3PXKA

Focal adhesion kinase catalytic domain in complex with pyrrolo[2,3-d]thiazole
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
273
structure length
256
Chain Sequence
YEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords PTK2 protein
publication title Co-crystal Structures of FAK with an Unprecedented Pyrrolo[2,3-d]thiazole
rcsb
source organism Homo sapiens
total genus 90
structure length 256
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3pxkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3pxkA01
3PFQA 4CYIA 3OWPA 4O0XA 3UPXA 4IXPA 4BI2A 4AAAA 1I44A 1J3HA 1S9JA 2R3OA 5D9HA 4D5KA 2X9EA 3KMWA 3Q2JA 4MXAA 2BAQA 3AC4A 2VRXA 3Q52A 4J99A 3VIDA 1Q4LA 3C5IA 1LUFA 4J52A 4EH7A 4QNYA 3ANQA 5B2LA 1Q3DA 1KUTA 4FKTA 3UMXA 2BMCA 2W1DA 3RHKA 3SXSA 1OITA 2OFUA 2BZKB 3RWPA 5E8TA 4MTAA 4ZP5A 5G6VA 4LL0A 5CEIA 1PXPA 2OIDA 3HRBA 5M07A 4LV5A 1XH7A 4BIEA 4ZSAA 1FBNA 5AV3A 4XS2A 4DFZE 3F7WA 3CKXA 3N9XA 4RIYB 3FC1X 5CQWA 1YXTA 3LMIA 3IW7A 5FEDA 4TRLA 2XNEA 3UVRA 4IANA 1FINA 5J8IA 4GT4A 2R0IA 4XOYA 3PJ2A 1UKHA 4QMZA 3AGMA 3PZEA 3R21A 4DH8A 2SRCA 4YJTA 2W1HA 4NCTC 5ETIA 4IIRA 1ZAOA 5C8MA 4EH8A 2YITA 2R3PA 3RTPA 4ITIA 4RLKA 1GIIA 4OGRA 1V0PA 4O1OA 3BLHA 4PUZA 5DR9A 3ROYA 2Y8OA 3ODZX 4C4IA 1XH4A 4FT9A 4KRCA 2QOKA 4YTCA 4BKZA 3E5AA 3IGGA 1OPLA 3R1NA 4C3RA 4DEHA 2B9JA 4L52A 1ZARA 3NRMA 3UE4A 4AGCA 2VTSA 4DYMA 4EZ3A 4F9BA 2ETKA 4L01A 4A4XA 2DQ7X 4BCHA 2ZAZA 3G0EA 4R1YA 3QUEA 1TQIA 3BBTB 2XK9A 1GZOA 5H3QA 3RKBA 2PHKA 3CGFA 4QTDA 4HCTA 3BU6A 4QTAA 3HGKA 4AA4A 1RDQE 2NPQA 4S30A 4CD0A 2XH5A 2WGJA 3W18A 4A4LA 4Y5HA 4RX7A 5CTPA 4FTOA 4BYJA 2C69A 3ALOA 4YJRA 4NYEA 3SHEA 5CANA 3D2IA 3E3PA 2XVDA 1H25A 3C4XA 3A7FA 4JL9A 4TNBA 2OLCA 1OI9A 3I0OA 2I0EA 4WNOA 3QQLA 4QMLA 4NL0A 3FZOA 4E6DA 3P78A 4ANLA 3PY1A 4OT5A 4F09A 2GNFA 1IR3A 3EZVA 3Q53A 3UOJA 2CKPA 3S2PA 3RAIA 3GB2A 2EUFB 4WUAA 5E91A 1YXSA 3CXWA 4RT7A 4IAKA 3R02A 4BVUA 3UNKA 4NH1A 4DLJA 3BWFA 1PXNA 2GU8A 2VU3A 3GOPA 5HBEA 2LAVA 3QTRA 1VR2A 4FKRA 4BFMA 4PMPA 2XRUA 4NTTA 3MBLA 2UZNA 3VW6A 4EK6A 2PVRA 4U8ZA 3K3JA 3W1FA 3NVMB 3QFVA 2ZVAA 4AF3A 2YIRA 5LWNA 5JRSA 3DJ7A 4YZNA 1ZYLA 3MI9A 4FZ6A 2ZJWA 3UZTA 5T6KA 3M1SA 3DTWA 2PVNA 4YBJA 4B7TA 1UWJA 4ACGA 5L2WA 4FL2A 1QPDA 2CPKE 4JX3A 3BRBA 4FV6A 4WNMA 5D1JA 5F95A 4EOKA 4GSBA 2Q83A 3FY2A 4IVBA 1OBDA 1J91A 3WI6A 5KBRA 3W2SA 3OXZA 3ZFYA 2BKZA 3F61A 5C26A 3RAHA 3HNGA 3ORIA 4OBOA 4EOSA 1ND4A 5JMSA 1YRPA 3FMKA 2BZJA 2X8EA 5M4UA 2OJFE 5HTIA 3QCSA 4NIFB 4E4XA 2VGOA 3EMGA 3LXPA 3L9MA 2GNGA 2JIUA 3LOKA 4XEYA 4A7CA 1K2PA 2F4JA 4YZDA 1HCKA 2C5YA 3I5ZA 1CKIA 3U4WA 3QU0A 3VUGA 3R83A 4DG3E 2WTVA 3NAXA 4F70A 4ZS4A 3LJ1A 1T46A 2XEZA 3ULIA 3UYTA 3WZJA 4D0XA 3IDBA 3N4VA 2PMIA 4N4SA 2ITZA 3VRZA 3IK3A 4BCOA 2CNQA 3D7TB 3GC7A 3EH9A 3TV6A 4ANMA 4ZTHA 4FI1A 3UC4A 4UWYA 2UZVA 3WF9A 4DEDA 3BZ3A 1WVWA 4H58A 5JH6A 3QTZA 4IZAA 3R7VA 3AT4A 4GJ3A 1UNGA 2W4JA 4WNPA 2E2BA 3P9JA 2CJMA 4L3LA 2ZOQA 1VYWA 3WZEA 4JR3A 4UMRA 2Y7JA 5HCYA 1J7UA 5J1VA 4RPVA 5AAEA 5AAGA 4RZWA 4N0SA 2PSQA 2OZAA 5HVJA 5KMNA 3I4BA 2REIA 2DYLA 2X7OA 5KNJA 3ZUTA 4G17A 2VTLA 3LFAA 5HCXA 3COHA 4BHZA 3HEGA 3CLYA 1QMZA 4IWQA 4MXYA 4UMQA 4R7IA 3HRCA 1SNXA 3DZOA 4ANQA 5DFPA 3FHRA 3DBEA 1WBSA 2OKRA 4CXAA 2WTCA 2WAJA 4XV3A 2FO0A 4DF3A 2CMWA 3PSBA 4QPSA 1ZWSA 5LVMA 3HAVA 1TKIA 4IM3A 2ZYBA 1BI7A 1ZOHA 3OWJA 4ZTRA 4FBXA 3ZCLA 4AZWA 4C02A 3MJ2A 5H8BA 3F3UA 4DBXA 3HX4A 2C6MA 5IQIA 5EHYA 4F99A 1XBCA 3PLSA 4FSRA 4QPAA 4EH6A 3IQ7A 2P3GX 2WXVA 3UOKA 4EKKA 5BPYA 5J5SA 2X2MA 2P2IA 4PDPA 1O6YA 3OP5A 4BDFA 3PA3A 2R3QA 4DGLC 4B99A 4GMYA 5A6NA 4BCGA 4J95A 4BI1A 1VEBA 4I6BA 1R39A 2QO2A 4O22A 5GNKA 5TO8A 1YW2A 5AUUA 2J50A 2Y9QA 2WMUA 3DKOA 3KCKA 3IW4A 5HQ0A 4NW5A 3CPCA 2HENA 2VTQA 4FG7A 4R7BA 3MIAA 3AD6A 2QOQA 3FPMA 5K0KA 4FYNA 4K33A 4I20A 4GL9A 3MY1A 4FKVA 4HOKA 2ETRA 5DT0A 1Q62A 3OY1A 2V62A 3F88A 4JG6A 4KIPA 4KB8A 4B4LA 2VNWA 4BKJA 4E4MA 4JG8A 3VN9A 4TYIA 5IKWA 2EU9A 3DNDA 3LCOA 4UY9A 3E87A 3BYVA 4XBRA 2GTMA 2XK4A 4AFJA 3TUCA 5HEZA 3LM0A 1JQHA 4HJOA 2B0QA 3QYWA 3PVWA 5CSHA 3EFLA 5TF9A 4FSTA 1TQPA 4ZSGA 4KNBA 3AC1A 4FG9A 5KMKA 2V0DA 3ZO3A 4EOPA 3PJ3A 5J9LA 3ZFMA 1U59A 4KAOA 4M0ZA 2A4LA 4XUFA 5HI2A 5AP6A 4QMOA 5GJGA 1Y6AA 2PY3A 3M42A 1OL6A 3UYSA 2WPAA 3W33A 2ZV8A 4D58A 5HD4A 3UOLA 4AN3A 4FEUA 3PVUA 3Q2MA 4TYEA 2G1TA 3I81A 5FBOA 4JBPA 4X6QC 3KXNA 4ZEGA 3QTXA 2CDZA 2VAGA 4YZ9A 3UZPA 3FHIA 5K9IA 1SVEA 5CEPA 3DK6A 1CDKA 3ORKA 5LVPA 3AC5A 3DZQA 3AMYA 3ZDIA 4L68A 2OICA 4JIKA 5EI6A 3UIUA 3D5XA 3Q4TA 1H0VA 4FKSA 4YJUA 3SX9A 2OIBA 2Q0BA 3W2PA 3WOWA 2Z2WA 1G5SA 3FLSA 4NKAA 2V7OA 5AADA 3AMAA 5GZ8A 2ESMA 1JSTA 2H6DA 2XJ0A 3F5XA 3ZMMA 3CC6A 3P7BA 5FD2A 3R9DA 3MFSA 2V55A 5AEPA 3TDVA 3A8XA 5GINE 4I21A 5CYIA 4CTBA 2WMAA 2BRBA 4UALA 4O0WA 2HW7A 3LZBA 5C01A 3SLSA 3C4ZA 4BGHA 2JBPA 5ACBC 4IWOA 4FTAA 3D94A 1NA7A 2J5EA 5IQDA 3NUSA 4BL1A 3EQRA 4EC8A 3ATSA 3NZ0A 5L6OA 2ZV9A 3QZIA 3UNZA 3ENHA 5BNJA 3FZTA 3P7AA 3N4TA 3V6SA 5AA8A 4LUEA 4H3PA 4WIHA 4BBEA 2F7EE 5E8SA 4U9AA 4O0UA 3C13A 3QQJA 3UVPA 1L8TA 4E20A 1QCFA 5AUVA 5E4HA 2OO8X 4AQCA 3NUNA 1JSUA 3AOXA 4ACDA 4CCBA 