1Q41A

Gsk-3 beta complexed with indirubin-3'-monoxime
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
352
structure length
339
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
publication title Structural Characterization of the Gsk-3Beta Active Site Using Selective and Non-selective ATP-Mimetic Inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 339
sequence length 352
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1q41A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1q41A01
3D2IA 4AW5A 1GZOA 4FNXA 1CDKA 2ZDTA 1U46A 3FMNA 2Q0NA 4O6LA 3HMOA 3VIDA 3NZ0A 1KE8A 1HOWA 5AR8A 5AUZA 4TYHA 3AD4A 4K1BA 2JKMA 5HBEA 4RFMA 4NM7A 3FMHA 3UZTA 3D94A 3UDBA 4FIHA 4DH8A 2OIQA 2IJMA 4JDJA 4CYJA 4TT7A 1F3MC 3HAMA 5KMMA 5CSHA 4F64A 4YTCA 3TJCA 4IM0A 3LE6A 3U8WA 3G33A 5AAEA 4C2WA 2OF2A 2XNBA 3N4VA 2FH9A 2O64A 4G3FA 2V55A 5HESA 3C4CA 4YC3A 4IIRA 1RDQE 1Q24A 4JDIA 1GJOA 4X2GA 4C58A 1PXKA 2HZ4A 1J1BA 4RX8A 4DFXE 3WE4A 3D7TA 5EDPA 3ITZA 2P4IA 2QO2A 4X2NA 3BYOA 3OUKA 2XJ2A 3QRIA 3QUDA 3O23A 2C5OA 5EHYA 3SGCA 1WCCA 3HRBA 3V5JA 2XS0A 4AZWA 4DYMA 1OBGA 4QMLA 2WD1A 4FTIA 3BV3A 2EXMA 3OMVA 3ZYAA 3O71A 5BMSA 3R00A 5DG5A 1L3RE 2HY0A 2SRCA 4XRJA 2XK7A 4D1SA 5HOAA 2XMYA 1WBVA 1H24A 3DBQA 2Q83A 5CEMA 1FOTA 3KVWA 4UEUA 3CIKA 3IDPA 4KWPA 3LM0A 5I3RA 3BGPA 4WRSA 2BRNA 4IFGA 5FGKA 1LP4A 4WSQA 1OVEA 3ZO4A 1P5EA 4J8NA 4D4RA 1GIIA 4G5PA 3OT3A 3I6WA 2J2IB 3OOGA 4YZNA 5AP0A 2VTPA 5IA5A 4AZVA 4ZY5A 3GC8A 5BUJA 5M06A 2B54A 5CEPA 5GHVA 2PE1A 3SA0A 1WVXA 4QQCA 2GS7A 3TNQB 3PA3A 3VVHA 1LEWA 1VEBA 3ZTXA 4C4GA 5A9UA 2GNLA 2X4FA 3MVMA 5DRBA 3HV3A 4E20A 3SAYA 1JVPP 3GI3A 3DXNA 4X6RA 4B0GA 4RJ4A 3O7LD 1K3AA 2QO7A 3UZRA 4C36A 3QX2A 2WMTA 2C6OA 2B55A 3JYAA 4YJOA 4BDFA 2ZOQA 2YAKA 2Z7SA 3H9RA 2Z2WA 3AGMA 3L9MA 2FSMX 4N0SA 5C01A 5EDRA 4F9WA 4FEUA 4X2KA 1XQZA 5L2QA 3JPVA 3GUBA 1WBOA 2B9IA 4J96A 1Z57A 3VUMA 5EYKA 3MWUA 4FBXA 2Z7RA 4IWDA 4GYIA 3HMPA 3V04A 5EKNA 3PWDA 4D2WA 4E73A 3NCZA 1PMEA 3FMJA 1QPJA 1ZOGA 2QU5A 3F82A 3GFEA 1K2PA 2OH0E 4CD0A 3LFCA 2RFSA 1GIJA 3G51A 2OU7A 2YIQA 4GW8A 4BHZA 2HY81 3CS9A 2XVDA 4YUQA 2XRUA 5JGDA 3PVWA 3Q52A 4YZMA 1JNKA 5FXSA 4ZS0A 5G6VA 1ZZLA 4I3ZA 4RJ7A 2JITA 4NL0A 5GIOE 1YOJA 4DC2A 4DT9A 3PLAE 1M2QA 2YZAA 4NKSA 3OS3A 3ATSA 4RWKA 3IKAA 3ULIA 4G6NA 4AS0A 3F3WA 3FSFA 5E8TA 3RVGA 4FK6A 2C5XA 4BTJA 4RWIA 2Y4IC 5CU2A 5ACBC 3VUGA 4IE9A 2Z02A 2J5EA 4I0TA 4JRVA 3G15A 1KOAA 5L6WL 2VO6A 4GMYA 3I0QA 1Q8YA 2OKRA 4U8ZA 4EOKA 3SLSA 2BROA 1PMVA 2WQOA 3R7IA 4YJQA 2BKZA 3RK9A 2BAKA 3K5UA 5KX8A 4YBKA 2C3JA 2OH4A 3P23A 2C47A 1L8TA 1Y6BA 3Q96A 3A8XA 3IW6A 3PXZA 3IGGA 1M17A 2ITQA 5AV0A 4OBOA 4Z16A 3ZMMA 1VYZA 4ACDA 4PP7A 4BICA 1IAJA 3FZOA 5KBQA 2WXVA 2Y6OA 5HIDA 2JC6A 3DBEA 3MYGA 3R7YA 2WNTA 3H9FA 3RTPA 4O84A 3P7CA 4CFNA 2Y8OA 2HENA 1H26A 3ORKA 4DH7A 3MH1A 2DQ7X 3ROYA 2PUIA 3D2KA 3GCPA 4H58A 4IAAA 4R7HA 3CQWA 4AT4A 2H34A 5DI1A 2W1CA 5J87A 3ZU7A 2JBOA 3LCTA 2CKPA 3DV3A 1H0WA 2UVZA 3LMGA 4HYHA 4KRCA 4CG9A 3ZXZA 3FMKA 3PY3A 4EEVA 5J9YA 3QU0A 3GBZA 4FL3A 3E5AA 2PMIA 2J6MA 3MY1A 3TIYA 2PMOX 3HMIA 3PG3A 4IEBA 3PVBA 4QQJA 5JKGA 3Q4ZA 3ACKA 4LFIA 4QP2A 4QP3A 3H10A 4II5A 3ZRMA 2VGPA 2XF0A 3VS2A 2HOGA 4O7NA 4IM2A 4PDPA 2EUFB 2B1PA 5JRQA 3P9JA 3PUPA 4GRBA 3VC4A 5IH6A 3BEGA 2YIXA 5IKWA 2P2HA 4FZ6A 4NYEA 4O86A 3S3IA 5BUIA 3VUHA 4CMUA 2R3KA 3R22A 2ZMCA 3KN5A 4FSUA 1YDSE 4IQ6A 3ZEWA 2XIXA 2OG8A 5C8MA 3R7EA 2YITA 4HVIA 2WAJA 4AUAA 4I4EA 2Y4IB 3F7ZA 3UP2A 1OGUA 3TN8A 3BIZA 5FQDC 4XV2A 3BBWA 4OTWA 5HD4A 4A9SA 4BDGA 2CNQA 4KBCA 4KBAA 4WA9A 5C27A 1H27A 1OIUA 3COMA 1WFCA 3QRTA 3QTXA 4BCJA 4JR3A 4BDIA 2BDFA 4KINA 2RIOA 3R8MA 3LCDA 3CCNA 3FAAA 5EHOA 2EVAA 3AMBA 3IO7A 3COHA 2UZVA 2R0UA 2XBAA 4W4XA 2QR8A 5AWMA 2QG5A 4F08A 3CC6A 1TVOA 3PG1A 2P3GX 4ZMFA 3ORMA 4FIIA 4O0TA 2X9FA 4WNMA 5ETIA 3D83A 1REKA 2XK8A 3MFSA 2PZIA 3QGYA 2O8YA 4WUAA 5CEKA 5B2KA 4C61A 4E93A 3F3UA 3PXFA 4Y72A 4AU8A 5HLNA 2F7ZE 4Y8DA 5LVOA 3PLSA 4XG2A 5DBXA 3PZHA 5CALA 2PVLA 3DKCA 4GIHA 4EOOA 2JFMA 2CGUA 3KB7A 1XH5A 3R9DA 1JBPE 3F7WA 4PPBA 4K9YA 2OIBA 4YGAA 4B9DA 4BCQA 1URCA 3V8TA 1QPEA 3O8PA 3TV7A 5B7VA 2WQNA 2RKUA 4WKQA 4KD1A 3DNEA 3VHEA 2C68A 4CSVA 5J7HA 3F5PA 4DEDA 1PKDA 5J1WA 3GXLA 3BGQA 4R78A 4P2KA 3EH9A 5EM8A 5I3OA 2NPQA 4KIPA 4AFJA 5JQ5A 3UC4A 3I81A 1STCE 3AD5A 3OWKA 5CZHA 3EYHA 4CT1A 3LFAA 5JMSA 1OL7A 1XJDA 3R73A 3DZOA 4I6HA 3TACA 3QFVA 4U41A 5HE3A 3VRZA 3DS6A 3MV5A 3WZJA 3UIUA 2V7OA 4L8MA 4FUXA 3D14A 4R8QA 5A6NA 4QPSA 3BCEA 1YHVA 2ONLC 3AC2A 3PRFA 5AIRA 2X7GA 4RX9A 1H0VA 2WTCA 3DB6A 1Q61A 4I5HA 5KCVA 3WARA 1S9JA 4G9CA 4XP3A 1FMOE 5FBOA 1Z5MA 2IW8A 2XJ0A 4DG2E 2O5KA 1A06A 1JPAA 1LR4A 2ITNA 3EQCA 3R8UA 3IOPA 3PJ8A 4RG0A 3UYSA 4MNEA 4C4IA 1OKZA 2BUJA 4Q5HA 5AP7A 1A48A 3FZSA 3ZO2A 1OUKA 2QOKA 2ZMDA 4RT7A 4R5SA 1S9IA 2ZM3A 4OAVB 3F66A 3RZFA 1E9HA 5EYMA 3NVMB 3TNWA 3Q3BA 4C0TA 4BCOA 2R3QA 4L68A 4WBOA 3FMDA 5ICPA 3LM5A 4FNYA 3FC1X 3KREA 5IQDA 4BCIA 2W05A 3Q4UA 4DEGA 4R1YA 4ZJVA 5GIPE 3PWYA 4O0UA 4RFYA 3Q9ZA 3UOHA 2CDZA 3ORZA 4OTGA 4CEGA 4DAWA 4YR8A 2BRMA 2F7EE 2YCRA 2OI4X 1R0EA 1ZXEA 1KE5A 4FE2A 1Q8ZA 