4F4PA

Syk in complex with ligand lasw836
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
273
structure length
262
Chain Sequence
LDRKLLTLEDKELGSGNFGTVKKGYVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase SYK
publication title Highly potent aminopyridines as Syk kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 262
sequence length 273
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4f4pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4f4pA01
3R83A 3CSVA 3NNVA 4AOIA 3AC1A 1Q5KA 2J0IA 4PL5A 3HVCA 4X6QC 4YSMA 2IVSA 4KINA 2ZV2A 1MQBA 4L6QA 4XG2A 3VVHA 4YTIA 5EI2A 4ASDA 1ZOEA 5DWRA 4HVHA 5JGBA 4ZJVA 3NUYA 4L45A 3VF9A 4LMNA 3AQVA 3UOLA 4OT5A 3DBQA 4CKRA 4FTMA 4G31A 5HO8A 4E6QA 5L6OA 5L8LA 2UZWE 3E92A 3NYVA 2GQSA 4J1RA 1IAHA 2W99B 5ANDA 2GHGA 5HIBA 1UU7A 2BTSA 5DEYA 3ID6C 3Q9WA 3C0IA 3A4PA 4JJRA 3GC8A 3MWUA 3FKLA 4KSPA 2UZTA 3QUPA 3VUMA 5GZ8A 4ORKA 3EB0A 5L6WL 3O96A 4GT4A 4LRKA 5EW3A 2VU3A 4DINA 4IAZA 3DAJA 4FTAA 4FZ7A 4JR3A 2JDOA 4AXAA 4R7HA 2CSNA 3ATSA 1PXLA 1SZMA 3D7TA 2IWIA 5E90A 2OJJA 4IIRA 3T9IA 3O8UA 3UZPA 5CASA 2OBJA 3N4UA 4DEEA 4RVMA 2UZNA 4EKKA 4V04A 2JKKA 3EYHA 5IA4A 2VWYA 3EFWA 3ZM4A 4EYJA 3TKUA 3D5VA 3GU5A 4K8AA 3K3IA 2YFXA 3UQFA 1MRUA 1ZYJA 4KSQA 2XIRA 4R5SA 4EUTA 2H9VA 3V3VA 3BRBA 1CM8A 3JUHA 3LXNA 5DMZA 3CEKA 3R8MA 2P4IA 2XK4A 4NEUA 4L3PA 1U46A 1GNGA 3DKOA 4YPDA 4XP2A 4AGUA 3CY3A 3FDNA 2OU7A 3DKGA 5CI7A 4E20A 2VTRA 4FX3A 3F7WA 4DH1A 1CMKE 1GAGA 2VTJA 3O50A 5CAQA 5GIOE 3DTCA 3V6RA 2YISA 5CU0A 3FZTA 3PSBA 4BKZA 3QKMA 3SGCA 2W5BA 3P23A 5CSHA 2ITPA 1YXUA 2YACA 3AC4A 5K4IA 3D2IA 3R63A 4EJNA 4FKUA 3H9OA 1XJDA 2ZM4A 3R7GA 4F1OA 3EZVA 4RWJA 1B38A 3R7YA 4Z7HA 1Q24A 3VWAA 5AP6A 3LCDA 3Q4ZA 5AR5A 3U4WA 3WBLA 3D94A 5DT4A 4IWDA 4NTTA 3L8XA 4C38A 2YITA 4O86A 4G9RA 4WOVA 3QHWA 4CYIA 4P90A 3MVLA 2O64A 3NWWA 3QZGA 3COIA 2NRYA 3T8OA 5DT3A 2HOGA 3DXQA 2VO7A 1R3CA 3C4WA 4KBCA 2WFYA 3AMAA 3SC1A 3NCZA 1FINA 3GXLA 3NVKI 2WTVA 2JDRA 3GCQA 2ETMA 2E9OA 3Q5ZA 4DBXA 3QC4A 4FSTA 2RGPA 3GBZA 3QTXA 2PVYA 4AT5A 4WUNA 2DWBA 3ZEPA 3NLBA 4R7IA 4EK6A 2VTTA 2XEYA 4YNEA 5AJQA 3RAHA 4MHAA 1R39A 4FE2A 3VN9A 4C62A 2YM3A 3GC7A 3RK9A 3G90X 3DBFA 4KRCA 4PY1A 3P7CA 4TYHB 5BUJA 1CTPE 3RMFA 2CLQA 1Q8UA 2EB3A 1NVQA 2W96B 3CGFA 3FC1X 3FKNA 4FKGA 4GFOA 4JRNA 4UZDA 4BFMA 4FA2A 5M56A 5IPJA 2FSLX 3E8NA 3UO6A 5ANOA 3C4ZA 1RW8A 3ULIA 4EH4A 3FQEA 4BDDA 2WO6A 5I3RA 4HGLA 3KXXA 3QRKA 4HJOA 5I0BA 4LI5A 4LRMA 3PY0A 4XG4A 3WIKA 2ITZA 2XEZA 1GOLA 1PJKA 2X2MA 4YZNA 5JH6A 3F3WA 4O0UA 3COHA 3IECA 3QQJA 4EC8A 3U4UA 2X7GA 4YTCA 2A4LA 1FQ1B 2W4KA 2RSVA 1R1WA 4LOPA 5HLNA 4IBMA 3VQUA 3OWJA 2GNIA 4HGTA 3QQFA 4TTHB 4HZRA 3GENA 1RJBA 3IO7A 1G8AA 5DPVA 1U54A 1XBBA 3G6GA 4IADA 5CZHA 2CNUA 4FTJA 3IDBA 3IGGA 4RA4A 3F6XA 3BLQA 3BYSA 3SOAA 4YU2A 3AC8A 1NXKA 2XK9A 3KXNA 1KV2A 5HOAA 5I3OA 2VTQA 2WIHA 4JBOA 3Q6WA 4WT6A 4QO9A 2ITXA 3R7EA 3LMIA 2F2UA 3KMUA 3PVBA 2J2IB 4WBOA 1O6LA 2RKUA 3FE3A 3CD8A 4F4PA 4K6ZA 3UP7A 4H05A 5AA8A 3UIMA 1Q3DA 4MEDA 5EHLA 3WI6A 4IX6A 4BICA 4XRLA 3WF5A 2B0QA 4JR7A 5LARA 4LV8A 3ZYAA 2X2LA 3NYOA 4V05A 3NUUA 4XV3A 4BKYA 2UW6A 5HIEA 4FV2A 3OOGA 4MXOA 5L8KA 4W8DA 3U87A 4JLCA 4IAYA 2CPKE 4TNBA 3W2PA 3R22A 4CFNA 4R77A 2QLQA 5CT0A 4P5ZA 2WTKB 4U40A 3CC6A 1ZLTA 3WZUA 3HEGA 4AAAA 4MH7A 4LOQA 3VUGA 3LQ8A 2WMQA 1UVRA 5AUYA 4QPAA 3VS3A 2PUIA 1FOTA 2XH5A 2J0JA 4WIHA 3TUDA 3WYYA 3AT2A 3OC1A 4IACA 2JDVA 3E93A 3QLFA 4XNEA 5EI8A 5FXQA 4EZ7A 4DITA 3QA0A 3EN6A 2XNPA 1W82A 1GIJA 3PYYA 4IDTA 4QNAA 4MXXA 3RJCA 4XMOA 5EM5A 2PVJA 2ETKA 4O7TA 4KB8A 4QQ5A 2I6LA 5CVGA 4FTIA 1BI7A 3TZ7A 3IDPA 4OLIA 3MY5A 3ORMA 3NMUF 3UIUA 1NVRA 4HPUE 3RM6A 4DEDA 5J7BA 2EB2A 2HIWA 4U3YA 3UNZA 4OTIA 2LGCA 5JFVA 5IZFA 3VULA 3Q60A 3KU2A 3NVMB 3D5WA 2VWWA 3H0ZA 3PA5A 5TR6A 1PXIA 4Y5QA 1PHKA 4Q5EA 3COMA 4AE9A 4AACA 4FG8A 5J87A 3HV3A 3FMLA 3K2LA 2Z8CA 3I4BA 3OROA 4RWIA 5DE2A 3FSKA 2ZOQA 2XKDA 1F5QA 2JITA 3GC9A 3NUPA 3NUSA 4FV8A 4M13A 3VUDA 2GMXA 4YGAA 4AW1A 4D28A 2ZV7A 4GT5A 4Q9SA 4IX3A 4BL1A 3BLHA 3FHIA 4D4YA 4FYNA 4I24A 5AFVA 3QTQA 5IISA 4RJ7A 2PVNA 4JBQA 4XX9A 2VWZA 5AV2A 1L8TA 1ZYCA 5FBOA 4CG9A 4XG6A 4JBPA 2I1MA 5AUTA 3JY9A 1H1PA 4BIBA 4C4FA 5A46A 5D41A 1XQZA 2QCSA 3AMYA 1JWHA 4AW2A 4GRBA 1Q8TA 3HZTA 3M42A 2IVTA 1NT2A 4O0VA 2ITUA 5D10A 1HCKA 2X6EA 5FM2A 4BTFA 3OXIA 3QU0A 4A9TA 4R3PA 5A6NA 5E8VA 2BAJA 4HYSA 3UDBA 2YIYA 3GOPA 2PZIA 2YERA 4JG8A 2IZTA 2JKQA 2WKMA 4O7WA 3C4EA 4IZ7A 2X2KA 4MD9E 3OW3A 5FXSA 4C02A 5F4NA 2UZLA 2XNOA 4XRJA 5BVDA 3KF7A 3H0YA 4R1VA 2R5TA 5J79A 3CPCA 1DI9A 2W9FB 2C5YA 4DH3A 3ORPA 2XKEA 4PTGA 4QMNA 3TZ8A 4PDPA 2WMBA 4MWHA 3VNTA 3ZRLA 3EQDA 2QVSE 4TN6A 3DTWA 3QRIA 4B4LA 3FY2A 5CT7A 4I94A 4IC7A 3PIZA 3M2WA 3QD0A 2GS7A 4ZSGA 5F20A 5KMMA 5M08A 5HG7A 3R9NA 5E7RA 3FZPA 5A6OA 3ELJA 4CTCA 1XH6A 4OBQA 2BRMA 4DEIA 4EH2A 1PY5A 2BROA 2GNHA 2H96A 1JSUA 3B8RA 4RX8A 5D7AA 3RZBA 2O5KA 4O7LA 3FV8A 4BVUA 2Y7JA 2F49A 4KIQA 3NR9A 3ET7A 3WARA 3PJ1A 5EG3A 4BHNA 4DFUA 3R2YA 5C03A 1OITA 3LJ0A 4EH9A 1WVXA 4CVAA 3C5IA 3RCDA 2Z7SA 2GQRA 5BVKA 3KEXA 2LAVA 3RTPA 4D2VA 3TM0A 5CY3A 2F57A 3KCKA 3PPJA 3HECA 