2HELA 2OW3A 2PMNX 1M2RA 3DJ6A 3KCFA 4RIWB 4M8TA 1DAWA 4PPCA 5FTGA 4M7IA 1Y8GA 2ONLA 3AD5A 3QTWA 3RK7A 5J7HA 5IDPA 2JD5A 1W82A 3QA8A 3E8NA 3R7GA 3HMPA 4GUEA 5L2IA 4C2WA 2PZIA 4V01A 2J90A 2VX1A 4P5QA 2OJJA 4MXOA 4CFMA 4O81A 3EKNA 3HV3A 1R0EA 1R1WA 4FOBA 3OTVA 3UVQA 1YWVA 4E7WA 3R1YA 4FG8A 4F1MA 5DPVA 1WBOA 3QHRA 2Q0NA 2XA4A 5I3OA 2WQBA 4HVDA 4I1ZA 3TZ9A 3NYXA 5IA0A 5EI2A 3NWWA 3QXPA 5K5XA 2VWIA 2BTRA 5FXQA 4L46A 4DA5A 1BL7A 4AOIA 1PXOA 5CU6A 5FQDC 2PYWA 3NMUF 4ONAA 2YJSA 1SNUA 3R7YA 1JOWB 5AV2A 3UO4A 4AZVA 2OGVA 3H4JA 5KUPA 3JXWA 2W1GA 3ZOSA 1MRUA 3OUNB 4FEVA 3QGYA 3QHWA 4OTQA 4KS8A 2QD9A 5AR4A 4HVHA 3V5JA 4IADA 5CXZA 3ZEWA 3I0QA 4MXCA 3BIZA 4FEXA 4FL1A 4FODA 2GFCA 3F3WA 4GG5A 2UW7A 2VO0A 2ITOA 2ZB1A 4BCNA 4EEVA 4O7LA 3DKGA 4V0GA 4BDEA 4X2JA 3SGCA 5EQYA 3OCBA 2GNLA 3D2KA 3OOMA 3QRIA 4LRMA 5IUIA 2QOCA 4ZMEA 4FV0A 4TWPA 4GV1A 3RAWA 1U4DA 4U7ZA 3F5GA 4ZJIA 1M14A 3HP2A 3D0EA 4GW8A 4NZWB 2ZM3A 4PTCA 1LPUA 4YP8A 3VS7A 3KULA 3R30A 5JSMA 1MUOA 3R0TA 3RWQA 4USFA 1WBPA 5L8JA 4ACCA 4BZOA 1Z5MA 2W1IA 3LMGA 5AR5A 3ZXZA 3BE9A 2X4FA 3FSFA 1Q8UA 3MVHA 4FTMA 3Q60A 5GZ9A 4FA2A 2W4OA 2Z7SA 3TIYA 4D2TA 5CEOA 4Q9SA 2Y4PA 5HX8A 4QMQA 2C3LA 3P7CA 1NVRA 3TNPC 2YCQA 4MCVA 4C4JA 3A7HA 4G31A 2XNOA 3DAKA 3C4WA 4YO6A 1BUHA 5HO8A 3REPA 2BROA 4QYGA 3ZTXA 2PUPA 3MESA 4RX9A 2P4IA 2WU7A 4H1MA 4JRNA 4UYNA 1NW1A 4GVAA 5HIDA 5L2QA 3EN7A 3KN5A 3LCKA 1J7IA 4G6NA 2DS1A 4XJ0A 3GU7A 4IB5A 3PSCA 1PXIA 2I0VA 5HBHA 4AUAA 4APCA 5EYCA 4X0MA 3FKOA 3W2RA 1BMKA 3AQVA 3D5VA 2R3MA 2UZBA 4NSTA 1KE7A 3MVLA 4FSWA 3SXRA 2OK1A 3V04A 2E9UA 2B9HA 2KTYA 5M53A 4CMTA 3W55A 3PDTA 1CKJA 2JIIA 3F2RA 4AG8A 5IG1A 4L9IA 4TY1A 4QOXA 3F5UA 2WOTA 5ANEA 3HL7A 4LV8A 4BRXA 4D5HA 4IH8A 2BILB 5A4TA 3QCQA 4O7SA 2YJRA 4BCKA 5L2SA 2C6KA 3MWUA 4HZRA 3DV3A 5AUYA 3BU3A 3QAME 4JI9A 4TWNA 4FKWA 4D28A 1OIQA 1PF8A 2BUJA 4JRVA 4YTIA 1FGIA 4EOQA 1M52A 3KXZA 5JN2A 2VO6A 2PK9A 4D1XA 2QCSA 4Y73A 4F6SA 5IISA 1YDSE 5J9ZA 4IB1A 5LARA 2EXMA 3OS3A 3T9TA 3VS3A 4HVSA 3NGAA 3KF7A 3GXLA 4EH3A 4J8NA 4K2RA 5F94A 3QYZA 3SG8A 4O7RA 5K0XA 2WMXA 2C6EA 3QRUA 5IQCA 3F9NA 5HBJA 3BX5A 2XKDA 3RMFA 5IZFA 3MA6A 4N57A 4ZTQA 1H01A 2XIZA 4G6LA 5HHWA 2CN5A 2JAMA 4FIFA 4FKLA 3DCVA 3VBVA 4WUNA 5CVGA 5BYZA 2VTPA 2C0IA 4UBAA 2WHBA 2Y4IB 2BVAA 2OXDA 1IEPA 2RKUA 3DTCA 3PXRA 4HYUA 4U80A 3GCUA 4E5BA 2DUVA 3GC0A 3V8WA 4W9WA 2J6MA 3ZS5A 4BDBA 1PYXA 3TV7A 4E26A 3R9OA 1IAJA 4HCVA 3FDNA 3DAJA 3NNVA 2LGCA 2WMTA 3GFEA 3TZ8A 5CF5A 4FTIA 3VC4A 2HZ4A 3QC9A 1PXMA 4FV9A 2CCHA 2XNBA 2IZTA 3G5DA 4MWIA 4X2FA 4QMUA 3VULA 3FY0A 3KQ7A 3GGFA 3O96A 4M3QA 4L43A 4LI5A 3FEGA 5KMIA 4U3YA 3EQFA 4IC8A 5T68A 3RZFA 4EORA 5A4CA 3Q4CA 2X1NA 4PP9A 3BV3A 4I4EA 5EM6A 4EK3A 5AP5A 3A4PA 4JQ8A 4RJ4A 3U9NA 2IVUA 2YCSA 3E3BX 1RJBA 3CGOA 3FMNA 3QTIA 4BI0A 2RG6A 5EQPA 3DFCB 2H8HA 3FLYA 3JYAA 3QZFA 4S34A 4QYYA 4HGSA 4R3CA 4FEQA 2NO3A 4EBVA 2FSLX 5E7RA 4XG3A 4BDGA 5M51A 3VS6A 4DEBA 5AIRA 5CEQA 4G34A 1T45A 4DFBA 5M55A 5LVOA 3NNXA 4EL9A 5IQHA 4J1RA 4EOJA 1PKDA 4IMYA 4QMMA 3HV4A 3OZ6A 4D1SA 2J0KA 1IA8A 1XQZA 3UBDA 1YXUA 3ORTA 4GH2A 3FLQA 4UXQA 4YJOA 2IN6A 4OAVB 2QU5A 2GNJA 4AOJA 3MFUA 3SDJA 1YHVA 3M11A 5AP1A 1H1WA 2WO6A 4RIXA 3U4UA 5HNIX 3UC3A 4O7WA 2V22A 2HY0A 5CU2A 3Q9YA 5AR3A 1PKGA 4DFYA 4HGEA 4ALWA 3G90X 3PG1A 3MB6A 3V5TA 4BDAA 5CEKA 3JVRA 3GCQA 4KSPA 5GIPE 5EM5A 5J9YA 2CHLA 2J7TA 2P33A 2WTKB 1MP8A 2W0JA 4YJNA 3FZ1A 4F0FA 1Z57A 5JEBA 3UP7A 4J96A 4YTHA 4AWIA 4E73A 2JAVA 1JKKA 3VW8A 4U81A 3BGQA 4Y95A 5KX8A 4I6HA 2WQMA 3CE3A 3LFDA 4EH5A 4U41A 3TI1A 4EOIA 1F5QA 4I0RA 3C4EA 2ITPA 2XIKA 3HDNA 4LRKA 4TKSA 3D14A 3TIZA 3PWYA 5AWMA 2JKQA 2YCRA 2Y0AA 4FT5A 2C1BA 3BELA 5M09A 3HUBA 4OUCA 4NFMA 3O8UA 4C62A 5J95A 3LXNA 3V6RA 3DS6A 5CVHA 2ETMA 4L3JA 5ANOA 4HVGA 4M69A 3LQ8A 4IAIA 4MNEA 3FC2A 3O23A 3OWLA 4LL5A 5AUTA 4CG8A 5EM7A 5CNNA 2UW4A 3VJOA 4ASZA 1SMHA 1E9HA 1JLUE 3F66A 2C6IA 3VJNA 3CIKA 2JDSA 2YEXA 1B39A 4D9TA 4R77A 1YDTE 2VGPA 3COIA 1ERKA 4N6YA 5CAUA 2YLEA 4JAIA 1UKIA 2ITXA 2HXQA 2PPQA 4F7SA 2XKCA 3EQGA 2X8DA 4AS0A 4X2KA 4DH5A 3VUHA 1ZXEA 2PZYA 4WBBB 3CPBA 1KWPA 2IZRA 3QX2A 4QTCA 3S00A 4U45A 5HU9A 3A62A 5A54A 2C5OA 3I5NA 4AGUA 4YJSA 4YU2A 3FXXA 1BYGA 3ZO1A 1KE8A 3QX4A 4Y83A 4UV0A 3E62A 4I24A 2GQRA 3Q32A 4G3EA 5TR6A 5D41A 4UN0C 3PIYA 1YI4A 1MQ4A 3LFFA 5CZIA 1WBTA 4F7JA 1MQBA 3ORPA 4MWHA 5HKMA 1AD5A 5T3QA 1WVXA 4IM2A 2Y6MA 4IAAA 3VUKA 4TTHB 4HYIA 3CY3A 4WHZA 2Z7QA 4KIQA 5LWMA 1YI6A 5G1XA 1XH9A 2UZOA 4RFMA 4FSQA 4YHJA 2G2IA 4ZTNA 4E6CA 2G15A 3A7JA 1JKLA 1PMNA 4RWKA 3UIXA 2CSNA 2A2AA 2WNTA 5CY3A 5AV4A 5IA2A 4PTEA 2B52A 2FB8A 2GPHA 4L53A 1YVJA 4CV9A 3VUTA 3LW0A 1F0QA 5LJJA 2IW9A 2C47A 3KF4A 4DCAA 3PVBA 4M14A 3L8VA 3C0HA 4BCQA 1H08A 4EONA 4FKOA 1YXXA 5IPJA 4N6ZA 4Y5QA 5BYYA 2ZM4A 3I1AA 4AACA 5KMLA 1FVTA 3KB7A 4FSMA 4J98A 4IX5A 3ET7A 4NT4A 3V5LA 4D2VA 4NU1A 4ACMA 1ZOGA 1YXVA 2F9GA 1U5QA 4YJVA 2IO6A 4Y8DA 3KRWA 5KHXA 4A9RA 2WIHA 3O51A 2YIXA 4RIOA 3ORLA 4F63A 3RM7A 4O7NA 2J0IA 4YHTA 3WILA 1LR4A 2GHLA 4JX7A 2X6DA 4QD6A 2X81A 3D15A 2IW8A 3MY5A 3K54A 3R2BA 5FTOA 2HZNA 3GFWA 1ZZLA 4YC6A 4OLIA 2FVDA 4DEGA 3A60A 1PHKA 4PMTA 