4JRVA

Crystal structure of egfr kinase domain in complex with compound 4c
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
324
structure length
300
Chain Sequence
GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELTSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDDMDDVVDADEYLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Protein Kinase Inhibitor Design by Targeting the Asp-Phe-Gly (DFG) Motif: The Role of the DFG Motif in the Design of Epidermal Growth Factor Receptor Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
total genus 86
structure length 300
sequence length 324
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4jrvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4jrvA01
5AEPA 5CVHA 1Z57A 5FTGA 2HZ0A 4USDA 4NW5A 3K3JA 3CXWA 3MSSA 5AP4A 3WF9A 4H05A 3DCVA 4EK6A 1SVHA 4FIHA 3V51A 3EMGA 2F2CB 3FQEA 4FTIA 2XZSA 5FEQA 2OZOA 4ALVA 4CD0A 3KF4A 3KQ7A 5FEEA 3ODYX 4CFWA 2QLUA 5M51A 3RMFA 5GINE 1XHAA 3PSBA 3LJ1A 4L46A 4YSMA 3MIAA 4AZSA 2VWWA 3QTXA 2FO0A 2JDRA 2VWXA 3PP1A 4DITA 4ANLA 1J7IA 4JBVA 5TO8A 3ORKA 4I23A 5L6WL 3BYUA 2XNEA 3NYVA 4B8MA 1ZXEA 3EQDA 3QYWA 1FMOE 4FK3A 4IMYA 4F9YA 3R9RA 2CGUA 3ZBFA 2IW6A 4F64A 3TNPC 3UOKA 2JD5A 5TOZA 3LIJA 4DHFA 5AX3A 5FUTA 3IOPA 2ITXA 4ENXA 3R2BA 3FI2A 4BWPA 3CTJA 2WMBA 2IW9A 3E87A 3M11A 4MYGA 5F20A 4PPBA 1XO2B 3OTUA 3F69A 1SMHA 5KKRC 3TACA 3LFNA 4LM5A 1CKPA 4YZBA 3MI9A 4U9AA 1OM1A 1Q99A 1OVEA 4Q9ZA 3D7TA 2ERKA 3CQUA 4FV0A 1JKSA 4XLIA 3VWAA 4E5AX 2IN6A 3BELA 3EZVA 3LQ5A 4NFMA 1ZZ2A 2QNJA 4RZWA 5TE0A 3LZBA 4LUEA 5AR7A 5CAPA 2W4KA 2UVYA 3AMAA 1BKXA 4DG2E 3QXOA 4UYNA 2YCSA 3W55A 4F70A 5BVNA 2PE2A 2HK5A 3UP2A 2PMLX 3R8UA 4O7LA 3F5XA 4Y73A 2ZV8A 5L2WA 2BFXA 3G15A 3IKAA 3P08A 3T3VA 4H3QA 2QC6A 4PDSA 2O65A 4MQ2A 4FIGA 3S95A 4BCPA 2DUVA 4PMMA 2BAKA 5L8JA 3R83A 3QD3A 5F4NA 4HW7A 3VUIA 3FE3A 3P23A 4BDKA 5LVLA 2YLFA 3VJNA 2RSVA 4R1VA 2PVFA 3NR9A 4GG5A 4F1TA 5C8KA 3W2OA 3ZRMA 3OCBA 4FT0A 4F7LA 4MNEA 1H1RA 5HO8A 4C59A 1YHVA 1Q8YA 2WTWA 3PA5A 1QL6A 4CFNA 5IMXA 3GGFA 4QYGA 4KIQA 3UG2A 4PMSA 4AA5A 2P2HA 5LMKC 4X2KA 1E1VA 1MRYA 3LJ0A 4QP4A 3V8WA 4F99A 3IW6A 4D4YA 1UU3A 2C0TA 4I94A 3LQ8A 3GXLA 3TKHA 4FZAB 4CZYB 4QP3A 4EONA 4FG7A 5J7HA 4GIIA 2J50A 5C26A 2EXEA 4FVRA 3DKOA 1G5SA 5H8EA 3EH9A 3GU5A 3WI6A 3PPZA 2CN8A 3FJQE 4LL0A 5DG5A 5TKDA 3UIUA 5BMMA 3HKOA 3D15A 5HX8A 3IGOA 3E64A 5ANKA 3AC8A 2WQMA 5ANEA 4EZ3A 4U3YA 4RFZA 4CMOA 2RKUA 4EOJA 1IRKA 4L52A 3MTLA 5CI7A 1ZOHA 2YDJA 5L4QA 3NS9A 4FOBA 3Q6UA 5CYIA 3R0TA 3HDNA 4YJQA 2PMOX 3ORIA 5HCZA 4EUTA 1XH7A 5AWMA 3A7HA 3Q4TA 4RVLA 1NY3A 2RGPA 3UBDA 3DAJA 4DH7A 4LGGA 2ZVAA 1Q61A 4JS8A 2XEYA 4A9SA 5BVWA 4FTAA 3SG9A 3OWLA 2VWIA 3C7QA 3BYOA 3GCPA 1GJOA 3NUPA 3QKKA 3TZMA 5ITAA 2IWIA 1IAHA 5LVPA 1KV2A 5DEWA 4UZHA 5H8BA 1YWRA 1YXTA 4PDYA 4EOKA 3ZFMA 4F7NA 1ZMUA 2R3FA 3F2AA 2OW3A 4LG4A 2GHMA 4GVJA 5EW8A 3VUMA 3R7VA 2XRUA 3EQGA 3BCEA 3GP0A 2VO3A 3DQWA 2OF4A 1YQJA 3CY3A 5EKNA 5EOBA 3I6UA 3V04A 5CSVA 4DEIA 3R9NA 3E8CA 3QYZA 3DK6A 5JKGA 4UXLA 4ZLYA 4BCQA 3EQFA 3GCSA 4IAIA 4M7IA 4XUFA 5KMIA 2XA4A 3JY0A 5I9ZA 4HPTE 4U41A 5CVFA 4GJ2A 5ANGA 3L8SA 4YTIA 4AN9A 4I5PA 3DT1A 4NSTA 5IQAA 4MBJA 2WMRA 4IHPA 3QA8A 4USFA 2QOHA 3VS7A 2R7BA 3NUUA 1FVRA 3BYVA 3QTZA 2XJ1A 3W8LA 3EYGA 3MIYA 5E8VA 2XK7A 1J3HA 2VO0A 3HVCA 3SXSA 3BLQA 3TIZA 1LR4A 3P7AA 2JKOA 3DAKA 1FBNA 4BCFA 5AV3A 4ZLOA 3FY0A 3FSKA 4BZDA 1XWSA 3EQCA 4U0IA 5AR4A 3QQHA 4BTKA 4WUAA 5HX6A 1YW2A 3AC5A 1F5QA 4G2FA 4XG3A 3VBWA 1NXKA 2QOFA 3DDQA 5CAUA 4C36A 5BYYA 1Q4LA 4EUUA 3UOHA 3PFQA 4RIWB 2W17A 3UQGA 4TXCA 3PPKA 3S1HA 2VTHA 4FE2A 2IO6A 5L2IA 4IANA 1M2PA 4R78A 3COKA 5HVYA 1F0QA 4JJRA 1V0OA 3D94A 5LCKA 3W2QA 4C3RA 3V8TA 3CLYA 4U3ZA 4Y46A 4PMPA 4K0YA 3NCZA 2XIZA 3COIA 3FKNA 3H10A 3QQKA 4NM3A 5A3XA 5CXHA 5EHLA 4J95A 3W32A 1UU9A 2WMTA 4AT5A 3UPXA 2XYNA 4FV5A 3S3IA 5E1SA 3I5ZA 4X2FA 2JBPA 4UXQA 1SYKA 4XG4A 4IAYA 2XK4A 3R1NA 4YZCA 4YHFA 4NU1A 3RK9A 3D7TB 5M44A 3DZQA 1GNGA 2QG7A 3D2KA 2GQSA 4G9CA 3TNIA 3PJ3A 2C5OA 4BDJA 3H3CA 2XIXA 2PZRA 3FYJX 4G5PA 2LGCA 2JAVA 1K9AA 1JPAA 3C0IA 3CC6A 3QGWA 5AR2A 4RVMA 3SDJA 1PMVA 2OWBA 4J99A 4B99A 1OL6A 2JFMA 5JK3A 5CNNA 2YM6A 3MH3A 2WIPA 5HICA 2AC5A 2Z7LA 4HVIA 5BYLA 1FMKA 5DA3A 4DEAA 3LFCA 5HNBA 4ZY4A 4WKQA 5EKOA 3QRIA 5AUXA 4AG8A 3DB8A 1SNUA 3MESA 2QI8A 3CS9A 3LJ2A 1JQHA 1XBBA 4F08A 3QX2A 2UUEA 3E88A 3JUHA 2JDSA 4BBMA 3C4EA 3RJCA 3HV5A 2I0HA 4R5YA 4G17A 5FEDA 4U79A 2HZ4A 3TZ9A 1YDRE 2PMNX 4MBLA 4RIXA 4KNBA 3FWQA 3RINA 4AFEA 4B4LA 4BGHA 3OT8A 5M09A 5CXZA 3GNIB 4L43A 3OEZA 4G3GA 2QU5A 3OOGA 4BI1A 1IAJA 4FICA 3A7FA 4JRNA 1YRPA 2CHLA 4CYJA 3NW5A 2XK6A 4A9RA 3ODZX 5LVMA 4OT6A 1YXUA 2XS0A 1W82A 4S31A 2EWAA 2PVKA 3HL7A 2WTIA 3GUBA 3P9JA 4G3CA 3GC8A 3R1YA 3FZOA 5DN3A 5IUIA 3FLQA 3TI1A 4RQKA 4PP7A 3PP0A 3ZMMA 5M4CA 2GQRA 3D5XA 4YTFA 4U8ZA 4XG2A 4CRLA 3BLRA 3D2IA 4L53A 4FEXA 5EQEA 3A7JA 1YWVA 1O9UA 3MY0A 2W1HA 4MXOA 2YJSA 5IF1A 3QWJA 2O5KA 1U54B 4G3EA 3ZFYA 2UW8A 2VD5A 2BDFA 3R7IA 1GY3A 2BRBA 2JKMA 2PVNA 5J9YA 4CLJA 5IH6A 4XH6A 4FL2A 2OXXA 2YHVA 3DAEA 3L9LA 2R3MA 3KK9A 1UNHA 4FSYA 4JDKA 4NKAA 5HGIA 4ZTLA 5ETFA 2V5QA 