1BL6A

The complex structure of the map kinase p38/sb216995
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
351
structure length
351
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (MAP KINASE P38)
publication title Structural basis of inhibitor selectivity in MAP kinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 351
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 1998-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1bl6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1bl6A01
3EL8A 2DWBA 1WBNA 3AT2A 2AC5A 4OBPA 3Q32A 4DLIA 4DT9A 3BX5A 3FMEA 3KL8A 3P78A 5A3XA 5C4LA 5KKRC 4O84A 1AQ1A 3OCTA 5FTOA 3DBQA 3PIYA 4TTHB 4YZBA 4DFUA 3V5QA 3NVKI 2BVAA 3R7IA 2XNMA 5AUXA 2XCKA 1PXNA 1U54B 4FI1A 3OXIA 4HJOA 5EOLA 3UG1A 4DE4A 4E4MA 2R0IA 3O7LD 4YZNA 5JH6A 1OVEA 2RFEA 2OXXA 3B2WA 3TJCA 3TV6A 4JRVA 5GINE 2VTOA 1M2RA 3ANQA 4OAUC 5E91A 4MKCA 4L8MA 5IA2A 5AADA 4ZY4A 3EFLA 1PXOA 3FYJX 3G0FA 4X2NA 4JBOA 5C8MA 3FKNA 3VIDA 4B8LA 3EZVA 3A8WA 2QNJA 3OG7A 5CF6A 4ITHA 5CQWA 4BGQA 4AP7A 2V7OA 4KBCA 3TV7A 2V62A 2YN8A 4N4SA 1ZMVA 3V8SA 5BUEA 4FZ6A 4XH6A 5HVYA 2O64A 3CY3A 4NFNA 5CI7A 2PYWA 2X9EA 4RVLA 3EQFA 5AUTA 2UV2A 5IMEA 3RNIA 4UX9A 4Q9ZA 3F3WA 2OZAB 1YQJA 4E20A 4FTOA 4LRMA 5AM6A 1Q3WA 3HV3A 4GVJA 4ALVA 3DBDA 5CSWA 2CDZA 4I1ZA 4XV2A 1OB3A 1YKRA 2C3JA 3MI9A 1PYEA 3A4PA 2GNHA 4B6LA 5M4FA 4D4YA 3OOMA 4M3QA 3OTVA 3ULZA 4CKRA 3Q52A 3F3ZA 3VO3A 5ANJA 4AS0A 5E1SA 3VAPA 2JAVA 5IEVA 2CCHA 2IJMA 3R9RA 4FKGA 3SXRA 4AACA 4ASEA 4CZYB 3MESA 2PVLA 5HKMA 3EKKA 4BCQA 3W2SA 2UW9A 3GCQA 3TG1A 3KN6A 5M4IA 3TZ7A 2UZBA 5JKGA 5LCKA 2BZKB 4LFIA 3HP2A 3PVWA 2G2IA 2YM3A 2C6TA 3LPBA 1LPUA 5DI1A 5HIBA 3VS1A 4FGRA 3TDWA 1XH4A 4AXAA 4ANSA 4HZRA 3TJDA 3NRMA 4IIRA 4RFYA 1PXMA 3CPCA 4ZJJA 1Q8WA 3M42A 2ITOA 3NUYA 4GU6A 3KRLA 3ZC6A 2QOQA 2IO6A 3QBNA 5CU2A 2CKQA 2GNJA 4IWQA 3ZM9A 4YLLA 4CT1A 3VS6A 3R8ZA 1YHWA 1OIUA 2QR7A 4DGOA 3ORPA 2P2IA 4XMOA 3V6SA 1FGIA 4BDGA 2QR8A 4EWQA 3W2RA 4FKLA 4JJRA 4RIOA 3ZEWA 4FSMA 4ANOA 3JVRA 3PY1A 5DRBA 2WQNA 3RINA 2LGCA 3AMAA 5CSXA 2PUNA 2ZV9A 1GIHA 2PY3A 3BHVA 5IQFA 3VC4A 3VS4A 5M56A 3FHRA 3QRJA 4YJUA 2JD5A 2FVDA 4RIYA 2WEIA 3C1XA 3ZTXA 3HMNA 3C0GA 2P4IA 3QX4A 4L43A 1UU7A 4C37A 2CGUA 3O23A 1OZ1A 5CU4A 4FL1A 1XHAA 4HYUA 4KRDA 4AOIA 4O0VA 4MF1A 4EH8A 4PX6A 4EHVA 4JIAA 1BMKA 3CD8A 5LXMA 4EHZA 1BKXA 3EH9A 2R5TA 4G2FA 4TWOA 5HG7A 3V5WA 5AFVA 2EXMA 5CAOA 4F7SA 4D0WA 2J6MA 3OBGA 2QOKA 4ZLYA 4LM5A 5HLPA 5AUYA 2HW6A 1JSUA 4MD7E 2GS2A 3QA8A 1H4LA 4IH8A 4DTBA 3LCOA 4D0XA 2YCQA 4FT9A 3RCDA 4APCA 4JBQA 4QP9A 1FVTA 4IDVA 2F2UA 4BZOA 1H1WA 3KVXA 2JIIA 4ZTNA 1KV2A 5ETIA 4EOIA 4YTFA 5BMMA 4Z55A 5EW8A 3P7BA 5HTBA 3ZXTA 4LV5A 3Q9ZA 3EFJA 1Q99A 2BRGA 4GG5A 4R6VA 3MA3A 4I5PA 4UYNA 2GNIA 4CRLA 4PP9A 3ZDIA 2PVJA 4KKGA 1JBPE 2VAGA 3SC1A 3ZHPC 1IA9A 3KN5A 3AC1A 4H58A 1P14A 4PUZA 2QG7A 4C4IA 4JG7A 3JY0A 3QXPA 3GOKA 4U3YA 3EL7A 3ORTA 5IEYA 4FKRA 5K5XA 3RI1A 3BV2A 4UWYA 1GNGA 4JL9A 3E63A 2OSCA 5B2LA 2WB8A 3Q4UA 4U80A 2FSOX 2VWYA 3DLSA 4U7ZA 4QRCA 3AMBA 1SNXA 2XRUA 3LW0A 3BHTA 3D7TB 4D4RA 3KVWA 4OTFA 4EJ7A 3LXNA 3OT8A 4I0SA 3ZBFA 5IPJA 4U44A 3QGWA 4FL2A 3DPKA 1G3NA 3NZ0A 4I93A 4TYGA 4OTGA 3RALA 4BDHA 2H8HA 3F6XA 1NA7A 5CT7A 3O51A 4XG2A 5GNKA 4ZSAA 3DAJA 4FA2A 5HX6A 5IU2A 1FMOE 4FVPA 3UDBA 2I0YA 2SRCA 1NXKA 3RAKA 3ZFXA 5EHLA 3FQEA 4RRVA 1JNKA 2YWVA 2GPHA 4BZDA 4XP2A 2CKOA 3U9NA 2WHBA 1PW2A 2ZV7A 4OT5A 3WZDA 3DAEA 1YXXA 5HVJA 2OJFE 2G2HA 4RA5A 5A14A 4I0RA 2O63A 4QMPA 4P2KA 4F0IA 3BHYA 5KMNA 4X6RA 2VN9A 3QF9A 1H01A 3TL8A 3K3IA 5KMMA 3MTFA 3ORNA 4GYIA 2ONLA 4CG9A 1UV5A 2QOFA 3QUEA 4GK2A 4GSBA 5IG1A 2B7AA 2QOLA 2WIHA 3I0QA 3P4KA 4LYNA 4PWNA 5L8JA 5C9CA 3LFFA 2XB7A 3QQUA 4F08A 3F3UA 1VYWA 2WIPA 3CEKA 5HG5A 5TO8A 2I40A 4YSMA 4OTPA 3SV0A 4M13A 1OPJA 2YA9A 4YO4A 3CE3A 1WAKA 3AC8A 3ID6C 3FMKA 3QKMA 4WRGA 4EYMA 3F61A 3PZEA 1F5QA 2C0IA 4M84A 4A06A 4QMXA 3TZMA 5I4NA 1KE9A 4M12A 3KXZA 5AAEA 4L7FA 4KD1A 4QYHA 4WKQA 3IDCA 4PV0A 5HU9A 5IEXA 3QTIA 4QYYA 4FTLA 3I79A 2CGWA 2VX3A 4BBEA 3AD5A 3EHAA 3GXLA 4H1MA 4BHZA 4CMTA 1JWHA 3LJ0A 2PVMA 4M15A 3UOLA 4FUYA 4G3GA 4V05A 5KMKA 3AC5A 3EKNA 2ITXA 3NYNA 3ENMA 3PG1A 5C26A 5LCJA 2WKMA 3BLQA 5GIOE 5CEMA 1H08A 4AGWA 1K9AA 4ITIA 3D2IA 4EH5A 1UU9A 2Y4IC 4CZTA 3QCQA 4KS7A 5EM8A 5GHVA 5FM3A 5DHJA 1MRUA 3QD0A 1JVPP 4QP4A 4FKIA 1BL6A 3S0OA 5A4EA 2VWZA 4O21A 4J7BA 5FTQA 2BAJA 2VV9A 4E5BA 4FKSA 2BHEA 4CLIA 3BRBA 2H34A 4KWPA 4AX8A 3NEWA 2C6MA 5GJDA 4F4PA 2UUEA 4FK6A 3BZ3A 3Q5IA 3LQ5A 4FR4A 1G8AA 2IVTA 3F9NA 4FOBA 4J53A 2VRXA 4G3DA 3GOPA 3QD2B 3O8TA 4AZTA 3CBLA 4ASXA 2C5VA 3DBCA 3DXNA 3PJ2A 4XG7A 4XS2A 4U42A 4CFVA 2G15A 2ITTA 3R2BA 2IW6A 5AR8A 1XWSA 4CEGA 2J0JA 4TYIA 4K2RA 1XJDA 1P2AA 3ANRA 4L3LA 1NVSA 4D4VA 3QZGA 1PF8A 2J90A 2C47A 3B8QA 3BYUA 5KBRA 4IE9A 5LVPA 3VWAA 4GFOA 3WF6A 4IACA 1GZ8A 3PXFA 4UY9A 2WELA 3NW6A 1WVXA 3SAYA 4E5AX 2HXLA 1R3CA 3JS2A 1ZY5A 3Q53A 4QOXA 2R3RA 4AOJA 3PJCA 1L3RE 4F1TA 5J1WA 1NVQA 2O0UA 3QUDA 3NMUF 2BZJA 2VNWA 4FKJA 5A54A 5IQEA 4XHKB 5AP7A 5EW9A 4B0GA 3HLLA 4L6QA 3ZYAA 5L6WL 3MJ1A 3D94A 4FYNA 1PXJA 1CKPA 1FGKA 