5DPVA 1YXUA 2ERZE 3LHJA 4BHNA 2X7FA 3NIZA 4ALUA 5EHLA 3AC3A 5FLFA 5EK7A 4MX9A 3LFNA 2A19B 4EH3A 4O7TA 2VAGA 1U4DA 3WE8A 2WU7A 2UW7A 4FSTA 4BKZA 1ZY4A 2XYNA 3DJ7A 2XCKA 3L9PA 5B2LA 3TUCA 1AGWA 1NT2A 4YPDA 5IQHA 4MD7E 4BDBA 3E3BX 2CPKE 4E5AX 4D4VA 2C1AA 2JKQA 4RBLA 3V51A 4JDHA 4D1XA 3QQUA 4NIFA 2WTIA 4FEQA 4PMSA 2GSFA 3DXQA 3HRFA 2XRWA 3G6GA 3TM0A 4KIKA 1UA2A 4JBQA 4U3YA 1PHKA 5CAUA 2C0IA 2W1IA 1CMKE 2OZAB 3TZ7A 5IH4A 1O6YA 4FTUA 3ZLYA 4DFNA 3DQWA 2QR7A 4BDHA 5HTIA 2UW6A 2UZLA 3KXXA 4G16A 4CZUA 5JFSA 3EQDA 3OEFX 4FZDB 4WD5A 3IW4A 4GKHA 4OTIA 5HI2A 4D0WA 1WBTA 3AT4A 4JQ7A 4M97A 4MXCA 4ZSEA 4R3RA 4CFVA 4E6CA 5J79A 4MQ1A 3KRRA 4U7ZA 4NFMA 1ZOHA 1JSVA 3BV2A 4C4HA 1WBPA 3CPBA 4CFWA 1MQ4A 2R3MA 1W82A 3ZUVA 3LAUA 3ZDUA 5FXQA 3F69A 4FKWA 4ID7A 4MH7A 4RZWA 4UYNA 2BZJA 1ZYSA 3R7GA 3W32A 4BCPA 4KABA 2UZWE 3MFUA 3OTUA 4GU6A 4I6BA 4F7LA 3EQFA 3Q6UA 3C4FA 3FDNA 1IASA 4AGCA 5KO1A 1GZNA 2A27A 2GU8A 3K2LA 2WMVA 3DB8A 3DFCB 4FKQA 4TXCA 5CSVA 3TV4A 2W5HA 4XOYA 3FBVA 3PP0A 3O0GA 2ITOA 2YIYA 4K33A 3FLNC 4PPCA 5L8JA 4BDAA 4JX3A 4UN0C 1OIYA 2PHKA 4IWQA 4V01A 3UVPA 4BVUA 1IA9A 4FNWA 3MY5A 4CXAA 3FYJX 2YAAA 4EKLA 4PTGA 3OF0A 4BDDA 4D5KA 3QCYA 3WOWA 4NU1A 4C33A 4NKAA 4ERKA 3PJ2A 1JSUA 3MH2A 4WNOA 4LUEA 2XNPA 1MRYA 5IA4A 2IVTA 2KTYA 3DK7A 4OTQA 2X6DA 2VWXA 3IDBA 4ANSA 5D9HA 3HV7A 2IZUA 2YACA 3EQGA 4BWKA 4DH1A 4FKUA 1ZARA 3FLYA 4RX5A 2IO6A 3R0TA 5CI6A 3VO3A 5CF4A 3E62A 2CN8A 4L3PA 4W4WA 3PA4A 4QYHA 2VTAA 3EHAA 3QGWA 5E8WA 3W2OA 4ASZA 4U81A 4PPAA 5ETAA 3OWLA 3V5WA 1YHSA 3ZO1A 1OKWA 5K5NA 4O0XA 4RPVA 4ZAUA 3A8WA 3Q5IA 4XG6A 5E8UA 5TF9A 3HNGA 5L2SA 2V0DA 4S33A 4ZMEA 3DOGA 3JVRA 4F99A 3IECA 4N70A 4UMUA 2PPQA 3HA8A 1ATPE 4M84A 4O1PA 2FVDA 4DG0E 2J0LA 3NUYA 5CAQA 5FXRA 3C0HA 4JT3A 4IZ5A 5CEIA 5M44A 4U43A 3QTQA 4JX7A 1YHWA 2JFLA 4TZRA 2J7TA 5TE0A 3V5TA 4ANNA 5LQFA 3R8PA 3UIXA 3FMMA 1AD5A 2VV9A 5FDXA 3F2RA 5M08A 4LUDA 2WMUA 4AA4A 4QQTA 2R7IA 4AN9A 5KHWA 5BVWA 2CCHA 4U40A 4ENYA 1OKYA 3MB6A 5M51A 2PSQA 3G9NA 1Q5KA 5I9YA 3VULA 1VJYA 2FYSA 3CD8A 4S30A 4ZIMA 5KMJA 4E5WA 3GVUA 4G17A 5HO8A 2YLFA 4G31A 2QOBA 2Y6MA 2XNNA 4D0XA 1TQPA 4XX9A 1Q99A 2JLDA 4IZ7A 4PL4A 4CKIA 1YDTE 3ENMA 3RZBA 3LFSA 4L00A 2VZ6A 4GYGA 4F6SA 3I4BA 4PDYA 3QTRA 3RMFA 5JFVA 4EH5A 4QPMA 3QX4A 4F1OA 2G2HA 4XOZA 2B7AA 3EN9A 3PE2A 5L2WA 3ZONA 1YXSA 3TG1A 3WF7A 3MFRA 3R83A 5J95A 4EHEA 3MS9A 4ZJIA 4RJ5A 3FKOA 3GGFA 3WYYA 2A0CX 4FYOA 2FUMA 4OT6A 4WBBB 1JSTA 4XG9A 4BWXA 1UU7A 4LL0A 4YPSA 3QTUA 4D55A 3FV8A 4MD9E 5IISA 4XLVA 3A99A 3OW4A 2JDTA 1UNHA 4YNOA 4CQGA 4DLIA 4F0GA 2ITWA 3A2CA 3UO5A 2WMBA 2PE0A 5J1VA 3OEZA 3QCSA 4W8DA 5CQUA 1GZ8A 4ONAA 3BU3A 3ZZEA 2HZIA 3ODZX 5E4HA 4ZS4A 3ZRKA 3IW8A 1HCLA 4EYJA 4BL1A 4PDOA 1KE9A 2R3HA 3RAKA 4F9CA 1W7HA 3C51A 1O6KA 4PNIA 4BF2A 2BFXA 3HX4A 4PTEA 4V04A 2AYPA 4DFUA 4M8TA 4AX8A 2WOUA 3G9LX 3S0OA 4F65A 1CKJA 1H1RA 3UGCA 3O96A 4MF0A 4IMYA 2YWPA 2QO9A 2HK5A 4FSNA 2ITYA 3PSBA 3HV6A 1G5SA 4PMMA 3A62A 3PA5A 3QCQA 4E6AA 5ETFA 3AGLA 3EN5A 2VO3A 5HNIX 4UZHA 2ITTA 2HWOA 5GJGA 4CFUA 4RVLA 1W98A 2BTSA 4FT7A 5CNOA 3QTZA 4O7LA 4L9IA 4UYAA 4BDEA 1WVYA 4NM3A 2LAVA 5BVNA 4QTAA 4JNWA 2DUVA 4AA5A 2B4SB 4CGAA 4FT3A 2F9GA 5AMNA 1WAKA 3ZZWA 2C69A 4QMWA 5HKMA 4BZDA 2PK9A 3TKUA 4I5CA 3IOKA 4V0GA 3ZSIA 3HL7A 3II5A 3PJCA 4CV9A 4XG7A 4O0RA 2GMXA 4IJPA 4FEWA 1YXTA 5EH0A 5L3AA 3GCSA 5CI7A 2BKKA 4IVBA 3ZUUA 2YDIA 3LKMA 3Q2MA 4YSMA 5HG9A 3R1NA 2C5NA 5KMKA 3PY1A 3UNZA 4EOJA 4FMQA 3R02A 3RGFA 4HVSA 3QC4A 3TTIA 3BWJA 4QTDA 5HZNA 3S4QA 3FMLA 5KMIA 2RG6A 4IX5A 5CX9A 4DF3A 4CNHA 2XIKA 3LIJA 3MB7A 3DJ5A 4I4FA 4O6EA 4YLLA 3MTLA 5AIKA 4ZTSA 5CQWA 2YCFA 3GCQA 2Y0AA 5HX6A 1Q97A 2QOFA 4USEA 4IZYA 3F5XA 3DLZA 2HWPA 4MVFA 4RIXB 3TJDA 2BALA 4E4NA 4F7JA 4GIIA 2X0GA 3MJ2A 4C4FA 2C1BA 1F5QA 1Y6AA 3LJ0A 4A4XA 2C4GA 3I0OA 2JIIA 2OICA 3KMWA 4GUEA 4AP7A 3LMHA 3TDWA 2ZYBA 3MN3A 4G34A 2PZ5A 1AQ1A 1NVRA 2C30A 2B9JA 4LOPA 2J90A 4I24A 3ATTA 4O1OA 4BB4A 3MBLA 4HGEA 2VTLA 4M7IA 3F6XA 3QRKA 5AP3A 4F9AA 2WEVA 3DK3A 4OTHA 2BFYA 2IVVA 3BYMA 2IPXA 2HXLA 3MIAA 4YLJA 4CQEA 4XLIA 1JKTA 3DTCA 5EG3A 3BHUA 4DITA 3H4JA 4FV6A 3KRJA 4DT8A 4IADA 5AR2A 4LI5A 4W4YA 3NCGA 4M3QA 5LMKC 1TQMA 2ITPA 2VTRA 4L46A 4L52A 4AE6A 3REPA 3TV6A 4RIYB 1PMUA 1FINA 4XG8A 3RK7A 1X8BA 2GS6A 2JBPA 3I60A 4FIJA 4J99A 5FBNC 5BX0A 5HORA 2R3OA 3ANQA 1V0BA 2XYUA 1JWHA 2RGPA 3DZQA 2PVJA 2WPAA 3NPCA 3D0EA 3KCKA 2PULA 4KIOA 5E1SA 3P4KA 2VWIA 4FKJA 2F2UA 4U6RA 2VN9A 2O63A 3VW6A 4JBOA 5GZAA 2AC3A 2VWYA 4OGRA 4FV7A 3ALOA 2BPMA 4Y95A 4MBLA 3UMXA 5JQ8A 3TUBA 5LMKA 4WSYA 5L2IA 4O96A 4AN3A 2R64A 3MFTA 3U9CA 4UWCA 4W9XA 3E7VA 3GENA 4I23A 2BIKB 2CNUA 2OGVA 4ACCA 4YZCA 3WIKA 2P2IA 3SV0A 4BCKA 3C4ZA 4WG3A 4APCA 4C34A 5LVNA 3U6JA 5IQEA 2YM4A 4G3GA 4QP7A 4E7WA 4MQ2A 4FNZA 1KV1A 3KULB 4XV3A 1ZYCA 2CKEA 3PSDA 1UVRA 4LRMA 3JR1A 2ZB0A 3K3JA 3W2SA 1RW8A 1XBBA 2QOCA 4PMTA 1W0XC 2LGCA 4EJ7A 4AOTA 2XK4A 4U5JA 5CANA 4AN2A 1PJKA 2XUUA 2YJSA 2CGWA 3E8EA 4FKVA 1PKGA 3C0IA 4L6QA 3UO6A 4NW5A 4O7YA 4UMPA 4XS2A 2X39A 3U55A 3EQRA 4L3JA 4ANOA 1DM2A 4A9RA 4AOJA 4FICA 3UOLA 4KKEA 3VUDA 2XK9A 2XEZA 3KXZA 