3PXKA

Focal adhesion kinase catalytic domain in complex with pyrrolo[2,3-d]thiazole
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
273
structure length
256
Chain Sequence
YEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PTK2 protein
publication title Co-crystal Structures of FAK with an Unprecedented Pyrrolo[2,3-d]thiazole
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 256
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3pxkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3pxkA01
5HORA 4N70A 3ZM4A 2CNQA 4E3CA 2IW9A 4EHEA 4FIEA 5BVEA 4FYNA 2PE1A 1GOLA 3W32A 2R3PA 2HWPA 3EIDA 5CZIA 5LVLA 4X3FB 3R8MA 4D1ZA 4EBWA 3LAUA 4PMTA 2VTOA 4F0GA 4V01A 5BVWA 4D2WA 4YSJA 3TIYA 3WF7A 4JLCA 3WILA 4AT4A 5IDPA 2C68A 4EZ3A 2VNYA 1H24A 4CLJA 2WD1A 4ALUA 5AV0A 5DGZA 4LRMA 4CNHA 1M7QA 5DRDA 4W4WA 2BCJA 3I5ZA 4LM5A 1ATPE 4FL3A 4FVRA 4ANNA 4EC8A 4ITIA 2J5FA 4ZSLA 3VW8A 2BKKA 2OW3A 5HTIA 4CKJA 4S30A 3F3UA 1KOBA 5GJGA 4BCMA 4I3ZA 4O7TA 1VYWA 3HRFA 4MEDA 3A62A 4BFMA 3KY2A 4PDOA 4GK3A 5AM6A 5J87A 4DHFA 3FSFA 4DLJA 4DE4A 5JMSA 1BI7A 1IAJA 4FT7A 5ICPA 5CXZA 4F70A 4YURA 5K4IA 5H2UA 1M52A 4R3PA 4ZJJA 5CI7A 4XG2A 4IDTA 2V7OA 4FKLA 4PPCA 4WBBB 1CDKA 3GT8A 3KN5A 4NM3A 4USDA 3R7UA 4Z16A 1RDQE 3M2WA 3GCPA 4YP8A 2WTKC 5IQHA 3K3IA 4EH2A 1XO2B 5GINE 5E8ZA 2ETKA 4EOSA 1F5QA 1LPUA 2JLDA 4IJ9A 4BTMA 3S0OA 4V04A 3KREA 4JS8A 3ORPA 2XKCA 3QTSA 3OBJA 4NZWB 3ENMA 4XRLA 2QC6A 2F9GA 2JAVA 3LQ5A 3OTVA 2JKOA 3DAEA 4R1YA 4XRJA 2I0YA 3W2QA 4U80A 4BB4A 4E4XA 4HPTE 4WHZA 3V6SA 3UO6A 4AX8A 5H8BA 1Q8UA 3QRIA 4RT7A 4RWJA 2PU8A 3NVMB 4QO9A 3BHYA 3L9MA 3SOAA 2B0QA 1I09A 2OG8A 4QMNA 4GCJA 3REPA 3QD3A 5DR2A 3TKHA 4BDHA 1T45A 4IM0A 4ITJA 3AMAA 4NCTA 3MTFA 3COMA 4TYJA 4YJQA 1UKIA 4PDSA 5C1QB 3M42A 2BVAA 3OD6X 4N4SA 2QOQA 4IM2A 3FQHA 4I6HA 4A06A 2ITVA 2QI8A 3CTHA 3ZEPA 5AUWA 3C4ZA 2C6MA 4MBLA 5A9UA 5J5TA 4AW5A 2C3JA 3D9VA 4FEWA 3C5IA 2BTSA 4I0RA 4O96A 3MH0A 4WD5A 3R1YA 4BTKA 4FR4A 3I0QA 3RNIA 3SDJA 4NU1A 3IG7A 1MQ4A 2O8YA 3C0HA 4DF3A 5DH3A 1OKWA 4C4FA 5AEPA 3UQCA 4FSUA 4ANOA 5FXSA 2XIZA 2A27A 2X0GA 5DEWA 1OPLA 3DKOA 4A9YA 3MPAA 4AOJA 2CMWA 2DUVA 1FQ1B 2IWIA 1WBNA 2QODA 3AT4A 4ZIMA 3UP2A 1PKGA 2J0JA 5KKRC 3WIGA 3TZ7A 2ITZA 2BZJA 4IAAA 3MPTA 3ZDIA 2C0OA 1IRKA 3W2SA 3PIYA 3PJCA 5AV3A 4Y8DA 2FYSA 1U5QA 2VD5A 4CEGA 2BUJA 4JQEA 3PY3A 2YJSA 2WMWA 4X7QA 1K3AA 2JDTA 4NEUA 4M3QA 4EOPA 3NAYA 2BFYA 3I6UA 4HZRA 4EOJA 3KMUA 4D5KA 2PWLA 3MY1A 5LVMA 3G33A 2XB7A 5DIAA 2CKPA 2ITOA 1KE6A 3IQ7A 2R4BA 3R9NA 2CDZA 4DEDA 3RNYA 4BIBA 4R77A 5M55A 3TUDA 3ZLYA 2J90A 4XOYA 4EK5A 4FICA 4R1VA 4LOOA 4KBAA 2WQNA 4O0YA 1W82A 1UU9A 4KA3A 2GDOA 2PULA 5AR8A 2VX1A 4EOKA 5LOHA 3DA6A 4RG0A 4YHJA 2R0IA 5AM7A 1RW8A 5EH0A 3OUKA 4WA9A 3L8XA 4A9SA 4D4SA 5EI6A 2CNVA 2Z8CA 3QL8A 4UBAA 4O21A 3O7LB 3PXQA 3LFCA 4I94A 4U7ZA 1OBDA 3V5JA 2UW5A 3P78A 4FIIA 2OFVA 3QALE 4QYGA 2QO2A 3GC7A 4JNWA 5L2IA 2GTMA 3VO3A 3LQ8A 1YWNA 5CENA 2HK5A 5LVOA 4D55A 4HZSA 2HXQA 3I6WA 2W1CA 3AC8A 3QQJA 2JIUA 4O0SA 4AZTA 3R2YA 4DFLA 2C0TA 3W8QA 4M68A 2OZOA 3VS4A 5AP5A 3UVQA 3L9NA 4KBCA 4J71A 3FI8A 5J7HA 1ZARA 4FBXA 4FKPA 3GXLA 4L43A 4YHTA 3OZ6A 1WBWA 3AC4A 4IZAA 4PL4A 1RJBA 5EKOA 3ZUUA 3HA8A 4APCA 3VW6A 2Y7JA 3DTCA 2VTRA 5KNJA 4DCAA 4KKEA 1XBCA 4O83A 3G5DA 1SVHA 3P4KA 1NXKA 3ODZX 2XVDA 4LUEA 4YNOA 5HNGA 3G0FA 3H4JA 5CQUA 3SV0A 4PL3A 3TKUA 4IXPA 5F4NA 4M69A 4ID7A 3DDPA 2BRMA 2VRXA 4I0TA 4JBOA 1S9IA 4B0GA 1NW1A 2GHMA 4RIXB 1YXUA 1OMWA 3UNZA 5HCXA 4M13A 4YLJA 4ACDA 4GS6A 2RG6A 3EN6A 4MH7A 4MNEA 2W9FB 4UY9A 3PZHA 2ZAZA 3UIXA 3LPBA 5AX9A 1W83A 5HESA 3THBA 4QMQA 5KHXA 3R30A 4EL9A 4AU8A 2Y4IB 2BDJA 5FP6A 5E7RA 4LMUA 3QYWA 4LUDA 5CSXA 4BDEA 2C6IA 2VTQA 5IA2A 3LFSA 3QTXA 5K9IA 4EH4A 2WMVA 3NS9A 4Y85A 2G2HA 3EN4A 4Q9ZA 4G6OA 3BE2A 3TNHA 2WU7A 3BYUA 5EW3A 5CSWA 3CLYA 4F9CA 5KCVA 5EM5A 5CVHA 4OTPA 4W8EA 3QA8A 3FKNA 5IEXA 4XYFA 4F4PA 3HEGA 3VHKA 2QOBA 3HDMA 3DZQA 4ANLA 4BKZA 4P4CA 2OIQA 5TF9A 3GGFA 4ZTNA 2E9NA 3IW8A 4X21A 3QCXA 4FTTA 3SOCA 4PMSA 4C2WA 5TR6A 4NSTA 3RCJA 3NCGA 4FTAA 2CSNA 4DEIA 5H3QA 1UA2A 3C4FA 3PXFA 4OAUC 1UU3A 3KGAA 3FXZA 1BLXA 3BIZA 3C9WA 5A4LA 4B7TA 5D7VA 1GNGA 3Q3BA 2YLFA 1DAWA 4HYUA 3RM7A 5M53A 2VWYA 4YJVA 5M06A 3QWKA 2YACA 5EOLA 4FSTA 4D0WA 1YDSE 2GNJA 4KINA 5G6VA 4BI1A 2YZAA 3R00A 4WKQA 5FRIA 3S95A 2PZ5A 4BICA 3ORXA 2AUHA 4DLIA 4PP7A 4GFGA 4PMPA 3V5PA 3GU8A 4NIFA 1UNHA 2OF2A 3DXNA 3NMUF 3MFUA 3SQQA 5CVFA 2ZMCA 4A07A 5HZNA 4JQ7A 4CTCA 5IMXA 3IO7A 3W2RA 4DFXE 3TNIA 1CM8A 4U3YA 1V1KA 1W0XC 3PVUA 4RC3A 5B0XA 3AD5A 2V5QA 4KIQA 5AP1A 2X7OA 4FZFB 4IX5A 4B6LA 4ZTLA 1H4LA 1DI8A 2CN8A 3MJ1A 3QX2A 2QO9A 4PV0A 3VS7A 4ITHA 1S9JA 3S3IA 5DG5A 2UW7A 4U5JA 2YM4A 3A4PA 1Z57A 2XYUA 4JDIA 3RZBA 4ZLYA 3F88A 1JPAA 3POOA 4JIAA 4YJUA 2XNBA 1PMVA 1ZYSA 2V55A 4RX9A 2HW7A 5T6KA 3UYTA 4C7TA 4CZUA 4PDYA 4WO5A 3BGPA 5ANKA 4DN5A 3HNGA 4QYYA 3TI1A 2IZTA 2PMLX 3QKMA 3QZHA 4FKJA 4I4FA 4LL0A 4X2GA 2WMSA 3A7IA 5IZFA 2O63A 3ZC6A 4DEGA 2PVJA 3BLHA 1OL2A 4QMPA 3MJ2A 4RWKA 1BUHA 1OPKA 2V62A 3CEKA 3PPKA 2W1ZA 2XZSA 3BHVA 5GZ9A 5HG7A 5KMNA 3W18A 4RC2A 3G9NA 5BVKA 3R7GA 4RBLA 