4AE9A

Structure and function of the human sperm-specific isoform of protein kinase a (pka) catalytic subunit c alpha 2
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
339
structure length
321
Chain Sequence
SSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA
publication title Structure and Function of the Human Sperm-Specific Isoform of Protein Kinase a (Pka) Catalytic Subunit Calpha2
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 321
sequence length 339
chains with identical sequence B
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ae9A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ae9A02
5HIBA 4C36A 1YI3A 2J0IA 3NNVA 4FVQA 4K9YA 5IH4A 4TRLA 4ZJJA 1NVQA 5JN2A 1Q99A 3SKCA 2VTRA 4JBQA 5FEQA 3MESA 5HLPA 4C62A 4QYEA 2WELA 3U4WA 4AW0A 5IQAA 3W32A 3IOPA 2E2BA 2W1GA 2ZJWA 3TIZA 3F6XA 4MXCA 3KF7A 3IPHA 3R00A 2VTJA 5FP6A 5A6NA 1NXKA 3P5KA 1FMOE 3FKNA 2SRCA 3OCTA 4Z9LA 3HV5A 3D2IA 1QPJA 4QP4A 4E4XA 5KKRB 4ZIMA 4ACHA 3R1SA 4ZK5A 2VTPA 1M14A 2R3FA 2JIUA 5HNIX 5CAPA 4FKVA 1ZOEA 3QHWA 2GCDA 2X8EA 4NM7A 4OTHA 3FMEA 4QRCA 4UWCA 4CCUA 4PMSA 2J6MA 5FP5A 5JK3A 3CTQA 1FGKA 3DDQA 3II5A 3T9IA 3OF0A 4D2VA 1UWHA 3O17A 1BX6A 1RJBA 3QAME 3FMLA 4I6HA 4I20A 3BYUA 5KCVA 1H1PA 1PXOA 1WBOA 3OBJA 3QQLA 3K3IA 4IZYA 3COMA 4LV5A 5ANDA 4BDGA 1BKXA 5CVGA 5IQGA 1SVEA 3O8TA 2CLXA 3W8QA 2F7EE 4BI1A 3BKBA 4RX7A 4FYOA 3CP9A 2ITWA 4O21A 2J2IB 4TYIA 1OM1A 2R7IA 3TEIA 3WF5A 1DI9A 3ENMA 4O6LA 4YZ9A 3R83A 2Z02A 5IQIA 3FWQA 4DCEA 4DFXE 3UQCA 4D4SA 1OIQA 4KS7A 5DE2A 5KUPA 3CGFA 4H36A 1FVRA 5C8NA 4CLJA 3FUPA 2RGPA 4CGAA 2UVZA 3Q60A 2C5YA 4H39A 5EHLA 2XCKA 5A4EA 4L00A 4QTAA 2YA9A 3M2WA 2CKOA 3FI8A 3MFRA 3C5UA 4IWQA 4DTBA 4CSVA 3TCPA 2OZOA 2F4JA 3GQIA 4JG7A 2W4JA 3M11A 4LL5A 5DHJA 4J1RA 2UZWE 4ITJA 4O0TA 1RW8A 2EWAA 4V05A 3TJDA 5EQPA 5CT7A 4EK3A 3UIUA 3SXSA 3UIMA 2C47A 3QTUA 4AGDA 3A4OX 3KGAA 4EH2A 4AZTA 5M51A 5M4CA 3FLWA 3MA6A 3UOLA 4IDVA 4YJNA 2LGCA 5HGIA 2QI8A 1S9IA 2PUNA 3NUAA 3ENHA 4FTKA 5CU6A 4ZXTA 5C4KA 3LXPA 4U97A 4W4VA 4D5HA 5EM5A 1Z5MA 2X2MA 3DLZA 2X4FA 4L43A 3VBXA 2OXDA 4L52A 4O6EA 3U55A 4TWOA 2PSQA 4FOCA 2CHLA 4H3QA 5ANKA 2GHLA 4K33A 2R3LA 1ZYSA 4AZWA 3HRBA 4MTAA 1OPLA 4OGRA 1UA2A 3ZHPC 5LMKA 3KRRA 4HZRA 3V8WA 3A2CA 2VGOA 3HEGA 4U5JA 4TWNA 3GT8A 1O6KA 3DBQA 3MIYA 3MPTA 2BALA 4PP7A 4O1OA 4NKAA 4DEBA 4U79A 2O65A 4E3CA 1G8AA 3VQHA 2O3PA 3OY1A 3R63A 4I1ZA 4OTDA 5I9UA 4EOSA 3QCQA 2UV2A 1OUKA 2ZV8A 4X2GA 4CFXA 4LGHA 2XB7A 4A9RA 4GIIA 4YU2A 4HGEA 5K0XA 3EQRA 1KE7A 3KFAA 2EB2A 4BR3A 4WNOA 3NUNA 3MBLA 3EB0A 4CG8A 4ENXA 2WTJA 4FZFB 4IEBA 3NW6A 4TYJA 3BBTB 3BHVA 3FYKX 3MJ2A 4D4RA 4HCTA 4RBLA 2A2AA 2Y6OA 3D5WA 3LFNA 3POOA 3G51A 4FOBA 3IDPA 5TO8A 3U51A 4TN6A 4R3PA 5KKRC 3NMUF 3NUUA 5AX9A 2CNVA 3GQLA 3SC1A 3OZ6A 2B9HA 5IQHA 4D0XA 3D4QA 4MWIA 1CKIA 2JAMA 3LCOA 2GNFA 5KZIA 3TT0A 3VUTA 2BFYA 4GKHA 4KUJA 4KNBA 3R8VA 3H9FA 3QFVA 3FLNC 3IOKA 4IB5A 3OHTA 3ZXZA 5M4UA 3U6IA 1H24A 3A7IA 4TYGA 3ZEWA 3NNWA 5IQEA 4UV0A 4YHTA 4FVRA 3MFTA 3OY3A 4JVGA 4M67A 3MVHA 3GFEA 4JX3A 5BVWA 5A54A 3PVBA 1GIHA 4RJ7A 3LVPA 3ZLYA 3OXTA 4AAAA 4YSJA 3F61A 4J96A 2C5XA 2F57A 4FTUA 5DT4A 5E8VA 4F09A 5JMSA 2B52A 5FUTA 3P9JA 4ERKA 3HP5A 3P0MA 3UG2A 4HGSA 5J7HA 1VYWA 3GC7A 3MS9A 4NIFA 2OW3A 2X9FA 5HBJA 3WZJA 4OBPA 2G2FA 3RPVA 5IISA 3QQKA 1GZNA 5JQ8A 3NRMA 4AUAA 2FSLX 4CFWA 3UVQA 1XH9A 2OK1A 3NWWA 5HKMA 5DI1A 2B9FA 4D1XA 4RA5A 4YJOA 4XP2A 3O71A 3OUNB 4MNEB 5EI8A 4QYHA 4EQCA 3VS0A 5ANGA 3VS7A 3RHKA 3LMHA 4DBNA 3IDCA 4RT7A 5EH0A 2Y4PA 3I81A 3GC9A 4M97A 1REKA 5AV3A 3GOKA 3CGOA 1ZOGA 3PLSA 3U9NA 4BCGA 5H8EA 3KRLA 3MV5A 4FNYA 2WB8A 2JDTA 1YVJA 2IPXA 4IVBA 3UO5A 2W17A 4XP3A 3LMIA 3AMYA 3BV3A 3UIBA 4RFMA 3TN8A 2X6DA 4FNZA 4B99A 4NK9A 5H8GA 2CLQA 2YHVA 3EFJA 4BCIA 1T45A 4O86A 3QCYA 1YHWA 2BIKB 4L46A 4YBKA 1ATPE 3PWYA 3TKUA 3UQGA 2IZUA 4DT9A 4RRVA 3JY0A 4X6RA 5EW8A 1OI9A 2QKWB 3UJGA 4QT1A 4AG8A 5C9CA 4DGNA 3A7JA 5HCXA 2CPKE 5EFQA 2BRNA 2PVNA 5BMSA 2R3HA 4PPAA 4GUEA 2VWXA 2PUPA 3PE1A 1U54B 1URWA 4FIIA 5BVNA 3BGZA 2PVKA 3RJCA 2NRYA 3FY0A 2R5TA 3LM0A 2JKQA 2W1IA 3LFBA 2JDVA 5D11A 5HNBA 2OXYA 4FF8A 3VS5A 5BVKA 4MNEA 3CPCA 4XV3A 4FKUA 3G0EA 1W82A 3GGFA 4RLLA 4AZVA 2REIA 4KRDA 4ASEA 4PDPA 3DKFA 5AR5A 2YCRA 3HZTA 2WOTA 3NSZA 1OPKA 4RVKA 4C4GA 1WFCA 2VTNA 5HNGA 4UMTA 3PJ8A 1LP4A 4C3RA 1CSNA 3R7GA 4XS2A 1LEWA 4YTFA 1M2PA 4BZDA 2JKKA 3ULZA 3SXFA 3DFCB 1NW1A 2CKPA 1GAGA 5L8LA 3H10A 4QQTA 4EUTA 4BB4A 3LXNA 2OF4A 3IW4A 3OVVA 3MFSA 1PW2A 4FTRA 2JC6A 5CI7A 5M07A 4QD6A 3ZO2A 2WHBA 3ZM9A 2ITNA 4OTIA 1RQQA 5FM2A 3R7IA 3VUKA 1OKYA 4S34A 5L6PA 1F5QA 4MK0A 3FV8A 4W4XA 4DFZE 4HNIA 3NIEA 1JKTA 3SW4A 3ZO4A 1ZZLA 4FG8A 4NKSA 4E6AA 5D10A 5ICPA 3DKCA 3G9LX 3QRIA 5I4NA 2CMWA 4I0RA 4O27B 5AV4A 3OC1A 2XCHA 4KA3A 4RLKA 5EYKA 3KCFA 2F9GA 1K3AA 1U54A 4GCJA 2XYUA 4L68A 4KBCA 5DIAA 4O0UA 4GU9A 1AD5A 2CGWA 4BBEA 1SVGA 4ZY4A 4CT1A 4DLIA 3UNKA 2R3QA 1G5SA 4E93A 1YWRA 4RVLA 4KRCA 3C0HA 5EKNA 1DS5A 5TF9A 2ONLA 2QOOA 1JKLA 1MP8A 4N6YA 3EQIA 4FT0A 4IAKA 5LVOA 2WQEA 5C03A 3MSSA 4N0SA 5CY3A 2C69A 1LPUA 2QNJA 3E62A 4K8AA 5E1SA 1PXMA 5CEMA 5FBNC 