3P79A 3TWJA 2XIZA 3KXNA 3D15A 3Q60A 5HNBA 5H3QA 5L2TA 3OY1A 5AP4A 3RBWA 1XHAA 2RFDA 4Y85A 5I9XA 2FO0A 3NIEA 4GFOA 3O2MA 4O27B 4ANBA 5IA1A 2QOIA 4NTSA 5HD7A 5LCKA 4NM5A 4D9TA 4UZDA 4YBJA 4JJRA 1J7UA 3OCBA 3D7ZA 4LQMA 2BZHB 5E9EA 3BEAA 2CGXA 4MHAA 3EQBA 3FUPA 4YJPA 4ZXTA 4ZSAA 3UJGA 4EYMA 5HLWA 2PVKA 1KSWA 5IQGA 2CNVA 5A4EA 2XZSA 2CN5A 2QLUA 2GTNA 4RC2A 4GJ3A 5E8VA 3NNXA 4F70A 2RL5A 3QUEA 2XIRA 3FI8A 1BKXA 2GQSA 3DBCA 2OSCA 4B99A 5H8EA 3QALE 4GG5A 3D7TB 3P86A 4ITIA 4NZWB 4XRLA 5F4NA 3CXWA 3NDMA 4ZP5A 2AUHA 4DHFA 5HCXA 4ZJJA 5M4CA 2C0TA 3E8NA 4DEIA 3JXWA 1BL7A 3F9NA 3FHIA 3Q4TA 3FZPA 3MVJA 3QRUA 2W99B 2YA9A 3ID6C 4CMTA 1U5RA 3FLWA 1P4OA 2ZV2A 3LFDA 5CXHA 3V8SA 4ACGA 3E7OA 2YN8A 2ZM4A 2J4ZA 4BCFA 4D2PA 4PMPA 3QD3A 4AA0A 5CZIA 5CASA 4QT1A 4C37A 2X81A 4AXAA 4IVDA 5J9LA 5J5SA 4R77A 2R9SA 3OFMA 2ZV8A 1MRVA 4NH1A 3P5KA 2YDKA 4QMNA 4U97A 3O50A 4M66A 3MIYA 2IG7A 3A4PA 2VTHA 1HCKA 4TN6A 3CPCA 3KMMA 4IAFA 4EOPA 1OBDA 2I7QA 5HLPA 4JIKA 3UOKA 3WZDA 2R3FA 4MF1A 3BX5A 3DK6A 5C8KA 3Q04A 2OFUA 1LUFA 2BDWA 1XR1A 2XKEA 4IDTA 5KZ0A 4BRXA 3VUIA 2A2AA 3O7LB 4MXZA 3OCGA 4BDKA 4LOOA 2CHLA 2HAKA 2B53A 2VNWA 4ALVA 4QPAA 4Z7GA 3ZRLA 3DAEA 2WMRA 5E8YA 5JGAA 2Z7LA 5JZJA 2H8HA 3A7JA 4FR4A 4H3PA 4JRNA 3V3VA 3A7IA 4OUCA 5FTQA 3KF4A 4K0YA 2I1MA 4UV0A 2Q0BA 2W17A 3BGZA 2VTJA 3G90X 4EUTA 1KWPA 3CQUA 3SD0A 5CU4A 4FSYA 4DEAA 3QQKA 4C02A 4R5YA 3FEGA 4GKIA 3IONA 5GINE 4WOVA 1SZMA 5IEXA 3RHKA 5KBRA 4F63A 4U9AA 4IX3A 4PL5A 3UNKA 1LEZA 1NVQA 1Y91A 3DGKA 3ZDIA 3UG1A 1XH6A 1I44A 4M12A 5CU6A 5DWRA 2R2PA 3QQJA 4RRVA 4FKIA 4X6QC 5L8KA 4MEDA 2G9XA 4BBEA 3THBA 4IAZA 4XG4A 3CD3A 1KE6A 3RAIA 5T6KA 5I9VA 1UNGA 2YWVA 5IQIA 3R9RA 3UIMA 4YTHA 3Q9WA 5HTBA 4KUJA 3FC2A 4H3QA 4RWLA 5CWZA 3VBVA 3RPOA 1SMHA 1VYWA 5HG7A 5CSPA 5D41A 3QLFA 5M56A 1PY5A 2WTDA 1Q62A 1J7LA 4DBNA 5J8IA 2QC6A 4E5BA 4IAKA 1ZYLA 2WZJA 5CEOA 4MWHA 2VNYA 3QD2B 4HPUE 3UPXA 2VRXA 5AUYA 2BZIB 2BDJA 3WF6A 3KF7A 4XP2A 2B9FA 3TZ9A 4FSZA 3VNTA 1UWJA 4MBIA 3C5UA 4FSRA 4IB0A 3H30A 5I0BA 5IMEA 3AOXA 2WOTA 4GCJA 5FEEA 4IJ9A 2EXEA 1URWA 4DA5A 3R63A 3EYGA 5JZNA 4YO4A 4A9YA 1QL6A 4PY1A 4AW0A 3A7GA 4U3ZA 5HVYA 4EH4A 3TEIA 4BBFA 4YZ9A 3JY9A 4S2ZA 3E93A 2R7BA 4DINA 1YWNA 5BYYA 3VQUA 4B4LA 2QG7A 4IACA 1QCFA 4JAIA 5CS6A 1YOMA 1JOWB 3I7CA 1BI7A 3NYNA 5LVLA 5A4TA 3KXHA 5KNJA 2PUNA 4TWOA 4U80A 2PUUA 4P4CA 4RMZA 5K4JA 3KL8A 5BVEA 4RZVA 2G2FA 2QOLA 1PW2A 4XUFA 5EYCA 4BDCA 4IANA 4YMJA 2C6MA 5LOHA 1PYEA 3FLSA 4I94A 5DN3A 5LVPA 2ITVA 5IA2A 2GHLA 4XP0A 4YJRA 2QHNA 5A14A 4QYYA 4GSBA 5DYJA 4A06A 4ZLZA 5HO7A 3PXRA 3K3IA 1KOBA 3F88A 3ZC5A 2XH5A 3GU8A 5KKRB 5A3XA 5JH6A 4FZ7A 3E3PA 5EW9A 4DFYA 3QKMA 3QAME 4J52A 2O65A 3FY2A 3U54A 1ZY5A 5CT0A 5L6OA 1SVEA 3PXKA 4Q5EA 4DFZE 1YWRA 3NR9A 1OIQA 2DWBA 3OCSA 1OMWA 1Q3DA 4JLCA 1U54B 3QL8A 4EC8A 1UU8A 1UNLA 2OBJA 5M53A 1SM2A 3LCKA 3NUUA 4CRSA 3VF9A 4YJVA 3CBLA 4NW6A 4R3CA 4Y5QA 1J3HA 2RFEA 3KN6A 2BAQA 3R71A 2YJRA 4MKCA 2EB3A 2VU3A 3POOA 4OTPA 5KZIA 3U4WA 4ACMA 5L4QA 2PU8A 3CSVA 4QMPA 5IMXA 4LRKA 2XEYA 3UBDA 1PYXA 4BGHA 3LJ1A 3KK8A 3UODA 5FUTA 3GB2A 4QMYA 4KS7A 4EOQA 4H1JA 1QPCA 2GQGA 1GNGA 4BIEA 3L1SA 5DA3A 4MXXA 2OJFE 2GFSA 1YVJA 3G2FA 4LL5A 2X8DA 4GT5A 4YTFA 2ONLA 2BIYA 1PRYA 5FDPA 2BTRA 4GG7A 4OTFA 3Q9YA 3L8VA 4CFFA 1BYGA 4S31A 4ZTHA 4EI4A 2ZV7A 3GP0A 4IX4A 2XCHA 3LZBA 4EH7A 5C4LA 4LGHA 5HVJA 3SXFA 3R01A 5I5ZA 4CFXA 5K9IA 4YURA 4FKRA 5HIEA 2BRGA 3QQHA 3ZFMA 4IVAA 3OD6X 5AP6A 3PY0A 4L3LA 2E2BA 2G01A 1Q4LA 3FZRA 5IEYA 5BYLA 3VBQA 1QPDA 3TNIA 4DGMA 1ZLTA 4CLIA 3KC3A 4QP4A 4EK4A 4EZ7A 2OXXA 5IUGA 5DEYA 3R21A 3EZVA 1BX6A 3GEQA 3TDVA 1YWVA 4EWQA 3UZPA 2ZB1A 3RINA 4DGLC 2I40A 2WELA 4FVQA 4JAJA 4AWIA 3BI6A 4NEUA 3IG7A 3ZM9A 2XK3A 3F2NA 3VBXA 4EQCA 5AP1A 5GJDA 3LW0A 4LMNA 3HLLA 4HZSA 4HJOA 5JT2A 5ACKA 4R1VA 4FTRA 4FVRA 4L43A 3DTWA 4BYIA 1YXVA 3DT1A 4C3RA 2P0CA 4FTKA 4RJ3A 4U45A 5E91A 3R1SA 3V5PA 4BIDA 2YCSA 1M14A 4NWMA 3PXQA 2W5BA 3C50A 4QMOA 5CXZA 4QTEA 3ROCA 4B7TA 5T68A 1R39A 3HDNA 4CMOA 5AV4A 1YDRE 2GTMA 4FV4A 3TI1A 4L44A 2I6LA 5HBJA 4M69B 3RNYA 1EH4A 3Q5ZA 4WNPA 3UNJA 1RJBA 3R8LA 4EH9A 5DR2A 4V05A 2QOHA 2OJIA 3OVVA 4J98A 5AUXA 3OP5A 4TWPA 1W8CA 5D7VA 4GL9A 3FLZA 3ZLXA 3W55A 1JQHA 4X0MA 4QMMA 1YOLA 3LLAA 4EH6A 2WTVA 4GV1A 3HV5A 4CT2A 2ZJWA 1K9AA 2B52A 5DR6A 2FSTX 4DTKA 4UMQA 3NYVA 3RPRA 2GQRA 1XH8A 3GU7A 4RC4A 4GT4A 4D2VA 3DDQA 5D12A 5AFVA 4FZFB 2VO7A 3BRBA 2W1HA 4FKSA 3SXSA 3CLYA 5CSWA 4FX3A 4JXFA 2VD5A 2QOQA 3CE3A 4RIWB 3EZRA 4DN5A 3TUDA 3V6RA 4G3EA 2IZSA 3UE4A 4AFEA 1KV2A 5AAGA 3BHHA 2W1EA 4RA5A 4C8BA 4OR5A 3KXMA 4QP6A 4AW2A 4DGNA 5HU3A 5TKDA 4FOBA 2PYWA 1PXLA 5JN2A 3COKA 3VHKA 2OO8X 3F3VA 2PWLA 4OW8A 5DIAA 4ZSLA 4ACHA 4B6LA 4DEBA 5IQFA 3BELA 4D1ZA 3NYOA 3WILA 3V8WA 4YC6A 3DAJA 3QD4A 5DGZA 1XBAA 4FOCA 2G15A 3TKHA 1ZWSA 3F3ZA 1Y57A 2HZ0A 3C13A 3NW6A 2WB8A 3RPYA 4USDA 5IA3A 3NEWA 5CVGA 3JY0A 4BCNA 4RVKA 4X7QA 3NNUA 3CGOA 3W8LA 3M11A 5IUIA 5AUVA 4J53A 1MQBA 4BZNA 4Z9LA 4D4YA 2WU6A 3E63A 3IW7A 1UU3A 3VBTA 4BWPA 4F9YA 3QF9A 3B2TA 5A4QA 1ZYDA 3A4OX 5GJFA 4K77A 3PE1A 4HNIA 1WZYA 4JDKA 2XK6A 3GC7A 3LQ5A 1H25A 