2UW3A 4BDIA 1Q8YA 2C5VA 2W1FA 5CX9A 5AFVA 4DC2A 3R9HA 3ZC5A 4L42A 2BRGA 4DFLA 3VQUA 2PVKA 1F3MC 2YIYA 4RA4A 5KO1A 3PPZA 3R04A 5F4NA 5H2UA 2W1EA 2V5QA 4RQKA 3V3VA 5M57A 4CV8A 3POOA 3FQEA 1WVYA 4PF4A 5DI1A 5FP6A 3W2OA 4C4HA 4G9CA 4H36A 4KS7A 1H27A 3R8PA 4CZTA 3AD4A 4DFXE 5IA1A 2BKKA 1CKPA 4NEUA 1JPAA 2QR7A 4D2SA 3OROA 2BFYA 1YHSA 5L6WL 2R64A 2WMBA 4KIKB 5FUTA 3DT1A 4GYIA 2J4ZA 3MPAA 2PE0A 4S33A 3VUIA 2BPMA 3PXQA 2RFDA 3CQUA 3PYYA 5EW9A 3EL7A 2BHHA 2GDOA 3HV6A 4JDIA 4M68A 5B2MA 5A6OA 2OJIA 2WMQA 4QQCA 3QQKA 1JKSA 2HZIA 4FVPA 3R8ZA 2BALA 1DI9A 4FVQA 4ZOGA 3CS9A 2PTKA 4RJ5A 1JAMA 3PXZA 4E6QA 1OVEA 4FTUA 3T3VA 3NPCA 4QYEA 4A9YA 5M06A 4FICA 2OFVA 5K4JA 4K6ZA 3UOHA 4HYHA 2VTAA 3HMOA 5I9VA 2XIRA 3QZGA 2VNYA 4C59A 3OEFX 4B8LA 3LFBA 2BRNA 2Y4IC 1I09A 2E9NA 4O0RA 2YERA 2HK5A 4AT5A 4F9CA 1OL5A 5IQEA 1ZMVA 3R7OA 3U6JA 3B8RA 4M0YA 3Q5ZA 4JBVA 5M44A 3A8WA 3IOKA 5AIKA 5HO6A 4K0YA 5GJDA 3EFKA 3SW4A 1ZZ2A 2VTIA 4M12A 4Q2AA 3WARA 4P5ZA 3GCVA 3TT0A 3MIYA 4O82A 2XK3A 1QL6A 5CI6A 3DFAA 5LOHA 3PPKA 4WG3A 2J2IB 3L8XA 2NRYA 4I94A 4YZMA 3ZSGA 2UVYA 4FC0A 3E93A 1YQJA 2WKMA 4CGAA 4LGHA 5M56A 3KN6A 3Q9XA 4V05A 5BUEA 3S3IA 3BBWA 4QP9A 5CQUA 5DRBA 2JKOA 2ZMDA 3TKHA 5KMOA 1YWNA 2BRHA 1ZY5A 5CENA 4MNFA 4X6RA 2CGVA 4C33A 4AZFA 1GOLA 5EYMA 1R3CA 2XZSA 3SKCA 3BLQA 2BRMA 4CMOA 2W9ZB 5H9BA 3GCPA 4IX3A 4QMXA 3S4QA 3OVVA 2R3GA 2W7XA 3ACKA 3QD0A 5LVLA 3WZKA 4PY1A 3NVKI 3GU4A 3PE2A 4CLIA 3NUAA 1KE5A 2W05A 4U97A 5AP2A 5I9ZA 1UA2A 4QP7A 3FWQA 4NM7A 4HYSA 4CZYB 2FH9A 2YM5A 3AT2A 4MXZA 3FXWA 4EQCA 4HW7A 5FDXA 4OTIA 2JLDA 5ETFA 3KVWA 2OXXA 2UZEA 4MKCA 4O0SA 4BBMA 5KMMA 3UZRA 1BLXA 3BYOA 3I6UA 3N4UA 3KXXA 5J1WA 4ITJA 4DT9A 1UNHA 1Q8WA 5HZNA 3TZMA 4L00A 4ORKA 3KK8A 4K8AA 3BHYA 1NY3A 2CGUA 3OHTA 1S9IA 3FL4A 2WMSA 4G2FA 4R5SA 4TYHB 3ZONA 1IAHA 4PP7A 3UMWA 2QLUA 1AQ1A 3DBFA 2WTKC 2XCHA 3DDQA 3AC2A 2A0CX 4EYMA 3UNJA 3LJ2A 3RVGA 3PA4A 3OCGA 4D2WA 2JC6A 3R7EA 5AP0A 4J71A 4AGWA 4I5MA 2J0MB 4KA3A 4RWIA 4XP0A 3WE8A 3LAUA 2GMXA 1UU3A 1W83A 1PRYA 5IH5A 3H10A 4F4PA 4APPA 3EN4A 1ZY4A 2OU7A 4OBPA 4S2ZA 3T9IA 2OJ9A 4ZS0A 1KV1A 2UV2A 3SRVA 4H05A 3RPYA 1UU9A 4YSMA 3VAPA 1OUYA 1V0OA 4L7FA 4ZTLA 3UODA 5CASA 3MFRA 4QMNA 4LGGA 3KXHA 3TJDA 2IWIA 4FTKA 2R2PA 3PJ1A 3BQCA 4XG9A 1H1RA 2UVZA 4FE2A 2V7AA 5EW8A 2CKEA 3EN9A 1M2PA 5CLPA 3S95A 5HTBA 3RAKA 4AGDA 4U3ZA 3LCTA 1P4OA 1UU7A 2XS0A 2RGPA 4OTFA 3OBGA 5HNBA 4ZIMA 3V5PA 4BC6A 4F9YA 4MQ2A 2VX0A 4ZLZA 4YGAA 3A4OX 3FL5A 3EJ1A 5EDQA 2R3HA 5JK3A 1FPUA 2I1MA 4QQJA 4GK2A 2X6EA 4TN6A 3P1AA 5IUHA 2P2HA 3BYMA 4X3JA 2QOHA 3IKAA 4AT3A 5FGKA 4I0SA 3MTLA 3G9LX 2PE1A 2ZDTA 4IE9A 2C6TA 2VZ6A 2OH4A 2R3RA 4G3DA 4G3GA 4I4FA 4IACA 4U5JA 5E8ZA 4CFUA 5I5ZA 5IA4A 2UZUE 3A7GA 1ZMUA 4U43A 4QTEA 3VNTA 3PIZA 2XK7A 4JR7A 1APME 3IW6A 2CGWA 3R8UA 5EFQA 3LLTA 3ZYAA 4WKQA 2J5FA 3E8CA 5AP3A 4E6AA 2O63A 3C9WA 1XH5A 2CNUA 4ALUA 4F6WA 4DTKA 4RIYA 3SOAA 3U87A 3RPSA 1IA9A 5A46A 1TVOA 3Q6UA 2AYPA 2JKKA 3ORXA 4C58A 2XKEA 4DG2E 2QI8A 3VS5A 1JSVA 1Z9XA 3UTOA 2CLXA 3E92A 4GKIA 2C6DA 1Y8YA 1WBNA 3OMVA 2GTNA 3PA5A 4IBMA 5CXHA 4DINA 4XRLA 5AV1A 3RPRA 2A19B 2B54A 3BEGA 3DA6A 3KMUA 5B2KA 5AR2A 1PXJA 3KREA 2H34A 3GU8A 5IDNA 3ERKA 4HNFA 5H8GA 4TL0A 3EOCA 3CTQA 3DY7A 2OG8A 3HP5A 3G6GA 4RIXB 3E88A 3U54A 2QHNA 2YAAA 3KU2A 2JEDA 2ITTA 2VWVA 4BF2A 2RF9A 2NNWB 4XG6A 4IW0A 4CEGA 3C4FA 3UDBA 3TV4A 1ZYDA 4YLJA 5IA3A 2QQ7A 4ZY4A 5L6PA 1R78A 4JOAA 3R8VA 3BGPA 2FUMA 4IB0A 4D2PA 2ERZE 1H1SA 1J7LA 2JKMA 3ODYX 4C36A 4U0IA 2C6OA 3V5WA 2CCIA 4GK3A 2C4GA 4XV2A 4TNDA 5AUXA 4IC7A 1HOWA 3KMMA 3QRJA 3KRLA 4AFEA 3FI8A 3IDCA 1KOAA 3OT8A 4C4GA 4AW2A 3UP2A 4FZAB 5IH6A 2ZDUA 4RLLA 3UO5A 4H39A 1A9UA 3FSKA 4D4RA 3G0FA 4FIEA 5AR7A 2BAKA 3EFWA 4JDJA 4MD7E 2XYUA 3QGWA 4P7EA 4M13A 3TKIA 4EUTA 2ITNA 3Q9WA 3PLAE 2R3FA 3EYGA 3PP0A 3R1QA 4FTJA 4O91A 3RJCA 4EHEA 3WIGA 3DB6A 1ZYSA 3HZTA 3R01A 3ENMA 4CRLA 5CZHA 4CT1A 4DH1A 2GHGA 3TACA 2QLQA 3CQEA 4DG0E 2YFXA 4DGOA 1O6LA 5JGDA 3L8PA 4D55A 1ZYCA 2B7AA 3MH1A 4AP7A 3L9PA 1DS5A 5BVFA 5KMJA 5BQ0A 1OZ1A 1PJKA 2OSCA 2W06A 5EG3A 3P86A 1FOTA 3OBJA 3POZA 4R78A 4EWHA 2ONLC 4YTFA 3PVGA 4C4EA 1FQ1B 4J97A 1UWHA 3RK5A 4C38A 5HESA 3TN8A 4GIHA 3BEAA 3C51A 1OBGA 2O5KA 3KFAA 4BWKA 4JLCA 5FDPA 4XNEA 2G01A 2QODA 2PUUA 3MJ1A 3QZHA 4KUJA 2YDIA 2VV9A 1P14A 5E8WA 2BAJA 4RMZA 3Q04A 2E9PA 3G2FA 3EIDA 4JBQA 2C3KA 3PP1A 3VRYA 5LMKA 3I6WA 3EQPA 4FKQA 3BGZA 4FT7A 3CKWA 5BVEA 3IW5A 3PTGA 3FUPA 4I5PA 4B9DA 1XWSA 3FV8A 1ZMWA 2W17A 2RFNA 2UZLA 4FSUA 4QP8A 3FZPA 3AG9A 3MGYA 5AA9A 2J0JA 4PMSA 4XP3A 3PUPA 1CMKE 3KXMA 4O86A 3ZHPC 2XM9A 4GVJA 5KKRC 4U44A 2CLQA 4GG7A 4UYAA 4XG4A 4LG4A 4NM3A 3DK7A 4OR5A 5C27A 3ZU7A 1IG1A 2WMWA 4ZJJA 2R0UA 2YISA 5I4NA 2QU6A 3LJ0A 1W8CA 1REKA 2RFSA 2GQSA 5EHOA 4G1WA 3WF5A 4BN1A 3R8MA 4BDJA 2X0GA 3DAEA 3D7TA 3BV2A 4XHKB 3SVVA 2CKOA 3G15A 2YLFA 1WAKA 2H96A 1H24A 2WB8A 2JFLA 2XIYA 3GCSA 1FVVA 3PY3A 4O27B 2W9FB 4O21A 4FV8A 4UMPA 5KZ0A 5ETCA 4CLJA 5HG5A 5EK7A 2C1AA 2HWOA 4GT5A 4QP1A 4NK9A 2HY81 2IG7A 4OTDA 4PDOA 1GY3A 3GNIB 3R73A 4ENXA 4USDA 5DEYA 4R3RA 5ITAA 4XG2A 3MV5A 5IEVA 3NUYA 5C1QB 4J7BA 4F0IA 3BKBA 2VTJA 