4F4PA

Syk in complex with ligand lasw836
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
273
structure length
262
Chain Sequence
b'LDRKLLTLEDKELGSGNFGTVKKGYVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Highly potent aminopyridines as Syk kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 84
structure length 262
sequence length 273
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4f4pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4f4pA01
2QR7A 3ANRA 3LFNA 4FT3A 4IB1A 3RAHA 5KUPA 4TL0A 4GJ2A 1OIQA 3DJ7A 4QQ5A 1YI3A 4JG6A 4BWKA 1PKDA 4EQMA 2W7XA 1P14A 4KA3A 4X6QC 3LHJA 3E62A 4DGMA 4MHAA 4U80A 5FM3A 2ITTA 3BU3A 4FV4A 1UV5A 5CSVA 3ZHPC 4DYMA 3DPKA 3HRBA 4PPAA 3FBVA 2CGXA 4W9WA 5HE3A 3FI2A 1YHVA 3GXLA 4P5QA 3GC8A 4RWLA 4HYIA 3T9IA 2EWAA 1S9JA 5EOBA 3V6RA 2GU8A 4KIOA 3JVSA 3L1SA 4YTCA 3IGOA 4J8NA 5IQDA 4EK6A 3U6HA 2YIQA 3KRXA 3FPMA 2B9FA 2IVTA 4I22A 5E1SA 5EYMA 3E7VA 4I5HA 2WFYA 5EM7A 1R0EA 3QRJA 1ZXEA 5H2UA 4FTLA 3VBQA 4TY1A 1FMKA 3QTZA 4YJRA 3W32A 5DR6A 3QZGA 3RALA 1OL5A 4PRJA 4EOLA 2GCDA 2XIKA 3OF0A 2VTNA 2Y9QA 3V5PA 5K5XA 5L3AA 4CKRA 2F9GA 2HZ4A 3QRUA 3I81A 3OEFX 3ZTXA 2PHKA 2YA9A 1GIHA 2VGOA 4FZ6A 4YJQA 3G0EA 1OUKA 5CF5A 5DNRA 4BCQA 1M2PA 3Q2MA 3QTIA 1ND4A 3EQGA 3MB7A 2FA2A 2WMTA 3POZA 3SRVB 3TTIA 3ROCA 1PF8A 5FUTA 5J9YA 3QA8A 3LCOA 3VC4A 4JVGA 3R30A 3RCDA 3SW7A 1U4DA 3BGQA 5IUHA 4UWYA 3HKOA 5E90A 4TNBA 3ORLA 3MA6A 3LMGA 4GFMA 4F6UA 2WPAA 3I79A 3OW4A 5HQ0A 3TUDA 2FVDA 4H1MA 4OBPA 4QOXA 3DXQA 4KAOA 3EFLA 3LQ5A 3EN6A 3ET7A 3Q96A 5CVFA 1ZYCA 2XJ0A 1JSTA 1FQ1B 4R3CA 4U8ZA 5E8TA 4F7JA 3JYAA 4KB8A 3KEXA 5HIBA 1W7HA 4DBNA 2ITNA 2V55A 3PG1A 2IZUA 4ASEA 3B2WA 4GCJA 1KE6A 5F1ZA 5K0XA 2Q0NA 2ITYA 3MIAA 1MQ4A 3MWUA 4F1TA 4L46A 4YJUA 1OIUA 3P7CA 4HNFA 3R9OA 3FMJA 3VUHA 5HBEA 4O0XA 3WZJA 4AN3A 4FSRA 1BKXA 2EXEA 5L6OA 3O96A 4Q9ZA 3MN3A 3REPA 1V0BA 2C1AA 3BGPA 5FBNC 2VTRA 3QCQA 1Q5KA 3QUPA 4X3FC 4S2ZA 3NMUF 2OZAA 3HA6A 4P7EA 4BN1A 5AV4A 4IWOA 4V0GA 4O0TA 4UZDA 4NKAA 2R5TA 2BFYA 2XNNA 4G3EA 2ZV9A 5AUZA 1LEZA 4FV7A 1YDTE 3AC8A 2JITA 3H3CA 5CEIA 1BI8A 4F08A 3CJFA 4WA9A 1RJBA 5HU9A 4K1BA 3QKMA 2GQSA 5AV1A 2QOLA 4XRLA 2RKUA 3ULIA 3A7FA 4UV0A 4WG4A 2PL0A 3AMYA 5GNKA 1KWPA 2PMLX 4EHEA 3DFAA 3N4TA 4AFJA 4LQMA 2R3PA 2VWVA 4K2RA 4IX3A 4JOAA 2WTIA 3FL5A 1U59A 4W4VA 5AMNA 3RMFA 4QPMA 3MTFA 4BCNA 5JGAA 2F7EE 3E87A 2CGUA 4JDIA 4EYJA 3D15A 3MH2A 2ZAZA 4N0SA 4AUAA 2VD5A 3TV7A 2BKZA 2J50A 4MXYA 2BIYA 2OICA 4CRSA 4TWNA 2FSOX 3W55A 4BCJA 3AT4A 5IUGA 2H34A 4IX5A 2KTYA 4G3CA 5HVJA 1YOLA 2OK1A 4FTIA 3COKA 4AOIA 4FODA 3TV4A 1JKTA 2R0IA 4BCIA 1X8BA 1H07A 2WTDA 3IDPA 3LXLA 2YZLA 4EOKA 2X81A 2XIZA 3R63A 4IWPA 2PUNA 4IAYA 4LMNA 4UMPA 5JN2A 5IISA 3FMKA 4S33A 4ZSJA 1IRKA 3HYHA 1ZZ2A 4IMYA 5IZFA 3D83A 4HYSA 5HG5A 4OTIA 5IQGA 1J7IA 1IEPA 3EIDA 2Z7SA 4QMMA 1UKIA 4BGHA 5M51A 3NUUA 4RC4A 2OI4X 4OT5A 2CSNA 2F2CB 4JS8A 4O0RA 3KXMA 3RZFA 1TVOA 3OCBA 4QQJA 4QT1A 2C5YA 2F2UA 5A4EA 4FTMA 5HHWA 4LUEA 4HZSA 3AXWA 1APME 4XG4A 3Q4TA 2XNEA 3FI4A 3G15A 2JKKA 3V5LA 1ZZLA 3P7AA 1QL6A 3NUAA 4FKLA 3CTJA 4XLVA 5JMSA 4J97A 4ZY6A 3R8LA 1GY3A 3KXZA 3VULA 5BVEA 4IVBA 2C3KA 4XBUA 3QUDA 2WMBA 4YTIA 2NRYA 4FGRA 3KF4A 2QHMA 3QF9A 4IWQA 1PMUA 4RIWA 4DTAA 2A19B 1WVWA 4YMJA 4OAVB 3AGLA 4C2VA 3DTCA 3EL7A 4JDJA 4D4YA 1J7UA 2YM3A 1R3CA 5IPJA 5AUUA 4PWNA 3CSVA 1FVTA 5AX3A 2KULA 3FV8A 3GOKA 4CXAA 4RFZA 4XHKB 2IW6A 5HNIX 2P2IA 3CPBA 2QOFA 2QOOA 4UYNA 3D2KA 4QQCA 4JAJA 4JBPA 4QMNA 3C0IA 1ZY4A 2CGWA 3D5WA 3EQFA 3E8CA 3ORMA 4HOKA 3RINA 4EHGA 2JDSA 1HOWA 4ZOGA 2W1GA 2WTKC 4QP7A 2JDTA 2XEYA 3MDYA 3RWPA 3TZ7A 3Q4CA 3TNIA 1U5QA 2HXLA 3F66A 4A06A 3BU6A 3OHTA 2XK3A 4RIXA 3OUNB 4X2KA 4HYUA 4F6SA 1P4FA 4QNAA 4D1XA 4YJSA 4FNXA 3ZDUA 1BLXA 4YJPA 1JVPP 5HORA 1F3MC 3GT8A 5HX8A 2PVHA 4CV8A 2Q0BA 3TKIA 1R0PA 4M84A 2ZMCA 5TE0A 4FTRA 3VS6A 2X9FA 3UPZA 3BKBA 3FUPA 3TL8A 4OTFA 5DN3A 3Q6UA 2WO6A 3CD8A 3RNYA 3ZOSA 4BI1A 4MAOA 1G5SA 5BYLA 3PJCA 2Z7RA 5AV2A 4GVAA 2PMOX 4X2JA 1M7NA 4GV1A 4CMTA 4D2SA 3QYZA 4L8MA 1E1XA 1CM8A 4FIHA 1Q41A 4C3RA 4GIHA 3VW8A 3ZH8A 5CAQA 4H36A 3TCPA 4APCA 3C51A 2W05A 3QHWA 5KMLA 2PUIA 4GW8A 4CCBA 4FTAA 1ZY5A 3D0EA 3H9OA 4FKSA 2W1HA 2WMUA 2BALA 2HELA 3L8VA 3NNXA 4NW6A 5D11A 5DIAA 3W2CA 4CMOA 4DFXE 5KMKA 4NIFB 5H8GA 2F57A 5CEKA 4O7NA 1UU9A 1OL6A 3WF7A 4KIKA 4D9UA 4ANLA 2OJFE 3ACJA 2WQNA 4EONA 3QQKA 5LVNA 2CKQA 2PU8A 2ZOQA 4XH6A 3WF5A 3EQRA 4ANMA 3BHUA 2WELA 1GZKA 3SXRA 3OZ6A 5CYIA 4ZK5A 2YISA 4O0VA 4F1MA 2W4KA 3DTWA 3E3PA 4MD8E 3TJDA 4UALA 4PL5A 2XNPA 3I6UA 3ORIA 4BWXA 4ZTLA 2OFUA 3DQWA 4DH1A 3PWYA 4E6AA 3ZLXA 5HTIA 3FXWA 3BEGA 2QODA 4O96A 2B53A 3E88A 5EK7A 4LL5A 4YSJA 4JXFA 2I0HA 4EC9A 5CAUA 3TTJA 4EUUA 3UGCA 3EZVA 2CKPA 3ID6C 3PP1A 5JFSA 3F7WA 4ZSAA 3VUKA 5GZ8A 3ZRKA 1ZRZA 1Q24A 2CCIA 1XBAA 3G2FA 3H9FA 2WTJA 2VTAA 4U40A 4Z7GA 4DT9A 2VWBA 4J8MA 5HVKA 1OL7A 3EKKA 5ACBC 3MIYA 3PA5A 3OCTA 5DOSA 5J5SA 2R7IA 3PSBA 2X7FA 2GHLA 3QA0A 4Y95A 5C27A 3W33A 2IVSA 4IJPA 3GCQA 5LOHA 3E63A 1YOJA 4RA4A 3E8EA 4IH8A 5HD4A 5CTPA 4A4LA 3MJ2A 1Y6AA 3TV6A 4I92A 4AG8A 4BDKA 5M4IA 5EQEA 1WAKA 2XF0A 4TWCA 