3GNIB 2WTKC 3JR1A 3BGZA 3RWQA 2XM9A 4TN6A 2W1ZA 4GKHA 3LZBA 3P0MA 1J1CA 3ZUTA 3DS6A 3O50A 3UOKA 3PXZA 2WFYA 1H24A 4I5MA 4YJSA 3N4TA 3R9DA 4R8QA 4TYHA 5H3QA 5IA3A 3KB7A 3LFSA 3PA4A 2HZIA 4II5A 4RLKA 4WNKA 3ZS5A 3COMA 1OECA 3NWWA 3ENHA 4MX9A 4QNAA 5FWKK 1YWVA 5IQCA 3MIAA 3P86A 4D55A 4YJRA 1JKKA 2IZUA 4YPDA 5CU6A 4RVKA 1PXKA 4PPBA 3PXKA 3AGLA 4RC3A 4XYFA 5TE0A 2Y7JA 4DH3A 2X8EA 2YCFA 4DH5A 3UG2A 4CFWA 1A48A 4XX9A 4X6QC 3Q04A 4R7BA 1H8FA 3KU2A 4KSQA 4MWIA 4P7EA 2ZJWA 4AGUA 1YRPA 4BYIA 4FV0A 1SVEA 5A9UA 3QTSA 3OROA 3DV3A 3UVQA 4BCJA 4UXQA 1Q3DA 1V1KA 2WMTA 4DITA 2ETMA 1Q5KA 3QRUA 4FEQA 2YAKA 1QL6A 2Y8OA 3O7LB 2GU8A 3IPHA 4ALUA 4BDCA 2CN5A 2CJMA 3CSVA 2PU8A 2OJGA 2VNYA 3BYVA 2J9MA 3NGAA 1B39A 3SXFA 3V51A 5HLWA 3DXQA 2XIZA 2O3PA 4PP7A 3HV7A 1GZNA 2OF4A 5BNJA 4BGGA 3UO5A 2R3KA 4C2VA 3QCYA 2EB3A 5K5NA 4IAAA 4BCNA 1PYXA 5E8ZA 4I5HA 2C6DA 5BYYA 4FTMA 1JLUE 2OIQA 4NM3A 4YJOA 4FNWA 2KTYA 2PL0A 5LVOA 2BTSA 3N4VA 3UNZA 5CF4A 5J9YA 4YNOA 5FM2A 4L67A 4OGRA 4FZ7A 5AV2A 5T3QA 4YURA 4C02A 4GCJA 1R39A 4RFMA 3D5UA 3RMFA 1M14A 4WSQA 5KNJA 3DNDA 2X2KA 4I21A 3LM5A 2B54A 5K4JA 2ESMA 4TRLA 1OPLA 2YDIA 4JRNA 2I1MA 2W17A 4FNYA 4NM0A 3WARA 3LQ8A 3O8UA 2ITPA 3C4CA 3BWJA 3DTWA 2OZOA 1REJA 3KULA 3PZHA 5CU0A 2P55A 1P4FA 2WTDA 1BI7A 1LEWA 3F3TA 4XEYA 2FSMX 3Q9YA 5IQHA 3UQCA 1H07A 5L2QA 3QYWA 4FSTA 1IEPA 3QGYA 3PXRA 4QYGA 4DGGA 4F9WA 3Q2MA 3HEGA 5D11A 3OUKA 4C4HA 4IZYA 4EKKA 3HUCA 3QUPA 4I24A 5DT4A 2XK3A 3TKHA 2R7IA 3FKLA 5KX8A 2C5XA 3BU3A 3IW8A 2BROA 4IX6A 4X3FB 4C57A 3RGFA 5L6PA 4FT7A 3C4WA 2OIDA 1ZYSA 3TT0A 4ZLOA 3HZTA 4Q5HA 2ZM1A 4M0YA 5HBHA 2HK5A 4ANQA 4MD8E 1YXTA 5DIAA 5T68A 1ZXEA 4XNEA 3F2NA 4XOYA 4RWJA 5GIPE 3CY2A 5ANEA 2ITUA 5CYIA 4IM0A 4O7NA 4FV2A 4AWIA 4ACGA 5HG8A 3ZRLA 4QMLA 2IG7A 2IPXA 3VUMA 4N6YA 2JDVA 4F7NA 4CCBA 3VS7A 4V0GA 1H0VA 5I9ZA 5EYDA 4PDOA 3OC1A 3W16A 1P5EA 1YVJA 4I4EA 4FGBA 1J7IA 3KMUA 3RZFA 1Z9XA 4EI4A 3W2OA 5JGAA 3CJGA 3ZONA 2ZMCA 3AXWA 3GI3A 4R3CA 4L00A 5AX3A 2EXCX 4V04A 3L8PA 4EZ5A 4ACHA 4D5KA 5HICA 2C6OA 5HORA 3MPAA 2X8DA 3HX4A 2V22A 4G31A 4F70A 1STCE 1SVGA 2XK9A 1Q8UA 4U41A 1QPEA 4O96A 2X7GA 5IF1A 5J5TA 1U46A 4IC7A 1PKGA 4ACCA 1YW2A 2VWVA 2H6DA 4F6SA 3PJ3A 2YJRA 3MY1A 4FV6A 4HZSA 4LRJA 3IO7A 5KMIA 3DKGA 1PY5A 2FUMA 3VVHA 2W06A 4I6QA 5AP0A 4C4FA 3Q6WA 5CS6A 2BZHB 4QP8A 2VTQA 3K3JA 2VTTA 1W83A 4S31A 4E1ZA 3ALOA 4ORKA 4C59A 1ATPE 2ACXA 4F7JA 4BCPA 3R9HA 2BKKA 3RAHA 3MB7A 2OFVA 1GZOA 3ORLA 3R22A 2JKQA 2YIXA 4ITJA 3MTLA 5I9UA 3UODA 2VWUA 4OBQA 2JIUA 1T45A 5EQPA 5EQEA 1VJYA 4O7SA 1V0PA 3CC6A 4P4CA 3OUNB 2IVUA 5B2KA 2X8IA 3ZFYA 5KMOA 2O8YA 4DEEA 3AG9A 3E8NA 4QMYA 4A07A 2RG5A 2ZV8A 4XRLA 1YI3A 4A9RA 4BCFA 3FZSA 5A4LA 4GT4A 4EQUA 4QQTA 3OCSA 4IAKA 2CLQA 4LOOA 1Q8YA 3HMPA 1XKKA 3NIEA 5ANKA 4IADA 4D2PA 2VTLA 4YBKA 4DHFA 3OWPA 3WF9A 1KUTA 4CTBA 4AOTA 5J7BA 5F4NA 3LLAA 4XG9A 3GT8A 2G2FA 3LHJA 1YDSE 2C0TA 4UMPA 4CYJA 1H25A 5D7VA 5B0XA 4X2KA 4XLIA 4MK0A 3VUKA 3U6IA 4F0FA 5CEKA 5CEOA 2NPQA 2CNUA 2BAKA 4AZEA 3FL5A 3FY0A 4MXYA 4IANA 5L2SA 3F88A 4BDAA 4YUQA 4BCGA 4YJNA 1ZYCA 2XRWA 4D1SA 5HGIA 2JFLA 2YFXA 3II5A 2JIVA 3DKOA 4M69A 4NWMA 4NUSA 2BDJA 2VGPA 4L42A 2UZWE 4AUAA 5DA3A 2RKUA 3B2TA 3UC3A 2WMXA 3VF8A 3W32A 1LP4A 3PJ1A 3R63A 5FTGA 4RJ5A 3I60A 5DLSA 2PZIA 3JYAA 4FG7A 5I9WA 3VBTA 3Q96A 3GU5A 1AD5A 4BWKA 4S34A 2BUJA 2PZ5A 1T46A 2HENA 2X4ZA 2XCHA 3A7JA 4W4YA 4KAOA 1BYGA 3OXZA 4JBPA 2GTNA 4U9AA 3CTHA 4YC8A 1OKYA 4P90A 4WRSA 4WD5A 4ZMFA 4O6EA 3ULIA 5CAVA 3WIKA 4PRJA 1ERKA 3CTQA 3VUDA 5AMNA 4EOSA 1KE5A 4O7YA 4M68A 2Y4IB 2YIRA 3DKCA 4YMJA 5KO1A 5CAQA 3P08A 3F5XA 2HYYA 4OTRA 4YJVA 3TV4A 4ZY5A 5E8UA 4U97A 2QOCA 4QMWA 2F7ZE 3SD0A 1ZOGA 4O0WA 4UYAA 2VTMA 5CWZA 5E8YA 2Z7QA 3DQWA 3HRBA 5HD4A 3FLSA 5T6KA 2OU7A 3RM6A 1KSWA 3ZCLA 4RVTA 4IB1A 5CSVA 2ONLC 3OF0A 4NH1A 2PZRA 2UW6A 4G17A 4IMYA 2YEXA 3MFRA 2AC3A 1JKLA 4YZMA 4DEBA 3O17A 1FBNA 3U54A 4UALA 3OS3A 2UZNA 4JS8A 3DDPA 3IECA 4WG4A 3KK9A 3SVVA 3QZFA 4DEGA 2FYSA 4M14A 3UYTA 3W2QA 4FODA 3BCEA 4IX4A 3PY3A 2JC6A 4HVIA 1LUFA 4AZVA 2WO6A 3GC7A 4GUEA 3E62A 2W4JA 1MRYA 2XF0A 5ANDA 3ORMA 3VBXA 4DF3A 3PRFA 5FD2A 1PXIA 3REPA 1Q24A 4WSYA 3MH2A 4LOQA 4FOCA 4ZJIA 3ALNA 4S2ZA 1Q97A 3DU8A 4TWCA 3KF4A 3QFVA 2VO0A 3T3UA 1CDKA 1PXLA 2C6LA 5IKWA 2B53A 2HELA 4M69B 4EOMA 5E4HA 1QPDA 3QLFA 4EOJA 3C0HA 1SM2A 4IZ7A 1UU8A 4MD9E 1R78A 2W9ZB 3UIBA 2GSFA 2B9HA 5HNGA 4QMNA 3FLNC 4BDEA 2XVDA 2W9FB 3KEXA 3KRWA 2GHMA 3GUBA 3O8PA 4TKSA 4W4XA 3T9TA 2E9NA 2W1HA 4JR3A 2JLDA 3VHKA 2BRHA 3VS2A 4F6UA 2Q0NA 3AC4A 5I9XA 4YC6A 2WTKB 1NY3A 2F2CB 3NNWA 2OF2A 3QTWA 4LUDA 4A4LA 3EQBA 2Q83A 3HYHA 4C7TA 4D1ZA 4JQEA 4EZ3A 3SQQA 3SRVA 4EOOA 3TACA 4DBXA 3KXGA 1GZKA 1XH5A 3V8TA 5M51A 2A27A 2OK1A 3L9LA 2Y0AA 3PIZA 4NTTA 3C9WA 5L3AA 4FBXA 1ZY4A 4OUCA 2EB2A 2B55A 3QRKA 4FT3A 4LV8A 4IAIA 4QNYA 4BI2A 4BWXA 4IZ5A 3I5NA 2X2MA 3N51A 4YZCA 4PDSA 3MSSA 2ZB0A 3GGFA 3NDMA 3VUIA 5IDNA 5JFSA 4KKEA 4GT3A 1IAJA 2BRNA 3ELJA 4AFEA 3ORZA 4DH7A 3MV5A 4JOAA 4W8DA 5HHWA 2CKEA 2VTPA 4P5QA 4JDJA 1J7LA 2J51A 2ZAZA 2J50A 2W0JA 3PXYA 3ATSA 2QCSA 5CVHA 4FTQA 1OKWA 3RPVA 4DN5A 2F7EE 2R3QA 