1PKDA 4R1YA 4F63A 4YO4A 3DY7A 3MV5A 4G3CA 3SXRA 2YDJA 3OY3A 5CXZA 5JFSA 5AUVA 3L9PA 3PXRA 3DLSA 3CJFA 3EQGA 4EWQA 4FIEA 4G6OA 4W9XA 5L4QA 2IG7A 4LMUA 3GU6A 5JKGA 3F69A 3RINA 3VS4A 2YWPA 4IDVA 5DHJA 3HV5A 5HE0A 2QOLA 4ANLA 4NM3A 3JVSA 2BDFA 2XNEA 3KULA 4F0FA 3BELA 1YWRA 5HVKA 2CKOA 1XBAA 4UMUA 4KUJA 1NY3A 1M7NA 2B1PA 3R28A 4USDA 4EQMA 4UXLA 4ZS4A 3C1XA 3ZRMA 1MRVA 2HXQA 3FMNA 4BBMA 4LGDA 3GQIA 4IW0A 3QALE 4FSQA 3UYSA 4J71A 4G3DA 4II5A 4I0SA 4N6YA 4H3BA 4ZP5A 5GJFA 4M84A 3ZONA 3U6JA 4CG8A 2QR8A 3TJDA 3I79A 1YWVA 2YM5A 4LV5A 3O7LD 4AP7A 2BAKA 4F09A 4C0TA 2RFSA 2ZMDA 2ZDTA 3LW0A 3OHTA 5AIKA 3ZM9A 2Y4IC 1OKYA 4GVAA 3TV7A 4DG2E 3NNXA 3IOPA 3Q53A 4GFGA 2ITVA 3PJ3A 3ZZWA 2PVHA 4QP6A 2IJMA 4OUCA 3PIXA 5E91A 4BIEA 3R6XA 4XOYA 3H9RA 5M44A 3P86A 4DFNA 3JR1A 3HMIA 3P0MA 4I22A 4CFWA 4FTNA 1H25A 5K4JA 3SXFA 3ZXZA 4F64A 2FGIA 2VRXA 4PL3A 4U45A 5HNBA 5HBHA 4DHFA 3ETAA 4FKVA 4FUXA 1WVWA 4MXCA 3FZRA 1U59A 2X39A 5EHOA 5CSPA 3IGOA 5CNOA 3D7ZA 3SV0A 4CNHA 3UZTA 4PMPA 3UC4A 3N51A 4DFXE 3SVVA 3PJ2A 5AP2A 4CEGA 3MJ1A 5L2SA 4M15A 3AOXA 4AZWA 3FI3A 4GK4A 3TUCA 4EQUA 3GCSA 3LXPA 1ERKA 4OTDA 4ZIMA 4A9UA 3RPSA 3U51A 4S30A 3ORLA 1MP8A 3M1SA 1OB3A 5DVRA 2YIRA 4KIOA 1JVPP 5KO1A 3HA8A 4F7JA 3QTSA 2YCFA 4L9IA 5HU3A 3KXZA 3LCKA 2E9UA 3HMOA 2IW6A 3S0OA 1PXOA 5K0KA 4FIJA 5HORA 2JBOA 2HYYA 4J97A 4KA3A 4O96A 5G6VA 3HAMA 5C4KA 2PWLA 3S1HA 3DDQA 4X2FA 2I0VA 3Q4TA 3VQHA 4S31A 4TZRA 4W4YA 2AC5A 4O0RA 5AV1A 3TUBA 3L9NA 4AFJA 1OMWA 4TYHA 3DNEA 3RPYA 2OZAA 5HKMA 2J4ZA 3BIZA 2OKRA 2BIYA 5HD7A 4BCFA 3FPMA 3WE8A 2DQ7X 1M17A 4FIFA 4IAFA 2JLDA 4Y83A 3RAWA 3HMMA 4MD8E 3LFSA 1ZOGA 4BWKA 3W55A 2CN5A 3VJNA 2QD9A 4U8ZA 4IFGA 4WG3A 4FK3A 4BGHA 2C3IB 3FYKX 5JEBA 1H1QA 3S2PA 2X9FA 1CKPA 4UMPA 5I5ZA 1MUOA 2CN8A 3TT0A 4CFUA 3I60A 1PXMA 3KVXA 4ASZA 4TYEA 3HRFA 2CNQA 1KSWA 2R3JA 2PTKA 3H9FA 3C7QA 3Q32A 2WMAA 5GIPE 4UN0C 4C4JA 3MB7A 5CLPA 4N6ZA 3V8WA 3WOWA 1JNKA 4ASEA 4MK0A 2XB7A 3G15A 4O6EA 4EL9A 4RC3A 5EQYA 3BE9A 4CD0A 5L6PA 4B7TA 4QMQA 2IZSA 3AD6A 4IX4A 4JXFA 4KNBA 4WG5A 2QKRA 3SD0A 1YXXA 3E8EA 5I9VA 4FZAB 3CIKA 4FTRA 3HRBA 3HX4A 3QTWA 4FKIA 4A4OA 3QC9A 4O0XA 5CEQA 4BB4A 5EFQA 5A4EA 2JC6A 5AUWA 5LVNA 4EOQA 1E1XA 4RZWA 1SYKA 1H0VA 3Q52A 1ZYLA 2W1DA 4XEYA 3ZMMA 3L9LA 3BV2A 3OT3A 4D2PA 4XYFA 2FSOX 4BCHA 3KXGA 4CMOA 4I20A 2C6TA 1OUKA 4DGOA 4ASXA 3RP9A 1ZZ2A 2XIXA 1YDSE 2UVXA 3PRFA 4IWQA 4FR4A 3LFQA 3POOA 5EDQA 5KZ0A 4IVCA 4BDCA 3F3VA 4DFYA 5AAEA 2EWAA 4PUZA 4I5CA 4FBXA 4U42A 4F7LA 5BVOA 3GGFA 1H00A 3KF4A 1ZMVA 5HI2A 3PJCA 3FZOA 3WF9A 4O0SA 1Y6BA 3GC0A 4JG7A 2XYUA 4DC2A 3TI1A 1JKLA 3QTUA 4WSYA 1NA7A 1U4DA 2X1NA 2H34A 4NM0A 3DB8A 5CU3A 4C3PA 5FM3A 4HW7A 4NIFA 4YUQA 4FSWA 3DJ7A 1YI6A 3LJ1A 4J8NA 5E8YA 3W33A 5L8JA 3MTFA 4FEUA 3LCTA 4YJSA 4S33A 3UODA 2B7AA 4YC6A 3OEFX 3V51A 4CZYB 1H1SA 4HVIA 2QHMA 1ZY5A 4R7BA 1OPLA 1XH7A 3H4JA 2WU6A 3ZLWA 2GS6A 3DDPA 4IM0A 2CGWA 5ETFA 3OUNB 2A0CX 3G0EA 2C0TA 3KGAA 4IE9A 4NU1A 4D0WA 4F7NA 4ARKA 4OTPA 3JVRA 3VRZA 1LPUA 3LFNA 3UOKA 3FI8A 4JIKA 3VS5A 1H08A 4M69B 5M57A 3TV6A 1WAKA 2PPQA 2UZDA 3R7IA 4R78A 1Q3WA 2W06A 3P4KA 4XP3A 4QD6A 1BL7A 2VTNA 3OWPA 4GL9A 3A60A 4BDBA 4DT8A 2VWUA 3FY0A 4YC3A 3ZHPC 4ZMFA 1V0OA 3TTJA 1Q41A 5BVWA 2DYLA 3NSZA 4D5HA 5KX8A 1WBTA 2VD5A 4BTJA 4CRLA 4GG7A 1JSTA 4QP3A 4D4RA 2BZKB 3LKMA 3GCVA 3ZXTA 2R3HA 3TZ9A 3NIZA 5CTPA 3KMWA 5J9YA 3KRXA 3NUAA 5ACBC 4Y85A 3I0OA 3WYXA 2XVDA 1BKXA 5IQDA 5AR7A 3LFEA 4FIGA 2EXMA 4I6FA 4MNEA 2W4JA 4U41A 3VRYA 1R78A 3ORTA 2XJ1A 3JY0A 4O0YA 5DI1A 4DH5A 4EK8A 5IQGA 2CDZA 2BUJA 5J5TA 5E4HA 4YZ9A 3NZ0A 4HPTE 5FLFA 1SVGA 4E8AA 1OL6A 5E1SA 3EQIA 5GJGA 3DKCA 5AM6A 4BBFA 3DLZA 3FXWA 2PVKA 5IUIA 3WF8A 4DLIA 4YTHA 1J1BA 4ZOGA 3COKA 2VTIA 5IUGA 3PPZA 4RQVA 4AZTA 4MKCA 2KULA 2OLCA 4RIWB 2W5HA 2YWVA 3UNJA 2A1AB 4QYFA 4XLVA 2QG5A 3OMVA 3PPKA 4OR5A 3WE4A 4O7YA 3CCNA 1P2AA 1KOBA 5BNJA 3LXKA 2X4FA 3F82A 5I9XA 4FTUA 4RIXB 5CXHA 4J8MA 3UGCA 3UP2A 4ZZOA 3AGLA 3M11A 3ORIA 3BPRA 4I23A 4DG3E 4ALVA 3WZJA 2G15A 4YTFA 4D2WA 4O82A 3R7VA 2C3LA 1WBOA 3DZQA 2XNGA 4FUYA 3I81A 3R0TA 2P3GX 4HZSA 4B0GA 4O0WA 1ZZLA 5J7HA 2XIZA 3BEGA 4L52A 4BI1A 3FI4A 3CXWA 3MGYA 4GUEA 2XKFA 4ZTRA 2GHLA 5IA0A 5LJJA 2YIXA 5GNKA 3VBQA 1M2QA 2VX1A 4LUEA 2XCKA 4B8MA 2BRBA 3F88A 3QCSA 4BDHA 2YM4A 3A7IA 3BU6A 4LRJA 4LGHA 2F7XE 5ANKA 2BFXA 2EUFB 4QMPA 1STCE 3F2AA 1YI3A 3JS2A 4FOBA 4GIIA 2W4OA 3CTQA 3MESA 4PRJA 3Q2JA 4EJ7A 5GZ9A 4CQEA 5DGZA 4YPSA 5HNGA 5H9BA 5HU9A 2JDSA 2QOKA 2VO3A 4MYGA 3UQGA 5EYMA 4IAIA 4CZUA 2ZYBA 3I5ZA 5F94A 2Z02A 5LOHA 5HGIA 3MPTA 2UV2A 4BGQA 2G9XA 2C1AA 2YM6A 5GZAA 3W2OA 1XH5A 4RJ8A 1OPKA 5HTBA 4EHGA 3OT8A 4U6RA 1PXJA 4BCPA 2WOUA 1IAJA 3A7GA 3KL8A 4QMTA 1GZOA 3QTZA 2A2AA 3CD3A 5E9EA 4GK3A 4L53A 4XH6A 3SXSA 5EW9A 3I6UA 2HENA 3K54A 2VUWA 4EORA 2JKOA 4QYYA 3ZUUA 1PYXA 2PY3A 4K9YA 1YI4A 3NCGA 3R2BA 5C1QB 3UQCA 1OPJA 2NO3A 5M07A 4ENYA 5HEZA 4XS2A 4LM5A 4JOAA 2GQGA 4BTMA 2OF4A 3FMHA 3HAVA 4R5YA 3FI2A 3ZSIA 5HTIA 3G51A 5CSWA 3N9XA 5HIDA 1NW1A 4C33A 4D1XA 5AAGA 2WQNA 4BKJA 4CZTA 3F2NA 3AD4A 3VUTA 2X8DA 3QQGA 4QRCA 1Z9XA 3QRTA 3TL8A 5AP1A 1XH8A 1QPJA 3O17A 5D7VA 