3PP0A 4JBVA 5BYZA 2HZNA 2WB8A 3EN9A 2G9XA 3LJ2A 5GHVA 3KCKA 4JG7A 3BYSA 3RTPA 2YAAA 5EYCA 2BVAA 2RFEA 3BPRA 3C0HA 4FTCA 5AP5A 2VZ6A 1OI9A 2PZ5A 3D7TB 4IZ5A 5HG7A 4F7LA 2C6KA 4GS6A 4WRGA 3EQDA 5EHOA 4CLJA 3MVLA 3P23A 3PSCA 4O0WA 2A4LA 2ZB0A 5IA1A 5JFWA 4BFMA 4ZTSA 3DKOA 3A99A 5BUIA 3CD3A 2YZAA 4FIFA 5EDRA 4BIDA 3ENMA 3V8WA 5EM6A 2BKKA 3C7QA 1I44A 3BWJA 4E20A 4E5BA 3R2BA 4RVLA 4FV8A 5LQFA 3SVVA 4MBIA 4D55A 1DM2A 2PY3A 2LGCA 3ZMMA 4WG5A 4AW1A 2WMRA 4G3FA 4CFVA 3HAMA 2BFXA 2Y4IC 5CF6A 1U46A 4XG9A 3M1SA 3IKAA 4DTBA 4H3PA 5IUIA 3V3VA 3CKXA 1DI8A 4IHPA 3DA6A 1XWSA 4BCKA 4C38A 2X9EA 1T46A 4GMYA 4L44A 3VS0A 2IJMA 2BROA 2E9OA 2Z2WA 3RAIA 1MRUA 4AGDA 5DHJA 4WBOA 2GTMA 4UZHA 3BYMA 3VS2A 2UZOA 5CXHA 3MGYA 3AGMA 4U41A 1OMWA 4UMQA 3VNTA 4D4VA 5IQBA 3R2YA 5CT0A 3LM0A 2BUJA 3UBDA 4O83A 4YGAA 3OWJA 4M0ZA 3RBWA 4BDBA 3AD5A 4K9YA 3QRTA 4EH7A 3KRRA 1ZMUA 3K3JA 3GCPA 2XBAA 5JFVA 4QMTA 5CVHA 4KABA 3OOGA 3R71A 1PMVA 4NH1A 3LXNA 4XBRA 5EKOA 4NU1A 3IPHA 4LOPA 1KV2A 4N70A 3UZTA 2UW5A 3R7GA 2O65A 4W9XA 2H6DA 4KS7A 2HY0A 2VTLA 3R21A 2JFMA 4AN2A 3E7OA 3TXOA 2YM8A 4ZP5A 4RC3A 3FXZA 4R5YA 2QLUA 5HO7A 3O0GA 3HRFA 3PRFA 4RWIA 3VF9A 4F64A 5TO8A 3ZCLA 2WU7A 2Y6MA 3O23A 4PL3A 4W8DA 3Q52A 1XHAA 2VWUA 2W9FB 5DA3A 2QOKA 4A9RA 3P7BA 4QTEA 5AUXA 2O2UA 3F3VA 2R3KA 4YO6A 3Q9WA 2F7XE 3T3VA 4XJ0A 2A2AA 4C4HA 2CKOA 2IZSA 4GFGA 3ELJA 4LG4A 3QCXA 2X8DA 5CS6A 3RK7A 5ACKA 2JEDA 2UVYA 4QP1A 3ODZX 5E4HA 2YN8A 4XYFA 1WZYA 1OL2A 3FSFA 3MFUA 4NM0A 4IE9A 2XJ2A 3QC9A 3JPVA 4NFNA 4XG7A 2ITPA 1JNKA 3F3UA 1ZYLA 4C59A 3OG7A 2WAJA 4BI2A 4EOSA 2W1CA 4S30A 3IK3A 5AUTA 4KIQA 2F7ZE 4DLJA 4WSYA 3SX9A 4IWDA 2XCHA 5I9XA 4UWCA 2GQGA 2JDOA 3QD4A 2HOGA 4PTGA 4FL1A 5ANJA 4BC6A 2EXCX 3U4WA 2VO3A 3Q5ZA 2R3GA 3U54A 2V7AA 1G3NA 2O63A 3IGGA 5GZ9A 2GNGA 4B0GA 5I4NA 5AV0A 4GK3A 3FY0A 4L42A 5I9ZA 3IOPA 2GQRA 4GU9A 3R8ZA 1BI7A 5KKRB 3OP5A 1YDSE 5FLFA 5TT7A 1GZOA 3HMIA 3ZBXA 3Q3BA 3OWPA 5IG1A 2R3HA 2BDWA 4DEGA 3ZYAA 3FWQA 3UVRA 4F9YA 4GL9A 1J91A 2PZPA 3NWWA 3U87A 3AG9A 3G0FA 5E8VA 5HVYA 4FYOA 4NTSA 2VTPA 3FLZA 4YLKA 2VTJA 4JR7A 4PMMA 3TN8A 4I93A 3N9XA 4WNPA 1B38A 3R6XA 5AUWA 1ZOHA 5CQWA 4QMXA 3QTWA 2PVKA 1GNGA 1W98A 2XYNA 3OW3A 4JX3A 4NJ3A 1MRYA 4TTHB 3T8OA 4QQTA 3IW4A 4ERWA 4CG8A 3S2PA 5KHXA 5A46A 3KRJA 3CXWA 3C4CA 4C62A 4ITJA 3UO5A 2ITOA 2OH0E 2GDOA 3HMPA 4IC8A 2VWWA 5IMEA 2FYSA 2LAVA 1NW1A 2X7OA 4QMVA 2O8YA 1DI9A 4CFWA 4H1JA 5J7BA 2IG7A 4D2VA 4AACA 4JNWA 2IPXA 3TZ8A 1JLUE 1UU8A 5HU3A 5AEPA 4L52A 3GU5A 3DAJA 2OF2A 5HE1A 1H1RA 3VBYA 2G2HA 4BDEA 4C02A 5TF9A 3TIZA 3KK8A 3MW1A 3W8QA 2VTMA 2GMXA 3S4QA 3IW8A 5HIDA 3GP0A 4NFMA 5FTOA 1IR3A 3HV4A 4HGSA 1L3RE 1OVEA 1Q8UA 4I6QA 4YTFA 3N4UA 1PMEA 2BZHB 4WUNA 3VS5A 3VBXA 4CT1A 2PSQA 1UU3A 2CNVA 4M13A 4P5ZA 5AIKA 2WTCA 4HYHA 3DK6A 3ZM4A 4NM7A 4D2RA 4MWIA 5I3RA 5EYDA 3DJ6A 1K2PA 3CTQA 3FHIA 3WYYA 4LFIA 4E6CA 1B39A 5E8ZA 4A7CA 3BLHA 3D94A 4XEYA 4ZAUA 5M4FA 2QO2A 3ROYA 1QPCA 2J0LA 4NJDA 3QALE 3SA0A 4MQ2A 2ITVA 5EQYA 5GZAA 2BRBA 4ARKA 3OXZA 3WIKA 1PMNA 4IAAA 4BTFA 4EC8A 1YXSA 2PZIA 3F5PA 4S31A 4PPCA 4DE4A 5HESA 2ERZE 1PY5A 3ZUUA 1SMHA 4GK2A 2NO3A 5E7RA 3W16A 3ZFXA 4CSVA 4EH2A 1Q8WA 2C5NA 4ZLOA 2GNJA 4Y5QA 2XYUA 4QMPA 1QCFA 2CN5A 3OOMA 4U7ZA 1P5EA 3WE8A 1Y91A 3NZ0A 4RMZA 5ETCA 3DZQA 2ACXA 4J96A 4ANBA 3NW5A 2ZM3A 3F3WA 1YXUA 1PXOA 3K54A 4ZLZA 5AP4A 1V0PA 3FLSA 2G2FA 4UXLA 4B99A 5AADA 4EK3A 5EI6A 3PDTA 5CEPA 2WIPA 3JVRA 4WD5A 4GIIA 3AMAA 2XKCA 3COMA 1OBDA 4AT3A 2WMWA 5EW8A 5GIOE 4FL3A 3TG1A 2O64A 5C03A 3DBCA 1SNXA 4FSZA 2ETMA 4WUAA 5EOLA 4XNEA 2R0UA 5M57A 4XP3A 4TYHB 4ANQA 2E9NA 5GJDA 2BZKB 3FQSA 4G1WA 4L68A 2C5VA 1A48A 3R1QA 2YM4A 4JDHA 4ALVA 3HV7A 2QO9A 1KOAA 4I0RA 4BF2A 2X8EA 1O9UA 3VBVA 3WZUA 5DT4A 1YWRA 2BHHA 1LR4A 4BHNA 4LV5A 1H8FA 3UIMA 3PXKA 3IECA 1V0OA 4TYGA 3PXFA 3VS3A 2OKRA 3ORTA 5CSWA 3UQFA 4M0YA 4RX9A 4JX7A 5F4NA 3W2RA 2PZRA 4FG9A 4WOVA 5HO6A 2IZTA 2P4IA 3O71A 3KMUA 4QRCA 3ZC5A 4B7TA 2OO8X 4BCMA 3SGCA 4IADA 4RSSA 4D5KA 4LUDA 4IZAA 4TYJA 2PVMA 3FI3A 3DOGA 4FEXA 5AR2A 1JQHA 3P78A 5JT2A 3CC6A 2GPHA 2XIYA 5T6KA 4G9RA 4AZSA 3QQHA 5L2TA 2BCJA 4CCUA 1XBCA 4GT5A 4L3LA 5TOZA 4QP9A 3KA0A 3NSZA 4O6EA 4C0TA 3Q9YA 2I7QA 3HGKA 5GIPE 4KIPA 2QNJA 1KUTA 3QKLA 3IDBA 4MCVA 5A54A 2VX0A 3L9NA 3UNZA 2RL5A 2WMXA 3GENA 3O8UA 4C3FA 3MS9A 3OS3A 1M7QA 1RDQE 2QOIA 4HVDA 3LFSA 2VRXA 3FC2A 4TWPA 1URCA 3H4JA 3IOKA 4HPTE 3WF6A 4BZOA 4CFXA 4K0YA 3PY0A 2I0EA 4YC3A 3KXGA 5HTBA 3PJ8A 2J90A 4O6LA 3W10A 4DEEA 4WKQA 4JRVA 4HVHA 1O6KA 1GZ8A 3DLSA 4NM5A 1OKVA 1BX6A 1NVRA 2R3IA 2X7GA 4OBQA 5B2MA 3ALOA 3JXWA 4DEBA 3QD0A 3M42A 4XG8A 4I6FA 1O6YA 5BQ0A 2DS1A 2ONLC 2FUMA 3MVMA 2YLEA 3PXRA 2ZM1A 3LCSA 5HOAA 1NVQA 4Q2AA 3N4VA 2YABA 4BDCA 5BVWA 5IQHA 3A7HA 4R7HA 3U55A 3COHA 3PSDA 5M4UA 3NIEA 4JAIA 3FKNA 2QQ7A 4BKZA 3LCTA 4NWMA 4C4IA 5IMXA 5H3QA 4OTHA 2XBJA 3P5KA 4OTPA 2CPKE 4I5PA 1OIYA 3EQHA 3TNWA 2BPMA 2J0MB 2ONLA 4MX9A 5F95A 3VBTA 4IB0A 4F1OA 4FMQA 3EQCA 2HY81 3HRCA 2NPQA 3QAME 1JPAA 1TKIA 3JS2A 2YAKA 1XKKA 3CCNA 4FEWA 1PJKA 2ZDUA 3HNGA 3IDCA 2UVXA 4AT5A 4QYEA 4O7WA 1OECA 5KMJA 1PXPA 3QD3A 3R28A 4C8BA 3LMIA 3TEIA 