4RA5A 4V04A 5IQAA 3P79A 1XBAA 3BLRA 3MW1A 3R28A 1M7NA 4I5HA 4M67A 5HG9A 3C0IA 4RVKA 5DA3A 2OH0E 3D83A 4HNIA 2FSMX 3TCPA 2OZOA 3E64A 2QOFA 3RINA 3WE4A 3TM0A 4EQUA 4NFNA 2JFMA 4FGBA 4NUSA 4A9UA 4KBKA 1UV5A 4I23A 4ITHA 4KWPA 3O7LD 5DR6A 2IZSA 3W32A 2B4SB 2WQOA 4IVDA 5GZAA 2J0LA 1VZOA 4MBJA 2BHEA 1U54A 2EWAA 3RPVA 4HGLA 2RL5A 4FTNA 3RP9A 1Q8ZA 4YSJA 4YNEA 4JJRA 2IVSA 4IDVA 3TNQB 3ZUVA 4OAUC 4CKJA 1IRKA 3RI1A 5JGAA 3SW7A 3GUBA 3DOGA 1M17A 2PVFA 4OBQA 4M84A 1GZNA 1PW2A 3R1SA 2W96B 1BX6A 1QPJA 2R3NA 3FLNC 4MEDA 5B7VA 4EK8A 3CBLA 3KA0A 2EVAA 3MPMA 1OM1A 2R3LA 5HOAA 4BR3A 4ARKA 4AX8A 5CF4A 2XF0A 5F9EA 1Q24A 1AGWA 2I40A 3ZM4A 3ZO4A 2XUUA 2WMVA 3EFJA 4FTLA 3F6XA 5BVDA 3QTQA 3U55A 3FQSA 3NYVA 4RRVA 4BTMA 3QKMA 3HAMA 1V1KA 4ALVA 3FKNA 4K11A 4ANSA 4FSZA 3EQIA 2WTJA 3TEIA 3FE3A 1GJOA 3DQWA 3QRKA 3LQ3A 2IZUA 5HE1A 2I7QA 3HDMA 4DGGA 3L9NA 4IEBA 4KKEA 1H1QA 2C68A 3VWAA 4DGNA 1UVRA 4S32A 5E8VA 2WD1A 3V5QA 1LP4A 3ZEPA 1H1PA 3JY0A 2PZRA 4Y85A 3CSVA 3RM6A 2YZLA 3UIBA 4FIIA 4QQ5A 3NW5A 2YM6A 3VQHA 5BMSA 4OTPA 4C37A 5I3RA 5C4LA 4FMQA 3RNIA 4JVGA 2RIOA 5LQFA 1PY5A 3ZH8A 4FEWA 2RFEA 2YAKA 1XHAA 4KBAA 3VBWA 3EQDA 1FMKA 2O64A 4RVLA 4D4YA 2GSFA 2WIPA 2VN9A 2UW8A 3DBDA 3KXGA 3JY9A 5CS6A 4BKYA 2QG7A 3U51A 2XIXA 4EOMA 5IQFA 4CFXA 4RC3A 2QHMA 1BI8A 4UWCA 1Q3WA 4FNZA 2XBJA 3LVPA 3VBQA 1DI8A 3FI3A 4O84A 4BWXA 2QG5A 1O9UA 4L8MA 4JQEA 4TYGA 4XX9A 5EH0A 2P0CA 3AMBA 4FKIA 2F7ZE 4FUYA 3WIKA 1OL7A 2VO7A 4FKPA 4FV1A 3H30A 4PRJA 5I9UA 4DT8A 4YZCA 2HCKA 3OW4A 3QA0A 3TG1A 3FKLA 3ZLSA 4LRJA 4DAWA 3F3TA 3G51A 2UW9A 4IVAA 4FKJA 1YHWA 1OUKA 5E90A 4FYOA 4F1OA 1RE8A 3ZLYA 4JAJA 4RC2A 4QMTA 3L9LA 4FV5A 4TW9A 4BWPA 3L1SA 2I0YA 3PE1A 5FM2A 3V01A 1MRYA 2G9XA 4IWPA 1OGUA 1P4FA 3RZBA 4ZZNA 5BVKA 4L3PA 4O2ZA 4O96A 4PPAA 2IVTA 2BZIB 2QNJA 5AJQA 4JIAA 4XMOA 3QALE 1LEWA 2OZAB 3BHUA 4EUUA 4O7ZA 4AE9A 2XRWA 5BYLA 3SV0A 4IX4A 4A06A 4BTKA 3E7VA 2EB3A 3NW6A 5DGZA 5A14A 4CKRA 5KHWA 5EM8A 4OTRA 5ACKA 3FLWA 2GCDA 3R00A 3VS4A 2WQNA 3NUXA 5ANKA 1TQMA 1UU8A 1Y57A 1XH8A 2ITUA 4CRSA 1OMWA 2CN8A 4O7YA 4W8DA 5CSWA 5BVWA 1BL6A 4UEUA 5ICPA 3T3UA 3O71A 4BICA 1BKXA 3TTIA 5IEXA 5DLSA 1R0PA 5DIAA 4DH7A 3AC3A 4TT7A 3EN5A 3SQQA 2WOUA 3D7ZA 4BCMA 3W2CA 4EOLA 1CM8A 5AAFA 2BDFA 3CR0A 4RIWA 5DH3A 4RBLA 1KOBA 5A3XA 4G6OA 4K18A 4FV4A 2YM3A 2WZJA 1VYZA 3W8QA 4WSYA 4EK4A 3P0MA 2XNPA 3FJQE 3O2MA 5IMXA 3PWDA 4FOCA 4RJ6A 1Q5KA 4KKHA 5D7VA 3MPTA 1VJYA 3FMJA 4O0YA 3IDPA 1WCCA 4X3FA 4KIOA 5FBNC 4MF1A 2YCFA 4WO5A 2Z02A 5HTCA 3C50A 4E3CA 5ETAA 5CEMA 5L4QA 5HE2A 4ZY5A 3OWKA 2ZM1A 3UO6A 4RX5A 5IA5A 3F69A 3ZLXA 3SRVB 4ZJVA 5A4LA 2F2CB 3P5KA 3EZRA 4M97A 1STCE 2XK8A 2YM8A 2VUWA 4RC4A 4O6LA 4TWCA 4E5AX 4GFOA 3FMHA 4FX3A 3QCYA 2FYSA 4BYIA 2GS7A 5E1SA 4DE4A 4P90A 4YC8A 4HCUA 3QQFA 3GEQA 3SC1A 1GIHA 2W99B 4DITA 4YC3A 5A4EA 1IASA 5E8YA 3MN3A 4RVMA 3ORMA 1PYEA 2NP8A 4KSQA 2C30A 5JZNA 3MB7A 4GIIA 3WYYA 4CFWA 4KKGA 3PRFA 4AZEA 2RG5A 4XG7A 4FVRA 4PTGA 2F57A 3RNYA 4C2VA 3WZUA 4LOQA 5FRIA 4LYNA 3MFTA 2JIVA 5BUIA 5HIEA 3OXTA 4NCTA 2XYNA 1GAGA 5DE2A 3F82A 2C3JA 3EQCA 3V51A 3S1HA 2OWBA 4QPMA 5A4QA 5BMMA 2XNGA 5M4IA 4E4LA 4U40A 3Q9ZA 4QMPA 4UWBA 4AT4A 3PXFA 3MA3A 3AT3A 2G2FA 3OT3A 3DBCA 2HAKA 3WF8A 4JQ7A 2ITQA 5HE0A 3VS2A 3COKA 5FWKK 4PNIA 3WBLA 3KRJA 4HVIA 3IONA 4FNYA 3OC1A 2YIWA 4CTCA 4ZAUA 4U42A 5EQEA 4YBKA 3I7CA 3DK3A 3OFMA 3QBNA 4ASXA 4WBOA 2ZMCA 3QRTA 3VHKA 1WBWA 4FKGA 4FZFB 4QP6A 4JDKA 3UG1A 4C3PA 3K5UA 4K77A 3GC8A 1H26A 2X39A 1XKKA 4DHFA 5E8UA 3TTJA 2W5HA 2DWBA 4YUQA 5L8LA 2VD5A 2QKRA 2BIYA 3FZRA 4CYJA 1QPEA 4C61A 3V8TA 2OBJA 5DVRA 4AA5A 2R4BA 3QUPA 3ZZWA 1L3RE 2PVMA 5DYJA 3LXLA 5K3YA 3S0OA 3ULZA 3QUDA 4CNHA 4BTFA 3FAAA 4WNKA 4IB3A 4ZSEA 5GIOE 2VWUA 3QF9A 3TKUA 3R7IA 5FP5A 2VWBA 4EZ7A 3SXFA 2ITYA 1YOLA 4O38A 4FV3A 3KEXA 3THBA 3DDPA 3LCSA 1B38A 3KRXA 2R7BA 3PJ8A 3QLGA 3AGLA 3EHAA 3GU5A 1K9AA 5CSXA 4BDCA 4IJPA 5CU3A 2YWVA 4XLIA 3C7QA 5HIBA 3BE2A 3GBZA 4QMWA 5TKDA 5J5TA 1SM2A 2QOLA 4YHFA 4CVAA 4LFIA 4FUXA 2PWLA 3QD2B 3ITZA 4FSNA 3EQHA 5TOZA 4EBWA 3KC3A 5I9WA 3QLFA 3TNWA 1X8BA 4O83A 3K5VA 4B6LA 4Z7HA 4O1PA 3HMMA 4C3FA 3QD4A 4YR8A 4EJ7A 4M15A 3BU5A 3O8PA 5FXSA 4F08A 4FNWA 3BQRA 4CQGA 3ZRLA 5KBQA 3ZSHA 4S31A 3H0YA 3JS2A 4ANOA 4EHGA 3OW3A 5HD7A 3FZSA 5JFXA 2XMYA 1XO2B 1WMKA 1U5RA 2JDTA 2P55A 5TT7A 5I9XA 3CD3A 4BCFA 4Z3VA 2Z60A 1OECA 3BYSA 2IPXA 4IAZA 2JDRA 5IEYA 5DMZA 2C3IB 4IZ7A 3SA0A 5KKRB 3LE6A 2XJ1A 3PIXA 2GNHA 3ZO2A 4Q5HA 3U6HA 3MSSA 3QWKA 4WT6A 4GRBA 4ZSJA 3G33A 3VO3A 3R9RA 4EH4A 5A9UA 2W1CA 3WYXA 4LOPA 3F3VA 4I22A 1E1VA 2BDJA 4W8EA 2XEYA 5CT0A 3MVJA 3N51A 1FVRA 2HWPA 5HORA 4C0TA 2HYYA 4FV2A 2ITVA 2OF4A 1WZYA 4I3ZA 4V0GB 4AA0A 4DN5A 4E5WA 2PZPA 4EJNA 4F0GA 2B55A 3D9VA 3UGCA 3Q5IA 2O3PA 1Y6BA 4QO9A 4ID7A 4UZHA 5CT7A 3MVMA 4FL3A 3ROCA 4W4VA 4IQ6A 3B8QA 3FI4A 4KD1A 3P4KA 4ZTSA 1B6CB 3ZXTA 4UXLA 4XYFA 4QMVA 3KULB 1CTPE 3R2YA 4TYJA 5AUWA 4BGQA 4GU6A 5EDPA 2FA2A 4OW8A 4F7LA 1V0BA 4IAYA 4QYHA 4W4YA 2CGXA 3MH2A 1CSNA 2ITWA 3LHJA 4ERKA 1E1XA 1OKWA 3QTSA 3KGAA 4XP2A 3MH3A 4EHZA 1P5EA 5E8XA 2O0UA 4MHAA 3R6XA 5K5NA 5JRQA 2GS2A 2ACXA 1UNLA 4LOOA 2ZB0A 5HO7A 