4G3CA 1IG1A 3GCUA 2CKQA 3ZHPC 5HICA 4A9UA 5CF8A 4PDSA 4C4EA 3UTOA 5EYDA 1CM8A 2GNGA 2F4JA 1H28A 3TL8A 3KGAA 3DFAA 2PZPA 3BLHA 4J97A 3SKCA 2YCQA 3FQEA 3L8XA 3OZ6A 4X3FC 4WO5A 3T3UA 4EQUA 3MY0A 3OC1A 2JIUA 3ZUTA 4AQCA 3LCOA 5M57A 1ND4A 4CLJA 4FIGA 4Z7HA 4W8EA 5H8GA 2R3LA 4Q9ZA 2VWWA 4D2TA 2BRHA 4RLKA 4UWBA 3GOKA 2YM6A 4RGJA 4BFMA 4OAUC 4TY1A 1Q41A 2PVRA 2CLQA 2BILB 5ANJA 5FEQA 3SG9A 4NTTA 4FTTA 4FL1A 2OK1A 3NSZA 1P14A 2HW6A 2J0MB 3AC8A 5AP5A 2OLCA 1XBCA 3OHTA 4GT3A 3R9OA 3VS0A 4QTBA 2R4BA 4ZZOA 3JUHA 3CKWA 3PXYA 4IB1A 3W16A 3OBJA 3PPJA 1B39A 1JKKA 3SX9A 3QBNA 4Y73A 4RC3A 3CEKA 3G0FA 2NO3A 5HGIA 4EHZA 3G0EA 4RSSA 4KNBA 2XBJA 4TPTA 5J7BA 3CKXA 4L7FA 4PNKA 3M1SA 4HYUA 3BQCA 5K5XA 4C38A 4FIEA 4EUUA 3HVCA 2WO6A 4IX6A 5AM6A 1XH9A 1ZAOA 2YZLA 3CQEA 3V6SA 5LVMA 3EKKA 4MBJA 3BPRA 3EFLA 1PXJA 4FV1A 3GU6A 5B2MA 2QOOA 3RCDA 2W9ZB 5D10A 2W9FB 3L8PA 3MSSA 4HGLA 4QOXA 5AR7A 4BTMA 3C7QA 3EJ1A 2PTKA 3QWKA 4L45A 3W33A 4EK3A 3ODYX 4YSJA 3SW4A 4EL9A 2OXDA 4C35A 4QMSA 5JK3A 2WKMA 1OUYA 2NNWB 1OL5A 4F09A 3MGYA 2R5TA 4RIXA 4O0YA 4ANLA 4F0FA 3QWJA 3DKFA 5FG8A 5TR6A 3BYVA 3L8SA 2WIPA 3R7OA 3A7FA 4TWNA 3R7UA 4I92A 2WEIA 4X3FB 2ERKA 2UV2A 1XH4A 2X9EA 4XV1A 4EK8A 3ZSGA 3FQSA 3P08A 5DOSA 2IW9A 4D2RA 5LWNA 2R3JA 4TRLA 5ANEA 3AC4A 2QLQA 4EC9A 5C4KA 4LV5A 5F1ZA 3ZXTA 4YJTA 4M15A 3TXOA 4ZTMA 4IAYA 4U42A 3HV4A 4PL3A 1NY3A 4OBPA 3EN6A 3ZC6A 3UQGA 2V5QA 4AZSA 4JBPA 5GZ9A 4I21A 3GC0A 3O17A 4A9TA 5IDPA 5DHJA 3OG7A 2J5FA 2RSVA 3MW1A 4NJ3A 2JIVA 4FF8A 3AT3A 5IF1A 4MWIA 4AG8A 5KE0A 2W7XA 3VS1A 5M4UA 2QQ7A 3NLBA 2ESMA 4W4VA 1DS5A 2WQEA 3QTWA 4RA4A 4ASDA 3A7HA 4PQNA 5EOLA 2RF9A 2QVSE 4HYIA 3QTIA 4JQEA 4LRJA 1R78A 5K0KA 4RIYA 3VS3A 5A46A 5CAPA 1R0PA 3SDJA 2ZVAA 3GCVA 3KMUA 4AZFA 4I22A 3E88A 2WTWA 2CGVA 3PZEA 4IH8A 2ZAZA 3QCXA 4EOIA 2VWUA 4NCTC 2C3IB 2HW7A 5DT4A 1R3CA 4QD6A 4C4JA 4O2ZA 3EN7A 4ITHA 3QTSA 1VR2A 3EFJA 5EDQA 1SNUA 3CJGA 4ZSGA 4NT4A 2ACXA 4MNFA 3OXIA 1FVVA 2ZDUA 4FUYA 5CAOA 4FKPA 4MCVA 3Q6WA 4TWCA 5FM3A 5BMMA 3EWHA 1MRUA 1FGIA 2NP8A 4F1TA 5AJQA 5HNGA 1WBWA 2F49A 4GUBA 1IEPA 4IWPA 2XNEA 3EL7A 4FKGA 4FTOA 4EHGA 3LQ8A 2ITUA 2XM8A 3WF8A 4AE9A 4K2RA 5E90A 4ANMA 1ZMVA 3PJ3A 2WIHA 4FYNA 3C5IA 4BI0A 1BUHA 3R8VA 3RM6A 2YIWA 4TNBA 3L9NA 3T8OA 4AAAA 3UOJA 3W2CA 4UX9A 2VTQA 2PZYA 5CF5A 4HCVA 3N4TA 2C6IA 3BYUA 5E7RA 3DKOA 2P33A 3NUPA 3KULA 1SNXA 1WMKA 4IWOA 4ASEA 3LQ3A 2A4LA 4EH8A 4DFLA 5F9EA 3VAPA 3VF8A 4G3DA 3OOMA 3R8ZA 3PIXA 2WMXA 4EOSA 5BQ0A 5CENA 3FI2A 3HMNA 4P5QA 5E8SA 3KEXA 2BZKB 2GNIA 2V22A 1T46A 4RIOA 4A4OA 4J95A 3FZTA 3B8RA 4EH2A 4UALA 2CCIA 2EXCX 2WHBA 2XB7A 4I6FA 4UMTA 4BDJA 1FVTA 2UW8A 2WMAA 4C62A 2OZOA 2QI8A 4K6ZA 3QXOA 3BHYA 1WVWA 3RAWA 3P1AA 4F7NA 2UUEA 5IQAA 3CJFA 5C1QB 4XNEA 4ZSJA 4K8AA 2BR1A 4H05A 3MI9A 3HA6A 2C6EA 4EWHA 3CTHA 5AP2A 4BN1A 3R04A 4OLIA 3OTVA 4DEHA 1XKKA 3VS7A 3GNIB 1KUTA 3I1AA 4MXOA 3SRVB 3P0MA 2AC5A 3N4UA 4IHPA 3C9WA 4C7TA 4JOAA 3KFAA 3F61A 5AUWA 2VTIA 2Y7JA 4U79A 4J1RA 2IWIA 4UXLA 1FBNA 2PUPA 2YHVA 5D7AA 4BBMA 4QQ5A 4YLKA 2PVHA 5A6OA 4GK4A 4ZTLA 1GY3A 2X7OA 5A4LA 2A1AB 2OJGA 3L9LA 4HPTE 4N6YA 4NK9A 4NFNA 4KKHA 2OFVA 2QONA 5AX9A 2QHMA 3VJNA 4FGRA 2J0IA 3DBDA 4XEYA 2E9PA 3KCFA 4IC8A 3EMGA 4IVCA 1J91A 2XNOA 5FWKK 5J9ZA 2R3IA 3G5DA 3QKKA 5CVHA 5CAVA 4YU2A 3VBWA 4XYFA 4A7CA 3R6XA 3QQGA 4BCMA 4ZY6A 3ZH8A 2REIA 2B9HA 2W4JA 2XKCA 4GU9A 3UIBA 1UKIA 1OITA 3AXWA 5BNJA 3LPBA 3MDYA 5D11A 4QYFA 5JSMA 2YEXA 3VQHA 5AADA 2W0JA 3HGKA 3IGOA 3BHVA 1E1XA 1H08A 5AA9A 2C0OA 1V0OA 3KXGA 3T9IA 3QA0A 4GFGA 4EK5A 4ZY4A 4H39A 5KHXA 4P5ZA 5CU3A 2X4ZA 3R9NA 3TNHA 4TYHB 2OF4A 3H0ZA 5CYIA 3CP9A 4O82A 1WBNA 2W1FA 2WGJA 3ENHA 4FA2A 4TW9A 4MTAA 4PRJA 2E9NA 4CYIA 5IUHA 2IZTA 4WG4A 3FLQA 1Y8GA 2E9UA 2W5AA 4FL2A 4RVMA 5ANKA 3FXZA 1H01A 4AW1A 4D9UA 1BLXA 2W4OA 3KA0A 4ARKA 2X6EA 4O83A 4OTDA 3OCTA 2EU9A 1VZOA 3G6HA 4NM0A 1YKRA 4YJSA 1V1KA 2J50A 2QCSA 2H9VA 4QYEA 3Q9XA 2J0KA 4AACA 2PVNA 5ANDA 4KB8A 3ZO3A 4NSTA 2ITXA 5CSXA 3HEGA 3ELJA 1OPLA 4F0IA 1IRKA 2C6KA 3M42A 1OIRA 4BYJA 1FQ1B 4FSWA 4JVGA 4HZRA 4AT3A 4F6WA 4HOKA 2VGOA 5FRIA 4YTIA 4CCUA 3WIGA 2QODA 3BWFA 2C5VA 5EQYA 4QRCA 3W2QA 5AR3A 2Z7QA 1CKIA 2H6DA 5DFPA 4QO9A 4RWJA 3SOAA 3HDMA 4PV0A 5I4NA 3GQIA 4TTHB 5I9UA 4ZK5A 2YIRA 4MAOA 5AEPA 2JD5A 3DPKA 5K3YA 2GHMA 3CY3A 4K11A 2VO0A 2WMSA 1V0PA 4GK2A 3RAHA 2GDOA 4RVTA 2JDOA 2JAMA 4WRGA 3VS6A 4G2FA 1OZ1A 5ANIA 1REJA 3KK9A 3FMEA 3EFWA 4I93A 4FT0A 4WIHA 3NGAA 2W4KA 3Q4CA 4AOIA 3R28A 4GEOA 3ZCLA 2DYLA 4DGOA 3FPQA 4KS8A 5DR9A 3TZMA 4YP8A 4DG3E 1ZOEA 3FE3A 4IDVA 3SC1A 5B0XA 4FV5A 5HTCA 3Q32A 5LARA 1CSNA 4O0VA 5CTPA 4FT5A 1ZMUA 2QKRA 2BHHA 3CTJA 3T9TA 2GCDA 4RQKA 4GK3A 5F94A 3UYTA 4L42A 2UW9A 3BLQA 4D58A 3NX8A 2FGIA 4L01A 3LXPA 3QUPA 4JG6A 4ZTRA 3LXLA 3AC1A 2F57A 4S34A 4CFMA 4E6DA 2HYYA 2I0YA 5E92A 4BGQA 1PXIA 5EI2A 4M0YA 5M4IA 4AGDA 2W1ZA 5BVKA 2UZDA 3QD0A 1SVHA 4UXQA 3ORPA 3D5XA 3VUTA 1O9UA 5DMZA 2R3RA 4M13A 4WNKA 1UKHA 1W84A 2XM9A 2VWVA 3C4WA 2O3PA 3NYXA 3KU2A 3LFBA 3VBYA 3NRMA 4QP8A 3VUKA 4C57A 4F7SA 3PP1A 1CKPA 4YHFA 5ANOA 4CVAA 5KMLA 1M52A 3F5UA 2WMQA 4DH5A 3KRWA 5LMAA 3FHRA 2X1NA 