2HW7A 5HG8A 5E8UA 4C37A 5D11A 2GDOA 3A99A 4FT5A 4RJ3A 5AUXA 2C5XA 1YQJA 4G5JA 3GFWA 5AX3A 2XMYA 5CF8A 4ZTNA 1YHVA 3KXHA 4DGLC 4P2KA 4EK5A 3HV4A 3IONA 4RWKA 2BDJA 3SAYA 4HGEA 4EH6A 3PA4A 5KMLA 4CFMA 2X8EA 3R01A 2AUHA 4M68A 3QZFA 3SRVA 4CKJA 2XBJA 4JQEA 4YZDA 2G2IA 3P7BA 1J7LA 2ZM1A 3BGPA 4YC8A 5EH0A 4FL2A 2UZOA 2VTOA 3F3TA 4GKIA 3FLWA 3IPHA 4TYGA 2UW4A 3L9MA 2GNLA 4LFIA 3HV6A 4JAIA 4QMYA 5CYIA 5L2TA 2P2HA 1WCCA 3TXOA 3ZRKA 4BRXA 3BLRA 1H4LA 2W1GA 3ZSHA 1H27A 3QWKA 3MVMA 1OL2A 4IMYA 5IU2A 2QG7A 5H2UA 3FBVA 4HCTA 4XJ0A 4YJRA 4LOOA 4V01A 4W9WA 3TKHA 2HWOA 2W05A 3BCEA 4DE4A 4OAUC 5AWMA 2F2CB 4PDOA 2IPXA 2BIKB 4O6LA 2JKMA 3ACJA 1B6CB 5DT0A 5A3XA 4RJ5A 3DQWA 2WMWA 1W84A 4RFMA 3HA6A 2J0MB 3QQHA 3LVPA 3RPOA 5LMKA 3AD5A 3F5XA 4O21A 4PP9A 4AA0A 4PPBA 1J7UA 3V5WA 5JGDA 2J50A 4W4XA 3EKNA 3U9CA 1A48A 4IAAA 3ALOA 3DXPA 1SNUA 3E8CA 4BZDA 2X0GA 2YCSA 2BZIB 3QKKA 3DAKA 3Q5IA 4ZJJA 5TO8A 2C5VA 4B99A 3E5AA 3PE2A 5CAPA 4F6UA 3NW5A 3WILA 4FSYA 3NYXA 3KKVA 3PWYA 2OJ9A 3NIEA 4FEXA 2UUEA 4LL0A 3ORZA 4MF0A 1XH9A 1A9UA 4HYHA 4AUAA 3ULZA 4C4HA 2JIVA 3BYOA 1YHSA 4USEA 4BCMA 4O0TA 5CSXA 4IB5A 3VUIA 1PW2A 2ITWA 2VWIA 4IJPA 3C50A 3QHRA 1GIIA 4PX6A 4QTAA 4JIAA 4EWHA 2QOCA 1IG1A 3ZO2A 3PVWA 4EK3A 5LMBA 3R8VA 1DAWA 2XZSA 4RA5A 3OOMA 2WMVA 4WNPA 5IA2A 1QPDA 4WNMA 3OF0A 4A9YA 1H0WA 1OUYA 3G0FA 5HE2A 2A27A 3AT4A 2WU7A 5KHWA 4FV1A 3S00A 3R8ZA 2XJ2A 4PP7A 3BQRA 4H39A 3V01A 5HG5A 4QT1A 4YMJA 4GUBA 4G16A 4M66A 4GS6A 2OXDA 2Q0BA 3DQXA 5DIAA 4CFFA 2XUUA 4APPA 2FO0A 4MCVA 4F1TA 5LMKC 5IQHA 4IB3A 3AC2A 2GU8A 4FOCA 4BZNA 4FSNA 3OCBA 3UE4A 4TWPA 2UZUE 3EWHA 4I6HA 3W8LA 3EL7A 4FV9A 3FUPA 4NM7A 2R3MA 4RIYA 5AIRA 1Z5MA 3FQSA 3RHKA 3ZUTA 2R4BA 4ZLOA 5BMMA 4EOLA 3MH3A 4XLIA 3LZBA 2C6IA 1H28A 3TN8A 4EOKA 2WPAA 5HCXA 3VBWA 4Y73A 1Y8GA 3RAKA 3DZOA 2Z60A 3EFLA 2AYPA 2KTYA 3QD2B 4BYIA 3UG1A 3QBNA 2GNJA 4QQJA 2C47A 2Z7LA 4TWNA 3HMNA 2B9FA 2ONLA 4QMMA 3TJCA 2CNVA 4RQKA 5FP5A 3P9JA 1ZRZA 4DA5A 2Z2WA 4FKLA 4A9RA 4FTQA 4BDEA 5AUUA 3TIYA 4TYIA 3LFAA 5AADA 4ZY6A 2BDWA 4BDKA 4E26A 4EZ5A 2BKZA 4G3GA 1OVEA 2C68A 4L00A 3U6HA 5CU2A 4L7SA 1YDTE 4D4SA 1G3NA 3RALA 4BN1A 2GTMA 5AV3A 4G3FA 5KKRC 1YOMA 4KRDA 4E6CA 4XOZA 5AP7A 3T3VA 4HCUA 4X3FA 5HLWA 4MTAA 2JDTA 4FEWA 3MPAA 2O63A 4DH7A 2WEVA 1XKKA 4GMYA 1FMOE 4XV9A 4ANQA 3LHJA 1QMZA 2X4ZA 1FGKA 4B9DA 3PG3A 3V5TA 3R8LA 2PHKA 2CKQA 4JX7A 4D5KA 3LMGA 1REJA 3BI6A 3NNUA 2VNWA 5C26A 3QXPA 1FGIA 1L3RE 4JI9A 4KS8A 3ZSGA 3BX5A 2REIA 3MJ2A 4RIOA 4WSQA 4GCJA 4Y5HA 4WHZA 1GY3A 2YDKA 4OTGA 5J5SA 3ENHA 2P2IA 1E1VA 3CQWA 3MH2A 3PUPA 4X6RA 3LAUA 5LVLA 3R7UA 1M2RA 5ACKA 3TDVA 3NAXA 2V7AA 4F70A 3FSFA 1PMVA 5B7VA 3MH0A 4RGJA 1SNXA 3CP9A 4ANSA 5IH6A 1W0XC 2GTNA 3HUCA 4FV3A 3V5QA 3ZU7A 3LPBA 4AT4A 5EKOA 4AOJA 5IDPA 1G5SA 2ONLC 3OP5A 5HCYA 4A9SA 4DN5A 2BMCA 2PVRA 3EKKA 3V8SA 2BRHA 3LOKA 4O7SA 1JPAA 2ITNA 2P0CA 3ODZX 4V0GB 2PVLA 4DH8A 4MD7E 3PY3A 3S3IA 1UNGA 4HOKA 1V0BA 4IXPA 4AA4A 1URWA 3R30A 2ERKA 4AN3A 1CDKA 1TQIA 2W1IA 4LQMA 4DG0E 3GCUA 3EJ1A 5IH4A 3HNGA 3FMJA 1XR1A 2O65A 4CTBA 3THBA 1KE8A 1H1WA 3R9OA 3CE3A 1YDRE 1ZMUA 2R7IA 3TEIA 4PTCA 2VAGA 2QR7A 4CFXA 4F0GA 4QYGA 3FYJX 2VO0A 2XRWA 4FZFB 2XKCA 4H1JA 4EHZA 5E8SA 4I5MA 4NWMA 1O9UA 4UWCA 4GVJA 4RX9A 4I21A 5FWKK 5CENA 4UB7A 2PZYA 3OFMA 4DFBA 4YJVA 3QQLA 3E7VA 4IFCA 3VW8A 2ITTA 3NUNA 4DCAA 3OTVA 4RX7A 4YZCA 1PYEA 3TG1A 4FG9A 3VS7A 5E1EA 4M7IA 3ZUVA 1VYZA 2V5QA 5D1JA 3K5UA 3KK8A 4ZY4A 2J5EA 4XBUA 3EN4A 3PE1A 5FEEA 3TTIA 4WO5A 4BCQA 3WF6A 4DFLA 5HLPA 4BCNA 3MIYA 5ITAA 2ERZE 5FBNC 3P7AA 2VN9A 4EBVA 1IA9A 1NVSA 3ORXA 5HE3A 2VTSA 4CLIA 3RGFA 2OFVA 5IMEA 2FSTX 3O8TA 4O91A 3DAEA 4AN2A 3DXNA 2Y6MA 3UMXA 3RWQA 4DTBA 3V6SA 4FTLA 2R3QA 5EDPA 5CVFA 2P55A 1VYWA 3RK5A 4DLJA 4C4GA 4RLLA 5CALA 3CY2A 4I41A 2OZOA 4AE6A 4AZVA 5CF6A 3MB6A 2QOQA 5EQEA 1JSVA 3QFVA 4FIIA 1ZYDA 1WBSA 3G9LX 4X2GA 1T46A 2XNBA 3KMMA 4L3JA 3RBWA 3EN9A 2ETRA 2GFSA 3H3CA 2FVDA 5EM6A 3G33A 3HL7A 2X81A 4J98A 2HZ0A 2VTPA 4E73A 4U7ZA 3Q4UA 5HBJA 4N4SA 5FP6A 3KB7A 3TDWA 4D2TA 4YLJA 3K5VA 4PMTA 5T3QA 2UW3A 2WQOA 2G2HA 4RVKA 4C61A 5JFWA 3DNDA 5JSMA 3C5UA 2WAJA 1XBCA 4UMQA 4BZOA 4E93A 2F7EE 2XNMA 4Z7GA 2C0IA 2GPHA 3FXXA 3UYTA 2BPMA 5IQIA 5M06A 3VS1A 3TKIA 3H10A 1JKSA 3KA0A 4PPAA 5CEPA 1BLXA 2ESMA 4ZAUA 3TCPA 3C4CA 5L2QA 2JIUA 3E7OA 1WFCA 5IDNA 5AMNA 4GH2A 4AW5A 1OM1A 3D83A 4Y72A 4BTKA 3BYMA 4NZWB 5CF4A 3F2RA 4HCVA 4RLKA 2HZNA 2B53A 4FTCA 4GK2A 3ANRA 4GKHA 2NNWB 3V5PA 4G9CA 1M14A 2FYSA 2VWBA 2WTDA 4FNWA 4QYHA 5FRIA 4Z16A 4ZXTA 5BX0A 4GSBA 5TKDA 4N57A 4OW8A 2OXXA 2BALA 3UVPA 1PMEA 5B0XA 4IX5A 2IZRA 2QQ7A 2WNTA 4C34A 4EHEA 2Q83A 1AGWA 1OL1A 3OXTA 3OY1A 3EFKA 4UMRA 1OECA 3ANQA 4QMWA 2RG6A 5EKNA 5C4LA 2ITYA 4D2SA 4TT7A 4EK4A 2J90A 4G6LA 1K9AA 2CGUA 3PLSA 3D2KA 3ZCLA 4RVTA 5CNNA 1JKTA 3U6IA 4C58A 2C6KA 2WELA 2YJSA 3FKOA 3ZZEA 2HY0A 3P08A 4AWIA 4K77A 2YZAA 1UWHA 2WQMA 4RFZA 3CQUA 3CJGA 2BAQA 1GJOA 3DK6A 5EDRA 4OGRA 2R3NA 1YHWA 4RJ4A 2I0EA 1OL5A 1W7HA 2IO6A 4E4XA 4OTRA 3O0GA 3AG9A 3EN7A 3OCTA 4FKRA 4QOXA 1BI8A 4KIKB 4WKQA 3UVQA 4KBAA 4QTEA 3PDTA 2R64A 4Y95A 4AU8A 2PULA 4O22A 3R8PA 