5HCXA 2EWAA 3EQRA 5HX8A 3K54A 4FTKA 3L9NA 3F5PA 2GDOA 3ZO2A 3QKKA 2Z7SA 3RHKA 3QWJA 2WTVA 1PJKA 4FTJA 4CNHA 3PVUA 4CRSA 4QD6A 1WBSA 4O2PA 1YDTE 1OUYA 4PMMA 4RA4A 1W8CA 4MBJA 2W1GA 4WO5A 5FP6A 4MVFA 5ANIA 1WBOA 2XYUA 4ZY6A 5CALA 3BLHA 4HVSA 3KRJA 4K0YA 3AT4A 1TQPA 3H0ZA 1OMWA 3KKVA 4K6ZA 4ZAUA 4N6ZA 3CCNA 5BVEA 2HWOA 3EYGA 2PTKA 5B7VA 4YU2A 5EKNA 4FIJA 4AE9A 1X8BA 5EHOA 3VRYA 3E92A 4FV1A 2QD9A 2XMYA 4FTIA 3GU4A 4UB7A 2F4JA 3C4XA 3NCGA 4O1OA 3NR9A 3EN7A 4Y95A 4E4LA 4APPA 4G6OA 3LXLA 4C4GA 2W5AA 1SMHA 4GKIA 2XNOA 4JX7A 4DG2E 4O7RA 1OL7A 3I7BA 3W8QA 2OJIA 2NP8A 5K0KA 4E6DA 3JVSA 5JN2A 3FWQA 3QTRA 2WMSA 3R8LA 3TWJA 3QQKA 5AR3A 4RC4A 4IVDA 4Q5EA 2UW3A 2YM5A 2C69A 2QU5A 3BBWA 1H28A 1V0OA 5C01A 4WUAA 3GVUA 4X3FC 1Q62A 1OPKA 2UVZA 3R9OA 4XJ0A 4BB4A 3AC3A 3VW8A 4KS8A 4TT7A 1SZMA 4I92A 4MYGA 4YNEA 5HCYA 4CV8A 3ETAA 3ACJA 3ZEPA 2ZYBA 4RPVA 3LQ3A 1W98A 3TCPA 4EQMA 5F20A 3SW4A 2FB8A 4XLVA 2P2HA 2WTWA 4O82A 3H30A 3KXNA 4IX5A 3Q5ZA 3QRTA 1Q4LA 4DGLC 2XIXA 5LQFA 2BPMA 3DAKA 2R3NA 2UVXA 3MDYA 1UWHA 2OXDA 1MP8A 4I0TA 4O6LA 4YLJA 4U40A 2C1AA 2QHNA 2WMQA 2R3HA 5IISA 4BY9E 1OUKA 4BICA 4UZDA 1VR2A 4NEUA 4QMQA 4F99A 4G3CA 5HCZA 5EDRA 3E5AA 5HI2A 4YHFA 2JBPA 4L9IA 3MA6A 3A62A 4RX8A 2WZJA 2CKPA 2BFYA 3UC4A 4CV9A 4DFBA 3RVGA 3JY9A 3IONA 2YDKA 4FG9A 4I94A 3A4OX 5FXSA 3R04A 2P0CA 4ZS0A 3UYSA 4FIFA 1MUOA 4OTHA 2GFSA 3VUTA 3BIZA 4GS6A 3VS5A 3Q6UA 3C51A 2OH0E 1ZARA 3FE3A 1PMVA 4Q9SA 4UZHA 5DT3A 3RWPA 4BIDA 4C35A 3JUHA 4HOKA 3M1SA 3V5JA 3TUBA 3FI8A 1H1PA 2CGVA 5JZJA 3CKXA 3UO4A 1PMUA 2YIYA 5HBEA 4Z7GA 3L8XA 3DB8A 2JDTA 5CZIA 2R9SA 1OL1A 4JVGA 4RX7A 4BF2A 1A9UA 4QMZA 5DVRA 3QTQA 2PZYA 1E1VA 4O86A 3L1SA 1FQ1B 5A6OA 3UTOA 5AJQA 4RIYB 3UQGA 2R0UA 1XO2B 4C34A 3IQ7A 4EH9A 3P5KA 4RLLA 1IA8A 3D0EA 3F5UA 1M52A 4QTAA 3QXOA 3AD6A 4DAWA 3PSDA 4F9CA 5AIKA 4MBIA 4LGHA 2BFXA 2GFCA 3LAUA 4BCMA 4FSYA 4X2JA 4FV3A 2WOUA 2PE0A 4M0ZA 4D2TA 2PVNA 3IOPA 4XBRA 5M4UA 3MFUA 2VWIA 3NNXA 5I0BA 2EVAA 2WMUA 1ZYJA 2PULA 1E9HA 3DDQA 2G01A 5ETFA 3GU8A 1BLXA 2X81A 4G1WA 3BEAA 4LRKA 5GJFA 4XG6A 4C3FA 4J71A 4PNIA 2JDOA 3RJCA 2PMNX 4TL0A 4GUBA 5M07A 5M09A 3O2MA 4H36A 1S9JA 5AAFA 3PRIA 2XK6A 4OTDA 3EQCA 5JFXA 3BHUA 3BGPA 5IA5A 5L8LA 3HDNA 4FE2A 2O2UA 3MVLA 5HO8A 4JQ8A 2I0HA 3RK9A 4AT5A 4YSJA 1RW8A 4B99A 4C0TA 1O6LA 1KE8A 4Y73A 4WBBB 1P4OA 2J0IA 2WTJA 4ZTQA 5DEWA 4JLCA 3WOWA 3KRRA 4EH7A 5C1QB 2RSVA 4DFYA 1ZRZA 3LFEA 3I6WA 2B1PA 3ZMMA 5IA1A 3CR0A 4QTDA 4HYHA 2Z60A 5A4CA 2O65A 3PA5A 4S30A 3DY7A 3LMHA 4S33A 4D28A 1XH9A 4XBUA 3ZO4A 3FUPA 3TNPC 3ZFMA 5K0XA 2BILB 2QG5A 2B9JA 4F9AA 3VW6A 4CFUA 1UKIA 4ERWA 5TOZA 3F66A 5M4CA 3SA0A 4BKJA 5HIDA 5HO7A 2F9GA 4F6WA 1SNUA 2XP2A 4FX3A 5TT7A 5GZAA 5EK7A 3GFWA 1OM1A 3JXWA 4A7CA 5IA0A 4FKVA 2PZPA 4ACMA 4B9DA 2XUUA 2RL5A 4U6RA 4CQGA 5LVMA 4H39A 5FBOA 3ROCA 1XR1A 5J5SA 2O5KA 3QC9A 4CXAA 5EI8A 3QWKA 4R1VA 4QO9A 3NUSA 4FSUA 2V0DA 3BBTB 3E8EA 5HG9A 4QYEA 4TYJA 2YLFA 4RWKA 2VTAA 3C5UA 5AP3A 3EWHA 2QONA 3IGGA 3E88A 3OT3A 3COKA 4GG7A 3RBWA 3HVCA 3VJOA 3UQFA 2CNQA 3IOKA 3NUAA 4LI5A 4AZWA 2CHLA 4JIKA 4O0YA 4CFXA 4EOKA 3QQFA 4AA5A 3MH3A 1O9UA 2OBJA 4FT0A 5EKOA 3TZ9A 5HU3A 3I6UA 4XP3A 4AT4A 1VYZA 1DAWA 2IZSA 3E93A 4NW5A 4R7HA 1FPUA 3R01A 3B8RA 3G9LX 3NYVA 4HNFA 4S32A 2ITQA 3R8VA 5E8XA 4E4XA 1JKSA 2PK9A 3VN9A 1WBWA 4BBFA 4EUTA 5DYJA 4HPUE 5CLPA 3OP5A 4EONA 2JBOA 2IW9A 3AGMA 2GQGA 2WU6A 4ALWA 3MYGA 4CFFA 5JFWA 3H10A 2FH9A 4RIXA 4D9TA 3MN3A 2JGZA 4GRBA 2R3GA 3QCSA 5DWRA 1NT2A 4ZSLA 5CVFA 3HMOA 5L6OA 4L01A 2FGIA 4IFGA 2HWPA 3WBLA 3I5ZA 2HCKA 4FNZA 4F9BA 2XK7A 3UE4A 4GV1A 3OY3A 4FKTA 2W96B 4BBMA 4BKZA 4DG3E 3LFNA 1TQMA 3R0TA 5A6NA 3GU6A 3P23A 1JPAA 3D15A 4K18A 3IDPA 1XBBA 5JMSA 4QTEA 2VTIA 5BMSA 4RZVA 5ACBC 5BVWA 4DTKA 4DEAA 5IUGA 2WTCA 2QKWB 3FMLA 3TDVA 1PMNA 2BZIB 1BUHA 5CENA 4G16A 4YJPA 5G1XA 2WU7A 4D58A 3HECA 2X0GA 4W4VA 2PMLX 2X2LA 2Z7RA 5F1ZA 1YXUA 2C1BA 3BE2A 4Y85A 5M06A 3W8LA 2Y9QA 4IX3A 4PTGA 3TZ8A 3PXQA 1NVRA 2VTRA 2ITYA 3HUBA 2QOOA 4QTBA 5BX0A 3ZUUA 4ANBA 3PP0A 4U3ZA 4YTCA 3NPCA 4H3QA 4O0TA 5IMXA 4MEDA 2WOTA 4CLJA 4IB3A 4FV5A 4O0RA 5IUIA 4L53A 3LE6A 4E73A 1YDRE 2P33A 3QKLA 4G34A 4AW0A 4ERKA 4PDYA 2WNTA 2ITZA 5FEQA 1CKJA 1KOBA 3LFCA 3WF8A 4K33A 4UMUA 2CPKE 2Y6OA 4J1RA 5AP2A 4CKJA 5HEZA 5M53A 2CCIA 5LARA 5EOBA 2GMXA 4DBNA 1OBGA 2GQRA 3CGFA 4RZWA 1Y57A 2Z7LA 4ZZNA 3CQUA 4IC8A 2E9OA 4QT1A 3G0EA 3W33A 4XUFA 3IG7A 4WOVA 3WIGA 5AA9A 4L45A 1LR4A 2YDJA 4EL9A 4QMMA 2QOIA 5F9EA 1H27A 4FTUA 4AW1A 2YZLA 3VHEA 1H1SA 4PQNA 2BR1A 5TF9A 3S00A 3A7FA 3MFSA 4CCUA 3GEQA 4FSRA 1YOJA 4C2WA 5AP1A 4F0GA 4UN0C 2CN8A 1E1XA 3I1AA 3R28A 4IJ9A 3H3CA 4FKWA 5EM7A 3ORIA 4JQ7A 4C8BA 3WZJA 3ZUVA 4FZAB 4J97A 3NW5A 4M66A 2VGOA 3MB6A 3VS0A 4CFMA 4BDDA 4N70A 3ORKA 4RFZA 5ICPA 5HE2A 3HMMA 4U81A 4OR5A 3V5LA 3FMHA 3FXXA 4FK3A 4KRCA 4BDKA 3EB0A 4TYHB 4W9XA 3H0YA 3R1NA 5BPYA 1M17A 5AP4A 4J52A 4J99A 2YAAA 3EIDA 5DR9A 3NUPA 4F63A 3A60A 1XH8A 2YISA 2NRYA 2X6DA 3EOCA 5D12A 1WVWA 5E1EA 5E7RA 2XNNA 4RJ7A 4K11A 3U87A 2JDRA 2YITA 3HL7A 2PVFA 4IVCA 3T9IA 4K8AA 4EZ7A 3ZSGA 3G15A 3Q2JA 3WZUA 3WZKA 5EDPA 2YZAA 1DI8A 2XM8A 