4CTCA 2R3OA 4Y83A 3NNXA 2W96B 4FKGA 2F7ZE 3VS6A 3FZRA 5BVFA 3MFTA 4EOOA 2XNBA 4F9CA 4USEA 3O51A 3QL8A 4JG8A 1Q8UA 3ROCA 4ARKA 5IDPA 1G3NA 5HIEA 3VF9A 2V55A 4TL0A 1ZYLA 3NUNA 4E4XA 5HTBA 3UMWA 2W5HA 3HDMA 3DKCA 4UMQA 4HGEA 3GEQA 4AZWA 4DH3A 2J0KA 3PG3A 3ZDUA 2IZUA 3KN5A 4EH5A 4YTHA 3FKLA 5I9YA 1YI4A 4YO4A 5GJGA 3GC0A 4IAFA 5C27A 4M0ZA 3KXNA 2A27A 5M08A 4D9TA 3SV0A 4K2RA 4WBOA 4LFIA 4E20A 1GAGA 1DI9A 2VTJA 3QQUA 2QOQA 3K2LA 4GV1A 4FKSA 5DH3A 2ITZA 4QTAA 3FY2A 5HU3A 3I7CA 5HESA 3FLWA 3ORPA 4W4YA 4TYEA 4DBXA 1PJKA 2GTNA 4BCKA 3HUBA 3CKXA 4YU2A 2ACXA 5HZNA 2PTKA 4C33A 5IMEA 3CGOA 3KKVA 1A48A 2ZMCA 3QFVA 3I7BA 2PSQA 3ZM4A 4IC7A 2O64A 1DM2A 4QMXA 4ZZNA 3W8QA 4GK3A 3T9IA 4BGQA 5KUPA 5AA9A 4BCGA 4IJPA 5D9HA 4UN0C 1PXIA 1R3CA 3GBZA 2H96A 5IA3A 3V5TA 4CVAA 2VZ6A 4PL3A 5H2UA 5CAOA 3A62A 4IDVA 5A4QA 3U55A 4FT7A 4OBQA 3LFQA 3MBLA 4X3FA 3HRFA 1JAMA 1LPUA 4CGAA 4O96A 4C0TA 3KGAA 4NYEA 4FTTA 2P0CA 4EC8A 5KX8A 2BROA 2OJJA 2WELA 1UNLA 4P2KA 3ZLYA 3FEGA 3QZGA 1YHSA 4MXAA 4OTQA 4MK0A 4NWMA 2PYWA 2JC6A 4IC8A 4CQGA 2R0UA 5DPVA 2BKKA 2C5YA 2JLDA 1Q3WA 2XIYA 3OG7A 3HEGA 5DI1A 1KE5A 4FSWA 3W2PA 4ACCA 4HJOA 3DPKA 3DJ5A 4AW2A 5FBNC 3K5UA 4YJVA 4JQ7A 3RWPA 4JIAA 5LJJA 4I1ZA 5IKWA 2W1EA 1YKRA 1H26A 2BRMA 4TZRA 5D11A 2XBAA 1PXLA 1Q8TA 2ZV7A 1VYWA 4QP9A 4PTGA 4HGLA 5IA0A 3EL8A 4GJ3A 3EL7A 4UWCA 1IA9A 5KMNA 3EN6A 1ATPE 4YJUA 4DFBA 4EQMA 1Y6AA 2OKRA 2A0CX 3SAYA 2HYYA 3G0FA 4EKLA 3DJ6A 4C4HA 5L2SA 4EH6A 3RGFA 4AGWA 2PVYA 2R3GA 4U7ZA 4JXFA 4YC3A 3RI1A 3WOWA 2YAKA 3FXXA 4GYGA 3F5PA 4QMVA 4FVQA 4ACHA 3FBVA 3MVHA 2ZM4A 2BHHA 3VC4A 1MUOA 1ZARA 4FTKA 3R71A 2WMXA 3RBWA 2XH5A 4EOIA 5DOSA 4NTSA 4YPDA 4RZVA 3VW8A 3DTWA 1TQPA 4E5WA 2BR1A 2HY81 2XIRA 1H00A 3U9NA 2J4ZA 3R6XA 4YNOA 4PRJA 4TWPA 4GG7A 3UZPA 5F1ZA 4QT1A 4NL0A 3BBWA 3BWJA 3IW8A 2VTOA 1KOBA 2I6LA 4EBWA 3SRVA 3AT2A 3FZSA 3O8UA 5L2QA 2CJMA 2YABA 1YXSA 2GS7A 3AGLA 3W33A 5EDRA 3EFWA 1OL1A 4RJ8A 2REIA 4QMZA 3C5IA 2R3LA 1UKIA 2O2UA 3C4FA 2Q0BA 1KUTA 1U5QA 4G3FA 3UO6A 3C4WA 5AADA 4OTIA 3GFWA 2F7XE 3R2YA 4D58A 5J5SA 5GIPE 1HCLA 2HAKA 4YNEA 3VS5A 3ZHPC 4EZ7A 4YPSA 4M69B 4TYHB 4C02A 2GSFA 5A9UA 1Q41A 3D0EA 2E2BA 2J90A 4A9UA 2V0DA 4KUJA 5CEPA 3RCJA 4FTMA 4F1OA 3OCTA 4CV9A 2C3LA 2Y8OA 4H1MA 4I20A 3Q2JA 2YDKA 2PZPA 3U4UA 4DG3E 4Y5QA 4AAAA 4ZTRA 2QO9A 2CKQA 3IGGA 3IECA 3HV7A 4FI1A 2YIQA 3A61A 2UZUE 3MH1A 2R3PA 4G9RA 4XOYA 2RG5A 3SC1A 4D9UA 4EH9A 1SNXA 5M4IA 3UQCA 4DCAA 3TZ8A 2JIVA 3ZSGA 2BAJA 4AS0A 2Z7RA 4BDHA 4XHKB 2X2LA 4J7BA 5FBOA 3R00A 4F09A 3IPHA 4K33A 4QOXA 2YZAA 4KS8A 5KE0A 4BKYA 3CIKA 1Q62A 3OBGA 3OT3A 4GT3A 4TWCA 1CTPE 4ZJIA 3LE6A 5ETCA 2CLXA 3OWJA 4Y5HA 3EWHA 2W9ZB 2XB7A 2WEIA 3BYSA 4FG8A 3CSVA 1TKIA 2VN9A 4ZMFA 3NWWA 2XK3A 3UIXA 3SGCA 3O17A 3ETAA 3MYGA 1VR2A 1IG1A 1P4OA 5E8SA 4ENYA 4DA5A 2JAMA 3A60A 3PIYA 3KCFA 3AC4A 4ZZOA 3AT4A 3OD6X 4BC6A 2WHBA 3GCQA 2PY3A 4KS7A 5AJQA 1I09A 4GFGA 5IQHA 1JKTA 2J5FA 3GOKA 3MV5A 5EDPA 4YP8A 4F0GA 5JSMA 4O7TA 2XUUA 4XLVA 1R78A 4O27B 3UYSA 5HBHA 3BHTA 3R8ZA 2X7FA 3I60A 3PSDA 2J0LA 4JR3A 1JBPE 3D14A 3PY1A 3QHRA 5IDNA 4FUYA 2BZJA 2DQ7X 2QVSE 5HNIX 2F7EE 3FPMA 4GK2A 1HCKA 1Q97A 4MXXA 4CFUA 4R7BA 4F9AA 3BQRA 4YJPA 4I5CA 4ZTNA 3VBYA 1R39A 3HYHA 4M14A 1JSUA 4C7TA 4IWQA 2QG5A 4FC0A 4D0XA 4KSPA 2VTLA 1RJBA 4DFYA 4N57A 3ULZA 3WZKA 3KXXA 4XBRA 4LGDA 5E8TA 3NMUF 4C34A 1UU8A 2C5VA 3NW7A 4BZOA 4DEHA 4EK4A 4QMLA 3V5WA 5J95A 1H27A 2OJ9A 3UVQA 1PXPA 2DS1A 4I5MA 2A2AA 5HVJA 3FMKA 2FSMX 3RM7A 3G51A 3AC2A 2W5AA 1KV1A 3HMNA 2GCDA 2QHMA 3LCSA 3NUXA 2GDOA 5CALA 4O7YA 3OTVA 3Q5IA 4Y72A 2DYLA 2GS6A 5FGKA 4DN5A 3LMHA 4KIKB 3GCVA 4I0SA 4GVAA 4D1SA 5E90A 4TW9A 3SXRA 1P2AA 2WOUA 3TCPA 2C3JA 2BDJA 4F6WA 4A9YA 3OXTA 4I41A 2J5EA 4UWBA 3RWQA 4LL5A 1A06A 3FMLA 3NCGA 4LRMA 4BTMA 5HIDA 1M52A 3NW6A 4L9IA 4YZNA 5HG9A 3RTPA 3PJ8A 4N6ZA 2IW8A 3UYTA 4E6DA 4PNKA 5LCJA 4DEEA 5IQGA 4HVSA 1WBPA 3BEGA 1FVVA 4L00A 4QTBA 5AR3A 2B9IA 4FSTA 4BCNA 4W4VA 3G2FA 4M15A 3SXFA 1REKA 4L45A 3OY1A 4UB7A 3POZA 4EKKA 2HW7A 3TT0A 5IA4A 3DBDA 4IWOA 1JSVA 1BYGA 5J87A 2I7QA 2RFSA 3QD4A 2C4GA 3OWKA 3N51A 5G6VA 1IASA 3N4UA 2X2MA 4DTKA 4U80A 1YDSE 3UGCA 5BQ0A 5M4FA 1NA7A 4BDEA 4IW0A 5JRQA 4PDOA 4NZWB 4QMPA 3LQ3A 3KY2A 3HA8A 2JFLA 4IVAA 3VF8A 4ERKA 1K3AA 4CG9A 4QYYA 4I92A 4JAJA 3EQRA 2QQ7A 1OITA 5EQYA 4NJDA 3B2WA 2C6KA 4FZDB 1GIJA 4A7CA 3LHJA 3VS4A 3KULB 1OGUA 5BVEA 1OL7A 5EM6A 2J6MA 5HE2A 5EHYA 4TYHA 3PXQA 1UNGA 2RFEA 2QURA 3QUDA 5LWNA 4RIOA 5H8GA 1QPEA 4BBEA 2BRNA 2GHLA 4J97A 4WG4A 5GNKA 1KE7A 2YCQA 5HNGA 4TTHB 4Q5HA 4KIPA 3LMIA 3QUEA 5FP6A 5M55A 2CNVA 1KE8A 3LCDA 3DB6A 3F82A 2OH4A 3C13A 5I9UA 4KRCA 5HBEA 1KWPA 4JBPA 2ITNA 2SRCA 3AOXA 4ZSGA 3LM5A 4ZXTA 1CDKA 4O7NA 4O1OA 4X6QC 4FG9A 5TR6A 4WO5A 4QMNA 2GFCA 3AG9A 3BHYA 3QTIA 2W05A 2XVDA 3HV4A 4HOKA 4M8TA 4P90A 1FQ1B 2Y7JA 5CTPA 4C4GA 5K4JA 3IK3A 3I0OA 4AUAA 3QCYA 4L68A 2CNQA 3RAHA 1UWHA 5I9WA 2W1CA 1V0BA 4JDJA 4YC8A 4IADA 4CV8A 5I0BA 4WIHA 1OPJA 1WZYA 1Q3DA 5A14A 3VVHA 3PZEA 4I21A 2ONLC 4I5HA 2CDZA 2VTAA 5EW3A 4BY9E 3QF9A 5HOAA 5A4EA 2VO7A 1TQIA 3PIXA 4QYFA 3KRWA 3MH0A 4DGLC 3MA3A 1W98A 3BWFA 3G0EA 3ORXA 3U6IA 4YBJA 2XKEA 3HECA 3O23A 