4AE9A

Structure and function of the human sperm-specific isoform of protein kinase a (pka) catalytic subunit c alpha 2
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
339
structure length
321
Chain Sequence
SSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA
publication title Structure and Function of the Human Sperm-Specific Isoform of Protein Kinase a (Pka) Catalytic Subunit Calpha2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 321
sequence length 339
chains with identical sequence B
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ae9A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ae9A02
3BLHA 3P7BA 2BRMA 3H0ZA 4U3ZA 1P5EA 4IIRA 4BCGA 1PYEA 3RNYA 4CZTA 2CCIA 3SXFA 5FDPA 2G01A 5CEKA 3UE4A 3ZRMA 3D2KA 2IVTA 2VTPA 3BHUA 3HX4A 3Q5IA 2JAVA 5BNJA 5A4QA 3TJDA 4KIKB 3ZHPC 3SA0A 2RGPA 2HWPA 4CLIA 5JGAA 3V3VA 4YMJA 2BR1A 4ZLOA 5AR2A 2GQRA 4FSRA 4CFUA 4WG5A 4IX3A 3BV2A 2ZOQA 4YPSA 2EXEA 4TNBA 4Y5HA 3UQCA 1PRYA 2XUUA 1UU9A 4JL9A 5B7VA 4UBAA 1YXUA 1CTPE 3OG7A 3GENA 4KBAA 2CKQA 1FMOE 4BWXA 2J5FA 2YIWA 4FIJA 5EW3A 3OBGA 4IAAA 5LMKC 4YO6A 1Q24A 2O0UA 4ORKA 3DY7A 3DLZA 3HRBA 2HIWA 2W06A 3DKGA 4U79A 2ZV2A 4G9CA 3R7UA 5TKDA 3IDPA 4CG8A 4CQEA 4E3CA 3OVVA 3NMUF 5HBEA 2WTCA 2QOFA 3OC1A 3AD6A 3NSZA 1RE8A 2QOHA 1XH6A 4NKAA 3R1YA 2OI4X 4GIIA 2E2BA 4KRCA 4A9UA 2BHEA 2OBJA 4KSQA 3U9CA 5HG9A 2BKKA 1BL6A 4EWQA 1QPCA 1MQ4A 3DKCA 4FV8A 2I0VA 2QC6A 3DQXA 1S9JA 3OCBA 1DAWA 3TZ9A 3R8VA 4IM2A 2DQ7X 4QTBA 5EYMA 2OICA 4YLLA 4YHTA 3RBWA 2XH5A 1J1BA 4OT5A 4DTKA 4DH8A 3G0EA 2C0OA 2RF9A 3EYHA 3FSFA 3QRIA 4O2ZA 4O7SA 2G2IA 3COHA 3ENHA 4CMOA 4ERWA 3VULA 3F3TA 4JX7A 2GNIA 5J87A 2PVRA 2JDVA 3DPKA 2EU9A 3U9NA 3QQLA 1MRYA 1SVHA 2UW9A 2QVSE 4R7HA 5AP3A 1NVQA 4ANLA 2ITWA 1IAHA 1M2RA 4DFXE 3R71A 4G5PA 4LGGA 5DR2A 1OIQA 4YNEA 2W1DA 2X81A 2W9FB 3ZMMA 4KUJA 4QP2A 3UMXA 2F9GA 3UNKA 4BDCA 1OGUA 4NCTC 4CLJA 2JFLA 2XBAA 5IQGA 3RK7A 4RJ7A 5C03A 3FJQE 3P79A 3KRLA 4CV9A 3CPBA 3IPHA 3BCEA 2XK7A 4A4LA 5ANEA 4J1RA 3VBYA 3GC8A 1QPEA 3QKMA 2HZIA 2XS0A 1J91A 3R21A 4CNHA 4JX3A 4P7EA 4DT9A 3P9JA 3V8TA 4TPTA 4ENYA 4IM3A 4UMRA 2YISA 2OXYA 2FSTX 2Z7SA 3PXQA 4AA5A 4C58A 2E9UA 2OK1A 4IANA 4W9XA 3KCKA 4U45A 5DT4A 3BRBA 3QCXA 5HO6A 4AX8A 4RWKA 3G0FA 4KAOA 4C36A 3R9RA 3BYVA 4RFYA 5L8JA 3CR0A 3HLLA 4MF1A 4DH1A 2BALA 4YTHA 4BGQA 5KX8A 2C3IB 4FG9A 1W83A 4OTPA 2ERZE 4LMUA 4KSPA 4U9AA 5B0XA 5FG8A 3ZC6A 3QC9A 5TT7A 3VBXA 3AMAA 3VWAA 2GPHA 4FOBA 1U59A 5AAEA 2X9EA 2F49A 5CF4A 4E5AX 1J7IA 3KRXA 4XG8A 2CKPA 1SYKA 4G3GA 4W4YA 3SRVB 3BYUA 3EN4A 2BDWA 4JS8A 3EIDA 3A7GA 4HPTE 4ASXA 2ZV7A 3KRRA 3R9NA 4PQNA 4TYJA 3NDMA 4H39A 5EOLA 2JITA 3CTHA 5CT0A 1YHSA 3R7OA 2R3NA 4WHZA 3MS9A 5DFPA 4A9TA 4PTEA 1VR2A 2YERA 4DGMA 3I6WA 4HZRA 4FZAB 4JAIA 4ALVA 3IW8A 4U8ZA 4DEEA 2PE2A 5DT0A 4MHAA 3R2YA 4OBQA 5EOBA 4OAUC 4R3PA 4FK6A 5TO8A 4F6UA 4FF8A 4M69A 4PMMA 3QKLA 4D9TA 3F7ZA 3VUKA 4AXAA 3CQWA 5JZJA 3WF6A 4CGAA 1UNLA 4D4YA 4RJ8A 4V04A 5CF8A 2XNEA 3W2CA 4AN3A 2J6MA 3BHYA 1G3NA 3Q4TA 3F5GA 4MXZA 2W0JA 3QTWA 3PZHA 4IVBA 3ZXTA 2VTNA 1WCCA 2HXQA 3D7TB 3MFSA 3VNTA 4N0SA 3NVMB 4PNKA 2ETKA 3BQCA 3QTXA 5D10A 3VAPA 3F66A 1S9IA 4RIOA 3UOKA 4IMYA 5JQ5A 4BTJA 4BGHA 4AT3A 4E6QA 2J9MA 2X7GA 2JD5A 2HXLA 1GAGA 3POOA 4CFFA 4F1MA 1APME 4JLCA 3I5NA 4TZRA 4GT5A 4PMTA 4EJ7A 4ANBA 3COKA 4KWPA 2WMRA 4YZDA 4O7VA 3PE2A 3VS7A 1ZXEA 5HTIA 2UZEA 3LPBA 2ITTA 1ZMWA 4O82A 4FIIA 3ODZX 3SXSA 3KN6A 4R78A 2ETRA 3HDMA 4HZSA 4IHPA 3RGFA 4AZTA 4TWNA 4I3ZA 4C4FA 4TYHB 3ZOSA 4ALWA 2OW3A 4KS7A 2R9SA 5BYYA 4QMXA 3IO7A 1R0EA 3PPZA 3HAMA 2F4JA 1Z5MA 3KVXA 3FPMA 4NKSA 2WQOA 3C1XA 1UWHA 3F9NA 1GOLA 4M67A 4E5WA 1PF8A 1FINA 5EM5A 5JH6A 5IA2A 4ACCA 1GIJA 1IR3A 3LHJA 4QQ5A 5J8IA 3M2WA 5KMIA 3CKWA 2JDSA 3RCJA 3EJ1A 5BMMA 1WBOA 1B38A 2J90A 4KB8A 3ORIA 4NT4A 1CSNA 2Z2WA 4PL5A 4QD6A 4WRSA 3LQ8A 4NTSA 2PVYA 3AC4A 4PDOA 4NM3A 4FVQA 1WBTA 5EQPA 4TNDA 1KV2A 5KE0A 2BUJA 5GJGA 2R0IA 2IW8A 4F0IA 2HAKA 5L2SA 4C4IA 3WZEA 4TXCA 1U4DA 3IECA 3EQBA 4LL0A 5CASA 3BYSA 2BPMA 3QAME 1IG1A 1IEPA 4ITIA 2BIKB 1ZYCA 4IAYA 5KMKA 4XUFA 4GJ2A 3D15A 5LOHA 5M51A 3G2FA 4UYNA 4USFA 3BEGA 3E8EA 3BE2A 4CT1A 2PUNA 2VWXA 4FV3A 4CFNA 4B8MA 2PVNA 2PWLA 1U54A 2PZ5A 4MNEB 1BX6A 2QOIA 4ZTMA 4NIFA 4OTWA 3D83A 2B53A 2IJMA 2Y8OA 3NEWA 2R3IA 3D5XA 5I3OA 4FKSA 4KKGA 3IOPA 4QMPA 1IA8A 3OOMA 2GS7A 3RK5A 1LEWA 3FL5A 1UKHA 4M8TA 3SVVA 3LLAA 4S30A 2R4BA 3NCGA 3CPCA 1OUYA 2OJGA 4KS8A 1EH4A 3MY5A 4D2RA 3B8QA 4GSBA 3QRTA 1UA2A 1P2AA 5EM6A 4O0VA 4NW5A 3TCPA 4GS6A 5K5XA 2HWOA 2P2HA 2C6OA 4Q9SA 4RC2A 3Q52A 2X8IA 3QXOA 3REPA 3EFWA 2B7AA 4DH7A 4J8MA 4FYNA 3TUCA 3MJ2A 2P2IA 4PRJA 1Y8YA 3FQHA 3ZLYA 2ZJWA 4G16A 4YGAA 1M7NA 3KXGA 1KOAA 5FTQA 5KMLA 3OP5A 4FG8A 4DGNA 1ZYDA 3PSCA 4PF4A 3NRMA 1PMVA 1OUKA 4KBCA 4FUYA 3DAJA 2FYSA 4MXYA 4W8EA 4E5BA 1UU7A 1XBAA 3NAYA 3B2WA 3F5XA 5CWZA 4QPMA 1B39A 3VJOA 4FTJA 4D4SA 5GZ8A 1PXLA 4U43A 2HY0A 3A61A 3V5LA 4NM0A 3NIEA 3EYGA 3VS3A 3ZM4A 5FXRA 3HKOA 3II5A 3AC2A 5EHLA 4BDDA 1XH8A 5C1QB 2CHLA 2YJRA 2ZAZA 2UZNA 4XP3A 4Y73A 4BIBA 1PW2A 3RZFA 2ITYA 1PKDA 5HIBA 3UVQA 2DYLA 3ZS5A 4HYIA 2IVUA 