4JRVA

Crystal structure of egfr kinase domain in complex with compound 4c
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
324
structure length
300
Chain Sequence
GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELTSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDDMDDVVDADEYLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Protein Kinase Inhibitor Design by Targeting the Asp-Phe-Gly (DFG) Motif: The Role of the DFG Motif in the Design of Epidermal Growth Factor Receptor Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
total genus 86
structure length 300
sequence length 324
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4jrvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4jrvA01
4I23A 2GHGA 4XG7A 2QOOA 2QLUA 3ODZX 3OF0A 4X2GA 3M1SA 2XEYA 4O0XA 5GIOE 5CYIA 3OT3A 1X8BA 4Z55A 4DAWA 2FSOX 4RBLA 3CD8A 4ZMFA 4FTIA 4PX6A 4ZTMA 5HX6A 1KE5A 1XBAA 3UGCA 1T46A 4G2FA 4R3PA 2C47A 2QKWB 1YXUA 3EQBA 4QMYA 4FKLA 2CHLA 4GJ3A 2C6DA 1ERKA 5HLPA 3NYNA 4ITJA 4LG4A 2DWBA 3C51A 2VWIA 2ITZA 4S33A 2XUUA 3P7AA 4IVCA 4ZLOA 4QP4A 3DNDA 4ONAA 2EXEA 2G9XA 2QG5A 3SXRA 3EL7A 2J4ZA 3GEQA 4PTCA 3RPSA 1ZOHA 3NUSA 3PSCA 3Q4TA 3QRJA 4X3FA 4I41A 5TO8A 4F9BA 4MKCA 4PL5A 3GC9A 1FVTA 5AUVA 4OT5A 2F7XE 4W4YA 2YM8A 4DFNA 2ETMA 2C0OA 3EJ1A 3NS9A 4IAIA 4PNKA 3QRIA 2XJ0A 3KU2A 4BBMA 1URCA 4U42A 4D4RA 3OW4A 2H34A 4GKHA 1ZXEA 3EQHA 3SW4A 3UVPA 3OXIA 5IF1A 3C13A 5M4UA 3TZ9A 3ORTA 4AGUA 5IA0A 1H28A 2GFSA 3PSBA 2ZJWA 4MXCA 1JKTA 2F49A 3DTCA 4RPVA 4FV9A 4B99A 4A7CA 2OJIA 4OTHA 3CTJA 1JKLA 1KE7A 2R9SA 5HCZA 2GNJA 1PKDA 3F5XA 4FTUA 3Q5ZA 1YW2A 3ZXTA 1XH7A 2XYNA 3DK6A 3QX2A 3UTOA 3C5UA 3LQ5A 3MFSA 3K2LA 4MD9E 3Q53A 4YTIA 3UVRA 1URWA 4TYIA 5IZFA 3P78A 3SG9A 4MWIA 5JRSA 2GPHA 2IO6A 5E8UA 4ARKA 4QNAA 5AUZA 3MVLA 4MTAA 4BR3A 5J87A 3POZA 2FYSA 3QL8A 5JGAA 2Z7LA 4E93A 4IX3A 3MESA 4EZ7A 4QTCA 5JZNA 3MA3A 4J52A 5AAFA 4J7BA 2JLDA 4JBOA 4H3QA 4UMTA 5AUUA 3W16A 2X8DA 4O2PA 4A07A 2YHVA 2VTOA 2Y6MA 4QQJA 2VWUA 2W96B 1P4FA 2VD5A 3RP9A 5IQBA 5CEMA 2A19B 3AXWA 1S9JA 1OL2A 1Q97A 3U6IA 3P4KA 1DS5A 3D5UA 2VO7A 3PPKA 2JFLA 4ANQA 2RKUA 3GFEA 3G33A 4ZOGA 4HVDA 4FKOA 3GGFA 1U5QA 3SDJA 3QQKA 3RAIA 3U9NA 3UOKA 2ZVAA 4H05A 1FOTA 3OBGA 2OJGA 2P33A 4PPAA 5EYCA 2CKQA 4PMPA 3LZBA 5IDNA 2UW9A 4HYUA 5J7HA 3SXFA 2WMTA 3HA8A 3LKMA 4YZDA 3ZSHA 3MJ2A 3W1FA 3HUCA 4FKRA 5AUXA 4E6CA 3DB8A 3DBCA 1ZY5A 5C1QB 1IR3A 4Y46A 1MP8A 3TZMA 3PG3A 2XYUA 4CZYB 4O21A 3IW4A 3ORPA 2UUEA 3FMNA 4LOQA 4G16A 4XLVA 3PUPA 4FIHA 1M52A 3UBDA 3ZDUA 4EONA 3BGPA 3VWAA 5KBQA 2W17A 2OH0E 1ZAOA 3N9XA 2XJ1A 2BPMA 4M84A 4Q2AA 4Y95A 2IW8A 2VO3A 4RZVA 3FZOA 4U97A 1OM1A 3QZFA 3LM0A 4JG6A 3HMOA 4EH9A 4QMVA 1RJBA 3HV3A 4IACA 3LXKA 3DPKA 5E8WA 4C3PA 3P5KA 2OZOA 3OOMA 3VW8A 1R1WA 4HVIA 5IA1A 2BDWA 5HU3A 4KS7A 2BROA 3DDPA 1JWHA 1B38A 3ZFYA 2YJSA 1BL6A 4BDHA 2OLCA 1H4LA 3EKNA 2ESMA 4DGLC 4Z16A 1ZOEA 2YCFA 4FG8A 4BI2A 4OAUC 4QMSA 4D5HA 4A9TA 3L9MA 4IJ9A 4IX4A 4F6UA 3D2KA 4U7ZA 5IPJA 2B52A 4J71A 4F9AA 5BVFA 2XEZA 5TKDA 4DF3A 1IEPA 1H24A 3DJ7A 5EG3A 4K6ZA 2E2BA 4YC8A 2VTRA 5G1XA 5HO6A 5TOZA 4BCGA 1MQ4A 4TWPA 4ZXTA 5D7VA 4Y73A 5KE0A 4QYYA 4FIGA 3P86A 3LFFA 4U81A 5CEIA 3C4XA 3R6XA 3PIYA 4YO4A 4FKSA 4MNFA 4RJ6A 4CVAA 3BV3A 3UDBA 4DG2E 4PDOA 2W5AA 3LXNA 2GNLA 4RIWA 2R3QA 2WPAA 3Q5IA 1A48A 3AMBA 4XG6A 2QO2A 5J9YA 2C6OA 3QLGA 4R77A 5LMAA 3C1XA 1WVXA 4ZAUA 4DHFA 1KE8A 3NUNA 3FXWA 2R7IA 5FWKK 4DLJA 4EOIA 3MIAA 1GZ8A 3K3IA 3L8VA 5IDPA 4UV0A 4CZUA 5DR2A 1LR4A 2UZEA 4AT3A 4BDJA 1DI8A 4HCVA 4PL4A 2UZTA 3CEKA 4DEBA 5CAQA 1Y57A 3BHUA 4CV9A 2J6MA 3R1YA 4LI5A 4BIDA 5CAOA 3RAWA 4LOPA 1JAMA 3HV7A 1XHAA 4QMXA 4OT6A 3A60A 4G5JA 4ZP5A 2R5TA 2JITA 5AV1A 4TNDA 5JKGA 2DQ7X 2UW3A 1I09A 4U3ZA 2WQNA 3MY1A 3QKKA 4M0ZA 4OTRA 4OLIA 5AWMA 1KV2A 2VWZA 3Q6UA 5KZIA 3PP1A 4YP8A 3GQIA 4XP3A 5DRBA 4BCPA 4GH2A 3FHRA 4IH8A 2C6IA 3ULIA 3QTUA 2WMXA 1PXMA 2XP2A 3H9FA 3PTGA 4OTWA 2ERKA 4RVMA 4E5AX 3SRVB 2DYLA 4WG4A 2HELA 3BE9A 2YM5A 3R01A 4FT0A 2NP8A 3UQGA 4JAJA 5KO1A 5M57A 3KC3A 5FP5A 4R7HA 1REJA 4FTQA 4O83A 3F3TA 4H3PA 5M4IA 2C4GA 3FY2A 2VTLA 3FAAA 4QQCA 4ZZMA 3MPAA 4EOJA 4I6BA 2EWAA 4P90A 5IEXA 3UNZA 3LMIA 2ONLA 5FD2A 3VVHA 4S2ZA 5GZ8A 3SW7A 3E7VA 2XB7A 4KBAA 4F64A 4E4NA 4AW2A 2HZNA 4GMYA 1Q62A 5JFSA 4GU6A 2X4FA 3QCSA 1IA9A 2CKEA 4D2RA 3IW7A 5ANOA 3KL8A 3BU6A 3LFEA 4L8MA 4TL0A 5DR6A 4RIOA 4ZTNA 3TDVA 4AZVA 4R7BA 2WXVA 4O2ZA 1XH6A 3GFWA 1Q8ZA 4WRGA 2Y4PA 4QTAA 4YLJA 1WFCA 2JDSA 4KKEA 4FZAB 4ERKA 3ID6C 4FT3A 4FEWA 1W83A 3QC4A 1OIRA 3VAPA 2G15A 5C03A 2VGOA 2H8HA 4ZEGA 4EKKA 1NVSA 1B39A 2XA4A 4PDYA 3CJFA 3NW6A 3BKBA 4EBVA 3CY3A 4AOTA 3F66A 5EW8A 4ENYA 4RIXA 5FTOA 3CBLA 2CKPA 4XCUA 2CGWA 2PZ5A 4HGLA 3OBJA 2C0TA 5AP3A 3PRFA 3P79A 5CAUA 4R5SA 1B6CB 3U87A 1QL6A 4BL1A 3RM6A 4AT5A 2WTWA 1OL7A 4IAYA 2B9HA 1XO2B 2XM8A 1RE8A 4DH8A 1YOMA 1AD5A 3DXNA 3KXHA 4FNYA 1O6YA 4MH7A 3CCNA 2AYPA 3KCFA 4V0GA 4Y5HA 5LVLA 4EL9A 4IWQA 5HCXA 4FT7A 3O50A 3DFCB 4I6HA 2WOTA 4WIHA 5DE2A 3VULA 3TTJA 1KE6A 3IDPA 1UNGA 3BYSA 3KK8A 5EYKA 4I3ZA 4FKPA 3TNQB 5A4EA 3GUBA 4KB8A 1REKA 4KKGA 2X4ZA 4XUFA 3ZSIA 2OFUA 3D5VA 4BICA 3ZLWA 4PQNA 