4PV0A 3W2QA 1URCA 5AP4A 1OKYA 3OG7A 3KRRA 4CFVA 3H9FA 4FTCA 4IHPA 3F2AA 4TXCA 1P2AA 2C0TA 5AUZA 4GJ2A 4R6VA 1H8FA 1KE9A 5EKOA 2X8IA 5DHJA 3VF8A 4EI4A 4O7TA 3LM5A 3ZRMA 3UQGA 4RFZA 2WEIA 2QONA 4GUBA 4AE6A 3ZLWA 3OCTA 3P23A 3GI3A 2XK6A 3LIJA 3DPKA 3H9RA 4GK4A 3VBXA 3W10A 3GT8A 4JS8A 5EOBA 2PMOX 4FKUA 5ANDA 4F9AA 3R71A 3FYJX 3CJFA 4CFNA 4FIHA 2YWPA 4WRGA 5LCJA 1ATPE 5L3AA 4RSSA 4GS6A 2GS6A 3QQGA 3BPRA 3GU6A 3HUCA 4G16A 1M2QA 3VUDA 3B2WA 4EWQA 5J7BA 5IQGA 3FI2A 3IW8A 2R9SA 2YM7A 3BHTA 3NAYA 4ZMFA 4OTWA 4AN9A 3RBWA 4DH3A 4PMMA 5DN3A 2PU8A 4ASEA 3ALNA 1Q97A 4EQMA 2PE2A 4LMNA 5IUGA 4WG4A 2VWXA 4MQ1A 3ZFXA 2PULA 4FTTA 4FZ7A 5EDRA 5JT2A 1OL2A 3R8LA 2QURA 4NJ3A 2YABA 3Q3BA 4ANBA 3DBQA 2X7GA 4NKSA 4KBCA 5IH4A 4JBOA 4EOOA 5FTQA 4PX6A 5HLNA 3QQUA 1Q41A 5EW3A 1U54B 2YIQA 2GHMA 3VUMA 5DT4A 1KV2A 3HECA 2XJ2A 3Q4UA 4EYJA 3ZUUA 4YJQA 3UG2A 5BUJA 3I60A 3COMA 4G5PA 4LQMA 2WU6A 4F9WA 4HPTE 4C34A 3NR9A 4RQVA 1J1BA 4FIGA 3JVSA 3CTHA 4B0GA 3IECA 4C57A 4E8AA 4DFUA 3K2LA 3EWHA 4Z9LA 1GZKA 3B2TA 5I0BA 1RW8A 1OPJA 5HG7A 1URWA 4I0TA 1FMOE 3MYGA 4F64A 3NCGA 2UVXA 3U8WA 4CQEA 4GKHA 2J9MA 3UIMA 4PL5A 1A48A 3A7IA 3OD6X 3ZSIA 3C1XA 3T8OA 3Q4ZA 3TWJA 5FXRA 3ETAA 4G5JA 3WF7A 4L67A 2H9VA 2XP2A 2VWZA 4ENYA 3VF9A 3LPBA 2B9IA 2QVSE 4BCJA 4MX9A 3UQFA 5HX6A 3NEWA 2C6LA 3ACJA 3D4QA 3O17A 2BTSA 3NW7A 4X21A 2Z7LA 2R3JA 4G3CA 3NIEA 4I41A 4AXAA 4LGDA 3A2CA 5AX9A 4QP4A 4EK5A 3W8LA 4A9TA 3HKOA 2O2UA 4GCJA 3OUKA 3GC9A 4F7NA 1H0WA 1W7HA 5J79A 2W4KA 4QMYA 3WZDA 3KY2A 5IQBA 1SVHA 4NW6A 4XRJA 2X7FA 5D7AA 5E1EA 4CZUA 5M4FA 4KINA 4BY9E 2QC6A 2WEVA 2YHVA 4KRDA 2BFXA 3BI6A 4FIJA 2FGIA 3FMDA 4PPBA 2EXCX 5EYKA 4HGTA 5DNRA 1JNKA 4O6EA 5CU4A 4X7QA 5CF6A 4KABA 4ZSLA 4AOTA 4D4VA 4MVFA 3SG9A 4UMUA 4IFGA 2VWYA 4TZRA 4R5YA 1XR1A 3R9NA 5C9CA 3ZDUA 4MD8E 4A07A 4NM0A 5HLPA 3PG3A 3PSDA 1O6KA 4IVCA 3EKKA 4PL3A 2AUHA 1QPCA 3EN6A 4FV7A 5EI8A 5B0XA 2PVLA 5HGIA 4IJ9A 5DWRA 2QOIA 4XH6A 4JXFA 3FLZA 3O50A 4ZZMA 4BDKA 5BX0A 3DKFA 2R3KA 2VTTA 4FGRA 2I6LA 2EB2A 4E1ZA 3MH0A 4MD9E 1YOMA 4JNWA 3A99A 5CSPA 2WMRA 4RG0A 2KULA 3CQWA 1ZRZA 3BHVA 3NCZA 2WELA 3EL8A 4RJ3A 3SAYA 4AW1A 3LKMA 3VS1A 4RWJA 1YKRA 1OPKA 3NS9A 2E9VA 4H3BA 4LMUA 2F2UA 5DEWA 3F2NA 4EKLA 1H07A 3IG7A 3II5A 4IM0A 4O2PA 1ZLTA 5J87A 3LFEA 4RWLA 4IZYA 2WTDA 4XCUA 4CMUA 4UMTA 3IS5A 2O65A 4QT1A 3LFNA 2PVHA 4GU9A 4IAFA 5CAVA 5C4KA 2AC5A 3NYNA 4MXXA 4O7VA 4M69B 4MNEB 4PDYA 5CI7A 4BIDA 4K9YA 3O0GA 3L8SA 1HCLA 1SVGA 3FYKX 3AC8A 4FT0A 3DJ5A 3ORZA 5K4IA 2BZHB 2W5BA 3KL8A 3NNUA 4PQNA 3QD3A 3CJGA 4KIKA 4GEOA 4AZTA 4NM5A 5KZIA 4DEIA 5DR2A 4GT3A 1LEZA 5EHLA 3TNHA 1Y91A 3H9OA 2CNVA 3FBVA 4BDDA 4CCUA 2XCKA 1YOJA 3D5WA 5HICA 5JFVA 5M08A 5BVNA 3LMHA 4R1VA 3HA6A 4I93A 2IJMA 4C8BA 3TL8A 5CAPA 4QYFA 4X3FB 2UW5A 3E7OA 3FMEA 3FPQA 5E9EA 5H8EA 3HLLA 4WRSA 3BCEA 3IO7A 5EOLA 1WFCA 4ZLOA 1GIJA 2AC3A 2UZWE 3A61A 3C0GA 3G6HA 3QKLA 4L45A 4Y72A 5FLFA 4YURA 2OXYA 3SOCA 1ZYJA 3QC4A 4CFFA 3DU8A 5HU3A 3RALA 4YMJA 1XH6A 1Q61A 5AM7A 4NJDA 4D2RA 3JR1A 3EQBA 4DBNA 3H0ZA 4FT3A 4YJPA 3JUHA 3VHEA 3GVUA 4HPUE 4MBIA 3I79A 3QQHA 3R7UA 4Q9ZA 2W1ZA 5AMNA 2A27A 2YN8A 1XBBA 3BWJA 3GQIA 5DG5A 1K3AA 4X2GA 3R22A 1W98A 2C0OA 2PVJA 4QRCA 2YDKA 1JWHA 1NXKA 3TUBA 1NT2A 2YDJA 3QL8A 2PL0A 4NIFA 3ELJA 2ERKA 3NDMA 4MBLA 1G8AA 4U79A 1OIRA 4ACHA 3M2WA 3QWJA 2R3IA 5LMBA 4YNOA 3PZHA 3TZ7A 2B9FA 3NUPA 1G3NA 2VTNA 3R63A 3F7ZA 4TWOA 1J1CA 1SZMA 1Q8TA 1JVPP 4RGJA 3RGFA 5CSVA 4EC9A 2XNNA 2HZ0A 5DT3A 4WG5A 1PMUA 3DB8A 2VTRA 5IU2A 3PXKA 4IX6A 5LMAA 1YI3A 2Y6OA 4BCPA 5FEQA 4GFMA 5LMKC 2WTIA 3DXNA 3E8EA 5HCZA 4JG7A 2HXLA 2VO3A 4AW5A 3ZBFA 4CKIA 4ZY6A 1DAYA 3LFQA 4U6RA 4CT2A 1ZOEA 5C8KA 2R7IA 3DLSA 5ANIA 5I9YA 4CG9A 3OTUA 3DLZA 1NVQA 4O0VA 4XG8A 4L6QA 2XM8A 2XNMA 4N70A 4G9RA 2WFYA 3DGKA 3IPHA 4QMSA 4WOVA 3Q96A 1MRVA 5IF1A 4FTQA 3PJCA 4A4OA 2JBOA 5HLWA 2ZV7A 5JFSA 4YPDA 4A9SA 4BZDA 3TUDA 2C5XA 4BIBA 3HVCA 3GP0A 3MS9A 2VX3A 5FG8A 1OIUA 3VBYA 4BDHA 4BBFA 3TJCA 4USEA 3Q6WA 4J8MA 4ZZOA 4H3QA 2ZV2A 3WF6A 3MTFA 1WBVA 4WA9A 3RCJA 2F49A 4AZSA 4IWDA 5ANJA 4RJ8A 4ASDA 3VBTA 5AX3A 2EXEA 3NX8A 5CNOA 1EH4A 4P2KA 1XJDA 2G2HA 3HRFA 4D4SA 2C5NA 4IFCA 2HIWA 2WQEA 3FQHA 3GQLA 3CD8A 3DQXA 4R7HA 4XOZA 3RK9A 4QTBA 2HOGA 4TYHA 2JDOA 4C7TA 3NUUA 2BR1A 3ZC6A 3NNWA 3ANRA 3V8SA 5JKGA 3FMLA 2Z7RA 4J53A 5JZJA 3F5PA 1SYKA 1M7QA 1H28A 3NYOA 1PMEA 3RHXA 4B8MA 1KSWA 4ZLYA 2X2KA 2VTHA 3OF0A 5D12A 4W4WA 2PVYA 4EH2A 4RJ7A 4MK0A 3D5UA 5DOSA 2RSVA 4W9XA 1PMVA 4X2NA 4DFNA 4LM5A 4AU8A 4FZDB 2W5AA 3TNIA 4D1ZA 3KK9A 5EKNA 1DM2A 4D0WA 1PXLA 5E92A 4PL4A 4PNKA 5CVFA 3ID6C 3HMIA 5DBXA 5JQ5A 3DXQA 4I6QA 4WSQA 3RCDA 2Z8CA 3O8TA 3BYUA 4Z16A 4IDTA 4OT6A 3LFSA 5EYDA 3QTUA 4ZK5A 5ANGA 2UW0A 2GFSA 3NSZA 3HA8A 4IZ5A 4OTGA 3MDYA 4AN2A 3EYHA 1YDRE 5FEEA 2X2LA 4LUDA 2OI4X 4C35A 5LVNA 4BGGA 4QP3A 2O8YA 1REJA 1Q99A 4JT3A 4PDSA 2QOOA 2YZAA 3UJGA 4UX9A 5IMEA 1YWRA 4XBUA 4I92A 4K1BA 5D11A 1OKZA 3CP9A 5AP7A 2VWWA 3QCXA 2X4ZA 3DKCA 4G3FA 2PZ5A 2QR8A 4D9UA 3NIZA 4JDHA 5AM6A 1G8SA 5HG8A 4EH9A 4HZSA 4XV9A 4DTBA 3LLAA 2E9OA 2OIQA 3H3CA 5HNGA 4FK6A 2BCJA 3O7LB 1W0XC 4R8QA 4BCIA 2YACA 3EB0A 3PY0A 