3W2QA 5J1WA 5LMKC 3G5DA 5JZJA 3F2NA 3KVXA 4OW8A 2UZTA 5D10A 4RLLA 1VYZA 3UTOA 4F65A 4R1VA 2QONA 4GEOA 1DS5A 3NYVA 3PPZA 3WF8A 4AA4A 3DZOA 4M7IA 4I0SA 2VNYA 4L7SA 4FZDB 3ZFYA 2PUPA 3A7IA 4AE9A 2QLQA 2UZWE 3O50A 3EFWA 4E8AA 3CP9A 2NRUA 5LMKA 1PRYA 5AA9A 2W0JA 5AA8A 4TT7A 5F94A 4XCUA 3KK9A 5ANGA 3QCYA 4B8MA 3Q6WA 4L9IA 5K0KA 4ZMEA 2YERA 2Z7QA 2YHVA 5AWMA 3PVBA 4PL4A 3DJ5A 3K3IA 3ZSHA 4D28A 5CEMA 2R3FA 5HZNA 5ANOA 2B54A 4IXPA 5ETIA 2X6EA 2B9HA 2BTRA 1UVRA 2W1FA 2JAVA 2YIRA 4KUJA 4R5SA 5IH5A 1ZMWA 2C6EA 4RJ4A 3DV3A 4JRNA 4TXCA 4FG7A 1YI6A 3DKCA 4IZ7A 2YITA 4DFZE 5IA4A 4FIIA 4NYEA 1GZNA 3UQCA 2UW4A 2UZVA 5CT7A 4LRKA 2WMSA 2X4FA 3QRKA 3SKCA 2FSMX 3A61A 5JH6A 3U6JA 5CALA 4XRJA 4CG9A 4X3FA 2O5KA 2WQBA 4QP4A 4G6OA 3SXSA 4ZZMA 1V1KA 2ITWA 2O0UA 4U6RA 3LJ0A 4FSNA 5CU4A 1L8TA 4D4RA 3ZO2A 2XVDA 2GFCA 4ID7A 4QPSA 4RA5A 2VNWA 3DXPA 5FEEA 4N57A 5AP7A 4FG8A 3ZONA 3DB8A 3UOJA 4USDA 4EH5A 2H9VA 2UW0A 4IIRA 3PVWA 2YCRA 4QTBA 5M53A 2ITXA 2VTOA 4BICA 2JIUA 5F20A 1PXIA 4ANSA 4CTBA 5H8EA 2GTNA 2XUUA 4E4NA 3RK9A 3CQEA 1WCCA 2BIKB 4FV5A 5EI2A 4TYIA 4ENXA 2R7BA 4ALUA 2PVJA 2I40A 5CENA 1H27A 1K3AA 3PE2A 3WE4A 2B7AA 2C4GA 4RVTA 4RGJA 3V5QA 4RC2A 5EM5A 5LVPA 2WKMA 5ITAA 4FK6A 5CEQA 4DT8A 1LPUA 3F5XA 2HW6A 2BAQA 2J2IB 4CQEA 1ZYSA 2C1BA 4M69A 4O27B 1FGKA 3KF7A 5JEBA 2XP2A 5JQ8A 4GG5A 4PX6A 3D5UA 4FSUA 4GYIA 3ZRMA 3AMBA 1DAYA 4DHFA 2C6OA 3BIZA 4XUFA 3GNIB 4LOOA 1FBNA 4XMOA 2JIIA 3R8PA 4BKJA 4FEVA 2Y0AA 5LMBA 2IWIA 4RFMA 5CSHA 2XJ1A 5IDNA 2VX1A 4O7VA 4H05A 3PE1A 2QI8A 2WGJA 3UE4A 4C61A 4F0IA 2CNUA 5E8SA 3NX8A 4CFFA 3HUBA 5CU2A 5ETFA 4F9CA 5FTGA 2O3PA 1OPJA 2XM9A 3B8RA 4F9AA 2W1EA 5DR9A 4U97A 4CFNA 2R3NA 3ACKA 4GT3A 4OTGA 4AXAA 4YU2A 3R8VA 4L53A 4C33A 3IW6A 4ZLYA 2OIQA 4FSWA 1U54A 3K5VA 1H28A 3VJOA 4C57A 1P4OA 5AV3A 2XZSA 5FBOA 4FKOA 1NXKA 5IDPA 1LP4A 3DBFA 4FZAB 5A4CA 2YDIA 3QGYA 3W2OA 3LPBA 4L3PA 3ALNA 3FC1X 4AX8A 3C4EA 4IQ6A 3L8PA 4I6HA 4J1RA 3EFJA 2C0TA 3OY1A 4MF1A 5B2KA 5BNJA 3GCUA 3QU0A 2PZYA 3UIXA 3EYHA 1K9AA 1YHWA 4ZSGA 2F49A 4EOPA 1T45A 3NW7A 4E4LA 2H96A 4YPSA 4ANNA 1XO2B 5K4JA 2XEZA 4IZYA 3LVPA 4RT7A 4YHTA 4D0XA 5CI7A 3TACA 3TZ9A 4O81A 5EH0A 3O17A 4EUTA 3D4QA 1XH4A 4FIEA 2W06A 3EFKA 3P4KA 1WVXA 3GCVA 2WD1A 4QYFA 4PTCA 4G34A 3W1FA 3EOCA 4DGOA 3PY3A 5LARA 4CGAA 4KSPA 3MESA 4QMYA 4DEHA 2BRNA 4CVAA 3DK3A 5A4QA 4I0TA 4FR4A 3WZDA 4U0IA 4EBVA 1OGUA 5DEYA 2G1TA 4PF4A 2UUEA 4RJ3A 3R02A 3R0TA 4MKCA 3KFAA 3KMWA 1Q4LA 3MYGA 3F61A 4QP2A 2C47A 3K2LA 4HCVA 1ERKA 3ZBFA 5E91A 3I7BA 4EKKA 1RW8A 2IZRA 2OIBA 2JD5A 5D12A 2WIHA 3R00A 3RJCA 3NS9A 1CKPA 2GNHA 4XOYA 5J1VA 3Q9XA 4QP8A 1XBBA 1H1PA 3Q60A 4LM5A 4YHFA 3AC1A 2XIRA 3E8DA 3RAKA 4D2TA 3MFTA 3GC0A 4IDVA 3A4OX 4C4GA 4AF3A 5CF8A 1IAJA 3BEAA 2B52A 3A2CA 3LXPA 4K33A 3SV0A 5EM8A 4JT3A 4E6QA 3AC2A 4AZVA 4I21A 1SM2A 4J71A 5DH3A 4BDJA 4DG3E 4O0SA 4GKIA 3SG8A 3TNPC 3KB7A 3R7OA 1KE8A 4U44A 3D7TA 2Z60A 1XJDA 4KKEA 4FT9A 5DBXA 2UW8A 1M52A 3V6SA 1GOLA 2QU6A 3FZPA 4F7SA 4YZNA 5FTQA 3KRLA 3VRZA 4CYJA 5BUJA 3NLBA 3CGOA 3HLLA 3D5XA 4MEDA 5G1XA 3SHEA 5CU6A 4ZJJA 1CKJA 2ZV2A 3L9MA 4DCEA 5BMSA 4YTHA 5HEZA 1W83A 3FLQA 2X39A 2YFXA 4KKHA 5A6OA 1R1WA 3CQUA 4NCTC 4DF3A 2QC6A 2B4SB 3OT8A 3PJ2A 3WOWA 2VO6A 2HENA 2QOBA 1ZMVA 4YC6A 4AGWA 3NAXA 3OMVA 3QCSA 1JKLA 1B6CB 3GGFA 4DINA 3QBNA 3NYNA 2W1DA 3FZRA 3IW7A 4NL0A 1ZOEA 4ZTMA 3BE9A 2WTKB 4EOIA 1IA9A 1UA2A 2J5FA 3BBWA 3FQEA 4FNWA 3DBDA 3PYYA 2W1ZA 3OVVA 2YM7A 1UNLA 3MI9A 4FUYA 2BTSA 2JKOA 4NCTA 4I23A 3BHYA 4XV3A 4YZBA 5DVRA 3SC1A 4HGLA 1J1CA 2GNFA 3HV5A 5LCKA 3VQHA 1MUOA 1Y8GA 1KE5A 2PK9A 4RZVA 3C4ZA 3I0OA 3H0YA 4QP3A 3SDJA 5HCXA 3VUDA 4EH9A 3WILA 2V0DA 4V05A 3ZEPA 3UOKA 4HPUE 4X21A 1H0WA 1H1QA 3COIA 4DGLC 4XG2A 4YC8A 4AGCA 4LGHA 4PMTA 4RIYA 1OM1A 1UWJA 2QKRA 3L8SA 4QO9A 4DBXA 4XLIA 3M2WA 4PDYA 4LL0A 2YEXA 4KIKB 5J95A 4QTDA 2VAGA 3OTUA 4EK5A 2OH4A 4Y83A 3VS1A 5M07A 2X2LA 4A9SA 3UDBA 4IFCA 1W82A 4NKSA 3KULB 2R3QA 1KOBA 3ANQA 1ZARA 2QOQA 5E8XA 4MBLA 2RGPA 4MVFA 3PA4A 3ZUVA 4C58A 4ZXTA 4ZJVA 3ZO1A 1QPEA 4TN6A 3WARA 4KINA 3SW4A 1PKGA 3QYWA 4FSTA 4AGUA 2C6LA 4FVRA 1OKWA 1PHKA 1QPJA 3PUPA 1FPUA 3FL4A 3ZFMA 1AQ1A 3BBTB 4UEUA 4LOQA 5J7HA 4HVIA 4PP9A 2JAMA 4EL9A 3WZKA 5A4TA 5IEYA 4V04A 2P2HA 4U3ZA 2C0OA 1ATPE 4MF0A 1OB3A 5K3YA 2CHLA 3DXNA 4A07A 3Q2JA 3OROA 3A62A 4X2NA 3UYTA 4I4FA 4U45A 3MVJA 3THBA 2BDFA 4DGGA 5T3QA 4EH4A 4CMUA 4O0UA 3EH9A 2R3JA 1KE7A 2REIA 1U5RA 4U79A 4PMPA 3G51A 3RPOA 3ORKA 4JBOA 3R22A 3OWKA 1I09A 4RJ5A 4GYGA 4MXXA 5IH4A 2VO7A 4FTQA 3FLWA 3LLAA 4C4FA 2FH9A 4E1ZA 3EQPA 4GRBA 5DRBA 4ORKA 4O7RA 2YDJA 3R1YA 5GINE 3EL8A 4AN9A 3ZC6A 2HXQA 4I4EA 5CASA 4RWJA 3ERKA 4EEVA 5KMOA 2WEIA 2Y4PA 1SVGA 4FTJA 2IW8A 3ZO3A 1CKIA 3LFCA 3PPJA 3LFBA 4RX7A 5HLWA 5H9BA 5FEDA 3FYJX 4DA5A 2UV2A 4EOOA 1MQBA 2AYPA 2XK9A 4C34A 3PVGA 4XOZA 3GC7A 4D1ZA 4C4EA 3KGAA 4QMZA 3IONA 1OZ1A 3ORNA 4ZSEA 4IB3A 3QQFA 5IKWA 2XNBA 3FHRA 4P2KA 5HD7A 3QZIA 3VUTA 3SOCA 3V5TA 3GEQA 4F9WA 4AOTA 2CMWA 2YWPA 1WBPA 3BHVA 5J87A 2G2IA 3R01A 4EZ7A 4QMQA 2R3OA 4IB5A 2P0CA 5CSXA 3T9TA 4RG0A 4EK4A 2R9SA 5KMNA 1Q99A 1PYEA 4X3JA 1QMZA 1PW2A 3F6XA 5L2SA 