4BHNA 3A7JA 1PXJA 3C5UA 1QPEA 3DU8A 4I20A 2FSTX 5CX9A 4DT8A 3Q6WA 2JIIA 4YUQA 4YC3A 3KN6A 5AAGA 3BRBA 1PY5A 5I9WA 4AW0A 4EHGA 3MIYA 2W99B 4JX3A 3JR1A 3KC3A 2JDVA 4UV0A 4ZSGA 4ARKA 2YDKA 4D1SA 4BWKA 2ZV8A 2WU6A 2P2HA 2C3KA 4IAKA 3HECA 5AUZA 3NR9A 1NVSA 4H36A 2E9VA 3KF4A 2R0UA 4MBIA 3DK6A 5EDRA 5M4CA 5HBEA 2C6KA 4AOIA 4D0XA 2B52A 4EJ7A 4BTJA 2XNOA 1ZYLA 4JJRA 5EYKA 3SX9A 4Y95A 3H9FA 4RIYB 2UW6A 5EHLA 2UVZA 4W4VA 3NIZA 3OWKA 4BL1A 3NUPA 2W0JA 3WZUA 1CKIA 3DKGA 1OUKA 3MS9A 4TRLA 1IR3A 2WZJA 4UXQA 5AR7A 2XH5A 1YQJA 3MWUA 2HELA 4KIOA 5M44A 5G1XA 3UOKA 3FZTA 4FIFA 3W2CA 4FVPA 3VUDA 3VS3A 3IDCA 3FXWA 5I9YA 3QTIA 2QOKA 2RFSA 3F82A 4I24A 4PRJA 3T8OA 1NT2A 5E8YA 2HIWA 4PTCA 4MF0A 3NWWA 2IZUA 4FNWA 3DKCA 5T3QA 4DA5A 2RSVA 2Q83A 1KUTA 5JH6A 3D5VA 1Z5MA 3N9XA 4AS0A 1VYZA 2WO6A 4X6RA 5M4IA 3DLZA 4QMOA 1WVXA 4BBFA 3ZTXA 4X2KA 4L44A 2BAKA 4E6DA 3SHEA 4KIKA 2QR8A 4HVSA 2WIPA 2CLXA 1U54B 3CP9A 4BWPA 4TL0A 3C4CA 1KV1A 3DBDA 4FNXA 4FKGA 3VAPA 5GJFA 4DBXA 3DQWA 4EZ7A 3AQVA 5FDPA 4DTBA 3FL4A 4EK8A 5A46A 4FIHA 4QNAA 1H07A 4I6QA 4Q5HA 3FHIA 3HKOA 5IQGA 2XIKA 3P7CA 5HNBA 5JZNA 3O17A 3Q4CA 1URCA 2ZMDA 2FSLX 5AV4A 5K0KA 2VWVA 3TUCA 3ET7A 3ZMMA 3BV3A 3KVWA 5CT0A 4FGBA 5D9HA 5CF8A 1Z9XA 1JOWB 4BDJA 3UMXA 3ZC5A 2EXMA 5FQDC 4JAIA 4F6UA 4E93A 4F7NA 4QTDA 2I0VA 3VRZA 2VGOA 3KKVA 3P1AA 5ETAA 3DT1A 3F3ZA 2CPKE 4ZY4A 3MH1A 2QOLA 3OCBA 4L68A 4QTBA 2IW8A 4ACHA 1Q8TA 2R3KA 4X2NA 4U3ZA 2XIXA 3C1XA 2Y9QA 4LOPA 3LLAA 1H00A 5EYMA 2X7GA 4IQ6A 4YZDA 2A1AB 1WFCA 2OZAB 4IVDA 2OICA 2WFYA 5JRQA 1ZYJA 5AJQA 3UO5A 5GIOE 2R3OA 4DFNA 1GZ8A 5M07A 2C1BA 4K77A 4CZYB 2GMXA 4C62A 5FLFA 3QLFA 4IAYA 1GY3A 2C47A 1YOJA 5L8JA 3ZRLA 1PF8A 2PE2A 1FGIA 2XNMA 3ZRMA 3Q6UA 3MESA 2UVYA 1OGUA 2XK7A 4LL5A 3HP5A 2VTMA 3CJGA 1PKDA 5IA3A 1UU7A 5L8LA 1YKRA 3F66A 4OTDA 2VWWA 5HE0A 3Q9WA 4TWPA 2QNJA 5HTBA 4QP4A 4QPAA 5LVPA 3LM5A 5CEIA 5BVNA 3BWJA 2YWPA 2EU9A 1SNXA 4JBVA 3TNWA 2B9HA 4QMZA 2WMUA 2J9MA 4GMYA 4I1ZA 3LLTA 4ZSAA 4TYHA 3FY0A 4EQUA 2R9SA 3LCSA 4FE2A 2W4KA 3KU2A 3E8NA 4O0RA 4FX3A 3R8VA 5HIEA 3E88A 3FZPA 4NTSA 2R3NA 4HPUE 4V05A 5C4KA 4FIGA 2PTKA 5J1WA 3TNPC 2OWBA 5E9EA 4YBJA 3GP0A 4D2SA 3VN9A 4Y83A 2PK9A 2VTHA 3DTWA 4RRVA 3VULA 2VTJA 3R8PA 3F9NA 2WQEA 4DGNA 2Z7LA 4LV5A 5DT4A 3QHRA 4C4GA 2QOHA 5IDNA 3EYGA 4CYJA 4YPDA 5AA8A 2G9XA 4YPSA 1J91A 2Y6MA 4YZBA 3ZXTA 2ZM3A 3OT3A 4BDDA 2R7BA 1B38A 2YCRA 4NK9A 3FZOA 4Z7GA 2XM8A 1H28A 4EYMA 5FEQA 4GYGA 4RIWB 4WG4A 4RVTA 5K5NA 3DLSA 1W98A 4XP0A 4JQ8A 2PYWA 3TZ8A 5HX6A 3LKMA 4W4YA 3DAJA 3BQRA 3PP1A 3HGKA 3BHTA 4FUXA 4JR3A 2OI4X 3PXYA 4MYGA 4UB7A 3NYNA 3R1NA 4FV0A 4IAFA 2C6DA 1B39A 3FJQE 5I9ZA 2FH9A 2YDJA 5HBHA 5LWMA 4O7ZA 5CS6A 1APME 5A3XA 4IBMA 3V8WA 3K2LA 4QYEA 5AMNA 5DE2A 4MD7E 4ZJVA 3F5GA 3Q53A 4ONAA 5HG9A 5BUEA 4C34A 2GFCA 2NNWB 4HVGA 4RWLA 4AFEA 4FKTA 4O22A 2W17A 3CKXA 1JAMA 1IEPA 4RLLA 2CKOA 2PE0A 4F65A 2R5TA 3SXSA 2XCKA 2QOIA 3HV7A 4O7LA 4DGMA 2XNNA 3A60A 5IH4A 3KB7A 2ZV9A 3JY9A 3R01A 5AP2A 1LUFA 5IH6A 2EXCX 2HZNA 2BROA 4J52A 1YW2A 2UW0A 3CS9A 4IAIA 4MWIA 2JFLA 3ZU7A 3HRCA 4Z9LA 4ACGA 4EK4A 4JRVA 2C5YA 2YIRA 4LGHA 2W5HA 3P23A 3BLRA 4O7SA 1YI6A 3OOGA 5IA4A 2YAAA 4G1WA 1DI9A 5IUGA 5JQ8A 2Z02A 2LGCA 4J7BA 5LMKC 3VUHA 3ZDUA 3R21A 4EK3A 3NUSA 2BIKB 5CT7A 2IG7A 4GVAA 3W2OA 4L00A 4AXAA 4E1ZA 2E9OA 3KXHA 3DK3A 3SW4A 1P14A 3U8WA 4J95A 3E3BX 3RP9A 5CAQA 1FBNA 5HG5A 3WBLA 1KE7A 2C6LA 4XBUA 1H1SA 3JVSA 3HAVA 4FGRA 1GZOA 2QOCA 4IX6A 4MNEB 5EI8A 1ZWSA 1ZZLA 4FV5A 1PMNA 1ZXEA 4NM7A 3LFEA 2JDOA 3Q5IA 4FTQA 4DG0E 3ZRKA 2R3GA 3VBWA 5A14A 4GJ3A 2GNHA 1G5SA 3IDPA 3IOKA 4GH2A 4K0YA 2YCQA 4YLKA 3UIBA 2OJJA 1XWSA 3WARA 5LCKA 4L46A 5KHWA 3ZHPC 2PUUA 3VBVA 3FBVA 4UZDA 3R9DA 4D2VA 4WSQA 1UV5A 5HU9A 1OPJA 5JRSA 4GFMA 2XIYA 4YJTA 3OWPA 5L6WL 4EH6A 3ZEWA 1STCE 3UG2A 2QU6A 3KRLA 4IZYA 3W8LA 1Q3DA 2B55A 3QRKA 4XMOA 2I7QA 1CMKE 1XBAA 4JXFA 2ZOQA 4AOTA 4C2VA 4LFIA 3II5A 2ITUA 3IW5A 4PNKA 2C5NA 3OROA 3QKLA 3IGGA 4DH5A 3PSBA 3RK9A 4ZTQA 4Z7HA 1Y8YA 2RF9A 3HV6A 4IX3A 3WE4A 4LRKA 2CKQA 2B9FA 5AP3A 4E5WA 4DEEA 2QKWB 3EOCA 5AV1A 4OGRA 2ZB0A 4UEUA 4UWBA 1QPJA 5J8IA 4E6CA 5JEBA 1U4DA 3E92A 2X6EA 1URWA 4B4LA 3D7TA 2YERA 2R64A 2BRBA 4JAJA 3PIXA 3R7EA 2IW6A 2B1PA 2WTIA 3ZM9A 2A19B 3C7QA 4CMOA 3CXWA 4XV3A 5HCZA 2C5OA 4MWHA 4G9RA 4E6AA 3JPVA 2NRYA 1GAGA 3HV4A 4QP3A 4ZSJA 5L2WA 5A4CA 4M7IA 4QP1A 5LJJA 4BCIA 4KRDA 4V0GA 4CT2A 3CCNA 3IOPA 3MV5A 2ITTA 4E4LA 3OVVA 3C0IA 4XG9A 3S1HA 3I7CA 4ERKA 2GNIA 4X6QC 3FKOA 3ZS5A 1Q3WA 2B53A 1LEWA 4MD9E 4HYIA 2WGJA 4WRGA 5EI2A 4XNEA 3VS1A 3QCYA 1ZOHA 3F61A 4BI0A 3G51A 4UMPA 5KBQA 4CG9A 3OY1A 5J95A 3ZSGA 2Y0AA 3P5KA 1E9HA 1PXLA 4M84A 4BGQA 5K0XA 4AWIA 3QRJA 3WF9A 2W1FA 1OVEA 3KQ7A 3QXPA 5EW8A 4YZNA 3V8TA 3VHEA 5CU4A 2CCHA 3MVLA 4CXAA 3UNKA 3RI1A 2GU8A 4ERWA 2ETMA 2JKQA 4FZ6A 3ORZA 4AG8A 4NWMA 3CTJA 3FE3A 4NW6A 4FZ7A 2ZB1A 3ZLWA 2HWOA 4E7WA 3KXZA 3COKA 3ZSIA 5EQEA 4FTOA 5F95A 4BCHA 1FGKA 3EWHA 3FI3A 4XG8A 4BDAA 3DB8A 2QD9A 3KA0A 5E8XA 3KFAA 4ZAUA 2ITYA 4JBPA 5ANDA 4WNKA 1WZYA 4WNOA 3EN7A 4BHZA 3A2CA 1OUYA 3DGKA 5E90A 3WZEA 3BZ3A 2X9EA 5CEOA 3QCQA 4XV1A 2C6OA 2R3MA 3VQUA 