5BQ0A 2PUIA 4GYGA 1ATPE 4CCBA 1H1WA 2W4OA 4ACHA 3O17A 3SOCA 4FSZA 5B2KA 2V5QA 5DEWA 2H34A 3UC4A 4F0FA 5JFWA 5FBNC 3K3JA 4QYGA 2OH4A 4HVGA 4X6RA 3RJCA 5KMOA 2ZDUA 3DCVA 1TQIA 2PYWA 4A9YA 1YOMA 4DN5A 1P4FA 3HMMA 4F7SA 4ANNA 3PXFA 4XV2A 3UPZA 4IJ9A 5D7AA 4EONA 1OL7A 2YDKA 3R1NA 3ORKA 3WI6A 5HU9A 3OWKA 4LFIA 5E8XA 2C6EA 3NZ0A 4E8AA 4AU8A 4BTMA 4X2KA 5DEYA 1Q5KA 5BVEA 4Z9LA 5C9CA 2QG5A 1Z57A 3C5UA 4RQVA 3R04A 3F2AA 2W99B 5D12A 4AQCA 4FT7A 4BIDA 3QQFA 5LMBA 2KTYA 5TF9A 3R9OA 4GFOA 2X9FA 4QYEA 2YM4A 3AD5A 3DDPA 1WBPA 4U6RA 5ETAA 3R6XA 3MFTA 2BVAA 3R2BA 4Y72A 3QQJA 3JY0A 3QUPA 2ZB1A 1TVOA 1GJOA 2NRUA 2BZKB 2QI8A 3UZTA 4YTFA 4IWQA 4USDA 2XRWA 3LCDA 4F7JA 2ERKA 5IA5A 3OUNB 2J2IB 3CQEA 2QOBA 3CEKA 3AT3A 1BMKA 3TM0A 3MB7A 3HA6A 3POZA 3THBA 2CGVA 2X7OA 1OKWA 3LCKA 3ORXA 3QL8A 5DNRA 2GQGA 5HKMA 3UNZA 1W0XC 2R3FA 3ITZA 4Q5HA 5DA3A 4CRSA 5IH6A 4JBPA 2YM3A 3EN6A 1R39A 3G5DA 2UVYA 2YA9A 3C0IA 1OM1A 4B9DA 3QLGA 3UYSA 2XJ2A 3CLYA 3RM6A 4EYMA 5JRQA 2CN5A 2QO7A 4FSWA 5CS6A 4QMYA 3OCGA 2ITQA 4UWCA 5AP7A 2UZWE 2FSMX 2R7BA 2V62A 3PPJA 5AX9A 4BDFA 3GC9A 3V8SA 3K3IA 4NM5A 3UZRA 1CM8A 1MQBA 1W7HA 3W2OA 2VTAA 3F3ZA 2QO9A 3I5ZA 2Q0NA 2CKEA 3BYMA 3QX4A 3V04A 3ZZWA 4YUQA 2WMXA 2JIUA 3WYXA 2ZYBA 3LAUA 2J0JA 3QRKA 4B0GA 3GU5A 2JLDA 5J5TA 4EQCA 4YBKA 3TKUA 4IACA 4AE6A 2Q83A 3GCPA 4IM0A 4X3FA 4ZTHA 3W2PA 4HGLA 4FVRA 3BYOA 4C3PA 5M56A 3KVWA 4G6NA 4RIYA 3ZTXA 2YLEA 4GG5A 4ANQA 1H07A 3DA6A 4D4RA 3ZO4A 5AV0A 4BI2A 2QOQA 2WMVA 3EH9A 3QHWA 4JDHA 3ZDUA 5I9ZA 3PIXA 4WG4A 1IASA 2Y4PA 4CZUA 2EVAA 2PZPA 5E90A 1FBNA 3C4ZA 3P78A 4JR7A 4TN6A 5JZNA 1PMEA 1CDKA 1L3RE 1YI4A 1O9UA 3BHVA 2VO6A 2CNVA 4UWYA 5A4CA 3L8XA 2WKMA 4YLJA 4CD0A 5IQHA 4F65A 3DS6A 1OB3A 2WEIA 4RJ4A 3G6GA 3ORNA 1J3HA 3ZO2A 2ZM1A 4F7NA 3ZZEA 5FP5A 4WRGA 2BCJA 4XEYA 3R7EA 3CE3A 4WT6A 3NGAA 3EL8A 5AWMA 3UIXA 5IQFA 4WSQA 2UUEA 4F4PA 4YHJA 2JC6A 3LJ1A 5FEQA 4RG0A 2V22A 2W4KA 4IB5A 4PUZA 3MV5A 4CG9A 3C4FA 4M3QA 2YIXA 3D14A 4FTAA 4NL0A 3G33A 1AQ1A 2F7EE 5D7VA 1CKIA 3HV5A 4APPA 4CYJA 3LCTA 2UZOA 3G9NA 1OMWA 2DUVA 2WMSA 4JOAA 4HGEA 4ZJVA 4AZFA 3NUYA 1ZZLA 4FEVA 2YM5A 2X6DA 1M2PA 4GIHA 4RWIA 5M09A 4Y85A 2BROA 3LFCA 4CXAA 4DT8A 2W1GA 3Q3BA 4IBMA 3CGOA 2OZAA 3KRJA 3LJ2A 3PA4A 4WG3A 4OBOA 2I7QA 4H05A 4O6EA 4UMQA 1ZRZA 4FT3A 5M4UA 3A4PA 1G8SA 3BQRA 4L3LA 5FLFA 2UVXA 3EQRA 4LQMA 1NVRA 4Z55A 5GHVA 5IUIA 4BFMA 5JGBA 5L2WA 3UIUA 3HA8A 4NW6A 4JIKA 5EHYA 5I9VA 3F88A 3QWJA 3UQGA 3ULZA 5CI6A 4BCQA 2Z8CA 4WO5A 5DG5A 1H01A 4U81A 4U40A 4WSYA 2FA2A 3CJGA 2J5EA 5TR6A 5I9YA 1Q61A 1YWRA 1KE6A 4MXAA 5CALA 2W1FA 3I4BA 2WQNA 4RIXA 5AP4A 1FMKA 2FGIA 4EUTA 3NR9A 4RQKA 5BVOA 2V7AA 3R9HA 1I44A 4G34A 4KIOA 4R3CA 3R7YA 3VBWA 1J7LA 1F5QA 3VS6A 2H6DA 4ONAA 3RAHA 3BGQA 4Q9ZA 3FZPA 4LG4A 4YO4A 5HCYA 3HECA 5GZ9A 3F3WA 1YKRA 4CMUA 3A7HA 3MH3A 4BGGA 5E7RA 2VWZA 5EYKA 3WF7A 4FYOA 2FB8A 4EHEA 4KA3A 2QG7A 3DKOA 3PSBA 3VS4A 1HCLA 5AADA 5JN2A 3CGFA 5DRBA 4A7CA 1SVEA 4FTKA 4DCEA 4J95A 1ZYLA 4EWHA 3UOLA 3NUXA 3LMIA 2PSQA 2C6IA 2R7IA 4IZYA 5HEZA 4RJ6A 5A6OA 2ESMA 2X6EA 3ZFXA 4Z7GA 4NUSA 3CY2A 4QMSA 4RIWB 3UZPA 2AYPA 3IONA 2UZVA 4I4EA 4PDSA 2ZB0A 4XOZA 3T3UA 5KNJA 1YI6A 4O7RA 3VIDA 1GIHA 2B1PA 2GQSA 3KXMA 3FI3A 3K5VA 4C57A 1DI9A 3OMVA 4DGLC 5D11A 4L7SA 3MI9A 4FIGA 3O2MA 3ZSIA 3QLFA 2NNWB 2I6LA 5TOZA 5K0XA 1OL1A 4ANMA 4OAVB 4ZMFA 2F2UA 5KUPA 5EQYA 2Y0AA 2GS2A 5K0KA 2WTIA 3I60A 4K77A 4P4CA 4S32A 2WELA 4C2WA 1B6CB 1Q99A 5FM3A 5IG1A 2XKEA 3PSDA 5CSHA 2C4GA 5IKWA 3VUTA 2VX0A 3DLSA 4WNPA 5IA4A 5JFSA 4UMTA 3I7BA 4E4LA 3WYYA 2XK4A 4XBUA 3RK9A 5FGKA 4CQGA 5ANGA 3R7IA 2BKZA 3E8NA 3L9NA 4M0YA 3KXZA 2FO0A 2PMLX 5AR5A 2WMQA 4R1YA 1ZOGA 1A9UA 4EI4A 4EK5A 2RL5A 4F70A 5LVNA 4DF3A 2XNNA 4RGJA 4RT7A 5LVLA 2XZSA 1Q3DA 2GNGA 4D2TA 4D2SA 2ZMCA 2W1ZA 4BL1A 5BPYA 4ZTSA 3UIMA 3HP2A 2YHVA 4A9SA 2W96B 4GFMA 4I6HA 5CAPA 4U44A 4YZCA 3A62A 3IDCA 2QOKA 3ORPA 3OY3A 2H9VA 4L52A 2WMTA 1PXPA 4IAIA 3D9VA 3SG8A 4OTGA 4K18A 4S2ZA 3N4TA 4BKJA 5JFVA 4Q2AA 2PHKA 5A4EA 4I5PA 5HX6A 3QTSA 3H0YA 4FKOA 4RC4A 5FQDC 4E26A 4QT1A 2QLUA 4EH3A 2A0CX 4BZDA 4ZLZA 3Q9ZA 4C4GA 2J0IA 5AUVA 5GNKA 3O96A 4JXFA 3ORZA 5CSVA 3PXKA 1PXKA 5E8TA 1REJA 4AGCA 4YURA 1WAKA 5HI2A 4CRLA 2B9IA 3DB8A 3F3VA 3TI1A 4AS0A 2XA4A 3Q2JA 4BCPA 4U7ZA 4KIKA 4OUCA 1H1PA 4BCHA 3GOPA 5AP5A 4D4VA 2YEXA 1WVWA 2GHLA 2UW6A 2HENA 4YZBA 3U8WA 4JDIA 4L53A 4QP7A 2OFVA 2GU8A 4FG7A 3TTIA 4J96A 3FXZA 3FQSA 3OS3A 4MD8E 3KMWA 3KF4A 3QFVA 2BAKA 3R28A 4ASZA 5DWRA 3OCSA 5G6VA 3E8DA 4E73A 1DS5A 5KBQA 4TWCA 2UZLA 2XB7A 2XIKA 3TUDA 1JWHA 1IA9A 3MPAA 1K9AA 3FHIA 3KF7A 3Q4CA 3FLYA 3QZGA 4XV3A 5ANDA 4QP1A 2WQMA 4K0YA 5DMZA 2O8YA 2OH0E 4FV2A 4EJNA 4O38A 3FLNC 2IPXA 3GXLA 2R64A 4I4FA 5DE2A 4WUAA 2VTQA 4YP8A 2YZAA 1OIRA 3U6IA 4PTCA 3ZO1A 1OL2A 4UN0C 4ZS4A 5AV4A 2XNOA 1YXTA 3EHAA 4IB3A 2I1MA 2VWUA 3QTQA 4HGTA 4QMQA 1CKPA 2IWIA 4O0YA 3DXPA 3VF8A 4DAWA 5HO8A 5K4IA 3AOXA 4QMUA 4HVDA 2CN8A 4K1BA 4MYGA 4C7TA 3JUHA 3MVLA 4NZWB 4C4JA 1U46A 3PA5A 5F95A 4MAOA 3Q6WA 3C0HA 4LUEA 5HD4A 4BDJA 4FEXA 4FIEA 4BI0A 5KMMA 4YZNA 2YM7A 2G2FA 3FI4A 4W8DA 4DA5A 3UO4A 3UP2A 5HIEA 4O7TA 3AT4A 4L9IA 3G9LX 