2VWYA 3NUSA 4FA2A 4FEVA 3A60A 4R8QA 5CALA 3AT2A 5DN3A 4I6QA 2J50A 2XNEA 4O0XA 2Z7LA 5CAOA 3TJCA 4Y5HA 4F63A 3RAKA 1IA9A 4FC0A 3DB8A 5LWNA 4OAVB 3RM6A 5CF4A 5KNJA 2PZPA 3HP2A 4D1ZA 5BVFA 4O7VA 5KMJA 4QMOA 5LVNA 2YDIA 4X2FA 2GDOA 2IW6A 1Q8UA 1KV2A 2KULA 2VNYA 3DQXA 3DT1A 3CR0A 4F1OA 4F0FA 3LCKA 4YHFA 4C02A 3JYAA 4Q2AA 3TIYA 2R3MA 3K5UA 2C6OA 4DC2A 4X0MA 1APME 4TNBA 5E8XA 4FSUA 2GQGA 1LR4A 4FUYA 4U7ZA 4UALA 2JFLA 3GUBA 2O0UA 2RG5A 1FINA 4J98A 3TV7A 2PE0A 1Q8WA 1QCFA 3IQ7A 2XBJA 2BAQA 1M7QA 4J8NA 4JIAA 1BLXA 3OEFX 3ORPA 2R3PA 4CRSA 4FE2A 2WFYA 2R3OA 2YZAA 4H58A 4EOIA 5CZIA 1X8BA 4ZJVA 3WARA 3ZRKA 4WO5A 4GK3A 1MUOA 4BDKA 4P5ZA 2XNOA 4QQJA 4BCMA 2PVRA 4BCFA 4NU1A 3BGQA 4F6SA 2BCJA 2JDSA 1FVTA 5FXRA 1SNXA 2WOUA 4MD8E 4L53A 4EK5A 4DAWA 4U41A 4CKJA 2HK5A 4F9YA 4O84A 1F3MC 4ZAUA 2C6EA 3JVRA 5CF8A 3P7AA 5LJJA 1LUFA 5HBHA 1H1SA 3A99A 2R0IA 2BTRA 4TYEA 2BKZA 5FG8A 3KRXA 5BX0A 1Q97A 4K2RA 3AD5A 3GC0A 1XBBA 2QR7A 4Q9ZA 5AAGA 4ZTNA 5FEDA 1IASA 3F82A 3HECA 3K54A 1YDRE 4TTHB 4WA9A 3OCBA 5J8IA 1YKRA 4CV9A 3U6HA 2IJMA 4DA5A 3HUBA 2PUIA 4FGRA 5HBEA 3ZDUA 3ZLXA 2XIZA 3QLFA 4B7TA 3GCQA 4IHPA 4WHZA 4BDEA 4DGGA 4R1VA 4CVAA 5I3RA 1Q5KA 5BVOA 3AC3A 3FSKA 1SNUA 4I93A 2EVAA 4E4NA 5HG7A 1UNLA 3IW7A 1FVVA 3HMOA 3VUGA 1FMKA 3A4PA 1WBWA 3THBA 5I9ZA 3EN9A 2FUMA 1ZYDA 3KULB 4Y95A 2CGVA 4D0WA 5IA4A 1M17A 4O2PA 2PPQA 5C01A 2QOHA 3HDNA 1GNGA 3JUHA 5M4IA 1PKGA 2B9JA 3JVSA 3QD4A 5HCZA 3UYSA 2X81A 2GTMA 2VO6A 3PXQA 2VN9A 4O7WA 4DFUA 3L1SA 3L8VA 4XBRA 4MD9E 3ULIA 3H0YA 3C4XA 1UU7A 5IDNA 5IG1A 2QD9A 1H01A 4BYJA 5HO8A 4O22A 4CQEA 4YZMA 4D4YA 5M06A 5AUYA 3TZ9A 4C3FA 3BLQA 5DR2A 3MY5A 4QPMA 2QR8A 3C4EA 4M13A 3BLRA 4MBIA 4PL3A 4U0IA 4WNKA 4IAYA 2GQRA 3MY1A 1BL6A 4Y83A 2ETKA 1WZYA 3ZUUA 4F0IA 2B53A 2UW4A 2X39A 1OKWA 3KCKA 3LXKA 4A4XA 3FMNA 3PPJA 5KHWA 2QLUA 4HJOA 2WMUA 4M7IA 4ONAA 2PE1A 4FSWA 3VBTA 4Q5EA 3ZZWA 1FOTA 5CQUA 2X9EA 5AWMA 4AF3A 3CJFA 3E7OA 3F5UA 2IZSA 2I0YA 3KXMA 2PTKA 2GFCA 2IZTA 4IJ9A 1XQZA 2PHKA 3EN5A 3O8PA 4HNFA 1JWHA 4K6ZA 4EH8A 4ZZMA 4JQ8A 1QPDA 5J9ZA 5EG3A 2EXCX 3I5ZA 4O7YA 4IAZA 3UDBA 5CQWA 1XH6A 2CN5A 3LFDA 5L2TA 2C6LA 2YJSA 4OW8A 4AWIA 5DOSA 4IDTA 3AG9A 3QZHA 4AT5A 3WIKA 2Z8CA 4FTQA 3DXNA 5D12A 3R7VA 5IEYA 3KEXA 2UVXA 3QRTA 4ZTHA 5T68A 3EN7A 4FKTA 2OH4A 3EQHA 4UY9A 3KULA 4OUCA 2WMTA 4R3RA 5JRQA 3DFAA 1J7UA 4DTKA 3KRJA 3BWFA 2GS7A 3E3BX 3P7BA 4O7TA 1DI8A 3TZ8A 4G3GA 3UO6A 2CGXA 3U4UA 2OXXA 1H0WA 4UYAA 4QNAA 1QMZA 2ZV7A 3G5DA 3KVXA 4R7HA 5IEXA 1MQ4A 2H96A 5CNOA 5DA3A 3DKOA 5ACKA 4QMMA 4EWHA 4YTIA 3O7LD 2YCFA 3QTZA 4I4FA 3BHUA 4KB8A 3EKKA 4MXOA 4RPVA 2XEYA 4AE9A 4ZS0A 3Q32A 3PXFA 4RC3A 1JOWB 2R3GA 3P86A 3R71A 4G6LA 4QP6A 2RFSA 4GYIA 5E92A 4ZEGA 4CFMA 4GVAA 5CEOA 2Y9QA 4EBWA 2G9XA 4C8BA 3TNWA 3BQRA 4PTEA 4PDSA 3ZXTA 5GZAA 2XMYA 3EQPA 4Q5HA 2UW7A 4BKYA 4I4EA 4QMYA 5E8ZA 2WIPA 2ZDUA 4LFIA 3GU7A 2OG8A 1OL7A 4AW2A 2J0KA 4UMUA 4FV5A 4U9AA 1YDTE 3WYYA 3FLZA 4I21A 4NEUA 5BYLA 3I0OA 4B4LA 2FSOX 4WG4A 3VN9A 4ANOA 5LVMA 3DXPA 4ASDA 4EK4A 2HZNA 3D9VA 4EOOA 3ETAA 5CU2A 4YP8A 2ZV2A 4G1WA 3KMWA 4F9BA 5AUZA 4AT3A 2WTVA 1URCA 3FEGA 1IAHA 2BILB 2QHNA 3KMUA 3NCZA 4AN2A 4JNWA 3DDPA 3UG1A 2XYNA 4LRKA 3TNPC 1REJA 3SVVA 3QZGA 3NUPA 2XF0A 3ORIA 5AADA 3OWPA 4UN0C 3ZFYA 2HOGA 1YW2A 4IB3A 1WMKA 1YXUA 3ALNA 3FI4A 2UUEA 2YWVA 3A8XA 3UODA 5AIKA 3NGAA 3MWUA 5C27A 3R9RA 4AU8A 1Q62A 2PMNX 5CXHA 2Z7QA 2WGJA 3BLHA 4MWHA 3ZDIA 5JZJA 4BWPA 1L8TA 2WPAA 3D14A 3WI6A 2W06A 5K5XA 2ERKA 2XKDA 4BDCA 5CAUA 5KZ0A 3I6UA 4Z16A 1JSUA 3PVUA 1P5EA 3IGOA 1KE8A 5M4FA 5AR3A 5J95A 5I3OA 4IZ5A 1ZMVA 4QMVA 4RIWA 4ZJIA 4A9TA 3QCSA 4ASXA 3IG7A 5IH5A 4HYSA 4K77A 3ZSGA 1PRYA 4R5YA 2GNGA 3IW5A 4YNEA 4G2FA 1IR3A 4UZHA 4DH5A 1IEPA 5CVHA 4EHVA 3JS2A 1HCKA 4ZSJA 3NUYA 4CG9A 2BRMA 3V5PA 1H8FA 4EI4A 4IM2A 3BE2A 4DE4A 3ZS5A 1WCCA 4FTOA 2FSMX 2WTCA 4FTTA 4FT3A 4GW8A 2J0JA 4M3QA 4QTDA 4PY1A 4X3FA 4H3PA 3R6XA 4JJRA 5AV2A 1F0QA 4JAIA 5CU4A 3RVGA 3ZZEA 1WVWA 2O2UA 4YC8A 1DAWA 3TL8A 5B2LA 4WIHA 1ZLTA 3NEWA 5LOHA 3ZC5A 3DKGA 5F4NA 2BVAA 1JSVA 3QTRA 5HD4A 2X2LA 3EJ1A 3E5AA 2P2HA 2J4ZA 3F66A 3OOMA 3KRWA 3QUDA 3PXRA 3MVJA 5AM7A 3NDMA 3LHJA 4K11A 3MH2A 3C4FA 2VX1A 3IKAA 4RWKA 4RX9A 1OIRA 4BZOA 3AD6A 3BYOA 4EH5A 2ITPA 4GVJA 3FZSA 3OP5A 4RJ3A 1V1KA 2ITVA 4U40A 4IB1A 3DY7A 4ANLA 3R9HA 5J87A 1R1WA 2Q83A 2GNIA 4H1MA 5AUTA 3IK3A 2J0LA 4KSPA 2WMRA 3F5PA 3GCSA 3RK7A 3VULA 3NR9A 4GRBA 1ZAOA 3DBEA 5K4JA 3SD0A 5BYYA 2C0TA 3FLSA 4IANA 2Y0AA 4IAIA 4NJ3A 5LQFA 3SLSA 1NA7A 5IA3A 2BHHA 1ZYJA 2YAKA 3T3UA 3O8UA 2QC6A 4F64A 5G6VA 5DYJA 5HX6A 3FI3A 3MB7A 3LFCA 4NTTA 1J1CA 3ZBFA 4C7TA 3FAAA 4E8AA 3VW6A 4D55A 3IECA 3KB7A 3VIDA 5F9EA 3PSDA 3O96A 4U81A 4QP3A 4CXAA 2W1ZA 5EOLA 5EW9A 5J79A 3VJOA 5E8WA 2OFUA 3FDNA 2G2IA 3GP0A 4XV9A 3F3ZA 3Q2MA 3AD4A 4HCVA 3HNGA 3UMXA 4BGHA 5ETIA 2XK7A 3FMDA 4GL9A 1OITA 3WF8A 5D41A 3OG7A 3FHRA 2WKMA 3SHEA 4DEDA 2XJ0A 2XVDA 1WBSA 3UC3A 4EH6A 2EXMA 2R7BA 3QD0A 4GT5A 5HCYA 3R1QA 2B0QA 5KBRA 4PRJA 5EQYA 4V01A 2PK9A 2WO6A 5F94A 3RNYA 3R04A 5BUEA 1OUYA 4IX5A 5A4TA 2HXQA 4MNFA 3NNXA 4FSYA 4V0GA 3OT8A 4O91A 4AZEA 3WBLA 3HV7A 3RTPA 4GK4A 2J51A 