4O0VA 2OJGA 3ZRKA 3VO3A 4RRVA 3W1FA 2W99B 5HG5A 4MD8E 3GB2A 5L8LA 3EHAA 3N9XA 4XG7A 5ETIA 4HNIA 3H0ZA 4BB4A 5K5NA 4O22A 1PYEA 2H8HA 4Q9SA 2C3IB 3BPRA 4EK5A 2XKDA 2VGOA 1XH6A 4IX5A 4BDAA 3HGKA 3PZHA 3LFFA 4OUCA 4L3PA 3PXFA 3QTRA 4OTPA 1WBSA 1YWNA 3OCGA 4O0WA 4RSSA 2WMWA 4BI0A 2UVXA 5AMNA 3O8TA 4FKWA 5AV2A 2RFNA 2JGZA 3T3UA 3BE9A 4MBIA 3O8PA 1Z9XA 4ZTMA 4IWPA 1MQ4A 5IH5A 2QODA 5FTQA 4YJTA 3RAIA 3ZZWA 3IS5A 2VWUA 3KXHA 4HZRA 4CSVA 4DBNA 2WIHA 3KRRA 4FKVA 4FSRA 2OIDA 4KRDA 3R8MA 1PF8A 3FMHA 3QQLA 5M06A 5HI2A 1PXOA 5CSHA 3PLAE 1FINA 4DEBA 3L1SA 2VTQA 3V6SA 1WVXA 3HMIA 5CU0A 2R4BA 2JDTA 4C35A 5EYKA 4GUEA 5CANA 4ASDA 4RFMA 5AP5A 2WZJA 4LYNA 1KE6A 3MN3A 5AP6A 5F95A 2JBOA 4LI5A 3U4WA 2IZSA 3KULA 3MVLA 4N6YA 2QCSA 3O0GA 5GJDA 4QPAA 1OIUA 2XMYA 4XRJA 2VAGA 2WXVA 4BDCA 3DU8A 5J9ZA 4KD1A 3LXKA 2G2HA 2NO3A 2X4ZA 4H36A 4RJ5A 4AA0A 2XF0A 3SD0A 5M4UA 1UU7A 4RQVA 3Q9WA 2HELA 3IDBA 4KB8A 3A4PA 5DT0A 5IH4A 3HAMA 3C9WA 4HZSA 5I5ZA 4IB3A 4LMNA 4CLIA 2PZYA 4FNZA 5K9IA 3LFDA 3CGFA 4EWQA 2WTDA 3DKFA 2C0OA 4JNWA 3VBVA 2J2IB 1CKJA 4X3FC 4X2NA 4XOZA 3PVUA 4O7VA 2XNNA 1PMUA 4LV8A 4BTJA 3OXIA 3WYYA 3ITZA 4ZSLA 5J8IA 4F63A 4L3JA 3SW4A 3MJ2A 4IVDA 2QKWB 4NUSA 1SVGA 3DNDA 3ZYAA 1FOTA 5GZAA 2CN5A 5CWZA 2HCKA 1MRVA 2O8YA 5CY3A 3B8RA 3EQBA 1V0PA 5EYCA 4KIKA 5CT7A 4GT4A 3B8QA 4FKPA 5AP7A 2BIYA 3BBTB 2R5TA 1W84A 1HOWA 4EHGA 3TTJA 1W8CA 3GU7A 5IPJA 4IAZA 4EYMA 3ACJA 3WZUA 3WF5A 2B4SB 5BVOA 4D55A 4BCJA 1JNKA 5D7AA 3SQQA 4NEUA 2GPHA 1U4DA 2ITTA 1OL2A 3LXPA 2IVSA 3EQHA 3F5GA 3MJ1A 4OLIA 4YJOA 3VJOA 4BDFA 4R1YA 5KMKA 4FT5A 3CQWA 3KF7A 4RX9A 5D1JA 4DFUA 2VTPA 3Q6WA 2ZDTA 4S32A 2OFVA 3G6GA 2YM3A 4Z3VA 4MWIA 5AP0A 3PRIA 1OIQA 5L2TA 4BL1A 3F3TA 4XRLA 3OC1A 3P86A 4X7QA 1OUYA 5DR2A 2UZDA 4FT3A 2X1NA 3R21A 5B2LA 4RIXB 5JQ5A 3NUAA 4DT8A 3LAUA 4E6QA 4AOJA 2PK9A 5CQWA 2E9PA 3VNTA 3ZO4A 5LMBA 3UVPA 4ACDA 4B8LA 2E9NA 1YOMA 3PXRA 4FIEA 3NIEA 3OROA 4S30A 5D41A 4WOVA 4ASEA 2G01A 3F2RA 4N4SA 2OXDA 4D5KA 5CEKA 1O6KA 1T46A 3TUDA 1FGKA 2OGVA 4LUDA 2W1IA 4LRKA 3ZOSA 1GZNA 3E3PA 4R77A 3EFJA 1PXNA 2QOIA 3QQGA 4O2ZA 2PHKA 4E4LA 3I6WA 2OLCA 5J1VA 1NVRA 2YEXA 2RFDA 2CGWA 5CEQA 3UP7A 4EK3A 3LPBA 1P5EA 1XBCA 4XBUA 4DE4A 2PUUA 3IW7A 3O96A 3H9OA 3UC4A 4O0RA 3F6XA 3M2WA 4X2GA 3RHXA 4DLIA 2DWBA 3W2RA 4QMYA 2J7TA 2UW6A 4MWHA 1BX6A 4FK6A 1ZYCA 3KCKA 2CKEA 2W0JA 2QONA 4W9XA 2YM5A 4RVTA 2GNFA 2JIIA 3GCUA 3MPAA 4D2SA 2QOCA 5HCXA 2X9EA 3HMPA 3LXLA 3Q9ZA 2ZDUA 3E3BX 3NYXA 5KCVA 4BDIA 3OS3A 1AD5A 4RC2A 2YISA 2WGJA 3CBLA 4H1JA 3RKBA 1SM2A 3ZLSA 1QPDA 4RG0A 4RLKA 5FM2A 3RP9A 2X6EA 3QGYA 4JRVA 3F3VA 4IX6A 1V1KA 3JPVA 3U6HA 3Q52A 4TT7A 2WQBA 5I3OA 2ITYA 1WMKA 5K4IA 3NLBA 4TNBA 4ZIMA 4BDDA 3P5KA 4FV6A 3THBA 5AUUA 4HGSA 3KC3A 3FMEA 5DR6A 3IDPA 3SA0A 4QRCA 3TM0A 4L67A 4MF1A 5CASA 3AQVA 5KBRA 5B0XA 2VTMA 3NEWA 4MCVA 2BKZA 4JT3A 5E9EA 2G1TA 3QKMA 1GIHA 2ZM3A 1U46A 3NUYA 3L9NA 5F94A 1M17A 2AYPA 3D4QA 1YHWA 1TQMA 3R8PA 3QRKA 4QQ5A 3PXYA 4MVFA 5EG3A 2LAVA 2B53A 5LQFA 4O0YA 2BILB 2Z02A 3C4XA 4CRSA 2UZNA 4AN3A 3MFRA 2RG6A 4BRXA 3OWPA 3P7CA 4I93A 4YGAA 4FODA 2IVTA 3DXNA 1K2PA 1J1BA 3DLSA 5DBXA 5AAEA 4RFYA 2W4JA 3SLSA 3R7UA 3V5LA 4BIEA 4I6BA 1XH9A 3ZEPA 4RX8A 2ZOQA 1OZ1A 3QCSA 5JZJA 3MTFA 4IM3A 2XNPA 3FUPA 2XK9A 3IW5A 4R3RA 4BN1A 1LP4A 5IEYA 1B39A 3KA0A 1G8SA 2ZV9A 3NPCA 5CEMA 3C5UA 4C4EA 5K3YA 4EOSA 4QPMA 5HVKA 5G1XA 2YM8A 3CTQA 3NRMA 2HZNA 3FL4A 5HU9A 3E92A 2ITOA 5JH6A 4GKHA 3V6RA 3PA3A 2FVDA 4YJNA 3G9LX 5FDXA 5JMSA 4ZAUA 4MAOA 5E1EA 3MWUA 2Y4IB 1FGIA 3II5A 3ORLA 4V0GB 2YJRA 5LVOA 4QPSA 2I0EA 2WMSA 3LM0A 2Z8CA 3COMA 4FA2A 1WBTA 4CTBA 1ZLTA 1JSTA 4PNIA 4XP2A 3LVPA 2ETKA 2NP8A 3MPTA 3TJDA 3LMGA 1AGWA 4KINA 3ZTXA 2H6DA 1EH4A 4DYMA 1BL7A 4HCTA 4ZJJA 2R7IA 4RC3A 1Y8YA 4D2PA 3FZPA 4B7TA 4C37A 3PDTA 3ROYA 2GFSA 2EUFB 2UV2A 2E9UA 2VTTA 5B2KA 3LKMA 2YLEA 4OAVB 3AD5A 3U54A 2UW9A 4QO9A 5IZFA 3JVRA 3EIDA 3U6JA 5C8NA 3I81A 1WCCA 3QZFA 5TT7A 4RWJA 3WZEA 3HA6A 4DGNA 4UMPA 1GZ8A 3OHTA 2P33A 4NM7A 4WNOA 3ZSHA 4X3FB 3QTWA 4DF3A 4EBVA 2F57A 3ZBXA 3WYXA 4OGRA 4QP2A 2ESMA 3UODA 4AGCA 2GHGA 3ZH8A 3RAKA 3U8WA 2X6DA 3QWKA 2R3QA 4BCIA 2PVJA 2YFXA 4OTFA 3OUNB 4BBFA 3DFAA 2VO6A 3AT3A 4O1PA 4ZSEA 5LMAA 4O38A 4JQ8A 4OBPA 5CVGA 5FLFA 3MA6A 4E5BA 4EH8A 2QHNA 1ZMWA 4YLJA 2XEZA 2QR8A 4AE6A 3UZTA 3CR0A 3RHKA 5ANIA 3FL5A 3HRCA 4JI9A 3E7OA 3PSCA 2CSNA 4BCHA 2YIRA 3OBJA 2Y0AA 1RDQE 4I0RA 3ZZEA 2PWLA 4IAKA 4KKHA 2BCJA 4FKIA 4ANQA 3JXWA 4EYJA 4NH1A 5AR5A 3FLZA 3VRYA 4BVUA 4WT6A 3ET7A 4MTAA 5AR8A 5DRDA 2C47A 3F3WA 4YJRA 4DG0E 5CU4A 4X2JA 3QTUA 5JGDA 4YURA 2VU3A 4GUBA 4PY1A 4TPTA 2YWVA 4Z55A 5KKRB 5TF9A 4TRLA 4EI4A 4E7WA 3H4JA 1U59A 3R1QA 3HX4A 4I4FA 4BHZA 3MDYA 4L6QA 1NVSA 3FLYA 4IB5A 4IVBA 3PUPA 4GH2A 4XMOA 4BWKA 1RE8A 4GIHA 3AC1A 4BYIA 1OKVA 2R2PA 3R22A 4FT9A 3CPBA 2C3KA 3BU3A 3LCTA 3GQLA 3JYAA 2BDWA 2B54A 3NNUA 3WILA 4GU6A 2HY0A 1S9JA 3W10A 4L42A 4FKTA 1XR1A 4FSUA 4U40A 5FRIA 3ZUTA 5J1WA 2YM4A 3DBQA 2H9VA 4AF3A 2RIOA 4BTFA 4RA5A 4YMJA 3WE8A 5GZ8A 5C8MA 4IEBA 3FDNA 3ENMA 3HP2A 3ERKA 2F9GA 3OOMA 5FXQA 1UV5A 3KREA 3A4OX 2IVVA 3DFCB 3LFSA 3PVWA 5DNRA 4QMUA 5IA5A 3VQUA 4F6SA 4CT2A 4RT7A 2AC3A 