2W7XA 5E8UA 5A4LA 5AR4A 4QP8A 5D1JA 3S0OA 4F09A 3R30A 4JAJA 3QTUA 4QOXA 4YC6A 4BIEA 3CCNA 4GEOA 2GDOA 1W82A 4IAFA 1R1WA 1H00A 3FMKA 3EKNA 4IWOA 4RVLA 4TTHB 2QCSA 4M0ZA 1OECA 3OXZA 3EWHA 3UMWA 3T8OA 4HW7A 2WTKC 4QQCA 4F0GA 2R3QA 3E62A 4GU6A 3CXWA 4ITHA 1AD5A 3MVHA 4FR4A 4R1VA 4N6YA 2JDTA 3TV7A 4FODA 2XK9A 4RMZA 3O51A 3SW4A 3QX2A 4FKUA 4BF2A 4E4XA 5DLSA 5C26A 5M4CA 5BVKA 3VW8A 4XV1A 4DFUA 4DLJA 4JIAA 4D2PA 4XV9A 4QNYA 2PE1A 2CLQA 4NEUA 5HZNA 3P7CA 3ZUTA 4I23A 4YBJA 1X8BA 5BUIA 1MRUA 4K8AA 4G6OA 5EQEA 2CGUA 3GEQA 4ZXTA 1BI8A 1PXOA 5LMKA 1YDSE 3WIGA 2IZSA 3RP9A 4LOPA 3F2RA 3TXOA 4L43A 3HMIA 2E9PA 3MA6A 1PXJA 5J9LA 4E20A 4ENXA 2Y6OA 3HVCA 3OXTA 3A60A 3NCZA 5DRDA 4JQ7A 1YI3A 5AX3A 2YAAA 1PY5A 5HHWA 3EFJA 5HE2A 4TYIA 3FZTA 4RLKA 4X3JA 4ITJA 4AW1A 1IRKA 1BKXA 3TDVA 4FIFA 3EL7A 3OXIA 2DWBA 2BZJA 3G6HA 4IX6A 4ZY6A 4F64A 4XP0A 2X0GA 3GU7A 3TZMA 3DJ7A 2E9NA 3R63A 3SRVA 2GMXA 3RCDA 4V05A 5HVKA 4YZMA 4IB0A 5HO7A 5JKGA 3VF9A 1QL6A 1XWSA 3WF5A 3G15A 5CNNA 2OF4A 4IFGA 3Q4ZA 3PJ2A 4BTKA 2XNGA 3ELJA 3S2PA 5L6OA 4FE2A 4F6WA 1PMUA 3O71A 4EEVA 4RBLA 3PWYA 3UOHA 2ONLC 1XH4A 3DK6A 3S3IA 4L67A 5LXMA 4QMLA 2UW0A 4MXOA 3PLAE 1PXMA 4B8LA 2BRNA 4YLKA 4OGRA 1PJKA 4ACMA 1W8CA 2GCDA 2XJ0A 4IJPA 4I1ZA 3E63A 4FTRA 2VTRA 4EH7A 3RAWA 1FOTA 3UNJA 3BWFA 2YIYA 3AMBA 3D7TA 3QA0A 5EDQA 4DFYA 3FZOA 4LOOA 4GCJA 4NCTA 3WE4A 5EKOA 5CQWA 3MA3A 4UX9A 4LL5A 1YHWA 2BFYA 3ETAA 1WBSA 4FTTA 3ZSGA 5L8KA 5JRSA 2CJMA 4BRXA 4P2KA 3VO3A 3RTPA 4TW9A 2QNJA 3F5PA 2I0HA 4FZDB 4DFBA 3MH0A 3D4QA 4ARKA 3VVHA 4AFEA 3R8ZA 4DITA 5CU3A 5HESA 5CQUA 2F57A 2KULA 4BDHA 3FI8A 4M15A 4OTRA 4ANSA 5IA1A 2EWAA 3IG7A 4D1XA 2AC5A 2VGPA 4XBRA 3QQGA 1GY3A 2V0DA 1YDTE 4O0UA 2WB8A 4LM5A 4CTBA 4RPVA 4MVFA 5CANA 5GJFA 2C5NA 3FXWA 4D55A 4IQ6A 4QMMA 4TYHA 3L8PA 3T3VA 3I6UA 3QQKA 2X39A 2B0QA 3SC1A 1XO2B 3AQVA 5ANIA 4DFLA 4LUDA 2W5BA 3BBTB 5L2TA 2REIA 2OU7A 1JPAA 4YPDA 3CTJA 2HELA 4CCUA 3FC2A 3C4XA 3CIKA 4BR3A 2WTDA 5DBXA 4PY1A 2GNHA 4ZS0A 5L6PA 3E92A 2WOTA 3QCYA 4MH7A 2QOOA 4D2WA 2UW4A 2EB3A 4X0MA 3V5TA 3QTZA 5IQIA 2H8HA 3W32A 2VWYA 4NJDA 5AAFA 2W05A 5HICA 4FC0A 1TKIA 2RFNA 3HL7A 3L9LA 5AAGA 3DV3A 1RDQE 3Q5ZA 4IAZA 2C68A 3PVUA 5FEDA 3P7AA 4JNWA 2P0CA 4JRVA 4TYGA 5EDPA 4BWKA 4XRLA 5K5NA 4AN9A 2PUUA 1OI9A 3GQIA 4GJ3A 2VGOA 1DM2A 5A46A 1OKVA 2WEVA 4L42A 2JBOA 4KNBA 3OD6X 5CVGA 3ZCLA 4PNIA 2BDFA 2VTJA 1KE7A 2Y6MA 2XP2A 4ZSEA 3VJNA 3KULB 1RQQA 5D9HA 3SX9A 1JKLA 1R78A 1XH7A 4FT5A 3VUDA 2XEYA 3RZBA 2CLXA 4YC8A 2JBPA 3O8TA 3UIBA 4FV5A 3PFQA 3BPRA 4YHFA 3AC3A 4MNEA 4JDKA 3AG9A 4BHNA 4R5SA 3FLZA 3GCQA 3T9IA 4A07A 4ACGA 3QALE 4Q5EA 3FEGA 4AE9A 4EOLA 2VTIA 5K4JA 3ERKA 2W9ZB 4Y83A 3BEAA 3LFBA 3KU2A 4BBFA 4PP9A 3C4CA 1R3CA 3I1AA 4UZHA 4GUEA 4L46A 1URCA 4NTTA 4X6QC 4JG8A 4I5MA 4XLIA 3ID6C 1UV5A 3F5UA 3H9FA 4BC6A 5B2LA 3KY2A 1ZARA 4O1OA 2JKKA 3BELA 4QQJA 1H1SA 2QO2A 4R8QA 2V7OA 1FGIA 4BDGA 2W1HA 1Q8UA 4L7FA 4QYYA 5EI8A 3TJCA 4TWPA 4BVUA 3MESA 2VWVA 3QC4A 3DBDA 3OFMA 3RPYA 3LXNA 2BRHA 2C5OA 3MPMA 3WBLA 1LPUA 3LFNA 5IEXA 1A48A 3PG1A 2FH9A 1KWPA 2XKCA 1XQZA 4FT9A 2QOCA 2C6DA 3PTGA 4JR3A 4U0IA 4ZY4A 4HVHA 5E91A 4IH8A 4QP6A 2PMIA 3MDYA 3PUPA 1I09A 3PXRA 4O1PA 5B2MA 5HCZA 3BKBA 3E64A 3Q96A 3KRWA 3GC7A 2F7ZE 3HMPA 4HCTA 2Y4IC 3QGYA 5DHJA 5KHWA 4AZVA 1LP4A 4LGHA 2QU6A 4TRLA 4FT0A 4M7IA 3BX5A 4FEUA 4K6ZA 4JQEA 4IX4A 1WBVA 2IO6A 2WQBA 2XNMA 1XKKA 3BZ3A 4PWNA 2AUHA 1YXXA 3NYOA 4U5JA 4JVGA 4QTEA 3QUDA 5AV3A 3FYJX 1CKJA 3NVKI 3QUEA 1XR1A 2XM9A 4WNMA 5DPVA 4V01A 5EK7A 5KZIA 1H25A 4H58A 4WNKA 1GZOA 2B55A 4XH6A 5EH0A 2CGXA 5ICPA 4LYNA 3QYZA 3UDBA 1QPJA 4NM7A 4G31A 4D0WA 3WE8A 3N4VA 5C4LA 3KEXA 4C02A 5HORA 5HLNA 2WGJA 3GGFA 2X2KA 5IDNA 3LFQA 4UYAA 2EXCX 4FKTA 1Z9XA 3UPXA 1FVTA 3ZFYA 1YQJA 4BZNA 2PE0A 4DH3A 4I0RA 1JOWB 3PDTA 2PL0A 2OKRA 3NLBA 4C0TA 2UW5A 1BUHA 3BIZA 3Q2MA 2OIDA 3SDJA 2ITVA 1JKSA 5DR6A 4MBIA 3FMEA 4JI9A 3DNDA 4G1WA 1UNGA 5AUTA 2VTOA 5IMEA 3W1FA 2OO8X 4FSYA 4D0XA 3C0GA 3TNQB 3WIKA 1E1VA 3R73A 4O7ZA 2WFYA 1YXSA 2WMAA 3LM0A 2VO3A 4GYIA 5H9BA 3GT8A 3WILA 4AOIA 3BLQA 4RJ5A 1M52A 4HGSA 5T3QA 3COIA 3R8UA 5LVOA 2VAGA 2JDOA 2RFEA 3LCOA 3DFCB 3Q6UA 4BB4A 4N6ZA 2YITA 5BVFA 3FMLA 4FTOA 2CSNA 2WHBA 2X4FA 5CVFA 4G9RA 5D41A 5AV1A 3BE9A 2QHNA 4LV8A 5HBHA 4CV8A 5IA0A 2R3JA 3E3BX 4P5ZA 2ZMDA 3UC3A 4W4VA 1JQHA 3RMFA 4EZ3A 1JSVA 2JGZA 2Z60A 4R7IA 5CU2A 4Y46A 1H0WA 5E8VA 3I81A 3E87A 4EK3A 4H1JA 3RINA 1P14A 4HNIA 5C8KA 1BLXA 3CC6A 3QBNA 5IDPA 5FM2A 5LWNA 1Q8YA 4E4MA 4CTCA 3ORTA 2XKFA 2Y4IB 5BX0A 2VTHA 5IPJA 4QMNA 1TQMA 3TACA 3DK3A 3CP9A 4DG2E 3ZBFA 3P5KA 2J50A 3NUUA 4J99A 4X3FC 5JSMA 1PKGA 3CSVA 1OPJA 4IDTA 4U3YA 3H4JA 3DJ6A 2GNLA 2QU5A 4R77A 4DGOA 1VJYA 5J7BA 3M1SA 4FEQA 4IB1A 4YJOA 3RI1A 3AC1A 4E7WA 3IKAA 1W84A 5K9IA 2B52A 5CAQA 2XCHA 2OXXA 3FMNA 5IH4A 2IN6A 4TYEA 5HTCA 3EZRA 2XK6A 3ZH8A 4MBJA 3DAEA 3ZYAA 3EZVA 3U6HA 5LARA 5BVNA 4F9AA 4EH6A 1KOBA 4EOIA 5LVMA 2WU7A 5EI6A 3LE6A 2CPKE 3QYWA 5HVJA 2OG8A 5DOSA 4JBQA 5AP6A 4BDKA 4BICA 2XK3A 2F2CB 2HK5A 3ANQA 3PG3A 4ID7A 4ZEGA 4O21A 4K33A 2BILB 2YAKA 3LQ3A 1JKTA 5DH3A 3QCSA 5CZIA 3DZQA 4LOQA 2OWBA 3GBZA 3FDNA 4JDJA 