3D9VA 3MY0A 5JGDA 1ZLTA 5GJGA 1WBVA 2F49A 2VO6A 2OICA 1APME 2AUHA 3E7OA 5H2UA 2XNEA 4QP3A 4AGCA 5C8KA 3V5PA 3R1SA 4EOPA 4ZSGA 1Y8YA 3FKOA 3D5XA 3K2LA 5HO6A 4O1PA 3PLSA 3AQVA 4EEVA 3CGOA 4ANNA 4I23A 3W1FA 3EQHA 5KMJA 2XKDA 3E8DA 5LMKA 4R78A 3RPSA 2Z2WA 3NVMB 3U8WA 1KE6A 1XQZA 2RFDA 3KXHA 5CAPA 5JSMA 3HDMA 5C03A 1TQIA 3OEFX 2VTNA 4I22A 4CFNA 3LCDA 4KKHA 2E9UA 3R8PA 5AR5A 3VUGA 4EK8A 3TKIA 3I81A 4H1JA 4YTIA 4HGSA 4ZK5A 3MPMA 2B9FA 5CT0A 2XNPA 4FZFB 3OTUA 4KNBA 4XG3A 5FEDA 1F3MC 1XBCA 3FMJA 3OEZA 4YLKA 3LXKA 4ACDA 2PUPA 3VF9A 4FEWA 1M2PA 4KUJA 3HRCA 4MNEA 5IQIA 4Y8DA 2QC6A 2HXQA 3C0IA 5B2MA 3BLRA 1M7NA 1GIIA 4J98A 4JXFA 3TIZA 3GC9A 3QQHA 2W1FA 4NU1A 4RQVA 3EFWA 3FXZA 3DLZA 5ANOA 3WF7A 4I41A 1IAHA 4LGGA 4MF0A 5E90A 4L44A 4Y5QA 3EFKA 3DXPA 1UKHA 4NFMA 2VO3A 4PPCA 5DOSA 5H8BA 3POZA 5CI6A 3RKBA 5BYLA 2A1AB 2ZDUA 3OOGA 5K3YA 5D9HA 3DK3A 3LIJA 3ORXA 4M8TA 3TUDA 4J8MA 2A4LA 3OZ6A 3KULB 3P7AA 5K4IA 2GHLA 2R3IA 3AT3A 4U45A 4DEDA 3RNYA 4DINA 4C36A 4Z3VA 3R00A 2GNGA 2J7TA 4YO6A 5EM6A 5CEQA 2VWXA 1SVHA 4CSVA 1IASA 3P9JA 1V0BA 4XG8A 3NCZA 3S4QA 3I0OA 3P7CA 4FIHA 2X6EA 5AUZA 4Y5HA 1OL5A 2OG8A 3OY1A 2Y4PA 1LEZA 3KMWA 3NNVA 2I7QA 3DBEA 4FG8A 2OLCA 3Q9WA 3ATTA 5HVKA 3KK8A 3COIA 4FSZA 1DM2A 3TNQB 3ET7A 2WGJA 4LMUA 2YM8A 3W18A 5TKDA 4CVAA 1RJBA 1Z5MA 3HKOA 4X0MA 4E3CA 3ZXZA 2J0KA 4UEUA 5HD7A 4AAAA 4FL3A 3HGKA 4BCOA 4FEXA 2E9VA 3MS9A 4IEBA 4KIKA 3VBQA 4BC6A 3DT1A 1K2PA 3PPJA 4IWPA 3L9PA 1HCLA 5J9ZA 4V0GB 4I4FA 5BUJA 5FBNC 5AA8A 2YIQA 4QPAA 1ZMWA 4GK4A 5FXQA 4HCUA 2R64A 5FG8A 4FTTA 1H26A 5CNNA 5EYKA 4EK4A 4R5YA 3OCGA 3MBLA 3BYSA 3HP5A 3A2CA 5DRDA 2R4BA 3UVRA 3DA6A 4JT3A 5CAUA 3T3VA 3C5IA 5AV4A 3MVJA 4O91A 2UZEA 4E6QA 5HIEA 3PYYA 4G5JA 1Y91A 3FPMA 3A99A 4QP7A 5LVNA 3FI3A 3W2CA 2ETRA 4QMUA 5KMLA 3LMIA 2I0VA 3BU5A 5AR2A 4WHZA 3EQDA 2YABA 3PWYA 4NIFA 3R7VA 4C61A 4NYEA 5BYZA 4GIIA 5EG3A 4U5JA 5FRIA 5CNOA 3H9RA 1YWNA 3JPVA 5DFPA 3V5TA 3LVPA 3FY2A 4A9SA 2W1CA 3DGKA 2HZ4A 2XA4A 2C4GA 4RT7A 4XRJA 1Z57A 2H96A 3HV4A 5I9VA 1PMEA 2OWBA 2PE2A 4HGTA 4KB8A 3PDTA 3RM7A 4FMQA 4QP2A 3LMGA 2W5HA 3WZEA 5KE0A 4GVAA 4O0XA 3CIKA 3PE1A 5E92A 5J79A 4CZUA 2JAMA 4BDFA 1OIRA 5AAGA 2C6EA 2XNBA 3EN4A 5C4KA 4W4WA 4ZEGA 4BVUA 5K9IA 5H8GA 3BKBA 3C4FA 1YXSA 2C5YA 5FEEA 4ZZMA 1H1QA 2W05A 3KA0A 2H9VA 4JDIA 2PWLA 4TPTA 1YWRA 2UZOA 3FV8A 2BRMA 3F3VA 3I4BA 2ZB1A 1JQHA 1U54A 1GJOA 3K5VA 4R3RA 3U4UA 3ZLYA 3NUXA 2HAKA 5CANA 2G1TA 3SLSA 1DS5A 1FVRA 3FLQA 4NKSA 4F09A 4W8EA 5JQ8A 3ACKA 3FL4A 2B0QA 2BRBA 1J3HA 5AUWA 4GU9A 1CTPE 4Z16A 2J5FA 3SG9A 3UGCA 3R7OA 2FSLX 5HE0A 3O71A 4QPSA 4G9CA 3TKUA 2XS0A 4HYIA 3FYKX 3I7CA 2UW5A 5KZ0A 4BKYA 4QP6A 4C4JA 1J7UA 1W7HA 4OTWA 4GW8A 4ZXTA 4BDJA 4FKPA 4IVBA 2IZRA 2YCSA 4TYEA 3R21A 3BHHA 4UBAA 2ERZE 1JKTA 3QLGA 3DCVA 4O2ZA 1WVYA 1KV1A 3UOHA 4BI1A 3RPOA 4BCKA 4D2SA 2OZAA 4QMVA 3RCJA 3KXXA 4AT3A 5AUUA 2JDSA 4BHNA 4NM7A 4FIIA 2QVSE 2W1IA 5DN3A 1UU3A 2ITNA 3ZRKA 1QCFA 3TEIA 3L8VA 4RJ4A 4C38A 3ROYA 5A46A 1XH6A 1RDQE 3LJ2A 2YACA 2WQBA 4YHJA 2QLUA 3D7ZA 3KGAA 3KFAA 4PPAA 4YJTA 4EHGA 4KIQA 2YWPA 2R3JA 4M7IA 3WE8A 4A9UA 4FNXA 3PSBA 3D83A 2GCDA 3QD4A 4ANLA 2LAVA 3GP0A 4PDPA 4DYMA 4KA3A 2ZVAA 3LCKA 4ZP5A 5EH0A 2FO0A 2IN6A 4U0IA 3R02A 2YERA 4PNKA 3ITZA 4UXLA 1OKVA 2CLXA 4I6BA 3AD4A 4OT6A 1URCA 2PE1A 4DGMA 3COHA 2XZSA 5AV0A 5LWNA 2X7OA 3MPTA 4F65A 5AUVA 4HVGA 2UZTA 2X9FA 2XJ0A 3Q4ZA 3QQJA 4FKOA 4IXPA 4Y83A 3VQHA 4AU8A 2BIKB 3R7YA 4WUNA 4X7QA 5FUTA 1XBAA 2C0OA 1WBPA 2OI4X 2XYNA 3RHXA 3NNUA 4UV0A 4IJPA 3R9NA 3S95A 4CTCA 4EWHA 2WTIA 4BZNA 4K1BA 3BE9A 1QPJA 2XKFA 4YGAA 3IK3A 5KCVA 3THBA 3P79A 5EQYA 4WT6A 4BDIA 4IHPA 4DEIA 2PVKA 3KRXA 3FSKA 3LFAA 4J95A 3C4EA 4E5WA 5DBXA 1OKZA 4DG0E 1W82A 3C4ZA 4NJ3A 5HZNA 4AQCA 3R30A 3UZTA 3FZOA 4E6AA 4EC9A 2ZMDA 1GAGA 3SOCA 3D4QA 3FI2A 5A4TA 3BPRA 5L2WA 1KE7A 3MH0A 4USFA 4ONAA 4ZTHA 1FOTA 4JDKA 3MVMA 4AG8A 4W9WA 4JAIA 2DUVA 4NCTA 4QMOA 3UVPA 4E4NA 4DA5A 3C13A 1UNHA 2RFSA 4GL9A 4GMYA 4PTEA 2F7XE 4TZRA 1YI4A 4FVRA 3DK6A 5DGZA 2YCRA 4IM3A 1WCCA 2J5EA 3OVVA 4MHAA 3U4WA 4KSPA 5E8SA 3WI6A 3T8OA 4V01A 2IW8A 1WZYA 2REIA 4IAYA 2XK8A 4PL4A 2UVYA 5KZIA 3S1HA 1Y6AA 3CLYA 4C62A 4PMPA 2JEDA 4IBMA 4MCVA 3C7QA 4RWLA 4BGHA 5CEPA 4O7ZA 2UZVA 5M55A 4EBVA 1B38A 3PA3A 3R8MA 1RQQA 4TNBA 2UW0A 3PY0A 1IG1A 4G6NA 5AX9A 4IB0A 4CYIA 4B7TA 5EYMA 1H0WA 3VULA 3GCVA 5EYCA 5E9EA 4MBLA 2CMWA 3N9XA 1ZOHA 1WMKA 2JITA 3D2KA 3MGYA 3RPYA 3SRVB 4BWPA 5EI2A 1OIQA 3OD6X 3VBYA 3GQLA 4XV3A 3TN8A 4ANMA 2ZDTA 2I0EA 2QO2A 3HAVA 3F7WA 3DKFA 4O0SA 5HBJA 1U5QA 2B52A 4LUEA 4OBOA 4FKQA 4CKIA 5BQ0A 5CXZA 4RSSA 2X4FA 3TTIA 4O7LA 5CSHA 4U43A 4BCIA 2GS6A 5CXHA 1BI8A 3U9CA 1NW1A 2JKOA 3CKWA 4L3JA 3DNEA 1YI6A 3D7TA 2CSNA 4PTCA 4TWNA 4YJQA 5AV1A 3UMXA 3WILA 3GBZA 2KULA 4LGDA 2W7XA 3FMMA 3PWDA 4EUUA 3FEGA 4K9YA 1G5SA 3W55A 3TM0A 3QALE 4AA4A 5LVLA 4EC8A 2E9PA 4MQ1A 5FXRA 2BTRA 5EFQA 1JSVA 1OGUA 3RTPA 3ZSHA 2W5BA 5HE1A 4GH2A 3NSZA 4PF4A 2XJ2A 4IDTA 1Q41A 3GENA 3ZO1A 5EDQA 2R3LA 2BIYA 3G6HA 3QD3A 3Q9XA 4KBKA 2QU6A 3LM0A 4UMTA 4D1XA 3QAME 2BCJA 4EBWA 1KOAA 2Z8CA 3LCSA 5IQAA 3EQPA 2GS7A 5A4QA 2OGVA 3V8WA 