5DH3A 4XV9A 2VX0A 1UV5A 3R2YA 4ZZNA 4KIQA 1FPUA 5T3QA 3LLTA 4DBXA 5KKRC 3R30A 5DLSA 2YM7A 3MH0A 4CV8A 1ZYJA 3QZIA 5CY3A 3AMYA 4FG9A 4JQ8A 4EORA 3WF9A 4BCHA 5AX3A 2WQMA 5DNRA 4DLJA 3LMIA 5AUUA 3BZ3A 3LJ2A 2YLEA 3PDTA 2X2MA 4O7VA 3S95A 4HVGA 3QQFA 4ZTNA 1H8FA 5CNNA 3MH3A 2BMCA 2HELA 3P7BA 3HKOA 3DU8A 5EM6A 3R9HA 1APME 3HECA 4XJ0A 1YI6A 5GZ8A 4GH2A 3VRYA 4E3CA 4KKGA 1H4LA 4BIBA 4I20A 3UPZA 1ZRZA 4O38A 3A60A 4DH3A 2OXYA 3DDPA 2E9OA 4FTJA 4JL9A 5DVRA 4D2SA 4FG8A 3RK5A 3H3CA 3NNVA 3QQLA 4E4XA 2C3KA 2ETKA 5AM7A 2IN6A 4AZEA 5IH5A 1R1WA 3IQ7A 3CTQA 3HRCA 3LVPA 5HCZA 4F6UA 3RP9A 5M4FA 1OL6A 3QXPA 4ZLOA 4RJ6A 3MPMA 2UVYA 1U54A 4BTFA 1FVRA 3FI4A 1OPKA 4PTCA 3RPVA 1M7NA 2JGZA 5BVDA 3PIYA 3NUSA 4XMOA 3FSKA 1XO2B 4I1ZA 3UO4A 1RQQA 4AZTA 2W1GA 5IPJA 2I0VA 3IW5A 1YXXA 4PP9A 3OWPA 3MVLA 5IQCA 2VX3A 2V62A 4I0RA 4O7SA 5HU9A 4O0WA 4QTCA 2VTTA 3ZBFA 3F5GA 5K4IA 5AR5A 4J71A 3V01A 3OT8A 4BR3A 3MESA 4TYGA 4A4LA 3VW8A 4CG8A 3O8TA 3BLRA 4Y5HA 3TKIA 4L53A 4AT5A 3PPZA 4JI9A 5DRDA 1NA7A 1OI9A 3D5UA 2RG5A 5EKOA 3E8CA 5FP6A 3UQCA 1GOLA 3U51A 5HE0A 5BVFA 4EBWA 4QNAA 2H96A 4AGUA 3D5VA 3OBGA 3EB0A 2GNJA 4R6VA 4TYIA 4FC0A 2UZEA 4FG7A 4FSQA 2UW3A 4OBQA 4E1ZA 3PSCA 4KAOA 1SYKA 4CRLA 1PXNA 4HCUA 1Q3WA 2VTMA 4ZOGA 2PVMA 3QZGA 3SOCA 1QMZA 3NMUF 3LXKA 1H1WA 3HUCA 4GS6A 1DI8A 1H1SA 2NRUA 2UW4A 2JAVA 1WBSA 5HG8A 4FV0A 3VS4A 3ZFYA 4KA3A 5HE1A 4EJNA 5KMOA 4FODA 1DAWA 2V7AA 2YERA 3KKVA 5IU2A 1P4FA 4RFZA 4EHVA 2OZAA 2R3PA 4UMRA 3EFKA 3W10A 2UW5A 3TTJA 4CTBA 4FKLA 2CMWA 1H07A 2HIWA 3I7BA 1E1VA 2VX1A 4AF3A 3K5VA 3HYHA 2X2LA 1OL2A 2EB2A 3NW7A 1J7IA 2Z8CA 4ERWA 3ZOSA 4QMZA 4HVDA 2FB8A 5E1EA 3P78A 3BE2A 4AGWA 5F95A 4YO6A 4QMQA 4GFMA 3NW5A 3D4QA 3ERKA 3I79A 3PVGA 3QKLA 5JFWA 3N9XA 4WG5A 4ASXA 2IW6A 1OB3A 4M69A 1TKIA 4BKJA 4EONA 3ZBXA 4U0IA 2FSLX 4J8MA 3RNIA 3NUNA 4O21A 4XBUA 1G8SA 4N57A 3DJ6A 3AC5A 2ITZA 4E4LA 5CU0A 2QD9A 1M2RA 3ZLSA 4C3FA 3RALA 5HE2A 4LG4A 4E4MA 5AUTA 2JDSA 1MP8A 4YJNA 3H9OA 3U6HA 3HP5A 3SVVA 1OPJA 3E64A 4I6QA 4FK3A 2PVYA 3C4EA 2XJ1A 3CGFA 3GU5A 2UZBA 4H3BA 2JEDA 3HAVA 4IXPA 4JIAA 1MUOA 3ZS5A 2UVXA 3QHRA 3V5QA 1ZZ2A 2PZRA 2YM8A 1DAYA 2IZRA 3DKGA 3QYZA 5HG5A 3EQPA 1NW1A 1F0QA 2GFCA 4XHKB 1J1CA 3GQLA 4YZDA 3TNPC 4FEXA 4I5MA 4KBKA 4BGGA 4RIWA 3LFQA 1H00A 2ETRA 4FI1A 2C6TA 4G9RA 4ZZMA 2R3NA 4NJDA 3TCPA 2YISA 1OL1A 4EZ3A 5G1XA 2VUWA 3UC3A 5HO6A 2DS1A 4FZAB 2C3LA 3S1HA 4A07A 4C2VA 3ZEPA 2E9VA 3PVUA 3ZFXA 4YC8A 2OJJA 3HUBA 5BVOA 4TYJA 3ULZA 5HCYA 3SQQA 2YM3A 2BAJA 5DT0A 3KY2A 3PRIA 4IW0A 5LWMA 3AMAA 3B8QA 4G6OA 4ORKA 2P55A 4FGBA 3UVRA 4FV2A 5CVFA 5JRSA 3DBFA 4DE4A 4M67A 3MPAA 1H1QA 1PXMA 4MNEB 4TKSA 3U9NA 4S32A 3NS9A 5TO8A 5HX8A 1YQJA 5EQEA 4O7RA 2YM5A 4UY9A 1M7QA 4E8AA 3AQVA 1FMKA 5FD2A 5CEQA 3ZSHA 3RPSA 1XWSA 4DTAA 4F9BA 3K54A 4FTCA 3EKNA 1W83A 3UMWA 3POZA 4YHJA 3U87A 4O7ZA 3FY0A 1PXOA 3FWQA 3QYWA 1UU9A 4L7SA 2OWBA 3FL4A 2CKOA 5K0XA 4LOQA 3DNDA 1BMKA 2KULA 2PVFA 3RCJA 4DCEA 5FM2A 4FV9A 4ZLYA 4Y83A 2XKFA 5LMBA 3KRLA 3I6UA 5ITAA 4RJ8A 3EOCA 1LPUA 3B2WA 4F1MA 2GNHA 2ZM1A 2JKOA 3FKLA 4FV8A 4P90A 3WI6A 3Q2JA 2I0HA 3C1XA 3GU4A 3HMMA 5A4CA 1NVSA 2JDVA 3KVXA 2J9MA 3LXNA 1U5QA 4O0SA 5AV2A 3EN4A 1A9UA 4QMUA 4BY9E 1KE7A 1OECA 2GNFA 3ACJA 4I41A 4U44A 4J7BA 4C59A 5BUEA 3BU6A 4NIFB 4C3PA 3UQFA 2BRBA 1G8AA 3D5WA 4HVHA 1B6CB 4RX7A 4KIKB 2WMWA 5CT7A 1GIHA 4B8MA 4R7IA 4LMUA 3LFEA 4XH6A 3SHEA 4BCGA 4CZTA 5I9WA 5IG1A 3S00A 2OW3A 1GZKA 2BVAA 3MA6A 2WFYA 4N6ZA 3ET7A 4LGGA 5HHWA 3ZLWA 3DXPA 2CJMA 4O2PA 2PL0A 3TZ8A 5A54A 3ETAA 5C9CA 1PXPA 3TIZA 2FSOX 4HGSA 2X8IA 3OUNB 2Y9QA 3CR0A 3ORNA 3W8QA 5HQ0A 4BC6A 5FP5A 2GHGA 3FPMA 5GNKA 3S2PA 3EIDA 4YHTA 3NWWA 2C6LA 2XA4A 4HCTA 2QURA 5H8BA 2GPHA 3CY2A 3FJQE 4IB3A 4D5HA 5KMNA 2QNJA 3O8UA 1Q8TA 4FT9A 2GS2A 4YJUA 1Q8UA 3QHWA 4G1WA 4TL0A 1GAGA 3QC9A 1CTPE 3QRJA 3JS2A 3P7AA 3R2BA 1ZMWA 5CLPA 4JG8A 4XBRA 5KUPA 5J5TA 2UZNA 3OXTA 4O22A 3QA8A 4I5PA 4D28A 2OIDA 2IVUA 2VTNA 3ORTA 3ORXA 4X2FA 4PX6A 1Q8WA 4M68A 2NRYA 5EQPA 5HBHA 1TQIA 3UG2A 5EW8A 3RKBA 2YABA 3QZFA 5AR4A 4KSQA 4EK6A 2JDRA 2I0EA 4LM5A 5TOZA 4HGTA 3EQIA 1ERKA 2UZOA 2XKDA 5C26A 3FI3A 4H36A 3ZM4A 3LCSA 3IDCA 5ANGA 5AA8A 1YI4A 2QKWB 4QMTA 5ETCA 4EQMA 5IZFA 3COIA 4Z3VA 1PMNA 5M55A 4L67A 5FEDA 2B0QA 3D9VA 2XP2A 4IBMA 1JKLA 2VTSA 3PPKA 4X3FA 3PFQA 2OJ9A 4UWYA 3FZ1A 4O91A 4IB5A 4RQVA 3R1QA 4EOLA 2PMLX 4IAIA 4QP1A 5L8LA 4ITJA 4BI1A 1BI8A 3WYXA 2F7XE 2WTKC 1Y8YA 4RLLA 5EFQA 1FGKA 4KSPA 3GT8A 3GOPA 3RM7A 3AD6A 3W2RA 4E26A 4MD8E 1BL6A 4JR7A 4QP9A 3Q53A 4PWNA 3WBLA 4GVAA 4ENXA 2XNMA 2YDJA 2FA2A 1NXKA 3BYSA 4JBVA 4QMXA 4Y46A 3AG9A 3OW3A 4EKKA 1IA8A 5EI8A 4HNFA 5DE2A 4ZEGA 2IVSA 5EM5A 1I09A 3VWAA 1JAMA 4BZOA 1U59A 5DEWA 4DGGA 1PF8A 2BHEA 3R7VA 4GJ2A 3RJCA 4LV8A 3RWQA 4PF4A 5C03A 4ANQA 4FEVA 1JKSA 3NUXA 4R7BA 4O7WA 2CSNA 3NAYA 3PJ1A 3W18A 4H1MA 5IEVA 3SG8A 3WZEA 3DCVA 5E8ZA 2PMNX 3NAXA 5L6PA 4D4SA 4FTNA 4APPA 1OKVA 2YFXA 3C0GA 3KQ7A 2HXQA 4YNEA 5C8NA 3GC9A 4CTCA 4OT5A 4Z55A 2WTJA 4GVJA 1JLUE 4IZAA 4ALWA 4BI2A 4KRDA 3BU5A 3MJ1A 4FV3A 3BHTA 3FL5A 3BE9A 3FYKX 3PYYA 3NVKI 2UW0A 4FSMA 3PTGA 1YRPA 5CF6A 4I0SA 