3FLNC 3PIZA 5IQAA 2PTKA 1CDKA 3P86A 3BGZA 3QTRA 3A7JA 2IO6A 4ZTNA 4WSQA 3MB6A 5KX8A 4EZ5A 4YP8A 4APPA 2W17A 3MH0A 1GJOA 4B9DA 4DG0E 4F7NA 3P0MA 4JJRA 1CSNA 5FXRA 4R78A 3PA3A 4E3CA 4YLLA 1YRPA 4MD7E 4ZTQA 5HCYA 4A4OA 3UNKA 2V5QA 4PPBA 5E1EA 5B7VA 2HIWA 4FL2A 3ZXZA 3GUBA 3F5UA 1OPKA 4MNEA 3PJ1A 3BWFA 4RJ8A 1YDRE 2OGVA 5AM7A 5IH6A 4O91A 2GHGA 2XCKA 3C4FA 2C6TA 4DEDA 5CAVA 3UC3A 4UY9A 3Q9ZA 3A7GA 1Q3WA 3CEKA 3UO6A 5HTCA 1G8AA 2ZV8A 1H08A 4A9UA 3FMMA 4WIHA 3AT3A 4AZFA 2I0YA 4FOBA 3QQUA 4FV3A 5DWRA 3VVHA 4EHZA 2QU5A 3LKMA 2X8IA 5D41A 2HW7A 2ETKA 3FI8A 3TM0A 2ETRA 4FNZA 4BIEA 4QMUA 5IQCA 3LFFA 4GSBA 5T68A 4RPVA 2FB8A 2HWOA 3EWHA 3QQJA 4NZWB 2HZIA 3GQLA 3R9HA 3HDMA 3CY2A 4FSYA 4KRCA 5AX9A 4AZEA 4BTKA 2C3IB 3MJ1A 5TR6A 4O84A 3DT1A 3R7YA 4CKIA 4DLIA 1ZAOA 3KXNA 5DGZA 4H3BA 4EOMA 2W5HA 4A4XA 4O7YA 2W96B 3R1NA 2AC5A 1Q8TA 3ZLWA 4YJVA 3NAYA 3VIDA 3G9NA 2HCKA 3TDWA 2C6DA 3TKUA 2PVFA 1W0XC 4LMUA 5HBJA 4MD9E 2Z02A 4YBKA 1Y8YA 3POOA 5CQUA 5JRQA 5IU2A 5LWMA 2P33A 3DFCB 4FTKA 4Y85A 1WBWA 5ANKA 2BRMA 2FGIA 5C8MA 4L01A 5KE0A 3Q5IA 5IA2A 3MY1A 4PDOA 4FI1A 4R1YA 4DAWA 2BDJA 1LEWA 4LRJA 4OTQA 5HG9A 3DGKA 3R83A 3FZSA 4G16A 3RVGA 2VX3A 3V04A 5DG5A 2CJMA 3HZTA 4O21A 4MBJA 1W8CA 2X0GA 5AUYA 3IS5A 3ITZA 4YZCA 2NNWB 4FT5A 2ITQA 5GJGA 2JLDA 4BDFA 2VO0A 4KBAA 2C0IA 3U4UA 5HLNA 5L8JA 3ZDIA 4TYHA 3NNUA 3P9JA 3QUEA 5FGKA 5LWNA 3C0GA 3HL7A 2X2MA 2R3RA 3QTSA 3R73A 2UZUE 4IFGA 4YNOA 5BVDA 4KD1A 2YWVA 4R77A 2YIXA 4AW0A 2ZVAA 4O82A 1YOMA 4UX9A 1AD5A 4FT0A 3P79A 4IDTA 4E5WA 3DBQA 4XP0A 4DFNA 5BYYA 2RFNA 3ENHA 5I9YA 5LVMA 3I60A 4XV1A 3RPRA 2BRGA 4FT7A 1SYKA 4BGQA 4BCOA 3I0QA 5KCVA 3R1SA 3QFVA 4DFLA 2VN9A 3QTQA 5FP5A 4JQ7A 5EKNA 4RX5A 2EU9A 1REKA 2VWXA 3FQHA 4O7SA 2ESMA 2XRWA 1XH9A 2XNMA 3FMEA 4JQEA 1SNUA 3RK5A 4FKTA 2OJGA 4QD6A 3ORPA 4KRDA 4DCAA 4OBOA 5LMAA 2RG5A 4DH3A 1JSUA 4CZTA 4Y8DA 3UO4A 4X0MA 2X1NA 2ZM4A 3AD6A 4O86A 3D5VA 4X2FA 4I6BA 2EB3A 1OBGA 5DT3A 3FXXA 5DR2A 3O51A 5FXSA 2OF4A 5AAFA 4NW5A 3TZMA 5L4QA 3GU6A 3BCEA 5FD2A 1TQPA 2YDKA 3BYUA 5BVOA 3T3UA 1Z57A 3CS9A 3RHXA 3QD2B 4Y46A 3MA3A 3H10A 3UNJA 3KKVA 1J1BA 4RLKA 2C3LA 3DK7A 5FG8A 4AAAA 3PPKA 3EQIA 3VS4A 4HZRA 4I3ZA 5DFPA 3RPSA 3V8SA 2ZYBA 3UZPA 2QG7A 3DS6A 4Q5EA 2E9PA 5JK3A 3ZLSA 3HMOA 2QKWB 4HGTA 4G2FA 4BYIA 2WTVA 4FZ7A 4CT2A 3UVQA 1PXKA 3EMGA 1SVEA 4RVKA 1F5QA 3OCGA 3PRIA 4O22A 4BRXA 4LRMA 4RZWA 4IM2A 2P3GX 2JBPA 4CKJA 3LFEA 1GAGA 4ANOA 4PP7A 5LXMA 2FSLX 4O1OA 3ORXA 3WI6A 4E5AX 3DB6A 5CNNA 2IVUA 4L43A 3SLSA 3NPCA 2VUWA 5HX6A 3CKWA 3WF9A 2A27A 2B55A 4CLIA 5M4CA 3DBEA 3DLZA 3BV2A 4IAIA 5DT0A 2UW7A 3SRVA 4C4JA 4QTCA 5CNOA 2B1PA 3C5UA 3C4XA 5HNBA 4BKYA 3H9RA 4F70A 1YW2A 2CDZA 2V7OA 1BL6A 3GC9A 3LAUA 4IVCA 5IEVA 3BU5A 3F88A 5C4KA 3CR0A 2QURA 3R8MA 5A14A 4BVUA 4F4PA 3R9NA 2VU3A 3OT3A 5AUVA 1UKHA 4IEBA 5ANDA 3VAPA 4YUQA 4ACCA 2R2PA 3F69A 4QMWA 4UN0C 1WFCA 4FBXA 4K6ZA 4L00A 4FTUA 2VTTA 3JY0A 4JBQA 4YSMA 5HKMA 3QXPA 3TJCA 4ACMA 2PUUA 3BLRA 3LIJA 2BAJA 4FOCA 2UZNA 4UB7A 5EHLA 4D1SA 2Z8CA 2XB7A 1IG1A 1H25A 2DUVA 5HE0A 5DLSA 5L6WL 1FGIA 4NEUA 3HV3A 4FVQA 4CQGA 2B9IA 3OXIA 5EDPA 2W5AA 1JBPE 3ETAA 2QG5A 3KMMA 3PTGA 4RQVA 4QNYA 4G6NA 4IAZA 4P4CA 1KV1A 2W5BA 4OUCA 4AE6A 1YWNA 5EW3A 2A1AB 3FZTA 3TI1A 4EOJA 2OLCA 4ASDA 4J52A 3E92A 3KRWA 4HW7A 2UW3A 4JLCA 2W1IA 4JIKA 2DWBA 4HJOA 4F6WA 4AW5A 2XK4A 2C3JA 4QMLA 3R9DA 3HEGA 1ZOGA 5G6VA 3QX4A 3OD6X 1JKKA 3GBZA 1SZMA 5CZIA 3MPMA 2BZIB 5C1QB 3LFAA 4E4XA 5DYJA 3UVPA 5J79A 2EUFB 3RHKA 1TQIA 2FO0A 1IA8A 3BZ3A 2C30A 5DE2A 4AZWA 5I5ZA 3VBWA 4E6DA 3NVKI 5AAGA 4AT4A 3WBLA 3HX4A 2J6MA 2ZDTA 4L67A 3TUBA 4ZS4A 3Q4UA 4MTAA 3U8WA 3LCDA 1ZYJA 3B8QA 4S34A 5AIRA 4CV9A 2Y6OA 3MFRA 4W8EA 1BL7A 5CVGA 4F99A 2X2KA 2PE0A 4BY9E 4ZZOA 4UMTA 3QTUA 5KZIA 4R3PA 4UXQA 4LYNA 2J0IA 5CANA 2OJIA 1NA7A 3OY3A 4KBKA 4XX9A 4BBMA 1DAWA 2IN6A 2WQEA 3KL8A 3VUIA 5I0BA 2YCSA 3S0OA 5AR8A 4X2GA 3AD4A 3TUCA 4OTDA 2OW3A 5M56A 4PMSA 1UWHA 1WBSA 2WHBA 1REJA 4KKGA 4RFYA 4DC2A 2VV9A 2BMCA 4OR5A 4TW9A 2R64A 3QQLA 4F9BA 2J51A 4M8TA 5LVOA 3NRMA 4TWOA 4EOQA 3I1AA 2GHMA 2C69A 3HUCA 5IA5A 3UMXA 3CY3A 5E8YA 4OT6A 3AT2A 3K5UA 3F2AA 4DH8A 1J7LA 5FDPA 3FMDA 2GNIA 3E5AA 3IW5A 3QLGA 3W2PA 4IJ9A 4M12A 2WOUA 5I9UA 5CI6A 4F0FA 3I4BA 3LCKA 5FWKK 1XH6A 4TRLA 4QP6A 4U5JA 2W4JA 2X6DA 2GS2A 3AQVA 3LQ8A 3NYOA 4DITA 4FSQA 5KBQA 2ZMDA 3U9NA 4JQ8A 4GVJA 5DI1A 3FJQE 1VZOA 4U42A 4EQCA 5IEXA 3RKBA 4C7TA 4YR8A 1JKSA 1GIIA 2XKEA 2XNGA 2V62A 4QYGA 3SXFA 3TIYA 4H58A 4F63A 1SVHA 3RNIA 1CTPE 5AJQA 5CU3A 4EK8A 3VN9A 2OZOA 1M14A 2UZLA 4EQUA 4PNKA 1Q62A 3F9NA 4ACGA 3C50A 3QZHA 4FKIA 4KBCA 3V5JA 5JKGA 3DNEA 5DMZA 4ZSLA 2JDRA 3KREA 5KZ0A 3TKHA 5M08A 5M44A 3I5ZA 4JDKA 3G33A 4FC0A 2QOHA 3KC3A 5D7VA 4USFA 4K77A 2XS0A 2GNLA 3PIXA 3PY1A 4C2WA 4QYHA 5CEOA 1PXMA 3NW6A 2J0JA 3L9LA 4FKJA 4RWKA 3MY5A 1BUHA 1VJYA 1KSWA 2UW6A 3TDVA 1PYXA 2A0CX 3NR9A 4C35A 3VUGA 4BCHA 4M68A 3KCFA 3E8NA 5IF1A 1OIRA 3LLTA 4UYAA 1FMOE 3CBLA 2YIWA 4EBWA 1HCLA 2CKEA 4IVDA 4O1PA 4YPDA 4I5CA 1Y6BA 4FZFB 5CX9A 4MQ1A 3BHTA 4YBJA 1RQQA 3HA8A 4L6QA 2HWPA 5C26A 5E9EA 2JBOA 1WBNA 3G90X 4FGBA 3VS7A 1JOWB 