4ZOGA 4AW5A 5M57A 3TV4A 5FWKK 3HV7A 5AP0A 3EFLA 3H30A 3VQHA 2VNYA 2ZM4A 5FEEA 3FL4A 2G9XA 3CD8A 2B9FA 2WTVA 4MNFA 3BLRA 4GW8A 4QTDA 4GKIA 1RW8A 4FMQA 4MQ2A 3TIYA 3RAIA 4MXXA 4OW8A 5M55A 1ND4A 1G5SA 4GT3A 3BU5A 1WBWA 4KIQA 3F82A 1E9HA 1HOWA 3ALOA 4EK4A 3W55A 4YTCA 4OR5A 4DE4A 5CENA 3B8RA 2NRYA 4MEDA 3T9TA 2R3MA 5KBRA 4IADA 5CAVA 1OL5A 3DOGA 3EFKA 4FIHA 3NPCA 2CGWA 2PZIA 4XNEA 1DAYA 4CFVA 4P90A 4BWPA 3P4KA 4BCMA 2HY81 5CY3A 4MTAA 3F3UA 4O0SA 3TKIA 4FNWA 3LCSA 4GVAA 3EQGA 5AA8A 2E9OA 4U80A 1O6LA 3AXWA 3OWLA 4FZFB 3NS9A 5AIRA 4XG7A 3NYXA 3W2QA 5HGIA 2QOLA 4U42A 4AW2A 3LM5A 1OITA 3E5AA 3R83A 2XYUA 3UQFA 4EUUA 4X3FB 4CYIA 2BDJA 3C4WA 4R7BA 4Z3VA 3DB6A 3ZDIA 3ZC5A 3SOAA 4XG9A 2XNBA 5EG3A 2BZHB 4JQ8A 3ORLA 1H1QA 1YDRE 4IWDA 3AGMA 3L9PA 4H3PA 1QMZA 4X21A 2ACXA 3IW6A 4F9CA 3MIYA 3TT0A 1YW2A 3QQHA 4FSUA 2CDZA 3IW4A 2ZDTA 1E1XA 2YLFA 1XH9A 5C01A 4C35A 3I0QA 5CT7A 4BCKA 3EQDA 2R3LA 2XYNA 3UGCA 2PVMA 3P0MA 4C4EA 4EOSA 2X7FA 4I6BA 3OWJA 2C6MA 2O65A 3EQFA 3HMOA 5EKNA 3LXPA 3SKCA 4EKLA 3FZRA 2HW7A 2JEDA 2PZRA 2GFSA 5M08A 5AR8A 3V51A 3MH2A 4B7TA 2OGVA 3U6JA 3E93A 3QWKA 3PIYA 4LMNA 1XJDA 3CKXA 4RA4A 4W9WA 4EK6A 4EK8A 3OBJA 1JNKA 5FXSA 1LR4A 3SLSA 1H27A 4MQ1A 4AWIA 4EH2A 3LMHA 2H96A 3UO6A 1U5QA 1Y8GA 1LEZA 2F7XE 5HG8A 1R0PA 5CLPA 3I79A 4HOKA 4RRVA 5LMAA 2YCRA 4M13A 4AT5A 3KC3A 5M4FA 5IU2A 5E4HA 1GZNA 2VTLA 1Q4LA 3IK3A 3HP5A 3SD0A 4JJRA 4AN2A 4D28A 4DINA 4O0TA 1T45A 3TTJA 3FMHA 1AGWA 3HRCA 3OUKA 4AW0A 4NWMA 1Q8TA 5I9XA 5H3QA 5F94A 3FKOA 3HYHA 3OW4A 4L45A 5CF5A 2GNJA 3GC0A 5GIOE 4FKJA 3PVGA 2CNUA 4QYFA 5F9EA 1OPLA 1YVJA 2UZBA 1ZY4A 4YJSA 3NYVA 5FTOA 3PWDA 4RIWA 5AFVA 4MBLA 3ZUUA 2ZM3A 3QCQA 3MVJA 3DFAA 4IX5A 3MY0A 4UXQA 2QURA 4O84A 2PMNX 3KXXA 5L2QA 4I92A 2XF0A 4XOYA 3F61A 4FTUA 2BAQA 3BHTA 3FUPA 5E9EA 3DXNA 2J51A 3E7VA 4BCJA 4FEWA 2OF2A 4M97A 1PHKA 2PVFA 3RVGA 2A2AA 2C5VA 4FK3A 4FNXA 5CU4A 1XBCA 3KREA 4AGDA 4L8MA 4ZMEA 5DI1A 3W8QA 3M11A 4EHVA 4ZSJA 4FTCA 3F6XA 4FNZA 3QZIA 4G3DA 5CU6A 4XHKB 4CKJA 5AIKA 3TZ7A 2CKOA 4FV0A 2RIOA 1JAMA 4OT6A 3PY3A 4CT2A 4R6VA 3AMYA 5CX9A 4YJPA 1JVPP 2I0EA 5CSPA 4KIPA 4TL0A 2FUMA 3QTIA 3FE3A 3C4EA 1H0VA 2GTMA 3LVPA 3SV0A 2FSOX 5ETFA 2B54A 5CSXA 4C33A 4V0GB 2WTJA 4I6FA 3DTCA 3NUPA 2W5HA 5HU3A 5J1WA 4OTQA 3HRFA 5HQ0A 5J9ZA 4ANOA 3GCVA 5AM6A 2ITNA 2PVJA 1Q8WA 3IW5A 2BRBA 5HG5A 3OF0A 4PPBA 3PJ8A 3TDWA 3ENMA 3M42A 3GFWA 4A9RA 1YHVA 4UB7A 3HEGA 3RKBA 4EL9A 3LFAA 2QQ7A 1NW1A 3JY9A 4ACDA 4PP7A 2WXVA 4FX3A 4ZZMA 4F9YA 1NA7A 3ZLXA 5AA9A 5DIAA 4D1SA 1H08A 1A06A 3ZLSA 1URWA 3O7LB 3SQQA 4BI1A 4FVPA 2VWIA 4MX9A 3PJCA 4I6QA 1PYXA 4FSMA 4O7LA 1XBBA 3LFEA 4BKZA 4DFZE 1Y57A 4RX7A 4AFJA 4OBPA 2Z7RA 3IDBA 2XVDA 5C8NA 4F1OA 4UY9A 5CEIA 3COMA 3DDQA 3O0GA 3UYTA 1UVRA 4FNYA 5GJDA 1J1CA 2NPQA 3D5WA 4IW0A 2JAMA 5HE1A 4H1MA 3H10A 2VZ6A 4DC2A 3LOKA 5GZAA 3Q04A 5ETIA 4O0WA 5IQCA 2WIPA 4I0TA 2WTWA 5DR9A 2IVSA 5ANKA 5CXHA 1K2PA 2HZ4A 4O22A 3FMJA 4O2PA 5F1ZA 5GIPE 5K3YA 4RSSA 2EUFB 3RHKA 4QP4A 1WMKA 5ITAA 1V0BA 4RX9A 4KD1A 4DFNA 4E6DA 3ROYA 5BUEA 3VC4A 2RSVA 3DBQA 3MSSA 4BCNA 3QTRA 2VX1A 3ALNA 2C1AA 5LWMA 5HNGA 4E93A 4E6AA 4F9BA 3EOCA 2YJSA 5KMJA 3A4OX 4LV5A 4AUAA 4XG2A 3I7CA 4BY9E 4YJRA 4D5KA 4HYSA 3QD4A 5CXZA 4L68A 3FLQA 4EBVA 4AZWA 4FUXA 1YRPA 4C61A 2UV2A 3PJ3A 2VWBA 4WUNA 3A8WA 4S33A 2QONA 2YABA 1W98A 4KBKA 4BYIA 2RG6A 4F08A 5A14A 2I0YA 3DT1A 3GB2A 1QPDA 5FBOA 5T68A 2QLQA 4TT7A 4CMTA 4GK2A 5KZ0A 3FAAA 4PL3A 3DGKA 4EOKA 2GTNA 4F1TA 3PIZA 1JLUE 4PX6A 5HX8A 2YACA 2GNFA 4U41A 4EOPA 2C3LA 5AUWA 3ROCA 4QMVA 3R9DA 3TNIA 1H8FA 3VW6A 2SRCA 3ZBXA 3BGZA 5IISA 4EOMA 4FOCA 2QD9A 3BV3A 4NU1A 1GZKA 3FLWA 3OEZA 1UNHA 4KKHA 1WVYA 4M66A 4X2FA 1JKKA 3AC8A 4QRCA 3FY2A 3SHEA 3O50A 4C4HA 4ZY5A 2IZTA 2LAVA 5J79A 4O83A 1CMKE 1YOLA 4FGBA 1GIIA 4JT3A 5HNIX 3PY1A 1ZY5A 2CNQA 5M07A 4EH8A 4DHFA 2I40A 2X8DA 3DU8A 3VS5A 5CTPA 2OJIA 5IUGA 2BFXA 3ZU7A 5AJQA 3V6RA 4RFZA 4FL3A 1BL7A 4WKQA 2J4ZA 2YIQA 3EB0A 3MN3A 2P55A 4A06A 4MD7E 3I0OA 2WZJA 4FV9A 4IXPA 2YIRA 4ASEA 3ODYX 3GU4A 3PP0A 5IEYA 2WOUA 3V6SA 3JYAA 1UKIA 5KMNA 3PY0A 2C5XA 3UOJA 1Q62A 2W1CA 2YWVA 4FA2A 4FV6A 3OCTA 3W10A 2R3OA 4WD5A 1JBPE 4X7QA 3D5VA 3Q60A 4XYFA 5A3XA 5AMNA 1V1KA 1FVVA 3Q9XA 4EHGA 5EYCA 2P3GX 2XK8A 4O7NA 3VRYA 4YR8A 3VHEA 2O63A 2Q0BA 3F7WA 2YFXA 4IVAA 5AR3A 4FKIA 1ZMVA 5EDRA 5HTBA 4EH5A 5ANOA 4UEUA 3FQEA 4N70A 3C50A 4XS2A 4XRJA 2PPQA 3QZHA 4PDPA 3KN5A 2IZUA 3DAKA 5JQ8A 2C6KA 3W33A 4QMZA 3O8PA 2R3PA 4ASDA 4UALA 4AAAA 4USEA 2EB2A 5DN3A 4O81A 3NYNA 3NWWA 1FQ1B 4F7LA 3PXZA 4DCAA 3GVUA 4G3EA 4O91A 4DG0E 3UG1A 4NSTA 4GV1A 5HVYA 1Q41A 3OW3A 2JIVA 3PRFA 4XX9A 4J97A 3LMGA 4IZ7A 5CYIA 4FTIA 4BYJA 4LRJA 3R00A 4QO9A 4HYUA 1KE9A 2VO7A 3BU3A 4IVDA 5LJJA 4NJ3A 1SNUA 3VS2A 3ZFMA 4HCUA 4LRMA 4RA5A 5E1EA 2OJFE 3W2SA 2WAJA 3DJ5A 4BHZA 1J7UA 4MF0A 3MTFA 4ZSAA 2J0LA 2OSCA 3A7FA 3K54A 3L9MA 2YCSA 4AT4A 3NW5A 4O0RA 5J95A 3PJ1A 3ORMA 4Z16A 4DGGA 4L44A 5ETCA 5FDXA 3TIZA 4D2VA 4D1ZA 3MGYA 4MWIA 2XRUA 3LW0A 4GFGA 4YJNA 1ZZ2A 3UO5A 3LKMA 2WTKB 3Q32A 3R0TA 4RX8A 3DBEA 3D94A 2W1EA 4MWHA 4I20A 3GUBA 3EN5A 3GI3A 3MPTA 1ZOHA 3P1AA 2YDJA 5JT2A 4DEBA 