4Y72A 1ZZLA 2QOHA 2W4KA 4MNFA 4OTQA 4QP1A 4TNDA 1R0EA 4XV9A 4F1MA 4NL0A 5EM5A 3O0GA 3UJGA 4O81A 1YHSA 3FXWA 5JEBA 5JT2A 2QHMA 3VBVA 3HA6A 1K3AA 3HAMA 3DTCA 5J95A 1FINA 1YOMA 2JFMA 3H9FA 3PVBA 4OLIA 4Y46A 4HGLA 3W2PA 1UNGA 4XOZA 3PJ8A 3LOKA 5HOAA 4I5CA 5CTPA 3AMYA 3LLTA 2C5OA 4AF3A 3Q4TA 4A4OA 2QO7A 5L2IA 4X3JA 1JSTA 3MIYA 3G9NA 3UZRA 1W0XC 2A2AA 1FVVA 2P3GX 3RZBA 4E8AA 5C8NA 3ZRMA 4LG4A 3UNKA 1M7QA 4MXAA 3VBWA 1Y6BA 4P5ZA 2C68A 2XK4A 4YZ9A 3FHIA 3PFQA 3OWJA 4MXOA 3LCTA 3V3VA 1M2QA 5KBQA 4L3PA 3BV3A 5F94A 3PUPA 4IQ6A 4R3PA 3U51A 4DFLA 1ND4A 3ZO3A 3C50A 3F69A 3P1AA 1ZWSA 5EHYA 2XIRA 4C33A 4M97A 3VQUA 5FQDC 5LMKC 3EN6A 3OCBA 1SYKA 4J8NA 4NTSA 3D14A 5BVOA 4FSWA 4WNOA 2WAJA 4HYSA 2YM7A 4JX3A 4HVDA 5ITAA 3GCPA 2XKCA 4H3PA 5L8KA 3VUHA 4FZDB 2W4OA 4IW0A 2DQ7X 4KBAA 4DGNA 2ZM4A 2IVSA 3OWLA 4YP8A 3VJNA 4BR3A 3TXOA 3WE4A 2A19B 3CP9A 2C6IA 5EW3A 4JG6A 2QO9A 2ZV2A 2YLEA 1XH7A 1GIJA 3LFBA 4YTHA 5LOHA 4FKUA 2VUWA 1ZYLA 3FSFA 5AM7A 3R71A 4GFMA 4FT5A 1H1RA 4E6CA 3IKAA 4BFMA 1JAMA 4EH4A 5I5ZA 4CQEA 2WMBA 3ZLWA 4XCUA 1PKDA 2VTJA 4MWHA 5LJJA 3FI4A 2BMCA 3SG8A 4DFXE 2RF9A 2XH5A 3DJ5A 4PMTA 4EJNA 3DK7A 5CX9A 4ZMEA 4I6HA 2HY0A 2X39A 3KREA 3PTGA 2DS1A 4GFGA 1RE8A 2PVHA 3ZBXA 4EYJA 1PHKA 2CGXA 1CM8A 4LMNA 2IZTA 4BTJA 5E8WA 3N4UA 4QQ5A 3UNJA 4U79A 3RPRA 3V01A 2IWIA 3UZPA 4D5HA 1YXVA 4BL1A 3MH1A 1ZMUA 4DCEA 1OBDA 4ZJVA 4J96A 5J87A 1ZZ2A 3SXSA 1BL7A 3DZOA 4TY1A 2PVRA 4XV1A 3QHRA 4EHEA 3IS5A 4ZLZA 3BI6A 4I3ZA 4PL5A 4QPMA 1EH4A 4EK3A 1F0QA 4JAJA 3A61A 5CEIA 5D7AA 3AOXA 1BX6A 3CS9A 4TXCA 1S9IA 4RWIA 3ZSIA 3AC2A 4Z9LA 5IQGA 4D9UA 3D5WA 4EH6A 4IFCA 4JG8A 3RK5A 4GJ3A 5EI6A 5D41A 4RVMA 3A7HA 4KABA 3GCUA 3ZLXA 4DFNA 4EK6A 4FTAA 2BHHA 2WPAA 5E8TA 5FDPA 3ERKA 4NSTA 4G3EA 4TW9A 4D2VA 4QMTA 4G3FA 3R7UA 5AR4A 1PXPA 1KWPA 2OW3A 3A7IA 3IDBA 5CZHA 4BIEA 4RJ8A 1I44A 2ZM3A 3FJQE 3QTXA 3FZ1A 4GIHA 4BDBA 3TNIA 4OAVB 3ZZEA 5LMBA 4CMOA 4HVHA 4L68A 2UZLA 5JQ5A 3DJ6A 4NJDA 3QTZA 4JBVA 3BQRA 5DG5A 3QC4A 5HE3A 5KHXA 4R77A 4EOLA 3BELA 2NNWB 3UOJA 4GK3A 2VX0A 4LQMA 4QYFA 1W84A 2XNGA 2YHVA 3G51A 1JOWB 1UNLA 4AN3A 1MQBA 2XKEA 2PMIA 2EUFB 3OHTA 5FP5A 4RG0A 1ZAOA 3PVGA 4FICA 5AV3A 4O22A 3QYZA 3CXWA 4EQCA 4ZS4A 4ZZOA 4ID7A 4ARKA 3MWUA 1GY3A 3HA8A 3EZRA 4FEUA 1TKIA 4FV7A 1AGWA 2DYLA 2OO8X 3GCSA 2C3KA 5ETCA 4A9TA 4BYJA 1MRVA 3QL8A 4R7IA 4USEA 3EN9A 5HQ0A 2C3IB 3F5GA 4YC3A 3G2FA 4IZAA 5BVNA 3RP9A 5KKRB 4ZOGA 3DJ7A 2R3MA 4ZSEA 3PE2A 3TIYA 3E3PA 3LXPA 2Y6MA 2RIOA 4H3BA 3E87A 4HNIA 4AN9A 3ZLSA 2W1DA 4E7WA 2HY81 5IH5A 3PLAE 3QQLA 1Q8TA 5CY3A 4I20A 5M57A 1R1WA 3QHWA 2C6KA 5TR6A 4KIOA 4C58A 1OL6A 5CF5A 3R6XA 4ZIMA 2VU3A 4FIEA 2R2PA 3SDJA 1HCKA 4ENXA 1J91A 2J4ZA 4F7LA 5H8EA 4FF8A 4N57A 2XIYA 4NT4A 3IW4A 4JDHA 4BTKA 2V7AA 2VWBA 3ODZX 3EYHA 3WYYA 4CT2A 1PRYA 2BKZA 2IVVA 4CG8A 4L52A 3UP2A 3UPXA 4MXXA 3V6RA 3WF5A 3L8SA 3KXMA 4LOPA 2WD1A 3BGQA 2XEYA 4MH7A 3ODYX 3KF7A 4FSQA 2XBAA 1UVRA 4NM5A 4DFZE 3F2AA 5IH4A 4X3FA 3FPQA 3ZH8A 4CGAA 4DH1A 2OXYA 5IA4A 5M08A 3LFQA 5FGKA 5M44A 4FTRA 5BUIA 5AP5A 3W10A 4EKLA 2WMVA 2X7FA 4RIXB 4G5PA 1HOWA 5CVGA 3QZIA 2J0LA 4EORA 3MVHA 4BI0A 3FC1X 3CD3A 5IQBA 5HESA 4D2RA 3K5UA 2PUIA 3EMGA 2G9XA 4CMUA 4E26A 5J9LA 2R3OA 5IUHA 3FLYA 3FLZA 2XJ1A 3RAIA 5JZNA 3BWFA 2RG6A 3A8XA 3HV6A 3KCFA 2VTSA 4MAOA 3SKCA 3KCKA 4YZDA 2J2IB 3RAWA 4IAZA 4GJ2A 2GHGA 5E8VA 3UPZA 3QCXA 1URWA 1YHVA 4AN2A 5KHWA 4G6LA 3S2PA 2GNLA 3U6JA 4ENYA 3DBFA 1O6YA 3CTJA 3DZQA 2QODA 3NUUA 4PY1A 3G90X 3R7EA 2HZNA 2C5NA 3OW4A 4FUXA 3KY2A 3NS9A 2OJ9A 4A4XA 4O7TA 4WNMA 4WIHA 3MFTA 4H05A 4DH8A 1J1BA 5DR2A 3GC8A 2I6LA 3DFAA 4ZTSA 5LWMA 4ZTLA 3ZOSA 4RJ6A 3NLBA 4GT5A 4RIWA 2NO3A 3FQSA 1UA2A 4QTCA 5AR7A 2OJJA 3UP7A 3OXTA 5DT0A 4AZFA 1G8SA 1H00A 3EQGA 4WNPA 1DAYA 5ACKA 2W99B 3KMMA 3Q4CA 5J8IA 3GB2A 4OTIA 3FZRA 4OW8A 2B4SB 5FDXA 3H9OA 2Q0BA 2OFUA 4MXCA 3SW7A 5I3RA 2R3PA 3DFCB 5CF8A 3O96A 2EXEA 2QQ7A 3PSCA 4FTNA 3FMDA 5H9BA 1YOLA 5JGBA 4NCTC 1WBTA 1Y8GA 4AZSA 2V5QA 4ASDA 4HPTE 2VTHA 3FDNA 2UZUE 4WBOA 3FZPA 4QQCA 4NK9A 4D2WA 5HTIA 4HW7A 4L7SA 4RX9A 4A9YA 2R7BA 4QQJA 3UBDA 4F9YA 3RK7A 4EK5A 2BDWA 2YJSA 2WQMA 3E3BX 5CQUA 3CJFA 2EU9A 3SGCA 3E64A 4AGDA 3D5VA 4C4EA 5L4QA 4IWDA 4CD0A 2WMWA 2VWWA 4Q2AA 2VX1A 3KQ7A 5IQDA 4LL0A 3PP1A 3M11A 4E93A 3TNWA 5HLNA 3ZC5A 4JR7A 2PHKA 5I9YA 4USDA 5D10A 5DPVA 4U8ZA 4BCHA 4RX5A 2QOBA 2GQSA 3L9MA 4EH3A 5AIRA 4AW2A 3TI1A 3F7ZA 2ZOQA 3FLWA 2ITVA 3NUNA 5JFVA 5HNIX 2ETKA 4ZSJA 4X21A 3DOGA 3OWKA 2VO7A 3UO6A 3OMVA 5J1VA 1I09A 3QQGA 4RMZA 5CASA 4MXZA 4XP0A 1Q8ZA 5IZFA 1VZOA 4NKAA 3BYOA 4FYOA 3TNHA 4DLJA 2UW4A 4R5SA 3IGOA 4NZWB 5J7HA 5FLFA 4Z7HA 4YR8A 4G9RA 3OW3A 5BVDA 3OFMA 1CKIA 3R73A 1MQ4A 4BTFA 3E8CA 3FZTA 3UIMA 5IH6A 2VZ6A 1GOLA 3V04A 5AP6A 3H4JA 4PMSA 4FIGA 2X1NA 4RIWB 2WMRA 3QX2A 3SHEA 3POOA 3ZU7A 2Z02A 1B6CB 2QKRA 3SOAA 3R1YA 2YIWA 4KINA 5AEPA 3EQIA 2C30A 4I6FA 5DEYA 3NW7A 4FV8A 2V55A 3SX9A 5DE2A 3MW1A 5C27A 4DEHA 4UMRA 1REKA 2HZ0A 2R3FA 4PL3A 3R83A 4AE6A 4C3PA 1ZYDA 3NX8A 3Q60A 4M67A 4N0SA 2BAQA 3HRFA 2E2BA 4GYGA 4IWOA 3GFEA 4RJ3A 4NW6A 4B8MA 1CMKE 5HNBA 3FQHA 4O38A 3LKMA 4HCVA 3WYXA 1R0PA 3CQWA 