3VC4A 5BUJA 1REJA 4BDKA 5A4QA 3NCZA 5E8VA 1WAKA 4PUZA 1OL6A 4EOOA 3NW6A 4G3EA 3F5UA 5B2KA 3M11A 4ZMFA 2QVSE 1BL6A 1SNUA 2JBPA 3FI4A 4GU9A 1DAYA 1LP4A 4U45A 5J5SA 4DH8A 3GC9A 3W2PA 3EQGA 2CLQA 5LVNA 4GW8A 4ZMEA 3CPCA 3LW0A 3F2AA 3VUIA 2GS6A 5IEVA 2C0IA 5DFPA 5M4FA 3MIAA 1JQHA 2X4FA 2BHEA 3RALA 4EQMA 4I0SA 3CPBA 3DZOA 1ND4A 1WBSA 3R71A 4FEQA 2XMYA 4WIHA 4TW9A 4K6ZA 5JGBA 5AIRA 3OEFX 1JSTA 4ASEA 4ASXA 5KMKA 4YZCA 1FOTA 4Q9SA 4BDBA 4BIDA 5H9BA 1XJDA 3FMMA 4BBMA 4F6WA 4GJ2A 2A2AA 4ZS4A 4XG3A 2WTJA 3PRIA 2OO8X 4EWQA 1HOWA 2Y4IC 4FNZA 5FDXA 3OS3A 5M57A 5TE0A 4IC7A 3SG8A 4EBVA 2QHMA 3WF8A 3ZXZA 5EQPA 2F7ZE 3GOKA 5K4JA 5J9ZA 4HNIA 2PZPA 3WE8A 4TZRA 4XJ0A 2YZLA 3QD0A 4XS2A 3FC1X 3IK3A 1KOAA 3CQWA 4C59A 3O50A 3V51A 2BRNA 2PVRA 3DJ5A 3DFCB 3FLYA 4KIKB 3ORNA 4MXXA 1EH4A 3TWJA 4RZVA 4RGJA 3CC6A 3IS5A 4C4JA 3V5LA 5FXRA 2WXVA 1XHAA 3AC2A 3BI6A 4IHPA 3SRVB 2W1HA 3GEQA 4YNEA 1H08A 4QMUA 4AN2A 3Q04A 1W7HA 3EQCA 1OB3A 3TV6A 5EHOA 4UN0C 3UMWA 2VV9A 4FTMA 5HICA 4MQ2A 2XK4A 1WBPA 2QG5A 5CF4A 3N4VA 2IVSA 3ANQA 5EKNA 4IE9A 5CYIA 2BAQA 4FSQA 5F20A 3EQFA 3ULZA 3NX8A 4FOBA 4O0XA 5E1EA 3O8UA 2VN9A 1GIJA 5IU2A 2CGUA 3OXTA 4FKUA 1QPDA 3MGYA 4C36A 5LQFA 2CCIA 4RJ8A 5CXHA 4AN3A 5GHVA 3HA6A 1UWHA 1YXSA 4MCVA 4PP9A 3LIJA 5AWMA 4L3JA 4DCEA 3HUBA 3ORIA 5EYDA 4O7RA 3PG1A 5CU2A 4CRSA 4C0TA 2UZDA 2VNWA 4IVAA 3W33A 2PPQA 2WTKB 3UYSA 3GENA 4CV8A 4BCJA 2P0CA 4G5PA 5ETCA 5C26A 4AGCA 4C3PA 4QT1A 2XK6A 3MFRA 3ORMA 2EB3A 4RX5A 4Y46A 2WTVA 5HVYA 3WOWA 5KMIA 1HCLA 5ACBC 2C5XA 4EHZA 4JR7A 3ELJA 5BVDA 3LHJA 4RVLA 3GQLA 3B2TA 1SM2A 4XG7A 2RIOA 3BE9A 4AACA 3UDBA 4EH5A 4FEUA 3IW6A 4BF2A 1SYKA 4U79A 2KULA 1OIYA 3JXWA 2PUNA 4YSMA 4OT6A 2GPHA 3TNQB 3A8WA 3MH3A 4F09A 4YZ9A 4L3PA 1H8FA 4FT5A 3PP0A 3Q96A 2G15A 4IACA 5CQWA 5EHYA 3HX4A 4O7NA 4N6YA 5JKGA 2F7XE 2PVMA 3NLBA 3EZRA 1MP8A 2YIWA 2R3HA 3B8RA 3M1SA 3R63A 2G2FA 2PUPA 4FK6A 2FGIA 1JKTA 1YHVA 1Q61A 5ACKA 1PJKA 1ZYCA 3A7GA 3CBLA 4QMTA 3V01A 2X6DA 5I9VA 3QTWA 5DA3A 3MFTA 2BILB 3ZO4A 4CFWA 3HAMA 1XH6A 1JKSA 2G1TA 4DC2A 3V5TA 4N57A 2C3LA 2OJ9A 3O7LD 5J1VA 5HIDA 3G6GA 3ODYX 5FUTA 4IZ7A 4PQNA 4GK4A 3TDWA 4A4LA 3CQEA 3W1FA 5CEQA 3P08A 2YEXA 3MA6A 3CGFA 2WOUA 3QGWA 1Y57A 4OTRA 1PXOA 4D2PA 2I0HA 4FEVA 3FDNA 5EQYA 3FLWA 3FWQA 4FSWA 2ERZE 5CF5A 2XK9A 3CIKA 5GNKA 5HNIX 4I93A 1YOMA 2HY0A 5BX0A 4YO6A 4AGWA 1R0PA 5DI1A 4F9AA 4AT3A 3OC1A 3O23A 4KKGA 4C4IA 2PUIA 3ALOA 2OFUA 2XP2A 2BKZA 4D2TA 4FK3A 4C8BA 3PJ2A 5ANJA 2JAMA 1IG1A 2PY3A 4HGEA 4QMVA 5C03A 4JDKA 5M09A 4QMMA 2B9IA 1HCKA 5ETIA 3A7FA 3VIDA 2E9UA 4MAOA 3R8ZA 3V04A 2XNEA 4FTLA 3CQUA 3ROCA 1O6LA 4FSYA 3UPXA 1CKPA 1ZYDA 4QPSA 5FTQA 3R8UA 2VTNA 2C6EA 3VS2A 3TJCA 3RAHA 1JSVA 3QZFA 2VWZA 3V8SA 5IPJA 3UNJA 3GI3A 2WMXA 2I40A 2X1NA 4IB0A 4JDJA 4TNBA 4O2ZA 4UALA 3RHXA 3NGAA 4IW0A 4LV8A 3TM0A 2QR7A 2WMRA 4F9YA 3BBWA 5AR5A 4ZEGA 5IF1A 4TT7A 4YC8A 4WNPA 4X3FA 3OWLA 5KO1A 2H8HA 2UW9A 4EKLA 5DT3A 5IQCA 2FSMX 3ITZA 4BWXA 4P7EA 3BV2A 4YC6A 1FMOE 3FPQA 4GFOA 5IA0A 2OIBA 4E20A 3U54A 4LYNA 3ALNA 4FT9A 5HE1A 4TPTA 5DPVA 4BY9E 2G01A 5AP0A 3BWFA 5AA9A 3QRUA 3BYVA 3RM6A 3ACJA 1U46A 2YFXA 4ZSEA 3UQGA 4L6QA 3PXRA 4FV1A 4RMZA 5IQEA 5IG1A 1W8CA 4BDFA 5ETFA 2PVFA 4G16A 3R7VA 2ITWA 3UG1A 4NFMA 4YJRA 4JBQA 4NFNA 4EYJA 5HKMA 2GQRA 3FQEA 2R3LA 5AP4A 3MBLA 3GU6A 4IMYA 3R83A 3UC4A 3ZUTA 3P86A 2GHLA 3NIEA 1OI9A 3LXLA 4IH8A 1XBBA 2W5AA 3OP5A 4O2PA 2P3GX 4U43A 2W1EA 5LMKA 2ONLA 1Q62A 3F7WA 3QD2B 1UKHA 3R6XA 3A99A 3VJNA 5DR6A 4BCNA 2YM6A 3AG9A 4C3RA 4RQKA 3GFEA 2FB8A 2JKMA 4R8QA 5HX8A 5J79A 5A6NA 4G3GA 1ZY5A 3R22A 3U55A 3R9OA 2BDWA 3VRYA 3QFVA 1WBTA 3L1SA 1ZMWA 4FSZA 4LRJA 3TZ9A 4FSMA 4L52A 5HE3A 2Z7SA 5JFXA 5F9EA 1B6CB 5BVOA 4C38A 5KUPA 4CCBA 4YO4A 5I4NA 1XH7A 2BTRA 4BGGA 2VAGA 4TWOA 4CYIA 4FTNA 2NO3A 2HOGA 3BEAA 2XBJA 3IPHA 1SZMA 3PPJA 4R5SA 2PMIA 3TXOA 4XV2A 5E8SA 5AUYA 5D1JA 4I92A 1GIIA 2X2MA 4EORA 3QQFA 4G6NA 2W7XA 5M4UA 3PA3A 1CTPE 3QC4A 3T9TA 5TKDA 1YDTE 3DNEA 2JFMA 1R39A 4C61A 3VF8A 5TO8A 3BPRA 3G0EA 4QOXA 4O7YA 4NJ3A 5BMSA 3ORTA 2O0UA 3QTQA 1MRVA 2PSQA 3B8QA 2YITA 4FV7A 5GJDA 2BFXA 2GS2A 4FT0A 5AP7A 3FHRA 2OXYA 4AE9A 4J98A 2LAVA 5HO8A 2OU7A 2YA9A 2FSOX 3L9PA 3QCSA 3Q5ZA 4QMYA 5BQ0A 4FV4A 4S2ZA 5BPYA 4AA0A 3F3WA 3QHWA 4Q2AA 3S00A 4K8AA 3V6RA 4C57A 3OEZA 2BRHA 4F99A 1SVGA 3BU5A 1ZZ2A 1L3RE 3NUNA 3EN5A 3CKWA 2B7AA 1MRYA 2J6MA 1H26A 1QCFA 3QKKA 4CQGA 4EH8A 2GNFA 4EOIA 5CEKA 2XKEA 3RK5A 4Q5EA 5ITAA 5CNNA 5AFVA 4FNYA 4TYEA 2V22A 2XJ2A 3O0GA 4ANSA 3CY2A 5HHWA 3I7BA 3UBDA 4J8MA 3HRBA 4O0UA 3SLSA 2EUFB 4EQCA 4F7LA 1V0BA 4KB8A 4YJOA 3PJ3A 2OH0E 2QHNA 3E93A 2C6TA 4OTFA 4L7SA 3U9NA 2AYPA 4YTHA 3EMGA 1H27A 2VWBA 4YMJA 4CKRA 3O71A 5CLPA 1Y6AA 1PXPA 4L53A 4EH9A 5I5ZA 4DG2E 5CSVA 3KK9A 2XKFA 4FZAB 5FEDA 3RMFA 2YCFA 5M56A 2VTPA 5C8MA 5AUTA 4GKIA 4G9CA 3I0OA 1JNKA 2RFDA 4FKOA 2H34A 3FQSA 3QC9A 2A4LA 4D4YA 5C8KA 4F1TA 1F0QA 3LFQA 4QTEA 3MVMA 4J96A 1A9UA 5HE2A 1Y91A 2BZHB 3U6IA 5IQDA 3VUKA 4TY1A 4Z55A 2YM5A 3H30A 3CGOA 4JG8A 5DMZA 2J2IB 2EXEA 3PVBA 4FV2A 2JDSA 2IPXA 4BDGA 5CU0A 4MTAA 3AC3A 2XF0A 5HLPA 4I22A 3W10A 3F2RA 3OBGA 4C35A 2IVUA 2PVYA 1CSNA 