4QNYA 5EM7A 4K18A 4FIFA 5BPYA 4NUSA 3W1FA 2ZV9A 4DEEA 4TNDA 2PY3A 3VN9A 3SW7A 3VJOA 5IQBA 2J51A 4N4SA 5M07A 3EL8A 4FTMA 5LJJA 3DY7A 3TT0A 4M14A 4R3PA 5EI6A 1UWHA 3ANRA 3FKNA 2G1TA 3M2WA 1RE8A 3HZTA 4M0ZA 2R3GA 3MPTA 4MK0A 4ZTQA 4UBAA 4HW7A 3WZKA 4CCBA 2O0UA 2VWBA 2XIYA 4EBVA 1H1PA 4W9WA 4FVPA 3EQHA 3FXWA 3NNWA 5AV3A 4FTLA 4JS8A 5F20A 4CKJA 4DCAA 5FTOA 5HIBA 4CKRA 5LXMA 5I9ZA 2CLXA 3DLSA 5JGBA 4Q2AA 3MA3A 2WTKB 3OWJA 4QMVA 4UB7A 2C6DA 4X21A 1YI3A 1XH7A 2R0IA 3GFWA 2O2UA 2W06A 5AAFA 3RI1A 4BTKA 3PIZA 2Y4PA 4P7EA 1B38A 4MXYA 5JFXA 3AT2A 3OY3A 4G5JA 4MXAA 4DTBA 1P2AA 4X2JA 2C5YA 3E8DA 4WHZA 2Z60A 2QU6A 3BKBA 3JVSA 4LYNA 4IC7A 5TT7A 2VTOA 4XG3A 3UVQA 5M09A 3IK3A 4F4PA 3WF5A 4DFBA 1O6LA 4FTAA 3BQRA 4G6LA 3KRXA 5IA0A 2W96B 3R1YA 1M2PA 4YZBA 4Q9SA 2BCJA 4X3JA 3I5NA 3U4UA 2PE2A 3T3VA 3WZUA 4TYEA 4CZYB 4OTRA 3ORIA 5HEZA 3SRVA 3F3TA 4NCTA 4E6QA 4QYGA 3DAKA 4HYSA 1IR3A 2F2CB 2W1DA 3E92A 3N51A 5HVKA 3H0YA 3UP7A 5LCJA 3FQHA 5EOBA 3QLGA 4MYGA 2J0JA 2UZTA 3HP2A 3QZHA 3A61A 4USFA 5DT3A 2WQBA 2RFNA 3O51A 3DA6A 3V5LA 3LFFA 4FTQA 2G2IA 2JKKA 2VWZA 2XNGA 3I5ZA 3OXZA 5AV1A 3W2PA 5IDNA 3E87A 4IM3A 5JEBA 4V0GB 5H9BA 2HZNA 1YW2A 4O81A 5H2UA 3RHXA 4EOMA 3MTFA 4WT6A 4IFCA 1DI9A 5E8XA 5D1JA 3NUAA 3C4XA 3FXXA 1SVGA 1T45A 5EW3A 2UZUE 3F2AA 3BBTB 2ETMA 4FKOA 1OM1A 3RWPA 2X2KA 4EZ5A 5FTGA 1Z9XA 3IS5A 5BYZA 1G3NA 2X8EA 3LOKA 3SXRA 4B8LA 2HCKA 4LGDA 3OROA 4PUZA 4JG7A 2EWAA 3ALNA 4BKYA 4FKTA 4XCUA 3ORLA 3U6IA 1IAHA 4WUNA 3DQXA 3IPHA 3MVHA 3VS5A
chains in the Genus database with same CATH superfamily
3D2IA 4AW5A 1GZOA 4FNXA 1CDKA 2ZDTA 1U46A 3FMNA 2Q0NA 4O6LA 3HMOA 3VIDA 3NZ0A 1KE8A 1HOWA 5AR8A 5AUZA 4TYHA 3AD4A 4K1BA 2JKMA 5HBEA 4RFMA 4NM7A 3FMHA 3UZTA 3D94A 3UDBA 4FIHA 4DH8A 2OIQA 2IJMA 4JDJA 4CYJA 4TT7A 1F3MC 3HAMA 5KMMA 5CSHA 4F64A 4YTCA 3TJCA 4IM0A 3LE6A 3U8WA 3G33A 5AAEA 4C2WA 2OF2A 2XNBA 3N4VA 2FH9A 2O64A 4G3FA 2V55A 5HESA 3C4CA 4YC3A 4IIRA 3KIOC 1RDQE 1Q24A 4JDIA 2XARA 1GJOA 4X2GA 4C58A 1PXKA 2HZ4A 1J1BA 4RX8A 4DFXE 3WE4A 3D7TA 5EDPA 3ITZA 2P4IA 2QO2A 4X2NA 3BYOA 3OUKA 2XJ2A 3QRIA 3QUDA 3O23A 2C5OA 5EHYA 3SGCA 1WCCA 3HRBA 3V5JA 2XS0A 4AZWA 4DYMA 1OBGA 4QMLA 2WD1A 4FTIA 3BV3A 2EXMA 3OMVA 3ZYAA 3O71A 5BMSA 2ZFYA 3R00A 5DG5A 1L3RE 2HY0A 2SRCA 4XRJA 2XK7A 4D1SA 5HOAA 2XMYA 1WBVA 1H24A 3DBQA 2Q83A 5CEMA 1FOTA 3KVWA 4UEUA 3CIKA 3IDPA 4KWPA 3LM0A 5I3RA 3BGPA 4WRSA 2BRNA 4IFGA 5FGKA 1LP4A 4WSQA 1OVEA 3ZO4A 1P5EA 4J8NA 4D4RA 1GIIA 4G5PA 3OT3A 3I6WA 2J2IB 3OOGA 4YZNA 5AP0A 2VTPA 5IA5A 4AZVA 4ZY5A 3GC8A 5BUJA 5M06A 2B54A 5CEPA 5GHVA 2PE1A 3SA0A 1WVXA 4QQCA 2GS7A 3TNQB 3PA3A 3VVHA 1LEWA 1VEBA 3ZTXA 4C4GA 5A9UA 2GNLA 2X4FA 3MVMA 5DRBA 3HV3A 4E20A 3SAYA 1JVPP 3GI3A 3DXNA 4X6RA 4B0GA 4RJ4A 3O7LD 1K3AA 2QO7A 3UZRA 4C36A 3QX2A 2WMTA 2C6OA 2B55A 3JYAA 4YJOA 4BDFA 2ZOQA 2YAKA 2Z7SA 3H9RA 2Z2WA 3AGMA 3L9MA 2FSMX 4N0SA 5C01A 5EDRA 4F9WA 4FEUA 4X2KA 1XQZA 5L2QA 3JPVA 3GUBA 1WBOA 2B9IA 4J96A 1Z57A 3VUMA 5EYKA 3MWUA 4FBXA 2Z7RA 4IWDA 4GYIA 3HMPA 3V04A 5EKNA 3PWDA 4D2WA 4E73A 3NCZA 1PMEA 3FMJA 1QPJA 1ZOGA 2QU5A 3F82A 3GFEA 1K2PA 2OH0E 4CD0A 3LFCA 2RFSA 1GIJA 3G51A 2OU7A 2YIQA 4GW8A 4BHZA 2HY81 3CS9A 2XVDA 4YUQA 2XRUA 5JGDA 3PVWA 3Q52A 4YZMA 1JNKA 5FXSA 4ZS0A 5G6VA 1ZZLA 4I3ZA 4RJ7A 4DHJA 2JITA 4NL0A 5GIOE 1YOJA 4DC2A 4DT9A 3PLAE 1M2QA 2YZAA 4NKSA 3OS3A 3ATSA 4RWKA 3IKAA 3ULIA 4G6NA 4AS0A 3F3WA 3FSFA 5E8TA 3RVGA 4FK6A 2C5XA 4BTJA 4RWIA 2Y4IC 5CU2A 5ACBC 3VUGA 4IE9A 2Z02A 2J5EA 4I0TA 4JRVA 3G15A 1KOAA 5L6WL 2VO6A 4GMYA 3I0QA 1Q8YA 2OKRA 4U8ZA 4EOKA 3SLSA 2BROA 1PMVA 2WQOA 3R7IA 4YJQA 1VLRA 2BKZA 3RK9A 2BAKA 3K5UA 5KX8A 4YBKA 2C3JA 2OH4A 3P23A 2C47A 1L8TA 1Y6BA 3Q96A 3A8XA 3IW6A 3PXZA 3AKJA 3IGGA 1M17A 2ITQA 5AV0A 4OBOA 4Z16A 3ZMMA 1VYZA 2A98A 4ACDA 4PP7A 4BICA 1IAJA 3FZOA 5KBQA 2WXVA 2Y6OA 5HIDA 2JC6A 3DBEA 3MYGA 3R7YA 2WNTA 3H9FA 3RTPA 2NYAA 4O84A 3P7CA 4CFNA 2Y8OA 2HENA 1H26A 3ORKA 4DH7A 3MH1A 2DQ7X 3ROYA 2PUIA 3D2KA 3GCPA 4H58A 4IAAA 4R7HA 3CQWA 3PUFC 4AT4A 2H34A 5DI1A 2W1CA 5J87A 3ZU7A 2JBOA 3LCTA 2CKPA 3DV3A 1H0WA 2UVZA 3LMGA 4HYHA 4KRCA 4CG9A 3ZXZA 4AAYA 3FMKA 3PY3A 4EEVA 5J9YA 3QU0A 3GBZA 4FL3A 3E5AA 2PMIA 2J6MA 3MY1A 3TIYA 2PMOX 3HMIA 3PG3A 4IEBA 3PVBA 4QQJA 5JKGA 3Q4ZA 3ACKA 4LFIA 4QP2A 4QP3A 3H10A 4II5A 3ZRMA 2VGPA 2XF0A 3VS2A 2HOGA 4O7NA 4IM2A 4PDPA 2EUFB 2B1PA 5JRQA 3P9JA 3PUPA 4GRBA 3VC4A 5IH6A 3BEGA 2YIXA 5IKWA 2P2HA 4FZ6A 4NYEA 4O4EA 4O86A 3S3IA 5BUIA 3VUHA 4CMUA 2R3KA 3R22A 2ZMCA 3KN5A 4FSUA 1YDSE 4IQ6A 3ZEWA 2XIXA 2OG8A 5C8MA 3R7EA 2YITA 4HVIA 2WAJA 4AUAA 4I4EA 2Y4IB 3F7ZA 3UP2A 1OGUA 3TN8A 3BIZA 5FQDC 4XV2A 3BBWA 4OTWA 5HD4A 4A9SA 4BDGA 2CNQA 2X0OA 4KBCA 4KBAA 4WA9A 5C27A 1H27A 1OIUA 3COMA 1WFCA 3QRTA 3QTXA 4BCJA 4JR3A 4BDIA 2BDFA 4KINA 2RIOA 3R8MA 3LCDA 3CCNA 3FAAA 5EHOA 2EVAA 3AMBA 3IO7A 3COHA 2UZVA 2R0UA 2XBAA 4W4XA 2QR8A 5AWMA 2QG5A 4F08A 3CC6A 1TVOA 3PG1A 2P3GX 4ZMFA 3ORMA 4FIIA 4O0TA 2X9FA 4WNMA 5ETIA 3D83A 1REKA 2XK8A 3MFSA 2PZIA 3QGYA 2O8YA 4WUAA 5CEKA 5B2KA 4C61A 4E93A 3F3UA 3PXFA 4Y72A 4AU8A 5HLNA 2F7ZE 4Y8DA 5LVOA 4LDTA 3PLSA 4XG2A 5DBXA 3PZHA 