4L3JA 4ZAUA 3IGOA 2VWWA 2XEZA 2IW9A 2W17A 3MIAA 1KV1A 3Q9YA 4EYJA 1RJBA 3AT2A 3N9XA 4QMTA 4WBOA 4F99A 3MH1A 2WNTA 3FZSA 4ZLYA 3UP7A 5J7HA 3TG1A 2W5AA 4QYHA 1FPUA 5IZFA 3KL8A 4BDAA 3BI6A 4GMYA 2A27A 5AP1A 3V5QA 1UWJA 3OROA 4NK9A 4AA4A 5J5SA 2ZVAA 2A4LA 5E8YA 2HOGA 2IW6A 4Y95A 3NAXA 1STCE 5EM7A 1H1RA 3RALA 5IA3A 2UZUE 4GU9A 4IEBA 2PZYA 4RVMA 4FZ6A 4UXLA 5HIDA 3A7IA 3EN7A 3VUHA 4II5A 4O7YA 2WQEA 1V0PA 2E9VA 3H3CA 4YJTA 3JR1A 5BYLA 1NT2A 3HGKA 3FHRA 2ONLA 1YOJA 4O0XA 3DBFA 4M69B 3UVPA 5I9WA 3VS1A 2X2LA 2GHGA 3C13A 3Q4UA 4C37A 3QD2B 4LGDA 4AOJA 1QCFA 5KKRC 1WVXA 4GRBA 3KGAA 4FKRA 4OTIA 5EHOA 3LFFA 5IQEA 5I5ZA 2HW6A 2YZLA 3FBVA 4NFNA 1Q8ZA 3KULA 2YN8A 4PPAA 4CFWA 4L3PA 3BGPA 3EQIA 4FV1A 2IVVA 2PY3A 3WZJA 1ZWSA 4XLVA 4CKRA 3PYYA 3IOKA 4OLIA 1MUOA 4PL4A 4EOQA 3HMNA 4BDIA 4UZDA 3OT3A 4KABA 2C1BA 5AV2A 2XBJA 4I5HA 3CQUA 3R01A 5BUJA 4O6LA 2UW7A 5FD2A 2O5KA 2Y9QA 4H36A 2R3KA 3P23A 4FTLA 4RC3A 3VUMA 3FKNA 3ACKA 3PRIA 4O96A 4QMOA 5F4NA 4GK4A 4QTAA 1PMNA 4ZZNA 4XG4A 4GUBA 3TUBA 5HE3A 1O6YA 3OTUA 3PPKA 2VV9A 4UMUA 3ANRA 3ACJA 2YWPA 3U4UA 4B99A 3V5PA 2B9HA 3DNEA 2XIYA 4J7BA 3VBVA 4EKKA 5IQBA 5DT3A 4AA0A 2J7TA 3SXRA 5IEVA 1ZOEA 5L8LA 4D9UA 3BBWA 2BMCA 4GK3A 2ITUA 4DH5A 4G5JA 4YJQA 5CEMA 3E3PA 4XJ0A 5E92A 3RNIA 4WA9A 4BBEA 2DS1A 5DYJA 2WMUA 4RZVA 5L4QA 4A4XA 2LGCA 3LZBA 4TKSA 3V5JA 5CZHA 2PMOX 2PVKA 4NH1A 5E8WA 3PE1A 3S4QA 3ZXZA 3O23A 4FL2A 2YM8A 4APCA 4K9YA 3MY1A 3FV8A 3KK8A 4XG6A 3NX8A 4FKLA 4FSTA 4ZTNA 4O27B 1PXNA 2R3GA 3PZEA 3VHKA 3C5IA 4I93A 5CAUA 4PV0A 4O86A 3SG9A 3WOWA 3BU6A 4EQUA 1Y91A 4B6LA 4RX5A 3CY3A 5M53A 3R22A 4LRKA 1YXVA 3CJFA 3JPVA 4C2VA 3BWJA 2QR8A 3R8PA 2ITXA 3KB7A 2X2MA 4EOOA 4IAKA 3HUBA 3L1SA 3QD3A 5KKRB 2QHMA 3VQUA 5E8SA 3OWPA 4RVKA 1TQPA 4RVTA 3VBTA 4HVIA 3N4UA 5A9UA 1UU8A 4EZ5A 2IG7A 3W8LA 2OFUA 1OPKA 2OJ9A 1UU3A 2V55A 4NFMA 3KA0A 3U55A 5AM7A 3S1HA 4R5YA 3H9RA 1U54B 2NO3A 4EC8A 4IDVA 4OTHA 3ZRKA 2BRGA 4G3FA 3G90X 4E6CA 1M14A 1M17A 4NIFB 2HCKA 4RJ3A 1WBNA 4MK0A 4CFXA 2PTKA 3HNGA 1WFCA 5EM8A 2WIHA 5L6WL 4HYHA 3FYKX 4EHZA 5BMSA 5GINE 5EFQA 1MP8A 1L8TA 4ZJIA 5BVDA 3WF8A 4I22A 4ZTLA 3NUNA 3VBQA 3FLSA 4FBXA 3D5UA 5G1XA 2PK9A 3ZSHA 3CBLA 3PVBA 2OIBA 1SM2A 4X2GA 5I0BA 1KE5A 3EQCA 4GG7A 5CEPA 4WIHA 3LIJA 3RM7A 1K3AA 4EZ7A 4DTBA 5FTGA 4QQTA 3MFRA 1XHAA 4AGUA 3ZEPA 3SW7A 2BAJA 4AZEA 3FC1X 4RWLA 3TEIA 3KKVA 3DXQA 2RG5A 2GSFA 4XMOA 1OZ1A 2C0IA 4Y5QA 4G3CA 2OIQA 3F2NA 2O3PA 4BCOA 3PLSA 2XMYA 5H8EA 4IC8A 1O6KA 5C8MA 3QRUA 4C38A 4FSQA 4D58A 2VTMA 3JXWA 3ZEWA 4J53A 3EKKA 3DKFA 3G51A 2RFDA 3MTLA 4KKEA 2X8EA 3NUAA 3K2LA 3FXXA 2BTRA 3Q9WA 4QP3A 3WZDA 5CNOA 3VN9A 3S95A 2VRXA 4C62A 5EI2A 5FUTA 4Y8DA 3UJGA 1F3MC 3LLTA 3OZ6A 2JKOA 4IE9A 4WNOA 4ZTQA 5CEQA 3TL8A 5H8BA 4ZK5A 4I21A 4JBVA 4I0SA 2CCHA 4IWPA 5AUYA 1KUTA 3HV4A 4YJVA 1M7QA 2PVHA 3OEFX 1NY3A 4GH2A 4Z7HA 4ERKA 3IQ7A 3VS0A 4YNOA 2XNPA 5I4NA 3KK9A 2JDRA 3MYGA 3Q53A 4B4LA 3PVWA 4JG6A 3IW7A 1SMHA 5CEOA 1JSUA 4L6QA 2J0KA 1FVRA 4AF3A 3QKKA 1OIYA 4W4WA 5KCVA 5J1VA 3GOKA 3LFDA 4CVAA 3MFUA 4F63A 4BDEA 4I24A 4L01A 3C51A 2X1NA 4FTMA 4N4SA 2WO6A 1VYWA 2PULA 2WPAA 2A1AB 4EQMA 4EC9A 4ZSLA 2VTSA 4BBMA 3KXNA 3V5WA 4DBNA 2NP8A 4CEGA 2JFMA 5HCXA 3QF9A 4FKGA 3MVMA 2QKRA 2XIXA 2YCQA 3NIZA 2C69A 1GZ8A 2YDIA 4EORA 5HG7A 2WU6A 5L2IA 5E8ZA 3L8VA 5J9YA 2WMBA 4R3RA 3V8WA 4EOJA 3FY0A 2Y7JA 2UVZA 5DVRA 4E4NA 2ZV9A 3N51A 4AACA 4BCIA 4DEGA 3R1QA 5E1SA 4FSNA 4PPCA 3JVSA 2UZTA 3OHTA 4EH9A 3QHRA 4J8NA 5BVWA 1H28A 2CMWA 4MCVA 4ZP5A 2R0UA 3RPSA 1OIUA 3KQ7A 4FKPA 5LQFA 5HD7A 2HYYA 2R5TA 4I5CA 1HCKA 1Q97A 5H2UA 3UODA 4F6SA 2C6LA 5FRIA 5EYDA 3RWQA 1BI7A 2JIIA 4BTFA 3LXLA 3NNUA 3NNVA 2UZDA 1M2QA 2ZV8A 4L00A 4X2NA 2C6TA 2P4IA 2XIZA 3LJ0A 3AGLA 3QZFA 1KSWA 5T6KA 4ZJJA 5A4TA 5FP6A 4U97A 2Z7LA 4C59A 4PMPA 3IS5A 3QXPA 2YCFA 2R2PA 5AUZA 4BCFA 4GVJA 5HBJA 3VUIA 1H24A 4RFMA 4MD9E 4S31A 1T46A 4G6LA 4RWJA 1ZLTA 3TNHA 4RIYB 4YZ9A 2O64A 3WZKA 5A6NA 1SNXA 2C30A 3NNWA 3NW7A 4MKCA 2C3KA 5JFXA 1OBGA 4GKHA 4CZYB 3RPOA 4PMSA 5AEPA 2BZIB 2ITPA 3QU0A 5AR7A 1VYZA 4HJOA 4HNFA 1NVSA 4WBBB 3TWJA 2YM6A 3ET7A 1F0QA 1V0OA 2R3RA 4JBOA 4UV0A 4WOVA 4AGWA 3R7GA 4FKVA 2C3JA 4QNAA 3R7VA 3RPRA 4K11A 1P4OA 3R8LA 4QTCA 1SVGA 4RZWA 3OT8A 4YJUA 4DTAA 4UMPA 3R1SA 2VO0A 3R02A 2WMWA 2XM8A 3RHXA 4YSMA 1ZYSA 3GU8A 1VEBA 2G1TA 4BDBA 4AG8A 2R3HA 1MRVA 1PXIA 3K5UA 3KXHA 4CFMA 3CD3A 5CSWA 5HE0A 4OTDA 3QD0A 4FICA 2QKWB 3V01A 2IZRA 3CTQA 2OZOA 5IUHA 4IVCA 2EXMA 3A7JA 4HVSA 4DEIA 3TN8A 4A4OA 2FVDA 3NW6A 3HAVA 5ACBC 3A99A 2OLCA 2GS6A 2J0MB 3A8XA 3ZO3A 2GFCA 2VU3A 3MWUA 2C0TA 2OXDA 5F20A 5IH5A 5I3RA 5KHXA 3DTWA 3GQLA 4HCVA 3TZ8A 1OKZA 2VTTA 2XJ1A 3FZ1A 4FKWA 2GHMA 5BYZA 3W18A 4NYEA 4JG7A 3QGWA 2BHHA 3PP1A 1YWNA 5M4IA 4W4XA 3FMDA 5FXQA 3ZRLA 3EMGA 2B9JA 3L8SA 3FPQA 3CS9A 3LQ5A 2XCKA 3DZOA 2A19B 5AP2A 4DEDA 3GU6A 4BKYA 2Z02A 2X4ZA 3P08A 2ITZA 2FSLX 3ZLWA 3OY1A 4EBWA 4QP9A 3W16A 3HUCA 4I41A 2OZAB 3ZONA 3UG2A 3C7QA 1NXKA 5HNBA 2G15A 3E88A 4G2FA 3HV3A 1ZMUA 2QR7A 4I94A 3O7LD 2RFSA 3IGGA 3KMMA 3TNPC 4P5QA 3ATSA 2VD5A 3E8CA 3MW1A 4C3RA 3TV6A 1REKA 5AUUA 2P33A 2PVLA 4ZSGA 3BHHA 3NNXA 3EN9A 3F69A 