5FM3A 1RQQA 4MYGA 1JBPE 1FGKA 2UUEA 5GHVA 5JQ8A 3E8DA 1OIYA 3VVHA 4DLIA 3TXOA 4XV1A 3CCNA 4QQTA 5C03A 4H1JA 1JKTA 3OOGA 3HMNA 3OCSA 4ANNA 3IOPA 4L7SA 4MF0A 5M4CA 2PUNA 3DXPA 4YZBA 4YLKA 4EZ5A 2JDVA 5HE3A 4E93A 4NWMA 4O0TA 2B1PA 3C4CA 3OXIA 4GYGA 2B53A 3QXOA 3BHHA 2VTMA 4BTJA 3C5UA 3GOKA 5LCKA 4I5CA 2QO7A 5CF8A 3U9CA 2HW6A 2JITA 3ZRKA 1OL1A 3ATTA 2UZTA 4NTSA 1OB3A 3PRIA 4UZDA 3UQCA 5D10A 2F7XE 3JPVA 4Y46A 2A1AB 5TE0A 4FTRA 4M66A 4UB7A 4F65A 5CALA 4ERWA 2YA9A 2IVVA 3HV5A 4YLLA 3LXKA 4R3PA 4F6UA 1H00A 2XBAA 3CY2A 3P08A 3E63A 2WTWA 5LXMA 2R5TA 3UPZA 3FMMA 5CWZA 4FK3A 3G9NA 2XKFA 4QP2A 4FNXA 2JGZA 3RPOA 4FR4A 3KKVA 4GFGA 4PWNA 4I6FA 1GZ8A 2GQGA 5F1ZA 4BB4A 3CEKA 3K3IA 1KE6A 3NLBA 2BDWA 3SD0A 2NRUA 1U46A 5BVOA 3DNEA 5DRDA 4MAOA 5AV0A 4F1TA 4RVTA 4CSVA 1W84A 2QKWB 4DGMA 4W4XA 4FSYA 3GENA 5L8KA 4FF8A 2X9FA 5C8NA 3W16A 2FSOX 2QO9A 3PPJA 4OTHA 2QOBA 4DEAA 2UZDA 2J51A 3F3ZA 4ZTMA 5HVYA 2FSTX 5KE0A 5F20A 4E4NA 4BZNA 3QKKA 4Z7GA 5GJFA 2OJGA 3PXYA 2PMLX 4Z55A 2PUIA 3VS0A 2IW6A 3FXZA 5CAQA 3HV7A 3ORNA 4AW0A 4II5A 3LCDA 2CKQA 4RX8A 3LFCA 2VTOA 1NVSA 3AXWA 3KVXA 3ZZEA 4YO4A 5CU0A 5L2TA 4ZXTA 3I7BA 4RZVA 1H4LA 3TDWA 4TPTA 3CTJA 4EHVA 5CAOA 2I0HA 4XLVA 3ZBXA 2GNIA 3OY3A 1OKVA 5JGBA 5KCVA 4L44A 3MY0A 3HYHA 4WD5A 4C4FA 2UW6A 3IGOA 3OEZA 4RFYA 4DTAA 4Q5EA 2YM4A 5HVKA 1PXKA 5JFWA 4DCEA 4P4CA 3LQ5A 4BHNA 2XB7A 1A06A 2BIKB 1GNGA 4YPSA 5AR8A 3U6IA 4MH7A 3ZM9A 4DEEA 4QNAA 2OF2A 4X3FC
chains in the Genus database with same CATH superfamily
3PFQA 4CYIA 3OWPA 4O0XA 3UPXA 4IXPA 4BI2A 4AAAA 1I44A 1J3HA 1S9JA 2R3OA 5D9HA 4D5KA 2X9EA 3KMWA 3Q2JA 4MXAA 2BAQA 3AC4A 2VRXA 3Q52A 4J99A 3VIDA 1Q4LA 3C5IA 1LUFA 4J52A 4EH7A 4QNYA 3ANQA 5B2LA 1Q3DA 1KUTA 4FKTA 3UMXA 2BMCA 2W1DA 3RHKA 3SXSA 1OITA 2OFUA 2BZKB 3RWPA 5E8TA 4MTAA 4ZP5A 5G6VA 4LL0A 5CEIA 1PXPA 2OIDA 3HRBA 5M07A 4LV5A 1XH7A 4BIEA 4ZSAA 1FBNA 5AV3A 4XS2A 4DFZE 3F7WA 3CKXA 3N9XA 4RIYB 3FC1X 5CQWA 1YXTA 1XMMA 3LMIA 3IW7A 5FEDA 4QEBA 4TRLA 2XNEA 3UVRA 4IANA 1FINA 5J8IA 4GT4A 2R0IA 4XOYA 3PJ2A 1UKHA 4QMZA 3AGMA 3PZEA 3R21A 4DH8A 2SRCA 4YJTA 2W1HA 4NCTC 5ETIA 4IIRA 1ZAOA 5C8MA 4EH8A 2X0OA 2R3PA 2YITA 3RTPA 4ITIA 4RLKA 1GIIA 4OGRA 1V0PA 4O1OA 3BLHA 4PUZA 5DR9A 3ROYA 2Y8OA 3ODZX 4C4IA 1XH4A 4FT9A 4KRCA 2QOKA 4YTCA 4BKZA 3E5AA 3IGGA 1OPLA 3R1NA 4C3RA 4DEHA 2B9JA 4L52A 1ZARA 3NRMA 3UE4A 4AGCA 2VTSA 4DYMA 4EZ3A 4F9BA 2ETKA 4L01A 4A4XA 2DQ7X 4BCHA 2ZAZA 3G0EA 4R1YA 3QUEA 1TQIA 3BBTB 2XK9A 1GZOA 5H3QA 3RKBA 2PHKA 3CGFA 4QTDA 4HCTA 3BU6A 4QTAA 3HGKA 4AA4A 1RDQE 2NPQA 4S30A 4CD0A 2XH5A 2WGJA 3W18A 4A4LA 4Y5HA 4RX7A 5CTPA 4FTOA 4BYJA 2C69A 3ALOA 4YJRA 4NYEA 3SHEA 5CANA 3D2IA 3E3PA 2XVDA 1H25A 3C4XA 3A7FA 4JL9A 4TNBA 2OLCA 3VONA 1OI9A 3I0OA 2I0EA 4WNOA 3QQLA 4QMLA 4NL0A 3FZOA 4E6DA 3P78A 4ANLA 3PY1A 4OT5A 4F09A 2GNFA 1IR3A 3EZVA 4LV7A 3Q53A 3UOJA 2CKPA 3S2PA 3RAIA 3GB2A 2EUFB 4WUAA 5E91A 1YXSA 3CXWA 4RT7A 4IAKA 3R02A 4BVUA 3UNKA 4NH1A 4DLJA 3BWFA 1PXNA 2GU8A 2VU3A 3GOPA 5HBEA 2LAVA 3QTRA 1VR2A 4FKRA 4BFMA 4PMPA 2XRUA 4NTTA 3MBLA 2UZNA 3VW6A 4EK6A 2PVRA 4U8ZA 3K3JA 3W1FA 3NVMB 3QFVA 2ZVAA 4AF3A 4O4EA 2YIRA 5LWNA 5JRSA 3DJ7A 4YZNA 1ZYLA 3MI9A 4FZ6A 2ZJWA 3UZTA 5T6KA 3M1SA 3DTWA 2PVNA 4YBJA 4B7TA 1UWJA 4ACGA 5L2WA 4FL2A 1QPDA 2CPKE 4JX3A 3BRBA 4FV6A 4WNMA 5D1JA 5F95A 4EOKA 4GSBA 2Q83A 3FY2A 4IVBA 1OBDA 1J91A 3WI6A 5KBRA 3W2SA 3OXZA 3ZFYA 2BKZA 3F61A 5C26A 3RAHA 3HNGA 3ORIA 4OBOA 4EOSA 1ND4A 5JMSA 1YRPA 3FMKA 2BZJA 2X8EA 5M4UA 2OJFE 5HTIA 3QCSA 4NIFB 4E4XA 2VGOA 3EMGA 3LXPA 3L9MA 2GNGA 2JIUA 3LOKA 4XEYA 4A7CA 1K2PA 2F4JA 4YZDA 1HCKA 2C5YA 3I5ZA 1CKIA 3U4WA 3QU0A 3VUGA 3R83A 4DG3E 2WTVA 3NAXA 4F70A 4ZS4A 3LJ1A 1T46A 2XEZA 3ULIA 3UYTA 3WZJA 4D0XA 3IDBA 3N4VA 2PMIA 4N4SA 1VLRA 2ITZA 3VRZA 3IK3A 4BCOA 2CNQA 3D7TB 3GC7A 3EH9A 3TV6A 4ANMA 4ZTHA 4FI1A 3UC4A 4UWYA 2UZVA 3WF9A 4DEDA 3BZ3A 1WVWA 4H58A 5JH6A 3QTZA 4IZAA 3R7VA 3AT4A 4GJ3A 1UNGA 2W4JA 4WNPA 2E2BA 3P9JA 2CJMA 4L3LA 2ZOQA 1VYWA 3WZEA 4JR3A 4UMRA 2Y7JA 5HCYA 1J7UA 5J1VA 4RPVA 5AAEA 5AAGA 4RZWA 4N0SA 2PSQA 2OZAA 5HVJA 5KMNA 3I4BA 2REIA 2DYLA 2X7OA 5KNJA 3ZUTA 4G17A 2VTLA 3LFAA 5HCXA 3COHA 4BHZA 3HEGA 3CLYA 1QMZA 4IWQA 4MXYA 4UMQA 4R7IA 3HRCA 1SNXA 3DZOA 4ANQA 5DFPA 3FHRA 3DBEA 1WBSA 2OKRA 4CXAA 2WTCA 2WAJA 4XV3A 2FO0A 4DF3A 2CMWA 3PSBA 4QPSA 1ZWSA 5LVMA 3HAVA 1TKIA 4IM3A 3UDZA 2ZYBA 1BI7A 1ZOHA 3OWJA 4ZTRA 4FBXA 3ZCLA 4AZWA 4C02A 3MJ2A 5H8BA 3F3UA 4DBXA 3HX4A 2C6MA 5IQIA 5EHYA 4F99A 1XBCA 3PLSA 4FSRA 4QPAA 4EH6A 3IQ7A 2P3GX 2WXVA 3UOKA 4EKKA 5BPYA 5J5SA 2X2MA 2P2IA 4PDPA 1O6YA 4LDTA 3OP5A 4BDFA 3PA3A 2R3QA 4DGLC 4B99A 4GMYA 5A6NA 4BCGA 4J95A 4BI1A 1VEBA 4I6BA 1R39A 2QO2A 4O22A 5GNKA 5TO8A 1YW2A 5AUUA 2J50A 2Y9QA 2WMUA 3DKOA 3KCKA 3IW4A 5HQ0A 4NW5A 3CPCA 2HENA 2VTQA 4FG7A 4R7BA 3MIAA 3AD6A 2QOQA 3FPMA 5K0KA 4FYNA 4K33A 3PFYA 4I20A 4GL9A 3MY1A 4FKVA 4HOKA 2ETRA 5DT0A 1Q62A 3OY1A 1XMLA 2V62A 3F88A 4JG6A 4KIPA 4KB8A 4B4LA 2VNWA 4BKJA 4E4MA 4JG8A 3VN9A 4TYIA 5IKWA 2EU9A 3DNDA 3LCOA 4UY9A 3E87A 3BYVA 4XBRA 2GTMA 2XK4A 4AFJA 3TUCA 5HEZA 3LM0A 1JQHA 4HJOA 2B0QA 3QYWA 3PVWA 5CSHA 3EFLA 5TF9A 4FSTA 