2OZAB 4MK0A 4V0GB 3BQCA 3D7ZA 1HCKA 4NSTA 4R6VA 3FYKX 3V8TA 3A8WA 1JWHA 1NY3A 5BVFA 1Q97A 3RPVA 4G17A 5EYKA 4BCGA 2J7TA 3GU8A 3QTXA 5TKDA 2E2BA 5BVNA 2BAKA 1STCE 4X3FB 4O2ZA 3PZHA 4Z3VA 3CJGA 3GCSA 4U81A 5HO8A 3PXQA 2J4ZA 3EB0A 3OWLA 3UOLA 5J5TA 3DDQA 4DFYA 5C8KA 1H4LA 5I3OA 2FSTX 3QRIA 2W9ZB 1JSVA 3FZOA 3LFQA 4DEIA 3OEZA 4MXOA 3TT0A 1XH5A 5BUEA 3PG3A 2WTWA 3QLFA 5IQEA 3KN6A 4BZDA 2XK7A 4NIFA 1WBVA 1XQZA 4FE2A 3HMMA 5HI2A 4M15A 4D5HA 2AC3A 2RG6A 5ETAA 1WBTA 5EI8A 4DH5A 2WZJA 3ODYX 4N6YA 4BDGA 5CSPA 5K4IA 3NUXA 4FSMA 4GU6A 4BTMA 4L3JA 3CPCA 3R7VA 4EI4A 3ORZA 4FKPA 3EYGA 3O2MA 3RI1A 4DFUA 1H0VA 2VGPA 4U43A 5JFXA 2SRCA 4ONAA 3EN4A 3KXXA 2WXVA 3UMWA 1R39A 2VTIA 3DQXA 3LE6A 4BBEA 4IM0A 4WHZA 4BR3A 3RCJA 3UG2A 4W4WA 4G9CA 1YQJA 5EFQA 2YM6A 4M69B 1WBOA 4ENYA 2Z7LA 4ZY5A 3BE2A 3R7UA 4B8LA 5C8NA 4AA0A 1OITA 4L7FA 4MXAA 4CNHA 4ZS0A 4HVGA 3FKOA 2CCHA 2JKMA 2WMQA 3DCVA 4FICA 5AR7A 3LMHA 1WVYA 3JUHA 1Z9XA 3OCSA 2CNQA 3FLYA 4K18A 4X6RA 3FPQA 3RGFA 4Z16A 3RPYA 4UMRA 4B6LA 3CGFA 2PMNX 3NYXA 3Q32A 4FV6A 3BYVA 2WMAA 3HECA 3R04A 4FX3A 4IW0A 4NM3A 4Y73A 3VWAA 3NDMA 5H8BA 2UZDA 2OXDA 3MBLA 3CE3A 4Z9LA 3FMHA 1E9HA 2PE2A 3F3TA 3LJ1A 3UIBA 2WEVA 4ZTRA 3ZEWA 4BWPA 3OBGA 4RIWB 4WG3A 2QHNA 3KVWA 1YWVA 1P2AA 2C6IA 3MSSA 3G6GA 3A4PA 4J95A 4HNIA 3E93A 4II5A 3D14A 3OTVA 5B0XA 1Q8YA 1U54B 3GB2A 4FIGA 3PXZA 3UP7A 3PJ3A 4FNYA 1H01A 4V01A 3UIUA 4BDIA 4C36A 2H8HA 2BHEA 3P1AA 4LI5A 4ZMFA 4HVSA 4YO4A 3FDNA 1Z5MA 5HLPA 2YIYA 4QTAA 5AFVA 5L2IA 4WO5A 5J9LA 4OGRA 4FVPA 4GJ3A 4E4MA 5EG3A 5BPYA 3B2TA 5BX0A 2YCQA 3NVMB 4OAUC 5C4LA 4GK4A 4I1ZA 3KN5A 4EWHA 1VEBA 2ITZA 4WNOA 5L2QA 2EVAA 5BMMA 2G15A 3QHRA 4IAFA 5E8UA 2PVNA 3QWKA 3ZZWA 3KULA 4RIXB 2QR8A 4W4XA 3S95A 4DH7A 2JGZA 4IANA 5EW9A 4NTTA 3QQGA 2CGVA 5DEWA 3U6IA 2ZV7A 2XA4A 4AZTA 4XG6A 2VTSA 2QD9A 1XR1A 1XH8A 4I94A 2IW9A 3UODA 2OJJA 5IQFA 4FYNA 1NT2A 4D2PA 3PXYA 3GU7A 3MH3A 4BZNA 1H26A 2PMIA 2UZEA 4FV2A 4R7BA 4GT4A 4IBMA 5JRSA 4FV1A 4KWPA 4Y72A 1YXVA 5C01A 2VTHA 3HV6A 4IX6A 2RF9A 4YZMA 2IVVA 3PLAE 4PTEA 3VF8A 2I0VA 3UG1A 5KBRA 5LCJA 4KSQA 5FM2A 3ATSA 3UZRA 3NUSA 3ZZEA 4AP7A 3VUMA 3NNVA 3FSKA 4K11A 2QVSE 4ACDA 4XP2A 4FA2A 4O38A 2GS7A 4YZ9A 1KE9A 3EJ1A 3DAKA 5CF4A 1EH4A 1UU7A 4A9TA 5EQPA 1OKZA 3MFSA 5D1JA 4DEAA 3AOXA 3FMLA 3QC4A 4MH7A 3VO3A 5KMMA 2W4OA 4O7LA 4HCUA 1BMKA 3JY9A 3VRYA 2J9MA 2RFSA 3NEWA 5J8IA 4FEUA 4B4LA 4EZ3A 4BBFA 3QWJA 4RX8A 2E9UA 4FF8A 2X4ZA 5AP3A 5BVKA 5F9EA 2PYWA 4YHJA 4ALWA 5HICA 4D9TA 4F0GA 5EHYA 2J0KA 2P55A 2PVRA 3EZRA 2JFLA 3MTLA 3NIZA 4XV9A 2PWLA 3ZSGA 3N51A 5L8KA 4RVMA 3D2IA 1J3HA 3VW6A 3RZBA 4M3QA 4I20A 4M66A 1OUYA 5DPVA 1BYGA 2C5XA 5HE2A 3HMNA 1QPDA 2YLFA 4O7TA 3CTHA 2GS6A 3FKLA 3NNWA 4JIAA 3S3IA 5CAOA 4J7BA 2C68A 1RE8A 3NUYA 3DNDA 4CZUA 4EYMA 2HAKA 2W99B 4J98A 5E8WA 3O7LD 5C9CA 5A6NA 3QX2A 4YLJA 5CU0A 5HNGA 3SG9A 1UNGA 2PULA 2YJRA 2B0QA 1FVVA 3C9WA 3HP2A 3OXTA 1LUFA 2F4JA 5KO1A 2OSCA 1IASA 3D9VA 3BELA 3W8LA 4AQCA 3HVCA 2YCFA 3W2SA 2XH5A 3H0ZA 4IX4A 3WZEA 5L2WA 4GG7A 4UBAA 5KKRC 3BV3A 3BX5A 1XH7A 5A3XA 4PQNA 4G3GA 3SQQA 4AOJA 2BR1A 3LOKA 1M2RA 3LZBA 3U9CA 2XKFA 3O7LB 2E9VA 1UNHA 4FV9A 4MNFA 3ZU7A 2PPQA 3KU2A 3GQIA 5CWZA 4QPAA 4ITIA 2ERKA 4Q5HA 1YKRA 3KY2A 4QMOA 2WNTA 5IA3A 3MPAA 4RIYB 1IAHA 1YI4A 3BRBA 3SOAA 1MP8A 2XIXA 3MH1A 1YHSA 3A8XA 2XNOA 3U51A 3M11A 1A06A 1FVRA 4NK9A 3RM6A 4EH8A 3LQ3A 4H39A 4Z7HA 4FKRA 2XM8A 4DGNA 5CAPA 2CLXA 4WNMA 2RIOA 3BI6A 2GSFA 1OPLA 4CFUA 3L8XA 5K9IA 3UJGA 4RJ6A 5HG8A 4AS0A 2OWBA 3ZRLA 5JQ5A 3DKGA 5CY3A 1YVJA 1GIJA 4GUBA 2XKDA 4YJTA 4ASXA 4FKVA 2C5OA 2I1MA 4CFMA 3ZS5A 4EHVA 3UC4A 4YJNA 2HK5A 4XV2A 5D9HA 4BCPA 5ANIA 5KNJA 3BYOA 5CXZA 2Q83A 2UZBA 3QL8A 2BRHA 1H24A 4PUZA 4IACA 2C6MA 5AP6A 2QOCA 4BDHA 3GVUA 5M06A 3PLSA 5AAEA 1YXXA 3EN5A 4OLIA 2Y4IB 3MV5A 3E64A 2OJ9A 5HGIA 1O6LA 3CLYA 4DTKA 1VYWA 3G9LX 3HP5A 3FY2A 2OU7A 4G5JA 3Q53A 3GFWA 4RQKA 4E73A 3JR1A 4FTTA 3R9RA 1WMKA 3AC3A 3C1XA 2WOTA 1TQMA 3RM7A 5J9ZA 2JIVA 1JAMA 4I24A 4BI0A 4FKQA 5CZHA 4LGGA 5K5NA 1Y57A 5LJJA 4R7IA 3PZEA 5KHWA 3PVUA 3GU4A 5AM6A 4CEGA 4EORA 3ULZA 5E92A 4MXZA 5AP2A 3BLQA 1M17A 5FDXA 4Q9SA 4E26A 3RWQA 4FIJA 2EB2A 3WIGA 4YNEA 5GJFA 1FOTA 2PVYA 3F5GA 3F2RA 4YURA 3UP2A 4BTJA 3FEGA 4PDSA 4RBLA 4O7ZA 2B9JA 5JZNA 4HGEA 2UVZA 2XK8A 4PDPA 3QGWA 3R7EA 4KNBA 3O8PA 3R7IA 3P08A 4DFBA 2VWZA 4CZYB 4E93A 5AP0A 3GFEA 3GOPA 4I41A 3II5A 4CTCA 1H00A 3C4WA 2VWIA 3OUKA 3S00A 4RIOA 3UPXA 3IQ7A 1F0QA 4U3YA 3UQGA 4H3QA 5AR4A 4BYJA 4DG2E 2WU6A 2GFSA 3TWJA 4HCTA 4IVAA 3SAYA 2VTQA 4IAKA 4FK3A 5FQDC 5L8LA 4M97A 2R4BA 4RJ7A 3ZLYA 3RAWA 3F7ZA 5FRIA 3TNQB 3I6WA 4EH3A 2EXMA 4TZRA 1ZWSA 3ATTA 4ZJIA 1NVSA 3NCGA 4XG3A 4WRSA 4WT6A 4I5MA 3V51A 2YACA 4ZIMA 4W4YA 2Y7JA 3AC4A 3EN7A 4ASZA 4MWHA 3V5WA 4JG8A 3ZUTA 3EKNA 3IO7A 4FEQA 5DRDA 5M55A 3HAVA 4AA5A 1M2QA 3FZ1A 2WQOA 3OBJA 4GUEA 4G3DA 4YZDA 3NUPA 4EKLA 2XK6A 3LM5A 4FKGA 1FINA 4G6LA 2DYLA 2ZJWA 4U9AA 3EHAA 4NUSA 3DY7A 2OBJA 4D0WA 4J53A 3A60A 4MYGA 1H1WA 5EDQA 3V01A 4KS8A 3AC5A 4MNEB 5AP1A 4FKWA 4TNDA 1YXTA 4Z55A 1E1VA 4ZTHA 4JL9A 4GH2A 4GFOA 5ANEA 3H30A 4JI9A 4IC7A 1G8SA 3CQWA 3S1HA 5AR3A 