4QTDA 5CEKA 4JVGA 4IH8A 4IQ6A 2OH0E 2XP2A 3LCSA 4YZMA 3UVRA 3R8UA 4EEVA 3ZFYA 2PSQA 4AW0A 5KE0A 1PMNA 3NX8A 1KWPA 2C5OA 4XG7A 3SG8A 3DA6A 2XS0A 3NRMA 1OIUA 2QOOA 4ZY5A 2WZJA 4U43A 4BHZA 5J95A 1CKJA 2XM8A 3ZBXA 4ZZMA 2OIDA 2WEIA 4DEGA 4QP1A 2PUNA 1ZOHA 2W1EA 3F66A 2B9JA 3FL5A 4IC8A 5DG5A 3ENMA 1SVEA 1JQHA 4JAJA 2JAVA 3TNPC 2O8YA 5J8IA 4UWYA 3E62A 2R3KA 4BCIA 1XHAA 2FSMX 2J6MA 3ODYX 1XWSA 3MY1A 3PXQA 4UALA 5BQ0A 3EN5A 1YW2A 4XG8A 4FNYA 4GV1A 1V0PA 3FWQA 3UJGA 4EOOA 5ETAA 5FD2A 3ZFXA 4NW5A 5BYLA 4EH7A 4EOPA 2J9MA 4FF8A 4D9TA 5IQAA 2OJFE 3DB6A 4L67A 5AR8A 2DUVA 2IW8A 3CQEA 3GU8A 1SMHA 4WNKA 4IZYA 5ANJA 3Q3BA 4G17A 4FG7A 4QQTA 3ZDIA 3A8XA 1TKIA 3VBTA 4OT6A 3II5A 2P33A 3GCPA 5IKWA 2E9PA 3WZKA 3R7OA 2QOBA 3AXWA 4BI2A 5IA5A 3HP5A 5TF9A 5E8XA 2C1BA 3QGWA 4CV8A 2X6DA 4DEHA 2B4SB 2WIPA 4FT3A 3HMPA 4NW6A 4DGNA 4E5WA 1J91A 1Y6AA 3W2SA 4B8LA 4D9UA 4A4XA 5A4TA 3V5LA 3VUKA 1YXSA 1CSNA 4U5JA 2Y8OA 3PP0A 4JT3A 3UG2A 2UVYA 4TRLA 5C8KA 3VO3A 4MF1A 2XYNA 4UX9A 3BHTA 1GZ8A 3C4FA 3EQCA 1YKRA 4E7WA 5ICPA 4L42A 3MN3A 4PMSA 3CBLA 3QCXA 1S9IA 2X9EA 3GB2A 4W8EA 1OGUA 2PMNX 1U54B 4XG3A 3WZDA 2PE1A 3Q6UA 2CLXA 3UNKA 1H07A 2C30A 3GOKA 3MFTA 1FPUA 3LM5A 4CQGA 3DBDA 5CEOA 4LL5A 4L8MA 2XK3A 3FAAA 3REPA 4ACDA 2XF0A 2PMIA 3EQPA 2V62A 4X2KA 4DGMA 3DK7A 3D15A 2GSFA 4GJ3A 1W98A 3WF7A 2C4GA 3MYGA 4WD5A 4AA5A 5FDXA 5CANA 4BY9E 2WQEA 2PL0A 5KMOA 3GQLA 3EH9A 4C2WA 3UZRA 2YZLA 3EMGA 4PDSA 2O2UA 4L44A 5TT7A 3VJOA 1KOAA 4MVFA 3WZEA 5JQ8A 4BCKA 4YJNA 3IOKA 1A06A 4YSJA 4YBJA 5IG1A 4P4CA 2F9GA 4FSRA 5DNRA 3RKBA 4O84A 3LCOA 4IVBA 1KE5A 3TWJA 5DR6A 3VBXA 3AGMA 2YM8A 4ZTQA 2CGXA 5EM8A 4RSSA 2R3GA 3QTRA 4DFZE 1TQPA 1O6YA 4NH1A 4CT1A 2ZB1A 2WTKC 3IS5A 4ZTLA 4KS7A 1APME 3DBEA 3IW4A 4FKQA 5J1WA 4NFMA 5HVJA 4GG5A 4ZTSA 4FVQA 2V55A 3LMHA 4QP7A 2PK9A 2UZVA 4BWPA 5GINE 2QHNA 1WZYA 2J51A 4IHPA 1Z57A 3CTHA 4QMZA 2B54A 1KV1A 5A4LA 3UBDA 4FNXA 5BVFA 5CWZA 1JLUE 4RG0A 5HX6A 2QONA 1OKZA 5AP3A 3O2MA 4O38A 4P7EA 2VTMA 2ZMCA 3VHKA 4D55A 2OG8A 1URCA 1LEWA 2VO6A 4S32A 3FMEA 3L8SA 1VJYA 2C6MA 2J7TA 3LIJA 4BGGA 4RMZA 4AZFA 2XK6A 2ZB0A 4DAWA 3OTUA 3BKBA 4A07A 4E3CA 3UPZA 4G34A 4QTBA 2OI4X 4FICA 3QAME 3ZO4A 4C57A 5IEYA 5JT2A 5KMIA 4RRVA 2OF2A 4EH3A 1REKA 4DYMA 2BTRA 1V1KA 2V0DA 3JYAA 4H3QA 3VC4A 5M4CA 3QRJA 1YVJA 2X7OA 5CF5A 1PRYA 4GYIA 5AM7A 4B6LA 3GNIB 2FA2A 4W4VA 5BVNA 3Q4CA 1YXVA 3E64A 3QCQA 1IRKA 1R0PA 2YIQA 3TNQB 3LQ3A 4AG8A 2C6LA 5FEQA 4QP4A 4U81A 3HKOA 1LUFA 4I6BA 3W1FA 4C35A 3VIDA 5BYYA 3QKLA 2RFNA 5AR2A 2EVAA 3KY2A 3O8PA 4MXAA 3BBTB 4QP8A 1T45A 2R0UA 4UWBA 5EI6A 5KUPA 1RDQE 1OIYA 1LP4A 3OEZA 3ORKA 2Z7QA 5EOBA 5EYKA 4C4EA 4JDIA 2YAAA 2ITQA 4FT9A 2BHEA 2C6EA 4M12A 2CGVA 2IW9A 4FSUA 3RVGA 3U8WA 1G8SA 2W5AA 2FB8A 2HY81 2VX3A 3L1SA 4JS8A 1LEZA 2GNGA 4H36A 5HICA 2YDIA 5FTGA 3R1NA 5M53A 5LXMA 2PZPA 4YURA 1PKGA 3CKWA 4I0TA 4ZJIA 5M4IA 3BGZA 2BRGA 4K33A 3KREA 1R0EA 2C6OA 2OO8X 5HZNA 4GJ2A 2G01A 5ETCA 3R1SA 4YBKA 4FYOA 3MFSA 4JDJA 5L2IA 4C4IA 5HVYA 4IB0A 2CHLA 2XRUA 1KE9A 1PXPA 2BHHA 4MBJA 4L43A 3RCJA 3NDMA 3E63A 2PZ5A 2RFDA 2Y4IB 5LQFA 4IWOA 5AX9A 3F7ZA 5H3QA 3GT8A 5M55A 1H8FA 3ZEWA 4PQNA 5CAVA 4U9AA 4FEQA 3IW8A 3UO4A 5ANEA 4F9YA 2B52A 2QC6A 2R3FA 3PWDA 5DA3A 4EH8A 4GEOA 3LLTA 4K18A 3BU5A 3EHAA 3MDYA 3PJ8A 4IZ5A 3DT1A 3E3PA 3OG7A 4UMTA 5ANIA 3UIBA 4QMVA 5I9UA 4E1ZA 4J99A 5C8NA 3ALNA 4R3RA 4NJDA 1UU3A 1GZNA 3G5DA 4O1OA 3BWFA 1OIQA 4YZBA 1Q97A 2SRCA 4ID7A 4ONAA 4GW8A 4BBEA 1OKWA 4J52A 4D4VA 2CCHA 4Z9LA 4USFA 4R3CA 5K0XA 3O7LB 5G1XA 3W10A 4ZMEA 2CCIA 2W1ZA 3OWLA 2NRUA 3A2CA 2YA9A 5FTOA 3ZOSA 5GHVA 2UW9A 3FMMA 4K2RA 4LYNA 4YLLA 4JDKA 3NW7A 4QQCA 3I7CA 4R8QA 1OZ1A 2HELA 3EQBA 5FDPA 2W7XA 2F7ZE 3PSCA 3KULB 4D2RA 3HUBA 3F9NA 3RI1A 2RIOA 4QMXA 3QZHA 5DRBA 3OBGA 2BR1A 4I5HA 3UMWA 4AS0A 5I9ZA 2QLUA 3QQKA 3ZO3A 3QL8A 4XV2A 3R02A 4X0MA 5LVOA 4UYNA 2ITOA 2R3PA 4OTQA 4JNWA 3MS9A 2JFLA 4PL4A 5HTCA 2EXEA 1UA2A 4Q9ZA 4XUFA 1DI8A 4UV0A 1RQQA 4NUSA 4RZVA 1OI9A 2UW8A 1IR3A 3NYNA 2WMTA 4F65A 4FEVA 3O23A 2QU6A 3D5XA 3A62A 3GVUA 5C8MA 1SM2A 2JFMA 2ZAZA 4C3RA 1WMKA 3HRCA 4MNFA 2WGJA 3P1AA 3SHEA 4Z3VA 3FQHA 1IEPA 4QPSA 4WA9A 3LQ5A 2ZV8A 1ZYSA 4I3ZA 4BR3A 4KIKA 5EM7A 3CKXA 4Y8DA 5BPYA 2I0HA 2OK1A 1W83A 2QURA 3PTGA 4KD1A 4RFYA 2XCHA 3IW5A 5H8GA 3FXZA 4C59A 3GP0A 4E4LA 1UKHA 5KMJA 5JFXA 3ERKA 4FVPA 4E4MA 1HOWA 2UW7A 1K3AA 3R1QA 3UIXA 3VF8A 4BYJA 3ZC6A 1H1RA 3UO5A 4X2NA 3CR0A 2WTWA 4YLKA 3G6HA 2Y4PA 3RHXA 1J7IA 4DCEA 3FLYA 3W8QA 4OTHA 5EYDA 5CEIA 4FK6A 4X2JA 1O6KA 2BILB 3OWKA 4IWPA 4C2VA 4CXAA 1KE6A 3DK3A 1PMUA 4AT3A 4DEAA 3DFCB 3MA3A 4KWPA 3UOHA 4EH5A 5IEXA 4GU9A 2G2FA 4FV6A 4JBVA 2WMXA 4YJPA 4FV7A 2RF9A 3D9VA 4WRGA 1FVTA 1YRPA 3ZFMA 2UW5A 4RVLA 4CT2A 4FTTA 2C69A 3BYUA 1WVYA 3DU8A 4YR8A 4YNOA 4I0RA 3D14A 4QTCA 3E88A 4ZLZA 4O7RA 3PP1A 3F61A 3OBJA 4JG6A 3N4VA 4RWLA 3C0GA 1S9JA 2C3JA 2WD1A 4F1MA 1VEBA 4TYJA 3PSDA 4GT3A 4JRVA 3ZTXA 2VTHA 4CKIA 4YJUA 3P79A 2CMWA 5EYCA 3QGYA 4EOMA 4ANOA 5DFPA 4U97A 2VV9A 4XHKB 2OZAB 2QOHA 5CZIA 4KKHA 4IANA 4NSTA 3EQRA 2AC3A 2YM7A 4PNIA 3Q9YA 4BCOA 3QXOA 5IF1A 3NUXA 3QD3A 4I1ZA 2JBPA 2BCJA 3BHYA 3E87A 