3VW6A 3UOJA 5GIOE 4JG6A 4APPA 2BTSA 2EU9A 2JDVA 5AX9A 4FTNA 5L6OA 3OP5A 1WVYA 4FSMA 4P5ZA 4PMTA 3UIBA 3UG1A 3KU2A 4HCVA 3QX4A 4YZ9A 2B0QA 3RALA 4BHNA 5CLPA 4CMTA 4E4MA 2X4FA 2G2FA 1W0XC 4CKRA 4AT4A 4C57A 2NNWB 3TWJA 2YM7A 5FXRA 2B1PA 2J0JA 4U45A 4LMUA 3NX8A 3R7YA 4AN2A 2ETRA 4QQJA 3TN8A 2HOGA 2WB8A 4KSQA 4F7SA 3Q53A 2OJFE 4S33A 4A4XA 2NRYA 5H9BA 3TKIA 4G1WA 2CGVA 4APCA 1CMKE 4UMUA 4DTAA 1XKKA 2OH0E 5HO7A 2QOBA 3VHEA 3CKWA 4D4VA 5DVRA 3EN7A 4LQMA 3NGAA 4WNMA 4GSBA 4TNDA 4YBKA 4X3JA 4AW0A 4W4XA 4AT3A 4Z16A 5HQ0A 3VIDA 5JGAA 3TDWA 4ZK5A 4IH8A 4IZ7A 4BKZA 2YCFA 3L9MA 4YLLA 4D2WA 4HVGA 2BRGA 4D2VA 3KN6A 3FHRA 1QPCA 3C4ZA 5CU2A 3TUCA 5A46A 1GOLA 2R3HA 3O7LD 3QZHA 2P4IA 5CEOA 1Z5MA 3BE2A 5AM7A 3CY2A 4AW1A 4IBMA 1WBWA 4ZY5A 3TKUA 4L7FA 3HLLA 5EYMA 4IQ6A 4DTBA 4D1XA 4IM0A 1P4FA 5KMMA 2CGXA 5CX9A 3LLTA 3EOCA 4EQCA 4LRJA 4BIDA 3FC2A 1H24A 4YLKA 3UTOA 1NVQA 2WMQA 3R01A 4UMRA 5BVDA 1PXKA 4MD9E 4F9WA 2OBJA 3DBCA 4FKUA 3DOGA 3OY3A 4KBAA 4QNYA 4AW5A 4F7JA 4C2WA 4O2PA 3QRJA 3BQCA 4IM2A 3VHKA 3KVXA 4XP3A 4DFZE 1OIRA 2C6LA 2CNUA 3Q9YA 5HD7A 2B9FA 2W5BA 3DTCA 5KZ0A 5JN2A 2ZJWA 4B9DA 3E62A 4YHJA 2I1MA 5A4TA 3CD3A 3OZ6A 1RQQA 2UZWE 3F88A 3L9PA 4FV2A 4G6OA 2GNHA 3OXZA 4I6HA 4ACGA 2OXYA 2GS2A 3VBTA 4DFLA 2IG7A 5M53A 1F3MC 1J7UA 4XNEA 4HVDA 4P4CA 2VTSA 3KRJA 2WTKB 2X39A 3ZC6A 1WVWA 4A9TA 4AX8A 3HUCA 3DY7A 3ZO1A 1H0VA 3TIYA 2A4LA 4KIOA 3DA6A 2WTJA 4NIFB 2P2IA 5JFSA 1PXJA 4C3PA 3FMDA 5E92A 4E4NA 3F2NA 3TUBA 1YVJA 1UVRA 3ENHA 3F3ZA 3OCSA 5DIAA 5A4LA 2NPQA 5HE1A 3REPA 4KBKA 4JLCA 3DXQA 1WFCA 5BMSA 1BLXA 3M1SA 3ANRA 4NCTC 2R0IA 1OKWA 2Y6OA 3DKGA 2A1AB 3RPSA 3ULIA 3QTQA 1VJYA 4L7SA 3AXWA 2E9VA 4U6RA 3EN9A 3PVBA 4ZZMA 5AUWA 4XEYA 5KZIA 4OBOA 4PP9A 3VUHA 4NM0A 3QC4A 4B0GA 4RJ3A 5IUHA 4AQCA 3Q4ZA 4O81A 3QA0A 4M3QA 3UOLA 4WG5A 4ONAA 2VTNA 4IDTA 3LOKA 3C0GA 3ZU7A 3BU5A 5LARA 3D83A 3D7ZA 2JITA 3ZSIA 4WD5A 3EKNA 2BMCA 2FGIA 3L8PA 4XG9A 3PRFA 4I24A 2EB3A 1MRUA 5CF4A 3EYHA 2I0YA 3R02A 4V04A 5LOHA 3ZONA 5CAVA 4GKIA 3NAXA 4NCTA 2PVHA 4OTHA 5IQBA 5EFQA 2EXCX 3RPOA 1SZMA 4CFXA 2WD1A 4XV3A 4EC9A 5E8ZA 3N4VA 4NKSA 4CG8A 3QRUA 4JBQA 4FTUA 1YOLA 3DK7A 5H3QA 2IJMA 4NJ3A 3ZLXA 4CZTA 3TZ7A 2YACA 3V8SA 2PMIA 3GU4A 4HYIA 3RNYA 2PE0A 1ZY4A 3R28A 4L3LA 4KA3A 2HXQA 2UZLA 4MQ1A 1M14A 4DH8A 4EH4A 2Q0NA 4GFOA 4EOPA 5LVNA 2OIQA 4YC6A 2B55A 5IU2A 4FTCA 3F66A 4M12A 4WRSA 1IEPA 3OUKA 4M97A 4BDBA 3E5AA 5D10A 5BYZA 4M66A 4FZ6A 4ZS0A 3RPYA 4ITIA 3QXPA 3D5VA 4ALUA 5A54A 4WNKA 3DLZA 4K18A 3QD2B 4DFXE 2J0IA 2W1FA 4P7EA 1ZYJA 5C1QB 4XV2A 5IUGA 4QMMA 4F65A 5A6NA 5AUTA 4TYJA 5E8XA 3GC9A 1H1QA 3UZRA 4EK8A 4MHAA 1DAYA 5C4KA 1OB3A 3OW3A 3BGZA 2UZBA 1U5RA 5FP5A 5FM3A 5HBJA 4QMSA 4KBCA 4QYEA 3ORTA 4I0TA 4G6LA 3O50A 1PMEA 3PJ1A 2OK1A 4O82A 3MY1A 1WBVA 4K9YA 2QLQA 4X0MA 3FMNA 4Q5EA 4IE9A 3RVGA 1PKDA 4C62A 1CKIA 3FHIA 5B7VA 2R64A 2BZHB 2YITA 2VGPA 3HMMA 3DS6A 4FSZA 2GNJA 4EQUA 4U97A 1XH5A 4GL9A 3I0QA 1M2QA 4IIRA 4XG6A 3KK8A 1CM8A 3UMXA 4FVPA 3MFSA 3Q32A 1H0WA 3I1AA 5JEBA 4MX9A 4U42A 3QBNA 5DR9A 3AMBA 3RNIA 3GU6A 3MGYA 2IVUA 3FQHA 4MXZA 3ACKA 4NK9A 4PWNA 4ZMEA 4A4LA 5AV0A 4O7ZA 3N4TA 4IZYA 3PY3A 3MH2A 1IR3A 3F61A 4RC4A 5DGZA 3S4QA 3SG8A 5HG7A 3OF0A 3VULA 5JFWA 4MH7A 3FMJA 4XG8A 1OUKA 4I3ZA 4CEGA 3F5UA 1SVEA 3PE2A 2ZAZA 4FTJA 4NM5A 3CJGA 3CD8A 1PRYA 1IA8A 3OEFX 4GK4A 2XCKA 2QO2A 3NDMA 4FV8A 5K0XA 2FSTX 3GQIA 3OVVA 4BCOA 4C61A 2J0MB 4ZLZA 2HZIA 4BCMA 1XBAA 5AUZA 4D28A 5EYDA 4KABA 5HKMA 2NRUA 3VUGA 4QQCA 3VS1A 2ITWA 4HNFA 1URWA 3FSFA 2X8IA 3QCXA 3BI6A 5K0KA 3TL8A 3CTHA 4C58A 5L6PA 4G3DA 3UVRA 4BI2A 1BMKA 2RL5A 2GQGA 3QZIA 1I44A 3BIZA 1JKLA 3I79A 4O0UA 1R1WA 4TKSA 4AZEA 2PL0A 4XP0A 1H08A 5T68A 3H9FA 4YJSA 2ZV2A 2W1GA 4UEUA 5BNJA 4BKJA 4UBAA 4BR3A 5ICPA 4W8EA 2VWBA 3BGQA 5HTIA 4H39A 2ZYBA 3FKOA 5BUEA 3JR1A 2CKOA 3TXOA 4EHEA 3S00A 3RPVA 4RJ7A 4BZNA 3MW1A 4JVGA 5ANDA 4QP1A 2Q83A 1DAWA 1T45A 4RMZA 5AP2A 2VTRA 1WBOA 4TWOA 3CPCA 1OBGA 4OTRA 5DT3A 3ZLWA 3OMVA 2OI4X 2UW5A 4RWKA 3VS3A 4Z7HA 3PWYA 3KMMA 2ITVA 2XK8A 5CSPA 3G6HA 5CEIA 3FZ1A 3R9HA 2GU8A 5CSXA 4ACMA 4JOAA 5HLNA 4EH7A 5IQDA 2WMUA 3R04A 1ZY5A 5CI6A 4EOLA 3HV3A 4F0FA 3VS2A 3DZOA 2VWYA 5EH0A 1M7QA 3DBFA 4AZTA 3MY5A 5KHWA 2VX0A 1O6YA 4AOTA 3ALOA 1LUFA 4IZAA 3WF7A 5CQUA 3ANQA 2FYSA 4DEGA 4AA4A 2R3KA 3Q4CA 4UALA 2A19B 3ATTA 1J7LA 4WG3A 1JOWB 3FPQA 5J79A 4FEVA 2XRWA 4FOCA 2YDIA 4YHTA 4NT4A 5L3AA 3SOAA 4FEQA 4S2ZA 2UVZA 3ZO2A 1PXMA 2VUWA 2XCHA 4ITJA 2RF9A 3C51A 5HHWA 3EQPA 5CF8A 3PIZA 3KXZA 4CFFA 4ZSAA 4ZP5A 2HXLA 2YIYA 3T9TA 3PXKA 4LGHA 2C5XA 2YIXA 3FV8A 4IJ9A 3W2SA 3KFAA 4ANNA 1XH4A 4QD6A 2VNYA 3P79A 3PJ2A 4RLLA 4BICA 4UY9A 5DWRA 3FQSA 4UYAA 4I6QA 2YIWA 5ANOA 2V22A 2WEVA 3GENA 5T3QA 4ANSA 5CAQA 1BI8A 1LEZA 2UZEA 5DT4A 1A9UA 4IFGA 1BL6A 2O0UA 2ITUA 2BHEA 4EL9A 2PUNA 5E8YA 3EFKA 2HIWA 3T8OA 4O0XA 3VRZA 2OU7A 4EHZA 4FBXA 2WU6A 2WQEA 5JGBA 3QC9A 3AD6A 2WO6A 3F3UA 2OO8X 4X6RA 1B6CB 5I3RA 5JFXA 3K54A 2X8DA 4IZ5A 3WZDA 3E8DA 4FIIA 4EOMA 4H3PA 2PZIA 1H1PA 2PVRA 4JAIA 4A06A 5I9XA 5KNJA 3QU0A 3UQFA 2I40A 3BX5A 1KOAA 4F9BA 2PUPA 4HYHA 4ANBA 4J98A 3BEAA 4RA4A 2W7XA 3TTIA 3R63A 5HG8A 3NNVA 3PLSA 4FF8A 3ZEWA 