4PNIA 4BDAA 2RSVA 4BB4A 3F82A 2JC6A 4NT4A 2R3LA 4G5PA 1OL1A 5LVLA 3TNHA 5JGDA 3Q4ZA 5M09A 2BZJA 2PVLA 4BGGA 2QCSA 4PV0A 4QYYA 4S32A 3UOHA 3F3ZA 3QZFA 3GI3A 2JDVA 4N4SA 4OTWA 4P90A 3VQUA 5L6PA 3L9PA 1ZYDA 3NGAA 4UWBA 3VHKA 5IQIA 2VWYA 4AWIA 3C13A 4BL1A 4C37A 5FXQA 2RFDA 1VR2A 1A9UA 2WQMA 5KMIA 3OFMA 2HYYA 2QO7A 4ERKA 4EJ7A 2HZ0A 1Q61A 4Y5HA 2ITUA 4O0YA 4RRVA 1AGWA 2CN8A 4D58A 3DAEA 4EH6A 5B2LA 4FKUA 4JR3A 1PXLA 3FMNA 4ITHA 2XMYA 2I6LA 4N6ZA 1W84A 3IG7A 2OXYA 3RP9A 4BDDA 3LFDA 3I7CA 4CD0A 2JKQA 4TPTA 3ZSIA 4D2WA 4ZZNA 5HIEA 4FV0A 4FTNA 4LGDA 3DU8A 1R78A 2OFVA 2OIDA 2V22A 5FEQA 5HCZA 4X7QA 4GKHA 3ZM9A 5CLPA 3WYXA 5A4LA 4XS2A 4R3RA 2R3MA 2PE1A 4FTOA 5HBHA 4BCFA 2OXXA 3LXKA 5ICPA 4ACHA 5AR5A 4BHZA 2YJSA 4F09A 2Y8OA 4J99A 5D7AA 5JSMA 3OC1A 2CLQA 3MY0A 3W18A 4USEA 5JGBA 3DDPA 1PXJA 2DQ7X 3EQBA 3FAAA 3I5NA 3LW0A 3MVHA 3PFQA 3Q04A 4O2PA 3G6HA 4R8QA 5IA0A 3DKFA 4C3PA 4CYIA 1CMKE 1H1SA 4AFEA 4D4SA 1ZLTA 4TYEA 2NP8A 4EWQA 3QXOA 4K8AA 3VHEA 1Q3DA 4AU8A 4UMUA 3CIKA 2OG8A 4G31A 3BQRA 4FUXA 4OTRA 4A9YA 3R8UA 2UW9A 3NCZA 3VJNA 4M14A 4AW2A 3NUNA 3PIYA 3O8TA 3QKKA 1S9IA 2WMVA 1PXNA 1Q8ZA 3PWDA 2BILB 4WNKA 3C5IA 4E7WA 3MPTA 1OKYA 4WBBB 2AUHA 4DN5A 3SD0A 3HDNA 4LV8A 1MRVA 3KQ7A 2XRUA 5I9VA 3KXHA 4PY1A 5FP6A 4EJNA 2ZB1A 3FE3A 4IM3A 3ZXTA 3BHHA 2YM5A 5A9UA 4ZY4A 2J5EA 4BIBA 4YJOA 4ZEGA 1URWA 4MXCA 4L45A 4M67A 2G01A 4TKSA 4QMSA 3UYSA 4CRLA 5I9WA 3ZO4A 3E3BX
chains in the Genus database with same CATH superfamily
2QR7A 3ANRA 3LFNA 4FT3A 4IB1A 3RAHA 5KUPA 4TL0A 4GJ2A 1OIQA 3DJ7A 4QQ5A 1YI3A 4JG6A 4BWKA 1PKDA 4EQMA 2W7XA 1P14A 4KA3A 4X6QC 3LHJA 3E62A 4DGMA 4MHAA 4U80A 5FM3A 2ITTA 3BU3A 4FV4A 1UV5A 5CSVA 3ZHPC 4DYMA 3DPKA 3HRBA 4PPAA 3FBVA 2CGXA 4W9WA 5HE3A 3FI2A 1YHVA 3GXLA 4P5QA 3GC8A 4RWLA 4HYIA 3T9IA 2EWAA 1S9JA 5EOBA 3V6RA 2GU8A 4KIOA 3JVSA 3L1SA 4YTCA 3BLAA 3IGOA 4J8NA 5IQDA 4EK6A 1ST4A 3U6HA 2YIQA 3KRXA 3FPMA 2B9FA 2IVTA 4I22A 5E1SA 5EYMA 3E7VA 4I5HA 2WFYA 5EM7A 1R0EA 3QRJA 1ZXEA 5H2UA 4FTLA 3VBQA 4TY1A 1FMKA 3QTZA 4YJRA 3W32A 5DR6A 3QZGA 3RALA 1OL5A 4PRJA 4EOLA 2GCDA 2XIKA 3OF0A 2VTNA 2Y9QA 3V5PA 5K5XA 5L3AA 4CKRA 2F9GA 2HZ4A 3QRUA 3I81A 3OEFX 3ZTXA 2PHKA 2YA9A 1GIHA 2VGOA 4FZ6A 4YJQA 3G0EA 1OUKA 5CF5A 5DNRA 3W0SA 4BCQA 1M2PA 3Q2MA 3QTIA 1ND4A 3EQGA 3MB7A 2FA2A 2WMTA 3POZA 3SRVB 3TTIA 3ROCA 1PF8A 5FUTA 5J9YA 3QA8A 3LCOA 3VC4A 4JVGA 3R30A 3RCDA 3SW7A 1U4DA 3BGQA 5IUHA 4UWYA 3HKOA 5E90A 4TNBA 4O4CA 3ORLA 3MA6A 3LMGA 4GFMA 4F6UA 2WPAA 3I79A 3OW4A 5HQ0A 3TUDA 2FVDA 4H1MA 4OBPA 4QOXA 3DXQA 4KAOA 3EFLA 3LQ5A 3EN6A 3ET7A 3Q96A 5CVFA 1ZYCA 2XJ0A 1JSTA 1FQ1B 4R3CA 4U8ZA 5E8TA 4F7JA 4QEBA 3JYAA 4KB8A 3KEXA 5HIBA 1W7HA 4DBNA 2ITNA 2V55A 3PG1A 2IZUA 4ASEA 3B2WA 4GCJA 1KE6A 1TZDA 5F1ZA 5K0XA 2Q0NA 2ITYA 3MIAA 1MQ4A 3MWUA 4F1TA 4L46A 4YJUA 1OIUA 3P7CA 4HNFA 3R9OA 3FMJA 3VUHA 5HBEA 4O0XA 3WZJA 4AN3A 4FSRA 1BKXA 2EXEA 5L6OA 3O96A 4Q9ZA 3MN3A 3REPA 1V0BA 2C1AA 3BGPA 5FBNC 2VTRA 3QCQA 1Q5KA 3QUPA 4X3FC 4S2ZA 3NMUF 2OZAA 3HA6A 4P7EA 4BN1A 5AV4A 4IWOA 4V0GA 4O0TA 4UZDA 1ST0A 4NKAA 2R5TA 2BFYA 2XNNA 4G3EA 2ZV9A 5AUZA 1LEZA 4FV7A 1YDTE 3AC8A 2JITA 3H3CA 5CEIA 1BI8A 4F08A 3CJFA 4WA9A 1RJBA 5HU9A 4K1BA 3QKMA 2GQSA 5AV1A 2QOLA 4XRLA 2RKUA 3ULIA 3A7FA 4UV0A 4WG4A 2PL0A 3AMYA 5GNKA 1KWPA 2PMLX 4EHEA 3DFAA 3N4TA 4AFJA 4LQMA 2R3PA 2VWVA 4K2RA 4IX3A 4JOAA 2WTIA 3FL5A 1U59A 4W4VA 5AMNA 3RMFA 4QPMA 3MTFA 4BCNA 5JGAA 3PFYA 2F7EE 3E87A 2CGUA 4JDIA 4EYJA 3D15A 3MH2A 2ZAZA 4N0SA 4AUAA 2VD5A 3TV7A 2BKZA 2J50A 4MXYA 2BIYA 2OICA 4CRSA 4TWNA 2FSOX 3W55A 4BCJA 3AT4A 5IUGA 2H34A 4IX5A 2KTYA 4G3CA 5HVJA 1YOLA 2OK1A 4FTIA 3COKA 4AOIA 4FODA 3TV4A 1JKTA 2R0IA 4BCIA 1X8BA 1H07A 2WTDA 3IDPA 3LXLA 3W0QA 2YZLA 4EOKA 2X81A 2XIZA 3R63A 4IWPA 2PUNA 4IAYA 4LMNA 4UMPA 5JN2A 5IISA 3FMKA 4S33A 4ZSJA 1IRKA 3HYHA 1ZZ2A 4IMYA 5IZFA 3D83A 4HYSA 5HG5A 4OTIA 5IQGA 1J7IA 1IEPA 3EIDA 2Z7SA 4QMMA 1UKIA 4BGHA 5M51A 3NUUA 4RC4A 2OI4X 4OT5A 2CSNA 2F2CB 4JS8A 4O0RA 3KXMA 3RZFA 1TVOA 3OCBA 4QQJA 4QT1A 2C5YA 2F2UA 5A4EA 4FTMA 5HHWA 4LUEA 4HZSA 3AXWA 1APME 4XG4A 3Q4TA 2XNEA 3FI4A 3G15A 2JKKA 3V5LA 1ZZLA 3P7AA 1QL6A 3NUAA 4FKLA 3CTJA 4XLVA 5JMSA 4J97A 4ZY6A 3R8LA 1GY3A 3KXZA 3VULA 5BVEA 4IVBA 2C3KA 4XBUA 2XANA 3QUDA 2WMBA 4YTIA 2NRYA 4FGRA 4QDEA 3KF4A 2QHMA 3QF9A 4IWQA 1PMUA 4RIWA 4DTAA 2A19B 1WVWA 4YMJA 4OAVB 3AGLA 4C2VA 3DTCA 3EL7A 4JDJA 4D4YA 1J7UA 2YM3A 1R3CA 5IPJA 5AUUA 4PWNA 3CSVA 1FVTA 5AX3A 2KULA 3FV8A 3GOKA 4CXAA 4RFZA 4XHKB 2IW6A 5HNIX 2P2IA 3CPBA 2QOFA 2QOOA 4UYNA 3W0OA 3D2KA 4QQCA 4JAJA 4JBPA 4QMNA 3C0IA 1ZY4A 2CGWA 3D5WA 3EQFA 3E8CA 3ORMA 4HOKA 3RINA 4EHGA 2JDSA 1HOWA 4ZOGA 2W1GA 2WTKC 4QP7A 2JDTA 2XEYA 3MDYA 3RWPA 3TZ7A 3Q4CA 3TNIA 1U5QA 2HXLA 3F66A 4A06A 3BU6A 3OHTA 2XK3A 4RIXA 3OUNB 4X2KA 4HYUA 4F6SA 1P4FA 4QNAA 4D1XA 4YJSA 4FNXA 3ZDUA 1BLXA 4YJPA 1JVPP 5HORA 1F3MC 3GT8A 5HX8A 2PVHA 4CV8A 2Q0BA 3TKIA 1R0PA 4M84A 2ZMCA 1XMMA 5TE0A 4FTRA 3VS6A 2X9FA 3UPZA 3BKBA 3FUPA 3TL8A 4OTFA 5DN3A 3Q6UA 2WO6A 3CD8A 3RNYA 3ZOSA 4BI1A 4MAOA 1G5SA 1XMLA 3PJCA 2Z7RA 5AV2A 4GVAA 2PMOX 4X2JA 1M7NA 4GV1A 4CMTA 4D2SA 3QYZA 