5BVFA 3G6GA 3LFDA 4BTMA 2FA2A 4XG4A 5JRQA 1DI9A 1UWJA 3PPZA 2XIKA 5DNRA 4X2FA 2UW8A 3QTUA 4IB5A 4QMSA 4UMQA 4JI9A 4C3RA 4FTCA 4IVAA 3GU7A 5LMAA 4BN1A 2BDFA 4MNEB 3GQIA 2FSTX 3BU6A 4DCAA 3TUCA 1CSNA 4RGJA 3G33A 3LJ1A 4O83A 2PMOX 3PIXA 3U6HA 1U5RA 4IAFA 1IR3A 3BEGA 3VRZA 3DQXA 4KIPA 3TTJA 4R1YA 3UMWA 3MJ2A 3HV5A 4DC2A 5GZ9A 3BYMA 2JKKA 5CSPA 1OI9A 4WG5A 4D4SA 5CU3A 5JRSA 3M2WA 4F1OA 4FV9A 2XBJA 2RFNA 4HGEA 4L46A 3KC3A 4IM2A 4O27B 2C3LA 5G6VA 4BRXA 4AA0A 4O7WA 3R8UA 2QLQA 3QA0A 2WEVA 5IDPA 3R1QA 2UW7A 2J0MB 4LL5A 4WG3A 5I3OA 1L8TA 4ZTRA 3NAYA 2QURA 2JKMA 3CPBA 5DMZA 2HOGA 1OL2A 3DB6A 5JK3A 4DTAA 2OIBA 3FC2A 3QRIA 3R2YA 5DR6A 2PSQA 1QPCA 5DH3A 1Q61A 3OBJA 3E7VA 4RQKA 4O0UA 3HNGA 3U55A 2XEZA 4F64A 4FV4A 3ZM4A 1FMKA 5F95A 3EN5A 5ETAA 3IW6A 1O6KA 2WMAA 2CNVA 2GTMA 1OIYA 2A0CX 3NIZA 4MQ2A 4FEVA 3NAXA 3EJ1A 3QU0A 4B4LA 2RGPA 1QMZA 2UZDA 5BVKA 4K77A 3VNTA 3GC0A 2BALA 4KIKB 1ZOEA 4EOQA 5KUPA 2WQOA 4YPSA 1WFCA 2NRUA 2OH4A 2PPQA 4DT8A 4JNWA 4BIBA 3F2RA 3BQCA 2YM6A 4MTAA 2WQEA 4FC0A 4RC2A 3PG3A 2ERKA 3Q3BA 5D1JA 1IRKA 3FAAA 3S3IA 5ANGA 1TVOA 2PVYA 2PUUA 2HIWA 4FSNA 3VS3A 2QI8A 2HW7A 1A06A 3HMIA 4YBJA 4WA9A 2AYPA 4X2GA 3ZDUA 1OITA 3G5DA 3PPKA 4RBLA 3NYOA 2VD5A 4UWBA 1U59A 3CQEA 3FBVA 4UWCA 5AWMA 3ZZWA 2OKRA 5GZ8A 2WXVA 2F57A 4NIFB 4O7VA 4ASZA 3QZHA 2W1EA 4HCTA 5L2TA 1VEBA 3IW5A 2B9IA 2YM4A 3R7GA 4AW5A 4AFJA 4EH2A 4FVQA 3A7GA 3NYXA 4TWPA 3UIUA 2GNFA 3F82A 4GEOA 3FMNA 1U4DA 3IW7A 3UIXA 5HTCA 3MY5A 2ITWA 4YHTA 4ZTMA
chains in the Genus database with same CATH superfamily
3EL8A 2DWBA 1WBNA 3AT2A 2AC5A 4OBPA 3Q32A 4DLIA 4DT9A 3BX5A 3FMEA 3KL8A 3P78A 5A3XA 5C4LA 5KKRC 4O84A 1AQ1A 3OCTA 5FTOA 3DBQA 3PIYA 4TTHB 4YZBA 4DFUA 3V5QA 3NVKI 2BVAA 3R7IA 2XNMA 5AUXA 2XCKA 1PXNA 1U54B 4FI1A 3OXIA 4HJOA 5EOLA 3UG1A 4DE4A 4E4MA 2R0IA 3O7LD 4YZNA 5JH6A 1OVEA 2RFEA 2OXXA 3B2WA 3TJCA 3TV6A 4JRVA 5GINE 2VTOA 1M2RA 3ANQA 4OAUC 5E91A 4MKCA 4L8MA 5IA2A 2XARA 5AADA 4ZY4A 3EFLA 1PXOA 3FYJX 3G0FA 4X2NA 4JBOA 5C8MA 3FKNA 3VIDA 4B8LA 3O5AA 3EZVA 3A8WA 2QNJA 3OG7A 5CF6A 4ITHA 5CQWA 4BGQA 4AP7A 2V7OA 4KBCA 3TV7A 2V62A 2YN8A 4N4SA 1ZMVA 3V8SA 5BUEA 4FZ6A 4XH6A 5HVYA 2O64A 3CY3A 4NFNA 5CI7A 2PYWA 2X9EA 4RVLA 3EQFA 5AUTA 2UV2A 5IMEA 3RNIA 4UX9A 4Q9ZA 3F3WA 2OZAB 1YQJA 4E20A 4FTOA 4LRMA 5AM6A 1Q3WA 3HV3A 4GVJA 4ALVA 3DBDA 5CSWA 2CDZA 4I1ZA 4XV2A 1OB3A 1YKRA 2C3JA 3MI9A 1PYEA 3A4PA 2GNHA 4B6LA 5M4FA 4D4YA 3OOMA 4M3QA 3OTVA 3ULZA 4CKRA 3Q52A 3F3ZA 3VO3A 5ANJA 4AS0A 5E1SA 3VAPA 2JAVA 5IEVA 2CCHA 2IJMA 3R9RA 4FKGA 3SXRA 4AACA 4ASEA 4CZYB 3MESA 2PVLA 5HKMA 3EKKA 4BCQA 3W2SA 2UW9A 3GCQA 3TG1A 3KN6A 5M4IA 3TZ7A 2UZBA 5JKGA 5LCKA 2BZKB 4LFIA 3HP2A 3PVWA 2G2IA 2YM3A 2C6TA 3LPBA 1LPUA 5DI1A 5HIBA 3VS1A 4FGRA 3TDWA 1XH4A 4AXAA 4ANSA 4HZRA 3TJDA 3NRMA 4IIRA 4RFYA 1PXMA 3CPCA 4ZJJA 1Q8WA 3M42A 2ITOA 3NUYA 4GU6A 3KRLA 3ZC6A 2QOQA 2IO6A 3QBNA 5CU2A 2CKQA 2GNJA 4IWQA 3ZM9A 4YLLA 4CT1A 3VS6A 3R8ZA 1YHWA 1OIUA 2QR7A 4DGOA 3ORPA 2P2IA 4XMOA 3V6SA 1FGIA 4BDGA 2QR8A 4EWQA 3W2RA 4FKLA 4JJRA 4F78A 4RIOA 3ZEWA 4FSMA 4ANOA 3JVRA 3PY1A 5DRBA 2WQNA 3RINA 2LGCA 3AMAA 5CSXA 2PUNA 2ZV9A 1GIHA 2PY3A 3BHVA 5IQFA 3VC4A 3VS4A 5M56A 3FHRA 3QRJA 4YJUA 2JD5A 2FVDA 4RIYA 2WEIA 3C1XA 3ZTXA 3HMNA 3C0GA 2P4IA 3QX4A 4L43A 1UU7A 4C37A 2CGUA 3O23A 1OZ1A 5CU4A 4FL1A 1XHAA 4HYUA 4KRDA 4AOIA 4O0VA 4MF1A 4EH8A 4PX6A 4EHVA 4JIAA 2XALA 1BMKA 3CD8A 5LXMA 4EHZA 1BKXA 3EH9A 2R5TA 4G2FA 4TWOA 5HG7A 3V5WA 5AFVA 2EXMA 5CAOA 4JMQA 4F7SA 4D0WA 2J6MA 3OBGA 2QOKA 4ZLYA 4LM5A 4AAYA 5HLPA 5AUYA 2HW6A 1JSUA 4MD7E 2GS2A 3QA8A 1H4LA 4IH8A 4DTBA 3LCOA 4D0XA 2YCQA 4FT9A 3RCDA 4APCA 4JBQA 4QP9A 4LV7A 1FVTA 4IDVA 2F2UA 4BZOA 1H1WA 3KVXA 2JIIA 4ZTNA 1KV2A 5ETIA 4EOIA 4YTFA 5BMMA 4Z55A 5EW8A 3P7BA 5HTBA 3ZXTA 4LV5A 3Q9ZA 3EFJA 1Q99A 2BRGA 4GG5A 4R6VA 3MA3A 4I5PA 4UYNA 2GNIA 4CRLA 4PP9A 3ZDIA 2PVJA 4KKGA 1JBPE 2VAGA 3SC1A 3ZHPC 3W0RA 1IA9A 3KN5A 3AC1A 4H58A 1P14A 4PUZA 2QG7A 4C4IA 4JG7A 3JY0A 3QXPA 3GOKA 4U3YA 3EL7A 3ORTA 5IEYA 4FKRA 5K5XA 3RI1A 3BV2A 4UWYA 1VLRA 1GNGA 4JL9A 3E63A 2OSCA 5B2LA 2WB8A 3Q4UA 4U80A 2FSOX 2VWYA 3DLSA 4U7ZA 4QRCA 3AMBA 1SNXA 2XRUA 3LW0A 3BHTA 3D7TB 4D4RA 3KVWA 4OTFA 4EJ7A 3LXNA 3OT8A 4I0SA 3ZBFA 5IPJA 4U44A 3QGWA 4FL2A 3DPKA 1G3NA 3NZ0A 4I93A 4TYGA 4OTGA 3RALA 4BDHA 2H8HA 3F6XA 1NA7A 5CT7A 3O51A 4XG2A 5GNKA 4ZSAA 3DAJA 4FA2A 5HX6A 5IU2A 1FMOE 4FVPA 3UDBA 2I0YA 2SRCA 1NXKA 3RAKA 3ZFXA 5EHLA 3FQEA 4RRVA 1JNKA 2YWVA 2GPHA 4BZDA 4XP2A 2CKOA 3U9NA 2WHBA 1PW2A 2ZV7A 4OT5A 3WZDA 3DAEA 1YXXA 5HVJA 2OJFE 2G2HA 4RA5A 5A14A 4I0RA 2O63A 4QMPA 4P2KA 4F0IA 3BHYA 5KMNA 4X6RA 2VN9A 3QF9A 1H01A 3TL8A 3K3IA 5KMMA 3MTFA 3ORNA 4GYIA 2ONLA 4CG9A 1UV5A 2QOFA 3QUEA 4GK2A 4GSBA 5IG1A 2B7AA 2QOLA 2WIHA 3I0QA 3P4KA 4LYNA 4PWNA 5L8JA 5C9CA 3LFFA 2XB7A 3QQUA 4F08A 3F3UA 1VYWA 2WIPA 3CEKA 5HG5A 5TO8A 2I40A 4YSMA 4OTPA 3SV0A 4M13A 1OPJA 2YA9A 4YO4A 3CE3A 1WAKA 2ZFYA 3AC8A 3ID6C 3FMKA 3QKMA 4WRGA 4EYMA 3F61A 3PZEA 1F5QA 2C0IA 4M84A 4A06A 4QMXA 3TZMA 5I4NA 1KE9A 4M12A 3KXZA 5AAEA 4L7FA 4KD1A 4QYHA 4WKQA 3IDCA 4PV0A 5HU9A 5IEXA 3QTIA 4QYYA 4FTLA 3I79A 