2QO7A 4G3FA 4W9WA 2JAVA 1WVYA 4D2WA 3E64A 5TOZA 2YM5A 1FBNA 4FKJA 3N4UA 4IC8A 2O8YA 4PTCA 1DAYA 1B38A 1GZ8A 4II5A 3BX5A 4QMSA 3OD6X 1O6LA 3C9WA 4NW6A 3RBWA 3WF6A 4ERWA 3KC3A 4IX4A 3A8WA 3BU5A 1VYZA 3ITZA 4Y46A 2YLEA 1RE8A 4ZTRA 3F7WA 3SXRA 4QMPA 3ZC6A 2W1HA 3ERKA 3GI3A 5ETCA 3CXWA 4CKIA 2E9NA 3Q4CA 5FLFA 5HOAA 4C2VA 4UMPA 4JX7A 5HVYA 3REPA 4IAAA 4M8TA 3BELA 2ZYBA 4QP9A 5C1QB 4GT4A 1PXKA 2G01A 3EN6A 1CKPA 4B8LA 3F3WA 3RPRA 3T9TA 5J9LA 4TYHA 3CKXA 3GENA 3HV3A 3LAUA 5M09A 4CYJA 2B54A 2DQ7X 2AYPA 3F5GA 4RZWA 3BWJA 3FL5A 5HD7A 2PY3A 3QTSA 2V0DA 1Q8TA 5B2KA 4C4HA 5IH6A 2I6LA 4U42A 4BWKA 3I7BA 5A6OA 4DBXA 4O82A 3SOAA 2RFNA 3ZSIA 2YDJA 4FODA 3HMMA 5IQBA 2XK3A 3PA5A 3PIZA 4J7BA 4BCKA 4EBVA 2VWUA 4MF1A 5L6OA 3OOGA 5AP5A 3IONA 3HAVA 4APCA 4F7LA 2C6DA 4QPAA 2C6TA 4L42A 2YAAA 3UIXA 2Z2WA 3AGLA 3SOCA 2B9IA 3LFSA 4NIFB 4U44A 3VF9A 4UXQA 3D5UA 3LCTA 2OF2A 4E6QA 3L8XA 2YITA 4BIEA 4FSQA 1W7HA 4GUBA 4NH1A 4RA4A 3UNJA 5AFVA 2A19B 2YIQA 3DGKA 1GIIA 2PVJA 4JQ7A 3A61A 5EM8A 2BAJA 5AV0A 1ERKA 2VTLA 1JNKA 1WVXA 4EYJA 4AA0A 4BBMA 4CFUA 1K2PA 2AC3A 3MW1A 3Q9YA 5DMZA 4FV1A 5CSVA 4NM3A 5AP6A 4ORKA 5EDQA 3AMAA 4JDKA 3ORKA 5DNRA 3QX4A 1IA8A 4BKJA 2UZVA 4YMJA 2R3KA 3AT3A 5CAQA 4OT5A 4YTHA 5JFXA 3P7CA 3VS6A 3R9NA 3TKHA 5JFVA 2GNJA 3PJ2A 5CF6A 2XK8A 1PHKA 4JBPA 1GIJA 4PL5A 3VUDA 3E63A 4M66A 5IKWA 1I44A 3TNQB 4AOTA 5AP7A 4PNKA 2H8HA 3AGMA 1UKHA 1H07A 3H3CA 2ACXA 3VBVA 3GB2A 4AXAA 2WEVA 4N4SA 4RWLA 2VTQA 3VS3A 5CSPA 4D2PA 5LMKC 4LRJA 5AR7A 3R9DA 3VBWA 4FI1A 1CM8A 3SW7A 5K3YA 3E8EA 2WQMA 2PVYA 2UW6A 3LCDA 3IDBA 4IM3A 4TPTA 3FC1X 2GHGA 3HRFA 3RK5A 4AGUA 1PMEA 4BF2A 5DFPA 2WTKB 3F2AA 4EUUA 2QG7A 1G3NA 4R7BA 5HLNA 2QONA 3OTUA 1S9JA 3ACKA 4M84A 3M1SA 3HMIA 3OCGA 4MF0A 4AFJA 3MTFA 4Z7GA 4FTMA 4UX9A 4GH2A 2IN6A 3U6JA 4FTAA 3MYGA 4FIGA 3PVWA 4NUSA 2W9ZB 5IEVA 4YC6A 3CTHA 3KMMA 3EL8A 5JT2A 4TWPA 2BRGA 4H1JA 3ZLSA 2UZDA 4BDDA 5CAVA 2JKMA 3O23A 3Q96A 4F9CA 2JGZA 4JI9A 4CZYB 4G3EA 4XHKB 2EB3A 3BCEA 3VVHA 4FKGA 5CEQA 2ZB1A 3IW8A 3Q9ZA 3PTGA 2XKCA 3RAWA 1J7LA 2Y6MA 2HYYA 3QKKA 1A48A 2PVFA 3MDYA 5ETAA 2VO7A 2GS2A 3LFFA 5AAFA 3AQVA 4O0WA 4CYIA 3LFAA 4JBOA 4CMOA 4O0YA 4NTSA 4K1BA 4I5PA 4E1ZA 4IX3A 4A9UA 4C33A 2BPMA 2C1BA 2W99B 4A06A 5HVKA 4KBAA 3W16A 5E8UA 3AOXA 3QUEA 2WMWA 4HCUA 1UWJA 4LYNA 5KO1A 1XO2B 4BCJA 3L9MA 2XJ1A 4JIKA 4LGDA 4XG6A 3HDMA 5CVFA 1UKIA 2IWIA 2YM8A 4MXXA 2RF9A 4FIEA 2R4BA 4MKCA 3V5QA 2W7XA 3ID6C 2C3KA 3VJNA 3SGCA 5AP3A 1R39A 1IG1A 2VWZA 3QX2A 2WTWA 1R0EA 4NWMA 4L01A 2XK4A 3NVKI 2VWWA 2UZTA 3K3JA 4IE9A 5B0XA 2WD1A 1JSTA 3H4JA 4Q9SA 3FC2A 4E4LA 3OUKA 4WD5A 4C2WA 4I24A 1XH5A 3EHAA 1QL6A 1SVHA 1V0OA 2RIOA 4BCHA 4F9WA 3DZQA 3UC4A 2WIHA 4EOPA 4CQGA 3R7EA 4LQMA 3C5IA 4U3ZA 2XM8A 5LMBA 4YJUA 4F7SA 1U59A 2QHMA 3B8RA 2E9VA 1DM2A 4X2JA 5CTPA 4FGBA 4YO4A 2PVMA 2W96B 2X7GA 4FKWA 3R9OA 1R0PA 2ITUA 4S2ZA 5JFSA 5IUHA 2ZMCA 3QTQA 3Q2JA 2BDWA 4Y5QA 2W0JA 4RIYB 3UOJA 4NW5A 4BL1A 3JY9A 1OBGA 3ORTA 4JG8A 4G6NA 2HAKA 2UW9A 4I41A 4QMXA 3G9NA 1OKVA 5FXSA 5TT7A 4BDBA 4EC8A 4CEGA 2XKEA 5EHYA 2CGUA 3P08A 4XLIA 4QTCA 1Q3WA 3QL8A 5E9EA 4CFFA 2ITQA 3WE4A 5AUVA 4BTFA 3CS9A 5IA0A 4BBFA 3KXZA 5KMKA 5EK7A 4BDAA 1Y6BA 3D0EA 4XYFA 2OKRA 3KXHA 3BE9A 3CEKA 4HOKA 4IFGA 4KD1A 4DEGA 5CXZA 3DTCA 2WTKC 5AR2A 5KMOA 4DF3A 3EZVA 1ZWSA 3DU8A 3MH0A 4EOMA 4ZLYA 3HVCA 3V8SA 4AW5A 2GMXA 2BZHB 2UZUE 4K0YA 2GHMA 4PNIA 3W10A 3FI2A 4DG0E 3NAYA 4PPCA 4IADA 4EOKA 4F6UA 1PXJA 3A7GA 2WMSA 5HORA 1U5RA 4ANNA 3QQUA 3PG1A 3N4VA 2C68A 2J9MA 3EKNA 4M15A 4BDHA 3BQCA 2C0IA 2XK6A 3FXWA 1XKKA 2QLQA 2YIXA 4IVCA 4FZ7A 4P7EA 4LL0A 1OGUA 2PE2A 1Q8YA 4CD0A 4PMPA 5M56A 1PMVA 3MH1A 4G5JA 3QD3A 3I4BA 4YJQA 4OAUC 2YACA 1IAJA 2XNBA 5L8JA 4OR5A 2B1PA 2XA4A 3C4WA 4XG8A 3EWHA 3K2LA 2P4IA 3V8TA 2R2PA 4RIYA 4G31A 4E5AX 4E4MA 3VS1A 5L2WA 5F1ZA 1Q8ZA 2FGIA 2OJGA 4JDIA 3AXWA 3EYGA 4XNEA 4I3ZA 4YZBA 4C34A 4OTFA 4J99A 5E91A 4S31A 3LCSA 2QODA 4YSMA 5GJGA 3SRVB 3CSVA 2X6EA 3NW7A 3G90X 4G3CA 3EH9A 5IU2A 1H27A 4IM0A 3VWAA 3FLQA 2OWBA 2YISA 5DEYA 1Y8YA 2W1CA 3VUHA 3AC4A 4TWCA 3EQDA 4F4PA 2JIIA 4O81A 4ZSLA 2RG6A 1YWNA 2W5HA 3KXXA 5AP0A 3RPYA 3ALOA 2VO0A 4GT3A 3CD8A 4OLIA 1SMHA 1WBNA 4GU6A 1YXXA 2ITYA 3QALE 4OTGA 3MI9A 3I6WA 3B8QA 4AZSA 2J5FA 2XK9A 3VUIA 2ONLC 3A7HA 2EU9A 3QUPA 4JR7A 5EOBA 4CFNA 4IZAA 3CIKA 1GY3A 2DUVA 3CTJA 3DK6A 3C13A 3Q6UA 2XNNA 4HZSA 5KMMA 1OL1A 1EH4A 4FKLA 5LCKA 5A46A 5CU0A 4EH9A 5ETFA 5EYDA 4HVSA 4ANQA 2YM6A 5AAEA 1KV1A 3AT4A 4XRJA 4NM5A 4BC6A 1B6CB 4WSYA 4U6RA 4BN1A 1A06A 2PMOX 3Q52A 4ZSAA 3QU0A 4FG7A 3VHEA 3E8NA 2BR1A 4FTLA 3VBQA 4I5MA 2XNGA 3UOHA 3ACJA 2QU6A 4XLVA 4C3PA 5HHWA 4L7SA 5JQ5A 2JEDA 4NT4A 5FM3A 4ZLOA 4KABA 3KN6A 3NX8A 2YWPA 3NYOA 5CU3A 5I9VA 4DCAA 5AUXA 3QTXA 4G5PA 4CFVA 5M44A 4QMQA 3ODZX 3R8PA 2CCIA 4DEHA 5H2UA 2VTSA 4O2ZA 4DFLA 5AMNA 1KE9A 4L6QA 4FKQA 5FWKK 3OTVA 3UOKA 3W33A 5K9IA 4R3CA 3G6HA 3SRVA 3RI1A 4O7SA 4RWJA 3FLYA 4BIBA 3QHRA 3I0QA 5A4QA 1H25A 1J1BA 2VZ6A 4V04A 2XM9A 3S95A 4FSZA 1E9HA 4S32A 3LJ2A 4W9XA 4MQ1A 4EK6A 2PVLA 3NLBA 2UVYA 5HG5A 2Z7RA 3GEQA 4RJ4A 4ID7A 4DGLC 2WXVA 4XV1A 3LLTA 4IX6A 4BY9E 4QMZA 4MXZA 1PXIA 