2RL5A 4MWIA 3C0HA 1H26A 3OD6X 3U9NA 3KRLA 3JXWA 4NL0A 3PZHA 5JRSA 3G9NA 4F6WA 5TE0A 5LVMA 4OBPA 3CTJA 3EIDA 4F99A 1JOWB 1OBGA 3HV7A 3NGAA 3IW7A 4XCUA 4FV0A 2BRNA 3F5GA 1VZOA 2VX0A 4FV4A 3QUEA 2R3IA 4NYEA 1BMKA 1JKKA 4WUAA 4AGCA 5DOSA 5C9CA 2EXCX 4M8TA 2FUMA 2XIYA 3KK9A 3FJQE 3CPBA 1LR4A 4K0YA 4DEBA 2BKKA 2OH4A 2O3PA 4H1MA 4O2ZA 2YJRA 3RNIA 2R3RA 4NT4A 5E8TA 1Q4LA 3LFFA 4KKEA 2YCQA 3OCGA 5DLSA 4AX8A 4PF4A 5I9YA 1XO2B 3BBWA 5DN3A 3C51A 3F5UA 5E92A 5JZJA 5FUTA 3KN5A 3OW4A 4M69A 1FVRA 4Y46A 4NCTA 4ZS0A 5AR3A 3HP2A 2PMOX 3BHVA 2V7OA 1TQMA 4IM3A 3UTOA 3DV3A 4YJOA 3MTLA 4DTAA 1Y8YA 2JAMA 2X7FA 5HG9A 5K3YA 4F9BA 2QNJA 2ZJWA 2XNNA 3Q9XA 4C3FA 4CMTA 3ROCA 3MVHA 3CS9A 4HYUA 4TW9A 1KUTA 3BHUA 5HCZA 3MSSA 1U5RA 2ZM3A 5HX8A 2QO7A 3Q9ZA 5H8EA 2WQBA 4U3ZA 4L3LA 1YXTA 4ERKA 3Q2MA 4GYGA 4BDIA 3CLYA 2IN6A 3CGOA 4HNIA 5CSVA 5BYZA 4EBWA 5KHXA 4O7ZA 2YHVA 2DS1A 3E3BX 3ZH8A 5IQEA 2XIKA 3ROYA 1ZWSA 5EW8A 5HNIX 5KBQA 4HVGA 3D0EA 2UZBA 3BZ3A 5LCJA 3H30A 2H8HA 5D12A 4FSZA 4M14A 2ZVAA 3BYVA 3O71A 5AEPA 4DT9A 1KE7A 4IAKA 3OZ6A 4NIFB 2B9HA 2V22A 5CAOA 3DPKA 2OJGA 3FMDA 5E8ZA 2VZ6A 1H01A 2OXYA 3S4QA 5J1VA 3I6WA 3UC3A 3L8PA 5KZIA 3DOGA 5JK3A 1J1CA 2C3KA 3FEGA 4RIWA 4MBLA 5KMKA 3VS2A 3KRJA 3SG9A 4L68A 4A06A 2A19B 5B2MA 4MQ2A 2OGVA 4E6DA 2VWVA 4QMLA 5HQ0A 2HAKA 3PLAE 2VTLA 3MPMA 4FIHA 3QD4A 1YWNA 2XK8A 4RJ6A 4RIXA 4CLJA 3PY1A 2YLFA 3QA8A 3SW7A 4WG4A 3LFDA 2VGPA 3NEWA 4NCTC 5FG8A 4ANBA 4PTEA 4NFNA 2XM9A 4ZTHA 4BCJA 3AC5A 3P5KA 2VTAA 3NNWA 4FSMA 1IA8A 3ZDUA 5HD4A 3B2TA 3GUBA 4CGAA 1EH4A 2JEDA 2OIBA 5FTQA 4EOSA 5JN2A 4L01A 3PXKA 5AP5A 4FC0A 1ND4A 1UV5A 4L46A 5CI6A 4MXYA 2YAKA 1IASA 4M67A 2NP8A 3FZSA 4Q2AA 1J3HA 3A8WA 4X3FC 5IEVA 2PYWA 2WB8A 5EQPA 4TKSA 3PIYA 3QUDA 5AP0A 3R1YA 2QODA 3Q96A 4YO6A 4MNEB 5LCKA 3U54A 5DH3A 4RC2A 2Z7RA 4AGDA 5HBEA 5T68A 3MFRA 3RZFA 4APCA 4FODA 4EYMA 2J0KA 4EKLA 5IUHA 2HCKA 3HGKA 4O2PA 3QLGA 4GIHA 2QO9A 3RPVA 4ZZNA 2HXLA 4WRSA 1YOLA 3POZA 5T6KA 3FPQA 1FBNA 4TY1A 3DGKA 4KAOA 2JD5A 3I0QA 2XJ0A 3R71A 5DBXA 2JGZA 4FKJA 5A9UA 5L3AA 4J95A 1Q62A 4Z55A 4ALWA 4E5BA 2I0YA 2VGOA 4ZSLA 3EFJA 4QP2A 4D58A 5BMSA 4CYJA 3ZLYA 4ACHA 4C36A 3DKFA 1U5QA 3R73A 5IMXA 4DGGA 3PXFA 3TV4A 4FTKA 1QPEA 3PRIA 5EK7A 3BWJA 4AOTA 4AZEA 3I5NA 5AV0A 2GHMA 4BCGA 3N4TA 4PPCA 1Y91A 3MA6A 5AP4A 5HHWA 4BI0A 4M0YA 4MQ1A 5AR4A 3F3UA 1DAYA 4ZK5A 3TZMA 3V04A 4BF2A 4FGRA 5C01A 3PG1A 1UKIA 3R9DA 4E6AA 4NKSA 2PE2A 2HZ4A 2H6DA 2IVUA 2HK5A 4CMUA 3FLSA 4FI1A 2UVZA 3OCSA 3BQCA 4JX3A 4ALUA 4ZLYA 4QMSA 1TVOA 1YOJA 4ZEGA 3UOJA 5BVEA 4ITIA 4U0IA 3RM7A 4AN9A 5M51A 3PA3A 3OVVA 3IKAA 3SDJA 3QTIA 4RT7A 2YCRA 2WTCA 5DR2A 3QCYA 4MXZA 4NM5A 5CAUA 1AD5A 4J96A 2Y9QA 3F5PA 3QYZA 4FNZA 2R3OA 3FLQA 5KNJA 4LUDA 3AMBA 4BC6A 3VUHA 3QQUA 5KBRA 4ZSEA 2E9VA 4HYIA 2J0LA 2R3LA 2I40A 3AT3A 4R6VA 3I7BA 3SOCA 4PDYA 4G1WA 3GEQA 3RAIA 3R00A 1FMKA 3WIGA 2C5NA 3IDCA 4PV0A 3L8VA 4BDJA 3K3JA 5CVHA 3UPXA 3D7TB 4BDFA 4QP9A 2W1FA 4FTOA 4S2ZA 2PZRA 3A7FA 5I4NA 4F0IA 2PE0A 1UNLA 4IVDA 2BFYA 4TNDA 4JDHA 3ATTA 3R9HA 1UU8A 3KVWA 5DRDA 2QI8A 4YP8A 4E4NA 5F9EA 4TWCA 3RPRA 3A7JA 3ZC5A 2X8IA 3ZS5A 1P4FA 3E8DA 5CU6A 4NTSA 4AGWA 4FKWA 1Q99A 4ACMA 4F7SA 3W16A 1I09A 2HWPA 4FV5A 4XG9A 4E5AX 4EOJA 3IK3A 4AFEA 2OIQA 4N0SA 4TXCA 3NAYA 4M97A 5BUEA 5JMSA 2HZIA 4YJTA 4O81A 1CKIA 2C6DA 4JQ8A 3LFCA 4PNKA 1OBDA 2UW0A 3OUKA 2G1TA 4F9WA 3MW1A 4A4LA 3D5UA 4O1PA 2XBAA 4KABA 3W18A 4I92A 2PU8A 4KKGA 2BVAA 4ZSAA 2BZJA 2VNYA 1M2PA 1RE8A 3LLAA 5IA3A 3TNIA 2W9ZB 5IQBA 2PVMA 2W17A 4GFMA 5CQUA 1W8CA 3MIAA 2WOTA 4O27B 3SRVB 4CSVA 3MFUA 3FZ1A 3SLSA 3MY0A 3QZIA 4CV9A 5A4CA 5HE1A 4BDAA 4J53A 3QF9A 3FC2A 1P4OA 4G5PA 3BEAA 4ACCA 4AQCA 3V8TA 5FXRA 5IQFA 4CRSA 5AAFA 3B2WA 2XA4A 4I5PA 1F0QA 4FKSA 5DEWA 3LXLA 2W0JA 4EUUA 2OW3A 5CS6A 2C0OA 2OFUA 3GU4A 1BYGA 3T3UA 4G3EA 3EZRA 4AZSA 3QRUA 4IEBA 5IA1A 3S95A 3QX4A 2B9IA 5DR9A 2W1CA 3W2CA 4C7TA 3D4QA 4JQ7A 1WBWA 1PXNA 5JQ5A 5KCVA 2IZUA 2VWXA 4NJ3A 2YN8A 3A7HA 4EQCA 4ANMA 1OIRA 4NKAA 5L2WA 4FKOA 3GI3A 1AQ1A 3LM0A 4QNYA 1BUHA 2O0UA 2ZDUA 4OTWA 4TWOA 2RG5A 5H8BA 4A7CA 4EI4A 1X8BA 2F4JA 1H24A 2B55A 2PMLX 2WMSA 4LG4A 3VBYA 5BUIA 4I6QA 5AA9A 2QO2A 3U55A 4IVAA 1QCFA 3VBVA 3KC3A 5LMAA 1MQ4A 3DS6A 4W4WA 4I93A 4DTKA 4DF3A 5D9HA 2OICA 5EOLA 2IVVA 4HNFA 4BIDA 2EU9A 3BE2A 2WTJA 4M0ZA 4ITHA 5KMNA 1PF8A 3NW6A 4AF3A 3R21A 3KN6A 2R2PA 4CFVA 4EHVA 3VS6A 2WXVA 3FL4A 2R7BA 4TL0A 2YLEA 4YHTA 3B8QA 3VW6A 4NK9A 5CEMA 5ANGA 1I44A 2YABA 4MBIA 3HDNA 1Q8YA 4UBAA 5J9LA 3I1AA 1UNHA 2OWBA 4F9CA 3NPCA 5A4QA 4HVSA 5B2LA 1OKVA 4F6SA 4LGGA 5M4FA 4OBOA 5FEDA 5FQDC 4RX5A 4RC4A 1DS5A 3DBCA 5GJDA 1JAMA 1P5EA 4FL1A 4U80A 2QKWB 3VAPA 3HDMA 5HO7A 3KFAA 5EHYA 1VR2A 5M4UA 4IB1A 4MX9A 3ZLXA 4ZTMA 5I9WA 2W1HA 1ZXEA 4ENXA 1UU9A 3C13A 1FVVA 3KRWA 3KXMA 3ORNA 4FT7A 3OS3A 4PWNA 5B2KA 3ACKA 3GFEA 2FH9A 3SKCA 2PVFA 5LWNA 2QOIA 4KIPA 3MI9A 4X3JA 2CKPA 5KKRB 1Q8WA 4UEUA 4X7QA 4MAOA 4YJQA 1P14A 2OJIA 3QWJA 4UY9A 3ZO1A 5E8WA 5HESA 2QU5A 1BX6A 2GNFA 3FLNC 3T9TA 4EZ3A 5A14A 2ACXA 3P78A 3KCFA 3RWPA 3SQQA 3FMKA 4GU6A 3VS0A 1Q8ZA 4HGSA 2GS2A 4QMOA 1WBPA 4RIYB 3IQ7A 3PVUA 4FKTA 4D1ZA 