1TQPA 4ZSGA 4KNBA 3AC1A 4FG9A 5KMKA 2V0DA 3ZO3A 4EOPA 3PJ3A 5J9LA 3ZFMA 1U59A 4KAOA 4M0ZA 2A4LA 4XUFA 5HI2A 5AP6A 4QMOA 5GJGA 1Y6AA 2PY3A 3M42A 1OL6A 3UYSA 2WPAA 3W33A 2ZV8A 4D58A 5HD4A 3UOLA 4AN3A 4FEUA 3PVUA 3Q2MA 4TYEA 2G1TA 3I81A 5FBOA 4JBPA 4X6QC 3KXNA 4ZEGA 3QTXA 2CDZA 2VAGA 4YZ9A 3UZPA 3FHIA 5K9IA 1SVEA 5CEPA 3DK6A 1CDKA 3ORKA 5LVPA 3AC5A 3DZQA 3AMYA 3ZDIA 4L68A 2OICA 4JIKA 5EI6A 3UIUA 3D5XA 3Q4TA 1H0VA 4FKSA 3W0OA 4YJUA 3SX9A 2OIBA 2Q0BA 3W2PA 3WOWA 2Z2WA 1G5SA 3FLSA 4NKAA 2V7OA 5AADA 3AMAA 5GZ8A 2ESMA 1JSTA 2H6DA 2XJ0A 3F5XA 3ZMMA 3CC6A 3P7BA 5FD2A 3R9DA 3MFSA 4BJJB 2V55A 5AEPA 3TDVA 3A8XA 5GINE 4I21A 5CYIA 4CTBA 2WMAA 2BRBA 4UALA 4O0WA 2HW7A 3LZBA 5C01A 3SLSA 3C4ZA 4BGHA 2JBPA 5ACBC 4IWOA 4FTAA 3BLAA 3D94A 1NA7A 2J5EA 5IQDA 3NUSA 4BL1A 3EQRA 4EC8A 3ATSA 3NZ0A 5L6OA 3PUFC 2ZV9A 3QZIA 3UNZA 3ENHA 5BNJA 3FZTA 3P7AA 3N4TA 3V6SA 5AA8A 4LUEA 4H3PA 4WIHA 4BBEA 3W0PA 2F7EE 5E8SA 4U9AA 4O0UA 3C13A 3QQJA 3UVPA 1L8TA 4E20A 1QCFA 5AUVA 5E4HA 2OO8X 4AQCA 3NUNA 1JSUA 3AOXA 4ACDA 4CCBA 2HELA 2OW3A 2PMNX 1M2RA 3DJ6A 3KCFA 4RIWB 4M8TA 1DAWA 4PPCA 5FTGA 4M7IA 1Y8GA 2ONLA 3AD5A 3QTWA 3RK7A 5J7HA 5IDPA 2JD5A 1W82A 3QA8A 3E8NA 3R7GA 3HMPA 4GUEA 5L2IA 4C2WA 2PZIA 4V01A 2J90A 2VX1A 4P5QA 2OJJA 4MXOA 4CFMA 4O81A 3EKNA 3HV3A 1R0EA 1R1WA 4FOBA 3OTVA 3UVQA 1YWVA 4E7WA 3R1YA 4FG8A 4F1MA 5DPVA 1WBOA 3QHRA 2Q0NA 2XA4A 5I3OA 2WQBA 4HVDA 4I1ZA 3TZ9A 3NYXA 5IA0A 5EI2A 3NWWA 3QXPA 5K5XA 2VWIA 2BTRA 5FXQA 4L46A 4DA5A 1BL7A 4AOIA 1PXOA 5CU6A 5FQDC 2PYWA 3NMUF 4ONAA 2YJSA 1SNUA 3R7YA 1JOWB 5AV2A 3UO4A 4AZVA 2OGVA 3H4JA 5KUPA 3JXWA 2W1GA 3ZOSA 1MRUA 3OUNB 4FEVA 3QGYA 3QHWA 4OTQA 4KS8A 2QD9A 5AR4A 4HVHA 3V5JA 4IADA 5CXZA 3ZEWA 3I0QA 4MXCA 3BIZA 4FEXA 4FL1A 4FODA 2GFCA 3F3WA 4GG5A 2UW7A 2VO0A 2ITOA 2ZB1A 4BCNA 4EEVA 4O7LA 3DKGA 4V0GA 4BDEA 4X2JA 3SGCA 5EQYA 3OCBA 2GNLA 3D2KA 3OOMA 3QRIA 4LRMA 5IUIA 2QOCA 4ZMEA 4FV0A 4TWPA 4GV1A 3RAWA 1U4DA 3BL9A 4U7ZA 3F5GA 4ZJIA 1M14A 3HP2A 3D0EA 4GW8A 4NZWB 2ZM3A 4PTCA 1LPUA 4YP8A 3VS7A 3KULA 3R30A 5JSMA 1MUOA 3R0TA 3RWQA 4USFA 1WBPA 5L8JA 4ACCA 4BZOA 1Z5MA 2W1IA 3LMGA 5AR5A 3ZXZA 3BE9A 2X4FA 3FSFA 1Q8UA 3MVHA 4FTMA 3Q60A 5GZ9A 4FA2A 2W4OA 2Z7SA 3TIYA 4D2TA 5CEOA 4Q9SA 2Y4PA 5HX8A 4QMQA 2C3LA 3P7CA 1NVRA 3TNPC 2YCQA 4MCVA 4C4JA 3A7HA 4G31A 2XNOA 3DAKA 3C4WA 4YO6A 1BUHA 5HO8A 3REPA 2BROA 4QYGA 3ZTXA 2PUPA 3MESA 4RX9A 2P4IA 2WU7A 4H1MA 4JRNA 4UYNA 1NW1A 4GVAA 5HIDA 5L2QA 3EN7A 3KN5A 3LCKA 1J7IA 4G6NA 2DS1A 4XJ0A 3GU7A 4IB5A 3PSCA 1PXIA 2I0VA 5HBHA 4AUAA 4APCA 5EYCA 4X0MA 3FKOA 3W2RA 1BMKA 3AQVA 3D5VA 2R3MA 2UZBA 4NSTA 1KE7A 3MVLA 4FSWA 3SXRA 2OK1A 3V04A 2E9UA 2B9HA 2KTYA 5M53A 4CMTA 3W55A 3PDTA 1CKJA 2JIIA 3F2RA 4AG8A 5IG1A 4L9IA 4TY1A 4QOXA 3F5UA 2WOTA 5ANEA 3HL7A 4LV8A 4BRXA 4D5HA 4IH8A 2BILB 5A4TA 3QCQA 4O7SA 2YJRA 4BCKA 5L2SA 2C6KA 3MWUA 4HZRA 3DV3A 5AUYA 3BU3A 3QAME 4JI9A 4TWNA 4FKWA 4D28A 1OIQA 1PF8A 2BUJA 4JRVA 4YTIA 1FGIA 4EOQA 1M52A 3KXZA 5JN2A 2VO6A 2PK9A 4D1XA 2QCSA 4Y73A 4F6SA 5IISA 1YDSE 5J9ZA 4IB1A 5LARA 2EXMA 3OS3A 3T9TA 3VS3A 4HVSA 3NGAA 3KF7A 3GXLA 4EH3A 4J8NA 4K2RA 5F94A 3QYZA 3SG8A 4AXDA 4O7RA 5K0XA 2WMXA 2C6EA 3QRUA 5IQCA 3F9NA 5HBJA 3BX5A 2XKDA 3RMFA 5IZFA 3MA6A 2IF8A 4N57A 4DDIA 4ZTQA 1H01A 2XIZA 4G6LA 5HHWA 2CN5A 2JAMA 4FIFA 4FKLA 3DCVA 3VBVA 4WUNA 5CVGA 5BYZA 2VTPA 2C0IA 4UBAA 2WHBA 2Y4IB 2BVAA 2OXDA 1IEPA 2RKUA 3DTCA 3PXRA 4HYUA 4U80A 3GCUA 4E5BA 2DUVA 3GC0A 3V8WA 4W9WA 2J6MA 3ZS5A 4BDBA 1PYXA 3TV7A 4E26A 3R9OA 1IAJA 4HCVA 3FDNA 3DAJA 3NNVA 2LGCA 2WMTA 3GFEA 3TZ8A 5CF5A 4FTIA 3VC4A 2HZ4A 3QC9A 1PXMA 4FV9A 2CCHA 4O4BB 2XNBA 2IZTA 3G5DA 4MWIA 4X2FA 4QMUA 3VULA 1TFFA 3FY0A 3KQ7A 3GGFA 3O96A 4M3QA 4L43A 4LI5A 3FEGA 5KMIA 4U3YA 3EQFA 4IC8A 5T68A 3RZFA 4EORA 5A4CA 3Q4CA 2X1NA 4PP9A 3BV3A 4I4EA 5EM6A 4EK3A 5AP5A 3A4PA 4JQ8A 4RJ4A 3U9NA 2IVUA 2YCSA 3E3BX 1RJBA 3CGOA 3FMNA 3QTIA 4BI0A 2RG6A 5EQPA 3DFCB 3BL7A 2A98A 2H8HA 3FLYA 3JYAA 3QZFA 4S34A 4QYYA 4HGSA 4R3CA 4FEQA 2NO3A 4EBVA 2FSLX 5E7RA 4XG3A 4BDGA 5M51A 3VS6A 4DEBA 5AIRA 5CEQA 4G34A 1T45A 4DFBA 5M55A 5LVOA 3NNXA 4EL9A 5IQHA 4J1RA 4EOJA 1PKDA 4IMYA 4QMMA 3HV4A 3OZ6A 4D1SA 2J0KA 1IA8A 1XQZA 3UBDA 1YXUA 3ORTA 4GH2A 3FLQA 4UXQA 4YJOA 2AQXA 2IN6A 4OAVB 2QU5A 2GNJA 4AOJA 3MFUA 3SDJA 1YHVA 3M11A 5AP1A 1H1WA 2WO6A 4RIXA 3U4UA 5HNIX 3UC3A 4O7WA 2V22A 2HY0A 5CU2A 3Q9YA 5AR3A 1PKGA 4DFYA 4HGEA 4ALWA 3G90X 3PG1A 3MB6A 3V5TA 4BDAA 5CEKA 3JVRA 3GCQA 4KSPA 5GIPE 5EM5A 5J9YA 2CHLA 2J7TA 2P33A 2WTKB 1MP8A 2W0JA 4YJNA 3FZ1A 4F0FA 1Z57A 5JEBA 3UP7A 4J96A 4YTHA 4AWIA 4E73A 2JAVA 1JKKA 3VW8A 4U81A 3BGQA 4Y95A 5KX8A 4I6HA 2WQMA 3CE3A 3LFDA 4EH5A 4U41A 3TI1A 4EOIA 1F5QA 4I0RA 3C4EA 2ITPA 2XIKA 3HDNA 4LRKA 4TKSA 3D14A 3TIZA 3PWYA 5AWMA 2JKQA 2YCRA 2Y0AA 4FT5A 2C1BA 3BELA 5M09A 3HUBA 4OUCA 4NFMA 3O8UA 4C62A 5J95A 3LXNA 3V6RA 3DS6A 5CVHA 2ETMA 4L3JA 5ANOA 4HVGA 4M69A 3LQ8A 4IAIA 4MNEA 3FC2A 3O23A 3OWLA 4LL5A 5AUTA 4CG8A 5EM7A 5CNNA 2UW4A 3VJOA 4ASZA 1SMHA 1E9HA 1JLUE 3F66A 2C6IA 3VJNA 3CIKA 2JDSA 2YEXA 3UDTA 1B39A 4D9TA 4R77A 1YDTE 2VGPA 3COIA 1ERKA 4N6YA 5CAUA 2YLEA 4JAIA 1UKIA 2ITXA 