2OIDA 2ZVAA 4OBOA 3RAIA 3H9OA 5E4HA 3DOGA 4AZFA 3HMNA 3R7OA 4N57A 4TXCA 4L45A 2BAKA 3KXGA 1XHAA 2YIRA 3VQUA 4LOOA 3RWQA 4EK8A 2Y7JA 5HO6A 3QQJA 1UNGA 2OSCA 4FIHA 3FKLA 3R02A 2VGPA 4CLIA 4EJ7A 5C26A 4AOIA 3BPRA 2VUWA 2QURA 1G8SA 1U46A 4FSMA 3TTJA 2XKFA 2CSNA 4R77A 4ALWA 3O50A 4NJDA 4ZTQA 4FEWA 3DBFA 4ACGA 3VF8A 5IQDA 4B6LA 4GJ2A 3U87A 1MQBA 2PL0A 5DR9A 3PVGA 2ZM3A 3PPKA 4E5BA 3TUBA 5CSWA 2YM4A 4IXPA 3PRIA 4DLJA 3LZBA 4ZMEA 4FSTA 1OZ1A 3UZRA 1PF8A 2XBAA 4L67A 2VTOA 4M69B 4QMWA 3TDVA 2WQNA 3O7LB 3WIGA 5IZFA 2JFMA 2OI4X 3QQGA 4JDJA 4PMMA 2CDZA 1NY3A 2HZ4A 3NAXA 3KA0A 3QRUA 4FV6A 4YNOA 4EJNA 4LGGA 5DRDA 5KHXA 4O7RA 2A0CX 2PZYA 4FV8A 1BI7A 2C5NA 2VV9A 4KBKA 4BYIA 4QTEA 3DV3A 2XNMA 2DS1A 3P1AA 2B7AA 4FTJA 3RZBA 3L9PA 3DJ7A 3GU6A 3ATSA 3LM5A 4WT6A 3P4KA 5CWZA 4AS0A 4MBLA 3VRYA 1OB3A 3BHHA 3FSFA 5JH6A 4FZ6A 3R01A 2X0GA 3GNIB 5DPVA 1TQPA 1OL6A 2PMLX 4YJPA 3PXYA 1CMKE 2V62A 4IC7A 4YLJA 3D7ZA 5IDPA 3UZPA 4DH8A 4WRSA 4RJ8A 3W18A 3UQFA 3K5VA 3BYSA 3GC8A 2R3JA 5CX9A 4RGJA 4C4JA 4EONA 3PDTA 4E26A 4AQCA 4OTWA 4B9DA 2V22A 2PMIA 2W5AA 3DTWA 3KU2A 3QQHA 1YHSA 4XG3A 4IMYA 4LG4A 1Q61A 5F20A 4ACCA 2YM7A 1OVEA 5FEEA 3O51A 3W2PA 3JR1A 4XG4A 2ZM4A 5HE1A 2W1DA 3PJ3A 3RINA 4A9YA 1JAMA 2WTIA 3V5JA 4BCOA 3S1HA 1MRYA 4RIOA 3Q5ZA 4IIRA 4M69A 5BYZA 5EM6A 3EQFA 1WBVA 3RMFA 5DT0A 2QCSA 3AC2A 4UMQA 3RPOA 1ZY4A 3OXIA 2WMBA 5J5SA 4PPBA 5J7BA 4I0SA 2EXEA 1TQIA 2VTIA 2W05A 2XIYA 3DNDA 4U43A 4DYMA 4AA5A 3WZUA 5JEBA 3PP0A 3V01A 3KXNA 4W4WA 5HESA 3DS6A 4HYUA 3R8LA 4RIWB 4AGCA 2QOKA 1Z9XA 2FA2A 5IQCA 4UXLA 3IW6A 3CPBA 2AC5A 3E88A 2R9SA 4C0TA 1PMNA 2HW7A 4YGAA 5TE0A 1RDQE 1OKZA 1R78A 4I6FA 4ZTMA 5HO7A 1BI8A 4L8MA 1PXNA 4BFMA 4AA4A 3V6SA 4X3FB 4IZ7A 4YHJA 4O0RA 2DWBA 4EHEA 3BIZA 4R78A 4ALVA 4EQUA 2I7QA 4MHAA 1M2QA 2XIKA 3DK7A 3Q9XA 5B7VA 4PP9A 4ZZOA 4J52A 3HV6A 4I0TA 3TNHA 3P23A 4NFMA 5E8SA 5EHOA 1OIYA 3WZEA 5CEPA 4C57A 3S0OA 4G9CA 3GU8A 3V04A 2YCSA 4IJPA 4UWBA 4JAJA 1T46A 1KWPA 3QRJA 4MAOA 2HY0A 2VD5A 2AUHA 4C4FA 2DYLA 3ZLWA 4A07A 3EFWA 5GIPE 3NCGA 4EH4A 4JT3A 5D1JA 3VHKA 3CY3A 2RKUA 4BCQA 2F7ZE 5BQ0A 3MTLA 3R28A 2GS6A 4XUFA 3MFUA 1KSWA 4JL9A 4QMTA 2KTYA 2Z60A 5KE0A 3JXWA 2V7AA 2A27A 1PJKA 4MD7E 3QC4A 4MH7A 2FH9A 3LJ1A 4LI5A 2PUUA 2V7OA 3ANRA 4X2KA 2V55A 5H3QA 2CNUA 1M7NA 4KINA 4RFYA 5EM7A 4BI0A 3QRKA 4YJTA 3WF9A 2O63A 2VTAA 2W5BA 4GJ3A 5C8MA 2OO8X 4RMZA 4KSQA 5TKDA 2FYSA 4U3YA 4UBAA 3TG1A 4MX9A 4UB7A 3ZMMA 2HENA 3ET7A 3WF7A 3ZUVA 3FQSA 4FZAB 4Z55A 3IGGA 1ZXEA 3UTOA 4AGWA 3C7QA 4JRVA 5F95A 2QO9A 4DEEA 2YLFA 5KMNA 4R6VA 3F3VA 4P5QA 4U80A 2LAVA 3ZRLA 4GEOA 4ASZA 4JBVA 4XV2A 3F2RA 1Y57A 2UZLA 2IW8A 4DFYA 4RVMA 4PMTA 3FE3A 3PY1A 3D83A 2IO6A 3OWLA 4IW0A 2BKKA 3NZ0A 1UNHA 3PRFA 2XIRA 5AA9A 2OJIA 2O64A 2PVHA 4E73A 4BHZA 5IMEA 2R64A 3D15A 3F5XA 4V0GB 3DK3A 2W1FA 4YPSA 2X2KA 3DBDA 3N9XA 5IUIA 4Z3VA 3PZHA 5GIOE 3ZBXA 2XUUA 4GSBA 4BICA 3G6GA 4FV7A 4OTPA 1LEZA 2ZOQA 2GFSA 2IVUA 3NW5A 4I5CA 4MBJA 4FEQA 1JBPE 4DT8A 5HTBA 2OLCA 1YOMA 4EHZA 2HWOA 5GNKA 4WUNA 5JGBA 4YURA 5C8KA 4IAFA 4FSNA 4QMLA 4YBJA 3PSCA 3S3IA 3TWJA 1FQ1B 3ZUTA 1SZMA 4D9UA 2UW0A 2I0HA 3FMHA 5DH3A 4ZSGA 4FKRA 2BFXA 3SQQA 4L3PA 3VRZA 1JLUE 2HWPA 3BYMA 3WILA 3PA3A 2VU3A 4AN9A 4KIKA 4FKIA 4TYHB 1Y91A 3MY0A 3G15A 4FK6A 5CEKA 1HOWA 4FV0A 3FZPA 5ITAA 3C0GA 4X3FC 3TTIA 3MGYA 3OW3A 4KS8A 3SV0A 4FZDB 3AMBA 4LRMA 4YPDA 2I0VA 4HVGA 2F49A 1GZOA 2BHEA 2V5QA 1XH4A 2PZRA 2C4GA 3EMGA 4IB0A 4YO6A 4CRLA 3OS3A 4O83A 2Q0NA 2W4KA 3OT3A 4EHGA 3LJ0A 3CKWA 3PSBA 4J8MA 3PY0A 4YLLA 2VWIA 4RC2A 3I7CA 4BDFA 4EL9A 2WMAA 4YJSA 4EEVA 3HAMA 3NPCA 5L2SA 4O38A 4PF4A 1H28A 4AT4A 3ANQA 4O1PA 4RVTA 4RFZA 3NUXA 1WAKA 2HELA 4WG5A 2QVSE 2WQBA 4IWOA 3ZM4A 2P33A 2CNQA 4EOQA 4QYYA 4GG7A 2JITA 3LMGA 4IACA 3RKBA 3DJ5A 5J9YA 2JD5A 2BDJA 3QZIA 2Q0BA 4QOXA 5CNNA 3R8UA 5AP4A 2UZEA 3JPVA 5HU9A 3PWDA 2W4OA 4LOPA 1J91A 2YDKA 5CZHA 5L2IA 3ROCA 2O5KA 1JQHA 3HYHA 2BRBA 4R1YA 4WG3A 5EDPA 3VS2A 4BRXA 4E5WA 2F2UA 4X21A 3QWKA 4FV3A 4ANSA 5DRBA 5FD2A 2X8DA 3IO7A 3KKVA 2R0UA 1ZYLA 3NYVA 3QYWA 4QYGA 3H9RA 4Z7HA 4U8ZA 4D5KA 4OTRA 5BPYA 4YJRA 2YIYA 1VJYA 5CSXA 3RP9A 3FMKA 5CF5A 4BHNA 3OWJA 5A9UA 1BYGA 3KVWA 5EDRA 5JSMA 4ZY5A 4BIDA 3PYYA 3GU5A 5DT3A 3Q4ZA 3UP2A 4ZZNA 4FL1A 2P0CA 3FXZA 2ETRA 5E7RA 2WAJA 2XNPA 5E8YA 3A7FA 5CASA 4I94A 3LOKA 1VZOA 3C50A 4G6OA 3PA4A 1IRKA 3AC1A 1CTPE 4CV8A 3TUCA 2QOIA 2G1TA 4FNWA 5I9WA 4YZDA 5KMIA 2PZ5A 4DHFA 4XOYA 5D7AA 3QGWA 1GJOA 2RFEA 1V0BA 2XZSA 4BVUA 1E1VA 3ZYAA 3KK8A 1XR1A 4EH7A 4AP7A 4AACA 3GBZA 5ACBC 3WZKA 3W55A 4RQKA 4BDIA 4D2RA 3ZFXA 5LVLA 5HIDA 2C6MA 4A4OA 1ZZ2A 3BV2A 4G17A 5EYCA 5CANA 2I1MA 5FBOA 2CCHA 2NRUA 4R7IA 4EKKA 4GG5A 3V5LA 2I0EA 1TVOA 3FZTA 2C1AA 1Q3DA 3H0ZA 1OBDA 4JG6A 1J7IA 3F69A 5A14A 3OMVA 3ORNA 1PXLA 4DH7A 3HKOA 1YXVA 2XS0A 4P90A 4UMRA 3RALA 3LW0A 2XEZA 4FR4A 5DWRA 4EYMA 4BCPA 4NL0A 1O9UA 4I22A 3EIDA 3G33A 5E90A 4EWQA 4NCTA 3MVMA 3VO3A 2Y4IB 3W2SA 4F0GA 4G16A 3PJ1A 4O0SA 4D2SA 4KKEA 4L44A 1XBCA 4APPA 2BZIB 4GFGA 5LWMA 5DR6A 2F7XE 3L9NA 4BTMA 5AX3A 4I92A 3KL8A 4QYFA 3WE8A 2HXLA 3SA0A 1W83A 3RGFA 4UYNA 3L9LA 4ANMA 4C37A 4BTKA 2HY81 5T3QA 