4QYEA 4F08A 4FL3A 2E2BA 4G6NA 4BDGA 4HVDA 2R9SA 2WMUA 5ETIA 5CX9A 5J9ZA 3JPVA 2PUUA 4FVRA 3PVGA 3A4OX 4U44A 3MBLA 4PMMA 4D0XA 1ATPE 3A61A 4CCUA 4ZSJA 3TIZA 1M52A 2WMRA 4FKPA 3GU7A 5CU4A 3SX9A 1HCLA 1GIHA 3Q04A 1ZAOA 4WNOA 4U79A 1MRYA 5TOZA 3MH1A 5K5NA 4UZHA 3OXZA 3W32A 5LWMA 3FHRA 4ACGA 4QPMA 1SVHA 4WBBB 1OL7A 4IM2A 2YIWA 3DCVA 1M7QA 4O7NA 3DFAA 1WBNA 5AUZA 5FGKA 4EC9A 5F1ZA 3BV3A 4V0GA 5C27A 5IQCA 4UXQA 4C8BA 3HLLA 2HW6A 2Q0NA 2QOFA 3ITZA 4K1BA 5AV4A 2PUPA 5DYJA 4JL9A 3PXYA 4ERWA 1WBVA 4ANNA 2ZV9A 3BHHA 3NS9A 3W2QA 4FZ6A 4TPTA 3IW6A 3ZBFA 3R04A 4EOIA 3FLZA 4H3PA 5K9IA 2Y6OA 5F95A 4O7VA 1ZARA 1Y57A 3RK7A 4YHFA 4L7FA 1B39A 2BZHB 3PZEA 3AC3A 4QMUA 3TACA 3V5JA 4X3FB 2E9NA 3PFQA 3LJ2A 3LE6A 3R9RA 4RPVA 3C4XA 5JZNA 4K11A 2WTIA 4UYAA 1BL6A 3KQ7A 3EQHA 1QPCA 4XBRA 5M09A 4O83A 3DJ5A 5HO6A 4XP0A 4ITJA 1QL6A 4FGBA 3MVJA 4X21A 4OAVB 4I4FA 3TNHA 1K2PA 3PXZA 3DJ6A 3BGQA 3QX2A 1PXKA 3KRRA 4D1SA 3EL8A 5K5XA 3HYHA 3SA0A 3EYGA 4FT0A 3IG7A 4FZDB 3W2RA 4M3QA 1E9HA 1JBPE 3C9WA 2R0IA 4Q5HA 3RNYA 1ZMWA 2I7QA 3F3ZA 3BU3A 4IJ9A 2GFCA 2NPQA 5JGAA 1GZKA 4FMQA 1DM2A 1F3MC 4CCBA 4S34A 4RBLA 5CQWA 2J5FA 5JRQA 5LVPA 3G2FA 2OSCA 2Y0AA 4J7BA 4IZAA 3EOCA 1Q61A 3QYWA 5IH5A 4I4EA 2YEXA 4DBNA 2UZEA 2RFEA 1XH4A 3LFBA 2WHBA 1ZY4A 4G2FA 3EQFA 4EONA 2GCDA 4H58A 5A54A 2XK7A 4P5QA 4XV1A 3ZLSA 1UWJA 3O51A 3TNWA 4YHJA 2CJMA 3VHEA 2JIIA 2CKEA 3SW4A 4F9AA 4OTFA 4N70A 4BWXA 4KBKA
chains in the Genus database with same CATH superfamily
3R83A 3CSVA 3NNVA 4AOIA 3AC1A 1Q5KA 2J0IA 4PL5A 3HVCA 4X6QC 4YSMA 4DDIA 2IVSA 4KINA 2ZV2A 1MQBA 4L6QA 4XG2A 3VVHA 4YTIA 5EI2A 4ASDA 1ZOEA 5DWRA 4HVHA 5JGBA 4ZJVA 3NUYA 4L45A 3VF9A 4LMNA 3AQVA 3UOLA 4OT5A 3DBQA 4CKRA 1VLRA 4FTMA 4G31A 5HO8A 4E6QA 5L6OA 5L8LA 2UZWE 3E92A 3NYVA 2GQSA 4J1RA 1IAHA 2W99B 5ANDA 2GHGA 5HIBA 1UU7A 2BTSA 5DEYA 3ID6C 3Q9WA 3C0IA 3A4PA 4JJRA 3GC8A 3MWUA 3FKLA 4KSPA 2UZTA 3QUPA 3VUMA 4JMQA 5GZ8A 4ORKA 3EB0A 5L6WL 3O96A 4GT4A 4LRKA 5EW3A 2VU3A 4DINA 4IAZA 3DAJA 4FTAA 4FZ7A 4JR3A 2JDOA 4AXAA 4R7HA 2CSNA 3ATSA 1PXLA 1SZMA 3D7TA 2IWIA 2IF8A 2OJJA 4IIRA 5E90A 3O8UA 3T9IA 3UZPA 2OBJA 5CASA 4DEEA 4RVMA 3N4UA 2UZNA 4EKKA 4V04A 2JKKA 3EYHA 5IA4A 2VWYA 3EFWA 3ZM4A 4EYJA 3TKUA 3D5VA 3GU5A 4K8AA 3K3IA 2YFXA 3UQFA 1MRUA 1ZYJA 4KSQA 2XIRA 4R5SA 4EUTA 2H9VA 4DDGA 3V3VA 3BRBA 1CM8A 3JUHA 3LXNA 5DMZA 3CEKA 3R8MA 2P4IA 2XK4A 4NEUA 4L3PA 1U46A 1GNGA 3DKOA 4YPDA 4XP2A 4AGUA 3CY3A 3FDNA 2OU7A 3DKGA 5CI7A 4E20A 2VTRA 4FX3A 3F7WA 4DH1A 1CMKE 1GAGA 2VTJA 3O50A 5CAQA 5GIOE 3DTCA 3V6RA 2YISA 5CU0A 3FZTA 3PSBA 4BKZA 3QKMA 3SGCA 2W5BA 3P23A 5CSHA 2ITPA 1YXUA 2YACA 3AC4A 5K4IA 3D2IA 3R63A 4EJNA 4FKUA 3H9OA 1XJDA 2ZM4A 3R7GA 4F1OA 3EZVA 4RWJA 1B38A 3R7YA 4Z7HA 1Q24A 3VWAA 5AP6A 3LCDA 3Q4ZA 5AR5A 3U4WA 3WBLA 3D94A 2XALA 5DT4A 4IWDA 4NTTA 3L8XA 4C38A 2YITA 4O86A 4G9RA 4WOVA 3QHWA 4CYIA 4P90A 3MVLA 2O64A 3NWWA 3QZGA 3COIA 2NRYA 3T8OA 3KIOC 5DT3A 2HOGA 3DXQA 2VO7A 1R3CA 3C4WA 4KBCA 2WFYA 3AMAA 3SC1A 3NCZA 1FINA 3GXLA 3NVKI 2WTVA 2JDRA 3GCQA 2ETMA 2E9OA 3Q5ZA 4DBXA 3QC4A 4FSTA 2RGPA 3GBZA 3QTXA 2PVYA 4AT5A 4WUNA 2DWBA 3ZEPA 3NLBA 4R7IA 4EK6A 2VTTA 4QDEA 2XEYA 1W2FA 4YNEA 5AJQA 3RAHA 4MHAA 1R39A 4FE2A 3VN9A 4C62A 2YM3A 3GC7A 3RK9A 3G90X 3DBFA 4KRCA 4PY1A 3P7CA 4TYHB 5BUJA 1CTPE 3RMFA 2CLQA 1Q8UA 2EB3A 1NVQA 2W96B 3CGFA 3FC1X 3FKNA 4FKGA 4GFOA 4JRNA 4UZDA 4BFMA 4FA2A 5M56A 5IPJA 2FSLX 3E8NA 3UO6A 5ANOA 3C4ZA 1RW8A 3ULIA 4EH4A 3FQEA 4BDDA 2WO6A 5I3RA 4HGLA 3KXXA 3QRKA 4HJOA 5I0BA 4LI5A 4LRMA 3PY0A 4XG4A 3WIKA 2ITZA 2XEZA 3AKLA 1GOLA 1PJKA 2X2MA 4YZNA 5JH6A 3F3WA 4O0UA 3COHA 3IECA 3QQJA 4EC8A 3U4UA 2X7GA 4YTCA 2A4LA 1FQ1B 2W4KA 2RSVA 1R1WA 4LOPA 5HLNA 4IBMA 3VQUA 3OWJA 2GNIA 4HGTA 3QQFA 4TTHB 4HZRA 3GENA 1RJBA 3IO7A 1G8AA 5DPVA 1U54A 1XBBA 3G6GA 4IADA 5CZHA 2CNUA 4FTJA 3IDBA 3IGGA 4RA4A 3F6XA 3BLQA 3BYSA 3SOAA 4YU2A 3AC8A 1NXKA 2XK9A 3KXNA 1KV2A 5HOAA 5I3OA 2VTQA 2WIHA 4JBOA 3Q6WA 4WT6A 4QO9A 2ITXA 3R7EA 3LMIA 2F2UA 3KMUA 3PVBA 2J2IB 4WBOA 1O6LA 3NFFB 2RKUA 3FE3A 3CD8A 4F4PA 4K6ZA 3UP7A 4H05A 5AA8A 3UIMA 1Q3DA 4MEDA 5EHLA 3WI6A 4IX6A 4BICA 4XRLA 3WF5A 2B0QA 4JR7A 5LARA 4LV8A 3ZYAA 2X2LA 3NYOA 4V05A 3NUUA 4XV3A 4BKYA 2UW6A 5HIEA 4FV2A 3OOGA 4MXOA 5L8KA 4W8DA 3U87A 4JLCA 4IAYA 2CPKE 4TNBA 3W2PA 3R22A 4CFNA 4R77A 2QLQA 3ML1A 5CT0A 4P5ZA 2WTKB 4U40A 3CC6A 1ZLTA 3WZUA 3HEGA 4AAAA 4MH7A 4LOQA 3VUGA 3LQ8A 2WMQA 1UVRA 5AUYA 4QPAA 3VS3A 2PUIA 1FOTA 2XH5A 2J0JA 4WIHA 3TUDA 3WYYA 3AT2A 3OC1A 4IACA 2JDVA 3E93A 3QLFA 4XNEA 5EI8A 5FXQA 4EZ7A 4DITA 3QA0A 3EN6A 2XNPA 1W82A 1GIJA 3PYYA 4IDTA 4QNAA 4MXXA 3RJCA 4XMOA 5EM5A 2PVJA 2ETKA 4O7TA 4KB8A 4O4DA 4QQ5A 2I6LA 5CVGA 4FTIA 1BI7A 3TZ7A 3IDPA 4OLIA 3MY5A 3ORMA 3NMUF 3UIUA 1NVRA 4HPUE 3RM6A 4DEDA 5J7BA 2EB2A 2HIWA 4U3YA 3UNZA 4OTIA 2LGCA 5JFVA 5IZFA 3VULA 3Q60A 3KU2A 3NVMB 3D5WA 2VWWA 3H0ZA 3PA5A 5TR6A 1PXIA 4Y5QA 1PHKA 4Q5EA 3COMA 4AE9A 4AACA 4FG8A 5J87A 3HV3A 3FMLA 3K2LA 2Z8CA 3I4BA 3OROA 4RWIA 5DE2A 3FSKA 2ZOQA 2XKDA 1F5QA 2JITA 3GC9A 3NUPA 3NUSA 4FV8A 4M13A 3VUDA 2GMXA 4YGAA 4AW1A 4D28A 2ZV7A 4GT5A 4Q9SA 4IX3A 4BL1A 3BLHA 