HL7A 4RA4A 3BLQA 2AQXA 4WD5A 4MF0A 4LFIA 3R9NA 5GZAA 2JIUA 4II5A 3T9TA 4ZSGA 3QZIA 2HXLA 3E3PA 4OBPA 1UVRA 5DGZA 5LOHA 5ICPA 5IUIA 3PUFC 4RIWA 4U0IA 4FSZA 4IAAA 3QTRA 1BL7A 4B9DA 2WTJA 4PL4A 3NCZA 1UU3A 5DHJA 3G9NA 5GZ8A 2JDSA 2VWZA 2XKEA 4KSQA 5ANJA 3DXNA 3LFSA 3Q2JA 1M2RA 4ERWA 4OGRA 5DMZA 5HX6A 2IZUA 4ACGA 3AT2A 1PMVA 2Y6MA 2FSMX 4ANBA 4NM5A 5CZHA 3BELA 3KXHA 4QD6A 4EK5A 3MFSA 2SRCA 5HO8A 3TJCA 3DJ6A 4OT5A 3OTUA 4OUCA 1KE5A 5ETFA 3KXZA 5JGBA 2HOGA 4EOMA 2B54A 3OOMA 3QTXA 4EJ7A 3TZ9A 2RG5A 3EKNA 4JXFA 4YJPA 3ZEPA 4EQUA 1W82A 4RC2A 2ZV2A 4XEYA 2FSOX 3TUBA 2XK8A 3VS4A 3OBGA 4XHKB 3GCSA 3Q9XA 4FIHA 4MX9A 4GYGA 2C30A 3OT8A 4AACA 3W2OA 3FEGA 1JNKA 3A62A 1W2DA 5AP5A 4MCVA 3O23A 1ZYJA 1RE8A 4NFNA 2XKCA 1R1WA 2FH9A 5JN2A 3LAUA 4LQMA 4MNEB 5JQ8A 2OFVA 3QTWA 5AUVA 5M06A 3N51A 1GJOA 1CKIA 1WBVA 1YHVA 3EQPA 3PJ8A 3TMOA 4IZ7A 5EH0A 3UYSA 3ZEWA 4DFZE 4FEWA 3S00A 4O0UA 3KN6A 5HE2A 4Y85A 4AW5A 2X4ZA 5CLPA 4XMOA 5H8GA 5HNGA 2VTSA 3OXTA 4AG8A 5CXZA 4NL0A 4IVCA 3OMVA 4AOJA 2C6IA 2OKRA 2V7AA 3GU8A 2XNOA 3L9PA 3ACKA 3FPQA 3OROA 1JSUA 4Z3VA 4FKGA 5IEYA 2XNGA 3MGYA 2W4KA