1L3RE 2OIQA 4Y8DA 5FTQA 2Y8OA 3U54A 4DTAA 1ZY5A 1HCLA 5CI6A 5EW3A 2BZKB 3QTWA 3ORXA 5GJFA 4MEDA 3UPZA 4BKZA 1SYKA 4TKSA 1CKJA 3QGYA 2WZJA 4OBQA 4X7QA 3OCSA 4GS6A 4AN3A 3QQFA 2P2IA 4X3JA 3V51A 3VBYA 4FKSA 3LE6A 4EC9A 3V5TA 4C35A 3W1FA 5HU3A 4L3JA 4H05A 2QOLA 3BBWA 3V6RA 3CCNA 5AR8A 1KE6A 4L7FA 3VUMA 2PZIA 2C5VA 4JLCA 4YZCA 5KBQA 1BUHA 4XMOA 5HQ0A 1P14A 3MJ1A 1OECA 1OIUA 4JQEA 5DGZA 5A4CA 5EQEA 4HPTE 2CJMA 3R7UA 4E6DA 4E7WA 3GCUA 3ORMA 2VX3A 4FX3A 4LOQA 4USEA 2XRWA 3UBDA 3L8PA 2CKQA 3QXPA 3RNIA 1PYXA 3D5VA 4F08A 2ZM1A 3ZONA 1GOLA 5BNJA 3MIAA 5AIRA 4BZNA 3FKOA 2WNTA 5HE2A 4NCTC 4WNMA 2J5EA 3HA6A 4UEUA 5FQDC 4A9SA 4AW1A 4F7JA 4FNXA 4DG3E 3PIYA 4JS8A 4FEXA 4GKIA 3NYNA 2C30A 4I23A 5IF1A 1FGIA 3A62A 3AC5A 2QKRA 3HL7A 4FTIA 5K0KA 2VTHA 5EI2A 4PX6A 5AV1A 1U4DA 2GNLA 4ANBA 2NP8A 2UW5A 4O0VA 2NNWB 2G15A 3EQBA 1JKKA 4RWIA 4NZWB 5LXMA 2RL5A 2OBJA 3OEZA 2C6IA 2BRHA 4NFNA 3HMPA 4X6QC 3ELJA 3OFMA 4DFNA 4IVDA 2FSTX 2YABA 4EKLA 3Q3BA 5FTOA 1JPAA 4AX8A 1H0VA 4QO9A 3H30A 5A3XA 1WBPA 3ZSHA 4C38A 1W84A 5D9HA 3RWPA 3NVMB 3UVPA 5DLSA 3SAYA 4I6BA 4IFCA 3TM0A 4M14A 4D58A 1KE5A 3PY3A 4J95A 5HE3A 4WRGA 3HX4A 3E87A 3VW8A 3PLAE 1TKIA 1VR2A 3OWKA 3CQUA 1MRVA 2ESMA 4GYGA 4USDA 2GQSA 2ITXA 1Q24A 3BYVA 4C59A 4DN5A 2XIXA 3R1YA 3LFQA 3HGKA 4FMQA 4GMYA 4S30A 2EUFB 5FDXA 3PIXA 4ZSEA 1YRPA 2GTNA 2OIBA 2XRUA 3LIJA 3DJ6A 1OL2A 4J71A 3W2OA 1M52A 5AJQA 4USFA 4XG9A 3ZFMA 2UZBA 4D2TA 5J5TA 5M53A 3R73A 2Y4IC 4KIOA 3LQ5A 3MA3A 1P2AA 5CEIA 3Q4TA 3MVLA 3DNEA 5BUJA 1NVSA 2JKOA 3E8CA 2X8IA 3PXZA 3EN4A 4OTQA 5CT0A 3BI6A 4OT6A 3UYTA 4DGMA 2PYWA 5JGAA 1PKDA 4FBXA 5FTGA 2C3LA 4D28A 5IPJA 3QF9A 3HLLA 1H08A 1H1WA 3VS4A 4JRNA 2OZAB 3BHYA 2ZB0A 3EFLA 4ZOGA 5FRIA 5IA1A 4EORA 3M42A 3MPAA 2NPQA 5T6KA 1YHVA 1CDKA 2BZJA 3VC4A 4A4LA 4XG2A 3QLGA 2BIYA 1ZMWA 5CSHA 3SDJA 5JKGA 3QCXA 4K18A 3QC9A 4GFMA 4GIHA 1FPUA 2IW9A 3I5NA 1ZOHA 2FO0A 3QWJA 3DBCA 4KIPA 3BEAA 3PG3A 4XBUA 4XCUA 2WU6A 4DGOA 5ANIA 3DA6A 4YLKA 5HE0A 3E93A 1H00A 3EFKA 1ZMUA 1BMKA 3T8OA 3DB6A 4QQ5A 3OROA 4KWPA 5HIEA 4GFOA 1W98A 3FYJX 3E7VA 4FYNA 4TT7A 4FUXA 4WBBB 3CD3A 3DAKA 2A4LA 3ROYA 3ZEPA 3S2PA 3V5WA 4RIXB 5CLPA 4HGTA 4FIFA 4D1SA 2QOCA 3GCVA 5CENA 3ZCLA 2G2HA 3Q5IA 3RZFA 2OJFE 3BU6A 5I0BA 3R8ZA 3RM7A 5I5ZA 4MCVA 1P4FA 4DINA 2UW3A 3WZDA 1WBTA 3R2YA 4M0YA 5I9YA 5KX8A 4R5SA 1NT2A 5IUGA 3R0TA 4NYEA 3L8SA 3E8DA 4KKGA 1YXTA 2IVTA 5B2MA 3DAJA 1KOBA 2C5OA 3FL4A 2NO3A 3GFWA 4MYGA 5BMMA 1YQJA 2OZAA 3G2FA 2OFVA 4FV9A 4IVAA 3TV6A 3ZU7A 4BGGA 2FB8A 2QG5A 1BL7A 3ODYX 2WEIA 4HGLA 2ZDTA 5ANOA 2Z7SA 4QP1A 3EQCA 4TNDA 3LPBA 5EI6A 4Y85A 1A9UA 3COKA 4TL0A 5LVPA 4Y73A 4HYHA 3DLSA 4QPSA 4XH6A 4O7NA 3V3VA 3FMMA 5M57A 5K5NA 2YFXA 2ZMDA 3FZOA 3PUPA 4ZTSA 4PDYA 2XJ2A 5HX8A 4BCNA 3KK9A 1YOJA 3F3TA 3CBLA 5BVDA 4XJ0A 4XX9A 3BEGA 4WBOA 3P79A 4FG9A 3FMJA 3P78A 4EZ7A 3QZFA 3FHIA 3ZO1A 2BDFA 3MN3A 4RIXA 4EZ5A 4ZY6A 1I09A 1Y6AA 3C4CA 3GXLA 1J3HA 4O7LA 3F3UA 3COIA 4E20A 3ATTA 1R3CA 1ZYCA 2IVVA 1ND4A 5C4LA 5HTCA 1XH7A 2E9UA 3MPMA 3UE4A 1XJDA 2C0OA 2WU7A 4DG2E 1V0PA 3R8MA 2YCQA 4FT5A 3DXQA 4QMNA 3LQ8A 3R30A 4B8MA 4O96A 1W8CA 3F7ZA 2JDOA 4CZUA 4JXFA 3QA8A 4JDHA 3S4QA 3W2RA 2IG7A 4J97A 4EH3A 3TKIA 4RC4A 3R1NA 2HCKA 4HVIA 2HZ0A 2VRXA 5CYIA 3B2TA 3PJCA 4CCBA 4G9RA 4QP2A 5FXQA 2ZAZA 2ERZE 2R3NA 4J53A 3LFEA 4DH3A 3UZTA 5H9BA 2BUJA 3EQGA 4ZTLA 4BDJA 5L3AA 4CMTA 4F6WA 3BGPA 4YTCA 4W8EA 2H6DA 3D5XA 4EQMA 1YWVA 4S33A 4F99A 1Q41A 3UVRA 2YIWA 3OW4A 4PUZA 2PULA 3IS5A 4FEUA 4EOLA 2E9OA 2B4SB 4C58A 2XH5A 2UZOA 5KMLA 4FT7A 3QBNA 1VEBA 3UPXA 2QQ7A 4X2NA 5H8BA 3OXZA 5HI2A 4CNHA 3ZH8A 4UWYA 3BHTA 2VTTA 3FZRA 1PY5A 4N6ZA 5HTIA 2ITTA 1ZRZA 2GNHA 3QTIA 3FPMA 3I79A 3OBGA 4P2KA 4WOVA 4C61A 1Z57A 4PQNA 1YOLA 4ZMFA 1H1RA 4QTBA 2BROA 3T3VA 4QMUA 5CS6A 4UZDA 3N51A 1B39A 3HV4A 4YUQA 4HVDA 4AOJA 2X7FA 3FY2A 4AFEA 1MRUA 5HG8A 4Y72A 1H1QA 1UV5A 5JGDA 4ZP5A 4BTJA 3RCDA 4RG0A 1H26A 2VAGA 3FJQE 4PDOA 5E8TA 2HIWA 3VNTA 4RJ5A 5L6WL 3KF4A 4BI2A 4CT2A 2OU7A 5K4IA 3Q04A 4N70A 3GCPA 4RJ6A 3ORZA 4M68A 4CTCA 2JBPA 3FBVA 5JRSA 4C4EA 2ITZA 2E9PA 1KUTA 5GINE 3BRBA 2C3JA 5BUIA 2YZLA 2JBOA 3POZA 1XWSA 3C1XA 3W2CA 5AEPA 5IA2A 3LXLA 5GHVA 4YZNA 5DVRA 3CE3A 3UMWA 2YJRA 2OJ9A 5FGKA 3NIZA 1KOAA 3U9CA 2J7TA 2W1EA 3D2KA 3KN5A 2WMXA 3EZRA 1QPEA 4JOAA 3HUCA 5HICA 4QP7A 5G1XA 2YEXA 4C4IA 4LUDA 1Q4LA 5DBXA 3DAEA 5J1WA 5AUWA 4QP8A 3PE2A 3S00A 5DG5A 3FPQA 3LQ3A 1E1XA 4IQ6A 3CC6A 4RQVA 5HG9A 4DFBA 1AGWA 1K9AA 4XG7A 2FVDA 4FK3A 4P4CA 3U8WA 3MB6A 3O0GA 4TY1A 2BMCA 3KQ7A 4WSQA 5BVEA 4ACMA 4ITHA 3N4TA 3BZ3A 4YC3A 2OGVA 1YI6A 5HLWA 5DEWA 4IH8A 3RAHA 3EOCA 3TI1A 3Q4UA 3GVUA 2J0MB 1JKSA 2GPHA 4W8DA 3D7TB 4FIJA 4F7NA 4CKRA 2VO3A 1W0XC 2VWBA 2VX0A 3NNUA 4PL4A 4FL3A 5EYMA 4M12A 2P3GX 1YDSE 3DCVA 5AP1A 5HVJA 5L2QA 3TACA 4B0GA 2XP2A 2HW6A 2X1NA 4IWPA 3QD2B 4I5HA 4L9IA 5AP2A 4KKHA 4ARKA 3W2QA 2W9FB 2QOFA 2OJJA 1XH8A 3UGCA 4FV4A 3SX9A 3BU3A 1ZARA 3QXOA 4W4YA 3E3PA 3F9NA 4ITIA 3RPSA 3UP7A 4HW7A 4FV2A 3I60A 1P4OA 2OH0E 4QQCA 2UW8A 4EOJA 1Y8GA 3NS9A 4RX5A 3KY2A 2WTDA 5E1EA 3SG8A 1JVPP 4G3DA 3DQWA 5AUUA 2ITOA 3RCJA 2UZNA 2X4ZA 4MVFA 5GZ8A 3B2WA 2ETMA 