3MVHA 5F94A 4QMXA 3CR0A 4PPBA 2RG5A 4EEVA 2G2IA 3PFQA 3KK8A 4CT1A 4FC0A 2X2LA 1FVVA 2HZIA 1YOLA 4ACMA 1J7LA 4CTBA 4MKCA 5CVGA 2QCSA 4CVAA 2J51A 3RPVA 4AA5A 4QNYA 1PYXA 3RBWA 3FLNC 2BHHA 4CFXA 3MN3A 4I5HA 3RWQA 4D28A 4B9DA 4K9YA 4RJ7A 4YJSA 3DBQA 3PXKA 5LWNA 4K33A 4XLIA 3WYXA 2DYLA 4YU2A 3HVCA 2VTIA 3DAKA 1NA7A 3EN9A 3LCTA 4UMQA 2ZDTA 1JWHA 4YBKA 5FP5A 5AX3A 3AC5A 1M17A 3RZFA 3COHA 2OLCA 2YM7A 2FUMA 3SKCA 4U6RA 4W4XA 3ZBFA 1ZY4A 3G90X 2W5BA 1Q8ZA 1ERKA 2GNLA 1O9UA 2B9JA 3PSDA 2XJ1A 2VTSA 3PVGA 2O2UA 5C01A 4DEHA 4HYHA 3UO4A 2J4ZA 4IVBA 2GNGA 4IEBA 4CFUA 4APPA 4PX6A 4JT3A 3MH2A 4RIXA 3R28A 5LXMA 3NUAA 4DINA 1P4FA 1KE8A 2QURA 3LJ1A 4ZK5A 4EONA 4DGGA 4NL0A 3R2BA 4FTCA 1OIQA 2H6DA 4ANBA 2WMQA 4GU6A 3FMDA 2H9VA 2OJIA 4W8DA 3FV8A 4LGDA 3PLSA 2VO7A 2PHKA 2IJMA 3TL8A 4EH7A 3OWJA 3D15A 4I21A 4BKYA 4AGUA 3R8LA 2CJMA 3LXPA 4NKAA 3O8TA 2ETRA 4OBQA 5H8GA 1P4OA 4GT3A 4ZTRA 3RVGA 3KVXA 4QTCA 5JN2A 3UOJA 2X2KA 3IONA 4ASDA 5HD4A 4LGGA 4O91A 3BYOA 2WQMA 3HLLA 3IW4A 4FG7A 4JDHA 4UWCA 5BVFA 3SW7A 4GL9A 4X3FC 3DKFA 1H25A 3H10A 3QZGA 3ORLA 4WOVA 4ZXTA 3GCVA 1ZOEA 4AP7A 5CY3A 1RE8A 3D4QA 4AQCA 2QOOA 4EOMA 1UU8A 4QQTA 1YXVA 4B8MA 5LMBA 2NPQA 3OXIA 4C4EA 4DFBA 4UX9A 4RJ3A 4BCOA 2XYNA 3Q9XA 4KD1A 4L3LA 1X8BA 3TT0A 3VBXA 1KE9A 3PXZA 4D4RA 1IAHA 5HU3A 3K5VA 3W16A 3H0ZA 4U40A 4AFJA 5L2QA 4DEAA 3EH9A 1R3CA 2CN5A 3GCSA 3LFDA 4BRXA 2YM3A 4XH6A 2O64A 3NZ0A 1REKA 3BQCA 4BCKA 4QQ5A 4IM3A 5CAOA 5L8KA 3QQKA 1OBGA 2PVNA 4O7VA 2PL0A 4CFNA 4II5A 3F5PA 5IQFA 3S2PA 4E4NA 3MY5A 3VUTA 3OF0A 2BR1A 5DHJA 4QQCA 3DK7A 4E4MA 4ZY5A 3EQIA 3Q4TA 2RFNA 2ONLC 2W96B 1FMKA 1OITA 3H0YA 4FTJA 4D5HA 2Y4PA 5FTGA 4O7WA 1JBPE 4M69B 3EQHA 4M67A 3BKBA 2UW4A 4CLIA 3DXPA 4AZVA 3BCEA 2WIHA 4GUEA 4OBOA 1ZAOA 4EH3A 4RVKA 4ZLOA 2H96A 2XBAA 5E1SA 5BNJA 1PXMA 1PHKA 2DS1A 2HY81 2IZRA 4JOAA 4F7SA 4NTTA 2JKKA 4P90A 3FLZA 3EFKA 2NP8A 4I41A 1T46A 1G8AA 2ZYBA 4KSQA 5JK3A 4B8LA 1Q99A 3B2WA 4C33A 5LARA 4CZTA 4EUUA 4BN1A 4ALWA 2ZDUA 3TIZA 3VS0A 1CKJA 3CY3A 3LMGA 3Q4UA 5E8TA 5HD7A 3T3VA 3IKAA 2UZBA 3S4QA 3O2MA 2VTLA 2BMCA 2UZWE 4J53A 3I81A 4QTAA 4RSSA 3ZH8A 4CGAA 4G5JA 3E8DA 3PRFA 4MXAA 5D7AA 3LCOA 3W55A 3HP2A 4FV9A 3FLSA 1J7UA 3MY0A 3ATTA 4C58A 3Q9YA 5HVJA 4DITA 5HTCA 2ERKA 5BMMA 3NYOA 3SC1A 4I5MA 3OUNB 4J8NA 4IB3A 4YHFA 2P2IA 5DVRA 4O81A 3D83A 2OK1A 3LFBA 3VJOA 4RWIA 4UXLA 4WUAA 5FM2A 1YXTA 1M2QA 1XH4A 4E73A 5A6OA 4CSVA 3OFMA 3GU7A 5HIBA 4S31A 2VO0A 4OTQA 4K1BA 4AUAA 1QPCA 3QRTA 1M7NA 4JL9A 1OM1A 2Y6OA 3VBTA 4FOCA 2VUWA 3NUUA 3ZYAA 4TXCA 5CEMA 1BI8A 3FYKX 3O51A 4M97A 3KRXA 4L01A 4U8ZA 4MHAA 4YR8A 4EOQA 3BBTB 5CSPA 3NW7A 1Y8GA 2UZUE 3ZFXA 3BHHA 2PZYA 3KMWA 4OAVB 5L6OA 4GV1A 4R3CA 2OXDA 4FSRA 1GZNA 2W06A 4H58A 3UPZA 1ZOGA 4N6ZA 4YGAA 3MTLA 4TYGA 5AADA 3NVKI 1I44A 3R7IA 5L2SA 3D2IA 5FBNC 3R02A 1A48A 4NIFB 2CGXA 2Z2WA 4IIRA 2VWXA 4OTHA 3MW1A 4RIYA 3WYYA 5CAVA 4XCUA 2YHVA 4QMSA 5KX8A 3BYSA 2QQ7A 4DEBA 3ID6C 5FD2A 4DH3A 2UZLA 4ALVA 1ZMUA 5IQAA 2YDIA 2A0CX 4FKRA 4UWYA 1E1XA 4DFZE 2F2CB 2XK8A 1WVYA 2W05A 5EYCA 2F49A 2X7FA 4Y5QA 4D9UA 4EK6A 4M8TA 3CD8A 4R78A 1XH9A 1H01A 3PIZA 4J1RA 4IWQA 2XRWA 4M14A 4QMLA 3DV3A 4H1MA 3QYZA 2BALA 3HMIA 4ZY6A 4JX7A 5AUXA 1MRUA 2BIYA 3AGLA 3KMMA 4NJDA 4DH1A 3E7VA 1OL1A 3D2KA 4PL5A 2DWBA 2DQ7X 4NM5A 4RJ5A 4DFYA 3VUMA 2YIXA 1OZ1A 1VZOA 4TN6A 1V0PA 1DM2A 2VZ6A 3HZTA 3OHTA 4FL2A 5HG8A 3KRJA 4YTCA 3DY7A 2JD5A 4PMMA 4NM0A 3Q9ZA 4JVGA 5FWKK 4NH1A 4GEOA 4HW7A 4H05A 3D0EA 4X0MA 1U54A 5H8EA 3AT2A 4USFA 3FKLA 4FODA 4K18A 3LMHA 4FKSA 3HMMA 3BGZA 3DNDA 3I4BA 3DBEA 5IEYA 4L42A 4PDPA 4EHVA 4QMWA 4XUFA 3BU3A 3Q52A 3TV7A 2YJRA 5EM7A 1OIRA 2E9PA 3ZO3A 5CI6A 3ZOSA 2J5EA 4ZZOA 4GKHA 2W4JA 1G8SA 1UVRA 4FV6A 4I23A 2HW6A 4TWNA 4A9UA 5JT2A 3Q32A 3ZONA 4U0IA 1H0WA 5ANGA 1WBVA 1R1WA 3HL7A 3C4WA 5FM3A 5HCYA 4XBRA 4WT6A 2P33A 1M2PA 3QQLA 1Q5KA 4FYOA 5B2LA 2EVAA 3R7OA 5B2MA 3N4TA 4TNDA 4MF1A 4F0FA 1U59A 3E3PA 3PVWA 4RA4A 1H1QA 3NNUA 4K11A 4GSBA 2O65A 4C3FA 1WVWA 3NYXA 2ITQA 5E92A 5C9CA 4M66A 2IN6A 4M15A 3UZTA 2XJ0A 3GU4A 3QTZA 1Q4LA 4IC8A 3L9LA 3OG7A 2X81A 2WB8A 4DGOA 3BGQA 3OXZA 4Y73A 4HNFA 2QOFA 3U6JA 2OZAA 3VUGA 2R7IA 1E1VA 4HGLA 5AV2A 4HOKA 5FEEA 2JDRA 3FSKA 3LOKA 3UODA 4A4XA 2JEDA 2VU3A 3ORKA 3QTUA 3CSVA 3CD3A 4F64A 2VO6A 3HYHA 1FVTA 4RZWA 1U5RA 4HJOA 1QMZA 2X9FA 2ZJWA 5DRBA 4OBPA 3TEIA 4XOZA 4IDVA 3R04A 4MX9A 3ZCLA 4AZWA 4O0VA 4CRLA 2HYYA 4FL1A 3PUPA 3U4WA 2YIYA 5ANEA 2QG7A 2CGWA 3EJ1A 3ZBXA 3P7AA 5J9YA 4J97A 4F08A 4NKSA 4KS8A 2HAKA 1J7IA 2PZIA 1AGWA 3R9HA 2GTNA 4BBEA 4F0IA 2Q0NA 4DTKA 4G6LA 2YAKA 3LCDA 5CWZA 4O6LA 3ZUVA 3ZZEA 1VEBA 4CQEA 4PY1A 1XH8A 4W9WA 3UC3A 2FA2A 3FXXA 2HXLA 4OR5A 3R73A 2GSFA 3EFWA 1NVQA 2VWIA 1AQ1A 5TOZA 4MK0A 2OXXA 2REIA 4FTKA 3L8VA 1OECA 3OW3A 4RFZA 4BCFA 4E6QA 3EZVA 4UYNA 4AAAA 2ACXA 3WZKA 3NNWA 5EM8A 1XH5A 5KMJA 4FEXA 1WMKA 3KXMA 1Q8YA 2RGPA 4G3DA 4MD8E 4FVQA 2PVLA 4KKHA 2RL5A 2PZRA 3EQPA 3KCKA 3SA0A 3UZPA 4BGHA 2NRUA 4TYIA 5D12A 3IGOA 1NY3A 3E63A 2WHBA 4E5BA 4QD6A 3SAYA 4WG5A 4RIWA 5HLNA 4EZ5A 2ZV2A 3CE3A 4IFGA 5EG3A 5FGKA 5GZ8A 3MVJA 3LCKA 2BPMA 4HCVA 4FKIA 4RPVA 4FT3A 4AF3A 3ACKA 3P9JA 