2ITQA 4FYNA 3AD4A 4IX3A 5DHJA 1QCFA 2Y9QA 5D7VA 4KWPA 5KO1A 1YOJA 3FI4A 5E8UA 4O7RA 1WAKA 5CF6A 4NW6A 3U9CA 4QTEA 3DV3A 2YCRA 1UA2A 2JIUA 3BU6A 4AP7A 3V01A 3PJCA 2YERA 4WBBB 5J9LA 2B52A 4Y85A 4YUQA 2JDOA 3ORZA 3QRTA 4WHZA 3PYYA 4Y8DA 1L3RE 4YZMA 3E7VA 1G8AA 4J71A 4QTCA 3E8NA 4OTWA 4NFNA 4DCEA 4EHVA 4ANMA 3VS0A 1UWJA 2HWOA 2G2IA 4RVKA 4TYGA 5EI8A 5FWKK 4BGGA 3LLAA 4L8MA 3O71A 4TY1A 5LWMA 4HYUA 3BLHA 3SHEA 4A4OA 5IQFA 4FL1A 4V0GA 2BUJA 2C1BA 4JDIA 4XJ0A 5E91A 2C6DA 5KMLA 3SVVA 4RX5A 5E4HA 2UW7A 4R8QA 4FKLA 1DI8A 3EZRA 5BUIA 3PTGA 5C01A 5HCYA 3ALNA 2CMWA 1TVOA 4PQNA 3WF6A 4RJ4A 3ATSA 3QLGA 5DE2A 1M2RA 3AC3A 2F2UA 3A7GA 2Z60A 4UWYA 4FTOA 5HE0A 4ORKA 4PPCA 3SOCA 5LMKA 3FI8A 3O7LB 4RIWA 4R7HA 3E8EA 4JIKA 2PE1A 2BAQA 4FX3A 5IQCA 2Z7SA 4U5JA 2XYUA 3HRBA 2XJ2A 4II5A 4XV1A 5IG1A 4GW8A 3M42A 4UV0A 5HLPA 4O7WA 4HGTA 2C1AA 4Z9LA 3I5NA 4PL4A 4B6LA 2ITPA 2XKCA 3G33A 4FUXA 4E73A 4XS2A 2H34A 2W4OA 2UZVA 1O6LA 5FXSA 3WBLA 2QO7A 4RIYA 3K3IA 4IXPA 3DXPA 3IO7A 5JZNA 5JQ8A 3F7WA 2FSLX 2WQNA 4FV4A 4FSQA 4MKCA 3GI3A 1Y91A 4O6LA 4DGGA 4F6UA 4AGDA 4GS6A 5CSWA 3C1XA 5AFVA 3KVWA 5KMOA 2B7AA 3A2CA 2W1ZA 2CCHA 4CCUA 3PG1A 4FIFA 4XV9A 5CF5A 3TV4A 3FLNC 3R1SA 1PHKA 2FH9A 2JKKA 3FLSA 4G16A 5AM6A 3UNJA 3IG7A 4YR8A 3DDPA 2WOTA 4OR5A 3CP9A 4CCBA 2YAAA 3KEXA 2V62A 4AACA 5EK7A 2WTKC 2I0VA 3PE1A 4FNXA 2WFYA 4JL9A 5BVKA 4DC2A 4AZFA 4ZJVA 3WIKA 3ZUVA 3R7GA 5ACBC 2V7AA 4FNYA 4EORA 3RK5A 3SX9A 2PULA 4RPVA 3MS9A 2ZMDA 1R0EA 3DGKA 3R8VA 2FB8A 5GZ9A 4JQEA 2BZKB 2CCIA 1ZZLA 3EN4A 2VNWA 3W18A 3RK7A 3ZS5A 4QMQA 5HORA 5JFVA 3LFEA 3COHA 4S34A 5AP3A 5KBQA 2QU6A 3UO5A 4IB1A 2WTVA 3B2TA 2UW3A 3PY0A 2J51A 4EEVA 4MEDA 5CU6A 4K11A 3EJ1A 4RX7A 3OW4A 5EDQA 1L8TA 4C4IA 3GU8A 3UNKA 5CT0A 2HWPA 1ZRZA 4KAOA 3R9OA 4FTRA 4OW8A 4ZY6A 3WARA 4R5SA 3UE4A 2YZLA 2C0IA 4DGMA 1OL5A 2Y4IC 4PDPA 3ID6C 2XNGA 2G15A 3OFMA 3HAVA 2OZAA 3GC7A 2ONLA 5ACKA 3ZC5A 4FKQA 1YI3A 1OI9A 1U54A 3E63A 3ZO3A 1ZYDA 5EI2A 4KKGA 3ZRLA 3S0OA 3EQIA 3R8LA 4IFCA 4AE9A 4DLJA 3F9NA 2X8EA 1B38A 4Z7GA 2XM8A 2WKMA 4W9WA 3KRXA 4D2TA 3MVJA 4FV3A 3TV7A 3Q60A 4GEOA 4LV5A 4AWIA 3BHHA 3VUTA 4DH1A 3GFEA 3NSZA 3MVMA 2WMAA 3UPZA 4CNHA 1Q8ZA 3P4KA 1XH8A 3TJCA 1Y6BA 3NUSA 4JX3A 3UJGA 4EJ7A 3RM6A 5FTOA 4CXAA 2X7GA 3LFBA 5FQDC 1VYZA 2OJIA 3BV2A 2WU7A 5AV4A 4G34A 4FEUA 5IA2A 3TEIA 4ZSJA 1H25A 5AIRA 4YSJA 4MXCA 4QMTA 3U51A 4AZVA 3R73A 2OICA 1E1XA 4F1MA 3ZM9A 2PU8A 3TV6A 2BFYA 1H01A 4FTQA 5AA8A 2QOOA 2ZB0A 3H9RA 4FMQA 5AP1A 2F4JA 2PPQA 4N70A 4W4WA 5CZIA 4PX6A 4G6NA 4CFMA 4WSQA 2GMXA 4U43A 1VZOA 1X8BA 3PVGA 3P78A 2W9FB 1WBNA 3PWDA 5JRSA 3MFUA 4D4RA 4O91A 4AFJA 4K6ZA 4RIYB 3UDBA 2IZRA 4LOQA 3R9DA 3JY9A 3ZDIA 3UC3A 5IEVA 3Q04A 1RW8A 2W1DA 3Q3BA 3D9VA 4V05A 1PYXA 5BPYA 1GZOA 2C69A 3G5DA 5T6KA 2EB2A 2O3PA 2W06A 3BYMA 4FKRA 4QMWA 4U81A 4J1RA 4Y95A 2XBJA 5C9CA 3C50A 4NTTA 4FSNA 4C2VA 4EWHA 1OIYA 3NVKI 4EJNA 4JX7A 4J96A 2FSOX 2HENA 4E1ZA 4BYJA 4ZTSA 2P55A 1OPKA 2QR7A 5AV1A 4U44A 3D5UA 3SKCA 2R3NA 3QLFA 5HEZA 5EM5A 1XJDA 3EN5A 3NIZA 5EHOA 2BIKB 3BKBA 4I6FA 3CJFA 3LFAA 5FG8A 3RAWA 4I22A 3WE4A 5F9EA 4FIJA 4IB0A 4O7SA 5EQPA 1BUHA 4LOPA 3DBEA 1ZMVA 3ZFXA 3TNQB 3Q2MA 3AMYA 5DEYA 3VBQA 4FR4A 4D4SA 3BGPA 4XCUA 2UW0A 4HYSA 3P7BA 4FZFB 1ZOGA 4DGOA 4D1ZA 4D5HA 3TDVA 3PXZA 2X9FA 5BX0A 3UIMA 1S9IA 5CS6A 1J1CA 2FUMA 4QTDA 4RWIA 3ELJA 5HD4A 3CCNA 5I4NA 5C4LA 2GNLA 3LXNA 2OIBA 3Q5ZA 2R9SA 4JR7A 1URCA 3C0HA 4RBLA 4EH2A 5J5TA 3R7OA 3QCQA 1H1WA 4ZEGA 3VAPA 1W83A 5BUJA 1Y57A 4C3FA 4G31A 3GOPA 3PA4A 4Q2AA 4GT5A 1FVTA 5E7RA 5AAFA 1H4LA 5M56A 4O86A 3MPMA 5EW9A 1ND4A 1FPUA 3BV3A 4FV7A 4TYIA 1YXVA 3HNGA 4OTDA 4C4FA 2OG8A 5EM7A 4CQEA 2OF2A 3VN9A 4QYHA 1LEWA 5HLWA 1JLUE 3AGMA 4NIFA 1P14A 5K5XA 3EFLA 4FNWA 4DEDA 4YO6A 3IW4A 4J53A 2PVLA 3KRLA 2KULA 2WAJA 4HVHA 5IQEA 2UW4A 3L8XA 5AUYA 4MD7E 4FGBA 3L8VA 3LCKA 4O6EA 3H0YA 4FKJA 5HIBA 3TNHA 2VWZA 4C38A 3I4BA 5CZHA 3TG1A 4M0YA 4CMUA 1YI6A 2C6EA 4H58A 4OT5A 2X2KA 4H3BA 5DFPA 3H30A 3SW7A 2B9JA 3IOKA 4LOOA 1DS5A 1QPJA 5EOLA 4CZUA 4WA9A 2XNOA 2QD9A 4FV1A 4PV0A 5ANJA 1JWHA 2C5NA 2GTMA 3DQXA 2R3JA 2FA2A 3FYKX 3O2MA 4F4PA 1STCE 5AUVA 4TWNA 3V5QA 2O63A 3DNEA 4HPUE 3WZJA 5ETAA 3FC1X 4C8BA 1Q24A 4E6AA 3SRVB 3BZ3A 4ERWA 3ZXZA 2E9OA 3CEKA 1ZYSA 3W16A 4K77A 3RPRA 4UX9A 4YTCA 4RJ6A 5IA1A 4O0TA 2PZ5A 5EI6A 4DFNA 4IAAA 3G90X 5D12A 3KB7A 3DJ7A 3BHVA 3NZ0A 1MQBA 2OZAB 2QOKA 5CU3A 4BF2A 4QP8A 3JS2A 4XYFA 4FL3A 2Y6MA 4GRBA 2C6OA 4FGRA 3A7IA 2UZOA 1W7HA 2F49A 4DINA 3F7ZA 3DK3A 3VUKA 1GIIA 2KTYA 2XJ0A 2Y4PA 2WTCA 2XM9A 4IWDA 4E3CA 1OBDA 2WQOA 1H07A 3KXMA 3HP5A 2V7OA 3MB6A 4FTLA 4IVCA 5I9VA 2IPXA 2CKPA 3FAAA 1JVPP 4I4EA 1OECA 4R3CA 4QMOA 3KMUA 5FD2A 3WF8A 2IZTA 3BRBA 4KKEA 5HO6A 1NT2A 4XX9A 2Z2WA 3LW0A 1ERKA 4ID7A 4E93A 4CT1A 5HTCA 4DT9A 2BALA 4PF4A 3TNWA 4QNAA 4M69A 4OTGA 2QOLA 2BRHA 3QQFA 1BI7A 2C30A 4AXAA 3UO4A 4DH5A 5JT2A 4WRGA 4RGJA 1M7NA 2YWPA 3QKLA 2WMVA 1H28A 2VX1A 4M13A 3KMWA 4MNFA 4V01A 1KE9A 3QUPA 2WNTA 1ZAOA 5E8WA 1J91A 4F0IA 4MF0A 5IEXA 5A4CA 4R3PA 4FV9A 1YXXA 3HV6A 3D5WA 3R7EA 4ASZA 3NVMB 4J8MA 3VUDA 4M84A 2EVAA 3FMMA 1APME 3KXGA 4WSYA 1YDTE 1OPLA 2GNIA 4E26A 4EOQA 4QQTA 2AUHA 