4FICA 4KIQA 2CN8A 3CY2A 2RSVA 4PWNA 3LKMA 5JFWA 4E6CA 5IMXA 3Q53A 1AQ1A 3TUDA 3COHA 3DZOA 2R3IA 2VWVA 3QKLA 4LMNA 4XP0A 3TV4A 4ZLZA 3F2NA 3FZ1A 1UU8A 1PXPA 3PXKA 1PYEA 2OICA 5J1VA 2JDRA 1TQMA 3QKMA 3FQHA 4DH1A 4CMUA 4F70A 4CZTA 2WQOA 3LLAA 4BWXA 3Q9WA 5AA8A 2B55A 4WNPA 3TDWA 3D7TA 5JZNA 4RX8A 2CKEA 5M08A 4GK2A 4TZRA 3R22A 3E92A 1UU3A 3GU4A 3R21A 2QO2A 3UNZA 4PTGA 4FT9A 4ACDA 1GZKA 2GU8A 4MXAA 3W8LA 3G0FA 3ORLA 3Q6WA 2X7OA 3TZMA 2WMVA 3C51A 4FTNA 5GZ9A 1YI4A 3QYZA 1O6YA 3O2MA 4LV8A 3TXOA 3PFQA 2WMQA 1QPCA 5LMAA 3CLYA 3WYXA 4F65A 4M0ZA 2YERA 4O7ZA 4RSSA 4YJVA 4F9AA 4FTCA 1PMUA 4HVHA 4PV0A 3GOPA 3SG9A 3TNIA 4NM0A 3CJGA 1U5QA 4U45A 4WUAA 3EYHA 3NYXA 3C0IA 2PU8A 4L3LA 4XEYA 4F1TA 3EL7A 4KIKB 2R3RA 3RHXA 5EKOA 1OL5A 2YM3A 2QOBA 5A4LA 3TZ7A 1SM2A 1YXSA 4LMUA 4D4VA 4FSRA 4ALUA 1OPJA 2VTMA 2YN8A 5I9XA 3ZO3A 3AC8A 5D7VA 4FKOA 5HZNA 5L8KA 2GSFA 3DPKA 4LUEA 5IA5A 5L4QA 3RK9A 4KAOA 3PP1A 5GJDA 2RFDA 3D94A 5ANJA 3CQWA 3UO4A 2A1AB 5AR4A 3HA8A 4RZVA 3ZOSA 4QNYA 2BTSA 2J90A 3I1AA 1UU9A 4NSTA 3ZTXA 4FVPA 3R2BA 5AM6A 4FL2A 1XBAA 4IWDA 4YR8A 2HZIA 4XOZA 1UVRA 5TR6A 3FXXA 2IVSA 4MXYA 4TW9A 4ZS4A 2F2CB 3CQEA 4G34A 4FKPA 1M2RA 2PWLA 3VAPA 2C3IB 4EZ3A 4D9TA 2VNWA 4F1MA 2JLDA 1STCE 2H34A 3MH3A 3C4ZA 2H9VA 4JR3A 2I40A 4GV1A 5HEZA 5M55A 4A7CA 2ZV9A 3ZRMA 4DITA 2C6KA 3PPZA 5LCJA 3FQEA 4HPUE 2QU5A 3QA0A 4WKQA 5IQFA 1NVRA 2IZRA 2P55A 3HRCA 4IBMA 4DEIA 5ANEA 4CTBA 4H3BA 4AE6A 4ENYA 2JIVA 4MQ2A 5LARA 3F88A 3WOWA 4BGQA 5FDPA 4XRLA 4DEAA 1OMWA 4HYIA 3R7YA 2QOQA 1H4LA 3KREA 3PZEA 4LM5A
chains in the Genus database with same CATH superfamily
5HIBA 4C36A 1YI3A 2J0IA 3NNVA 4FVQA 4K9YA 5IH4A 4TRLA 4ZJJA 1NVQA 5JN2A 1Q99A 3SKCA 2VTRA 4JBQA 5FEQA 3MESA 5HLPA 4C62A 2IEWA 4QYEA 2WELA 3U4WA 4AW0A 5IQAA 3W32A 3IOPA 2E2BA 2W1GA 2ZJWA 3TIZA 3F6XA 4MXCA 3KF7A 3IPHA 3R00A 2VTJA 5FP6A 5A6NA 1NXKA 3P5KA 1FMOE 3FKNA 2SRCA 3OCTA 4Z9LA 3HV5A 3D2IA 1QPJA 4QP4A 4E4XA 5KKRB 4ZIMA 4ACHA 3R1SA 4ZK5A 2VTPA 1M14A 2R3FA 2JIUA 5HNIX 5CAPA 4FKVA 1ZOEA 3QHWA 2GCDA 2X8EA 4NM7A 4OTHA 3FMEA 4QRCA 4UWCA 4CCUA 4PMSA 2J6MA 5FP5A 5JK3A 3CTQA 1FGKA 3DDQA 3II5A 3T9IA 3OF0A 4D2VA 1UWHA 3O17A 1BX6A 1RJBA 3QAME 3FMLA 4I6HA 4I20A 3BYUA 5KCVA 1H1PA 1PXOA 1WBOA 3OBJA 3QQLA 3K3IA 4IZYA 3COMA 4LV5A 5ANDA 4BDGA 1BKXA 5CVGA 5IQGA 1SVEA 3O8TA 2CLXA 3W8QA 2F7EE 4BI1A 3BKBA 4RX7A 4FYOA 3CP9A 2ITWA 4O21A 2J2IB 4TYIA 1OM1A 2R7IA 3TEIA 3WF5A 1DI9A 3ENMA 4O6LA 4YZ9A 3R83A 2Z02A 5IQIA 3FWQA 4DCEA 4DFXE 3UQCA 4D4SA 1OIQA 4KS7A 5DE2A 5KUPA 3CGFA 4H36A 1FVRA 5C8NA 4CLJA 3FUPA 2RGPA 4CGAA 2UVZA 3Q60A 2C5YA 4H39A 5EHLA 2XCKA 5A4EA 4L00A 4QTAA 2YA9A 3UDSA 3M2WA 2CKOA 3FI8A 3MFRA 3C5UA 4IWQA 4DTBA 4CSVA 3TCPA 4DHIB 2OZOA 2F4JA 3GQIA 4JG7A 2W4JA 3M11A 4LL5A 5DHJA 4J1RA 2UZWE 4ITJA 4O0TA 1RW8A 2EWAA 4V05A 3TJDA 5EQPA 5CT7A 4EK3A 3UIUA 3SXSA 3UIMA 2C47A 3QTUA 4AGDA 3A4OX 3KGAA 4EH2A 4AZTA 5M51A 5M4CA 3FLWA 3MA6A 3UOLA 4IDVA 4YJNA 2LGCA 5HGIA 2QI8A 1S9IA 2PUNA 3NUAA 3ENHA 4FTKA 5CU6A 4ZXTA 5C4KA 3LXPA 4U97A 4W4VA 4D5HA 5EM5A 1Z5MA 2X2MA 3DLZA 2X4FA 4L43A 3VBXA 2OXDA 4L52A 4O6EA 3U55A 4TWOA 2PSQA 4FOCA 2CHLA 4H3QA 5ANKA 2GHLA 4K33A 2R3LA 1ZYSA 4AZWA 3HRBA 4MTAA 1OPLA 4OGRA 1UA2A 3ZHPC 5LMKA 3KRRA 4HZRA 3V8WA 3A2CA 2VGOA 3HEGA 4U5JA 4TWNA 3GT8A 1O6KA 3DBQA 3MIYA 3MPTA 2BALA 4PP7A 4O1OA 4NKAA 4DEBA 4U79A 4LDTA 2O65A 4E3CA 1G8AA 3VQHA 2O3PA 3OY1A 3R63A 4I1ZA 4OTDA 5I9UA 4EOSA 3QCQA 3PFYA 2UV2A 1OUKA 2ZV8A 4X2GA 4CFXA 4LGHA 2XB7A 4A9RA 4GIIA 4YU2A 4HGEA 5K0XA 3EQRA 1KE7A 3KFAA 2EB2A 4BR3A 4WNOA 3NUNA 3MBLA 3EB0A 4CG8A 4ENXA 2WTJA 4FZFB 4IEBA 3NW6A 4TYJA 3BBTB 3BHVA 3FYKX 3MJ2A 4D4RA 4HCTA 4RBLA 2A2AA 2Y6OA 3D5WA 3LFNA 3POOA 3G51A 4KUJA 4FOBA 3IDPA 5TO8A 3U51A 4TN6A 4R3PA 5KKRC 3NMUF 3NUUA 5AX9A 2CNVA 3GQLA 3SC1A 3OZ6A 2B9HA 5IQHA 4D0XA 3D4QA 4MWIA 1CKIA 2JAMA 2X0PA 2GNFA 3LCOA 5KZIA 3TT0A 2BFYA 3VUTA 4GKHA 4KNBA 3R8VA 3H9FA 3QFVA 3FLNC 3IOKA 4IB5A 3OHTA 3ZXZA 5M4UA 3U6IA 1H24A 3A7IA 4TYGA 3ZEWA 3NNWA 5IQEA 4UV0A 4YHTA 4FVRA 3MFTA 3OY3A 4JVGA 4M67A 3MVHA 3GFEA 4JX3A 5BVWA 5A54A 3PVBA 1GIHA 4RJ7A 3LVPA 3ZLYA 3OXTA 4AAAA 4YSJA 3F61A 4J96A 2C5XA 2F57A 4FTUA 5DT4A 5E8VA 4F09A 5JMSA 2B52A 5FUTA 3P9JA 4ERKA 3HP5A 3P0MA 3UG2A 4HGSA 5J7HA 4AXCA 1VYWA 3GC7A 3MS9A 4NIFA 2OW3A 2X9FA 5HBJA 3WZJA 4OBPA 2G2FA 3RPVA 5IISA 3QQKA 1GZNA 1TZDA 5JQ8A 3NRMA 4AUAA 2FSLX 4CFWA 3UVQA 1XH9A 2OK1A 3NWWA 5HKMA 5DI1A 2B9FA 4D1XA 4RA5A 4YJOA 4XP2A 3O71A 3OUNB 4MNEB 5EI8A 4QYHA 4EQCA 3VS0A 5ANGA 3VS7A 3RHKA 3LMHA 2IF8A 4DBNA 3IDCA 4RT7A 2XARA 5EH0A 2Y4PA 3I81A 3GC9A 4M97A 1REKA 5AV3A 3GOKA 3CGOA 1ZOGA 3PLSA 3U9NA 4BCGA 5H8EA 3KRLA 3MV5A 4FNYA 2WB8A 2JDTA 1YVJA 2IPXA 4IVBA 3UO5A 2W17A 4XP3A 3LMIA 3AMYA 3BV3A 3UIBA 4RFMA 3TN8A 2X6DA 4FNZA 4B99A 4NK9A 5H8GA 2CLQA 2YHVA 3EFJA 4BCIA 1T45A 4O86A 3QCYA 1YHWA 2BIKB 4L46A 4YBKA 1ATPE 3PWYA 3TKUA 3UQGA 2IZUA 4DT9A 4RRVA 3JY0A 4AAYA 4X6RA 5EW8A 1OI9A 2QKWB 3UJGA 4QT1A 4AG8A 5C9CA 4DGNA 3A7JA 5HCXA 2CPKE 5EFQA 2BRNA 2PVNA 5BMSA 2R3HA 4PPAA 4GUEA 2VWXA 2PUPA 3PE1A 1U54B 1URWA 4FIIA 5BVNA 3BGZA 2PVKA 3RJCA 2NRYA 3FY0A 2R5TA 3LM0A 