5DEWA 4O0VA 4TWNA 4JDKA 3ETAA 3JXWA 5FXRA 5JZJA 3R73A 1FGKA 1G8AA 3PLAE 2HK5A 4FICA 3VRZA 4BKJA 5DN3A 4Y83A 5AV2A 5TT7A 3OC1A 3R8UA 4KAOA 4FV6A 4W8EA 2V5QA 4IWPA 2O0UA 4IMYA 1YXTA 3TZ7A 4IBMA 3NX8A 1PXIA 4L67A 4CKRA 3UG1A 4QP9A 1OVEA 3G2FA 1NY3A 4F65A 4RQKA 3AG9A 3RNIA 4PUZA 4ENXA 4R6VA 4IB5A 4E6DA 3NRMA 3D7TB 4II5A 4C33A 5HLNA 4Q9SA 2C0IA 2UW0A 5CZIA 3PJ2A 3VN9A 1PMUA 3KB7A 2YJRA 1OIQA 4YTCA 5BNJA 1K3AA 3QKMA 5AR5A 3THBA 3VBQA 4BCJA 4EZ3A 3PVUA 5FG8A 2FUMA 4FI1A 1FMKA 3EQCA 1VR2A 3KKVA 2QONA 4HCUA 4UMQA 3RBWA 4O91A 4IX6A 2YFXA 3IQ7A 4UYNA 5HICA 4GEOA 1ZYSA 4CFVA 3CQUA 2XIXA 2BKZA 3E3PA 4ZSJA 5ANJA 2PE0A 2YAKA 4E6AA 3O8UA 4Z7GA 4Z7HA 4FIEA 4R5YA 2PMIA 4LGDA 5JFVA 2LAVA 3D7ZA 3ET7A 4G9RA 5HE2A 1LEWA 3D0EA 2FGIA 4EKLA 4L44A 4G6LA 1OI9A 4NTTA 2BRBA 4B6LA 4EOLA 4D2VA 3W8LA 4HW7A 4AOJA 2PMLX 1M17A 3A7IA 4RA5A 4CQEA 4FZDB 5C8KA 1YDRE 4Y5QA 4KS8A 1UU9A 3BLRA 3KVXA 3IECA 2XNOA 5JFWA 2VWYA 2VRXA 2B53A 5FRIA 4CYJA 4ZSGA 3I0QA 4GJ2A 3I7BA 3LFNA 4QMUA 2X81A 3E62A 2R3GA 2ZM3A 4LYNA 4NCTA 3RCDA 5KBRA 2ZV2A 1CMKE 4V04A 3R9HA 4G3DA 1UKHA 4BDFA 4PPCA 2IWIA 3EWHA 3WYXA 5IA2A 4O81A 3UE4A 4YGAA 5LCJA 2OFVA 5GZ9A 1SZMA 3FZSA 3GI3A 4DGGA 3LXPA 4X3FC 3ZRKA 2X2LA 1GZNA 3A7GA 1JSUA 3EQRA 4JIKA 3T8OA 1K9AA 2WEVA 1H1SA 5IISA 1DAWA 2W4JA 3PZEA 3T9IA 4AT4A 4HVGA 2JDVA 3DCVA 1RDQE 5H8BA 4IB1A 3ACKA 4FKGA 1P14A 4JQEA 3ZRMA 3I81A 4P5QA 3DKFA 5D1JA 2EB3A 3ORKA 4C57A 2XK9A 4XX9A 2R3PA 1YXXA 2YCRA 5GJFA 4RVLA 2GU8A 4NIFA 3AMYA 4ERWA 4FTRA 2YM4A 3EN4A 1U5RA 2VUWA 3QXOA 4G3FA 4XV2A 5FM2A 4EUTA 5L6WL 2OWBA 3F82A 2JC6A 3O7LD 5IUIA 4CFXA 2Q0NA 3ZDIA 3AT3A 2XNBA 2GCDA 4YZBA 3RPOA 4AW5A 3OCBA 5DOSA 4IM0A 2WTVA 3U4WA 3DBDA 3FPMA 2ZV8A 3G6HA 2ITTA 4RFZA 2WMSA 5HCYA 1H0VA 2ITNA 3AGLA 3GNIB 4O1PA 5E90A 3DBFA 3KMUA 2P2IA 3RJCA 3SX9A 1YI6A 3GCVA 4IXPA 5CT7A 4C8BA 5C8NA 1PXKA 2VZ6A 4DT9A 2DS1A 2QR8A 3VUHA 5EFQA 2P4IA 3KXMA 2WQEA 5J8IA 1ZZLA 4EH2A 1Q8YA 3VUIA 3UQFA 1YDSE 1NW1A 1VZOA 4ID7A 5KHWA 4O7VA 4QTDA 3RTPA 2R64A 4I6FA 4BHNA 3AC1A 4RJ4A 3SV0A 4I22A 4C4IA 2PMNX 3FLSA 2B9FA 1V0BA 2PTKA 2PY3A 2B7AA 5D11A 5DH3A 3V8WA 2X7OA 4YJNA 2CLXA 4TYHB 4FKJA 3GC0A 5HIEA 4JR3A 3DXQA 4KBCA 5HG9A 4ZTRA 1VYZA 2VWXA 2IVTA 5DLSA 1KSWA 3ZC5A 3PVWA 3QBNA 4J97A 3KRLA 2W4KA 1P5EA 3LW0A 4FE2A 3CPCA 3SGCA 4QP3A 4EH5A 4KBKA 4YJSA 3QZIA 3SVVA 4XP2A 2HZIA 4D28A 5A3XA 2OXXA 2PL0A 1WAKA 2EXMA 2JKOA 3FQHA 3DS6A 2BIYA 3MTLA 2W1CA 2XIYA 4YLKA 4A4LA 4FEXA 3IONA 2OIDA 3CXWA 3CQEA 2X8IA 3G51A 3GOKA 2JAMA 4S34A 4FUYA 4B0GA 3A7FA 3ZMMA 2BFYA 3Q4CA 1ND4A 2ZDUA 2UZDA 4FSZA 3QD2B 2W06A 4MBLA 5BMSA 5DWRA 3QQFA 1GIJA 3VW6A 4BYJA 5LVMA 4KIPA 3UOLA 5M4FA 5DT4A 5I9WA 5KMJA 2A0CX 5CQWA 1YI4A 3BWFA 5J1WA 2NO3A 1Z57A 3PG1A 4FVPA 5BVKA 4C58A 2B54A 4J1RA 4X2KA 4BI0A 1NVRA 3QRTA 2BAKA 3COHA 3DZQA 2QHMA 3NVKI 4D2SA 4L6QA 4FBXA 4ANLA 3R9RA 4R1YA 3KXXA 4K18A 4U41A 2BHHA 2C3JA 2OJFE 2VTSA 3DLZA 3DTWA 3A7JA 3LJ0A 4LOOA 4CT2A 3N4VA 4M69B 2WTJA 3BHTA 4JDHA 1GIIA 5CS6A 3Q4ZA 2OG8A 2OJ9A 1ZMWA 4FIFA 4D55A 3S00A 4WBBB 2YISA 2WMAA 4JOAA 4M8TA 5AR8A 5DEYA 3VNTA 2PUPA 4JG8A 2HWPA 3VBWA 4F9CA 3UC4A 3FSFA 4Q5HA 2QOLA 3ZEWA 4UX9A 2H6DA 4GSBA 3EFLA 3TZ8A 4EBWA 4IQ6A 2VWVA 1J91A 1OKWA 3QQUA 5J79A 2CNVA 1Y8GA 3FWQA 3OZ6A 5M53A 2V22A 5BQ0A 4MBJA 3H9RA 4H58A 4U9AA 3V5QA 5DBXA 4WA9A 4W9XA 2ONLC 1OECA 5T6KA 3O7LB 4D1SA 5I9ZA 4OR5A 4L9IA 4OGRA 4X21A 4YTHA 3NNUA 4XV3A 3VJNA 3IW6A 2R2PA 3R0TA 4YMJA 3N4UA 4NSTA 2XKFA 5BVDA 5J9LA 5T68A 4BCOA 3LQ3A 4EZ5A 3VF8A 4USFA 5LOHA 3DQWA 3HRBA 4CTCA 2FSLX 4EQUA 4FSYA 3BRBA 4W4VA 4DFLA 4QMNA 4CGAA 3BGQA 3ZRLA 4OTIA 3BI6A 3KQ7A 5LCKA 4EQCA 3LM5A 3WZKA 1OBDA 3PPJA 4KIKB 4F70A 5CXZA 4KA3A 5M4CA 2XKEA 3COMA 4FZ6A 4I92A 4TN6A 1Q3DA 3FZ1A 4O22A 4YPSA 4CV8A 3G5DA 4DYMA 2NRYA 3OTUA 3BQCA 3JUHA 3VS0A 3FLQA 3FV8A 1LEZA 3I5NA 4IWOA 3RZBA 4CKIA 4ALWA 4MF1A 5E91A 3HLLA 4ACHA 1JSTA 1W7HA 2BIKB 2QCSA 3JVRA 5CANA 1H00A 4BB4A 4YHFA 4JXFA 4USDA 4NFNA 3VUMA 2A1AB 3FI3A 4B7TA 4D2WA 3HMMA 3POOA 3OEZA 4CG9A 3RVGA 3U4UA 4D0WA 3NW7A 2YCSA 3F3UA 1KOBA 2PVHA 4QPMA 4O6LA 5CU3A 5A4QA 2J0JA 1Q41A 5IQEA 4IZ5A 4G34A 3IG7A 1UNLA 3OW3A 4WOVA 5EOLA 4AG8A 2W7XA 2O5KA 4MCVA 3SOCA 3O51A 3BE2A 3PE2A 2Y6OA 4I4FA 5AR2A 2W4OA 1BL7A 2HAKA 3IGGA 2P0CA 3H0ZA 2YAAA 1PXJA 3LHJA 4HJOA 4X3JA 5AP4A 5EW3A 4EOSA 4FA2A 4ZZNA 3RPRA 1E9HA 3TNHA 3QTSA 2XS0A 4WUAA 4TRLA 2QHNA 5DR9A 3RPVA 4ITHA 4C2WA 2RFEA 3L8SA 2C3IB 3FYJX 1WBWA 3NR9A 4EC9A 2YDIA 3R8LA 4FODA 4IIRA 1PMEA 3AC3A 3V5TA 3EL8A 2P55A 4LRKA 5K0KA 3NCZA 3HX4A 3R21A 5TE0A 4ZY4A 4L45A 4PRJA 1UU3A 1UV5A 5BVNA 2ZM1A 3QCXA 5HBEA 5CEKA 3CP9A 3ROCA 5CF8A 4BDBA 5LVNA 4IC8A 2VTTA 5HQ0A 5FDXA 2YZAA 3BELA 2R3LA 4K77A 4LQMA 5IKWA 2JKQA 5GZAA 2HCKA 1YOJA 2W1GA 3I6WA 5HG8A 3UIBA 5FEQA 2C6LA 3H0YA 3UP2A 4AX8A 4RGJA 5BYYA 1CKJA 1WBOA 2Z2WA 3EN9A 3Q2MA 3W55A 4D4VA 4X0MA 4RMZA 3DA6A 1H08A 3I7CA 3VS7A 2J0KA 3EZVA 4G31A 2OJJA 4GIIA 3RMFA 3K5VA 5ETIA 4GVJA 4HGTA 1SYKA 1YOLA 3AT4A 3W2RA 3FLYA 4V05A 5IQIA 3UZRA 2C3LA 2LGCA 4ZMEA 3QCYA 4L01A 3VUTA 5M06A 2PVMA 4UBAA 5AA8A 4IEBA 1BX6A 2WQOA 4PY1A 4XS2A 5HZNA 3QTXA 5EDRA 3RK9A 2GDOA 4QQTA 4FG9A 5LQFA 4FNZA 4L52A 4BYIA 