5CALA 2PVLA 3DKCA 4GIHA 4EOOA 2JFMA 2CGUA 3KB7A 1XH5A 3R9DA 1JBPE 3F7WA 4PPBA 4K9YA 2OIBA 4YGAA 4B9DA 4BCQA 1URCA 3V8TA 1QPEA 3O8PA 3TV7A 5B7VA 2WQNA 2RKUA 4WKQA 4KD1A 3DNEA 3VHEA 2C68A 4CSVA 5J7HA 3F5PA 4DEDA 1PKDA 5J1WA 4QDVA 3GXLA 3BGQA 4R78A 4P2KA 3EH9A 5EM8A 5I3OA 2NPQA 4KIPA 4AFJA 5JQ5A 3UC4A 3I81A 1STCE 3AD5A 3OWKA 5CZHA 3EYHA 4CT1A 3LFAA 5JMSA 1OL7A 1XJDA 3R73A 3DZOA 4I6HA 3TACA 3QFVA 4U41A 5HE3A 3VRZA 3DS6A 3MV5A 3WZJA 3UIUA 2V7OA 4L8MA 4FUXA 3D14A 4R8QA 5A6NA 4QPSA 3BCEA 1YHVA 2ONLC 3AC2A 3PRFA 5AIRA 2X7GA 4RX9A 1H0VA 2WTCA 3DB6A 1Q61A 4I5HA 5KCVA 3WARA 1S9JA 4G9CA 4XP3A 1FMOE 5FBOA 1Z5MA 2IW8A 2XJ0A 4DG2E 2O5KA 1A06A 1JPAA 1LR4A 2ITNA 3EQCA 3R8UA 3IOPA 3PJ8A 4RG0A 3UYSA 4MNEA 4C4IA 1OKZA 2BUJA 4Q5HA 5AP7A 1A48A 3FZSA 3ZO2A 1OUKA 2QOKA 2ZMDA 4RT7A 4R5SA 1S9IA 2ZM3A 4OAVB 3F66A 3RZFA 1E9HA 5EYMA 3NVMB 3TNWA 3Q3BA 4C0TA 4BCOA 2R3QA 4L68A 4WBOA 3FMDA 5ICPA 3LM5A 4FNYA 3FC1X 3KREA 5IQDA 4BCIA 2W05A 3Q4UA 4DEGA 4R1YA 4ZJVA 5GIPE 3PWYA 4O0UA 4RFYA 3Q9ZA 3UOHA 2CDZA 3ORZA 4OTGA 4CEGA 4DAWA 4YR8A 2BRMA 2F7EE 2YCRA 2OI4X 1R0EA 1ZXEA 1KE5A 4FE2A 1Q8ZA 5DPVA 1YXUA 2ERZE 3LHJA 4BHNA 2X7FA 3NIZA 4ALUA 5EHLA 3AC3A 5FLFA 5EK7A 4MX9A 3LFNA 2A19B 4EH3A 4O7TA 3TMOA 2VAGA 1U4DA 3WE8A 2WU7A 2UW7A 4FSTA 4BKZA 1ZY4A 2XYNA 3DJ7A 2XCKA 3L9PA 5B2LA 3TUCA 1AGWA 1NT2A 4YPDA 5IQHA 4MD7E 4BDBA 3E3BX 2CPKE 4E5AX 3W0PA 4D4VA 2C1AA 2JKQA 4RBLA 3V51A 4JDHA 4D1XA 3QQUA 4NIFA 2WTIA 4FEQA 4PMSA 2GSFA 3DXQA 3HRFA 2XRWA 3G6GA 3TM0A 4KIKA 1UA2A 2AEGA 4JBQA 4U3YA 1PHKA 5CAUA 2C0IA 2W1IA 1CMKE 2OZAB 3TZ7A 5IH4A 1O6YA 4FTUA 3ZLYA 4DFNA 3DQWA 2QR7A 4BDHA 5HTIA 2UW6A 2UZLA 3KXXA 4G16A 4CZUA 5JFSA 3EQDA 3OEFX 4FZDB 4WD5A 3IW4A 4GKHA 4OTIA 5HI2A 4D0WA 1WBTA 3AT4A 4BJJA 4JQ7A 4M97A 4MXCA 4ZSEA 4R3RA 4CFVA 4E6CA 5J79A 4MQ1A 3KRRA 4U7ZA 4NFMA 1ZOHA 1JSVA 3BV2A 4C4HA 1WBPA 3CPBA 4CFWA 1MQ4A 2R3MA 1W82A 3ZUVA 3LAUA 3ZDUA 5FXQA 3F69A 4FKWA 4ID7A 4MH7A 4RZWA 4UYNA 2BZJA 1ZYSA 3R7GA 3W32A 4BCPA 4KABA 2UZWE 3MFUA 3OTUA 4GU6A 4I6BA 4F7LA 3EQFA 3Q6UA 3C4FA 3FDNA 1IASA 4AGCA 5KO1A 1GZNA 2A27A 2GU8A 3K2LA 2WMVA 3DB8A 3DFCB 4FKQA 4TXCA 5CSVA 3TV4A 2W5HA 4XOYA 3FBVA 3PP0A 3O0GA 2ITOA 2YIYA 4K33A 3FLNC 4PPCA 5L8JA 4BDAA 4JX3A 4UN0C 1OIYA 2PHKA 4IWQA 4V01A 3UVPA 4BVUA 1IA9A 4FNWA 3MY5A 3NFFB 4CXAA 3FYJX 2YAAA 4EKLA 4PTGA 3OF0A 4BDDA 4D5KA 3QCYA 3WOWA 4NU1A 4C33A 4NKAA 4ERKA 3PJ2A 1JSUA 3MH2A 4WNOA 4LUEA 2XNPA 1MRYA 5IA4A 2IVTA 2KTYA 3DK7A 4OTQA 2X6DA 2VWXA 3IDBA 4ANSA 5D9HA 3HV7A 2IZUA 2YACA 3EQGA 4BWKA 4DH1A 4FKUA 1ZARA 3FLYA 4RX5A 2IO6A 3W0MA 3W0RA 3R0TA 5CI6A 3VO3A 5CF4A 3E62A 2CN8A 4L3PA 4W4WA 3PA4A 4QYHA 2VTAA 3EHAA 3QGWA 5E8WA 3W2OA 4ASZA 4U81A 4PPAA 5ETAA 3OWLA 3V5WA 1YHSA 3ZO1A 1OKWA 5K5NA 4O0XA 4RPVA 4ZAUA 3A8WA 3Q5IA 4XG6A 5E8UA 5TF9A 3HNGA 5L2SA 2V0DA 4S33A 4ZMEA 3DOGA 3JVRA 4F99A 3IECA 4N70A 4UMUA 2PPQA 3HA8A 1ATPE 4M84A 4O1PA 2FVDA 4DG0E 2J0LA 3NUYA 5CAQA 5FXRA 3C0HA 4JT3A 4IZ5A 5CEIA 5M44A 4U43A 3QTQA 4JX7A 1YHWA 2JFLA 4TZRA 2J7TA 5TE0A 3V5TA 4ANNA 5LQFA 3R8PA 3UIXA 3FMMA 1AD5A 2VV9A 3AKLA 5FDXA 3F2RA 5M08A 4LUDA 2WMUA 4AA4A 4QQTA 2R7IA 4AN9A 5KHWA 5BVWA 2CCHA 4U40A 4ENYA 1OKYA 3MB6A 5M51A 2PSQA 3G9NA 1Q5KA 5I9YA 3VULA 1VJYA 2FYSA 3CD8A 4S30A 4ZIMA 5KMJA 4E5WA 3GVUA 4G17A 5HO8A 2YLFA 4G31A 2QOBA 2Y6MA 2XNNA 4D0XA 1TQPA 4XX9A 1Q99A 2JLDA 4IZ7A 4PL4A 4CKIA 1YDTE 3ENMA 3RZBA 3LFSA 4L00A 2VZ6A 4GYGA 4F6SA 3I4BA 4PDYA 3QTRA 3RMFA 5JFVA 4EH5A 4QPMA 3QX4A 4F1OA 2G2HA 4XOZA 2B7AA 3EN9A 3PE2A 5L2WA 3ZONA 1YXSA 3TG1A 3WF7A 3MFRA 3R83A 5J95A 4EHEA 3MS9A 4ZJIA 4RJ5A 3FKOA 3GGFA 3WYYA 2A0CX 4FYOA 2FUMA 4OT6A 4WBBB 4O4FA 1JSTA 4XG9A 4BWXA 1UU7A 4LL0A 4YPSA 3QTUA 4D55A 3FV8A 4MD9E 5IISA 4XLVA 3A99A 3OW4A 2JDTA 1UNHA 4YNOA 4CQGA 4DLIA 4F0GA 2ITWA 3A2CA 3UO5A 2WMBA 2PE0A 5J1VA 3OEZA 3QCSA 4W8DA 5CQUA 1GZ8A 4ONAA 3BU3A 3ZZEA 2HZIA 3ODZX 5E4HA 4ZS4A 3ZRKA 3IW8A 1HCLA 4EYJA 3UDTA 4BL1A 4PDOA 1KE9A 2R3HA 3RAKA 4F9CA 1W7HA 3C51A 1O6KA 4PNIA 4BF2A 2BFXA 3HX4A 4PTEA 4V04A 2AYPA 4DFUA 4M8TA 4AX8A 2WOUA 3G9LX 3S0OA 4F65A 1CKJA 1H1RA 3UGCA 3O96A 4MF0A 4IMYA 2YWPA 2QO9A 2HK5A 4FSNA 2ITYA 3PSBA 3HV6A 1G5SA 4PMMA 3A62A 3PA5A 3QCQA 4E6AA 3TYKA 5ETFA 3AGLA 3EN5A 2VO3A 5HNIX 4UZHA 2ITTA 2HWOA 5GJGA 4CFUA 4RVLA 1W98A 2BTSA 4FT7A 5CNOA 3QTZA 4O7LA 4L9IA 4UYAA 4BDEA 1WVYA 4NM3A 2LAVA 5BVNA 4QTAA 4JNWA 2DUVA 4AA5A 2B4SB 4CGAA 4FT3A 2F9GA 5AMNA 1WAKA 3ZZWA 2C69A 4QMWA 5HKMA 4BZDA 4I6LA 2PK9A 3TKUA 4I5CA 3IOKA 4V0GA 3ZSIA 3HL7A 3II5A 3PJCA 4CV9A 4XG7A 4O0RA 2GMXA 4IJPA 4FEWA 1YXTA 5EH0A 5L3AA 3GCSA 5CI7A 2BKKA 4IVBA 3ZUUA 2YDIA 3LKMA 3O5AA 3Q2MA 4YSMA 5HG9A 3R1NA 2C5NA 5KMKA 3PY1A 3UNZA 4EOJA 4FMQA 3R02A 3RGFA 4HVSA 3QC4A 3TTIA 3BWJA 4QTDA 5HZNA 3S4QA 3FMLA 5KMIA 2RG6A 4IX5A 5CX9A 4DF3A 4CNHA 2XIKA 3LIJA 3MB7A 4FRFA 3DJ5A 4I4FA 4O6EA 4YLLA 3MTLA 5AIKA 4ZTSA 5CQWA 3BLAA 2YCFA 3GCQA 2Y0AA 5HX6A 1Q97A 2QOFA 4USEA 4IZYA 3F5XA 3DLZA 2HWPA 4MVFA 4RIXB 3TJDA 2BALA 4E4NA 4F7JA 4GIIA 2X0GA 3MJ2A 4C4FA 2C1BA 1F5QA 1Y6AA 3LJ0A 4A4XA 2C4GA 3I0OA 2JIIA 2OICA 3KMWA 4GUEA 4AP7A 3LMHA 3TDWA 2ZYBA 3MN3A 4G34A 