2CGWA 2VX3A 4BBEA 3AD5A 3EHAA 3GXLA 4H1MA 4BHZA 4CMTA 1JWHA 3LJ0A 2PVMA 1TZDA 4M15A 3UOLA 4FUYA 4G3GA 4V05A 5KMKA 3AC5A 3EKNA 2ITXA 3NYNA 3ENMA 3PG1A 5C26A 5LCJA 2WKMA 3BLQA 5GIOE 5CEMA 1H08A 4AGWA 1K9AA 4ITIA 3D2IA 4EH5A 1UU9A 2Y4IC 4O4EA 4CZTA 3QCQA 4KS7A 5EM8A 5GHVA 5FM3A 5DHJA 1MRUA 3QD0A 1JVPP 4QP4A 4FKIA 1BL6A 3S0OA 5A4EA 2VWZA 4O21A 4J7BA 5FTQA 2BAJA 2VV9A 4E5BA 4FKSA 2BHEA 4CLIA 3BRBA 2H34A 4KWPA 4AX8A 3NEWA 2C6MA 5GJDA 4F4PA 2UUEA 4FK6A 3BZ3A 3Q5IA 3LQ5A 4FR4A 1G8AA 2IVTA 3F9NA 4FOBA 4J53A 2VRXA 4G3DA 3GOPA 3QD2B 3O8TA 4AZTA 3CBLA 4ASXA 2C5VA 3DBCA 3DXNA 3PJ2A 4XG7A 4XS2A 4U42A 4CFVA 2G15A 2ITTA 3R2BA 2IW6A 5AR8A 1XWSA 4CEGA 2J0JA 4TYIA 4K2RA 1XJDA 1P2AA 3ANRA 4L3LA 1NVSA 4D4VA 3QZGA 1PF8A 2J90A 2C47A 3B8QA 3BYUA 5KBRA 4IE9A 5LVPA 3VWAA 4GFOA 3WF6A 4IACA 1GZ8A 3PXFA 4UY9A 2WELA 3NW6A 1WVXA 3SAYA 4E5AX 2HXLA 1R3CA 3JS2A 1ZY5A 3Q53A 4QOXA 2R3RA 4AOJA 3PJCA 1L3RE 4F1TA 5J1WA 1NVQA 2O0UA 3QUDA 3NMUF 2BZJA 2VNWA 4FKJA 5A54A 5IQEA 4XHKB 5AP7A 5EW9A 4B0GA 3HLLA 4L6QA 3ZYAA 5L6WL 3MJ1A 3D94A 4FYNA 1PXJA 1CKPA 1FGKA 3GNIB 2WTKC 3JR1A 3BGZA 3RWQA 2XM9A 4TN6A 2W1ZA 4GKHA 3LZBA 3P0MA 1J1CA 3ZUTA 3DS6A 3O50A 3UOKA 3PXZA 2WFYA 1H24A 4I5MA 4YJSA 3N4TA 3R9DA 4R8QA 4TYHA 5H3QA 5IA3A 3KB7A 3LFSA 3PA4A 2HZIA 4II5A 4RLKA 4WNKA 3ZS5A 3COMA 1OECA 3W0QA 3NWWA 3ENHA 4MX9A 4QNAA 5FWKK 1YWVA 5IQCA 3MIAA 3P86A 4D55A 4YJRA 1JKKA 2IZUA 4YPDA 5CU6A 4RVKA 1PXKA 4PPBA 3PXKA 3AGLA 4RC3A 4XYFA 5TE0A 2Y7JA 4DH3A 2X8EA 2YCFA 4DH5A 3UG2A 4CFWA 1A48A 4XX9A 4X6QC 3Q04A 4R7BA 1H8FA 3KU2A 4KSQA 4MWIA 4P7EA 2ZJWA 4AGUA 1YRPA 4BYIA 4FV0A 1SVEA 5A9UA 3QTSA 3OROA 3DV3A 3UVQA 4BCJA 4UXQA 1Q3DA 1V1KA 2WMTA 4DITA 2ETMA 1Q5KA 3QRUA 4FEQA 2YAKA 1QL6A 2Y8OA 3O7LB 2GU8A 3IPHA 4ALUA 4BDCA 2CN5A 2CJMA 3CSVA 2PU8A 2OJGA 2VNYA 3BYVA 2J9MA 3NGAA 1B39A 3SXFA 3V51A 5HLWA 3DXQA 2XIZA 2O3PA 4PP7A 3HV7A 1GZNA 2OF4A 5BNJA 4BGGA 3UO5A 2A98A 2R3KA 4C2VA 3QCYA 2EB3A 5K5NA 4IAAA 4BCNA 1PYXA 5E8ZA 4I5HA 2C6DA 5BYYA 4FTMA 1JLUE 2OIQA 4NM3A 4YJOA 4FNWA 2KTYA 2PL0A 5LVOA 2BTSA 3N4VA 3UNZA 5CF4A 5J9YA 4YNOA 5FM2A 4L67A 4OGRA 1XMLA 4FZ7A 5AV2A 5T3QA 4YURA 4C02A 4GCJA 1R39A 4RFMA 3D5UA 3RMFA 1M14A 4WSQA 5KNJA 3DNDA 2X2KA 4I21A 3LM5A 2B54A 5K4JA 2ESMA 4TRLA 1OPLA 2YDIA 4JRNA 2I1MA 2W17A 4FNYA 4NM0A 3WARA 3LQ8A 3O8UA 2ITPA 3C4CA 3BWJA 3DTWA 2OZOA 1REJA 3KULA 3PZHA 5CU0A 2P55A 1P4FA 2WTDA 1BI7A 1LEWA 3F3TA 4XEYA 2FSMX 3Q9YA 5IQHA 3UQCA 1H07A 5L2QA 3QYWA 4FSTA 1IEPA 3QGYA 3PXRA 4O4DA 4QYGA 4DGGA 3Q2MA 3HEGA 5D11A 3OUKA 4C4HA 4F9WA 4IZYA 4EKKA 3HUCA 3QUPA 4I24A 5DT4A 2XK3A 3TKHA 2R7IA 3FKLA 5KX8A 2C5XA 3BU3A 3IW8A 2BROA 4IX6A 4X3FB 4C57A 3RGFA 5L6PA 4FT7A 3C4WA 2OIDA 1ZYSA 3TT0A 4ZLOA 3HZTA 4Q5HA 2ZM1A 4M0YA 5HBHA 2HK5A 4ANQA 4MD8E 1YXTA 5DIAA 5T68A 1ZXEA 4XNEA 3F2NA 4XOYA 4RWJA 5GIPE 3CY2A 5ANEA 2ITUA 5CYIA 4IM0A 4O7NA 4FV2A 4AWIA 4ACGA 5HG8A 3ZRLA 4QMLA 2IG7A 2IPXA 3VUMA 4N6YA 2JDVA 4F7NA 4CCBA 3VS7A 4V0GA 1H0VA 5I9ZA 5EYDA 4PDOA 3OC1A 3W16A 1W2FA 1P5EA 1YVJA 4I4EA 4FGBA 1J7IA 3KMUA 3RZFA 1Z9XA 4EI4A 3W2OA 5JGAA 3CJGA 3ZONA 2ZMCA 3AXWA 3GI3A 4R3CA 4L00A 5AX3A 2EXCX 4V04A 3L8PA 4EZ5A 4ACHA 4D5KA 5HICA 2C6OA 5HORA 3MPAA 2X8DA 3HX4A 2V22A 4G31A 4F70A 1STCE 1SVGA 2XK9A 1Q8UA 4U41A 1QPEA 4O96A 2X7GA 5IF1A 5J5TA 1U46A 4IC7A 1PKGA 4ACCA 1YW2A 2VWVA 2H6DA 4F6SA 3PJ3A 2YJRA 3MY1A 4FV6A 4HZSA 4LRJA 3IO7A 5KMIA 3DKGA 1PY5A 2FUMA 3VVHA 2W06A 4I6QA 5AP0A 4C4FA 3Q6WA 5CS6A 2BZHB 4QP8A 2VTQA 3K3JA 2VTTA 1W83A 4S31A 4E1ZA 3ALOA 4ORKA 4C59A 1ATPE 2ACXA 4F7JA 4BCPA 3R9HA 2BKKA 3RAHA 3MB7A 2OFVA 1GZOA 3ORLA 3R22A 2JKQA 2YIXA 4ITJA 2AQXA 3MTLA 5I9UA 3UODA 2VWUA 4OBQA 2JIUA 1T45A 5EQPA 5EQEA 1VJYA 4O7SA 1V0PA 3CC6A 4P4CA 3OUNB 2IVUA 5B2KA 2X8IA 3ZFYA 5KMOA 2O8YA 4DEEA 3AG9A 3E8NA 4QMYA 4A07A 2RG5A 2ZV8A 4XRLA 1YI3A 4A9RA 4BCFA 3FZSA 5A4LA 4GT4A 4EQUA 3AKKA 4QQTA 3OCSA 4IAKA 2CLQA 4LOOA 1Q8YA 3HMPA 1XKKA 3NIEA 5ANKA 4IADA 4D2PA 2VTLA 4YBKA 4DHFA 3OWPA 3WF9A 1KUTA 4CTBA 4AOTA 5J7BA 5F4NA 3LLAA 4XG9A 3GT8A 2G2FA 3LHJA 1YDSE 2C0TA 4UMPA 4CYJA 1H25A 5D7VA 5B0XA 4X2KA 4XLIA 4MK0A 3VUKA 3U6IA 4F0FA 5CEKA 5CEOA 2NPQA 2CNUA 2BAKA 4AZEA 3FL5A 3FY0A 4MXYA 4IANA 5L2SA 3F88A 4BDAA 4YUQA 4BCGA 4YJNA 1ZYCA 2XRWA 4D1SA 5HGIA 2JFLA 2YFXA 3II5A 3W0OA 2JIVA 3DKOA 4M69A 4NWMA 4NUSA 2BDJA 2VGPA 4L42A 2UZWE 4AUAA 5DA3A 2RKUA 3B2TA 3UC3A 2WMXA 3VF8A 3W32A 1LP4A 3PJ1A 3R63A 5FTGA 4RJ5A 3I60A 5DLSA 2PZIA 3JYAA 4FG7A 5I9WA 3VBTA 3Q96A 3GU5A 1AD5A 4BWKA 4S34A 2BUJA 2PZ5A 1T46A 2HENA 2X4ZA 2XCHA 3A7JA 4W4YA 4KAOA 1BYGA 3OXZA 4JBPA 2GTNA 4U9AA 3CTHA 4YC8A 1OKYA 4P90A 4WRSA 4WD5A 4ZMFA 4O6EA 3ULIA 5CAVA 3WIKA 4PRJA 1ERKA 3CTQA 3VUDA 5AMNA 4EOSA 1KE5A 4O7YA 4M68A 2Y4IB 2YIRA 3DKCA 4YMJA 5KO1A 5CAQA 3P08A 3F5XA 2HYYA 4OTRA 4YJVA 3TV4A 4ZY5A 5E8UA 4U97A 2QOCA 4QMWA 2F7ZE 3SD0A 1ZOGA 4O0WA 4UYAA 2VTMA 5CWZA 5E8YA 2Z7QA 3DQWA 3HRBA 5HD4A 3FLSA 5T6KA 2OU7A 3RM6A 1KSWA 3ZCLA 4RVTA 4IB1A 5CSVA 2ONLC 3OF0A 4NH1A 2PZRA 2UW6A 4G17A 4IMYA 2YEXA 3MFRA 2AC3A 1JKLA 4YZMA 4DEBA 3O17A 1FBNA 3U54A 4UALA 3OS3A 2UZNA 4JS8A 3DDPA 3IECA 4WG4A 3KK9A 3SVVA 3QZFA 