3RI1A 5KKRC 5HORA 5IMXA 1HCKA 4IZ7A 4FNWA 4TT7A 5DA3A 2CN5A 4J53A 3SKCA 1PXLA 2F2UA 4BTKA 4EK8A 3GXLA 5CEPA 3R9OA 4QYHA 3KF7A 3ZO4A 3E8EA 4GFOA 4C61A 4YJRA 4EK4A 1A06A 4BTMA 1YHVA 3NZ0A 3OWPA 3RCJA 1WZYA 3BYUA 5HE1A 1GIHA 4E1ZA 2WOUA 5DFPA 4C35A 2QOBA 1JLUE 1DAYA 4F08A 2WKMA 2HIWA 1WCCA 3DU8A 3LFQA 4FTLA 5FQDC 4YU2A 3LMHA 4F6SA 2GTMA 4PMMA 4IB3A 2VX3A 3R22A 3NW5A 3DK7A 3ORLA 3F69A 1Y8YA 3LFDA 3BYOA 3DB6A 5D41A 2UZOA 2OO8X 1NVQA 5EI6A 4WG5A 4AFJA 3ANRA 5AP7A 3HECA 3CD3A 2WMVA 3MDYA 4C37A 1WBVA 1CM8A 3CKWA 5BVEA 4OAVB 1PXNA 1JKSA 3R7EA 4C38A 5HD4A 4D4YA 3S0OA 3QYZA 2OBJA 2WNTA 3B2TA 1J1BA 3OROA 4BN1A 2QR7A 2OIBA 2OXDA 1OPJA 3ULZA 4AA5A 1YKRA 2PE2A 3TI1A 4GVAA 4E5WA 2JDTA 5L6PA 3BBWA 3FKOA 4DFYA 5E92A 1STCE 4MBIA 3RK5A 4B8MA 2WMUA 2W1IA 3U51A 1FINA 5A46A 5GJGA 3ZLXA 1GOLA 3F7ZA 3R00A 4G6OA 4ZY6A 4D1XA 2XNGA 5D10A 1ZOGA 4XLIA 4RIYA 4USEA 3QRUA 3D4QA 1UVRA 3QGWA 1YWVA 3KN6A 5AP0A 3ORXA 4G1WA 3R8MA 4LM5A 4ZS0A 2X6DA 5E8ZA 4EOPA 3AOXA 2F57A 4O7LA 4GRBA 2VTQA 1CSNA 4XBRA 1NA7A 4G5PA 3CJGA 3DNEA 3R2YA 4MXXA 4A9RA 1VYWA 2PWLA 3Q6WA 2WMWA 4FSUA 5HD7A 2CJMA 4HNFA 4NIFB 2BRGA 4E8AA 4FTNA 3JYAA 1IG1A 2QOCA 5KZ0A 3SLSA 5DYJA 4FK6A 3MGYA 4XG9A 4RFYA 4TTHB 5HG7A 2GS7A 3BCEA 1KV1A 4FNXA 2Y9QA 3MVHA 3NNXA 5B2KA 2I40A 4FTAA 3PVGA 3D83A 4K9YA 3HUBA 2VTMA 4M68A 1AQ1A 3I5ZA 4L3LA 3BWJA 1LP4A 3CKXA 4MNEB 4O0YA 4W4WA 2F7ZE 3FSKA 2VX1A 3GC7A 3OHTA 3TT0A 4QYEA 4JR7A 4NFMA 1PRYA 2BILB 5ICPA 4RWLA 4NH1A 5K0XA 3UODA 4MVFA 5IU2A 5AIKA 5C8MA 2QG7A 4P5ZA 2WQBA 1PY5A 3DAEA 4X3FB 2UZBA 3FMMA 4M66A 4BWKA 4Z3VA 4FYNA 3UYTA 5HIBA 3QU0A 1NXKA 5A6OA 4AGWA 3QX4A 5JH6A 4X7QA 4DH5A 5KMIA 4IAFA 3VUDA 3SOAA 3UVQA 3QA0A 3OXTA 4U43A 2FVDA 3MFUA 2CN8A 1XKKA 3E64A 2GSFA 2BAJA 4R1VA 4CCBA 4ZTLA 5D12A 3UJGA 4CQGA 4EYJA 5HNIX 2PZPA 4FTMA 4O96A 1PYXA 4BKZA 2ERZE 4M14A 3ZXZA 4I5CA 1UKIA 2X9EA 3LFBA 2ZDTA 4FKTA 4K2RA 5DGZA 4QP7A 5A6NA 4ZIMA 3FI8A 3P1AA 3IO7A 5CT0A 2PPQA 2PVNA 5AV3A 2WZJA 2UW6A 3WIKA 2PZYA 3HNGA 4U6RA 5IUGA 2R3IA 4UWYA 4PV0A 5HEZA 4EI4A 1OL6A 3OP5A 4DG0E 3VQUA 1FBNA 2RG6A 4QYGA 3UPXA 3EZRA 4YC6A 2OI4X 2PVKA 3OWJA 3WIGA 4RWJA 3C4CA 4AGCA 3MFRA 3TUBA 5IH5A 3UP7A 2FA2A 4G9CA 4CEGA 2E9UA 3ZHPC 3DJ5A 5HOAA 2QOKA 4MQ1A 2QNJA 4F7NA 3IS5A 4D5KA 5HVYA 4IJPA 4M13A 1EH4A 2R7BA 3PY3A 4Y85A 1H8FA 3VJOA 4GG7A 5EQPA 5H2UA 4AFEA 4AN3A 2CDZA 4S32A 3FYKX 4QRCA 3FI4A 3WARA 4FTCA 5M09A 5JGBA 5EK7A 4MQ2A 4IVBA 3VUGA 4XRLA 5I9VA 3BIZA 1OKZA 5L3AA 2WMQA 2BR1A 3AT2A 2W1EA 4CMTA 4F1OA 3QHRA 3EQIA 3MY5A 4FZFB 2Y4IB 2B1PA 5CI7A 3UMXA 5I4NA 5L6OA 3G9NA 1PF8A 1CTPE 3AGMA 4APPA 4DH7A 3HAMA 4L7FA 3ZCLA 4AZFA 3LIJA 4YJPA 2HZ0A 2XRWA 1OUYA 5F95A 3KRWA 4LMUA 5AM6A 3LLTA 4CMOA 2RIOA 3F6XA 5A4LA 2AC3A 4GS6A 3G15A 3ZZWA 4UXQA 5LMKC 4O84A 3PRIA 2HY81 2EXCX 5ANDA 4FL1A 3EMGA 4PDSA 3UIXA 3NUAA 4I24A 4WUNA 1SVHA 4FUXA 1GZOA 2QU6A 4HGSA 4N70A 1Q3WA 3LQ8A 4G3CA 4HCTA 4XOYA 5IQFA 1M7QA 3BHVA 5JQ8A 3UG2A 1WBPA 3MPMA 5HX8A 3BZ3A 3QLFA 4NJ3A 4C4GA 1BKXA 2OIQA 1Q8UA 4FT9A 5I3OA 4ZJJA 5CSXA 5E8VA 3I4BA 4XV9A 4XV1A 3EB0A 4CXAA 2XBJA 4M3QA 4UMRA 2ZMCA 2OXYA 4JDIA 3BYMA 5I9XA 3A99A 5FTGA 4U40A 2XK3A 3VUKA 3ZH8A 4NWMA 2OF4A 3MFTA 4HPTE 3HRFA 3G0EA 3NWWA 2QOIA 2Z02A 2G2IA 3DZOA 2ITUA 3HRCA 4RLLA 5GHVA 4GKIA 5EHYA 5CSHA 3S4QA 4O86A 5EOBA 1SVEA 3KA0A 4UN0C 5DT3A 3ZLYA 2WHBA 4GU9A 3AC4A 3PFQA 4HYSA 3E63A 3ZONA 5AV0A 5IQHA 3H4JA 3IW5A 2BALA 3MBLA 1XH5A 3ZS5A 4UMUA 5BVOA 2W05A 5J5TA 4J96A 1JVPP 3RINA 4AA0A 2ITVA 4CFWA 5CSWA 4ZLYA 2IW9A 5EM7A 2B55A 3QA8A 3G6GA 3VRYA 4EH7A 2BZKB 2P2HA 4JBQA 3EQFA 4W4XA 4DN5A 3BYVA 3F7WA 4BGQA 1Q24A 2X0GA 3Q9XA 3O8TA 4CLIA 5FEDA 4YTFA 5CVHA 4NW5A 4FL3A 2JIIA 4DEIA 5IQDA 1HCLA 3R83A 4ACMA 4FZ7A 2XK8A 4JT3A 3NYVA 4GIHA 1DI9A 3EYHA 4I4EA 4F9YA 5I3RA 1FMOE 4MD8E 4WNPA 3TJDA 2YZLA 4RJ5A 3GQLA 2OW3A 4QMTA 4WNKA 3AD6A 3D5XA 4ANSA 2PVFA 4ZTSA 3CS9A 4C4JA 1OPKA 3MH1A 2WTIA 2XBAA 5C4LA 4TY1A 4OTGA 2R0IA 4IZYA 3WF8A 4BDGA 1OUKA 4IC7A 3AC5A 3ZU7A 3GP0A 3I79A 2VWBA 3A4PA 4LGGA 1Z9XA 3P9JA 2JBOA 3WI6A 4ALUA 3QKLA 4XMOA 4FV7A 4TNBA 3P23A 4DE4A 5HKMA 2HYYA 2R4BA 5AP1A 3TV7A 4AXAA 3PA3A 5HU9A 2RFDA 3LFCA 1YDTE 4JQ7A 4U5JA 2XNNA 4YJVA 4YJOA 2YITA 2PZIA 4KSQA 3FPQA 3L1SA 1ZMUA 3PA5A 3TCPA 5JN2A 4OBQA 4JS8A 4W9WA 4QNYA 4BCFA 5E4HA 4L43A 4FKQA 3Q9WA 2PUIA 2XIRA 1AGWA 5E8SA 2DUVA 3DOGA 2IVUA 4E73A 4O0TA 4R78A 2QOQA 4QP6A 5CNOA 5CAPA 4NU1A 2EU9A 2V7OA 2CCHA 2XCKA 4UXLA 2YABA 2IZSA 1GJOA 4NM3A 1T45A 1WVYA 1UU7A 3HP2A 3VS3A 4N57A 2GS2A 2UV2A 1OGUA 4UZHA 2BDFA 2O65A 3RHXA 1E1XA 3FZRA 4KIQA 4YBJA 3TWJA 2HENA 5HVJA 3TDWA 3WYYA 1CKPA 2SRCA 3N51A 3AD4A 3G9LX 2X2KA 3PVBA 2W9FB 4RJ3A 1Q4LA 5H9BA 2ITYA 3BU3A 3KVWA 4LL0A 1R0PA 4OW8A 5D7AA 4AE9A 4RX8A 3V5JA 3NLBA 5L2WA 3ACJA 3V01A 5CALA 3FMHA 3ORNA 4IDTA 4NYEA 2IZTA 3QGYA 3TUDA 3GT8A 4TYHA 4Y8DA 5C9CA 3R7GA 3WF6A 2VN9A 4EK6A 5FXSA 2QU5A 3C4ZA 4MXZA 3CSVA 1SVGA 5FM3A 1HOWA 1APME 3R9DA 3IK3A 2XF0A 4JI9A 2XNPA 4NK9A 5ANKA 4DEEA 5CTPA 2I1MA 4EHZA 2XRUA 5DPVA 3PIXA 3RAHA 4LUEA 3WE8A 2C5XA 4I5HA 2YEXA 4PTEA 3MSSA 2OICA 3WZJA 4Q9ZA 4IWDA 5EYMA 4CKJA 5JSMA 2HXQA 4WBOA 3ZOSA 2X8EA 4G17A 4DGMA 2UZLA 1IRKA 3LCKA 4KSPA 