2PZ5A 1AQ1A 1NVRA 2C30A 2B9JA 4LOPA 2J90A 4I24A 3ATTA 4O1OA 4BB4A 3MBLA 4HGEA 2VTLA 4M7IA 3F6XA 3QRKA 5AP3A 4F9AA 2WEVA 3DK3A 4OTHA 2BFYA 2IVVA 3BYMA 2IPXA 2HXLA 3MIAA 4YLJA 4CQEA 4XLIA 1JKTA 3DTCA 5EG3A 3BHUA 4DITA 3H4JA 4FV6A 3KRJA 4DT8A 4IADA 5AR2A 4LI5A 4W4YA 3NCGA 4M3QA 5LMKC 1TQMA 2ITPA 2VTRA 4L46A 3UDZA 4L52A 4AE6A 3REPA 3UDSA 3TV6A 4RIYB 1PMUA 1FINA 4XG8A 3RK7A 1X8BA 2GS6A 2JBPA 3I60A 4FIJA 4J99A 5FBNC 5BX0A 5HORA 2R3OA 3ANQA 1V0BA 2XYUA 1JWHA 2RGPA 3DZQA 2PVJA 2WPAA 3NPCA 3D0EA 3KCKA 2PULA 4KIOA 5E1SA 4AXEA 3P4KA 2VWIA 4FKJA 2F2UA 4U6RA 2VN9A 2O63A 3VW6A 4JBOA 5GZAA 2AC3A 2VWYA 4OGRA 4FV7A 3ALOA 2BPMA 4Y95A 4MBLA 3UMXA 5JQ8A 3TUBA 5LMKA 4WSYA 5L2IA 4O96A 4AN3A 2R64A 3MFTA 3U9CA 4UWCA 4W9XA 3E7VA 3GENA 4I23A 2BIKB 2CNUA 2OGVA 4ACCA 4YZCA 3WIKA 2P2IA 3SV0A 4BCKA 3C4ZA 4WG3A 4APCA 4C34A 5LVNA 3U6JA 5IQEA 2YM4A 4G3GA 4QP7A 4E7WA 4MQ2A 4FNZA 1KV1A 3KULB 4XV3A 1ZYCA 2CKEA 3PSDA 1UVRA 4LRMA 3JR1A 2ZB0A 3K3JA 3W2SA 1RW8A 1XBBA 2QOCA 4PMTA 1W0XC 2LGCA 2AQXA 4EJ7A 4AOTA 2XK4A 4U5JA 5CANA 4AN2A 1PJKA 2XUUA 2YJSA 2CGWA 3E8EA 4FKVA 1PKGA 3C0IA 4L6QA 3UO6A 4NW5A 4O7YA 4UMPA 4XS2A 2X39A 3U55A 3EQRA 4L3JA 4ANOA 1DM2A 4A9RA 4AOJA 4FICA 3UOLA 4KKEA 3VUDA 2XK9A 2XEZA 3KXZA 3P79A 4O4DA 3TWJA 2XIZA 3KXNA 3D15A 3Q60A 5HNBA 5H3QA 5L2TA 3OY1A 5AP4A 3RBWA 3ML1A 1XHAA 2RFDA 4Y85A 5I9XA 2FO0A 3NIEA 4GFOA 3O2MA 4O27B 4ANBA 5IA1A 2QOIA 4NTSA 5HD7A 5LCKA 4NM5A 4D9TA 4UZDA 4YBJA 4JJRA 1J7UA 3OCBA 3D7ZA 4LQMA 2BZHB 5E9EA 3BEAA 2CGXA 4MHAA 3EQBA 3FUPA 4YJPA 4ZXTA 4ZSAA 3UJGA 4EYMA 5HLWA 2PVKA 1KSWA 5IQGA 5BV3A 2CNVA 5A4EA 2XZSA 2CN5A 2QLUA 2GTNA 4RC2A 4GJ3A 5E8VA 3NNXA 4F70A 2RL5A 3QUEA 2XIRA 4O4CA 3FI8A 1BKXA 2GQSA 3DBCA 2OSCA 4B99A 5H8EA 3QALE 4GG5A 3D7TB 3P86A 4ITIA 4NZWB 4XRLA 5F4NA 3CXWA 3NDMA 4ZP5A 2AUHA 4DHFA 5HCXA 4ZJJA 5M4CA 2C0TA 3E8NA 4DEIA 3JXWA 1BL7A 3F9NA 3FHIA 3Q4TA 3FZPA 3MVJA 3QRUA 2W99B 2YA9A 3ID6C 4CMTA 1U5RA 3FLWA 1P4OA 2ZV2A 3LFDA 5CXHA 3V8SA 4ACGA 3E7OA 2YN8A 2ZM4A 2J4ZA 4BCFA 4D2PA 4PMPA 3QD3A 4AA0A 5CZIA 5CASA 4QT1A 4C37A 2X81A 4AXAA 4IVDA 5J9LA 5J5SA 4R77A 2R9SA 3OFMA 2ZV8A 1MRVA 4NH1A 3P5KA 2YDKA 4QMNA 4U97A 3O50A 4M66A 3MIYA 2IG7A 3A4PA 2VTHA 1HCKA 4TN6A 3CPCA 3KMMA 4IAFA 4EOPA 1OBDA 2I7QA 5HLPA 4JIKA 3UOKA 3WZDA 2R3FA 4MF1A 3BX5A 3DK6A 5C8KA 3Q04A 2OFUA 1LUFA 2BDWA 1XR1A 2XKEA 4IDTA 5KZ0A 4BRXA 3VUIA 2A2AA 3O7LB 4MXZA 3OCGA 4BDKA 4LOOA 2CHLA 2HAKA 2B53A 2VNWA 4ALVA 4QPAA 4Z7GA 3ZRLA 3DAEA 2WMRA 5E8YA 5JGAA 2Z7LA 5JZJA 2H8HA 3A7JA 4FR4A 4H3PA 4JRNA 3V3VA 3A7IA 4OUCA 5FTQA 3KF4A 4K0YA 2I1MA 4UV0A 2Q0BA 2W17A 3BGZA 2VTJA 3G90X 4EUTA 1KWPA 3CQUA 3SD0A 5CU4A 4FSYA 4DEAA 3QQKA 4C02A 4R5YA 3FEGA 4GKIA 3IONA 5GINE 4WOVA 1SZMA 5IEXA 3RHKA 5KBRA 4F63A 4U9AA 4IX3A 4PL5A 3UNKA 1LEZA 1NVQA 1Y91A 3DGKA 3ZDIA 3UG1A 1XH6A 1I44A 4M12A 5CU6A 5DWRA 2R2PA 3QQJA 4RRVA 4FKIA 4X6QC 5L8KA 4MEDA 2G9XA 4BBEA 3THBA 4IAZA 4XG4A 3CD3A 1KE6A 3RAIA 5T6KA 5I9VA 1UNGA 2YWVA 5IQIA 3R9RA 3UIMA 4YTHA 3Q9WA 5HTBA 4KUJA 3FC2A 4H3QA 4RWLA 5CWZA 3VBVA 3RPOA 3BL7A 1SMHA 1VYWA 5HG7A 5CSPA 5D41A 3QLFA 5M56A 1PY5A 2WTDA 1Q62A 1J7LA 4DBNA 5J8IA 2QC6A 4E5BA 4IAKA 1ZYLA 2WZJA 5CEOA 4MWHA 2VNYA 3QD2B 4HPUE 3UPXA 2VRXA 4DHZA 5AUYA 4DDIA 2BZIB 2BDJA 3WF6A 3KF7A 4XP2A 2B9FA 3TZ9A 4FSZA 3VNTA 1UWJA 4MBIA 3C5UA 4FSRA 4IB0A 3H30A 5I0BA 5IMEA 3AOXA 2WOTA 4GCJA 5FEEA 4IJ9A 2EXEA 1URWA 4DA5A 3R63A 3EYGA 5JZNA 4YO4A 4A9YA 1QL6A 4PY1A 4AW0A 3A7GA 4U3ZA 5HVYA 4EH4A 3TEIA 4BBFA 1ST0A 4YZ9A 3JY9A 4S2ZA 3E93A 2R7BA 4DINA 1YWNA 5BYYA 3VQUA 4B4LA 2QG7A 4IACA 1QCFA 4JAIA 5CS6A 1YOMA 1JOWB 3I7CA 1BI7A 3NYNA 5LVLA 5A4TA 3KXHA 5KNJA 2PUNA 4TWOA 4U80A 2PUUA 4P4CA 4RMZA 5K4JA 3KL8A 5BVEA 4RZVA 2G2FA 2QOLA 1PW2A 4XUFA 5EYCA 4BDCA 4IANA 4YMJA 2C6MA 5LOHA 1PYEA 3FLSA 4I94A 5DN3A 5LVPA 2ITVA 5IA2A 2GHLA 4XP0A 4YJRA 2QHNA 5A14A 4QYYA 4GSBA 5DYJA 4A06A 4ZLZA 5HO7A 3PXRA 3K3IA 1KOBA 3F88A 3ZC5A 2XH5A 3GU8A 5KKRB 5A3XA 5JH6A 2X0PA 4FZ7A 3E3PA 5EW9A 4DFYA 3QKMA 3QAME 4J52A 2O65A 3FY2A 3U54A 1ZY5A 5CT0A 5L6OA 1SVEA 3PXKA 4Q5EA 4DFZE 1YWRA 2XANA 3NR9A 1OIQA 2DWBA 3OCSA 1OMWA 1Q3DA 4JLCA 1U54B 3QL8A 4EC8A 1UU8A 1UNLA 2OBJA 5M53A 1SM2A 3LCKA 3NUUA 4CRSA 3VF9A 4YJVA 3CBLA 4NW6A 4R3CA 4Y5QA 1J3HA 1XMLA 2RFEA 3KN6A 2BAQA 3R71A 2YJRA 4MKCA 2EB3A 2VU3A 3POOA 4OTPA 5KZIA 3U4WA 4ACMA 5L4QA 2PU8A 3CSVA 4QMPA 5IMXA 4LRKA 2XEYA 3UBDA 1PYXA 4BGHA 3LJ1A 3KK8A 3UODA 5FUTA 3GB2A 4QMYA 4KS7A 4EOQA 4H1JA 1QPCA 2GQGA 4F78A 1GNGA 4BIEA 3L1SA 5DA3A 4MXXA 2OJFE 2GFSA 1YVJA 3G2FA 4LL5A 2X8DA 4GT5A 4YTFA 2ONLA 2BIYA 1PRYA 5FDPA 2BTRA 4GG7A 4OTFA 1W2CA 3Q9YA 3L8VA 4CFFA 1BYGA 4S31A 4ZTHA 4EI4A 2ZV7A 3GP0A 4IX4A 2XCHA 3LZBA 4EH7A 5C4LA 4LGHA 5HVJA 3SXFA 3R01A 5I5ZA 4CFXA 5K9IA 4YURA 4FKRA 5HIEA 2BRGA 3QQHA 3ZFMA 4IVAA 3OD6X 5AP6A 3PY0A 4L3LA 2E2BA 2G01A 1Q4LA 3FZRA 5IEYA 5BYLA 3VBQA 1QPDA 3TNIA 4DGMA 1ZLTA 4CLIA 3KC3A 4QP4A 4EK4A 4EZ7A 2OXXA 5IUGA 5DEYA 1TFFA 3R21A 3EZVA 1BX6A 3GEQA 3TDVA 1YWVA 4EWQA 3UZPA 2ZB1A 3RINA 4DGLC 2I40A 2WELA 4FVQA 4JAJA 4AWIA 3BI6A 4NEUA 3IG7A 3ZM9A 2XK3A 3F2NA 3VBXA 4EQCA 5AP1A 5GJDA 3LW0A 4LMNA