2X39A 3P7BA 5IA5A 2WMBA 3FPMA 4U81A 3EHAA 4H39A 2UZVA 3V5QA 4DTAA 5FBOA 4IZ5A 3E5AA 4MXYA 4X2FA 4Z3VA 3SD0A 3OMVA 3DBFA 4XP3A 4FA2A 4UMRA 3FMLA 2VX0A 3OCTA 3C0GA 5ANOA 2YWVA 3PWYA 3NPCA 4HGTA 2VO3A 2ZVAA 1YI4A 3QQHA 4L67A 3BELA 3COIA 2WAJA 1R78A 2QKRA 2KTYA 4O0WA 5KMLA 4TKSA 2VGPA 3E7OA 4FUYA 4ORKA 3AGMA 3GCUA 2OGVA 2ZM4A 4GVJA 3TV4A 2J7TA 2ITPA 3RHKA 3TTJA 4BTFA 2Z60A 1YHWA 5DT0A 3TTIA 4F1MA 5JFWA 2FO0A 5CEPA 4WUNA 4TYHB 3ATSA 2ESMA 3ETAA 4WNMA 3ZLSA 3HV5A 4F1OA 2WTDA 3KCFA 2I0EA 4K2RA 3HDNA 4KIPA 3RPOA 3EFLA 1R0EA 2IVVA 1JKKA 3DS6A 3ZSHA 3VS6A 3UOHA 4R3RA 3PA5A 5IISA 1TVOA 2GHGA 5CTPA 5K3YA 2P55A 2X8EA 4AGDA 4NYEA 3QXOA 1Y6BA 2J0LA 1YWVA 4CD0A 4AZEA 4GRBA 5TT7A 2J0KA 3KULA 1KSWA 3E87A 3TDVA 4L9IA 3L8SA 1BL7A 1PMUA 3BX5A 5E8UA 3DPKA 3LXNA 2W4OA 5AR2A 3UIUA 2Y8OA 2YABA 2WPAA 5EW9A 3EKNA 2W1GA 4FV3A 5C8NA 5D11A 3PSCA 2BZIB 5IUIA 3GUBA 3K54A 4N0SA 4HCTA 4XG6A 4F63A 2AC3A 2C3IB 3NNXA 3OCSA 1JVPP 2JIVA 1VR2A 2WOTA 3PY1A 2C30A 3A61A 5KKRB 2R3JA 3OY3A 5CNOA 4ZTMA 2ITXA 4KRCA 4ENXA 3QF9A 4EI4A 3MB6A 2UZEA 4I4EA 4P5ZA 2OF4A 4IWDA 4RFMA 5AUVA 4AT5A 2HZ4A 1YHSA 2BAJA 4RC4A 3C13A 1IASA 4F6SA 4P2KA 2JGZA 5CU6A 5IQBA 2WTWA 4XLVA 3UE4A 4RA5A 4AZSA 4ENYA 4O82A 2VTTA 1XQZA 3G2FA 3L8PA 4FZDB 4C02A 4I6BA 4MQ1A 3TJDA 4KUJA 3D94A 4UYAA 4FTRA 4IFCA 3QD4A 1MQBA 5IQIA 1WCCA 3DOGA 2B54A 4C37A 3K3JA 4L45A 3RAIA 3WI6A 3D5UA 5AR4A 1OKZA 3OT8A 3RKBA 2GQSA 4A9RA 3UJGA 2W9ZB 3QA0A 4IB1A 4J99A 3RK7A 2XUUA 4TTHB 4Y5HA 3SXRA 1GJOA 3EQDA 2R2PA 3OOMA 4BCGA 1BYGA 2YISA 4L8MA 3EB0A 4A9TA 2R3QA 3QX4A 3C4XA 1XKKA 4FIJA 3RTPA 3I79A 3MB7A 4NUSA 3I1AA 1MUOA 5KMOA 3MFSA 1OKYA 4R7BA 5CAUA 3P0MA 4C4HA 3EL8A 2O3PA 3ERKA 3GC8A 1F3MC 5JSMA 2VX3A 3BEGA 2W1IA 4U97A 1YVJA 5GIPE 5DWRA 4ZOGA 4EC9A 3O8PA 4IB5A 4XG4A 2PMOX 4JRNA 2RKUA 3JUHA 3LM0A 5I0BA 4U42A 4CKIA 2XRUA 4RX8A 3FMJA 3UTOA 4DG3E 3F2NA 2W1DA 3SXFA 3ZO1A 5D41A 1H1WA 2BDFA 3EQBA 4FKQA 3QZIA 4FKWA 4PTEA 4S32A 4BI2A 4GG7A 4S33A 3P79A 3WF5A 4FSNA 1K2PA 2QLUA 3GVUA 5KBRA 2WNTA 4DFUA 3Q2MA 3FUPA 1J1CA 4PWNA 4H1JA 4QP8A 3U4UA 4F9WA 4D9TA 4A4OA 4AW1A 4MVFA 3HV3A 4G3FA 3PG3A 4GYIA 3AD6A 3VBYA 3GBZA 4NCTC 3RPRA 5JQ5A 2JBOA 1GZKA 3E8EA 4X2JA 1Q41A 3QUPA 4ZTHA 3LFAA 4CG8A 4O38A 4WBOA 1JKLA 3HMPA 4I6FA 4NT4A 4WSYA 3U9CA 4KS7A 4CFMA 3Q4ZA 2V0DA 4MNFA 3WIKA 2Z7QA 3VWAA 2UZTA 4GT5A 3QUEA 4G31A 4BYJA 3AC1A 4LOQA 5LMAA 4JG6A 4KBKA 1J1BA 2BZKB 3TZMA 4LG4A 5GZAA 2WEIA 3DCVA 3TG1A 4ZJIA 3NRMA 5J7BA 4AW2A 4OTIA 3HUCA 3I5NA 1SMHA 3NAXA 3R1SA 2XEZA 4M0YA 3UIMA 3D7TB 5DLSA 3BYMA 2OIDA 4LQMA 3ROYA 1G3NA 3VNTA 4CFVA 3NUXA 4M12A 2HENA 4PTGA 5LCJA 4DT9A 3WZJA 4BIEA 5CAPA 2ITNA 2C5VA 2CGVA 3AXWA 2F4JA 4V0GB 5BYZA 3QQGA 4PPAA 1SVEA 4YJNA 3EQRA 4ASZA 4E5AX 3TUBA 3MA3A 1NVRA 4HGSA 2F2UA 5E4HA 3N51A 4PF4A 2AC5A 3GB2A 4BR3A 4PNIA 5B7VA 4JI9A 3R7YA 2QU5A 3U87A 1P5EA 5EM6A 5F1ZA 2ZV7A 5IMEA 1Q97A 3FI2A 2SRCA 4IANA 4BZDA 4QYHA 1BX6A 3PTGA 3FMKA 4GG5A 4IWOA 4U9AA 3PJ1A 4AN9A 4USEA 2I6LA 2C69A 2XK3A 3ZO2A 3DFAA 5IA1A 4FTUA 3G15A 4ANQA 5AAFA 1P2AA 1PMEA 4IAZA 1JSUA 4EWHA 2OBJA 3C4EA 4F7JA 5AUUA 3MDYA 5EK7A 4IWPA 5CSHA 4I5CA 2OJGA 2QONA 2J0IA 5CZHA 4O27B 5HGIA 3RPYA 3QGYA 4BDIA 3ZFMA 2CNUA 3NUYA 3D14A 1IA8A 4U41A 5JGAA 3NNVA 5KMMA 4MXOA 5AIKA 5FTOA 5JFVA 2C4GA 3CTQA 4BKJA 1H1RA 4R6VA 4YZMA 5FG8A 3QU0A 5FXQA 3RCDA 5K5XA 3ENHA 3GCQA 4HYSA 4O86A 3FYJX 5I9UA 3VVHA 3HMNA 1H1PA 2JITA 2WMAA 4ZZMA 3LMIA 3A7HA 3PWDA 2EB2A 2VTAA 4QQJA 5HOAA 3PLAE 5DN3A 3VBQA 2PVKA 1PW2A 4FV8A 3HMOA 3SRVA 3OTUA 1L8TA 1BKXA 3EKKA 3QTRA 4ZS0A 3EYHA 4FTIA 5EFQA 3UP7A 5JFSA 5M08A 2XS0A 3MYGA 3Q60A 3PYYA 4G2FA 4UMUA 4O1PA 2IVTA 3F6XA 3KEXA 4XV9A 3K5UA 4IVCA 1VJYA 2UVXA 4KABA 4P5QA 3O96A 3VQHA 2IZSA 3D5WA 4CCUA 3UZRA 2XKDA 3KRRA 4H3QA 3H3CA 3UOLA 2GCDA 4YJPA 3NDMA 2YN8A 3FMHA 3PA4A 3LQ3A 2GS7A 4QRCA 1DS5A 4S34A 1GIHA 3SGCA 5I9XA 5KE0A 2GQGA 4F9BA 5BYLA 3GU5A 2OJFE 2FVDA 4GUBA 3H9RA 4RQVA 2YCSA 3TCPA 4BZNA 4AA4A 2UW8A 5CF6A 4YLLA 4DH7A 2Q0BA 4RIOA 5L3AA 4RFYA 3A8XA 4H3PA 2R3IA 1JLUE 3LJ0A 2XM9A 4FF8A 4LI5A 1KV2A 1Q24A 1XR1A 5J9LA 3C51A 2E2BA 3JY0A 4G3CA 4UZHA 1WBOA 3H9OA 1PXNA 5AP6A 3NYVA 4B99A 2R3RA 4OTGA 4HVDA 1YWRA 3VF9A 1KWPA 3SG9A 3MPMA 2YLEA 2P4IA 3U6HA 5E91A 5CANA 2WELA 4YTFA 1PXIA 3FZSA 2CKEA 1QL6A 3PPZA 5BYYA 3QWJA 1RQQA 3IDBA 4ZTSA 4DYMA 1FVRA 2WQBA 3FLQA 4D4VA 4GT4A 2UW3A 1ZMVA 3DJ6A 3QUDA 4KSPA 5CU3A 4R7IA 3WF6A 4HVIA 4DBNA 3KRWA 3WZDA 4HCUA 4KWPA 2PVHA 3UGCA 3Q2JA 5EOBA 1M2RA 3LVPA 1TQIA 1FINA 2XCHA 1TQPA 3KL8A 4RLKA 4FKVA 4QP2A 2XNGA 3BLQA 5HVKA 2WQOA 4MXCA 5E8WA 3RAKA 5L4QA 3PE1A 1KE5A 1OL7A 5A4TA 5DR9A 2B4SB 2GFSA 2J50A 3D5XA 3OCGA 4OUCA 2PMNX 5DNRA 4H3BA 4O1OA 3RAWA 5M51A 4R5YA 4QPMA 4D1XA 2OSCA 4GIIA 3D7ZA 4IJPA 4QYFA 3RINA 4BZOA 4D58A 2XEYA 3RJCA 5C4LA 3UVRA 2XIRA 2HCKA 4IX4A 1PYEA 3DDQA 4BDCA 4X3JA 5T68A 4EUTA 2QLQA 1W84A 3KXXA 1O6KA 2X8IA 3LXKA 5L6PA 5KZ0A 3TKIA 1PRYA 3AT3A 4RJ6A 3NW5A 4UMTA 4KAOA 3C50A 1K9AA 1BMKA 3MSSA 4CMTA 4OW8A 3VS5A 3ZFYA 3DBCA 3LFNA 3AMBA 4A7CA 4EKKA 3FMEA 3RGFA 2IO6A 5HO7A 5I3RA 2YM8A 5DOSA 3F69A 5CASA 1YXXA 3R9RA 4BVUA 3AD4A 2C1AA 3PJ8A 5AR3A 3SVVA 