3BHUA 1QMZA 2ETMA 3FZTA 2P3GX 4GYIA 2BVAA 4ITHA 4CKIA 3ZXTA 2J9MA 2VWVA 2R3RA 3KL8A 3LCOA 2JEDA 2Z7QA 4C4JA 2XIKA 4D2RA 4JDHA 3QQJA 1CSNA 3CQEA 2X81A 4M68A 3W2CA 5DRBA 3V3VA 2C68A 1E9HA 4L44A 5DMZA 3NAYA 3PPJA 2HW6A 3CE3A 4QP7A 5L8KA 2OFUA 4EH3A 2X7OA 3G9NA 1Q8WA 1Y8GA 3C4CA 1Q5KA 4GMYA 4P5QA 4A07A 4RWLA 5IISA 3NYOA 4BWXA 3K5VA 3ZUUA 3QHWA 3Q96A 3QAME 2X0GA 3UNZA 4D0WA 2YA9A 4E6CA 3ORMA 1OKZA 1JKKA 5GJFA 3A8WA 4CYIA 5M07A 2OSCA 3QTSA 5CENA 3P0MA 3RZBA 3RCDA 4FYOA 1H8FA 3Q9XA 4AOIA 1PKGA 2UZTA 2C6IA 5A6OA 4BIBA 2C6MA 2VTIA 3RZFA 4FKOA 1REJA 3IQ7A 3POOA 1PW2A 4M67A 4WNPA 4J52A 2ZB1A 5GHVA 3JVSA 1ZWSA 4IACA 4J8NA 5EM8A 3HMOA 3E93A 5DLSA 1OMWA 4R7IA 5KHXA 4K1BA 3EKKA 3A8XA 3IDCA 4GFMA 4ZOGA 4AU8A 3Q4UA 4BFMA 4X21A 3MB7A 3WIGA 4QP6A 3R30A 1VEBA 2YN8A 3FXZA 5J7BA 4O84A 4GCJA 2CLQA 5M57A 2XKFA 4O21A 3A99A 4FZ7A 5LXMA 2C6TA 2QKRA 5FDPA 2XNMA 1H1SA 4L01A 2ZM1A 3ORNA 2BPMA 3FXWA 3QALE 2PUIA 1OKYA 1R0PA 4G5JA 4MXYA 3FI3A 5C03A 2VX3A 4CFVA 4ZS4A 4DAWA 4PPAA 2G9XA 2B9HA 3IONA 3NYNA 3QD0A 4W8DA 1XQZA 5DYJA 4FEWA 4PUZA 3GT8A 2JKQA 4CKJA 4JG7A 5KMJA 3ZCLA 1NW1A 4O83A 2GNGA 5AAGA 5AIKA 5IQIA 5B2MA 4K8AA 4PTCA 4WUNA 2R3IA 4TN6A 4YZDA 4EZ5A 3HZTA 5CNOA 2CPKE 3S2PA 3U87A 4UZDA 3GVUA 4PL5A 4N0SA 2WPAA 2BZIB 4R6VA 4UMTA 1MP8A 2VV9A 1AQ1A 1UKHA 4ZTHA 2ERZE 3P1AA 4MNEB 4E8AA 1KSWA 2EXMA 4AGUA 4IX4A 4ZTQA 2XP2A 1ZOEA 2PVMA 4O0SA 1PY5A 3EB0A 1GZKA 4ANOA 4ASXA 2BTRA 3V5PA 3V5JA 3VQHA 4ALWA 1PMNA 4PTEA 3VBXA 4JBOA 2VRXA 4OAUC 3NNWA 4BDGA 4GU9A 5HE3A 4HCUA
chains in the Genus database with same CATH superfamily
5AEPA 5CVHA 1Z57A 5FTGA 2HZ0A 4USDA 4NW5A 3K3JA 3CXWA 3MSSA 5AP4A 3WF9A 4H05A 3DCVA 4EK6A 1SVHA 4FIHA 3V51A 3EMGA 2F2CB 3FQEA 4FTIA 2XZSA 5FEQA 2OZOA 4ALVA 4CD0A 3KF4A 3KQ7A 5FEEA 3ODYX 4CFWA 2QLUA 5M51A 3RMFA 5GINE 1XHAA 3PSBA 3LJ1A 4L46A 4YSMA 3MIAA 4AZSA 2VWWA 3QTXA 2FO0A 2JDRA 2VWXA 3PP1A 4DITA 4ANLA 1J7IA 4JBVA 5TO8A 3ORKA 4I23A 5L6WL 3BYUA 2XNEA 3NYVA 4B8MA 1ZXEA 3EQDA 3QYWA 1FMOE 4FK3A 4IMYA 4F9YA 1G8KA 3R9RA 2CGUA 3ZBFA 2IW6A 4F64A 3TNPC 3UOKA 2JD5A 5TOZA 3LIJA 4DHFA 5AX3A 5FUTA 3IOPA 2ITXA 4ENXA 3R2BA 3FI2A 4BWPA 3CTJA 2WMBA 2IW9A 3E87A 3M11A 4MYGA 4FJVA 5F20A 4PPBA 1XO2B 3OTUA 3F69A 1SMHA 5KKRC 3TACA 3LFNA 4LM5A 2X0OA 1CKPA 4YZBA 3MI9A 4U9AA 1OM1A 1Q99A 1OVEA 4Q9ZA 3D7TA 2ERKA 3CQUA 4FV0A 1JKSA 4XLIA 3VWAA 4E5AX 2IN6A 3BELA 3EZVA 3LQ5A 4NFMA 1ZZ2A 2QNJA 4RZWA 5TE0A 3LZBA 4LUEA 5AR7A 5CAPA 2W4KA 2UVYA 3AMAA 1BKXA 4DG2E 3QXOA 4UYNA 2YCSA 3W55A 4F70A 5BVNA 2PE2A 2HK5A 3UP2A 2PMLX 3R8UA 4O7LA 3F5XA 4Y73A 2ZV8A 5L2WA 2BFXA 3G15A 3IKAA 3P08A 3T3VA 4H3QA 2QC6A 4PDSA 2O65A 4MQ2A 4FIGA 3S95A 4BCPA 2DUVA 4PMMA 2BAKA 5L8JA 3R83A 3QD3A 5F4NA 4HW7A 3VUIA 3FE3A 3P23A 4BDKA 1VLRA 5LVLA 2YLFA 3VJNA 2RSVA 4R1VA 2PVFA 3NR9A 4GG5A 4F1TA 5C8KA 3W2OA 3ZRMA 3OCBA 4FT0A 4F7LA 4MNEA 1H1RA 5HO8A 4C59A 1YHVA 1Q8YA 2WTWA 3PA5A 1QL6A 4CFNA 5IMXA 3GGFA 4QYGA 4KIQA 3UG2A 4PMSA 4AA5A 2P2HA 5LMKC 4X2KA 1E1VA 1MRYA 3LJ0A 4QP4A 3V8WA 4F99A 3IW6A 4D4YA 1UU3A 2C0TA 4I94A 3LQ8A 3GXLA 4O4DA 4FZAB 3TKHA 4CZYB 4QP3A 4EONA 4FG7A 5J7HA 4GIIA 2J50A 5C26A 2EXEA 4FVRA 3DKOA 1G5SA 5H8EA 3EH9A 3GU5A 3WI6A 3PPZA 3W0RA 2CN8A 3FJQE 4LL0A 5DG5A 5TKDA 3UIUA 5BMMA 3HKOA 3D15A 5HX8A 3IGOA 3E64A 5ANKA 3AC8A 2WQMA 5ANEA 4EZ3A 4U3YA 4RFZA 4CMOA 2RKUA 4EOJA 1IRKA 4L52A 3MTLA 5CI7A 1ZOHA 2YDJA 5L4QA 3NS9A 4FOBA 3Q6UA 5CYIA 3R0TA 3HDNA 4YJQA 2PMOX 3ORIA 5HCZA 4EUTA 1XH7A 5AWMA 3A7HA 3Q4TA 4RVLA 1NY3A 2RGPA 3UBDA 3DAJA 4DH7A 4LGGA 2ZVAA 1Q61A 4JS8A 2XEYA 4A9SA 5BVWA 4FTAA 3SG9A 3OWLA 2VWIA 3C7QA 3BYOA 3GCPA 1GJOA 3NUPA 3QKKA 3TZMA 5ITAA 2IWIA 1IAHA 5LVPA 1KV2A 5DEWA 4UZHA 5H8BA 4BJJA 1YWRA 1YXTA 4PDYA 4EOKA 3ZFMA 4F7NA 1ZMUA 2R3FA 3F2AA 2OW3A 4LG4A 2GHMA 4GVJA 5EW8A 3VUMA 3R7VA 2XRUA 3EQGA 3BCEA 3GP0A 2VO3A 3DQWA 2OF4A 1YQJA 3CY3A 5EKNA 5EOBA 3I6UA 3V04A 5CSVA 4DEIA 3R9NA 3E8CA 3QYZA 3DK6A 5JKGA 4UXLA 4ZLYA 4BCQA 3EQFA 3GCSA 4IAIA 4M7IA 4XUFA 5KMIA 2XA4A 3JY0A 5I9ZA 3NFFB 4HPTE 4U41A 5CVFA 4GJ2A 5ANGA 3L8SA 4YTIA 4AN9A 4I5PA 3DT1A 4NSTA 5IQAA 4MBJA 2WMRA 4IHPA 3QA8A 4USFA 2QOHA 3VS7A 2R7BA 3NUUA 1FVRA 3BYVA 3QTZA 2XJ1A 3W8LA 3EYGA 3MIYA 5E8VA 2XK7A 1J3HA 2VO0A 3HVCA 3SXSA 3BLQA 3TIZA 1LR4A 3P7AA 2JKOA 3DAKA 1FBNA 4BCFA 5AV3A 4ZLOA 3FY0A 3FSKA 4BZDA 1XWSA 3EQCA 4U0IA 5AR4A 3QQHA 4BTKA 4WUAA 5HX6A 1YW2A 3AC5A 1F5QA 4G2FA 4XG3A 3VBWA 1NXKA 2QOFA 3DDQA 5CAUA 4C36A 5BYYA 1Q4LA 4EUUA 3UOHA 3PFQA 4RIWB 2W17A 3UQGA 4TXCA 3PPKA 3S1HA 2VTHA 4FE2A 2IO6A 5L2IA 4IANA 1M2PA 4R78A 3COKA 5HVYA 1F0QA 4JJRA 1V0OA 3D94A 5LCKA 3W2QA 4C3RA 3V8TA 3CLYA 1W2FA 4U3ZA 4Y46A 4PMPA 4K0YA 3NCZA 2XIZA 3COIA 3FKNA 3H10A 3QQKA 4NM3A 5A3XA 5CXHA 5EHLA 4J95A 3W32A 1UU9A 2WMTA 4AT5A 3UPXA 2XYNA 4FV5A 3S3IA 5E1SA 3I5ZA 4X2FA 2JBPA 4UXQA 1SYKA 4XG4A 4IAYA 2XK4A 3R1NA 4YZCA 4YHFA 4NU1A 3RK9A 3D7TB 5M44A 3DZQA 1GNGA 2QG7A 3D2KA 2GQSA 4G9CA 3TNIA 3PJ3A 2C5OA 4BDJA 3H3CA 2XIXA 2PZRA 3FYJX 4G5PA 2LGCA 2JAVA 1K9AA 1JPAA 3C0IA 3CC6A 3QGWA 5AR2A 4RVMA 3SDJA 1PMVA 2OWBA 4J99A 4B99A 1OL6A 2JFMA 5JK3A 5CNNA 2YM6A 3MH3A 2WIPA 5HICA 2AC5A 2Z7LA 4HVIA 5BYLA 1FMKA 5DA3A 4DEAA 3LFCA 