3FHIA 4D4YA 4FYNA 4I24A 5AFVA 3QTQA 5IISA 4RJ7A 2PVNA 4JBQA 4XX9A 2VWZA 5AV2A 1L8TA 1ZYCA 5FBOA 4CG9A 4XG6A 4JBPA 2I1MA 5AUTA 3JY9A 1H1PA 4BIBA 4C4FA 5A46A 5D41A 1XQZA 2QCSA 3AMYA 1JWHA 4AW2A 4GRBA 1Q8TA 3HZTA 3M42A 2IVTA 1NT2A 4O0VA 2ITUA 5D10A 1HCKA 2X6EA 5FM2A 4BTFA 3OXIA 3QU0A 4A9TA 4R3PA 5A6NA 5E8VA 3W0NA 2BAJA 4HYSA 3UDBA 2YIYA 3GOPA 2PZIA 2YERA 4JG8A 2IZTA 2JKQA 2WKMA 4O7WA 3C4EA 4IZ7A 2X2KA 4MD9E 2AEGA 3OW3A 5FXSA 4C02A 5F4NA 2UZLA 2XNOA 4XRJA 5BVDA 3KF7A 3H0YA 4R1VA 2R5TA 5J79A 4MUQA 3CPCA 1DI9A 2W9FB 2C5YA 4DH3A 3ORPA 2XKEA 4PTGA 4QMNA 3TZ8A 4PDPA 2WMBA 4MWHA 3VNTA 3ZRLA 3EQDA 2QVSE 4TN6A 3DTWA 3QRIA 4B4LA 3FY2A 5CT7A 4I94A 4IC7A 3PIZA 3M2WA 3QD0A 2GS7A 4ZSGA 5F20A 5KMMA 4LDTA 5M08A 5HG7A 3R9NA 5E7RA 3FZPA 5A6OA 3ELJA 4CTCA 1XH6A 4OBQA 2BRMA 4DEIA 4EH2A 1PY5A 2BROA 2GNHA 2H96A 1JSUA 3B8RA 4RX8A 5D7AA 3RZBA 2O5KA 4O7LA 3FV8A 4BVUA 2Y7JA 2F49A 4KIQA 3NR9A 3ET7A 3WARA 3PJ1A 5EG3A 1W2DA 4BHNA 4DFUA 3R2YA 5C03A 1OITA 3LJ0A 4EH9A 1WVXA 4CVAA 3C5IA 3RCDA 2Z7SA 2GQRA 5BVKA 3KEXA 2LAVA 3RTPA 4D2VA 3TM0A 5CY3A 2F57A 3KCKA 3PPJA 3HECA 1PKDA 4R1YA 4F63A 4YO4A 3DY7A 3MV5A 4G3CA 3SXRA 2YDJA 3OY3A 5CXZA 5JFSA 5AUVA 3L9PA 3PXRA 3DLSA 3CJFA 3EQGA 4EWQA 4FIEA 4G6OA 4W9XA 5L4QA 2IG7A 4LMUA 3GU6A 5JKGA 3F69A 3RINA 3VS4A 2YWPA 4IDVA 5DHJA 3HV5A 5HE0A 2XAOA 2QOLA 4ANLA 4NM3A 3JVSA 2BDFA 2XNEA 3KULA 4F0FA 2A98A 3BELA 1YWRA 5HVKA 2CKOA 1XBAA 4UMUA 4KUJA 1NY3A 1M7NA 2B1PA 3R28A 4USDA 4EQMA 4UXLA 4ZS4A 3C1XA 3ZRMA 1MRVA 2HXQA 3FMNA 4BBMA 4AAYA 4LGDA 3GQIA 4IW0A 3QALE 4FSQA 3UYSA 4J71A 4G3DA 4II5A 4I0SA 4N6YA 4H3BA 4ZP5A 5GJFA 4M84A 3ZONA 3U6JA 4CG8A 2QR8A 3TJDA 3I79A 1YWVA 2YM5A 4LV5A 3O7LD 4AP7A 2BAKA 4F09A 4C0TA 2RFSA 2ZMDA 2ZDTA 3LW0A 3OHTA 5AIKA 3ZM9A 2Y4IC 1OKYA 4GVAA 3TV7A 4DG2E 3NNXA 3IOPA 3Q53A 4GFGA 4AXEA 2ITVA 3PJ3A 3ZZWA 2PVHA 4QP6A 2IJMA 4OUCA 3PIXA 5E91A 4BIEA 3R6XA 4XOYA 3H9RA 5M44A 3P86A 4DFNA 3JR1A 3HMIA 3P0MA 4I22A 4CFWA 4FTNA 1H25A 5K4JA 3SXFA 3ZXZA 4F64A 2FGIA 2VRXA 4PL3A 4U45A 5HNBA 5HBHA 4DHFA 3ETAA 4FKVA 4FUXA 1WVWA 4MXCA 3FZRA 1U59A 2X39A 5EHOA 5CSPA 3IGOA 5CNOA 3D7ZA 3SV0A 4CNHA 3UZTA 4PMPA 3UDTA 3UC4A 3N51A 4DFXE 3SVVA 3PJ2A 5AP2A 4CEGA 3MJ1A 5L2SA 4M15A 3AOXA 4AZWA 3FI3A 4GK4A 3TUCA 4EQUA 3GCSA 3LXPA 1ERKA 4OTDA 4ZIMA 4A9UA 3RPSA 3U51A 4S30A 3ORLA 1MP8A 3M1SA 1OB3A 5DVRA 2YIRA 4KIOA 1JVPP 5KO1A 3HA8A 4F7JA 3QTSA 2YCFA 4L9IA 5HU3A 3KXZA 3LCKA 2E9UA 3HMOA 2IW6A 3S0OA 1PXOA 5K0KA 4FIJA 5HORA 2JBOA 2HYYA 4J97A 4KA3A 4O96A 5G6VA 3HAMA 5C4KA 2PWLA 3S1HA 3DDQA 4X2FA 2I0VA 3Q4TA 3VQHA 4S31A 4TZRA 4W4YA 2AC5A 4O0RA 5AV1A 3TUBA 3L9NA 4AFJA 1OMWA 4TYHA 3DNEA 3RPYA 2OZAA 5HKMA 2J4ZA 3BIZA 2OKRA 2BIYA 5HD7A 4BCFA 3FPMA 3WE8A 2DQ7X 1M17A 4FIFA 4IAFA 2JLDA 4Y83A 3RAWA 3HMMA 4MD8E 3LFSA 1ZOGA 4BWKA 3W55A 2CN5A 3VJNA 2QD9A 4U8ZA 4IFGA 4WG3A 4FK3A 4BGHA 2C3IB 3FYKX 5JEBA 1H1QA 3S2PA 2X9FA 3AKKA 1CKPA 4UMPA 5I5ZA 1MUOA 2X0OA 2CN8A 3TT0A 4CFUA 3I60A 1PXMA 3KVXA 4ASZA 4TYEA 3HRFA 2CNQA 1KSWA 2R3JA 2PTKA 3H9FA 3C7QA 3Q32A 2WMAA 5GIPE 4UN0C 4C4JA 3MB7A 5CLPA 4N6ZA 3V8WA 3WOWA 1JNKA 4ASEA 4MK0A 2XB7A 3G15A 4O6EA 4EL9A 4RC3A 5EQYA 3BE9A 4CD0A 5L6PA 4B7TA 4QMQA 2IZSA 3AD6A 4IX4A 4JXFA 4KNBA 4WG5A 2QKRA 3SD0A 1YXXA 3E8EA 5I9VA 4FZAB 3CIKA 4FTRA 3HRBA 3HX4A 3QTWA 4FKIA 4A4OA 3QC9A 4O0XA 5CEQA 4BB4A 5EFQA 4BJJB 5A4EA 2JC6A 5AUWA 5LVNA 4EOQA 1E1XA 4RZWA 1SYKA 1H0VA 3Q52A 1ZYLA 2W1DA 4XEYA 3ZMMA 3L9LA 3BV2A 3OT3A 4D2PA 4XYFA 2FSOX 3UDSA 4BCHA 3KXGA 4CMOA 4I20A 2C6TA 1OUKA 4DGOA 4ASXA 3RP9A 1ZZ2A 2XIXA 1YDSE 2UVXA 3PRFA 4IWQA 4FR4A 3LFQA 3POOA 5EDQA 5KZ0A 4IVCA 4BDCA 3F3VA 4DFYA 5AAEA 2EWAA 4PUZA 4I5CA 4FBXA 4U42A 4F7LA 5BVOA 3GGFA 1H00A 3KF4A 1ZMVA 5HI2A 3PJCA 3FZOA 3WF9A 4O0SA 1Y6BA 3GC0A 4JG7A 2XYUA 4DC2A 3TI1A 1JKLA 3QTUA 4WSYA 1NA7A 1U4DA 2X1NA 2H34A 4NM0A 3DB8A 5CU3A 4C3PA 5FM3A 3VONA 4HW7A 4NIFA 4YUQA 4FSWA 3DJ7A 1YI6A 3LJ1A 4J8NA 5E8YA 3W33A 5L8JA 3MTFA 4FEUA 3LCTA 4YJSA 4S33A 3UODA 2B7AA 4YC6A 3OEFX 3V51A 4CZYB 1H1SA 4HVIA 2QHMA 1ZY5A 4R7BA 1OPLA 1XH7A 3H4JA 2WU6A 3ZLWA 2GS6A 3DDPA 4IM0A 2CGWA 5ETFA 3OUNB 4FRFA 2A0CX 3G0EA 2C0TA 3KGAA 4IE9A 4NU1A 4D0WA 4F7NA 4ARKA 4OTPA 3JVRA 3VRZA 1LPUA 3LFNA 3UOKA 3FI8A 4JIKA 3VS5A 1H08A 4M69B 5M57A 3TV6A 1WAKA 2PPQA 2UZDA 3R7IA 4R78A 1Q3WA 2W06A 3P4KA 4XP3A 4QD6A 1BL7A 2VTNA 3OWPA 4GL9A 3A60A 4BDBA 4DT8A 2VWUA 3FY0A 4YC3A 3ZHPC 4ZMFA 1V0OA 3TTJA 1Q41A 5BVWA 2DYLA 3NSZA 4D5HA 5KX8A 4DHIB 1WBTA 5BV3A 2VD5A 4BTJA 4CRLA 4GG7A 1JSTA 4QP3A 4D4RA 2BZKB 3LKMA 3GCVA 3ZXTA 2R3HA 3TZ9A 3NIZA 5CTPA 3KMWA 5J9YA 3KRXA 3NUAA 5ACBC 4Y85A 3I0OA 3WYXA 2XVDA 1BKXA 5IQDA 5AR7A 3LFEA 4FIGA 2EXMA 4I6FA 4MNEA 2W4JA 4U41A 3VRYA 1R78A 3ORTA 2XJ1A 3JY0A 4O0YA 5DI1A 4DH5A 4EK8A 3TYKA 5IQGA 2CDZA 2BUJA 4O4FA 5J5TA 5E4HA 4YZ9A 3NZ0A 4HPTE 5FLFA 1SVGA 4E8AA 1OL6A 5E1SA 3EQIA 5GJGA 3DKCA 5AM6A 4BBFA 3DLZA 3FXWA 2PVKA 5IUIA 3WF8A 4DLIA 4YTHA 1J1BA 4ZOGA 3COKA 2VTIA 5IUGA 3PPZA 4RQVA 4AZTA 4MKCA 2KULA 2OLCA 4RIWB 2W5HA 2YWVA 3UNJA 2A1AB 4QYFA 4XLVA 2QG5A 3OMVA 3PPKA 4OR5A 3WE4A 4O7YA 3CCNA 1P2AA 1KOBA 5BNJA 3LXKA 2X4FA 3F82A 5I9XA 4FTUA 