2V62A 1MUOA 4I0TA 4P4CA 1U46A 3JPVA 2ZM4A 4PTGA 4OUCA 2EUFB 2PE1A 4D9TA 3ZUTA 3BV2A 3HDMA 1O6LA 4C3FA 3A2CA 5ANGA 2ZV9A 2GFCA 2BZIB 4O1OA 1MRYA 5ETFA 4E26A 4U3YA 3KEXA 3E92A 3Q04A 3W2SA 3CGFA 4WKQA 2IW6A 3EYGA 1H25A 4DH3A 3Q52A 4E4XA 1IASA 5B2MA 2B4SB 4BDIA 2RF9A 2WMRA 3NUYA 3AD5A 2F7EE 4KIKA 4MEDA 2FSMX 4KRCA 5KMLA 3HDNA 1JQHA 2J2IB 1ZY4A 3OD6X 1YWRA 4IHPA 3KRXA 3UOHA 1H26A 1PJKA 3DK3A 4GG5A 4MWHA 5K4JA 2WB8A 3LCDA 4PDPA 5K5XA 5GJDA 3FXXA 3WZEA 5CSVA 3H10A 3KXZA 5AR7A 3VQHA 1U54B 4M12A 5DNRA 2BAQA 4H1MA 2RFNA 3L8XA 5B0XA 4E6QA 2G2FA 2C6EA 3IOPA 4YSJA 3PXQA 3TL8A 3NUUA 3VS6A 3EQPA 3V8TA 2OH4A 2YIWA 1J1CA 3MH3A 3V5PA 4IANA 4IB0A 3W2PA 2PZRA 3P08A 3BEGA 3PY1A 4N6ZA 3FLNC 4U44A 5FLFA 4O82A 2JEDA 1J3HA 2J0LA 3BU5A 3CGOA 3NIEA 2YLFA 5GINE 1BYGA 5L8KA 5JQ5A 2C5NA 3PA4A 4A9UA 1ATPE 5CU0A 5M44A 2Z7RA 1G3NA 4AP7A 2ZOQA 3VBVA 4BTJA 4D4SA 2ITOA 1V0PA 3UMWA 5IA4A 2V0DA 3V5WA 4E4MA 4ACGA 3NYOA 1Y6BA 3PWDA 4I1ZA 3FMLA 4PPBA 4QP1A 5EH0A 5B7VA 3UNJA 2Z7SA 2WD1A 2WU6A 3KK9A 4HGEA 3QUEA 5AUYA 2VV9A 3OT8A 4RLKA 1WBTA 2OZAA 4JX3A 1OPLA 1G8SA 3HV5A 3QAME 2Z7QA 3B8RA 3BGZA 4EC8A 2HWOA 4RC2A 4D0XA 3QTWA 4G6NA 3FMDA 3E93A 1J7LA 1KUTA 2XJ2A 3PZHA 4O7RA 5HG5A 2QOFA 3NNVA 4M97A 3V51A 1TKIA 4FKUA 4AZTA 2R3RA 4RG0A 2IN6A 3F3WA 4EHGA 5CF5A 1ZLTA 4X6QC 2CKOA 4BC6A 4CT1A 2VGPA 3GC8A 1Q8TA 3PP0A 3PXYA 3QRKA 2UZWE 4AAAA 3R04A 3R7OA 4FC0A 2YN8A 3ELJA 3H3CA 3SA0A 4NUSA 5E8TA 4F0FA 4ZZOA 2XK7A 5BPYA 4OTQA 3HAVA 3I0OA 4HVSA 2GQGA 4FG7A 5HTIA 4ITIA 1XWSA 4BVUA 2PYWA 3TJCA 3QZGA 1QPDA 2C3KA 3GU5A 4QT1A 4HZSA 5EI8A 4LL5A 5JMSA 4ALVA 3V8SA 3UO6A 4ORKA 4ANNA 1H27A 4YSMA 1OIYA 5I0BA 1F5QA 1TVOA 3TNWA 4ZSAA 1SM2A 4QMZA 5BUIA 4LMNA 2BZJA 4LV5A 2WO6A 1MQBA 5J7BA 2OF2A 3NAYA 1M2PA 3LCTA 4IM2A 4DITA 2Y0AA 4EORA 3NMUF 5LARA 5JT2A 2BKKA 5FBNC 2E9OA 1YVJA 2CMWA 4FTKA 5AA9A 3LFAA 2CSNA 1Z5MA 3SXSA 4BRXA 1LUFA 4EWHA 4MYGA 4UWCA 2QVSE 4FKVA 2I6LA 4I5PA 1FVVA 3MN3A 3WOWA 4BY9E 2ZB0A 3NAXA 3ORMA 3UZPA 2RFSA 2ZYBA 3D15A 2I7QA 5HIDA 3VHKA 4C3RA 3TXOA 3VBXA 2X7FA 3ANQA 2FH9A 2GNFA 3R7UA 4KKHA 5IA5A 4EH4A 5DI1A 4ASXA 2O8YA 3O96A 3NUPA 5FDPA 4DLIA 2ITWA 2FSTX 3L9NA 4I94A 4TWCA 5K3YA 3TACA 4E7WA 5CEQA 4PP7A 5AV4A 5GIPE 4FOBA 3ZO3A 1VJYA 3ALOA 2XVDA 3KY2A 4OTFA 3KXGA 5KMOA 3FBVA 3PE1A 3R71A 3ROYA 3FLWA 4PWNA 4NCTC 5FP6A 3VS1A 4BDCA 4D2PA 5B2LA 3LMGA 4MNEA 4DFUA 3UNKA 4RZWA 2QO7A 4LGHA 4H36A 3SHEA 4LRJA 5CF4A 4UWBA 3FZTA 2OGVA 4TZRA 5H8EA 5E1SA 4QTBA 5CVGA 5CY3A 4HYHA 2YIRA 4N0SA 3BPRA 3ZC6A 4DFZE 4YJTA 3VS4A 5JK3A 5K9IA 3NCGA 4I21A 4QMPA 4DC2A 2YACA 3R1QA 4K33A 5EKOA 3LPBA 3GU7A 3EN7A 4FIIA 2OK1A 4TWOA 3KULB 1PKGA 3FL4A 3L9PA 3OCGA 2R0UA 4YZMA 3OWLA 3S1HA 5E1EA 5FUTA 3TV6A 4ACCA 5AAGA 4O7TA 2UW8A 4IM3A 2X2MA 4GV1A 4MF0A 2XNEA 3ODYX 3HP5A 5HI2A 5CU6A 3ZYAA 2GTNA 2YIXA 2Z60A 4K11A 4WNOA 5K4IA 4KUJA 3OOGA 5AIRA 3F88A 3DXPA 3MYGA 1J7IA 5DIAA 2CPKE 4QP8A 5L4QA 2CGXA 3CY2A 5ANIA 4H39A 3RPYA 4XG2A 4BGHA 2HXLA 5ACKA 1OMWA 4XG3A 1QPJA 2I0YA 3E7OA 3FY0A 4UY9A 5L8JA 2IPXA 5EM5A 3PXKA 5C4KA 1BLXA 4C36A 3ZUVA 4O7YA 2XCHA 4AWIA 4P2KA 2VX0A 4N6YA 3V04A 4CCUA 4OTDA 3PIZA 5EW9A 4DBXA 5J95A 4LFIA 5HBHA 3MY0A 2C68A 3AQVA 3O17A 3R2BA 4GUEA 2XM9A 4PMSA 1W8CA 4J98A 4F99A 5I5ZA 3C0HA 4FV1A 3UC3A 1O6KA 1U59A 3Q32A 2YIQA 4W8DA 3RK7A 2IG7A 2PMOX 4RC4A 2AUHA 3RAKA 5F94A 3TTIA 4GUBA 4QP2A 1U54A 4TXCA 2JDRA 5HO7A 3CE3A 1KOAA 5E8XA 4FX3A 4UB7A 4FEQA 2RSVA 4C0TA 4F0GA 3OUKA 2FO0A 5M51A 3S3IA 2F9GA 4L00A 3NUXA 3DGKA 3R63A 4PP9A 2OSCA 1LPUA 3D9VA 1YI3A 3ORZA 4AF3A 4XRJA 3C5IA 2ZV7A 2C1BA 5EDPA 5FEEA 3C7QA 3F3VA 4L46A 4Y72A 4IE9A 4NM0A 3LVPA 3TIZA 4R8QA 1ZRZA 3MH0A 3Q4UA 4QMOA 2WMBA 3II5A 2VAGA 3ZO2A 4BDEA 4F0IA 3ENMA 5I9YA 1XH9A 3K54A 2QO9A 4FSNA 3OY1A 1ZMVA 2W1HA 3QXPA 2UZNA 1BI7A 2JAVA 3Q60A 4JBPA 4CD0A 5HBJA 2VTAA 3FL5A 4IADA 1GY3A 3A8WA 4U79A 4X2FA 4AZSA 5CU4A 4M67A 3EIDA 4PNIA 5AP2A 3E87A 5J5SA 3MTFA 4N4SA 5LVPA 2R3KA 2NNWB 1R39A 3C4FA 3QZHA 2Y7JA 5AR4A 3E5AA 3WILA 4ZLZA 4C34A 1IAJA 2HW7A 3QTRA 4ZS4A 3B2WA 4C59A 4QO9A 2BRNA 2JIVA 3DFAA 3VF9A 5EKNA 3S2PA 4CTBA 2ETKA 3GU8A 2CLQA 3UIMA 3VS5A 4XYFA 4EJNA 3GCSA 5CX9A 4NEUA 3R30A 2GQSA 4BBEA 2I0HA 3HV4A 5L2IA 2OZAB 3P7BA 3TKUA 4D2TA 4RX5A 1NT2A 4I20A 3BLHA 3DY7A 5EM6A 5A4TA 1Y6AA 4ZY5A 4F9WA 5AX9A 2B9IA 3HV6A 3K3JA 1OL5A 4O7SA 4FOCA 4NL0A 2J5EA 4H1JA 4BIBA 2XH5A 2UZUE 3PPZA 5KHXA 4YZ9A 4ZSEA 3T3UA 4DEHA 3DKOA 2EVAA 3VBYA 4EOMA 4IDVA 4QQ5A 5E8YA 3U6JA 4CMUA 5AP6A 4A9SA 4I0SA 4U45A 5BUEA 4L7SA 4QOXA 5KMNA 3LAUA 5L8LA 3LFSA 4JAIA 3U6HA 4ASZA 3LCSA 3Q9ZA 4G3EA 2V7AA 3F5GA 4ZSLA 2I0EA 4A06A 3FXZA 2ZB1A 2PULA 2R3JA 4FSRA 4NKSA 1YRPA 3T3VA 1TQPA 1WMKA 4MD7E 2B9JA 2XKCA 5DMZA 3TNIA 2VWWA 4DT8A 1Q99A 2C69A 3IPHA 3UOJA 3FKNA 2HW6A 2PUUA 3KRRA 2BRMA 2WU7A 3IDCA 2YWVA 4KD1A 2F4JA 2JIUA 2X7GA 3R7YA 4IFGA 2J7TA 3FDNA 3QD0A 4UYAA 4ANBA 4NZWB 5CENA 4R7IA 2PVRA 4FVRA 4IAKA 4I0RA 2C5OA 1OB3A 2WAJA 4NM7A 3L8PA 4V01A 3OMVA 2W5HA 3BEAA 4BZNA 5F4NA 3ZZEA 3A7HA 4F6WA 1PXPA 4L3PA 3PJCA 1Q5KA 3E8NA 1H07A 4QMMA 4GT3A 3FE3A 4GFGA 3F3ZA 4QMWA 4BDAA 3QYWA 4O0RA 3U55A 3V6RA 4M7IA 4B9DA 4YJUA 1JSVA 2GHLA 3DBQA 3QWKA 4EHEA 3HMPA 2PSQA 