1O6YA 3NSZA 1H0VA 3MI9A 5EDPA 1YDRE 3FAAA 1J3HA 2X4ZA 3AMYA 4XHKB 4ZP5A 3U51A 2ZM1A 3LFFA 5IUHA 2OH4A 5ANIA 4Y72A 4MBJA 5CALA 4XEYA 1ZLTA 3OW4A 1TQMA 3UQFA 3LJ2A 3FY2A 3DB6A 3KF7A 5HO6A 4NW5A 5I3OA 4CV9A 2QO7A 3F3TA 1PXKA 1UWJA 5AAEA 4U44A 1UNGA 2VWUA 3ANRA 4FG9A 4M0ZA 3JYAA 2F7EE 2WKMA 4OT5A 3G9LX 1M14A 3GFWA 1UNLA 2UZNA 4MXZA 5A4EA 1LR4A 4RVMA 3V3VA 4AE6A 4ANMA 2UV2A 1YRPA 3ZZWA 4G17A 5DBXA 3RPSA 3G6HA 3FEGA 4KNBA 2J0MB 5HI2A 4EJNA 5IKWA 3GOPA 2BRGA 4TWCA 5HEZA 3FZRA 2Z7RA 4JIKA 1OL5A 3FZ1A 4G34A 3I60A 4E26A 4E8AA 3DXQA 4XP2A 3N4UA 3BU6A 3IECA 4GIHA 3F3VA 3PZEA 4BCQA 2O5KA 4DAWA 1YI3A 3KULB 4ZLZA 1OIUA 3F5XA 4WRSA 1OKVA 3KXNA 3ZLXA 2RFEA 4AZFA 5DYJA 2HZ0A 2UUEA 4FMQA 5KZIA 5IH5A 4FG8A 2F57A 5C27A 3T3UA 1LEZA 1TKIA 3F7ZA 3TN8A 1Q8WA 4WG3A 5BUIA 4W9XA 2V7AA 3JS2A 3QAME 4QP9A 2I1MA 5EDQA 2WMTA 3KXGA 3NEWA 2YIQA 4D2RA 3TACA 3AOXA 1AD5A 3GQIA 3QLGA 3T9IA 3V5WA 4I5PA 3R1QA 2XA4A 2EWAA 4O6EA 2WTCA 4RX7A 3RWPA 5D10A 4XX9A 4OLIA 4R7HA 4YTIA 2X8DA 1IA9A 3PE2A 5HQ0A 5JZJA 3PDTA 5A54A 3PY0A 3UVPA 3CJFA 3E8CA 3DQXA 5HBJA 4QP7A 4BCPA 5JGDA 1V0OA 5DEYA 1FPUA 4IADA 3E64A 4HVHA 1ZRZA 3FMNA 3E62A 4O0TA 4OTWA 2WEVA 2UZOA 3FL5A 3IW7A 3JVRA 4L7FA 4BC6A 4ZZNA 4LMNA 2OKRA 4O84A 3EL7A 3BHUA 3EFJA 3POZA 5HLWA 3R0TA 4QP6A 4ACCA 3GNIB 4RJ4A 3FC2A 2JC6A 3LZBA 2R3FA 3QQUA 2XNPA 4CFFA 3GC0A 3ULIA 4DGLC 2CHLA 5L2TA 4GK2A 4JG7A 3LE6A 4BYIA 1A06A 3DJ7A 3A4OX 4FI1A 4EOLA 4CMUA 3QBNA
chains in the Genus database with same CATH superfamily
5HORA 4N70A 3ZM4A 2CNQA 4E3CA 2IW9A 4EHEA 4FIEA 5BVEA 4FYNA 2PE1A 4BJJA 3P5JC 1GOLA 3W32A 2R3PA 2HWPA 3EIDA 5CZIA 5LVLA 4X3FB 3R8MA 4D1ZA 4EBWA 3LAUA 4PMTA 2VTOA 4F0GA 4V01A 5BVWA 4D2WA 4YSJA 3TIYA 3PFYA 3WF7A 4JLCA 3WILA 4AT4A 5IDPA 2C68A 4EZ3A 2VNYA 1H24A 4CLJA 2WD1A 4ALUA 5AV0A 5DGZA 4LRMA 4CNHA 1M7QA 5DRDA 4W4WA 2BCJA 3I5ZA 4LM5A 1ATPE 4FL3A 4FVRA 4ANNA 4EC8A 4ITIA 2J5FA 4ZSLA 3VW8A 2BKKA 2OW3A 5HTIA 4CKJA 4S30A 3F3UA 1KOBA 5GJGA 4BCMA 4I3ZA 4O7TA 1VYWA 3HRFA 4MEDA 3A62A 4BFMA 3KY2A 4PDOA 4GK3A 5AM6A 5J87A 4DHFA 3FSFA 4DLJA 4DE4A 5JMSA 1BI7A 1IAJA 4FT7A 5ICPA 5CXZA 4F70A 4YURA 5K4IA 5H2UA 3KIOC 1M52A 4R3PA 4ZJJA 5CI7A 4XG2A 4IDTA 2V7OA 4FKLA 4PPCA 4WBBB 1CDKA 3GT8A 3KN5A 4NM3A 4USDA 3R7UA 4Z16A 1RDQE 1W2CA 3GCPA 3M2WA 2WTKC 4YP8A 5IQHA 3K3IA 4EH2A 1XO2B 5GINE 5E8ZA 2ETKA 4EOSA 1F5QA 1LPUA 2JLDA 4IJ9A 4BTMA 3S0OA 4V04A 3KREA 4JS8A 3ORPA 2XKCA 3QTSA 3OBJA 4NZWB 3ENMA 4XRLA 2QC6A 2F9GA 2JAVA 3LQ5A 3OTVA 2JKOA 3DAEA 4R1YA 4XRJA 2I0YA 3W2QA 4U80A 4BB4A 4E4XA 4HPTE 4WHZA 3V6SA 3UO6A 4AX8A 5H8BA 1Q8UA 3QRIA 4RT7A 4RWJA 2PU8A 3NVMB 4QO9A 3BHYA 3L9MA 3SOAA 2B0QA 1I09A 2OG8A 4QMNA 4GCJA 3REPA 3QD3A 5DR2A 3TKHA 4BDHA 1T45A 4IM0A 4ITJA 3AMAA 4NCTA 3MTFA 3COMA 4TYJA 4YJQA 1UKIA 4PDSA 5C1QB 3M42A 2BVAA 3OD6X 4N4SA 2QOQA 4IM2A 3FQHA 4I6HA 4A06A 2ITVA 2QI8A 3CTHA 3ZEPA 5AUWA 3C4ZA 2C6MA 4MBLA 5A9UA 5J5TA 4AW5A 2C3JA 3D9VA 4FEWA 3C5IA 2BTSA 4I0RA 4O96A 3MH0A 4WD5A 3R1YA 4BTKA 4FR4A 3I0QA 3RNIA 3SDJA 4NU1A 3IG7A 1MQ4A 2O8YA 3C0HA 4DF3A 5DH3A 1OKWA 4C4FA 5AEPA 3UQCA 4FSUA 4ANOA 5FXSA 2XIZA 2A27A 2X0GA 5DEWA 1OPLA 3DKOA 4A9YA 3MPAA 4AOJA 2CMWA 2DUVA 1FQ1B 2IWIA 1WBNA 2QODA 3AT4A 4ZIMA 3UP2A 1PKGA 2J0JA 5KKRC 3WIGA 3TZ7A 4LDTA 2ITZA 2BZJA 4IAAA 3MPTA 3ZDIA 2C0OA 1IRKA 3W2SA 3PIYA 3PJCA 5AV3A 4Y8DA 2FYSA 1U5QA 2VD5A 4CEGA 2BUJA 4JQEA 3PY3A 2YJSA 2WMWA 4X7QA 1K3AA 2JDTA 4NEUA 4M3QA 4EOPA 3NAYA 3VONA 2BFYA 3I6UA 4HZRA 4EOJA 3KMUA 4D5KA 1ST4A 2PWLA 3MY1A 5LVMA 3G33A 2XB7A 5DIAA 2CKPA 2ITOA 1KE6A 3IQ7A 2R4BA 3R9NA 2CDZA 4DEDA 3RNYA 4BIBA 4R77A 5M55A 3TUDA 3ZLYA 2J90A 4XOYA 4EK5A 4FICA 4R1VA 4LOOA 4KBAA 2WQNA 4O0YA 1W82A 1UU9A 4KA3A 2GDOA 2PULA 5AR8A 2VX1A 4EOKA 5LOHA 3DA6A 4RG0A 4YHJA 2R0IA 5AM7A 1RW8A 5EH0A 3OUKA 4WA9A 3L8XA 4A9SA 4D4SA 5EI6A 2CNVA 2Z8CA 3QL8A 4UBAA 4O21A 3O7LB 3PXQA 3LFCA 4I94A 4U7ZA 1OBDA 3V5JA 2UW5A 3P78A 4FIIA 2OFVA 3QALE 4QYGA 2QO2A 4AXFA 3GC7A 4JNWA 5L2IA 2GTMA 3BL9A 3VO3A 3LQ8A 1YWNA 5CENA 2HK5A 5LVOA 4D55A 4HZSA 2HXQA 3I6WA 2W1CA 3AC8A 3QQJA 2JIUA 4O0SA 4AZTA 3R2YA 4DFLA 2C0TA 3W8QA 4M68A 2OZOA 3VS4A 5AP5A 3UVQA 3L9NA 4KBCA 4J71A 3FI8A 5J7HA 1ZARA 4FBXA 4FKPA 3GXLA 4L43A 4YHTA 3OZ6A 1WBWA 3AC4A 4IZAA 4PL4A 1RJBA 5EKOA 3ZUUA 3HA8A 4APCA 3VW6A 2Y7JA 3DTCA 2VTRA 5KNJA 4DCAA 4KKEA 1XBCA 4O83A 3G5DA 1SVHA 3P4KA 1NXKA 3ODZX 2XVDA 4LUEA 4YNOA 5HNGA 3G0FA 3H4JA 5CQUA 3SV0A 4PL3A 3TKUA 4IXPA 5F4NA 4M69A 4ID7A 3DDPA 2BRMA 2VRXA 4I0TA 4JBOA 1S9IA 4B0GA 1NW1A 2GHMA 4RIXB 1YXUA 1OMWA 3UNZA 5HCXA 4M13A 4YLJA 4ACDA 4GS6A 2RG6A 3EN6A 4MH7A 4MNEA 2W9FB 4UY9A 3PZHA 2ZAZA 3UIXA 3LPBA 5AX9A 1W83A 5HESA 3THBA 4QMQA 5KHXA 3R30A 4EL9A 4AU8A 2Y4IB 2BDJA 5FP6A 5E7RA 4LMUA 3QYWA 4LUDA 5CSXA 4BDEA 2C6IA 2VTQA 5IA2A 3LFSA 3QTXA 5K9IA 4EH4A 1VLRA 2WMVA 3NS9A 4Y85A 2G2HA 3EN4A 4Q9ZA 4G6OA 3BE2A 4DHZA 3TNHA 2WU7A 3BYUA 5EW3A 5CSWA 3CLYA 4F9CA 5KCVA 5EM5A 5CVHA 4OTPA 4W8EA 3QA8A 3FKNA 5IEXA 3W0RA 4XYFA 4F4PA 3HEGA 3VHKA 2QOBA 3HDMA 3DZQA 4ANLA 4BKZA 4P4CA 2OIQA 5TF9A 3GGFA 4ZTNA 2E9NA 3IW8A 4X21A 3QCXA 4FTTA 3SOCA 4PMSA 4C2WA 5TR6A 4NSTA 3RCJA 2IEWA 3NCGA 4FTAA 