4L8MA 1E1XA 1CM8A 4FIHA 1Q41A 4C3RA 4GIHA 3VW8A 3ZH8A 5CAQA 4I6LA 4H36A 3TCPA 4APCA 3C51A 2W05A 3QHWA 5KMLA 2PUIA 4GW8A 4CCBA 4FTAA 1ZY5A 3D0EA 3H9OA 4FKSA 2W1HA 2WMUA 2BALA 2HELA 3L8VA 3NNXA 4NW6A 5D11A 5DIAA 3W2CA 4CMOA 4DFXE 5KMKA 4NIFB 5H8GA 2F57A 5CEKA 4O7NA 1UU9A 1OL6A 3WF7A 4KIKA 4D9UA 4ANLA 2OJFE 3ACJA 2WQNA 4EONA 3QQKA 5LVNA 2CKQA 2PU8A 2ZOQA 4XH6A 3WF5A 3EQRA 4ANMA 3BHUA 2WELA 1GZKA 3SXRA 3OZ6A 5CYIA 4ZK5A 2YISA 4O0VA 4F1MA 2W4KA 3DTWA 3E3PA 4MD8E 3TJDA 4UALA 4PL5A 2XNPA 3I6UA 2X0PA 3ORIA 4BWXA 4ZTLA 2OFUA 3DQWA 4DH1A 3PWYA 4E6AA 3ZLXA 5HTIA 3FXWA 3BEGA 2QODA 4O96A 2B53A 3E88A 5EK7A 4LL5A 4YSJA 4JXFA 2I0HA 4EC9A 5CAUA 2XAMA 3TTJA 4EUUA 3UGCA 3EZVA 2CKPA 3ID6C 3PP1A 5JFSA 3F7WA 4ZSAA 3VUKA 5GZ8A 3ZRKA 1ZRZA 1Q24A 2CCIA 1XBAA 3G2FA 3H9FA 2WTJA 2VTAA 4U40A 4Z7GA 4DT9A 2VWBA 4J8MA 5HVKA 1OL7A 3EKKA 5ACBC 3MIYA 3PA5A 3OCTA 5DOSA 5J5SA 2R7IA 3PSBA 2X7FA 2GHLA 3QA0A 4Y95A 5C27A 3W33A 2IVSA 4IJPA 3GCQA 5LOHA 3E63A 1YOJA 4RA4A 3E8EA 4IH8A 5HD4A 5CTPA 4A4LA 3MJ2A 1Y6AA 3TV6A 4I92A 4AG8A 4BDKA 5M4IA 5EQEA 1WAKA 2XF0A 4TWCA 3PP0A 4JBVA 5BYZA 2HZNA 2WB8A 3EN9A 2G9XA 3LJ2A 5GHVA 3KCKA 2XARA 4JG7A 3BYSA 3RTPA 2YAAA 5EYCA 2BVAA 2RFEA 3BPRA 3C0HA 4FTCA 5AP5A 2VZ6A 1OI9A 2PZ5A 3D7TB 4IZ5A 5HG7A 4F7LA 2C6KA 4GS6A 4WRGA 3EQDA 5EHOA 4CLJA 3MVLA 3P23A 3PSCA 4O0WA 2A4LA 2ZB0A 5IA1A 5JFWA 4BFMA 4ZTSA 3DKOA 3UDSA 3A99A 5BUIA 3CD3A 2YZAA 4FIFA 5EDRA 4BIDA 3ENMA 3V8WA 5EM6A 2BKKA 3C7QA 1I44A 3BWJA 4E20A 4E5BA 3R2BA 4RVLA 2AQXA 4FV8A 5LQFA 3SVVA 4MBIA 4D55A 1DM2A 2PY3A 2LGCA 3ZMMA 4WG5A 4AW1A 2WMRA 4G3FA 4CFVA 3HAMA 2BFXA 2Y4IC 5CF6A 1U46A 4XG9A 3M1SA 3IKAA 4DTBA 4H3PA 5IUIA 3V3VA 3CKXA 1DI8A 4IHPA 3DA6A 1XWSA 4BCKA 4C38A 2X9EA 1T46A 4GMYA 4L44A 3VS0A 4BJJB 2IJMA 2BROA 2E9OA 2Z2WA 3RAIA 1MRUA 4AGDA 5DHJA 4WBOA 2GTMA 4UZHA 3BYMA 3VS2A 2ZFYA 2UZOA 5CXHA 3MGYA 3AGMA 4U41A 1OMWA 4UMQA 3VNTA 4D4VA 5IQBA 3R2YA 5CT0A 3LM0A 2BUJA 3UBDA 4O83A 4YGAA 3OWJA 4M0ZA 3RBWA 4BDBA 3AD5A 4K9YA 3QRTA 4EH7A 3KRRA 1ZMUA 3K3JA 3GCPA 2XBAA 5JFVA 4QMTA 5CVHA 4KABA 3OOGA 3R71A 1PMVA 4NH1A 3LXNA 4XBRA 5EKOA 4NU1A 3IPHA 4LOPA 1KV2A 4N70A 3UZTA 2UW5A 3R7GA 2O65A 4W9XA 2H6DA 4KS7A 2HY0A 2VTLA 3R21A 2JFMA 4AN2A 3E7OA 3TXOA 2YM8A 4ZP5A 4RC3A 3FXZA 4R5YA 2QLUA 5HO7A 3O0GA 3HRFA 3PRFA 4RWIA 3VF9A 4F64A 5TO8A 3ZCLA 2WU7A 2Y6MA 3O23A 4LDTA 4PL3A 4W8DA 3Q52A 1XHAA 2VWUA 2W9FB 5DA3A 2QOKA 4A9RA 3P7BA 4QTEA 5AUXA 2O2UA 3F3VA 2R3KA 4YO6A 3Q9WA 2F7XE 3T3VA 4XJ0A 2A2AA 4C4HA 2CKOA 2IZSA 4GFGA 3ELJA 4LG4A 3QCXA 2X8DA 5CS6A 3RK7A 5ACKA 2JEDA 2UVYA 4QP1A 3ODZX 5E4HA 2YN8A 4XYFA 1WZYA 1OL2A 3FSFA 3MFUA 4NM0A 4IE9A 2XJ2A 3QC9A 3JPVA 4NFNA 4XG7A 2ITPA 1JNKA 3F3UA 3TMOA 1ZYLA 4C59A 3OG7A 2WAJA 4BI2A 4EOSA 2W1CA 4S30A 3IK3A 5AUTA 4KIQA 2F7ZE 4DLJA 4WSYA 3SX9A 4IWDA 2XCHA 5I9XA 4UWCA 2GQGA 2JDOA 3QD4A 2HOGA 4PTGA 4FL1A 5ANJA 4BC6A 2EXCX 3U4WA 2VO3A 3Q5ZA 2R3GA 3U54A 2V7AA 1G3NA 2O63A 3IGGA 5GZ9A 2GNGA 4B0GA 5I4NA 4AXFA 5AV0A 4GK3A 3FY0A 4L42A 5I9ZA 3IOPA 2GQRA 4GU9A 3R8ZA 4AQKA 1BI7A 5KKRB 3OP5A 1YDSE 5FLFA 5TT7A 1GZOA 3HMIA 3ZBXA 3Q3BA 3OWPA 5IG1A 2R3HA 2BDWA 4DEGA 3ZYAA 3FWQA 3UVRA 4F9YA 4GL9A 2IEWA 1J91A 2PZPA 3NWWA 3U87A 3AG9A 3G0FA 5E8VA 5HVYA 4FYOA 4NTSA 2VTPA 3FLZA 4YLKA 2VTJA 4JR7A 4PMMA 3TN8A 4I93A 3N9XA 4WNPA 1B38A 3R6XA 5AUWA 1ZOHA 5CQWA 4QMXA 3QTWA 2PVKA 1GNGA 1W98A 2XYNA 3OW3A 4JX3A 4NJ3A 1MRYA 4TTHB 3T8OA 4QQTA 3IW4A 4ERWA 4CG8A 3S2PA 5KHXA 5A46A 3KRJA 3CXWA 3C4CA 4C62A 4ITJA 3UO5A 2ITOA 2OH0E 2GDOA 3HMPA 4IC8A 2VWWA 5IMEA 2FYSA 2LAVA 1NW1A 3W0MA 2X7OA 4QMVA 2O8YA 1DI9A 4CFWA 4H1JA 5J7BA 2IG7A 4D2VA 4AACA 4JNWA 2IPXA 3TZ8A 1JLUE 1UU8A 5HU3A 5AEPA 4L52A 3GU5A 3DAJA 2OF2A 5HE1A 1H1RA 3VBYA 2G2HA 4BDEA 4C02A 5TF9A 3TIZA 3KK8A 3MW1A 3W8QA 2VTMA 2GMXA 3S4QA 3IW8A 5HIDA 3GP0A 4NFMA 5FTOA 1IR3A 3HV4A 4HGSA 1L3RE 1OVEA 1Q8UA 4I6QA 4YTFA 3N4UA 1PMEA 2BZHB 4WUNA 3VS5A 3VBXA 4CT1A 2PSQA 1UU3A 2CNVA 4M13A 4F78A 4P5ZA 5AIKA 2WTCA 4HYHA 3DK6A 3ZM4A 4NM7A 4D2RA 4MWIA 5I3RA 5EYDA 3DJ6A 1K2PA 3CTQA 3FHIA 3WYYA 4LFIA 4E6CA 1B39A 5E8ZA 4A7CA 3BLHA 3D94A 4XEYA 4ZAUA 5M4FA 2QO2A 3ROYA 1QPCA 2J0LA 4NJDA 3QALE 3SA0A 4MQ2A 2ITVA 5EQYA 5GZAA 2BRBA 4ARKA 3OXZA 3WIKA 1PMNA 4IAAA 4BTFA 4EC8A 1YXSA 2PZIA 3F5PA 4S31A 4PPCA 4DE4A 5HESA 2ERZE 1PY5A 3ZUUA 1SMHA 4GK2A 2NO3A 5E7RA 3W16A 3ZFXA 4CSVA 4EH2A 1Q8WA 2C5NA 4ZLOA 2GNJA 4Y5QA 2XYUA 4QMPA 1QCFA 2CN5A 3OOMA 4U7ZA 1P5EA 3WE8A 1Y91A 3NZ0A 4RMZA 5ETCA 3DZQA 2ACXA 4J96A 4ANBA 3NW5A 2ZM3A 3F3WA 1YXUA 1PXOA 3K54A 4ZLZA 5AP4A 1V0PA 3FLSA 2G2FA 4UXLA 4B99A 5AADA 4EK3A 5EI6A 3PDTA 5CEPA 2WIPA 3JVRA 4WD5A 4GIIA 3AMAA 2XKCA 3COMA 1OBDA 4AT3A 2WMWA 5EW8A 5GIOE 4FL3A 3TG1A 2O64A 5C03A 3DBCA 1SNXA 4FSZA 2ETMA 4WUAA 5EOLA 4XNEA 2R0UA 5M57A 4XP3A 4TYHB 4ANQA 2E9NA 5GJDA 2BZKB 3FQSA 4G1WA 4L68A 2C5VA 1A48A 3R1QA 2YM4A 4JDHA 4ALVA 3HV7A 2QO9A 1KOAA 4I0RA 4BF2A 2X8EA 1O9UA 3VBVA 3WZUA 5DT4A 1YWRA 2BHHA 1LR4A 4BHNA 4LV5A 1H8FA 3UIMA 3PXKA 3IECA 1V0OA 4TYGA 3PXFA 3VS3A 2OKRA 3ORTA 5CSWA 3UQFA 3PUFC 4M0YA 4RX9A 4JX7A 5F4NA 3W2RA 2PZRA 4FG9A 4WOVA 5HO6A 4FJVA 2IZTA 2P4IA 3O71A 3KMUA 