3O23A 5BX0A 2QOHA 3W2QA 3CC6A 4DGNA 2Q83A 3TKIA 3OG7A 3UZTA 3M11A 5IQGA 3QD3A 5AAEA 4FYOA 2R3OA 3GBZA 4I93A 4KABA 4RQVA 4YBKA 4L42A 1M2QA 4DGOA 2P3GX 3R8VA 5ETAA 4R3RA 2C6TA 4RVKA 4ANOA 3ZM9A 3F2AA 1YXSA 4XJ0A 4RRVA 1H1WA 3ITZA 2UW7A 3RGFA 4RSSA 2BTRA 3KULA 5DG5A 4AACA 5AX3A 4EWQA 4FV8A 3MVJA 4NT4A 1OKVA 1JBPE 4DCAA 4WHZA 3ORIA 5CLPA 4GL9A 3BHHA 4HPUE 4MXYA 5HNBA 4AN9A 4CRLA 4DG3E 1F3MC 2VU3A 3WZUA 3WF5A 2UW5A 3UO4A 2W1DA 5IH6A 4NM5A 4AGDA 5FXQA 2GMXA 1XJDA 2QC6A 5IEVA 3OY3A 5KCVA 2YA9A 4HYIA 2Q0BA 5KMKA 4BCKA 2X39A 2ZMDA 4IVAA 1XH8A 3W2OA 3MWUA 4FF8A 4TYJA 4AA4A 1XBCA 3OTVA 3DBEA 3I1AA 1M2RA 4MHAA 1H01A 5LMKA 1ZYJA 2VO0A 1BMKA 2J0MB 4UZDA 2BUJA 3A61A 2PVYA 4J99A 3P0MA 1OIUA 4OBOA 5HO8A 3DJ6A 4JVGA 5CF6A 2JKMA 4O6EA 1OL1A 5F1ZA 1RQQA 3HMNA 3DV3A 4E20A 2C5VA 4MXAA 2YWPA 1WBSA 3KRJA 4J8NA 5FGKA 3R9NA 3ZEPA 5A54A 3SG8A 4L68A 5IA3A 3E8CA 4KNBA 4O38A 4V0GB 5BYZA 2W1FA 5EHLA 4CG8A 4CZTA 3R28A 3R8PA 1M14A 2BRHA 3O8PA 3ZFXA 4D58A 4E5BA 3JR1A 4JRVA 2E9PA 3TV4A 1QPCA 4FL2A 5HE0A 3H9OA 3NSZA 4YO6A 2X6EA 4U8ZA 3DAKA 3MI9A 5FBOA 5L2SA 3ATTA 2VO6A 1YXVA 4FV0A 5IQCA 5FTQA 5CSPA 5EYDA 4JNWA 1J7UA 2I0VA 2IVVA 2R3HA 4RIYB 2C5YA 2XK4A 2Y8OA 3OXZA 2YDJA 2GNGA 3QTIA 3RWPA 3WBLA 4E4LA 1IA8A 2BCJA 2ZAZA 4FSQA 4X2JA 4QTEA 5AM7A 1QMZA 4J95A 5AFVA 2VTHA 3FJQE 3LOKA 2W5BA 3NGAA 4FEVA 3GENA 3LE6A 3RALA 5LWNA 1BUHA 3PLSA 2BDJA 3M2WA 4FT5A 1H1PA 4RVTA 1UWJA 3HMIA 4WT6A 4A4XA 4A9YA 5A4CA 4K8AA 3U9CA 3NNWA 4YLLA 4BCMA 1PMVA 3NEWA 5C27A 1ZARA 4BHZA 3A62A 1BI8A 4QPSA 4E3CA 4GCJA 4UEUA 3F5PA 5TR6A 5HNGA 3EKKA 5H8GA 3AMAA 4QMQA 4EHVA 4O27B 3PXFA 1W98A 4BKYA 3HVCA 4L3JA 4NW6A 3FUPA 5K5NA 4M69A 3IW8A 1FVRA 2C30A 3MVMA 4M0YA 4Z9LA 3V3VA 3QQHA 2CGVA 3DAJA 4BZOA 5F20A 5L2QA 2REIA 3MA6A 4YZCA 2XZSA 1YHWA 4JRNA 4AZEA 3MW1A 1V1KA 3QWJA 5KKRB 1Y91A 3KMMA 4C4FA 2VTJA 3U8WA 3IOKA 4I6QA 4S30A 3EFWA 4F4PA 4OTPA 3FMJA 5A14A 3OWKA 4AS0A 5CAVA 3KMWA 1VEBA 3PJ3A 4BGGA 4XNEA 2WTKB 2J51A 3GVUA 4KIOA 2JKKA 1QCFA 2WTDA 4CFMA 4FVQA 2IJMA 2KTYA 3FLZA 2UVYA 3P7CA 2O64A 3V5LA 4DTBA 5I9UA 1YHSA 4QMLA 3TEIA 3GU6A 3FHIA 5E7RA 4DBNA 5EQEA 5C26A 4JIAA 3W10A 3OFMA 4DEAA 5AADA 4BBFA 4EJ7A 3UIUA 4B4LA 2JGZA 2C6MA 2WTKC 3NYXA 5TF9A 3Q96A 3KGAA 3IGOA 4BF2A 2WEIA 3C0IA 4O7ZA 4JBVA 5H3QA 4C4EA 4DFXE 1TQMA 1V0OA 1ZYDA 2PK9A 3V6SA 4EOQA 4P7EA 3TKHA 4RIXB 5LJJA 2GHMA 4FMQA 1QPEA 2GQRA 2GNIA 4CLJA 3DDQA 1W84A 2PHKA 3ENHA 5JGDA 3ZLSA 3TUCA 2JD5A 3R8ZA 4TW9A 2RG5A 5AR3A 5HTCA 4GK2A 1YWNA 3MPTA 3QD4A 4JQ8A 2GS6A 5JEBA 3VIDA 2BZHB 3DKGA 2V55A 4DTAA 4AN2A 1PHKA 3I6UA 4ANMA 2PVJA 4AE6A 1P4OA 3WF9A 2R3MA 4H3BA 5AUTA 3ATSA 4FSTA 4UALA 3LJ1A 1H0WA 3GOPA 4IW0A 3Q3BA 1FPUA 3GCPA 4U80A 4D9UA 5KX8A 2VNYA 4S31A 4YNEA 3PXZA 4HVHA 3QCQA 4F63A 4BCHA 4XG8A 5KMMA 4WSYA 4BIEA 4IAAA 3N4TA 2XNMA 3B8QA 3BX5A 3CTHA 3SD0A 4AU8A 4FK3A 5DT0A 1DM2A 2VTPA 4QPAA 4IAZA 5CASA 4FTOA 4OBPA 2ITQA 3PY0A 5T3QA 2A2AA 4O0SA 3DLSA 3E88A 3R02A 1JNKA 3VC4A 2IVSA 4YURA 3ZSGA 4KRDA 1YQJA 3C50A 3RM7A 5ANEA 4MX9A 2OKRA 3OUNB 4TYEA 4WO5A 5J9ZA 3C4EA 2A27A 5JRQA 2XK6A 2BHEA 2VTIA 3VO3A 2E9NA 3AC8A 1K2PA 4FV2A 4I5MA 4YHJA 2E9VA 4L53A 4Q5EA 4F7JA 4FSMA 4IX5A 2QQ7A 3REPA 4GW8A 3OEFX 3GU4A 4XP0A 3TG1A 2CCIA 2ACXA 2IZRA 3HEGA 5F9EA 3WF7A 2VTNA 3CQWA 4RX7A 4YNOA 3Q9YA 4ZJIA 3W2CA 4APCA 2H9VA 3QHWA 1P2AA 2XMYA 3KN5A 3EQGA 3EFKA 2JBPA 3A8XA 1SMHA 2Y4IC 3D7TA 3TIYA 3QF9A 4GT5A 4EYMA 2J0IA 2NPQA 2PUNA 1GNGA 3D5WA 2C6KA 2W0JA 1GAGA 1PXOA 1KE9A 3PWYA 3G90X 1UU8A 4FR4A 4HOKA 3SRVA 1SNXA 3KREA 3O71A 5IMEA 4YC3A 2RGPA 2PVLA 1CDKA 3JS2A 3MS9A 5BUJA 4LV8A 5HVKA 3MV5A 4FV3A 3R7IA 1OITA 3QFVA 1R0EA 4RA4A 5M56A 4CFFA 4JLCA 4WG3A 4BCQA 3F61A 4O0WA 1E1VA 5CNNA 4XEYA 2GNHA 3C4WA 4JX7A 3TNPC 3BLQA 3OVVA 3TN8A 4UMPA 1UA2A 3ZBXA 3PDTA 4AQCA 1XH4A 2WTCA 3MJ1A 4FSWA 4NTSA 4FV5A 4A4OA 5LWMA 3NVMB 2WELA 2HY0A 3HZTA 3QTZA 2JFMA 3ZUUA 3CLYA 5AEPA 4C02A 4BI1A 4C2VA 5HLWA 2YM7A 3H30A 1H1QA 2R3FA 5LXMA 2QLQA 3JY9A 4WNMA 5JFXA 3D94A 2ITPA 3L9LA 3ZFMA 3RKBA 2FB8A 2JDOA 2W99B 1U4DA 3HA6A 3PJ8A 5A9UA 3VS2A 4BFMA 3TM0A 4FGBA 3KXNA 2QURA 2QKRA 3OS3A 2O2UA 2X9FA 3LCOA 4ASEA 2UVZA 3DT1A 1ZZ2A 4BZDA 4EOKA 4BTFA 2YERA 4CFNA 4R3CA 4FIJA 1FGIA 4F7SA 2QD9A 3SC1A 3F5UA 3EOCA 3BHYA 3MH2A 5AJQA 1MRUA 3UYSA 1PMNA 4BWPA 3COIA 4TYGA 5IG1A 3S95A 4YZNA 4F1TA 1JPAA 5J1VA 1O9UA 4K0YA 3BBTB 4DH1A 4GYGA 1G5SA 4BCIA 3MB6A 3ERKA 4TKSA 4EOOA 2XIZA 3ALNA 4WSQA 4WD5A 3W33A 5C01A 3HYHA 2ETRA 4G3GA 3FZPA 3HGKA 4JG7A 5DVRA 3VBTA 4BDDA 2G2HA 5IQAA 3IDBA 3NIZA 4RIWB 3PSDA 3CR0A 3I60A 4C4HA 1XR1A 4O0UA 2BMCA 3FQSA 3K5UA 4JDJA 3QC9A 3JVSA 3GB2A 1M7NA 5CU2A 3EN5A 3KCKA 3ZO1A 4BCNA 2KULA 3HL7A 4YJQA 1JKKA 2J50A 4NJDA 1TQIA 4EH3A 3R1SA 3SAYA 4EK5A 5BMMA 3CPBA 4BWXA 4FKWA 4CFUA 3G0FA 4HNIA 1R78A 3EH9A 1PYEA 3FQEA 3O0GA 2CNQA 3QQGA 3MB7A 2A4LA 4AW0A 5ITAA 2O3PA 3T9TA 5BVWA 4PMTA 4NKAA 2YM6A 3UO5A 3EFJA 4ASDA 3PXRA 5AP5A 2YIYA 4EQMA 1CKIA 2F2CB 4ZK5A 3QQJA 1W0XC 4RFMA 1MRVA 4DTKA 3JY0A 3ZBFA 2B0QA 5CQUA 5EM8A 3QALE 5IH4A 3QUPA 5CZHA 4FTJA 3OCSA 4DEDA 5EDQA 1KWPA 4JJRA 3C9WA 3R7VA 2HOGA 4EH6A 1XQZA 4CRSA 4XHKB 5HHWA 2WIPA 2WQMA 3FC2A 3FI2A 3O2MA 4DINA 3W8QA 