2CSNA 4DEIA 5H3QA 1UA2A 3C4FA 3PXFA 4OAUC 1UU3A 3KGAA 3FXZA 1BLXA 3BIZA 3C9WA 5A4LA 4B7TA 5D7VA 1GNGA 3Q3BA 2YLFA 1DAWA 4HYUA 3RM7A 5M53A 2VWYA 4YJVA 5M06A 3QWKA 2YACA 5EOLA 4FSTA 4D0WA 1YDSE 2GNJA 4KINA 5G6VA 4BI1A 2YZAA 3R00A 4WKQA 5FRIA 3S95A 2PZ5A 4BICA 3ORXA 2AUHA 4DLIA 4PP7A 4GFGA 4PMPA 3V5PA 3GU8A 4NIFA 1UNHA 2OF2A 3DXNA 3NMUF 3MFUA 3SQQA 5CVFA 2ZMCA 4A07A 5HZNA 4JQ7A 4CTCA 5IMXA 2XAOA 3IO7A 3W2RA 4DFXE 3TNIA 1CM8A 4U3YA 1V1KA 1W0XC 3PVUA 4RC3A 5B0XA 3AD5A 2V5QA 4KIQA 5AP1A 2X7OA 4FZFB 4IX5A 4B6LA 4ZTLA 1H4LA 1DI8A 2CN8A 3MJ1A 3QX2A 2QO9A 4PV0A 3VS7A 4ITHA 1S9JA 3S3IA 5DG5A 2UW7A 4U5JA 2YM4A 3A4PA 1Z57A 2XYUA 4JDIA 3RZBA 4ZLYA 3F88A 1JPAA 3POOA 4JIAA 4YJUA 2XNBA 1PMVA 1ZYSA 2V55A 4RX9A 2HW7A 5T6KA 3UYTA 4C7TA 4CZUA 4PDYA 4WO5A 3BGPA 5ANKA 4DN5A 3HNGA 4QYYA 3TI1A 2IZTA 2PMLX 3QKMA 3QZHA 4FKJA 4I4FA 4LL0A 4X2GA 2WMSA 3A7IA 5IZFA 2O63A 3ZC6A 4DEGA 2PVJA 3BLHA 1OL2A 4QMPA 3MJ2A 4RWKA 1BUHA 1OPKA 2V62A 3CEKA 3PPKA 2W1ZA 2XZSA 3BHVA 5GZ9A 5HG7A 5KMNA 3W18A 4RC2A 3G9NA 5BVKA 3R7GA 4RBLA 4BHNA 3A7JA 1PXJA 3C5UA 1QPEA 3DU8A 4I20A 2FSTX 5CX9A 4DT8A 3Q6WA 2JIIA 4YUQA 4YC3A 3KN6A 5AAGA 3BRBA 1PY5A 5I9WA 4AW0A 4EHGA 3MIYA 2W99B 4JX3A 3JR1A 3KC3A 2JDVA 4UV0A 4ZSGA 4ARKA 2YDKA 4D1SA 4BWKA 2ZV8A 2WU6A 2P2HA 2C3KA 4IAKA 3HECA 5AUZA 3NR9A 1NVSA 4H36A 2E9VA 3KF4A 2R0UA 4MBIA 3DK6A 5EDRA 5M4CA 5HBEA 2C6KA 4AOIA 4D0XA 2B52A 4EJ7A 4BTJA 2XNOA 1ZYLA 4JJRA 5EYKA 3SX9A 4Y95A 3H9FA 4RIYB 2UW6A 5EHLA 2UVZA 4W4VA 3NIZA 3OWKA 4BL1A 3NUPA 2W0JA 3WZUA 1CKIA 3DKGA 1OUKA 3MS9A 4TRLA 1IR3A 2WZJA 4UXQA 5AR7A 2XH5A 1YQJA 3MWUA 2HELA 4KIOA 5M44A 5G1XA 3UOKA 3FZTA 4FIFA 3W2CA 4FVPA 1XMLA 3VUDA 3VS3A 3IDCA 3FXWA 5I9YA 3QTIA 2QOKA 2RFSA 3F82A 4I24A 4PRJA 3T8OA 1NT2A 5E8YA 2HIWA 4PTCA 4MF0A 3NWWA 2IZUA 4FNWA 3DKCA 5T3QA 4DA5A 2RSVA 2Q83A 1KUTA 5JH6A 3D5VA 1Z5MA 3N9XA 4AS0A 1VYZA 2WO6A 4X6RA 5M4IA 3DLZA 4QMOA 1WVXA 4BBFA 3ZTXA 4X2KA 4L44A 2BAKA 4E6DA 3SHEA 4KIKA 2QR8A 4HVSA 2WIPA 2CLXA 1U54B 3CP9A 4BWPA 4TL0A 3C4CA 1KV1A 3DBDA 4FNXA 4FKGA 3VAPA 5GJFA 4DBXA 3DQWA 4EZ7A 3AQVA 5FDPA 4DTBA 3FL4A 4EK8A 5A46A 4FIHA 4QNAA 1H07A 4I6QA 4Q5HA 3FHIA 3HKOA 5IQGA 2XIKA 3P7CA 5HNBA 5JZNA 3O17A 3Q4CA 1URCA 2ZMDA 2FSLX 5AV4A 5K0KA 2VWVA 3TUCA 3ET7A 3ZMMA 3BV3A 3KVWA 5CT0A 4FGBA 5D9HA 5CF8A 1Z9XA 1JOWB 4BDJA 3UMXA 3ZC5A 2EXMA 5FQDC 4JAIA 4F6UA 4E93A 4F7NA 4DHJA 4QTDA 2I0VA 3VRZA 2VGOA 3KKVA 3P1AA 5ETAA 3DT1A 3F3ZA 2CPKE 4ZY4A 3MH1A 2QOLA 3OCBA 4L68A 4QTBA 2IW8A 4ACHA 1Q8TA 2R3KA 4X2NA 4U3ZA 2XIXA 3C1XA 2Y9QA 4LOPA 3LLAA 1H00A 5EYMA 2X7GA 4IQ6A 4YZDA 2A1AB 1WFCA 2OZAB 4IVDA 2OICA 2WFYA 5JRQA 1ZYJA 5AJQA 3UO5A 5GIOE 2R3OA 4DFNA 1GZ8A 5M07A 2C1BA 4K77A 4CZYB 2GMXA 4C62A 5FLFA 3QLFA 4IAYA 1GY3A 2C47A 1YOJA 5L8JA 3ZRLA 1PF8A 2PE2A 1FGIA 2XNMA 3ZRMA 3Q6UA 3MESA 2UVYA 1OGUA 2XK7A 4LL5A 3HP5A 2VTMA 3CJGA 1PKDA 5IA3A 1UU7A 4AXEA 5L8LA 1YKRA 3F66A 4OTDA 2VWWA 5HE0A 3Q9WA 4TWPA 2QNJA 5HTBA 4QP4A 4QPAA 5LVPA 3LM5A 5CEIA 5BVNA 3BWJA 2YWPA 2EU9A 1SNXA 4JBVA 3TNWA 2B9HA 4QMZA 2WMUA 2J9MA 4GMYA 4I1ZA 3LLTA 4ZSAA 4TYHA 3FY0A 4EQUA 2R9SA 3LCSA 4FE2A 2W4KA 4O4FA 3KU2A 3E8NA 4O0RA 4FX3A 3R8VA 5HIEA 3W0SA 3E88A 3FZPA 4NTSA 2R3NA 4HPUE 4V05A 5C4KA 4FIGA 2PTKA 5J1WA 3TNPC 2OWBA 5E9EA 4YBJA 3GP0A 4D2SA 3VN9A 4Y83A 2PK9A 2VTHA 3DTWA 4RRVA 3VULA 2VTJA 3R8PA 3F9NA 2WQEA 4DGNA 3NFGB 2Z7LA 4LV5A 5DT4A 3QHRA 4C4GA 2QOHA 5IDNA 3EYGA 4CYJA 4YPDA 5AA8A 2G9XA 4YPSA 1J91A 2Y6MA 4YZBA 3ZXTA 2ZM3A 3OT3A 4BDDA 2R7BA 1B38A 2YCRA 4NK9A 3FZOA 4Z7GA 2XM8A 1H28A 4EYMA 5FEQA 4GYGA 4RIWB 4WG4A 4RVTA 5K5NA 3DLSA 1W98A 4XP0A 4JQ8A 2PYWA 3TZ8A 5HX6A 3LKMA 4W4YA 3DAJA 3BQRA 3PP1A 3HGKA 3BHTA 4FUXA 4JR3A 2OI4X 3PXYA 4MYGA 4UB7A 3NYNA 3R1NA 4FV0A 4IAFA 2C6DA 1B39A 4MUQA 3FJQE 5I9ZA 2FH9A 2YDJA 5HBHA 5LWMA 4O7ZA 5CS6A 1APME 5A3XA 4IBMA 3V8WA 3K2LA 4QYEA 5AMNA 5DE2A 4MD7E 4ZJVA 3F5GA 3Q53A 4ONAA 5HG9A 5BUEA 4C34A 2GFCA 2NNWB 4HVGA 4RWLA 4AFEA 4FKTA 4O22A 2W17A 3CKXA 1JAMA 1IEPA 4RLLA 2CKOA 2PE0A 4F65A 2R5TA 3SXSA 2XCKA 2QOIA 3HV7A 4O7LA 4DGMA 2XNNA 3A60A 5IH4A 3KB7A 2ZV9A 3JY9A 3R01A 5AP2A 1LUFA 5IH6A 2EXCX 2HZNA 2BROA 4J52A 1YW2A 2UW0A 3CS9A 4IAIA 4MWIA 2JFLA 3ZU7A 3HRCA 4Z9LA 4ACGA 4EK4A 4JRVA 2C5YA 2YIRA 4LGHA 2W5HA 3P23A 2ZFYA 3BLRA 4O7SA 1YI6A 3OOGA 5IA4A 2YAAA 4G1WA 1DI9A 5IUGA 5JQ8A 2Z02A 2LGCA 4J7BA 5LMKC 3VUHA 3ZDUA 3R21A 4EK3A 3NUSA 2BIKB 5CT7A 2IG7A 4GVAA 3W2OA 4L00A 4AXAA 4E1ZA 2E9OA 3KXHA 3DK3A 4O4CA 3SW4A 4O4DA 1P14A 3U8WA 4J95A 3E3BX 3RP9A 2AQXA 5CAQA 1FBNA 5HG5A 3WBLA 1KE7A 2C6LA 4XBUA 1H1SA 3JVSA 3HAVA 4FGRA 1GZOA 2QOCA 4IX6A 4MNEB 5EI8A 1ZWSA 1ZZLA 4FV5A 1PMNA 1ZXEA 4NM7A 3LFEA 2JDOA 3Q5IA 4FTQA 4DG0E 3ZRKA 2R3GA 3VBWA 5A14A 4GJ3A 2GNHA 1G5SA 3IDPA 3IOKA 4GH2A 4K0YA 2YCQA 4YLKA 3UIBA 2OJJA 1XWSA 3WARA 5LCKA 4L46A 5KHWA 3ZHPC 2PUUA 3VBVA 3FBVA 4UZDA 3R9DA 4D2VA 4WSQA 1UV5A 5HU9A 1OPJA 5JRSA 4GFMA 2XIYA 4YJTA 3OWPA 5L6WL 4EH6A 3ZEWA 1STCE 3UG2A 2QU6A 3KRLA 4IZYA 3W8LA 1Q3DA 2B55A 3QRKA 4XMOA 2I7QA 4QEBA 1CMKE 1XBAA 4JXFA 2ZOQA 4AOTA 4C2VA 4LFIA 3II5A 2ITUA 3IW5A 4PNKA 2C5NA 3OROA 3QKLA 3IGGA 4DH5A 3PSBA 3RK9A 4ZTQA 