2JKQA 2W1IA 3LFBA 2JDVA 3UDZA 5D11A 5HNBA 2OXYA 4FF8A 3VS5A 5BVKA 4MNEA 3CPCA 4XV3A 4FKUA 3G0EA 1W82A 3GGFA 4RLLA 4AZVA 2REIA 4KRDA 4ASEA 4PDPA 3DKFA 5AR5A 2YCRA 3HZTA 2WOTA 3NSZA 1OPKA 4RVKA 4C4GA 1WFCA 2VTNA 5HNGA 4UMTA 3PJ8A 1LP4A 4C3RA 1CSNA 3R7GA 4XS2A 1LEWA 4YTFA 1M2PA 4BZDA 2JKKA 1TFFA 3ULZA 3SXFA 3DFCB 1NW1A 2CKPA 1GAGA 5L8LA 3H10A 4QQTA 4EUTA 4BB4A 3LXNA 2OF4A 3IW4A 3OVVA 3MFSA 1PW2A 4FTRA 2JC6A 5CI7A 5M07A 4QD6A 3ZO2A 2WHBA 3ZM9A 2ITNA 4OTIA 1RQQA 5FM2A 3R7IA 3VUKA 1OKYA 4S34A 5L6PA 1F5QA 4MK0A 3FV8A 4W4XA 4DFZE 4HNIA 3NIEA 1JKTA 4O7WA 3SW4A 3ZO4A 1ZZLA 4FG8A 4NKSA 4E6AA 5D10A 5ICPA 3DKCA 3G9LX 3QRIA 5I4NA 2CMWA 4I0RA 4O27B 5AV4A 3OC1A 2XCHA 4KA3A 4RLKA 5EYKA 3KCFA 2F9GA 1K3AA 1U54A 4GCJA 2XYUA 4L68A 4KBCA 5DIAA 4O0UA 4GU9A 1AD5A 2CGWA 4BBEA 1SVGA 4ZY4A 4CT1A 4DLIA 3UNKA 2R3QA 1G5SA 4E93A 1YWRA 4RVLA 4KRCA 3C0HA 5EKNA 1DS5A 5TF9A 2ONLA 2QOOA 1JKLA 1MP8A 4N6YA 3EQIA 4FT0A 4IAKA 5LVOA 2WQEA 5C03A 3MSSA 4N0SA 5CY3A 2C69A 1LPUA 2QNJA 3E62A 4K8AA 5E1SA 1PXMA 5CEMA 3AKKA 5FBNC 2VWYA 3NUSA 4FA2A 4FEVA 3A60A 4R8QA 5CALA 3AT2A 5DN3A 4I6QA 2J50A 2XNEA 4O0XA 2Z7LA 5CAOA 3TJCA 4Y5HA 4F63A 3RAKA 1IA9A 4FC0A 3DB8A 5LWNA 4OAVB 3RM6A 5CF4A 5KNJA 2PZPA 3HP2A 4D1ZA 5BVFA 4O7VA 5KMJA 4QMOA 5LVNA 2YDIA 4X2FA 2GDOA 2IW6A 1Q8UA 1KV2A 2KULA 2VNYA 3DQXA 3DT1A 3CR0A 4F1OA 4F0FA 3LCKA 4YHFA 4C02A 3JYAA 4Q2AA 3TIYA 2R3MA 3K5UA 2C6OA 4DC2A 4X0MA 1APME 4TNBA 5E8XA 3NFFB 4FSUA 2GQGA 1LR4A 4FUYA 4U7ZA 4UALA 2JFLA 3GUBA 2O0UA 2RG5A 1FINA 4J98A 3TV7A 2PE0A 1Q8WA 1QCFA 3IQ7A 2XBJA 2BAQA 1M7QA 4J8NA 4JIAA 1BLXA 3OEFX 3ORPA 2R3PA 4CRSA 4FE2A 2WFYA 2R3OA 2YZAA 4H58A 4EOIA 5CZIA 1X8BA 4ZJVA 3WARA 3ZRKA 4WO5A 4GK3A 1MUOA 4BDKA 4P5ZA 2XNOA 4QQJA 1G8KA 4BCMA 2PVRA 4BCFA 4NU1A 3BGQA 4F6SA 2BCJA 2JDSA 1FVTA 5FXRA 1SNXA 2WOUA 4MD8E 4L53A 4EK5A 4DAWA 4U41A 4CKJA 2HK5A 4F9YA 4O84A 1F3MC 4ZAUA 2C6EA 3JVRA 5CF8A 3P7AA 5LJJA 1LUFA 5HBHA 1H1SA 3A99A 2R0IA 2BTRA 4TYEA 2BKZA 5FG8A 3KRXA 5BX0A 1Q97A 4K2RA 3AD5A 3GC0A 1XBBA 2QR7A 4Q9ZA 5AAGA 4ZTNA 5FEDA 1IASA 3F82A 3HECA 3K54A 1YDRE 4TTHB 4WA9A 3OCBA 5J8IA 1YKRA 4CV9A 3U6HA 2IJMA 4DA5A 3HUBA 2PUIA 4FGRA 5HBEA 3ZDUA 3ZLXA 2XIZA 3QLFA 4B7TA 3GCQA 4IHPA 4WHZA 4BDEA 4DGGA 4R1VA 4CVAA 5I3RA 1Q5KA 5BVOA 3AC3A 3FSKA 1SNUA 4I93A 2EVAA 4E4NA 5HG7A 1UNLA 3IW7A 1FVVA 3HMOA 3VUGA 1FMKA 3A4PA 1WBWA 3THBA 5I9ZA 3EN9A 2FUMA 1ZYDA 3KULB 4Y95A 2CGVA 4D0WA 5IA4A 1M17A 4O2PA 2PPQA 5C01A 3ML1A 2QOHA 3HDNA 1GNGA 3JUHA 5M4IA 1PKGA 2B9JA 3JVSA 3QD4A 5HCZA 3UYSA 2X81A 2GTMA 2VO6A 3PXQA 2VN9A 3BLAA 4DFUA 3L1SA 3L8VA 4XBRA 4MD9E 3ULIA 3H0YA 3C4XA 1UU7A 5IDNA 5IG1A 2QD9A 1H01A 4BYJA 5HO8A 4O22A 4CQEA 4YZMA 4D4YA 5M06A 5AUYA 3TZ9A 4C3FA 3BLQA 5DR2A 3MY5A 4QPMA 2QR8A 3C4EA 4M13A 3BLRA 4MBIA 4PL3A 4U0IA 4WNKA 4IAYA 2GQRA 3MY1A 1BL6A 4Y83A 2ETKA 1WZYA 3ZUUA 4F0IA 2B53A 2UW4A 2X39A 1OKWA 3KCKA 3LXKA 4A4XA 3FMNA 3PPJA 5KHWA 2QLUA 4JMQA 4HJOA 2WMUA 4M7IA 4ONAA 2PE1A 4FSWA 3VBTA 4Q5EA 3ZZWA 1FOTA 5CQUA 2X9EA 5AWMA 4AF3A 3CJFA 3E7OA 3F5UA 2IZSA 2I0YA 3KXMA 2PTKA 2GFCA 2IZTA 4IJ9A 3W0OA 1XQZA 2PHKA 3EN5A 3O8PA 4HNFA 1JWHA 4K6ZA 4EH8A 4ZZMA 4JQ8A 1QPDA 5J9ZA 5EG3A 2EXCX 3I5ZA 4O7YA 4IAZA 3UDBA 5CQWA 1XH6A 2CN5A 3LFDA 5L2TA 2C6LA 2YJSA 4OW8A 4AWIA 5DOSA 4IDTA 4I6LA 3AG9A 3QZHA 4AT5A 3WIKA 2Z8CA 4FTQA 3DXNA 5D12A 3R7VA 5IEYA 3KEXA 2UVXA 3QRTA 4ZTHA 5T68A 3EN7A 4FKTA 2OH4A 3EQHA 4UY9A 3KULA 4OUCA 2WMTA 4R3RA 5JRQA 3DFAA 1J7UA 4DTKA 3KRJA 3BWFA 2GS7A 3E3BX 3P7BA 4O7TA 1DI8A 3TZ8A 4G3GA 3UO6A 2CGXA 3U4UA 2OXXA 1H0WA 4DHZA 4UYAA 4QNAA 1QMZA 2ZV7A 3G5DA 3KVXA 4R7HA 5IEXA 1MQ4A 2H96A 5CNOA 5DA3A 3DKOA 5ACKA 4QMMA 4EWHA 4YTIA 3O7LD 2YCFA 3QTZA 4I4FA 3BHUA 4KB8A 3EKKA 4MXOA 4RPVA 2XEYA 4AE9A 4ZS0A 3Q32A 3PXFA 4RC3A 1JOWB 2R3GA 3P86A 3R71A 4G6LA 4QP6A 2RFSA 4GYIA 5E92A 4ZEGA 4CFMA 4GVAA 5CEOA 3O5AA 2Y9QA 4EBWA 2G9XA 4C8BA 3TNWA 3BQRA 4PTEA 4PDSA 1XMMA 3ZXTA 5GZAA 2XMYA 3EQPA 4Q5HA 2UW7A 4BKYA 4I4EA 4QMYA 5E8ZA 2WIPA 2ZDUA 4LFIA 3GU7A 2OG8A 1OL7A 4AW2A 2J0KA 4UMUA 4FV5A 4U9AA 4AXEA 1YDTE 3WYYA 3FLZA 4I21A 4NEUA 5BYLA 3I0OA 4B4LA 2FSOX 4WG4A 3VN9A 3W0NA 4ANOA 5LVMA 3DXPA 4ASDA 4EK4A 2HZNA 3D9VA 4EOOA 3ETAA 5CU2A 4YP8A 2ZV2A 4G1WA 3KMWA 4F9BA 5AUZA 4AT3A 2WTVA 1URCA 3FEGA 1IAHA 2BILB 2QHNA 3KMUA 3NCZA 4AN2A 4JNWA 3DDPA 3UG1A 2XYNA 4LRKA 3TNPC 1REJA 3SVVA 3QZGA 3NUPA 2XF0A 3ORIA 5AADA 3OWPA 4UN0C 3ZFYA 2HOGA 1YW2A 4IB3A 1WMKA 1YXUA 3ALNA 3FI4A 2UUEA 2YWVA 3A8XA 3UODA 5AIKA 3NGAA 3MWUA 5C27A 3R9RA 4AU8A 1Q62A 2PMNX 5CXHA 2Z7QA 2WGJA 3BLHA 4MWHA 3ZDIA 5JZJA 4BWPA 1L8TA 2WPAA 3D14A 3WI6A 2W06A 5K5XA 2ERKA 2XKDA 4BDCA 1W2FA 5CAUA 5KZ0A 3I6UA 4Z16A 4LV7A 1JSUA 3PVUA 1P5EA 3IGOA 1KE8A 5M4FA 5AR3A 5J95A 5I3OA 4IZ5A 1ZMVA 4QMVA 3BL7A 4RIWA 4ZJIA 4A9TA 3QCSA 4ASXA 3IG7A 5IH5A 4HYSA 4K77A 3ZSGA 1PRYA 4R5YA 2GNGA 3IW5A 4YNEA 4G2FA 1IR3A 4UZHA 4DH5A 1IEPA 5CVHA 4EHVA 3JS2A 1HCKA 4ZSJA 3NUYA 3TYKA 4CG9A 2BRMA 3V5PA 1H8FA 4EI4A 4IM2A 3BE2A 4DE4A 3ZS5A 1WCCA 4FTOA 2FSMX 2WTCA 4FTTA 4FT3A 4GW8A 2J0JA 4M3QA 4QTDA 4PY1A 4X3FA 4H3PA 3R6XA 4JJRA 5AV2A 1F0QA 4JAIA 5CU4A 3RVGA 3ZZEA 1WVWA 2O2UA 4YC8A 