4DEGA 2FYSA 4M14A 3UYTA 3W2QA 4FODA 3BCEA 4IX4A 3PY3A 2JC6A 4HVIA 1LUFA 4AZVA 3NFFB 2WO6A 3GC7A 4GUEA 3E62A 2W4JA 1MRYA 2XF0A 5ANDA 3ORMA 3VBXA 4DF3A 3PRFA 5FD2A 1PXIA 3REPA 1Q24A 4WSYA 3MH2A 4LOQA 4FOCA 4ZJIA 3ALNA 4S2ZA 1Q97A 3DU8A 4TWCA 3KF4A 3QFVA 2VO0A 3T3UA 1CDKA 1PXLA 2C6LA 5IKWA 4O4CA 2B53A 2HELA 4M69B 4EOMA 5E4HA 1QPDA 3QLFA 4EOJA 3C0HA 1SM2A 4IZ7A 1UU8A 4MD9E 1R78A 2W9ZB 3UIBA 2GSFA 2B9HA 5HNGA 4QMNA 4QDEA 3FLNC 4BDEA 2XVDA 2W9FB 3KEXA 3KRWA 2GHMA 3GUBA 3O8PA 4TKSA 4W4XA 3T9TA 2E9NA 2W1HA 2X0PA 2JLDA 4JR3A 2BRHA 3VHKA 3VS2A 4F6UA 2Q0NA 3AC4A 5I9XA 4YC6A 2WTKB 1NY3A 2F2CB 3NNWA 3W0SA 2OF2A 3QTWA 4LUDA 4A4LA 3EQBA 2Q83A 3HYHA 4C7TA 4D1ZA 4JQEA 4EZ3A 3SQQA 3SRVA 4EOOA 3TACA 4DBXA 3KXGA 1GZKA 1XH5A 3V8TA 5M51A 2A27A 2OK1A 3L9LA 2Y0AA 3PIZA 4NTTA 3C9WA 5L3AA 4FBXA 1ZY4A 4OUCA 2EB2A 2B55A 3QRKA 4FT3A 4LV8A 4IAIA 4QNYA 4BI2A 4BWXA 4IZ5A 3I5NA 2X2MA 3N51A 4YZCA 4PDSA 3MSSA 2ZB0A 3GGFA 3NDMA 3VUIA 5IDNA 5JFSA 4KKEA 4GT3A 1IAJA 2BRNA 3ELJA 4AFEA 3ORZA 4DH7A 3MV5A 4JOAA 2XANA 4W8DA 5HHWA 2CKEA 2VTPA 4P5QA 4JDJA 1J7LA 2J51A 2ZAZA 2J50A 2W0JA 3PXYA 3ATSA 2QCSA 5CVHA 4FTQA 1OKWA 3RPVA 4DN5A 2F7EE 2R3QA 5HCXA 2EWAA 3EQRA 5HX8A 3K54A 4FTKA 3L9NA 3F5PA 2GDOA 3ZO2A 3QKKA 2Z7SA 3RHKA 3QWJA 2WTVA 1PJKA 4FTJA 4CNHA 3PVUA 4CRSA 4QD6A 1WBSA 4O2PA 1YDTE 1OUYA 4PMMA 4RA4A 1W8CA 4MBJA 2W1GA 4WO5A 5FP6A 4MVFA 5ANIA 1WBOA 2XYUA 4ZY6A 5CALA 3BLHA 4HVSA 3KRJA 4K0YA 3AT4A 1TQPA 3H0ZA 1OMWA 3KKVA 4K6ZA 4ZAUA 4N6ZA 3CCNA 5BVEA 2HWOA 3EYGA 2PTKA 5B7VA 4YU2A 5EKNA 4FIJA 4AE9A 1X8BA 5EHOA 3VRYA 3E92A 4FV1A 1G8KA 2QD9A 2XMYA 3TMOA 4FTIA 3GU4A 4UB7A 2F4JA 3C4XA 3NCGA 4O1OA 3NR9A 3EN7A 4Y95A 4E4LA 4APPA 4G6OA 3LXLA 4C4GA 2W5AA 1SMHA 4GKIA 2XNOA 4JX7A 4DG2E 4O7RA 3W0MA 1OL7A 3I7BA 3W8QA 2OJIA 2NP8A 5K0KA 4E6DA 3JVSA 5JN2A 3FWQA 3QTRA 2WMSA 3R8LA 3TWJA 3QQKA 5AR3A 4RC4A 4IVDA 4Q5EA 2UW3A 2YM5A 2C69A 2QU5A 3BBWA 3KIOC 1H28A 1V0OA 5C01A 4WUAA 3GVUA 4X3FC 1Q62A 1OPKA 2UVZA 3R9OA 4XJ0A 4BB4A 3AC3A 3VW8A 4KS8A 4TT7A 3ML1A 1SZMA 4I92A 4MYGA 4YNEA 5HCYA 4CV8A 3ETAA 3ACJA 3ZEPA 2ZYBA 4RPVA 3LQ3A 1W98A 3TCPA 4EQMA 5F20A 3SW4A 2FB8A 4XLVA 2P2HA 2WTWA 4O82A 3H30A 3KXNA 4IX5A 3Q5ZA 3QRTA 1Q4LA 4DGLC 2XIXA 5LQFA 2BPMA 3DAKA 2R3NA 2UVXA 3MDYA 1UWHA 2OXDA 1MP8A 4I0TA 4O6LA 4YLJA 4U40A 2C1AA 2QHNA 2WMQA 2R3HA 5IISA 4BY9E 1OUKA 4BICA 4UZDA 1VR2A 4NEUA 4QMQA 4F99A 4G3CA 5HCZA 5EDRA 3E5AA 5HI2A 4YHFA 2JBPA 4L9IA 3MA6A 3A62A 4RX8A 2WZJA 2CKPA 2BFYA 3UC4A 4CV9A 4DFBA 3RVGA 3JY9A 3IONA 2YDKA 4FG9A 4I94A 3A4OX 5FXSA 3R04A 2P0CA 4ZS0A 3UYSA 4FIFA 1MUOA 4OTHA 2GFSA 3VUTA 3BIZA 4GS6A 3VS5A 3Q6UA 3C51A 2OH0E 1ZARA 3FE3A 1PMVA 4Q9SA 4UZHA 5DT3A 3RWPA 4BIDA 4C35A 3JUHA 4HOKA 3M1SA 3V5JA 3TUBA 3FI8A 1H1PA 2CGVA 5JZJA 3CKXA 3UO4A 1PMUA 2YIYA 5HBEA 4Z7GA 4DDGA 3L8XA 3DB8A 2JDTA 5CZIA 2R9SA 1OL1A 4JVGA 4RX7A 4BF2A 1A9UA 4QMZA 5DVRA 3QTQA 2PZYA 1E1VA 4O86A 3L1SA 1FQ1B 5A6OA 3UTOA 5AJQA 4RIYB 3UDTA 3UQGA 2R0UA 1XO2B 4C34A 3IQ7A 4EH9A 3P5KA 4RLLA 1IA8A 3D0EA 3F5UA 1M52A 4QTAA 3QXOA 3AD6A 4DAWA 3PSDA 4F9CA 5AIKA 4MBIA 4LGHA 2BFXA 2GFCA 3LAUA 4BCMA 4FSYA 4X2JA 4FV3A 2WOUA 2PE0A 4M0ZA 4D2TA 2PVNA 3IOPA 4XBRA 5M4UA 3MFUA 2VWIA 3NNXA 5I0BA 2EVAA 5BV3A 2WMUA 1ZYJA 2PULA 1E9HA 3DDQA 2G01A 5ETFA 3GU8A 1BLXA 2X81A 4G1WA 3BEAA 4LRKA 5GJFA 4XG6A 4C3FA 4J71A 4PNIA 2JDOA 3RJCA 2PMNX 4TL0A 4GUBA 5M07A 5M09A 3O2MA 4H36A 1S9JA 5AAFA 3PRIA 2XK6A 4OTDA 3EQCA 5JFXA 3BHUA 3BGPA 5IA5A 5L8LA 3HDNA 4FE2A 2O2UA 3MVLA 5HO8A 4JQ8A 2I0HA 3RK9A 4AT5A 4YSJA 1RW8A 4B99A 4C0TA 1O6LA 2AEGA 1KE8A 4Y73A 4WBBB 1P4OA 2J0IA 2WTJA 4ZTQA 5DEWA 4JLCA 3WOWA 3KRRA 4EH7A 5C1QB 2RSVA 4DFYA 1ZRZA 3LFEA 3I6WA 2B1PA 3ZMMA 5IA1A 3CR0A 4QTDA 4HYHA 2Z60A 5A4CA 2O65A 3PA5A 4S30A 3TYKA 3DY7A 3LMHA 4MUQA 4S33A 4D28A 1XH9A 4XBUA 3ZO4A 3FUPA 3TNPC 3ZFMA 5K0XA 2BILB 2QG5A 2B9JA 4F9AA 3VW6A 4CFUA 1UKIA 4ERWA 5TOZA 3F66A 5M4CA 3SA0A 4BKJA 5HIDA 5HO7A 2F9GA 4F6WA 1SNUA 2XP2A 4FX3A 5TT7A 5GZAA 5EK7A 3GFWA 1OM1A 3JXWA 4A7CA 5IA0A 2X0QA 4FKVA 2PZPA 4ACMA 4B9DA 2XUUA 2RL5A 4U6RA 4CQGA 5LVMA 4H39A 5FBOA 3ROCA 1XR1A 5J5SA 2O5KA 3QC9A 4CXAA 5EI8A 3QWKA 4R1VA 4QO9A 3NUSA 4FSUA 2V0DA 3BBTB 3E8EA 5HG9A 4QYEA 4TYJA 2YLFA 4RWKA 2VTAA 3C5UA 5AP3A 3EWHA 2QONA 3IGGA 3E88A 3OT3A 3COKA 4GG7A 3RBWA 3HVCA 3VJOA 3UQFA 2CNQA 3IOKA 3NUAA 4LI5A 4AZWA 2CHLA 2IEWA 4JIKA 4O0YA 1W2CA 4CFXA 4EOKA 3QQFA 4AA5A 3MH3A 1O9UA 2OBJA 4FT0A 5EKOA 3TZ9A 5HU3A 3I6UA 4XP3A 4AT4A 1VYZA 1DAWA 2IZSA 3E93A 4NW5A 4R7HA 1FPUA 3UDZA 4AXFA 3R01A 3B8RA 3G9LX 3NYVA 4HNFA 4S32A 2ITQA 3R8VA 5E8XA 4E4XA 1JKSA 2PK9A 3VN9A 1WBWA 4BBFA 4EUTA 5DYJA 4BJJA 4HPUE 5CLPA 3OP5A 4EONA 2JBOA 2IW9A 3AGMA 2GQGA 2WU6A 4ALWA 3MYGA 4CFFA 5JFWA 3H10A 2FH9A 4RIXA 4D9TA 3MN3A 2JGZA 4GRBA 3AKLA 2R3GA 3QCSA 5DWRA 1NT2A 4ZSLA 5CVFA 3HMOA 5L6OA 4L01A 2FGIA 4IFGA 2HWPA 3WBLA 3I5ZA 2HCKA 4FNZA 4F9BA 2XK7A 3UE4A 4GV1A 3OY3A 4FKTA 2W96B 4BBMA 4BKZA 4DG3E 3LFNA 1TQMA 3R0TA 5A6NA 3GU6A 3P23A 1JPAA 3D15A 4K18A 3IDPA 1XBBA 5JMSA 4QTEA 2VTIA 5BMSA 4RZVA 5ACBC 5BVWA 4DTKA 4DEAA 5IUGA 2WTCA 2QKWB 3FMLA 3TDVA 1PMNA 2BZIB 1BUHA 5CEN