4YSJA 3DK7A 3GCUA 3FSKA 3D2IA 3GFEA 5CI7A 1OL6A 2XKDA 4X2JA 3DBCA 4LI5A 4RIXB 4QPAA 3U87A 5C4KA 2HZNA 5A54A 3AD4A 4DBXA 1G8AA 1OKYA 3A2CA 4V0GA 3FMMA 3MJ1A 3PA3A 4OTFA 5EW9A 2QODA 5M06A 4H3QA 4FV4A 3ZM9A 4ALUA 3C9WA 4IZ5A 3RPVA 2WD1A 5AUXA 5CVHA 2RKUA 3QRJA 4CSVA 3VUGA 4DYMA 1OVEA 2VNWA 3KFAA 4E1ZA 1JSTA 2HZ0A 3LFSA 4G17A 4J71A 5CAOA 2AC3A 5DGZA 3D7ZA 4FKQA 3O8UA 5HOAA 4BZOA 3HV6A 3AC5A 2VN9A 3KCFA 3FI2A 3OTVA 4YTIA 3HDNA 4EH4A 4QPSA 4F9WA 4DEAA 2O2UA 1IAJA 2XIRA 2BTSA 2G2HA 3JS2A 3JVRA 4HPUE 4PTGA 3ZUVA 5LVPA 5TE0A 1H26A 4XCUA 4GL9A 2W4JA 3U4WA 3ATTA 4PDYA 3U54A 5JK3A 2C5YA 5JEBA 4FGRA 3E7OA 3FWQA 5JMSA 4J52A 4ZZOA 3TKHA 3GCSA 4N57A 1Y6AA 3GNIB 4J98A 5H8GA 3TNWA 4AZSA 2B4SB 2ITOA 3MBLA 4JRNA 4YC3A 3GP0A 5HLPA 3MB6A 4M14A 2Z7QA 1GNGA 4MXCA 5I9UA 1H4LA 3H9OA 4H3BA 4FZ7A 4K2RA 1Q3WA 2JKMA 4IFCA 1DI8A 4TWOA 4M68A 1LUFA 1FGKA 5LCJA 2JKQA 3EQHA 4TY1A 4S34A 3UTOA 2OJJA 3VRZA 3KMUA 3RWPA 3QA8A 4C34A 3D0EA 1ZAOA 4DEHA 5ANJA 2VX3A 3PXYA 3R8MA 4M84A 5IF1A 4KRDA 1KE8A 3LXKA 3UVRA 4AOTA 3EQPA 4FTQA 3UBDA 3W2RA 1VZOA 5IMXA 5IQDA 3HZTA 3B2TA 3FKLA 3SAYA 2W1IA 1YWVA 5ACKA 4ZTRA 5CU0A 3WARA 4FI1A 5EW8A 3ULIA 4QMWA 3P86A 1OBDA 5M44A 1U5RA 1BYGA 5KO1A 4UWBA 4FV7A 4BN1A 1Y6BA 4GT4A 4FTNA 4XG3A 4C3FA 3RAKA 4D5HA 4YU2A 4IC7A 2VUWA 4AP7A 4M12A 4KINA 1ERKA 4DLIA 3U51A 3SGCA 3NUSA 4DG3E 2PU8A 4FL1A 4XP2A 3S00A 3WF9A 1WZYA 1XH5A 2UW3A 2UW8A 3QQUA 4IZAA 5L3AA 2PUPA 4O7WA 3DQWA 2C47A 3WZUA 5JGDA 5IQAA 5CF6A 2BIYA 2ETMA 4RLLA 4ZIMA 5C27A 5LCKA 4C8BA 4CKIA 3OOGA 5HLWA 1SZMA 1ZYJA
chains in the Genus database with same CATH superfamily
3BLHA 3P7BA 2BRMA 3H0ZA 4U3ZA 1P5EA 4IIRA 4BCGA 1PYEA 3RNYA 4CZTA 2CCIA 3SXFA 5FDPA 2G01A 5CEKA 3UE4A 3ZRMA 3D2KA 2IVTA 2VTPA 3BHUA 3HX4A 3Q5IA 2JAVA 5BNJA 5A4QA 3TJDA 4KIKB 3ZHPC 3SA0A 2RGPA 2HWPA 4CLIA 5JGAA 3V3VA 4YMJA 2BR1A 4ZLOA 5AR2A 2GQRA 4FSRA 4CFUA 2IF8A 4WG5A 4IX3A 3BV2A 2ZOQA 4YPSA 2EXEA 4TNBA 4Y5HA 3UQCA 1PRYA 2XUUA 1UU9A 4JL9A 5B7VA 4UBAA 1YXUA 1CTPE 3OG7A 3GENA 4KBAA 2CKQA 1FMOE 4BWXA 2J5FA 2YIWA 4FIJA 5EW3A 3OBGA 4IAAA 5LMKC 4YO6A 1Q24A 2O0UA 4ORKA 3DY7A 3DLZA 3HRBA 2HIWA 2W06A 4LDTA 3DKGA 4U79A 2ZV2A 4G9CA 3R7UA 5TKDA 3IDPA 4CG8A 4CQEA 4E3CA 3OVVA 3NMUF 5HBEA 2WTCA 2QOFA 3OC1A 3AD6A 3NSZA 1RE8A 2QOHA 1XH6A 4NKAA 3R1YA 2OI4X 4GIIA 2E2BA 4KRCA 4A9UA 2BHEA 2OBJA 4KSQA 3U9CA 5HG9A 2BKKA 1BL6A 4EWQA 3TYKA 1QPCA 1MQ4A 3DKCA 4FV8A 2I0VA 2QC6A 3DQXA 1S9JA 3OCBA 1DAWA 3TZ9A 3R8VA 4IM2A 2DQ7X 4QTBA 5EYMA 2OICA 4YLLA 4YHTA 3RBWA 2XH5A 1J1BA 4OT5A 4DTKA 4DH8A 3G0EA 2C0OA 2RF9A 3EYHA 3FSFA 3QRIA 4O2ZA 4O7SA 2G2IA 3COHA 3ENHA 4CMOA 4ERWA 3VULA 3F3TA 4JX7A 2GNIA 5J87A 2PVRA 2JDVA 3DPKA 2EU9A 3U9NA 3QQLA 1MRYA 1SVHA 2UW9A 2QVSE 4R7HA 5AP3A 1NVQA 4ANLA 2ITWA 1IAHA 1M2RA 4DFXE 3R71A 4G5PA 4LGGA 5DR2A 1OIQA 4YNEA 2W1DA 2X81A 2W9FB 3ZMMA 4KUJA 4QP2A 3UMXA 2F9GA 3UNKA 4BDCA 1OGUA 4NCTC 4CLJA 2JFLA 2XBAA 5IQGA 3RK7A 4RJ7A 5C03A 3FJQE 3P79A 3KRLA 4CV9A 3CPBA 3IPHA 3BCEA 2XK7A 4A4LA 5ANEA 4J1RA 3VBYA 3GC8A 1QPEA 3QKMA 2HZIA 2XS0A 1J91A 3R21A 4CNHA 4JX3A 4P7EA 4DT9A 3P9JA 3V8TA 4TPTA 4ENYA 4IM3A 4UMRA 2YISA 2OXYA 2FSTX 2Z7SA 3PXQA 4AA5A 4C58A 2E9UA 2OK1A 4IANA 4W9XA 3KCKA 4U45A 5DT4A 3BRBA 3QCXA 5HO6A 4AX8A 4RWKA 3G0FA 4KAOA 4C36A 3R9RA 3BYVA 4RFYA 5L8JA 3CR0A 3HLLA 4MF1A 4DH1A 2BALA 4YTHA 4BGQA 5KX8A 2C3IB 4FG9A 1W83A 4OTPA 2ERZE 4LMUA 4KSPA 4U9AA 5B0XA 5FG8A 3ZC6A 3QC9A 5TT7A 3VBXA 3AMAA 3VWAA 2GPHA 4FOBA 1U59A 5AAEA 2X9EA 4O4BB 2F49A 5CF4A 4E5AX 1J7IA 3KRXA 4XG8A 2CKPA 1SYKA 4G3GA 4W4YA 3SRVB 3BYUA 3EN4A 2BDWA 4JS8A 3EIDA 3A7GA 4HPTE 4ASXA 2ZV7A 3KRRA 3R9NA 4PQNA 4TYJA 3NDMA 4H39A 5EOLA 2JITA 3CTHA 5CT0A 1YHSA 3R7OA 2R3NA 4WHZA 3MS9A 5DFPA 4A9TA 4PTEA 1VR2A 2YERA 4DGMA 3I6WA 4HZRA 4FZAB 4JAIA 4ALVA 3IW8A 4U8ZA 4DEEA 2PE2A 5DT0A 4MHAA 3R2YA 4OBQA 5EOBA 4OAUC 4R3PA 4FK6A 5TO8A 4F6UA 4FF8A 4M69A 4PMMA 3QKLA 4D9TA 3F7ZA 3VUKA 4AXAA 3CQWA 4O4FA 3WF6A 5JZJA 4CGAA 1UNLA 4D4YA 4RJ8A 4V04A 5CF8A 2XNEA 3W2CA 4AN3A 2J6MA 3BHYA 1G3NA 3Q4TA 3F5GA 4MXZA 2W0JA 3QTWA 3PZHA 4IVBA 3ZXTA 2VTNA 1WCCA 2HXQA 3D7TB 3MFSA 3VNTA 4N0SA 3NVMB 4PNKA 2ETKA 3BQCA 3QTXA 5D10A 3VAPA 1XMLA 3F66A 1S9IA 4RIOA 3UOKA 4IMYA 5JQ5A 4BTJA 4BGHA 4AT3A 4E6QA 2J9MA 2X7GA 2JD5A 2HXLA 1GAGA 3POOA 4CFFA 4F1MA 1APME 4JLCA 3I5NA 4TZRA 4GT5A 4PMTA 4EJ7A 4ANBA 3COKA 4KWPA 2WMRA 4YZDA 4O7VA 3PE2A 3VS7A 1ZXEA 5HTIA 2UZEA 3LPBA 2ITTA 1ZMWA 4O82A 4FIIA 3ODZX 3SXSA 3KN6A 4R78A 2ETRA 3HDMA 4HZSA 3TMOA 4IHPA 3RGFA 4AZTA 4TWNA 4I3ZA 4C4FA 4TYHB 3ZOSA 4ALWA 2OW3A 4KS7A 2R9SA 5BYYA 4QMXA 3IO7A 1R0EA 3PPZA 3HAMA 2F4JA 1Z5MA 3KVXA 3BL7A 3FPMA 4NKSA 2WQOA 3C1XA 1UWHA 3F9NA 1GOLA 4M67A 4E5WA 1PF8A 1FINA 4DDGA 5EM5A 5JH6A 5IA2A 4ACCA 1GIJA 1IR3A 3LHJA 4QQ5A 5J8IA 3M2WA 5KMIA 3CKWA 2JDSA 3RCJA 3EJ1A 5BMMA 1WBOA 1B38A 2J90A 4KB8A 3ORIA 4NT4A 1CSNA 2Z2WA 4PL5A 4QD6A 4WRSA 3LQ8A 4NTSA 2PVYA 3AC4A 4PDOA 4NM3A 4FVQA 1WBTA 5EQPA 4TNDA 1KV2A 5KE0A 2BUJA 1W2CA 2R0IA 5GJGA 2IW8A 4F0IA 2HAKA 5L2SA 4C4IA 3WZEA 4TXCA 1U4DA 3IECA 3EQBA 4LL0A 5CASA 3BYSA 2BPMA 3QAME 1IG1A 1IEPA 4ITIA 2BIKB 1ZYCA 4IAYA 5KMKA 4XUFA 