1ZWSA 2UW4A 3WZDA 4DFBA 3VHEA 5KUPA 4CYIA 3UQCA 4GYIA 4ZJVA 3FC1X 4RJ7A 4KWPA 5LMBA 4RWIA 1SNUA 1R3CA 3Q2JA 2ITXA 1W82A 4RX9A 4JL9A 4AZWA 1I44A 4K1BA 4YHTA 4F1MA 5L2TA 5M55A 1L8TA 3A4OX 4GK3A 2G01A 4M15A 3AC2A 3GCUA 5ETCA 2XKDA 5AUWA 5HE3A 1UNHA 4AW1A 4QD6A 2EB2A 3QUDA 3E3BX 4J8MA 1WVWA 4RWKA 2VNWA 3COKA 5KNJA 2G1TA 2YCQA 2BTSA 4TPTA 3RHKA 2WIHA 4MXOA 4GFMA 4EEVA 3FEGA 3OCTA 5CI6A 4DA5A 2O63A 3F2NA 5D9HA 4O7NA 4LRMA 2UZVA 5GNKA 4EUUA 4YUQA 3ZM4A 3R1NA 4D1ZA 3M42A 5M07A 4C7TA 1Q61A 4XG4A 4ACDA 3LLAA 1ZYLA 1A9UA 2WFYA 3RZFA 3NDMA 5HGIA 3UPZA 1XBBA 3QTQA 1UWHA 1WBNA 4DCEA 4YR8A 5HTBA 4PL3A 3EHAA 4FGRA 2CNUA 4XOZA 1Q8WA 4DEGA 2OU7A 3U54A 2YLEA 3NPCA 2UVXA 2PU8A 1ZYCA 4X2NA 2WGJA 3BQRA 2BVAA 2YM3A 3PJ1A 3D14A 3CIKA 2Z8CA 3RNYA 4LUDA 4X6RA 4XH6A 3ZTXA 4AUAA 4IFCA 3KF4A 4FKIA 2W1ZA 4HZRA 2R3NA 4YPDA 3EN6A 3F9NA 4FEUA 5CXHA 2H96A 2QODA 4CSVA 4FV4A 1OBGA 1PW2A 4WRSA 2AC5A 5IEYA 5CEOA 3LXLA 4MK0A 4ZTHA 1IAHA 3DQXA 4QYFA 4FTTA 3SQQA 4B8LA 5CVFA 3FMEA 1H1RA 4EK3A 1OKYA 3FKLA 1L3RE 4ZTQA 4PF4A 3FMKA 3F2RA 3QQLA 2J90A 3RWQA 4GT4A 3C0GA 2CGUA 5ACBC 3WE4A 5E9EA 1OZ1A 2YDKA 4KINA 4AOIA 4BDKA 2HZ4A 3LJ2A 4GK4A 2NRUA 4IZAA 4CNHA 3PYYA 3D2IA 1GZKA 4XBUA 3KFAA 1S9IA 4RT7A 3W32A 2XIKA 2C1AA 4IVDA 3HKOA 5DRDA 3IKAA 2J5FA 2QI8A 3EQDA 2RL5A 1FQ1B 4RC3A 3W18A 4F7LA 2BFXA 4C62A 5M08A 4O7WA 5EQYA 4MAOA 2J9MA 1F0QA 3GCQA 5IUHA 5BYLA 5EI2A 5EHOA 5HESA 4F09A 4U0IA 4RJ8A 5G6VA 1JOWB 2IZUA 2X1NA 5DHJA 5AMNA 1RW8A 3E8DA 3CTQA 3MIYA 4EH8A 2W9ZB 5LVOA 3DKCA 5CWZA
chains in the Genus database with same CATH superfamily
4I23A 2GHGA 4XG7A 2QOOA 2QLUA 3ODZX 3OF0A 4X2GA 3M1SA 2XEYA 4O0XA 5GIOE 5CYIA 3OT3A 1X8BA 4Z55A 4DAWA 2FSOX 4RBLA 3CD8A 4ZMFA 4FTIA 4PX6A 4ZTMA 5HX6A 1KE5A 1XBAA 3UGCA 1T46A 4G2FA 4R3PA 2C47A 2QKWB 1YXUA 3EQBA 4QMYA 4FKLA 2CHLA 4GJ3A 2C6DA 1ERKA 5HLPA 3NYNA 4ITJA 4LG4A 2DWBA 3C51A 2XAOA 2VWIA 2ITZA 4S33A 2XUUA 3P7AA 4IVCA 4ZLOA 4QP4A 3DNDA 4ONAA 2EXEA 2G9XA 2QG5A 3SXRA 3EL7A 2J4ZA 3GEQA 4PTCA 3RPSA 1ZOHA 3NUSA 3PSCA 3Q4TA 3QRJA 4X3FA 4I41A 5TO8A 4F9BA 4MKCA 4PL5A 3AKJA 3GC9A 1FVTA 5AUVA 4OT5A 2F7XE 4W4YA 2YM8A 4DFNA 2ETMA 2C0OA 3EJ1A 3NS9A 4IAIA 4PNKA 3QRIA 2XJ0A 3KU2A 4BBMA 1URCA 4U42A 4D4RA 3OW4A 2H34A 4GKHA 1ZXEA 3EQHA 3SW4A 3UVPA 3OXIA 5IF1A 3C13A 5M4UA 3TZ9A 3ORTA 4AGUA 5IA0A 1H28A 2GFSA 3PSBA 2ZJWA 4MXCA 1JKTA 2F49A 3DTCA 4RPVA 4AXCA 4FV9A 4B99A 4A7CA 2OJIA 4OTHA 3CTJA 1JKLA 1KE7A 2R9SA 5HCZA 2GNJA 1PKDA 3F5XA 4FTUA 3Q5ZA 1YW2A 3ZXTA 1XH7A 2XYNA 3DK6A 3QX2A 3UTOA 3C5UA 3LQ5A 3MFSA 3K2LA 4MD9E 3Q53A 4YTIA 3UVRA 1URWA 4TYIA 5IZFA 3P78A 3SG9A 4MWIA 5JRSA 2GPHA 2IO6A 5E8UA 4ARKA 4QNAA 5AUZA 3MVLA 4MTAA 4BR3A 5J87A 3POZA 2FYSA 3QL8A 5JGAA 2Z7LA 4E93A 3BL7A 4IX3A 3MESA 4EZ7A 4QTCA 5JZNA 3MA3A 4J52A 5AAFA 4J7BA 2JLDA 4JBOA 4H3QA 4UMTA 5AUUA 3W16A 4DDGA 2X8DA 4O2PA 4A07A 2YHVA 2VTOA 2Y6MA 4QQJA 2VWUA 2W96B 1P4FA 2VD5A 3RP9A 5IQBA 5CEMA 2A19B 3AXWA 1S9JA 1OL2A 1Q97A 3U6IA 3P4KA 1DS5A 3D5UA 2VO7A 3AKKA 3PPKA 2JFLA 4ANQA 2RKUA 3GFEA 3G33A 4ZOGA 4HVDA 4FKOA 3GGFA 1U5QA 3SDJA 3QQKA 3RAIA 3U9NA 3UOKA 2ZVAA 4H05A 1FOTA 3OBGA 2OJGA 2P33A 4PPAA 5EYCA 2CKQA 4PMPA 3LZBA 5IDNA 2UW9A 4HYUA 5J7HA 3SXFA 2WMTA 3HA8A 3LKMA 4YZDA 3ZSHA 3MJ2A 3W1FA 3HUCA 4FKRA 5AUXA 4E6CA 3DB8A 3DBCA 1ZY5A 5C1QB 1IR3A 4FRFA 4Y46A 1MP8A 3TZMA 3PG3A 2XYUA 4CZYB 4O21A 3IW4A 3ORPA 2UUEA 3FMNA 4LOQA 4G16A 4XLVA 3PUPA 4FIHA 1M52A 3UBDA 3ZDUA 4EONA 3BGPA 3VWAA 5KBQA 2W17A 2OH0E 1ZAOA 3N9XA 2XJ1A 2BPMA 4M84A 4Q2AA 4Y95A 2IW8A 5BV3A 2VO3A 4RZVA 3FZOA 4U97A 1OM1A 3QZFA 3LM0A 4JG6A 3HMOA 4EH9A 4QMVA 1RJBA 3HV3A 4IACA 3LXKA 3DPKA 5E8WA 4C3PA 3P5KA 2OZOA 3OOMA 3VW8A 1R1WA 4HVIA 5IA1A 2BDWA 5HU3A 4KS7A 2BROA 3DDPA 1JWHA 1B38A 3ZFYA 2YJSA 1BL6A 4BDHA 2OLCA 1H4LA 3EKNA 2ESMA 4DGLC 4Z16A 1ZOEA 2YCFA 4FG8A 4BI2A 4OAUC 4QMSA 4D5HA 4A9TA 3L9MA 4IJ9A 4IX4A 4F6UA 3D2KA 4U7ZA 5IPJA 1ST0A 2B52A 4J71A 4F9AA 5BVFA 2XEZA 5TKDA 4DF3A 1IEPA 1H24A 3DJ7A 5EG3A 4K6ZA 2E2BA 4YC8A 2VTRA 5G1XA 5HO6A 5TOZA 4BCGA 1MQ4A 4TWPA 4ZXTA 5D7VA 4Y73A 5KE0A 4QYYA 4FIGA 3P86A 3LFFA 4U81A 5CEIA 3C4XA 3R6XA 3PIYA 4YO4A 4FKSA 4MNFA 4RJ6A 4CVAA 3BV3A 3UDBA 4DG2E 4PDOA 2W5AA 3LXNA 2GNLA 4RIWA 2R3QA 2WPAA 3Q5IA 1A48A 3AMBA 4XG6A 2QO2A 5J9YA 2C6OA 3QLGA 4R77A 5LMAA 3C1XA 1WVXA 4ZAUA 4DHFA 1KE8A 2X0OA 3NUNA 3FXWA 2R7IA 5FWKK 4DLJA 4EOIA 3MIAA 1GZ8A 3K3IA 3L8VA 5IDPA 4UV0A 4CZUA 5DR2A 1LR4A 2UZEA 4AT3A 4BDJA 1DI8A 4HCVA 4PL4A 4DHJA 2UZTA 3CEKA 4DEBA 5CAQA 1Y57A 3BHUA 4CV9A 2J6MA 3R1YA 4LI5A 4BIDA 5CAOA 3RAWA 4LOPA 1JAMA 3HV7A 1XHAA 4QMXA 4OT6A 3A60A 4G5JA 4ZP5A 2R5TA 2JITA 4BJJB 5AV1A 1OGYA 4TNDA 5JKGA 2DQ7X 2UW3A 1I09A 4U3ZA 2WQNA 3MY1A 3QKKA 4M0ZA 4OTRA 4OLIA 5AWMA 1KV2A 2VWZA 3Q6UA 5KZIA 3PP1A 4YP8A 3GQIA 4XP3A 5DRBA 4BCPA 4GH2A 3FHRA 2XAMA 4IH8A 2C6IA 3ULIA 3QTUA 2WMXA 1PXMA 2XP2A 3H9FA 3PTGA 4OTWA 2ERKA 4RVMA 4E5AX 3SRVB 2DYLA 4WG4A 2HELA 3BE9A 2YM5A 3R01A 4FT0A 2NP8A 3UQGA 4JAJA 5KO1A 5M57A 3KC3A 5FP5A 4R7HA 1REJA 4FTQA 4O83A 3F3TA 4H3PA 5M4IA 2C4GA 3FY2A 2VTLA 3FAAA 4QQCA 4ZZMA 3MPAA 4EOJA 4I6BA 2EWAA 4P90A 5IEXA 3UNZA 3LMIA 2ONLA 5FD2A 3VVHA 4S2ZA 5GZ8A 3SW7A 3E7VA 