5HNBA 4ZY4A 4WKQA 5EKOA 3QRIA 5AUXA 4AG8A 3DB8A 1SNUA 3MESA 2QI8A 3CS9A 3LJ2A 1JQHA 1XBBA 4F08A 3QX2A 2UUEA 3E88A 3JUHA 2JDSA 4BBMA 3C4EA 3RJCA 3HV5A 2I0HA 4R5YA 4G17A 5FEDA 4U79A 2HZ4A 3TZ9A 1YDRE 2AEGA 2PMNX 4MBLA 4RIXA 4KNBA 3FWQA 3RINA 4AFEA 4B4LA 4BGHA 3OT8A 5M09A 5CXZA 3GNIB 4L43A 3OEZA 4G3GA 2QU5A 3OOGA 4BI1A 1IAJA 4FICA 4QDVA 3A7FA 4JRNA 1YRPA 2CHLA 4CYJA 3NW5A 2XK6A 4A9RA 3ODZX 5LVMA 4OT6A 1YXUA 2XS0A 1W82A 4S31A 2EWAA 2PVKA 3HL7A 2WTIA 3GUBA 3P9JA 4G3CA 3GC8A 3R1YA 2A98A 3FZOA 5DN3A 3FLQA 5IUIA 4RQKA 3TI1A 3PP0A 3ZMMA 4PP7A 5M4CA 2GQRA 3D5XA 4YTFA 4U8ZA 4XG2A 4CRLA 3BLRA 3D2IA 4L53A 4FEXA 5EQEA 3A7JA 1YWVA 1O9UA 3MY0A 2W1HA 4MXOA 2YJSA 5IF1A 3QWJA 2O5KA 1U54B 4G3EA 3ZFYA 2UW8A 2VD5A 2BDFA 3R7IA 1GY3A 2BRBA 2JKMA 2PVNA 5J9YA 4CLJA 5IH6A 4XH6A 4FL2A 2OXXA 2YHVA 3DAEA 3L9LA 2R3MA 3KK9A 1UNHA 4FSYA 4JDKA 4NKAA 5HGIA 4ZTLA 4DHJA 5ETFA 2V5QA 4CTCA 2R3OA 4Y83A 3NNXA 2W96B 4FKGA 2F7ZE 3VS6A 3FZRA 5BVFA 3MFTA 4EOOA 2XNBA 4F9CA 4USEA 3O51A 3QL8A 4JG8A 1Q8UA 3ROCA 4ARKA 5IDPA 1G3NA 5HIEA 3VF9A 2V55A 4TL0A 1ZYLA 3NUNA 4O4BB 4E4XA 5HTBA 3UMWA 2W5HA 3HDMA 3DKCA 4UMQA 4HGEA 3GEQA 4AZWA 4DH3A 2J0KA 3PG3A 3ZDUA 2IZUA 3KN5A 4EH5A 4YTHA 3FKLA 1ST0A 5I9YA 3AKJA 1YI4A 4YO4A 5GJGA 3GC0A 4IAFA 5C27A 4M0ZA 3KXNA 2A27A 5M08A 4D9TA 3SV0A 4K2RA 4WBOA 4LFIA 4E20A 1GAGA 1DI9A 2VTJA 3QQUA 2QOQA 3K2LA 4GV1A 4FKSA 5DH3A 2ITZA 4QTAA 3FY2A 5HU3A 3I7CA 5HESA 3FLWA 3ORPA 4W4YA 4TYEA 4DBXA 1PJKA 2GTNA 4BCKA 3HUBA 3CKXA 4YU2A 2ACXA 5HZNA 2PTKA 4C33A 5IMEA 3CGOA 3KKVA 1A48A 2ZMCA 3QFVA 3I7BA 2PSQA 3ZM4A 4IC7A 2O64A 1DM2A 4QMXA 4ZZNA 3W8QA 4GK3A 3T9IA 4BGQA 5KUPA 5AA9A 4BCGA 4IJPA 5D9HA 4UN0C 1PXIA 1R3CA 3GBZA 2H96A 5IA3A 3V5TA 4CVAA 2VZ6A 4PL3A 5H2UA 5CAOA 1TZDA 3A62A 4IDVA 5A4QA 3U55A 4FT7A 4OBQA 3LFQA 3MBLA 4X3FA 3HRFA 1JAMA 1LPUA 4CGAA 4O96A 4C0TA 3KGAA 3PFYA 4FTTA 2P0CA 4EC8A 5KX8A 4NYEA 2BROA 2OJJA 2WELA 1UNLA 4P2KA 3ZLYA 3FEGA 3QZGA 1YHSA 4MXAA 4OTQA 1W2DA 4MK0A 4NWMA 2PYWA 2JC6A 4IC8A 4CQGA 2R0UA 5DPVA 2BKKA 2C5YA 2JLDA 1Q3WA 2XIYA 3OG7A 3HEGA 5DI1A 1KE5A 4FSWA 3W2PA 4ACCA 4HJOA 3DPKA 3DJ5A 4AW2A 5FBNC 3K5UA 4YJVA 4JQ7A 3RWPA 4JIAA 5LJJA 4I1ZA 5IKWA 2W1EA 1YKRA 1H26A 2BRMA 4TZRA 5D11A 2XBAA 1PXLA 1Q8TA 2ZV7A 1VYWA 4QP9A 4PTGA 4HGLA 5IA0A 3EL8A 4GJ3A 3EL7A 4UWCA 1IA9A 5KMNA 3EN6A 1ATPE 4YJUA 4DFBA 4EQMA 1Y6AA 2OKRA 2A0CX 3SAYA 2HYYA 3G0FA 4EKLA 3DJ6A 4C4HA 5L2SA 4EH6A 3RGFA 4AGWA 2PVYA 2R3GA 4U7ZA 4JXFA 4YC3A 3RI1A 3WOWA 2YAKA 3FXXA 4GYGA 3F5PA 4QMVA 4FVQA 4ACHA 3FBVA 3MVHA 2ZM4A 2BHHA 3VC4A 1MUOA 1ZARA 4FTKA 3W0SA 3R71A 2WMXA 3RBWA 2XH5A 4EOIA 5DOSA 4NTSA 4YPDA 4RZVA 3VW8A 3DTWA 1TQPA 4E5WA 2BR1A 2HY81 2XIRA 1H00A 3U9NA 2J4ZA 3R6XA 4YNOA 4PRJA 4TWPA 4GG7A 3UZPA 3PUFC 5F1ZA 4QT1A 4NL0A 3BBWA 3BWJA 3IW8A 2VTOA 1KOBA 2I6LA 4EBWA 3SRVA 3AT2A 3FZSA 3O8UA 5L2QA 2CJMA 2YABA 1YXSA 2GS7A 3AGLA 3W33A 5EDRA 3EFWA 1OL1A 4RJ8A 2REIA 4QMZA 3C5IA 2R3LA 1UKIA 2O2UA 3C4FA 2Q0BA 1KUTA 1U5QA 4G3FA 3UO6A 3C4WA 5AADA 4OTIA 3GFWA 2F7XE 3R2YA 4D58A 5J5SA 5GIPE 1HCLA 2HAKA 4YNEA 3VS5A 3ZHPC 4EZ7A 4YPSA 4M69B 4TYHB 4C02A 2GSFA 5A9UA 1Q41A 3D0EA 2E2BA 3BL9A 2J90A 4A9UA 2V0DA 4KUJA 5CEPA 3RCJA 4FTMA 4F1OA 3OCTA 4CV9A 2C3LA 2Y8OA 4H1MA 4I20A 3Q2JA 2YDKA 2PZPA 1G8JA 3U4UA 4DG3E 4Y5QA 4AAAA 4ZTRA 2QO9A 2CKQA 3IGGA 3IECA 3HV7A 4FI1A 2YIQA 3A61A 2UZUE 3MH1A 2R3PA 4G9RA 4XOYA 2RG5A 3SC1A 4D9UA 4EH9A 1SNXA 5M4IA 3UQCA 4DCAA 3TZ8A 2JIVA 3ZSGA 2BAJA 4AS0A 2Z7RA 3P5JC 4BDHA 4XHKB 2X2LA 4J7BA 5FBOA 3R00A 4F09A 3IPHA 4K33A 4QOXA 2YZAA 4KS8A 5KE0A 4BKYA 3CIKA 1Q62A 3OBGA 3OT3A 4GT3A 4TWCA 1CTPE 4ZJIA 3LE6A 5ETCA 2CLXA 3OWJA 4Y5HA 3EWHA 2W9ZB 2XB7A 2WEIA 3BYSA 4FG8A 3CSVA 1TKIA 2VN9A 4ZMFA 3NWWA 2XK3A 3UIXA 3SGCA 3O17A 3ETAA 3MYGA 1VR2A 1IG1A 1P4OA 5E8SA 4ENYA 4DA5A 2JAMA 3A60A 3PIYA 3KCFA 3AC4A 4ZZOA 3AT4A 3OD6X 4BC6A 2WHBA 3GCQA 2PY3A 4KS7A 5AJQA 1I09A 4GFGA 5IQHA 1JKTA 2J5FA 3GOKA 3MV5A 5EDPA 4YP8A 4F0GA 5JSMA 4O7TA 2XUUA 4XLVA 1R78A 4O27B 3UYSA 4LV7A 5HBHA 3BHTA 3R8ZA 2X7FA 3I60A 3PSDA 2J0LA 4JR3A 1JBPE 3D14A 3PY1A 3QHRA 5IDNA 4FUYA 2BZJA 2DQ7X 2QVSE 5HNIX 2F7EE 3FPMA 4GK2A 1HCKA 1Q97A 4MXXA 4CFUA 4R7BA 4F9AA 3BQRA 4YJPA 4I5CA 4ZTNA 3VBYA 1R39A 3HYHA 4M14A 1JSUA 4C7TA 4IWQA 2QG5A 4FC0A 4D0XA 4KSPA 2VTLA 1RJBA 4DFYA 4N57A 3ULZA 3WZKA 3KXXA 4XBRA 4LGDA 5E8TA 3NMUF 4C34A 1UU8A 2C5VA 3NW7A 4BZOA 4DEHA 4EK4A 4QMLA 3V5WA 5J95A 1H27A 2OJ9A 3UVQA 1PXPA 2DS1A 4I5MA 2A2AA 5HVJA 3FMKA 2FSMX 3RM7A 3G51A 3AC2A 2W5AA 1KV1A 3HMNA 2GCDA 2QHMA 3LCSA 3NUXA 2GDOA 5CALA 4O7YA 3OTVA 3Q5IA 4Y72A 2DYLA 2GS6A 5FGKA 4DN5A 3LMHA 4KIKB 3GCVA 4I0SA 4GVAA 4D1SA 5E90A 4TW9A 3SXRA 1P2AA 2WOUA 3TCPA 2C3JA 2BDJA 4F6WA 4A9YA 3OXTA 4I41A 2J5EA 5BV3A 4UWBA 3RWQA 4LL5A 1A06A 3FMLA 3NCGA 4LRMA 4BTMA 5HIDA 1M52A 3NW6A 4L9IA 4YZNA 5HG9A 3RTPA 3PJ8A 4N6ZA 2IW8A 3UYTA 4E6DA 4PNKA 5LCJA 4DEEA 5IQGA 4HVSA 1WBPA 3BEGA 1FVVA 4L00A 4QTBA 5AR3A 2B9IA 4FSTA 4BCNA 4W4VA 3G2FA 4M15A 3SXFA 1REKA 4L45A 3OY1A 4UB7A 3POZA 4EKKA 2HW7A 3TT0A 5IA4A 3DBDA 4IWOA 1JSVA 1BYGA 5J87A 2I7QA 2RFSA 3QD4A 2C4GA 3OWKA 3N51A 5G6VA 1IASA 3N4UA 2X2MA 4DTKA 4U80A 1YDSE 3UGCA 5BQ0A 5M4FA 