4GJ2A 3D15A 5LOHA 5M51A 3G2FA 3PFYA 4UYNA 4USFA 3BEGA 3E8EA 3BE2A 4CT1A 2PUNA 2VWXA 4FV3A 4CFNA 4B8MA 2PVNA 2PWLA 1U54A 2PZ5A 4MNEB 1BX6A 2QOIA 4ZTMA 4NIFA 4OTWA 3D83A 2B53A 2IJMA 2Y8OA 3NEWA 2R3IA 3D5XA 5I3OA 4FKSA 4KKGA 3IOPA 4QMPA 1IA8A 3OOMA 2GS7A 3RK5A 1LEWA 3FL5A 1UKHA 4M8TA 3SVVA 3LLAA 4S30A 2R4BA 3NCGA 3CPCA 1OUYA 2OJGA 4KS8A 1EH4A 3MY5A 4D2RA 3B8QA 4GSBA 3QRTA 1UA2A 1P2AA 5EM6A 4O0VA 4NW5A 3TCPA 4GS6A 5K5XA 2HWOA 2P2HA 2C6OA 4Q9SA 4RC2A 3Q52A 2X8IA 3QXOA 3REPA 3EFWA 2B7AA 4DH7A 4J8MA 4FYNA 3TUCA 3MJ2A 2P2IA 4PRJA 1Y8YA 3FQHA 3ZLYA 2ZJWA 4G16A 4YGAA 1M7NA 3KXGA 1KOAA 5FTQA 5KMLA 3OP5A 4FG8A 4DGNA 1ZYDA 3PSCA 4PF4A 3NRMA 1PMVA 1OUKA 4KBCA 4FUYA 3DAJA 2FYSA 4MXYA 4W8EA 4E5BA 1UU7A 1XBAA 3NAYA 3B2WA 3F5XA 5CWZA 4QPMA 1B39A 3VJOA 4FTJA 4D4SA 5GZ8A 1PXLA 4U43A 2HY0A 3A61A 3V5LA 4NM0A 3NIEA 3EYGA 3VS3A 3ZM4A 5FXRA 3HKOA 3II5A 3AC2A 5EHLA 4BDDA 1XH8A 5C1QB 2CHLA 2YJRA 2ZAZA 2UZNA 4XP3A 4Y73A 4BIBA 1PW2A 3RZFA 2ITYA 1PKDA 5HIBA 3UVQA 2DYLA 3ZS5A 1G8KA 4HYIA 2IVUA 5BQ0A 2PUIA 4GYGA 1ATPE 4CCBA 1H1WA 2W4OA 4ACHA 3O17A 3SOCA 4FSZA 5B2KA 2V5QA 5DEWA 2H34A 3UC4A 4F0FA 5JFWA 5FBNC 3K3JA 4QYGA 2OH4A 4HVGA 4X6RA 3RJCA 5KMOA 2ZDUA 3DCVA 1TQIA 2PYWA 4A9YA 1YOMA 4DN5A 1P4FA 3HMMA 4F7SA 4ANNA 3PXFA 4XV2A 3UPZA 4IJ9A 5D7AA 4EONA 1OL7A 2YDKA 3R1NA 3ORKA 3WI6A 5HU9A 3OWKA 4LFIA 5E8XA 2C6EA 3NZ0A 4E8AA 4AU8A 4BTMA 4X2KA 5DEYA 1Q5KA 5BVEA 4Z9LA 5C9CA 2QG5A 1Z57A 3C5UA 4RQVA 3R04A 3F2AA 2W99B 5D12A 4AQCA 4FT7A 3W0RA 4BIDA 3QQFA 5LMBA 2KTYA 5TF9A 3R9OA 4GFOA 2X9FA 4QYEA 2YM4A 3AD5A 3DDPA 1WBPA 4U6RA 5ETAA 3R6XA 3MFTA 2BVAA 3R2BA 4Y72A 3QQJA 3JY0A 3QUPA 2ZB1A 1TVOA 1GJOA 2NRUA 2BZKB 2QI8A 1OGYA 3UZTA 4YTFA 4IWQA 4USDA 2XRWA 3LCDA 4F7JA 2ERKA 5IA5A 3OUNB 2J2IB 3CQEA 2QOBA 3CEKA 3AT3A 1BMKA 3TM0A 3MB7A 3HA6A 3POZA 3THBA 2CGVA 2X7OA 1OKWA 3LCKA 3ORXA 3QL8A 2XAOA 5DNRA 2GQGA 5HKMA 3UNZA 1W0XC 2R3FA 3ITZA 4Q5HA 5DA3A 4CRSA 5IH6A 4JBPA 2YM3A 3EN6A 1R39A 3G5DA 2UVYA 2YA9A 3C0IA 1OM1A 4B9DA 3QLGA 3UYSA 2XJ2A 3CLYA 3RM6A 4EYMA 5JRQA 2CN5A 2QO7A 4FSWA 5CS6A 4QMYA 3OCGA 2ITQA 4UWCA 5AP7A 2UZWE 2FSMX 2R7BA 2V62A 3PPJA 5AX9A 4BDFA 3GC9A 3V8SA 3K3IA 4NM5A 3UZRA 1CM8A 1MQBA 1W7HA 3W2OA 2VTAA 3F3ZA 2QO9A 3I5ZA 2Q0NA 2CKEA 3BYMA 3QX4A 3V04A 3ZZWA 4YUQA 2WMXA 2JIUA 3WYXA 2ZYBA 3LAUA 2J0JA 3QRKA 4B0GA 3GU5A 2JLDA 5J5TA 4EQCA 4YBKA 3TKUA 4IACA 4AE6A 2Q83A 3GCPA 4IM0A 4X3FA 4ZTHA 3W2PA 4HGLA 4FVRA 3BYOA 4C3PA 3AKJA 5M56A 3KVWA 4G6NA 4RIYA 3ZTXA 2YLEA 4GG5A 4ANQA 1H07A 3DA6A 4D4RA 3ZO4A 5AV0A 4BI2A 2QOQA 2WMVA 3EH9A 3QHWA 4JDHA 3ZDUA 5I9ZA 3PIXA 4WG4A 1IASA 2Y4PA 4CZUA 2EVAA 2PZPA 5E90A 1FBNA 3C4ZA 3P78A 4JR7A 4TN6A 5JZNA 1PMEA 1CDKA 1L3RE 1YI4A 1O9UA 3BHVA 2VO6A 2CNVA 4UWYA 5A4CA 3L8XA 2WKMA 4YLJA 4CD0A 5IQHA 4F65A 3DS6A 1OB3A 2WEIA 4RJ4A 3G6GA 3ORNA 1J3HA 3ZO2A 2ZM1A 4F7NA 3ZZEA 5FP5A 4WRGA 2BCJA 4XEYA 3R7EA 3CE3A 4WT6A 3NGAA 3EL8A 5AWMA 3UIXA 5IQFA 4WSQA 2UUEA 4F4PA 4YHJA 2JC6A 3LJ1A 5FEQA 4RG0A 2V22A 2W4KA 4IB5A 4PUZA 3MV5A 4CG9A 3C4FA 4M3QA 2YIXA 3D14A 4FTAA 4NL0A 3G33A 1AQ1A 2F7EE 5D7VA 1CKIA 3HV5A 4APPA 4CYJA 3LCTA 2UZOA 3G9NA 1OMWA 2DUVA 2WMSA 4JOAA 4HGEA 4ZJVA 4AZFA 3NUYA 1ZZLA 4FEVA 2YM5A 2X6DA 1M2PA 4GIHA 4RWIA 5M09A 4Y85A 2BROA 3LFCA 4CXAA 4DT8A 2W1GA 3Q3BA 4IBMA 2AQXA 3CGOA 2OZAA 3KRJA 3LJ2A 3PA4A 4WG3A 4OBOA 2I7QA 4H05A 4O6EA 4UMQA 1ZRZA 4FT3A 5M4UA 3A4PA 1G8SA 3BQRA 4L3LA 5FLFA 2UVXA 3EQRA 4LQMA 1NVRA 4Z55A 5GHVA 5IUIA 4BFMA 5JGBA 5L2WA 3UIUA 3HA8A 4NW6A 4JIKA 5EHYA 5I9VA 3F88A 3QWJA 3UQGA 3ULZA 5CI6A 4BCQA 2Z8CA 4WO5A 5DG5A 1H01A 4U81A 4U40A 4WSYA 2FA2A 3CJGA 2J5EA 5TR6A 5I9YA 1Q61A 1YWRA 1KE6A 4MXAA 5CALA 2W1FA 3I4BA 2WQNA 4RIXA 5AP4A 1FMKA 2FGIA 4EUTA 3NR9A 4RQKA 5BVOA 2V7AA 3R9HA 1I44A 4G34A 4KIOA 4R3CA 3R7YA 3VBWA 1J7LA 1F5QA 3VS6A 2H6DA 4ONAA 3RAHA 3BGQA 4Q9ZA 3FZPA 4LG4A 4YO4A 5HCYA 3HECA 5GZ9A 3F3WA 1YKRA 4CMUA 3A7HA 3MH3A 4BGGA 5E7RA 2VWZA 4QEBA 5EYKA 3WF7A 4FYOA 2FB8A 4EHEA 4KA3A 2QG7A 3DKOA 3PSBA 3VS4A 1HCLA 5AADA 5JN2A 3CGFA 5DRBA 4A7CA 1SVEA 4FTKA 4DCEA 4J95A 1ZYLA 4EWHA 3UOLA 3NUXA 3LMIA 2PSQA 2C6IA 2R7IA 4IZYA 5HEZA 4RJ6A 3BL9A 5A6OA 2ESMA 2X6EA 3ZFXA 4Z7GA 4NUSA 3CY2A 4QMSA 4RIWB 3UZPA 2AYPA 3IONA 2UZVA 4I4EA 4PDSA 2ZB0A 4XOZA 3T3UA 5KNJA 1YI6A 4O7RA 3VIDA 1GIHA 2B1PA 2GQSA 3KXMA 3FI3A 3K5VA 4C57A 1DI9A 3OMVA 4DGLC 5D11A 4L7SA 3MI9A 4FIGA 3O2MA 3ZSIA 3QLFA 2NNWB 2I6LA 5TOZA 5K0XA 1OL1A 4ANMA 4OAVB 4AXFA 4ZMFA 2F2UA 3VONA 5KUPA 5EQYA 2Y0AA 2GS2A 5K0KA 2WTIA 3I60A 4K77A 4P4CA 4S32A 2WELA 4C2WA 1B6CB 1Q99A 5FM3A 5IG1A 2XKEA 3PSDA 5CSHA 2C4GA 5IKWA 3VUTA 2VX0A 3DLSA 4WNPA 5IA4A 5JFSA 4UMTA 3I7BA 4E4LA 3WYYA 2XK4A 4XBUA 3RK9A 5FGKA 4CQGA 5ANGA 3R7IA 2BKZA 3E8NA 3L9NA 4M0YA 3KXZA 2FO0A 2PMLX 5AR5A 2WMQA 4R1YA 1ZOGA 1A9UA 4EI4A 4EK5A 2RL5A 4F70A 5LVNA 4DF3A 2XNNA 4RGJA 4RT7A 5LVLA 2XZSA 1Q3DA 2GNGA 4D2TA 4D2SA 2ZMCA 2W1ZA 4BL1A 5BPYA 3AKKA 4ZTSA 3UIMA 3HP2A 2YHVA 4I6LA 4A9SA 2W96B 4GFMA 4I6HA 5CAPA 4U44A 4YZCA 3A62A 3IDCA 2QOKA 3ORPA 3OY3A 2H9VA 4L52A 2WMTA 1PXPA 4IAIA 3D9VA 3SG8A 4OTGA 4K18A 4S2ZA 3N4TA 4BKJA 5JFVA 4Q2AA 2PHKA 5A4EA 4I5PA 5HX6A 3QTSA 