4RIXB 5CXHA 4J8MA 3UGCA 3UP2A 4ZZOA 3AGLA 3M11A 3ORIA 3BPRA 4I23A 4DG3E 4ALVA 3WZJA 2G15A 4YTFA 4D2WA 4O82A 3R7VA 2C3LA 1WBOA 3DZQA 2XNGA 4FUYA 3I81A 3R0TA 2P3GX 4HZSA 4B0GA 4O0WA 1ZZLA 5J7HA 2XIZA 3BEGA 4L52A 4BI1A 3FI4A 3CXWA 3MGYA 4GUEA 2XKFA 4ZTRA 2GHLA 5IA0A 5LJJA 2YIXA 5GNKA 3VBQA 1G8KA 1M2QA 2VX1A 4LUEA 2XCKA 4B8MA 2BRBA 3F88A 3QCSA 4BDHA 2YM4A 3A7IA 3BU6A 4LRJA 4LGHA 2F7XE 5ANKA 2BFXA 2EUFB 4QMPA 1STCE 3F2AA 1YI3A 3JS2A 4FOBA 4GIIA 2W4OA 3CTQA 3MESA 4PRJA 3Q2JA 4EJ7A 5GZ9A 4CQEA 5DGZA 4YPSA 5HNGA 5H9BA 5HU9A 2JDSA 2QOKA 2VO3A 4MYGA 3UQGA 5EYMA 4IAIA 4CZUA 2ZYBA 3I5ZA 5F94A 2Z02A 5LOHA 5HGIA 3MPTA 2UV2A 4BGQA 2G9XA 2C1AA 2YM6A 5GZAA 3W2OA 1XH5A 4RJ8A 1OPKA 5HTBA 4EHGA 3OT8A 4U6RA 1PXJA 4BCPA 2WOUA 1IAJA 3A7GA 3KL8A 4QMTA 1GZOA 3QTZA 2A2AA 3CD3A 5E9EA 4GK3A 4L53A 4XH6A 3SXSA 5EW9A 3I6UA 2HENA 3K54A 2VUWA 4EORA 2JKOA 4QYYA 3ZUUA 1PYXA 2PY3A 4K9YA 1YI4A 3NCGA 3R2BA 5C1QB 3UQCA 1OPJA 2NO3A 5M07A 4ENYA 5HEZA 4XS2A 4LM5A 4JOAA 2GQGA 4BTMA 2OF4A 3FMHA 3HAVA 4R5YA 3FI2A 3ZSIA 5HTIA 3G51A 5CSWA 3N9XA 5HIDA 1NW1A 4C33A 4D1XA 5AAGA 2WQNA 4BKJA 4CZTA 3F2NA 3AD4A 3VUTA 2X8DA 3QQGA 4QRCA 1Z9XA 3QRTA 3TL8A 5AP1A 1XH8A 1QPJA 3O17A 5D7VA 2HW7A 5HG8A 5E8UA 4C37A 5D11A 2GDOA 3A99A 4FT5A 4RJ3A 5AUXA 2C5XA 1YQJA 4G5JA 3GFWA 5AX3A 2XMYA 5CF8A 4ZTNA 1YHVA 3KXHA 4DGLC 4P2KA 4EK5A 3HV4A 3IONA 4RWKA 2BDJA 3SAYA 4HGEA 4EH6A 3PA4A 5KMLA 4CFMA 2X8EA 3R01A 2AUHA 4M68A 3QZFA 3SRVA 4CKJA 2XBJA 4JQEA 4YZDA 2G2IA 3P7BA 1J7LA 2ZM1A 3BGPA 4YC8A 5EH0A 4FL2A 2UZOA 2VTOA 3F3TA 4GKIA 3FLWA 3IPHA 3O5AA 4TYGA 2UW4A 3L9MA 2GNLA 4LFIA 3HV6A 2IEWA 4JAIA 4QMYA 5CYIA 5L2TA 2P2HA 1WCCA 3TXOA 3ZRKA 4BRXA 3BLRA 1H4LA 2W1GA 3ZSHA 1H27A 3QWKA 3MVMA 1OL2A 4IMYA 5IU2A 1OGYA 5H2UA 3FBVA 4HCTA 2QG7A 4XJ0A 4YJRA 4LOOA 4V01A 4W9WA 3TKHA 2HWOA 2W05A 3BCEA 4DE4A 4OAUC 5AWMA 2F2CB 4PDOA 2IPXA 2BIKB 4O6LA 2JKMA 3ACJA 1B6CB 5DT0A 5A3XA 4RJ5A 3DQWA 2WMWA 1W84A 4RFMA 3HA6A 2J0MB 3QQHA 3LVPA 3RPOA 5LMKA 3AD5A 3F5XA 4O21A 4PP9A 4AA0A 4PPBA 1J7UA 3V5WA 5JGDA 2J50A 4W4XA 3EKNA 3U9CA 1A48A 4IAAA 3ALOA 3DXPA 1SNUA 3E8CA 4BZDA 2X0GA 2YCSA 2BZIB 3QKKA 3DAKA 3Q5IA 4ZJJA 5TO8A 2C5VA 4B99A 3E5AA 3PE2A 5CAPA 4F6UA 3NW5A 3WILA 4FSYA 3NYXA 3KKVA 3PWYA 2OJ9A 3NIEA 4FEXA 3W0QA 2UUEA 4LL0A 3ORZA 4MF0A 1XH9A 1A9UA 4HYHA 4AUAA 3ULZA 4C4HA 2JIVA 3BYOA 1YHSA 4USEA 4BCMA 4O0TA 5CSXA 4IB5A 3VUIA 1PW2A 2ITWA 2VWIA 4IJPA 3C50A 3QHRA 1GIIA 4PX6A 4QTAA 4JIAA 4EWHA 2QOCA 1IG1A 3ZO2A 3PVWA 4EK3A 5LMBA 3R8VA 1DAWA 2XZSA 4RA5A 4DHJA 3OOMA 2WMVA 4WNPA 5IA2A 1QPDA 4WNMA 3OF0A 4A9YA 1H0WA 1OUYA 3G0FA 5HE2A 2A27A 3AT4A 2WU7A 5KHWA 4FV1A 3S00A 2X0QA 3R8ZA 2XJ2A 4PP7A 3BQRA 4H39A 3V01A 5HG5A 4QT1A 4YMJA 2XAMA 3W0MA 4GUBA 4G16A 4M66A 4GS6A 2OXDA 2Q0BA 3DQXA 5DIAA 4CFFA 2XUUA 4APPA 2FO0A 4MCVA 4F1TA 5LMKC 5IQHA 4IB3A 3AC2A 2GU8A 4FOCA 4BZNA 4FSNA 3OCBA 3UE4A 4TWPA 2UZUE 3EWHA 4I6HA 3W8LA 3EL7A 4FV9A 3FUPA 4NM7A 2R3MA 4RIYA 5AIRA 1Z5MA 3FQSA 3RHKA 3ZUTA 2R4BA 4ZLOA 5BMMA 4EOLA 3MH3A 4XLIA 3LZBA 2C6IA 1H28A 3TN8A 4EOKA 2WPAA 5HCXA 3VBWA 4Y73A 1Y8GA 3RAKA 3DZOA 2Z60A 3EFLA 2AYPA 2KTYA 3QD2B 4BYIA 3UG1A 3QBNA 2GNJA 4QQJA 2C47A 2Z7LA 4TWNA 3HMNA 2B9FA 2ONLA 4QMMA 3TJCA 2CNVA 4RQKA 5FP5A 3P5JC 3P9JA 1ZRZA 1G8JA 4DA5A 4AQKA 2Z2WA 4FKLA 4A9RA 4FTQA 4BDEA 5AUUA 3TIYA 4TYIA 3LFAA 5AADA 4ZY6A 2BDWA 4BDKA 4E26A 4EZ5A 2BKZA 4G3GA 1OVEA 2C68A 4L00A 3U6HA 5CU2A 4L7SA 1YDTE 4D4SA 1G3NA 3RALA 4BN1A 2GTMA 5AV3A 4G3FA 5KKRC 1YOMA 4KRDA 4E6CA 4XOZA 5AP7A 3T3VA 3TMOA 4HCUA 4X3FA 5HLWA 4MTAA 2JDTA 4FEWA 3MPAA 2O63A 4DH7A 2WEVA 1XKKA 4GMYA 1FMOE 4XV9A 4ANQA 3LHJA 1QMZA 2X4ZA 1FGKA 4B9DA 3PG3A 3V5TA 3R8LA 2PHKA 2CKQA 4JX7A 4D5KA 3LMGA 1REJA 3BI6A 3NNUA 2VNWA 5C26A 3QXPA 1FGIA 1L3RE 4I6LA 4JI9A 4KS8A 3ZSGA 3BX5A 2REIA 3MJ2A 4RIOA 4WSQA 4GCJA 4Y5HA 4WHZA 1GY3A 2YDKA 4OTGA 5J5SA 3ENHA 2P2IA 1E1VA 3CQWA 3MH2A 3PUPA 4X6RA 3LAUA 5LVLA 3R7UA 1M2RA 5ACKA 3TDVA 3NAXA 2V7AA 4F70A 3FSFA 1PMVA 5B7VA 3MH0A 4RGJA 1SNXA 3CP9A 4ANSA 5IH6A 1W0XC 2GTNA 3HUCA 4FV3A 3V5QA 3ZU7A 3LPBA 4AT4A 4QEBA 5EKOA 4AOJA 5IDPA 1G5SA 2ONLC 3OP5A 5HCYA 4A9SA 4DN5A 2BMCA 2PVRA 3EKKA 3V8SA 3AKJA 2BRHA 3LOKA 4O7SA 1JPAA 2ITNA 2P0CA 3ODZX 4V0GB 2PVLA 4DH8A 2XARA 4MD7E 3PY3A 3S3IA 1UNGA 4HOKA 1V0BA 4IXPA 4AA4A 1URWA 3R30A 2ERKA 4AN3A 1CDKA 1TQIA 2W1IA 4LQMA 4DG0E 3GCUA 3EJ1A 5IH4A 3HNGA 3FMJA 1XR1A 2O65A 4CTBA 3THBA 1KE8A 1H1WA 3R9OA 3CE3A 1YDRE 1ZMUA 2R7IA 3TEIA 4PTCA 2VAGA 2QR7A 4CFXA 4F0GA 4QYGA 3FYJX 2VO0A 2XRWA 4FZFB 2XKCA 4H1JA 4EHZA 5E8SA 4I5MA 4NWMA 1O9UA 4UWCA 4GVJA 4RX9A 4I21A 5FWKK 5CENA 4UB7A 2PZYA 3OFMA 4DFBA 4YJVA 3QQLA 3E7VA 4IFCA 3VW8A 2ITTA 3NUNA 4DCAA 3OTVA 4RX7A 4YZCA 1PYEA 3TG1A 4FG9A 3VS7A 5E1EA 4M7IA 3ZUVA 1VYZA 2V5QA 5D1JA 3K5UA 3KK8A 4ZY4A 2J5EA 4XBUA 3EN4A 3PE1A 5FEEA 3TTIA 4WO5A 4BCQA 3WF6A 4DFLA 5HLPA 4BCNA 4AXCA 3MIYA 5ITAA 2ERZE 5FBNC 3P7AA 2VN9A 4EBVA 1IA9A 1NVSA 3ORXA 5HE3A 2VTSA 4CLIA 3RGFA 2OFVA 5IMEA 2FSTX 3O8TA 4O91A 3DAEA 4AN2A 3DXNA 2Y6MA 3UMXA 3RWQA 4DTBA 3V6SA 4FTLA 2R3QA 5EDPA 5CVFA 2P55A 1VYWA 3RK5A 4DLJA 4C4GA 4RLLA 5CALA 3CY2A 4I41A 2OZOA 4AE6A