1NA7A 4BDEA 4IW0A 5JRQA 4PDOA 4NZWB 4QMPA 3LQ3A 3KY2A 3HA8A 2JFLA 4IVAA 3VF8A 4ERKA 1K3AA 4CG9A 4QYYA 4I92A 4JAJA 3EQRA 2QQ7A 1OITA 5EQYA 4NJDA 3B2WA 2C6KA 4FZDB 1GIJA 4A7CA 3LHJA 3VS4A 3KULB 1OGUA 5BVEA 1OL7A 5EM6A 2J6MA 5HE2A 5EHYA 4TYHA 3PXQA 1UNGA 2RFEA 2QURA 3QUDA 5LWNA 4RIOA 5H8GA 1QPEA 4BBEA 2BRNA 2GHLA 4J97A 4WG4A 5GNKA 1KE7A 2YCQA 5HNGA 4TTHB 4Q5HA 4KIPA 3LMIA 3QUEA 5FP6A 5M55A 2CNVA 1KE8A 3LCDA 3DB6A 3F82A 2OH4A 3C13A 5I9UA 4KRCA 5HBEA 1KWPA 4JBPA 2ITNA 2SRCA 3AOXA 4ZSGA 3LM5A 4ZXTA 1CDKA 4O7NA 4O1OA 4X6QC 4FG9A 5TR6A 4WO5A 4QMNA 2GFCA 3AG9A 3BHYA 3QTIA 2W05A 2XVDA 3HV4A 4HOKA 4M8TA 4P90A 1FQ1B 2Y7JA 5CTPA 4C4GA 5K4JA 3IK3A 3I0OA 4AUAA 3QCYA 4L68A 2CNQA 3RAHA 1UWHA 5I9WA 2W1CA 1V0BA 4JDJA 4YC8A 4IADA 4CV8A 5I0BA 4WIHA 1OPJA 1WZYA 1Q3DA 5A14A 3VVHA 3PZEA 4I21A 2ONLC 3KIOC 4I5HA 2CDZA 2VTAA 5EW3A 4BY9E 3QF9A 5HOAA 5A4EA 2VO7A 1TQIA 3PIXA 4QYFA 3KRWA 3MH0A 4DGLC 3MA3A 2AQXA 1W98A 3BWFA 3G0EA 3ORXA 4BJJB 3U6IA 4YBJA 2XKEA 3HECA 3O23A 4O0VA 2OJGA 3ZRKA 3VO3A 4DHZA 4RRVA 3W1FA 2W99B 5HG5A 4MD8E 3GB2A 5L8LA 4O4EA 3EHAA 3N9XA 4XG7A 5ETIA 4HNIA 3H0ZA 4BB4A 5K5NA 3O5AA 4O22A 1PYEA 2H8HA 4Q9SA 2C3IB 3BPRA 4EK5A 2XKDA 2VGOA 1XH6A 4IX5A 4BDAA 2XANA 3HGKA 3PZHA 3LFFA 4OUCA 4L3PA 3PXFA 3QTRA 4OTPA 1WBSA 1YWNA 3OCGA 4O0WA 4RSSA 2X0PA 2WMWA 4BI0A 2UVXA 5AMNA 3O8TA 4FKWA 5AV2A 2RFNA 2JGZA 3T3UA 3BE9A 4MBIA 3O8PA 1Z9XA 4ZTMA 4IWPA 1MQ4A 5IH5A 2QODA 5FTQA 4YJTA 3RAIA 3ZZWA 3IS5A 2VWUA 3KXHA 4HZRA 4CSVA 4DBNA 2WIHA 3KRRA 4FKVA 4FSRA 2OIDA 4KRDA 3R8MA 1PF8A 3FMHA 3QQLA 5M06A 5HI2A 1PXOA 5CSHA 3PLAE 1FINA 4DEBA 3L1SA 2VTQA 3V6SA 1WVXA 3HMIA 5CU0A 2R4BA 2JDTA 4C35A 5EYKA 4GUEA 5CANA 4ASDA 4RFMA 5AP5A 2WZJA 4LYNA 1KE6A 3MN3A 5AP6A 5F95A 2JBOA 4LI5A 3U4WA 2IZSA 3KULA 3MVLA 4N6YA 2QCSA 3O0GA 5GJDA 4QPAA 1OIUA 2XMYA 4XRJA 2VAGA 2WXVA 4BDCA 3DU8A 5J9ZA 4KD1A 3LXKA 2G2HA 2NO3A 2X4ZA 4H36A 4RJ5A 4AA0A 2XF0A 3SD0A 5M4UA 1UU7A 4RQVA 3Q9WA 2HELA 3IDBA 4KB8A 3A4PA 5DT0A 5IH4A 3HAMA 3C9WA 4HZSA 5I5ZA 3UDSA 4IB3A 4LMNA 4CLIA 2PZYA 4FNZA 5K9IA 3LFDA 3CGFA 4EWQA 2WTDA 3DKFA 2C0OA 4JNWA 3VBVA 2J2IB 1CKJA 4X3FC 4X2NA 4XOZA 3PVUA 4O7VA 2XNNA 1PMUA 4LV8A 4BTJA 3OXIA 3WYYA 3ITZA 4ZSLA 5J8IA 4F63A 4L3JA 3SW4A 3MJ2A 4IVDA 2QKWB 4NUSA 1SVGA 3DNDA 3ZYAA 1FOTA 5GZAA 2CN5A 5CWZA 2HCKA 1MRVA 2O8YA 5CY3A 3B8RA 3EQBA 1V0PA 5EYCA 4KIKA 5CT7A 4GT4A 3B8QA 4FKPA 5AP7A 2BIYA 3BBTB 2R5TA 1W84A 1HOWA 4EHGA 3TTJA 1W8CA 3GU7A 5IPJA 4IAZA 4EYMA 3ACJA 3WZUA 3WF5A 2B4SB 5BVOA 4D55A 4BCJA 1JNKA 5D7AA 3SQQA 4NEUA 2GPHA 1U4DA 2ITTA 1OL2A 3LXPA 2IVSA 3EQHA 3F5GA 3MJ1A 4OLIA 4YJOA 3VJOA 4BDFA 4R1YA 5KMKA 4FT5A 3CQWA 3KF7A 4RX9A 5D1JA 4DFUA 2VTPA 3Q6WA 2ZDTA 4S32A 2OFVA 3G6GA 2YM3A 4Z3VA 4MWIA 5AP0A 3PRIA 1OIQA 5L2TA 4BL1A 3F3TA 4XRLA 3OC1A 3P86A 4X7QA 1OUYA 5DR2A 2UZDA 4FT3A 2X1NA 3R21A 5B2LA 4RIXB 5JQ5A 3NUAA 4DT8A 3LAUA 4E6QA 4AOJA 2PK9A 5CQWA 2E9PA 3VNTA 3ZO4A 5LMBA 4DDIA 3UVPA 4ACDA 4B8LA 2E9NA 1YOMA 3PXRA 4FIEA 3NIEA 3OROA 4S30A 5D41A 4WOVA 4ASEA 2G01A 3F2RA 4N4SA 2OXDA 4D5KA 5CEKA 1O6KA 1T46A 3TUDA 1FGKA 2OGVA 4LUDA 3AKKA 2W1IA 4LRKA 3ZOSA 1GZNA 3E3PA 4R77A 3EFJA 1PXNA 2QOIA 3QQGA 4O2ZA 2PHKA 4E4LA 3I6WA 2OLCA 5J1VA 1NVRA 3ML1A 2YEXA 2RFDA 2CGWA 5CEQA 3UP7A 4EK3A 3LPBA 1P5EA 1XBCA 4XBUA 4DE4A 2PUUA 3IW7A 3O96A 3H9OA 3UC4A 4O0RA 3F6XA 3M2WA 4X2GA 3RHXA 4DLIA 2DWBA 3W2RA 4QMYA 2J7TA 2UW6A 4MWHA 1BX6A 4FK6A 1ZYCA 3KCKA 2CKEA 2W0JA 2QONA 4W9XA 2YM5A 4RVTA 2GNFA 2JIIA 3GCUA 3MPAA 4D2SA 2QOCA 5HCXA 2X9EA 3HMPA 3LXLA 3Q9ZA 4QEBA 2ZDUA 3E3BX 3NYXA 5KCVA 4BDIA 3OS3A 1AD5A 4RC2A 2YISA 2WGJA 3CBLA 4H1JA 3RKBA 1SM2A 3ZLSA 1QPDA 4RG0A 4RLKA 5FM2A 3RP9A 2X6EA 3QGYA 4JRVA 3F3VA 4IX6A 1V1KA 3JPVA 3U6HA 3Q52A 4TT7A 2WQBA 5I3OA 2ITYA 1WMKA 5K4IA 3NLBA 4TNBA 4ZIMA 4BDDA 3P5KA 4FV6A 3THBA 5AUUA 4HGSA 3BL7A 3KC3A 4JMQA 3FMEA 5DR6A 3IDPA 3SA0A 4QRCA 3TM0A 4L67A 4MF1A 5CASA 3AQVA 5KBRA 5B0XA 2VTMA 3NEWA 4MCVA 2BKZA 4JT3A 5E9EA 2G1TA 3QKMA 1GIHA 2ZM3A 1U46A 3NUYA 3L9NA 5F94A 1M17A 2AYPA 3D4QA 1YHWA 1TQMA 3R8PA 3QRKA 4QQ5A 3PXYA 4MVFA 5EG3A 2LAVA 2B53A 5LQFA 4O0YA 2BILB 2Z02A 3C4XA 4CRSA 2UZNA 4AN3A 3MFRA 2RG6A 4BRXA 3OWPA 3P7CA 4I93A 4YGAA 4FODA 2IVTA 3DXNA 1K2PA 1J1BA 3DLSA 5DBXA 5AAEA 4RFYA 2W4JA 3SLSA 3R7UA 3V5LA 4BIEA 4I6BA 1XH9A 3ZEPA 4RX8A 2ZOQA 1OZ1A 3QCSA 3W0NA 5JZJA 3MTFA 4IM3A 2XNPA 3FUPA 2XK9A 3IW5A 4R3RA 4BN1A 1LP4A 5IEYA 1B39A 3KA0A 1G8SA 2ZV9A 3NPCA 5CEMA 3C5UA 4C4EA 5K3YA 4EOSA 4QPMA 5HVKA 5G1XA 2YM8A 3CTQA 3NRMA 2HZNA 3FL4A 5HU9A 3E92A 2ITOA 5JH6A 4GKHA 3V6RA 3PA3A 3NFGB 2FVDA 4YJNA 3G9LX 5FDXA 5JMSA 4ZAUA 4MAOA 5E1EA 3MWUA 2Y4IB 1FGIA 3II5A 3ORLA 4V0GB 3BLAA 2YJRA 5LVOA 4QPSA 2I0EA 2WMSA 3LM0A 2Z8CA 3COMA 4FA2A 1WBTA 4CTBA 1ZLTA 1JSTA 4PNIA 4XP2A 3LVPA 2ETKA 2NP8A 3MPTA 3TJDA 3LMGA 1AGWA 4KINA 3ZTXA 2H6DA 1EH4A 4DYMA 1BL7A 4HCTA 4ZJJA 2R7IA 4RC3A 1Y8YA 4D2PA 3FZPA 4B7TA 4C37A 3PDTA 3ROYA 2GFSA 2EUFB 2UV2A 2E9UA 2VTTA 5B2KA 3LKMA 2YLEA 4OAVB 3AD5A 3U54A 2UW9A 4QO9A 5IZFA 3JVRA 3EIDA 3U6JA 5C8NA 3I81A 1WCCA 3QZFA 5TT7A 4RWJA 3WZEA 3HA6A 4DGNA 4UMPA 1GZ8A 3OHTA 2P33A 4NM7A 4WNOA 3ZSHA 4X3FB 3QTWA 4DF3A 4EBVA 2F57A 3ZBXA <