3H0YA 4FKOA 4RC4A 5FQDC 4E26A 4QT1A 2QLUA 4EH3A 2A0CX 4BZDA 4ZLZA 3Q9ZA 4AAYA 4C4GA 2J0IA 5AUVA 5GNKA 3O96A 4JXFA 3ORZA 5CSVA 3PXKA 1PXKA 5E8TA 1REJA 4AGCA 4YURA 1WAKA 5HI2A 4CRLA 2B9IA 1TFFA 3DB8A 3F3VA 3TI1A 4AS0A 2XA4A 3Q2JA 4BCPA 4U7ZA 4KIKA 4OUCA 1H1PA 4BCHA 3GOPA 5AP5A 4D4VA 2YEXA 1WVWA 2GHLA 2UW6A 2HENA 4YZBA 3U8WA 3W0OA 4JDIA 4L53A 4QP7A 2OFVA 2GU8A 4FG7A 3TTIA 4J96A 3FXZA 3FQSA 3OS3A 4MD8E 3KMWA 3KF4A 3QFVA 2BAKA 3R28A 4ASZA 5DWRA 3OCSA 5G6VA 3E8DA 4E73A 1DS5A 5KBQA 4TWCA 2UZLA 2XB7A 2XIKA 3TUDA 1JWHA 1IA9A 3MPAA 1K9AA 3FHIA 3KF7A 3Q4CA 3FLYA 3QZGA 4XV3A 5ANDA 4QP1A 2WQMA 4K0YA 5DMZA 2O8YA 2OH0E 4FV2A 4EJNA 4O38A 2XALA 3FLNC 2IPXA 3GXLA 2R64A 4I4FA 5DE2A 4WUAA 2VTQA 4YP8A 2YZAA 1OIRA 3U6IA 4PTCA 3ZO1A 1OL2A 4UN0C 4ZS4A 5AV4A 2XNOA 1YXTA 3EHAA 4IB3A 2I1MA 2VWUA 3QTQA 4HGTA 4QMQA 1CKPA 2IWIA 4O0YA 3DXPA 3VF8A 4DAWA 4BJJB 5HO8A 5K4IA 3AOXA 4QMUA 4HVDA 2CN8A 4K1BA 4MYGA 4C7TA 3JUHA 3MVLA 4NZWB 4C4JA 1U46A 3PA5A 5F95A 4MAOA 3Q6WA 3C0HA 4LUEA 5HD4A 4BDJA 4FEXA 4FIEA 4BI0A 5KMMA 4YZNA 2YM7A 2G2FA 3FI4A 4W8DA 4DA5A 3UO4A 3UP2A 5HIEA 4O7TA 3AT4A 4L9IA 3G9LX 2W7XA 5E8UA 5A4LA 5AR4A 4QP8A 5D1JA 3S0OA 4F09A 3R30A 4JAJA 3QTUA 4QOXA 4YC6A 4BIEA 3CCNA 4GEOA 2GDOA 1W82A 4IAFA 1R1WA 1H00A 3FMKA 3EKNA 4IWOA 4RVLA 4TTHB 2QCSA 4M0ZA 1OECA 3OXZA 3EWHA 3UMWA 3T8OA 4HW7A 2WTKC 4QQCA 4F0GA 2R3QA 3E62A 4GU6A 3CXWA 4ITHA 1AD5A 3MVHA 4FR4A 4R1VA 4N6YA 2JDTA 3TV7A 4FODA 2XK9A 4RMZA 3O51A 3SW4A 3QX2A 4FKUA 4BF2A 4E4XA 5DLSA 5C26A 5M4CA 5BVKA 3VW8A 4XV1A 4DFUA 4DLJA 4JIAA 4D2PA 4XV9A 4QNYA 3BLAA 2PE1A 2CLQA 4NEUA 2X0OA 5HZNA 3P7CA 3ZUTA 4I23A 4YBJA 1X8BA 5BUIA 1MRUA 4K8AA 4G6OA 5EQEA 2CGUA 3GEQA 4ZXTA 1BI8A 1PXOA 5LMKA 4DHJA 1YDSE 3WIGA 2IZSA 3RP9A 4LOPA 3F2RA 3TXOA 4L43A 3HMIA 2E9PA 3MA6A 1PXJA 5J9LA 4E20A 4ENXA 2Y6OA 3HVCA 3OXTA 3A60A 3NCZA 5DRDA 4JQ7A 1YI3A 5AX3A 2YAAA 1PY5A 5HHWA 3EFJA 5HE2A 4TYIA 3FZTA 4RLKA 4X3JA 4ITJA 4AW1A 1IRKA 1BKXA 3TDVA 4FIFA 3EL7A 3OXIA 2DWBA 2BZJA 3G6HA 4IX6A 4ZY6A 4F64A 4XP0A 2X0GA 3GU7A 3TZMA 3DJ7A 2E9NA 3R63A 3SRVA 2GMXA 3RCDA 1ST0A 4V05A 5HVKA 4YZMA 4IB0A 5HO7A 5JKGA 2XANA 3VF9A 1QL6A 1XWSA 3WF5A 3G15A 5CNNA 2OF4A 4IFGA 3Q4ZA 3PJ2A 4BTKA 2XNGA 3ELJA 1W2FA 3S2PA 5L6OA 4FE2A 4F6WA 1PMUA 3O71A 4EEVA 1G8JA 4RBLA 3PWYA 3UOHA 2ONLC 1XH4A 3DK6A 3S3IA 4L67A 5LXMA 4QMLA 2UW0A 4MXOA 3PLAE 1PXMA 4B8LA 2BRNA 4YLKA 4OGRA 1PJKA 4ACMA 2A98A 1W8CA 2GCDA 2XJ0A 4IJPA 4I1ZA 3E63A 4FTRA 2VTRA 4EH7A 3RAWA 1FOTA 3UNJA 3BWFA 2YIYA 3AMBA 3D7TA 3QA0A 5EDQA 4DFYA 3FZOA 4LOOA 4GCJA 4NCTA 3WE4A 5EKOA 5CQWA 3MA3A 4UX9A 4LL5A 1YHWA 2BFYA 3ETAA 1WBSA 4FTTA 3ZSGA 5L8KA 5JRSA 2CJMA 4BRXA 4P2KA 3VO3A 3RTPA 4TW9A 2QNJA 3F5PA 2I0HA 4FZDB 4DFBA 3MH0A 3D4QA 4ARKA 3VVHA 4AFEA 3R8ZA 4DITA 5CU3A 5HESA 5CQUA 2F57A 2KULA 4BDHA 3FI8A 4M15A 4OTRA 4ANSA 5IA1A 2EWAA 3IG7A 4D1XA 2AC5A 2VGPA 4XBRA 3QQGA 1GY3A 2V0DA 1YDTE 4O0UA 2WB8A 4LM5A 4CTBA 4RPVA 4MVFA 5CANA 5GJFA 2C5NA 3FXWA 4D55A 4IQ6A 4QMMA 4TYHA 3L8PA 3T3VA 3I6UA 3QQKA 2X39A 2B0QA 3SC1A 1XO2B 3AQVA 5ANIA 4DFLA 4LUDA 2W5BA 3BBTB 5L2TA 2REIA 2OU7A 1JPAA 4YPDA 3CTJA 2HELA 4CCUA 3FC2A 3C4XA 3CIKA 4BR3A 2WTDA 5DBXA 4PY1A 2GNHA 4ZS0A 5L6PA 3E92A 2WOTA 3QCYA 4MH7A 2QOOA 4D2WA 2UW4A 2EB3A 4X0MA 3V5TA 3QTZA 5IQIA 2H8HA 3W32A 2VWYA 4NJDA 5AAFA 2W05A 5HICA 4FC0A 1TKIA 2RFNA 3HL7A 3L9LA 5AAGA 3DV3A 1RDQE 3Q5ZA 4IAZA 2C68A 3PVUA 3AKLA 5FEDA 3P7AA 4JNWA 2P0CA 4JRVA 4TYGA 5EDPA 4BWKA 4XRLA 5K5NA 4AN9A 2PUUA 1OI9A 3GQIA 4GJ3A 2VGOA 1DM2A 5A46A 1OKVA 2WEVA 4L42A 2JBOA 4KNBA 3OD6X 5CVGA 3ZCLA 4PNIA 2BDFA 4O4DA 2VTJA 1KE7A 2Y6MA 2XP2A 4ZSEA 3VJNA 3KULB 1RQQA 5D9HA 3SX9A 2ZFYA 1JKLA 1R78A 1XH7A 4FT5A 3VUDA 2XEYA 3RZBA 2CLXA 4YC8A 2JBPA 3O8TA 3UIBA 4FV5A 3PFQA 3BPRA 4YHFA 3W0PA 3AC3A 4MNEA 4JDKA 3AG9A 4BHNA 4R5SA 3FLZA 3GCQA 3T9IA 4A07A 4ACGA 3QALE 4Q5EA 3FEGA 4AE9A 4EOLA 2VTIA 5K4JA 3ERKA 2W9ZB 4Y83A 3BEAA 3UDTA 3LFBA 3KU2A 4BBFA 4PP9A 3C4CA 1R3CA 3I1AA 4UZHA 4GUEA 4L46A 1URCA 4NTTA 4X6QC 4JG8A 4I5MA 4XLIA 3ID6C 1UV5A 3F5UA 3H9FA 4BC6A 5B2LA 3KY2A 1ZARA 4O1OA 2JKKA 3BELA 4QQJA 1H1SA 2QO2A 4R8QA 2V7OA 1FGIA 4BDGA 2W1HA 1Q8UA 4L7FA 4QYYA 5EI8A 3TJCA 4TWPA 4BVUA 3MESA 2VWVA 3QC4A 3DBDA 3OFMA 3RPYA 3LXNA 2BRHA 2C5OA 3MPMA 3WBLA 1LPUA 3LFNA 5IEXA 1A48A 3PG1A 2FH9A 1KWPA 2XKCA 1XQZA 4FT9A 2QOCA 2C6DA 3PTGA 4JR3A 4U0IA 4ZY4A 4HVHA 5E91A 4IH8A 4QP6A 2PMIA 3MDYA 3PUPA 1I09A 3PXRA 4O1PA 5B2MA 5HCZA 3BKBA 3E64A 3Q96A 3KRWA 3GC7A 2F7ZE 3HMPA 4HCTA 2Y4IC 3QGYA 5DHJA 5KHWA 4QDEA 4AZVA 1LP4A 4LGHA 2QU6A 4TRLA 4FT0A 4M7IA 3BX5A 4FEUA 4K6ZA 4JQEA 4IX4A 1WBVA 2IO6A 2WQBA 2XNMA 1XKKA 3BZ3A 4PWNA 2AUHA 1YXXA 3NYOA 4U5JA 4JVGA 4QTEA 3QUDA 5AV3A 3FYJX 1CKJA 3NVKI 3QUEA 1XR1A 2XM9A 4WNMA 5DPVA 4V01A 5EK7A 5KZIA 1H25A 4H58A 4WNKA 1GZOA 2B55A 4XH6A 5EH0A 2CGXA 5ICPA 4LYNA 3QYZA 3UDBA 1QPJA 4NM7A 4G31A 4D0WA 3WE8A 3N4VA 5C4LA 3KEXA 4C02A 5HORA 5HLNA 2WGJA 3GGFA 2X2KA 5IDNA 3LFQA 4UYAA 2EXCX 4FKTA 1Z9XA 3UPXA 1FVTA 3ZFYA 1YQJA 4BZNA 2PE0A 4DH3A 4I0RA 1JOWB 3PDTA 2PL0A 4QDVA 2OKRA 3NLBA 4C0TA 2UW5A 1BUHA 3BIZA 3Q2MA 2OIDA 3SDJA 2ITVA 1JKSA 5DR6A 4MBIA 3FMEA