1DAWA 3TL8A 5B2LA 2XALA 4WIHA 1ZLTA 3NEWA 5LOHA 3ZC5A 3DKGA 5F4NA 2BVAA 1JSVA 3QTRA 5HD4A 2X2LA 3EJ1A 3E5AA 2P2HA 2J4ZA 3F66A 3OOMA 3KRWA 3QUDA 3PXRA 3MVJA 5AM7A 3NDMA 3LHJA 4K11A 3MH2A 3C4FA 2VX1A 3IKAA 4RWKA 4RX9A 1OIRA 4BZOA 3AD6A 3BYOA 4EH5A 2ITPA 4GVJA 3FZSA 3OP5A 4RJ3A 1V1KA 2ITVA 4U40A 4IB1A 3DY7A 4ANLA 3R9HA 5J87A 1R1WA 2Q83A 2GNIA 4H1MA 5AUTA 4BJJB 3IK3A 2J0LA 4KSPA 2WMRA 3F5PA 3GCSA 3RK7A 3VULA 3NR9A 4GRBA 1ZAOA 3DBEA 5K4JA 3SD0A 5BYYA 2C0TA 3FLSA 4IANA 2Y0AA 4IAIA 4NJ3A 5LQFA 3SLSA 1NA7A 5IA3A 2BHHA 1ZYJA 2YAKA 3T3UA 3O8UA 2QC6A 4F64A 5G6VA 5DYJA 5HX6A 3FI3A 3MB7A 3LFCA 4NTTA 1J1CA 3ZBFA 4C7TA 3FAAA 4E8AA 3VW6A 4D55A 3IECA 3KB7A 3VIDA 5F9EA 3PSDA 3O96A 4U81A 4QP3A 4CXAA 2W1ZA 5EOLA 5EW9A 5J79A 3VJOA 5E8WA 2OFUA 3FDNA 2G2IA 3GP0A 4XV9A 3F3ZA 3Q2MA 3AD4A 4HCVA 3HNGA 3UMXA 4BGHA 5ETIA 2XK7A 3FMDA 4GL9A 1OITA 3WF8A 5D41A 3OG7A 3FHRA 2WKMA 3SHEA 4DEDA 2XJ0A 2XVDA 1WBSA 3UC3A 4EH6A 2EXMA 2R7BA 3QD0A 4GT5A 5HCYA 3R1QA 2B0QA 5KBRA 4PRJA 5EQYA 4V01A 2PK9A 2WO6A 5F94A 3RNYA 3R04A 5BUEA 1OUYA 4IX5A 5A4TA 2HXQA 4MNFA 3NNXA 4FSYA 4V0GA 3OT8A 4O91A 4AZEA 3WBLA 3HV7A 3RTPA 4BJJA 4GK4A 2J51A 2QO7A 4G3FA 4W9WA 2JAVA 1WVYA 4D2WA 3E64A 5TOZA 2YM5A 1FBNA 4FKJA 3N4UA 4IC8A 2O8YA 4PTCA 1DAYA 1B38A 1GZ8A 4II5A 3BX5A 4QMSA 3OD6X 1O6LA 3C9WA 4NW6A 3RBWA 3WF6A 4ERWA 3KC3A 4IX4A 3A8WA 3BU5A 1VYZA 1W2DA 3ITZA 4Y46A 2YLEA 1RE8A 4ZTRA 3F7WA 3SXRA 4QMPA 3ZC6A 2W1HA 3ERKA 3GI3A 5ETCA 3CXWA 4CKIA 2E9NA 3Q4CA 5FLFA 5HOAA 4C2VA 4UMPA 4JX7A 5HVYA 3REPA 4IAAA 4M8TA 3BELA 2ZYBA 4QP9A 5C1QB 4GT4A 1PXKA 2G01A 3EN6A 1CKPA 4B8LA 3F3WA 3RPRA 3T9TA 5J9LA 4TYHA 3CKXA 3GENA 3HV3A 3LAUA 3P5JC 5M09A 4CYJA 2B54A 2DQ7X 2AYPA 3F5GA 4RZWA 3BWJA 3FL5A 5HD7A 2PY3A 3QTSA 2V0DA 1Q8TA 5B2KA 4C4HA 5IH6A 2I6LA 4U42A 4BWKA 3I7BA 5A6OA 4DBXA 4O82A 3SOAA 2RFNA 3ZSIA 2YDJA 4FODA 3HMMA 5IQBA 2XK3A 3PA5A 3PIZA 4J7BA 4BCKA 4EBVA 2VWUA 4MF1A 5L6OA 1W2CA 3OOGA 3IONA 5AP5A 3HAVA 4APCA 4F7LA 2C6DA 4QPAA 2C6TA 4L42A 2YAAA 3UIXA 2Z2WA 3AGLA 3SOCA 2B9IA 3LFSA 4NIFB 4U44A 3VF9A 4UXQA 3D5UA 3LCTA 2OF2A 4E6QA 3L8XA 2YITA 4BIEA 4FSQA 1W7HA 4GUBA 4NH1A 4RA4A 3UNJA 5AFVA 2A19B 2YIQA 3DGKA 1GIIA 2AQXA 2PVJA 4JQ7A 3A61A 5EM8A 2BAJA 5AV0A 1ERKA 2VTLA 1JNKA 1WVXA 4EYJA 4AA0A 4BBMA 4CFUA 1K2PA 2AC3A 3MW1A 3Q9YA 5DMZA 4FV1A 5CSVA 4NM3A 5AP6A 4ORKA 5EDQA 3AMAA 4JDKA 3ORKA 5DNRA 3QX4A 1IA8A 4BKJA 2UZVA 4YMJA 2R3KA 3AT3A 5CAQA 4OT5A 4YTHA 5JFXA 3P7CA 3VS6A 3R9NA 3TKHA 5JFVA 2GNJA 3PJ2A 5CF6A 2XK8A 1PHKA 4JBPA 1GIJA 4PL5A 3VUDA 3E63A 4M66A 5IKWA 1I44A 3TNQB 4AOTA 5AP7A 4PNKA 2H8HA 3AGMA 1UKHA 1H07A 3H3CA 2ACXA 3VBVA 3GB2A 4AXAA 2WEVA 4N4SA 4FJVA 4RWLA 2VTQA 3VS3A 5CSPA 4D2PA 5LMKC 4LRJA 5AR7A 3R9DA 3VBWA 4FI1A 1CM8A 3SW7A 5K3YA 3E8EA 2WQMA 2PVYA 2UW6A 3LCDA 3IDBA 4IM3A 4TPTA 3FC1X 2GHGA 3HRFA 3RK5A 4AGUA 1PMEA 4BF2A 5DFPA 2WTKB 3F2AA 4EUUA 2QG7A 1G3NA 4R7BA 5HLNA 2QONA 4O4EA 3OTUA 1S9JA 3ACKA 4M84A 3M1SA 3HMIA 3OCGA 4MF0A 4AFJA 3MTFA 4Z7GA 4FTMA 4UX9A 4GH2A 2IN6A 3U6JA 4FTAA 3MYGA 4FIGA 3PVWA 4NUSA 2W9ZB 5IEVA 4YC6A 3CTHA 3KMMA 3EL8A 5JT2A 4TWPA 2BRGA 4H1JA 3ZLSA 2UZDA 4BDDA 5CAVA 2JKMA 3O23A 3Q96A 4F9CA 2JGZA 4JI9A 4CZYB 4G3EA 4XHKB 2EB3A 3BCEA 3VVHA 4FKGA 5CEQA 2ZB1A 3IW8A 3Q9ZA 3PTGA 2XKCA 3RAWA 1J7LA 2Y6MA 2HYYA 3QKKA 1A48A 3TMOA 2PVFA 3MDYA 5ETAA 2VO7A 2GS2A 3LFFA 5AAFA 3AQVA 4O0WA 4CYIA 3LFAA 4JBOA 4CMOA 4O0YA 4NTSA 4K1BA 4I5PA 4E1ZA 4IX3A 4A9UA 4C33A 2BPMA 2C1BA 2W99B 4A06A 5HVKA 4KBAA 3W16A 5E8UA 3AOXA 3QUEA 4QEBA 2WMWA 4HCUA 1UWJA 4LYNA 5KO1A 1XO2B 4BCJA 2A98A 3L9MA 2XJ1A 4JIKA 4LGDA 4XG6A 3HDMA 5CVFA 1UKIA 2IWIA 2YM8A 4MXXA 2RF9A 4FIEA 2R4BA 4MKCA 3V5QA 2W7XA 3ID6C 2C3KA 3VJNA 3SGCA 5AP3A 1R39A 1IG1A 2VWZA 3QX2A 2WTWA 1R0EA 4NWMA 4L01A 2XK4A 3NVKI 2VWWA 2UZTA 3K3JA 4IE9A 5B0XA 2WD1A 1JSTA 3H4JA 4Q9SA 3FC2A 4E4LA 3OUKA 4WD5A 4C2WA 4I24A 1XH5A 3EHAA 1QL6A 1SVHA 1V0OA 2RIOA 4BCHA 4F9WA 3DZQA 3UC4A 2WIHA 4EOPA 4CQGA 3R7EA 4LQMA 3C5IA 4U3ZA 2XM8A 5LMBA 4YJUA 4F7SA 1U59A 2QHMA 3B8RA 2E9VA 1DM2A 4X2JA 5CTPA 4AXDA 4FGBA 4YO4A 2PVMA 2W96B 2X7GA 4FKWA 3R9OA 1R0PA 2ITUA 4S2ZA 5JFSA 5IUHA 2ZMCA 3QTQA 3Q2JA 2BDWA 4Y5QA 2W0JA 4RIYB 3UOJA 4NW5A 4BL1A 3JY9A 1OBGA 3ORTA 4JG8A 4G6NA 2HAKA 2UW9A 4I41A 4QMXA 3G9NA 1OKVA 5FXSA 5TT7A 4BDBA 4EC8A 4CEGA 2XKEA 5EHYA 2CGUA 3P08A 4XLIA 4QTCA 1Q3WA 3QL8A 5E9EA 4CFFA 2ITQA 3WE4A 5AUVA 4BTFA 3CS9A 5IA0A 4BBFA 3KXZA 5KMKA 5EK7A 4BDAA 1Y6BA 3D0EA 4XYFA 2OKRA 3KXHA 3BE9A 3CEKA 4HOKA 4IFGA 4KD1A 4DEGA 5CXZA 3DTCA 2WTKC 5AR2A 5KMOA 4DF3A 3EZVA 1ZWSA 3DU8A 3MH0A 4EOMA 4ZLYA 3HVCA 3V8SA 1VLRA 4AW5A 2GMXA 2BZHB 2UZUE 4K0YA 2GHMA 4PNIA 3W10A 3FI2A 4DG0E 3NAYA 4PPCA 4IADA 4EOKA 4F6UA 1PXJA 3A7GA 2WMSA 5HORA 1U5RA 4ANNA 3QQUA 3PG1A 3N4VA 2C68A 2J9MA 3EKNA 4M15A 4BDHA 3BQCA 2C0IA 2XK6A 3FXWA 1XKKA 2QLQA 2YIXA 4IVCA 4FZ7A 4P7EA 4LL0A 1OGUA 2PE2A 1Q8YA 4CD0A 4PMPA 5M56A 1PMVA 3MH1A 4G5JA 3QD3A 3I4BA 4YJQA 4OAUC 2YACA 1IAJA 2XNBA 5L8JA 4OR5A 1ST4A 2B1PA 2XA4A 3C4WA 4XG8A 3EWHA 3K2LA 2P4IA 3V8TA 2R2PA 4RIYA 4G31A 4E5AX 4E4MA 3VS1A 5L2WA 5F1ZA 1Q8ZA 2FGIA 2OJGA 4F78A 4JDIA 3AXWA 3EYGA 4XNEA 4I3ZA