2HXQA 2PPQA 4F7SA 2XKCA 3EQGA 2X8DA 4AS0A 4X2KA 4DH5A 3VUHA 1ZXEA 2PZYA 4WBBB 3CPBA 1KWPA 2IZRA 3QX2A 4QTCA 3S00A 4U45A 5HU9A 3A62A 5A54A 2C5OA 3I5NA 4AGUA 4YJSA 4YU2A 3FXXA 1BYGA 3ZO1A 1KE8A 3QX4A 4Y83A 4UV0A 3E62A 4I24A 2GQRA 3Q32A 4G3EA 5TR6A 5D41A 4UN0C 3PIYA 1YI4A 1MQ4A 3LFFA 5CZIA 1WBTA 4F7JA 1MQBA 3ORPA 4MWHA 5HKMA 1AD5A 5T3QA 1WVXA 4IM2A 2Y6MA 4IAAA 3VUKA 4TTHB 4HYIA 3CY3A 4WHZA 2Z7QA 4KIQA 5LWMA 1YI6A 5G1XA 1XH9A 2UZOA 4RFMA 4FSQA 4YHJA 2G2IA 4ZTNA 4E6CA 2G15A 3A7JA 1G8JA 1JKLA 1PMNA 4RWKA 3UIXA 2CSNA 2A2AA 2WNTA 5CY3A 5AV4A 5IA2A 4PTEA 2B52A 2FB8A 2GPHA 4L53A 1YVJA 4CV9A 3VUTA 3LW0A 1F0QA 5LJJA 2IW9A 2C47A 3KF4A 4DCAA 3PVBA 4M14A 3L8VA 3C0HA 4BCQA 1H08A 4EONA 4FKOA 1YXXA 5IPJA 4N6ZA 4Y5QA 5BYYA 2ZM4A 3I1AA 4AACA 5KMLA 1FVTA 3KB7A 4FSMA 4J98A 4O4CA 4IX5A 3ET7A 4NT4A 3V5LA 4D2VA 4NU1A 4ACMA 1ZOGA 1YXVA 2F9GA 1U5QA 4YJVA 2IO6A 4Y8DA 3KRWA 5KHXA 4A9RA 2WIHA 3O51A 2YIXA 4RIOA 3ORLA 4F63A 3RM7A 4O7NA 2J0IA 4YHTA 4JMQA 3WILA 1LR4A 4I6LA 2GHLA 4JX7A 2X6DA 4QD6A 2X81A 3D15A 2IW8A 3MY5A 3K54A 3R2BA 5FTOA 2HZNA 3GFWA 1ZZLA 4YC6A 4OLIA 2FVDA 4DEGA 3A60A 1PHKA 4PMTA 2UW3A 4BDIA 1Q8YA 2C5VA 2W1FA 2XARA 5CX9A 5AFVA 4DC2A 3R9HA 3ZC5A 4L42A 2BRGA 4DFLA 3VQUA 2PVKA 1F3MC 2YIYA 4RA4A 5KO1A 3PPZA 3R04A 5F4NA 5H2UA 2W1EA 2V5QA 4RQKA 3V3VA 5M57A 4CV8A 3POOA 3FQEA 1WVYA 4PF4A 5DI1A 5FP6A 3W2OA 4C4HA 4G9CA 4H36A 4KS7A 1H27A 3R8PA 4CZTA 3AD4A 4DFXE 5IA1A 2BKKA 1CKPA 4NEUA 1JPAA 2QR7A 4D2SA 3OROA 2BFYA 1YHSA 5L6WL 2R64A 2WMBA 4KIKB 5FUTA 3DT1A 4GYIA 2J4ZA 3MPAA 2PE0A 4S33A 3VUIA 2BPMA 3PXQA 2RFDA 2XALA 3CQUA 3PYYA 5EW9A 3EL7A 2BHHA 2GDOA 3HV6A 4JDIA 4M68A 5B2MA 5A6OA 2OJIA 2WMQA 4QQCA 3QQKA 1JKSA 2HZIA 4FVPA 3R8ZA 2BALA 1DI9A 4FVQA 4ZOGA 3CS9A 2PTKA 4RJ5A 1JAMA 3PXZA 4E6QA 1OVEA 4FTUA 3T3VA 3NPCA 4QYEA 4A9YA 5M06A 4FICA 2OFVA 5K4JA 4K6ZA 3UOHA 4HYHA 2VTAA 3HMOA 5I9VA 2XIRA 3QZGA 2VNYA 4C59A 3OEFX 4B8LA 3LFBA 2BRNA 2Y4IC 1I09A 2E9NA 4O0RA 2YERA 2HK5A 4AT5A 4F9CA 1OL5A 5IQEA 1ZMVA 3R7OA 3U6JA 3B8RA 4M0YA 3Q5ZA 4JBVA 5M44A 3A8WA 3IOKA 5AIKA 5HO6A 4K0YA 5GJDA 3EFKA 3SW4A 1ZZ2A 2VTIA 4M12A 4Q2AA 3WARA 4P5ZA 3GCVA 3TT0A 3MIYA 4O82A 2XK3A 1QL6A 5CI6A 3DFAA 5LOHA 3PPKA 4WG3A 2J2IB 3L8XA 2NRYA 4I94A 4YZMA 3ZSGA 2UVYA 4FC0A 3E93A 1YQJA 2WKMA 4CGAA 4LGHA 5M56A 3KN6A 3Q9XA 4V05A 5BUEA 3S3IA 3BBWA 4QP9A 5CQUA 5DRBA 2JKOA 2ZMDA 3TKHA 5KMOA 1YWNA 2BRHA 1ZY5A 5CENA 4MNFA 4X6RA 2CGVA 4C33A 4AZFA 1GOLA 5EYMA 1R3CA 2XZSA 3SKCA 3BLQA 2BRMA 4CMOA 2W9ZB 5H9BA 3GCPA 4IX3A 4QMXA 3S4QA 3OVVA 2R3GA 2W7XA 3ACKA 3QD0A 5LVLA 3WZKA 4PY1A 3NVKI 3GU4A 3PE2A 1W2FA 4CLIA 3NUAA 1KE5A 2W05A 4U97A 5AP2A 5I9ZA 1UA2A 4QP7A 3FWQA 4NM7A 4HYSA 4CZYB 3NFFB 2FH9A 2YM5A 4AXCA 3AT2A 4MXZA 3FXWA 4EQCA 4HW7A 5FDXA 4OTIA 2JLDA 5ETFA 3KVWA 1G8KA 2OXXA 2UZEA 4MKCA 4O0SA 4BBMA 5KMMA 3UZRA 1BLXA 3BYOA 3I6UA 3N4UA 3W0MA 3KXXA 5J1WA 4ITJA 4DT9A 1UNHA 1Q8WA 5HZNA 3TZMA 4L00A 4ORKA 3KK8A 4K8AA 3BHYA 1NY3A 2CGUA 3OHTA 1S9IA 3FL4A 2WMSA 4G2FA 4R5SA 4TYHB 1W2DA 3ZONA 4PP7A 3UMWA 2QLUA 1AQ1A 3DBFA 2WTKC 2XCHA 3DDQA 3AC2A 2A0CX 4EYMA 3UNJA 3LJ2A 3RVGA 3PA4A 3OCGA 4D2WA 2JC6A 3R7EA 5AP0A 4J71A 4AGWA 4I5MA 2J0MB 4KA3A 4RWIA 4XP0A 3WE8A 3LAUA 2GMXA 1UU3A 1W83A 1PRYA 5IH5A 3H10A 4F4PA 4APPA 3EN4A 1ZY4A 2OU7A 4OBPA 4S2ZA 3T9IA 2OJ9A 4ZS0A 1KV1A 2UV2A 3SRVA 4H05A 3RPYA 1UU9A 4YSMA 3VAPA 1OUYA 1V0OA 4L7FA 4ZTLA 3UODA 5CASA 3MFRA 4QMNA 4LGGA 3KXHA 3TJDA 5BV3A 2IWIA 4FTKA 2R2PA 3PJ1A 3BQCA 4XG9A 1H1RA 2UVZA 4FE2A 2V7AA 5EW8A 2CKEA 3EN9A 1M2PA 5CLPA 3S95A 5HTBA 3RAKA 4AGDA 4U3ZA 3LCTA 1P4OA 1UU7A 2XS0A 2RGPA 4OTFA 3OBGA 5HNBA 4ZIMA 3V5PA 4BC6A 4F9YA 4MQ2A 2VX0A 4ZLZA 4YGAA 3A4OX 3FL5A 3EJ1A 5EDQA 2R3HA 5JK3A 1FPUA 2I1MA 4QQJA 4GK2A 2X6EA 4TN6A 3P1AA 5IUHA 2P2HA 3BYMA 4X3JA 2QOHA 3IKAA 4AT3A 5FGKA 4I0SA 3MTLA 3G9LX 2PE1A 2ZDTA 4IE9A 2C6TA 2VZ6A 2OH4A 2R3RA 4G3DA 4G3GA 4I4FA 4IACA 4U5JA 5E8ZA 4CFUA 5I5ZA 5IA4A 2UZUE 3A7GA 1ZMUA 4U43A 4QTEA 3VNTA 3PIZA 2XK7A 4JR7A 1APME 3IW6A 2CGWA 3R8UA 5EFQA 3LLTA 3ZYAA 4WKQA 2J5FA 3E8CA 5AP3A 4E6AA 2O63A 3C9WA 1XH5A 2CNUA 4ALUA 4F6WA 4DTKA 4RIYA 3SOAA 3U87A 3RPSA 1IA9A 5A46A 1TVOA 3Q6UA 2AYPA 2JKKA 3ORXA 4C58A 2XKEA 4DG2E 2QI8A 3VS5A 1JSVA 1Z9XA 3UTOA 2CLXA 3E92A 4GKIA 2C6DA 1Y8YA 1WBNA 3OMVA 2GTNA 3PA5A 4IBMA 5CXHA 4DINA 4XRLA 5AV1A 3RPRA 2A19B 2B54A 3BEGA 3DA6A 3KMUA 5B2KA 5AR2A 1PXJA 3KREA 2H34A 3GU8A 5IDNA 3ERKA 4HNFA 5H8GA 4TL0A 3EOCA 3CTQA 3DY7A 2OG8A 3HP5A 3G6GA 4RIXB 3E88A 3U54A 2QHNA 2YAAA 3KU2A 2JEDA 2ITTA 2VWVA 4BF2A 2RF9A 2NNWB 4XG6A 4IW0A 4CEGA 3C4FA 3UDBA 3TV4A 1ZYDA 4YLJA 5IA3A 2QQ7A 4ZY4A 5L6PA 1R78A 4JOAA 3R8VA 3BGPA 2FUMA 4IB0A 4D2PA 2ERZE 1H1SA 1J7LA 2JKMA 3ODYX 4C36A 4U0IA 2C6OA 3V5WA 2CCIA 4GK3A 2C4GA 4XV2A 4TNDA 5AUXA 4IC7A 1HOWA 3KMMA 3QRJA 3KRLA 4AFEA 3FI8A 3IDCA 1KOAA 3OT8A 4C4GA 4AW2A 3UP2A 4FZAB 5IH6A 2ZDUA 4RLLA 3UO5A 4H39A 1A9UA 3FSKA 4D4RA 3G0FA 4FIEA 5AR7A 2BAKA 3EFWA 2NYAA 4JDJA 4MD7E 2XYUA 3QGWA 4P7EA 4M13A 3TKIA 4EUTA 2ITNA 3Q9WA 3PLAE 2R3FA 3EYGA 3PP0A 3R1QA 4FTJA 4O91A 3RJCA 4EHEA 3WIGA 3DB6A 1ZYSA 3HZTA 3R01A 3ENMA 4CRLA 5CZHA 4CT1A 4DH1A 2GHGA 3TACA