2XB7A 4KBAA 4F64A 4E4NA 4AW2A 2HZNA 4GMYA 1Q62A 5JFSA 4GU6A 2X4FA 3QCSA 1IA9A 2CKEA 4D2RA 3IW7A 5ANOA 3KL8A 3BU6A 3LFEA 4L8MA 4TL0A 5DR6A 4RIOA 4ZTNA 3TDVA 4AZVA 4R7BA 2WXVA 4O2ZA 1XH6A 3GFWA 1Q8ZA 4WRGA 2Y4PA 4QTAA 4YLJA 1WFCA 2JDSA 4KKEA 4FZAB 4ERKA 3ID6C 4FT3A 4FEWA 1W83A 3QC4A 1OIRA 3VAPA 2G15A 5C03A 2VGOA 2H8HA 4ZEGA 4EKKA 1NVSA 1B39A 2XA4A 4PDYA 3CJFA 3NW6A 3BKBA 4EBVA 3CY3A 4AOTA 3F66A 5EW8A 4ENYA 4RIXA 5FTOA 3CBLA 2CKPA 4XCUA 2CGWA 2PZ5A 4HGLA 3OBJA 2C0TA 5AP3A 3PRFA 3P79A 5CAUA 4R5SA 1B6CB 3U87A 4LDTA 1QL6A 4BL1A 3RM6A 4AT5A 2WTWA 1OL7A 4IAYA 2B9HA 1XO2B 2XM8A 1RE8A 4DH8A 1YOMA 1AD5A 3DXNA 3KXHA 4FNYA 1O6YA 4MH7A 3CCNA 2AYPA 3KCFA 4V0GA 4Y5HA 5LVLA 4EL9A 4IWQA 5HCXA 4FT7A 3O50A 3DFCB 4I6HA 2WOTA 4WIHA 5DE2A 3VULA 3TTJA 1KE6A 3IDPA 1UNGA 3BYSA 3KK8A 5EYKA 4I3ZA 4FKPA 3TNQB 5A4EA 3GUBA 4KB8A 1REKA 4KKGA 2X4ZA 4XUFA 3ZSIA 2AEGA 2OFUA 3D5VA 4BICA 3ZLWA 4PQNA 5DEWA 4O0VA 4TWNA 4JDKA 3ETAA 3JXWA 5FXRA 5JZJA 3R73A 1FGKA 1G8AA 3PLAE 2HK5A 4FICA 3VRZA 4BKJA 5DN3A 4Y83A 5AV2A 5TT7A 3OC1A 3R8UA 4KAOA 4FV6A 4W8EA 2V5QA 4IWPA 2O0UA 4IMYA 1YXTA 3TZ7A 4IBMA 3NX8A 1PXIA 4L67A 4CKRA 3UG1A 4QP9A 1XMLA 1OVEA 3G2FA 1NY3A 4F65A 4RQKA 3AG9A 3RNIA 4PUZA 4ENXA 4R6VA 4IB5A 4E6DA 3NRMA 3D7TB 4II5A 4C33A 4O4FA 5HLNA 4Q9SA 2C0IA 2UW0A 5CZIA 3PJ2A 3VN9A 3NFGB 1PMUA 3KB7A 2YJRA 1OIQA 4YTCA 5BNJA 1K3AA 3QKMA 5AR5A 3THBA 3VBQA 4BCJA 4EZ3A 3PVUA 5FG8A 2FUMA 4FI1A 1FMKA 3EQCA 1VR2A 3KKVA 2QONA 4HCUA 4UMQA 3RBWA 4O91A 4IX6A 2YFXA 3IQ7A 4UYNA 5HICA 4GEOA 1ZYSA 4CFVA 3CQUA 2XIXA 2BKZA 3E3PA 4ZSJA 5ANJA 2PE0A 2YAKA 4E6AA 3O8UA 4Z7GA 4Z7HA 4FIEA 4R5YA 2PMIA 4LGDA 5JFVA 2LAVA 3D7ZA 3ET7A 4G9RA 5HE2A 1LEWA 3D0EA 2FGIA 4EKLA 4L44A 4G6LA 1OI9A 4NTTA 2BRBA 4B6LA 4EOLA 4D2VA 3W8LA 4HW7A 4AOJA 2PMLX 1M17A 3A7IA 4RA5A 4CQEA 4FZDB 5C8KA 1YDRE 4Y5QA 4KS8A 1UU9A 3BLRA 3KVXA 3IECA 2XNOA 5JFWA 2VWYA 2VRXA 2B53A 5FRIA 4CYJA 4ZSGA 3I0QA 4GJ2A 3I7BA 3LFNA 4QMUA 2X81A 3E62A 2R3GA 2ZM3A 4LYNA 4NCTA 3RCDA 5KBRA 2ZV2A 1CMKE 4V04A 3R9HA 4G3DA 1UKHA 4BDFA 4PPCA 2IWIA 3EWHA 3WYXA 5IA2A 4O81A 3UE4A 4YGAA 5LCJA 2OFVA 5GZ9A 1SZMA 3FZSA 3GI3A 4DGGA 3LXPA 4X3FC 3ZRKA 2X2LA 1GZNA 3A7GA 1JSUA 3EQRA 4JIKA 3T8OA 1K9AA 2WEVA 1H1SA 5IISA 1DAWA 2W4JA 3PZEA 3T9IA 4AXEA 4AT4A 4HVGA 2JDVA 3DCVA 1RDQE 5H8BA 4IB1A 3ACKA 4FKGA 1P14A 4JQEA 3ZRMA 3I81A 4P5QA 3DKFA 5D1JA 2EB3A 3ORKA 4C57A 2XK9A 4XX9A 2R3PA 1YXXA 2YCRA 5GJFA 4RVLA 2GU8A 4NIFA 3AMYA 4ERWA 4FTRA 2YM4A 3EN4A 1U5RA 2VUWA 3QXOA 4G3FA 4O4DA 4XV2A 5FM2A 5L6WL 2OWBA 4EUTA 3F82A 2JC6A 3O7LD 5IUIA 4CFXA 2Q0NA 3ZDIA 3AT3A 2XNBA 2GCDA 4YZBA 3RPOA 4AW5A 3OCBA 5DOSA 4IM0A 2WTVA 3U4WA 3DBDA 3FPMA 2ZV8A 3G6HA 2ITTA 4RFZA 2WMSA 5HCYA 1H0VA 2ITNA 3AGLA 3GNIB 4O1PA 5E90A 3DBFA 3KMUA 2P2IA 3RJCA 3SX9A 1YI6A 3GCVA 4IXPA 5CT7A 4C8BA 5C8NA 1PXKA 2VZ6A 4DT9A 2DS1A 2QR8A 3VUHA 5EFQA 2P4IA 3KXMA 2WQEA 5J8IA 1ZZLA 4EH2A 1Q8YA 3VUIA 3UQFA 1YDSE 1NW1A 1VZOA 4ID7A 5KHWA 4O7VA 4QTDA 3RTPA 2R64A 4I6FA 4BHNA 3AC1A 4RJ4A 3SV0A 4I22A 4C4IA 2PMNX 3FLSA 2B9FA 1V0BA 2PTKA 2PY3A 2B7AA 5D11A 5DH3A 3V8WA 2X7OA 4YJNA 2CLXA 4TYHB 4FKJA 3GC0A 5HIEA 4JR3A 3DXQA 1G8KA 4KBCA 5HG9A 4ZTRA 1VYZA 2VWXA 2IVTA 5DLSA 1KSWA 3ZC5A 3PVWA 3QBNA 4J97A 3KRLA 2W4KA 1P5EA 3LW0A 4FE2A 3CPCA 3SGCA 4QP3A 4EH5A 4KBKA 4YJSA 3QZIA 3SVVA 4XP2A 2HZIA 4D28A 5A3XA 2OXXA 2PL0A 1WAKA 2EXMA 2JKOA 3FQHA 3DS6A 2BIYA 3MTLA 2W1CA 2XIYA 4YLKA 4A4LA 4FEXA 3IONA 2OIDA 3CXWA 3CQEA 2X8IA 3G51A 3GOKA 2JAMA 4S34A 4FUYA 4B0GA 3A7FA 3ZMMA 2BFYA 3Q4CA 1ND4A 2ZDUA 2UZDA 4FSZA 3QD2B 2W06A 4MBLA 5BMSA 5DWRA 3QQFA 1GIJA 4O4EA 3VW6A 4BYJA 5LVMA 4KIPA 3UOLA 5M4FA 5DT4A 5I9WA 5KMJA 2A0CX 5CQWA 1YI4A 3BWFA 5J1WA 2NO3A 1Z57A 3PG1A 4FVPA 5BVKA 4C58A 2B54A 2IF8A 4J1RA 4X2KA 4BI0A 1NVRA 3QRTA 2BAKA 3COHA 3DZQA 2QHMA 3NVKI 4D2SA 4L6QA 4AAYA 4FBXA 4ANLA 3R9RA 4R1YA 3KXXA 4K18A 4U41A 2BHHA 2C3JA 2OJFE 2VTSA 3DLZA 3DTWA 3A7JA 3LJ0A 4LOOA 4CT2A 3N4VA 3PUFC 4M69B 2WTJA 3BHTA 4JDHA 1GIIA 5CS6A 3Q4ZA 2OG8A 2OJ9A 1ZMWA 4FIFA 4D55A 3S00A 4WBBB 2YISA 2WMAA 4JOAA 4M8TA 5AR8A 5DEYA 3VNTA 2PUPA 4JG8A 2HWPA 3VBWA 4F9CA 3UC4A 3FSFA 4Q5HA 2QOLA 3ZEWA 4UX9A 2H6DA 4GSBA 3EFLA 3TZ8A 4EBWA 4IQ6A 2VWVA 1J91A 1OKWA 3QQUA 5J79A 2CNVA 1Y8GA 3FWQA 3OZ6A 5M53A 2V22A 5BQ0A 4MBJA 3H9RA 4H58A 4U9AA 3V5QA 5DBXA 4WA9A 4W9XA 2ONLC 1OECA 5T6KA 3O7LB 4D1SA 5I9ZA 4OR5A 4L9IA 4OGRA 4X21A 4YTHA 3NNUA 4XV3A 3VJNA 3IW6A 2R2PA 3R0TA 4YMJA 3N4UA 4NSTA 2XKFA 5BVDA 3UDZA 5J9LA 5T68A 4BCOA 3LQ3A 4EZ5A 3VF8A 4USFA 5LOHA 3DQWA 3HRBA 4CTCA 2FSLX 4EQUA 4FSYA 3BRBA 4W4VA 4DFLA 4QMNA 4CGAA 3BGQA 3ZRLA 4OTIA 3BI6A 3KQ7A 5LCKA 4EQCA 3LM5A 3WZKA 1OBDA 1XMMA 3PPJA 4KIKB 4F70A 5CXZA 4KA3A 5M4CA 2XKEA 3COMA 4FZ6A 4I92A 4TN6A 1Q3DA 3FZ1A 4O22A 4YPSA 4CV8A 3G5DA 4DYMA 2NRYA 3OTUA 3BQCA 3JUHA 3VS0A 3FLQA 3FV8A 1LEZA 3I5NA 4IWOA 3RZBA 4CKIA 4ALWA 4MF1A 5E91A 3HLLA 4ACHA 1JSTA 1W7HA 2BIKB 2QCSA 3JVRA 5CANA 1H00A 4BB4A 4YHFA 4JXFA 4USDA 4NFNA 3VUMA 2A1AB 3FI3A 4B7TA 4D2WA 3HMMA 3POOA 3OEZA 4CG9A 3RVGA 3U4UA 4D0WA 3NW7A 2YCSA 3F3UA 1KOBA 2PVHA 4QPMA 4O6LA 5CU3A 5A4QA 2J0JA 1Q41A 5IQEA 4IZ5A 4G34A 3IG7A 1UNLA 3OW3A 4WOVA 5EOLA 