4Z7HA 1Y8YA 2RF9A 3HV6A 4IX3A 3WE4A 4LRKA 2CKQA 2B9FA 5AP3A 4E5WA 4DEEA 2QKWB 3EOCA 5AV1A 4OGRA 2ZB0A 2NYAA 4UEUA 4UWBA 1QPJA 5J8IA 4E6CA 5JEBA 1U4DA 3E92A 2X6EA 1URWA 4B4LA 3D7TA 2YERA 3UDTA 2R64A 2BRBA 4JAJA 3PIXA 3R7EA 2IW6A 2B1PA 2WTIA 3ZM9A 2A19B 3C7QA 4CMOA 3CXWA 4XV3A 5HCZA 2C5OA 4MWHA 4G9RA 4E6AA 3JPVA 2NRYA 1GAGA 3HV4A 4QP3A 4ZSJA 5L2WA 5A4CA 4M7IA 4QP1A 5LJJA 4BCIA 4KRDA 4V0GA 4CT2A 3CCNA 3IOPA 3MV5A 2ITTA 4E4LA 3OVVA 3C0IA 4XG9A 3S1HA 3I7CA 4ERKA 2GNIA 4X6QC 3FKOA 3ZS5A 1Q3WA 2B53A 1LEWA 4MD9E 4HYIA 2WGJA 4WRGA 5EI2A 4XNEA 3VS1A 3QCYA 1ZOHA 3F61A 4BI0A 3G51A 4UMPA 5KBQA 4CG9A 3OY1A 5J95A 3ZSGA 2Y0AA 3P5KA 1E9HA 1PXLA 4M84A 4BGQA 5K0XA 4AWIA 3QRJA 3WF9A 2W1FA 1OVEA 3KQ7A 3QXPA 5EW8A 4YZNA 3V8TA 3VHEA 5CU4A 2CCHA 3MVLA 4CXAA 3UNKA 3RI1A 2GU8A 4ERWA 2ETMA 2JKQA 4FZ6A 3ORZA 4AG8A 4NWMA 3CTJA 3FE3A 4NW6A 4FZ7A 2ZB1A 3ZLWA 2HWOA 3W0PA 4E7WA 3KXZA 3COKA 3ZSIA 5EQEA 4FTOA 5F95A 4BCHA 1FGKA 3EWHA 3FI3A 4XG8A 4BDAA 3DB8A 2QD9A 3KA0A 5E8XA 3KFAA 4ZAUA 2ITYA 4JBPA 5ANDA 4WNKA 1WZYA 4WNOA 3EN7A 4BHZA 3A2CA 1OUYA 3DGKA 5E90A 3WZEA 3BZ3A 2X9EA 5CEOA 3QCQA 4XV1A 2C6OA 2R3MA 3VQUA 3VC4A 5BUJA 1REJA 4BDKA 5A4QA 3NCZA 5E8VA 1WAKA 4PUZA 1OL6A 4EOOA 3NW6A 4G3EA 3F5UA 5B2KA 3M11A 4ZMFA 2QVSE 1BL6A 1SNUA 2JBPA 3FI4A 4GU9A 1DAYA 1LP4A 4U45A 5J5SA 4DH8A 3GC9A 3W2PA 3EQGA 2CLQA 5LVNA 4GW8A 4ZMEA 3CPCA 3LW0A 3F2AA 3VUIA 2GS6A 5IEVA 2C0IA 5DFPA 5M4FA 3MIAA 1JQHA 2X4FA 2BHEA 3RALA 4EQMA 4I0SA 3CPBA 3DZOA 1ND4A 1WBSA 3R71A 4FEQA 2XMYA 4WIHA 4TW9A 4K6ZA 5JGBA 5AIRA 3OEFX 1JSTA 4ASEA 4ASXA 5KMKA 4YZCA 1FOTA 4Q9SA 4BDBA 4BIDA 5H9BA 1XJDA 3FMMA 4BBMA 4F6WA 4GJ2A 2A2AA 4ZS4A 4XG3A 2WTJA 3PRIA 2OO8X 4EWQA 1HOWA 2Y4IC 4FNZA 5FDXA 3OS3A 5M57A 5TE0A 4IC7A 3SG8A 4EBVA 2QHMA 3WF8A 3ZXZA 5EQPA 2F7ZE 3GOKA 5K4JA 5J9ZA 4HNIA 2PZPA 3WE8A 4TZRA 4XJ0A 2YZLA 3QD0A 4XS2A 3FC1X 3IK3A 1KOAA 3CQWA 4C59A 3O50A 3V51A 2BRNA 2PVRA 3DJ5A 3DFCB 3FLYA 4KIKB 3ORNA 4MXXA 1EH4A 3TWJA 4RZVA 4RGJA 3CC6A 3IS5A 4C4JA 3V5LA 5FXRA 2WXVA 1XHAA 3AC2A 3BI6A 4IHPA 3SRVB 2W1HA 3GEQA 4YNEA 1H08A 4QMUA 4AN2A 3Q04A 1W7HA 3EQCA 1OB3A 3TV6A 5EHOA 4UN0C 3UMWA 2VV9A 4FTMA 5HICA 4MQ2A 2XK4A 1WBPA 2QG5A 5CF4A 3N4VA 2IVSA 3ANQA 5EKNA 4IE9A 5CYIA 2BAQA 4FSQA 5F20A 3EQFA 3ULZA 3NX8A 4FOBA 4O0XA 5E1EA 3O8UA 2VN9A 1GIJA 5IU2A 2CGUA 3OXTA 4FKUA 1QPDA 3MGYA 4C36A 5LQFA 2CCIA 4RJ8A 5CXHA 4AN3A 5GHVA 3HA6A 1UWHA 1YXSA 4MCVA 4PP9A 3LIJA 5AWMA 4L3JA 4DCEA 3HUBA 3ORIA 5EYDA 4O7RA 3PG1A 5CU2A 4CRSA 4C0TA 2UZDA 2VNWA 4IVAA 3W33A 2PPQA 2WTKB 3UYSA 3GENA 4CV8A 4BCJA 2P0CA 4G5PA 5ETCA 5C26A 4AGCA 4C3PA 4QT1A 2XK6A 3MFRA 3ORMA 2EB3A 4RX5A 4Y46A 2WTVA 5HVYA 3WOWA 5KMIA 1HCLA 5ACBC 2C5XA 4EHZA 4JR7A 3ELJA 5BVDA 3LHJA 4RVLA 3GQLA 3B2TA 1SM2A 4XG7A 2RIOA 3BE9A 4AACA 3UDBA 4EH5A 4FEUA 3IW6A 4BF2A 1SYKA 4U79A 2KULA 1OIYA 3W0OA 3JXWA 2PUNA 4YSMA 4OT6A 2GPHA 3TNQB 3A8WA 3MH3A 4F09A 4YZ9A 4L3PA 1H8FA 4FT5A 3PP0A 3Q96A 2G15A 4IACA 5CQWA 5EHYA 3HX4A 4O7NA 4N6YA 5JKGA 2F7XE 2PVMA 3NLBA 3EZRA 1MP8A 2YIWA 2R3HA 3B8RA 3M1SA 3R63A 2G2FA 2PUPA 4FK6A 2FGIA 1JKTA 1YHVA 1Q61A 5ACKA 1PJKA 1ZYCA 3A7GA 3CBLA 4QMTA 3V01A 2X6DA 5I9VA 3QTWA 5DA3A 3MFTA 2BILB 3ZO4A 4CFWA 3HAMA 1XH6A 1JKSA 2G1TA 4DC2A 3V5TA 4N57A 2C3LA 2OJ9A 3O7LD 5J1VA 5HIDA 3G6GA 3ODYX 2X0PA 5FUTA 4IZ7A 4PQNA 4GK4A 3TDWA 4A4LA 3CQEA 3W1FA 5CEQA 3P08A 2YEXA 3MA6A 3CGFA 2WOUA 3QGWA 1Y57A 4OTRA 1PXOA 4D2PA 3UDSA 2I0HA 4FEVA 3FDNA 5EQYA 3FLWA 3FWQA 4FSWA 2ERZE 5CF5A 2XK9A 3CIKA 5GNKA 5HNIX 4I93A 1YOMA 2HY0A 5BX0A 4YO6A 4AGWA 1R0PA 5DI1A 4F9AA 4AT3A 3OC1A 3O23A 4KKGA 4C4IA 2PUIA 3ALOA 2OFUA 2XP2A 2BKZA 4D2TA 4FK3A 4C8BA 3PJ2A 5ANJA 2JAMA 1IG1A 2PY3A 4HGEA 4QMVA 5C03A 1W2FA 4JDKA 5M09A 4QMMA 2B9IA 1HCKA 5ETIA 3A7FA 3VIDA 2E9UA 4MAOA 3R8ZA 3V04A 2XNEA 4FTLA 3CQUA 3ROCA 1O6LA 4FSYA 3UPXA 1TFFA 1CKPA 1ZYDA 4QPSA 5FTQA 3R8UA 2VTNA 2C6EA 3VS2A 3TJCA 3RAHA 1JSVA 3QZFA 2VWZA 3V8SA 5IPJA 3UNJA 3GI3A 2WMXA 2I40A 2X1NA 4IB0A 4JDJA 4TNBA 4O2ZA 4UALA 3RHXA 3NGAA 4IW0A 4LV8A 3TM0A 2QR7A 2WMRA 4F9YA 3BBWA 5AR5A 4ZEGA 5IF1A 4TT7A 4YC8A 4WNPA 4X3FA 3OWLA 5KO1A 2H8HA 2UW9A 4EKLA 5DT3A 5IQCA 2FSMX 3ITZA 4BWXA 4P7EA 3BV2A 4YC6A 1FMOE 3FPQA 4GFOA 5IA0A 2OIBA 4E20A 3U54A 4LYNA 3ALNA 4FT9A 5HE1A 4TPTA 5DPVA 4BY9E 2G01A 5AP0A 3BWFA 5AA9A 3QRUA 3BYVA 3RM6A 3ACJA 1U46A 2YFXA 4ZSEA 3UQGA 4L6QA 3PXRA 4FV1A 4RMZA 5IQEA 5IG1A 1W8CA 4BDFA 5ETFA 2PVFA 4G16A 3R7VA 2ITWA 3UG1A 4NFMA 4YJRA 4JBQA 4NFNA 4EYJA 5HKMA 2GQRA 3FQEA 2R3LA 5AP4A 3MBLA 3GU6A 4IMYA 3R83A 3UC4A 3ZUTA 3P86A 2GHLA 3NIEA 1OI9A 3LXLA 4IH8A 1XBBA 2W5AA 3OP5A 4O2PA 2P3GX 4U43A 2W1EA 5LMKA 2ONLA 1Q62A 3F7WA 3QD2B 1UKHA 3R6XA 3A99A 3VJNA 5DR6A 4BCNA 2YM6A 3AG9A 4C3RA 4RQKA 3GFEA 2FB8A 2JKMA 4R8QA 5HX8A 5J79A 5A6NA 4G3GA 1ZY5A 3R22A 3U55A 3R9OA 4I6LA 2BDWA 3VRYA 3QFVA 1WBTA 3L1SA 1ZMWA 4FSZA 4LRJA 3TZ9A 4FSMA 4L52A 5HE3A 2Z7SA 5JFXA 5F9EA 1B6CB 5BVOA 4C38A 5KUPA 4CCBA 4YO4A 3TYKA 5I4NA 3BLAA 1XH7A 2BTRA 4BGGA 2VAGA 4TWOA 4CYIA 4FTNA 2NO3A 2HOGA 3BEAA 2XBJA 3IPHA 1SZMA 3PPJA 4R5SA 2PMIA 3TXOA 4XV2A 5E8SA 5AUYA 5D1JA 4I92A 4BJJB 1GIIA 2X2MA 4EORA 3QQFA 4G6NA