4QRCA 3ZC5A 4B7TA 2OO8X 4BCMA 3SGCA 4IADA 4RSSA 4D5KA 4LUDA 4IZAA 4TYJA 2PVMA 3FI3A 3DOGA 4FEXA 5AR2A 1JQHA 3P78A 5JT2A 3CC6A 2GPHA 2XIYA 5T6KA 4G9RA 4AZSA 3QQHA 5L2TA 2BCJA 4CCUA 1XBCA 4GT5A 4L3LA 5TOZA 4QP9A 3KA0A 3NSZA 4O6EA 4C0TA 3Q9YA 2I7QA 3HGKA 5GIPE 4KIPA 2QNJA 1KUTA 3QKLA 3IDBA 4MCVA 5A54A 2VX0A 3L9NA 3UNZA 2RL5A 2WMXA 3GENA 3O8UA 4C3FA 3MS9A 3OS3A 1M7QA 1RDQE 2QOIA 4HVDA 3LFSA 2VRXA 3FC2A 4TWPA 1URCA 3H4JA 3IOKA 4HPTE 3WF6A 4BZOA 4CFXA 4K0YA 3PY0A 2I0EA 4YC3A 3KXGA 5HTBA 3PJ8A 2J90A 4O6LA 3W10A 4DEEA 4WKQA 4JRVA 4HVHA 1O6KA 1GZ8A 3DLSA 4NM5A 1OKVA 1BX6A 1NVRA 2R3IA 2X7GA 4OBQA 5B2MA 3ALOA 3JXWA 4DEBA 3QD0A 3M42A 4XG8A 4I6FA 1O6YA 5BQ0A 2DS1A 2ONLC 2FUMA 3MVMA 2YLEA 3PXRA 2ZM1A 3LCSA 5HOAA 1NVQA 4Q2AA 3N4VA 2YABA 4BDCA 5BVWA 5IQHA 3A7HA 4R7HA 3U55A 3COHA 3PSDA 5M4UA 3NIEA 4JAIA 3FKNA 2QQ7A 4BKZA 3LCTA 4NWMA 4C4IA 5IMXA 5H3QA 4OTHA 2XBJA 3P5KA 4OTPA 2CPKE 4I5PA 1OIYA 3EQHA 3TNWA 2BPMA 2J0MB 2ONLA 4MX9A 5F95A 3VBTA 4IB0A 4F1OA 4FMQA 3EQCA 2HY81 3HRCA 2NPQA 3QAME 1JPAA 1TKIA 3JS2A 4O4BB 2YAKA 1XKKA 3CCNA 4FEWA 1PJKA 2ZDUA 3HNGA 3IDCA 2UVXA 2A98A 4AT5A 4QYEA 4O7WA 1OECA 5KMJA 1PXPA 3QD3A 3R28A 4C8BA 3LMIA 3BL9A 3TEIA 3W2QA 5J1WA 5LMKC 3G5DA 5JZJA 3F2NA 3KVXA 4OW8A 2UZTA 5D10A 4RLLA 1VYZA 3UTOA 4F65A 4R1VA 2QONA 4GEOA 1DS5A 3NYVA 3PPZA 3WF8A 4AA4A 3DZOA 4M7IA 4I0SA 3AKJA 2VNYA 4L7SA 4FZDB 3ZFYA 2PUPA 3A7IA 4AE9A 2QLQA 2UZWE 3O50A 3EFWA 4E8AA 3CP9A 2NRUA 5LMKA 1PRYA 5AA9A 2W0JA 5AA8A 4TT7A 4O4EA 4XCUA 3KK9A 5ANGA 5F94A 3QCYA 4B8MA 3Q6WA 4L9IA 5K0KA 4ZMEA 2YERA 2Z7QA 2YHVA 5AWMA 3O5AA 3PVBA 4PL4A 3DJ5A 3K3IA 3ZSHA 4D28A 5CEMA 2R3FA 5HZNA 5ANOA 2B54A 4IXPA 5ETIA 2X6EA 2B9HA 2BTRA 1UVRA 2W1FA 2JAVA 2YIRA 4KUJA 4R5SA 5IH5A 1ZMWA 2C6EA 4RJ4A 3DV3A 4JRNA 4TXCA 4FG7A 1YI6A 3DKCA 4IZ7A 2YITA 4DFZE 5IA4A 4FIIA 4NYEA 1GZNA 3UQCA 2UW4A 2UZVA 5CT7A 4LRKA 2WMSA 2X4FA 3QRKA 3SKCA 2FSMX 3A61A 5JH6A 3U6JA 5CALA 4XRJA 4CG9A 4X3FA 2O5KA 2WQBA 4QP4A 4G6OA 3SXSA 4ZZMA 3KIOC 1V1KA 2ITWA 2O0UA 4U6RA 3LJ0A 4FSNA 5CU4A 1L8TA 4D4RA 3ZO2A 2XVDA 2GFCA 4ID7A 4QPSA 4RA5A 2VNWA 3DXPA 5FEEA 4N57A 5AP7A 4FG8A 3ZONA 3DB8A 3UOJA 4USDA 4EH5A 2H9VA 2UW0A 4IIRA 3PVWA 2YCRA 4QTBA 5M53A 2ITXA 2VTOA 4BICA 2JIUA 5F20A 1PXIA 4ANSA 4CTBA 5H8EA 2GTNA 2XUUA 4E4NA 3RK9A 1WCCA 2BIKB 3CQEA 4FV5A 5EI2A 4TYIA 4ENXA 2R7BA 4ALUA 2PVJA 2I40A 5CENA 1H27A 1K3AA 3PE2A 3WE4A 2B7AA 2C4GA 4RVTA 4RGJA 3V5QA 4RC2A 5EM5A 5LVPA 2WKMA 5ITAA 4FK6A 5CEQA 4DT8A 2X0QA 1LPUA 3F5XA 2HW6A 2BAQA 2J2IB 4CQEA 1ZYSA 2C1BA 4M69A 4O27B 1FGKA 3KF7A 5JEBA 2XP2A 5JQ8A 4GG5A 4PX6A 3D5UA 4FSUA 4GYIA 3ZRMA 3AMBA 1DAYA 4DHFA 2C6OA 3BIZA 4XUFA 3GNIB 4LOOA 1FBNA 4XMOA 2JIIA 3R8PA 4BKJA 4FEVA 1TFFA 2Y0AA 5LMBA 2IWIA 4RFMA 5CSHA 2XJ1A 5IDNA 2VX1A 4O7VA 4H05A 3PE1A 2QI8A 2WGJA 3UE4A 4C61A 3UDTA 4F0IA 2CNUA 5E8SA 3NX8A 4CFFA 3HUBA 5CU2A 5ETFA 4F9CA 5FTGA 2O3PA 1OPJA 2XM9A 3B8RA 4F9AA 2W1EA 5DR9A 4U97A 4CFNA 2R3NA 3ACKA 4GT3A 4OTGA 4AXAA 4YU2A 3R8VA 4L53A 4C33A 3IW6A 4ZLYA 2OIQA 4FSWA 1U54A 3K5VA 1H28A 3VJOA 4C57A 1P4OA 5AV3A 2XZSA 5FBOA 4FKOA 1NXKA 5IDPA 1LP4A 3DBFA 4FZAB 5A4CA 2YDIA 3QGYA 3W2OA 3LPBA 4L3PA 3ALNA 3FC1X 4AX8A 3C4EA 4IQ6A 3L8PA 4I6HA 4J1RA 3EFJA 2C0TA 3OY1A 4MF1A 5B2KA 5BNJA 3GCUA 3QU0A 2PZYA 3UIXA 3EYHA 1K9AA 1YHWA 4ZSGA 2F49A 4EOPA 1T45A 3NW7A 4E4LA 2H96A 4YPSA 4ANNA 1XO2B 5K4JA 2XEZA 4IZYA 3LVPA 4RT7A 4YHTA 4D0XA 5CI7A 3TACA 3TZ9A 4O81A 5EH0A 3O17A 4EUTA 3D4QA 1W2FA 1XH4A 4FIEA 2W06A 1G8KA 3EFKA 3P4KA 1WVXA 3GCVA 2WD1A 4QYFA 4PTCA 4G34A 3W1FA 3EOCA 4DGOA 3PY3A 5LARA 4CGAA 4KSPA 3MESA 4QMYA 4DEHA 2BRNA 4CVAA 3DK3A 5A4QA 4I0TA 4FR4A 3WZDA 4U0IA 4EBVA 1OGUA 5DEYA 2G1TA 4PF4A 2UUEA 4RJ3A 3R02A 3R0TA 4MKCA 3KFAA 3KMWA 1Q4LA 3MYGA 3F61A 4QP2A 2C47A 3K2LA 4HCVA 1ERKA 3ZBFA 5E91A 3I7BA 4EKKA 1RW8A 2IZRA 2OIBA 2JD5A 5D12A 2WIHA 3R00A 3RJCA 3NS9A 1CKPA 2GNHA 4XOYA 5J1VA 3Q9XA 4QP8A 1XBBA 1H1PA 3Q60A 4LM5A 4YHFA 3AC1A 2XIRA 3E8DA 3RAKA 4D2TA 3MFTA 3GC0A 4IDVA 3A4OX 4C4GA 4AF3A 5CF8A 1IAJA 3BEAA 2B52A 3A2CA 3LXPA 4K33A 3SV0A 5EM8A 4JT3A 4E6QA 3AC2A 4AZVA 4I21A 1SM2A 4J71A 5DH3A 4BDJA 4DG3E 4O0SA 4GKIA 3SG8A 3TNPC 3KB7A 3R7OA 1KE8A 4U44A 3NFGB 3D7TA 2Z60A 1XJDA 4KKEA 4FT9A 5DBXA 2UW8A 1M52A 3V6SA 1GOLA 2QU6A 3FZPA 4F7SA 4YZNA 5FTQA 3KRLA 3VRZA 4CYJA 5BUJA 3NLBA 3CGOA 3HLLA 3D5XA 4MEDA 5G1XA 3SHEA 5CU6A 4ZJJA 1CKJA 2ZV2A 3L9MA 4DCEA 5BMSA 4YTHA 5HEZA 1W83A 3FLQA 2X39A 2YFXA 4KKHA 5A6OA 1R1WA 3CQUA 4NCTC 4DF3A 2QC6A 2B4SB 3OT8A 3PJ2A 3WOWA 2VO6A 2HENA 2QOBA 1ZMVA 4YC6A 4AGWA 3NAXA 3OMVA 3QCSA 1JKLA 1B6CB 3GGFA 4DINA 3QBNA 3NYNA 2W1DA 3FZRA 3IW7A 4NL0A 1ZOEA 4ZTMA 3BE9A 2WTKB 4EOIA 1IA9A 1UA2A 2J5FA 3BBWA 3FQEA 4FNWA 3DBDA 3PYYA 2W1ZA 3OVVA 2YM7A 1UNLA 3MI9A 4FUYA 2BTSA 2JKOA 4NCTA 4I23A 3BHYA 4XV3A 4YZBA 5DVRA 3SC1A 4HGLA 1J1CA 2GNFA 3HV5A 5LCKA 3VQHA 1MUOA 1Y8GA 1KE5A 2PK9A 4RZVA 3C4ZA 3I0OA 3H0YA 4QP3A 3SDJA 5HCXA 3VUDA 4EH9A 3WILA 2V0DA 4V05A 3ZEPA 3UOKA 4HPUE 4X21A 1H0WA 1H1QA 3COIA 4DGLC 4XG2A 4YC8A 4AGCA 4LGHA 4PMTA 4RIYA 1OM1A 1UWJA 2QKRA 3L8SA 4QO9A 4DBXA 4XLIA 3M2WA 4PDYA 3W0RA 4LL0A 2YEXA 4KIKB 5J95A