4AG8A 2W7XA 2O5KA 4MCVA 3SOCA 3O51A 3BE2A 3PE2A 2Y6OA 4I4FA 5AR2A 2W4OA 1BL7A 2HAKA 3IGGA 2P0CA 3H0ZA 2YAAA 1PXJA 3LHJA 4HJOA 4X3JA 5AP4A 5EW3A 4EOSA 4FA2A 4ZZNA 3RPRA 1E9HA 3TNHA 3QTSA 2XS0A 4WUAA 4TRLA 2QHNA 5DR9A 3RPVA 4ITHA 4C2WA 2RFEA 3L8SA 2C3IB 3FYJX 1WBWA 3NR9A 4EC9A 2YDIA 3R8LA 4FODA 4IIRA 1PMEA 3AC3A 3V5TA 3EL8A 2P55A 4LRKA 5K0KA 3NCZA 3HX4A 3R21A 5TE0A 4ZY4A 4L45A 4PRJA 1UU3A 1UV5A 5BVNA 2ZM1A 3QCXA 5HBEA 5CEKA 3CP9A 3ROCA 5CF8A 4BDBA 5LVNA 4IC8A 2VTTA 5HQ0A 5FDXA 2YZAA 3BELA 2R3LA 4K77A 4LQMA 5IKWA 2JKQA 5GZAA 2HCKA 1YOJA 2W1GA 3I6WA 5HG8A 3UIBA 5FEQA 2C6LA 3H0YA 3UP2A 4AX8A 4RGJA 5BYYA 1CKJA 1WBOA 2Z2WA 3EN9A 3Q2MA 3W55A 4D4VA 4X0MA 4RMZA 3DA6A 1H08A 3I7CA 3VS7A 2J0KA 3EZVA 4G31A 2OJJA 4GIIA 3RMFA 3K5VA 5ETIA 4GVJA 4HGTA 1SYKA 1YOLA 3AT4A 3W2RA 3FLYA 4V05A 5IQIA 3UZRA 2C3LA 2LGCA 4ZMEA 3QCYA 4L01A 3VUTA 5M06A 2PVMA 4UBAA 5AA8A 4IEBA 1BX6A 2WQOA 4PY1A 4XS2A 5HZNA 3QTXA 5EDRA 3RK9A 2GDOA 4QQTA 4FG9A 5LQFA 4FNZA 4L52A 4BYIA 3RI1A 1W2CA 5KKRC 5HORA 5IMXA 1HCKA 4IZ7A 4FNWA 4TT7A 5DA3A 2CN5A 4J53A 3SKCA 1PXLA 2F2UA 4BTKA 4EK8A 3GXLA 5CEPA 3R9OA 4QYHA 3KF7A 3ZO4A 3E8EA 4GFOA 4C61A 4YJRA 4EK4A 1A06A 4BTMA 1YHVA 3NZ0A 3OWPA 3RCJA 1WZYA 3BYUA 5HE1A 1GIHA 4E1ZA 2WOUA 5DFPA 4C35A 2QOBA 1JLUE 1DAYA 4F08A 2WKMA 2HIWA 1WCCA 3DU8A 3LFQA 4FTLA 5FQDC 4YU2A 3LMHA 4F6SA 2GTMA 4PMMA 4IB3A 2VX3A 3R22A 3NW5A 3DK7A 3ORLA 3F69A 4FJVA 1Y8YA 3LFDA 3BYOA 3DB6A 5D41A 2UZOA 2OO8X 1NVQA 5EI6A 4WG5A 4AFJA 3ANRA 5AP7A 3HECA 3CD3A 2WMVA 3MDYA 4C37A 1WBVA 1CM8A 3CKWA 5BVEA 4OAVB 1PXNA 1JKSA 3R7EA 4C38A 5HD4A 4D4YA 3S0OA 3QYZA 2OBJA 2WNTA 3B2TA 1J1BA 3OROA 4BN1A 2QR7A 2OIBA 2OXDA 1OPJA 3ULZA 4AA5A 1YKRA 2PE2A 3TI1A 4GVAA 4E5WA 2JDTA 5L6PA 3BBWA 3FKOA 4DFYA 5E92A 1STCE 4MBIA 3RK5A 4B8MA 2WMUA 2W1IA 3U51A 1FINA 5A46A 5GJGA 3ZLXA 1GOLA 3F7ZA 3R00A 4G6OA 4ZY6A 4D1XA 2XNGA 5D10A 1ZOGA 4XLIA 4RIYA 4USEA 3QRUA 3D4QA 1UVRA 3QGWA 1YWVA 3KN6A 5AP0A 3ORXA 4G1WA 3R8MA 4LM5A 4ZS0A 2X6DA 5E8ZA 4EOPA 3AOXA 2F57A 4O7LA 4GRBA 2VTQA 1CSNA 4XBRA 2X0PA 1NA7A 4G5PA 3CJGA 3DNEA 3R2YA 4MXXA 4A9RA 1VYWA 2PWLA 3Q6WA 2WMWA 4FSUA 5HD7A 2CJMA 4HNFA 4NIFB 2BRGA 4E8AA 4FTNA 3JYAA 1IG1A 2QOCA 5KZ0A 3SLSA 5DYJA 4FK6A 3MGYA 4XG9A 4RFYA 4TTHB 5HG7A 2GS7A 3BCEA 1KV1A 4FNXA 2Y9QA 3MVHA 3NNXA 5B2KA 2I40A 4FTAA 3PVGA 3D83A 4K9YA 3HUBA 2VTMA 4M68A 1AQ1A 3I5ZA 2XANA 4L3LA 3BWJA 1LP4A 3CKXA 4MNEB 4O0YA 4W4WA 2F7ZE 3FSKA 2VX1A 3GC7A 3OHTA 3TT0A 4QYEA 4JR7A 4NFMA 1PRYA 2BILB 5ICPA 4RWLA 4NH1A 5K0XA 3UODA 4MVFA 5IU2A 3W0SA 5AIKA 5C8MA 2QG7A 4P5ZA 2WQBA 1PY5A 3DAEA 4X3FB 2UZBA 3FMMA 4M66A 4BWKA 4Z3VA 4FYNA 3UYTA 5HIBA 3QU0A 1NXKA 5A6OA 4AGWA 3QX4A 5JH6A 4X7QA 4DH5A 5KMIA 4IAFA 3VUDA 3SOAA 3UVQA 3QA0A 3OXTA 4U43A 2FVDA 3MFUA 2CN8A 1XKKA 3E64A 2GSFA 2BAJA 4R1VA 4CCBA 4ZTLA 5D12A 3UJGA 4CQGA 4EYJA 5HNIX 2PZPA 4FTMA 4O96A 1PYXA 4BKZA 2ERZE 4M14A 3ZXZA 4I5CA 1UKIA 2X9EA 3LFBA 2ZDTA 4FKTA 4K2RA 5DGZA 4QP7A 5A6NA 4ZIMA 3FI8A 3P1AA 3IO7A 5CT0A 2PPQA 2PVNA 5AV3A 2WZJA 2UW6A 3WIKA 2PZYA 3HNGA 4U6RA 5IUGA 2R3IA 4UWYA 4PV0A 5HEZA 4EI4A 1OL6A 3OP5A 4DG0E 3VQUA 1FBNA 2RG6A 4QYGA 3UPXA 3EZRA 4YC6A 2OI4X 2PVKA 3OWJA 3WIGA 4RWJA 3C4CA 4AGCA 3MFRA 3TUBA 5IH5A 3UP7A 2FA2A 4G9CA 4CEGA 2E9UA 3ZHPC 3DJ5A 5HOAA 2QOKA 4MQ1A 2QNJA 4F7NA 3IS5A 4D5KA 5HVYA 4IJPA 4M13A 1EH4A 2R7BA 3PY3A 4Y85A 1H8FA 3VJOA 4GG7A 5EQPA 5H2UA 4AFEA 4AN3A 2CDZA 4S32A 3FYKX 4QRCA 3FI4A 3WARA 4FTCA 5M09A 5JGBA 5EK7A 4MQ2A 4IVBA 3VUGA 4XRLA 4DDIA 5I9VA 3BIZA 1OKZA 5L3AA 2WMQA 2BR1A 3AT2A 2W1EA 4CMTA 4F1OA 3QHRA 3EQIA 3MY5A 4FZFB 2Y4IB 2B1PA 5CI7A 3UMXA 5I4NA 5L6OA 3G9NA 1PF8A 1CTPE 3AGMA 4APPA 4DH7A 3HAMA 4L7FA 3ZCLA 4AZFA 3LIJA 4YJPA 2HZ0A 2XRWA 1OUYA 5F95A 3KRWA 4LMUA 5AM6A 3LLTA 4CMOA 2RIOA 3F6XA 5A4LA 2AC3A 4GS6A 3G15A 3ZZWA 4UXQA 5LMKC 4O84A 3PRIA 2HY81 2EXCX 5ANDA 4FL1A 3EMGA 4PDSA 3UIXA 3NUAA 4I24A 4WUNA 1SVHA 4FUXA 1GZOA 2QU6A 4HGSA 4N70A 1Q3WA 3LQ8A 4G3CA 4HCTA 4XOYA 5IQFA 1M7QA 3BHVA 5JQ8A 3UG2A 1WBPA 3MPMA 5HX8A 3BZ3A 3QLFA 4NJ3A 4C4GA 1BKXA 2OIQA 1Q8UA 4FT9A 5I3OA 4ZJJA 5CSXA 5E8VA 3I4BA 4XV9A 4XV1A 3EB0A 4CXAA 2XBJA 4M3QA 4UMRA 2ZMCA 2OXYA 4JDIA 3BYMA 5I9XA 3A99A 5FTGA 4U40A 2XK3A 3VUKA 3ZH8A 4NWMA 2OF4A 3MFTA 4HPTE 3HRFA 3G0EA 3NWWA 2QOIA 2Z02A 2G2IA 3DZOA 2ITUA 3HRCA 4RLLA 5GHVA 4GKIA 5EHYA 5CSHA 1VLRA 3S4QA 4O86A 5EOBA 1SVEA 3KA0A 4UN0C 5DT3A 3ZLYA 2WHBA 4GU9A 3AC4A 3PFQA 4HYSA 3E63A 3ZONA 5AV0A 5IQHA 3H4JA 3IW5A 2BALA 3MBLA 1XH5A 3ZS5A 4UMUA 5BVOA 2W05A 5J5TA 4J96A 1JVPP 3RINA 4AA0A 2ITVA 4CFWA 5CSWA 4ZLYA 2IW9A 5EM7A 2B55A 3QA8A 3G6GA 3VRYA 4EH7A 2BZKB 2P2HA 4JBQA 3EQFA 4W4XA 4DN5A 3BYVA 3F7WA 4BGQA 1Q24A 2X0GA 3Q9XA 3O8TA 4CLIA 5FEDA 4YTFA 5CVHA 4NW5A 4FL3A 2JIIA 4DEIA 5IQDA 1HCLA 3R83A 4ACMA 4FZ7A 2XK8A 4JT3A 3NYVA 4GIHA 1DI9A 3EYHA 4I4EA 4F9YA 5I3RA 1FMOE 4MD8E 4WNPA 3TJDA 2YZLA 4RJ5A 3GQLA 2OW3A 4QMTA 4WNKA 3AD6A 3D5XA 4ANSA 2PVFA 4ZTSA 3CS9A 4C4JA 1OPKA 3MH1A 2WTIA 2XBAA 5C4LA 4TY1A 4OTGA 2R0IA 4IZYA 3WF8A 4BDGA 1OUKA 4IC7A 3AC5A 3ZU7A 3GP0A 3I79A 2VWBA 3A4PA 4LGGA 1Z9XA 3P9JA 2JBOA 3WI6A 4ALUA 3QKLA 4XMOA 4FV7A 4TNBA 3P23A 4DE4A 5HKMA 2HYYA 2R4BA 5AP1A <