1Q41A

Gsk-3 beta complexed with indirubin-3'-monoxime
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
352
structure length
339
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
publication title Structural Characterization of the Gsk-3Beta Active Site Using Selective and Non-selective ATP-Mimetic Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 339
sequence length 352
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1q41A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1q41A01
4YHJA 3HRFA 4BVUA 4WT6A 4YTHA 2XKEA 4M68A 4IAZA 4D4RA 4BIBA 3SDJA 3W55A 5LWMA 4NM0A 3FZRA 4FTIA 4AQCA 4FT5A 4J97A 3CE3A 2F2UA 3IONA 4EI4A 2XEZA 5JGBA 4X7QA 3MJ1A 4D1ZA 2XYUA 3V5LA 5AADA 2E9UA 4IM3A 1FBNA 3OMVA 3DKGA 4DH7A 2OXXA 5HGIA 3UO5A 1A48A 1B6CB 4YBKA 4XNEA 4TWNA 4B9DA 4FTOA 1OBGA 1H27A 1WFCA 2O5KA 2XEYA 2XKFA 3PJ2A 2W1DA 3HV6A 3E87A 3WF6A 3I6UA 3EN7A 2Y7JA 4IC8A 4MXYA 4Q9SA 2Z7QA 4Z3VA 2QG5A 2GNLA 3CLYA 3FYJX 3I0OA 4FV9A 5AJQA 5M4UA 4DT8A 3OT3A 5HE2A 4O84A 4OBPA 3UBDA 2C3JA 2W1IA 2C1BA 4CTBA 3QRUA 3G90X 3I6WA 4CG9A 3R7OA 5BUJA 1YOMA 1XO2B 4RIXB 2FVDA 4DCAA 5AV3A 2OF2A 1REJA 2VUWA 1A06A 4O2ZA 1IAJA 5CEQA 3HVCA 3RM6A 2XKDA 4RIOA 2BKZA 3BHTA 2JFLA 3Q04A 4GT3A 4NIFA 4WD5A 4HVIA 4GUBA 4XP3A 2YITA 4IHPA 4WIHA 5AWMA 4WG3A 3PWYA 2FYSA 5EM7A 3CY3A 4U97A 1Z5MA 2VWUA 3VRZA 2X7OA 4ACCA 4KUJA 4ZMFA 2WQMA 2I0VA 2QG7A 3FV8A 3RM7A 2HOGA 3PE2A 5M09A 5H2UA 5CF8A 4OTRA 4H39A 5CEOA 3OTUA 1DI8A 4V05A 5CX9A 4IAKA 2UV2A 5F94A 3BHHA 4ZZMA 4D1SA 4XJ0A 4F9CA 5GZ9A 4ASXA 1FVRA 3BWJA 3PIXA 3QYWA 4ZJVA 4BKJA 3KULA 4IH8A 3HDMA 3CIKA 3PIYA 4FF8A 4C4EA 3EYHA 3DQWA 1T45A 2HZNA 3R22A 3UOKA 3DXPA 3O8UA 2WAJA 3R1SA 4HCUA 5TKDA 5BQ0A 4HCVA 3Q9WA 3N4TA 2XIXA 1ZOGA 3Q4ZA 2VU3A 4H3PA 4QO9A 2NO3A 2UZEA 3OHTA 5AUUA 3FHIA 4KIPA 4EYJA 3QZIA 4GW8A 3RAWA 4UY9A 1WBTA 4O7SA 2XNMA 2ONLC 3OXTA 3HAMA 3VJNA 4IX5A 2I0HA 5LWNA 2ZM3A 2XM8A 1CDKA 2X6EA 1B38A 2DQ7X 2RFDA 3QTWA 1XHAA 3QXOA 4UWCA 3WZJA 4AG8A 5D11A 3QZFA 2PUIA 4XRJA 2QOCA 4CRSA 4BBFA 4YJNA 3F5GA 5IDNA 2EWAA 2R5TA 5JFVA 4EHZA 4XBRA 1IRKA 4FYOA 3QX2A 1PF8A 2RKUA 3JS2A 2J0KA 3DK3A 3N51A 4G3FA 5HBEA 5HG8A 5JH6A 2C69A 4IACA 2UZDA 3MH2A 4LM5A 1JSTA 1NXKA 2FO0A 2W06A 3NNUA 3FMDA 3ZRKA 1YXTA 2DWBA 2R3JA 2WMWA 4IWOA 4JIKA 5LVLA 5EKOA 4DEDA 4C8BA 4J7BA 5A14A 3LQ3A 4QQJA 2I6LA 2WTKC 4F0GA 3PVUA 2R3KA 2XM9A 3THBA 4ALUA 2WMTA 2I7QA 2Y6MA 4QPAA 4TKSA 4UALA 3I7BA 2JD5A 3I4BA 5IUIA 4O7LA 4AOJA 5E8SA 2ITVA 4GJ3A 1KE8A 3H0ZA 1ZLTA 4Y5QA 4GV1A 3RINA 4IB3A 4G16A 4U7ZA 4DG2E 4BZOA 4FR4A 4E7WA 3MESA 3FAAA 4JT3A 3QCXA 4JNWA 3R7VA 3VS1A 2Q0BA 5IG1A 3LLTA 3RALA 3PVWA 4RFZA 3T9IA 3UIMA 3TV7A 4A7CA 1PMNA 3ULIA 4I1ZA 1REKA 2BALA 2YAKA 1WMKA 3QQUA 5GHVA 1Y57A 1WVWA 5AAEA 5C8KA 3TN8A 3BZ3A 1YXUA 5I3RA 5JQ8A 3HMIA 4ZOGA 5IQHA 4UZHA 3ZYAA 1YOJA 3B8RA 3U6IA 4DLJA 4GL9A 4O7TA 2WU7A 5IF1A 2ITQA 3U55A 3FMLA 2XK8A 4MNFA 1JSVA 2XKCA 4QMUA 4C4GA 1YDTE 4IQ6A 4GKIA 5AUZA 4FT0A 3RBWA 2C0OA 3OOGA 4ANBA 4DN5A 4NT4A 3I1AA 2EU9A 3EQBA 4G34A 4QMVA 4QP7A 4RFMA 4APCA 4HNIA 4Y83A 3VRYA 4QNAA 4N6ZA 5E1EA 4R7BA 2UW0A 4HW7A 1O6KA 3UQFA 2PWLA 1G8SA 3SHEA 2JGZA 4NFNA 4FEUA 5CEIA 4CNHA 2YZLA 1TQIA 4Y5HA 5EM6A 1YI3A 3I5ZA 4E1ZA 5JRQA 3SW7A 4EOPA 3C1XA 3JVSA 3CD3A 4QMNA 5IKWA 1W7HA 4DFBA 5CSWA 4QMSA 3E92A 2G2HA 3F82A 2ACXA 3RZFA 3VS6A 3ZCLA 2UZWE 3VBYA 2CN8A 2UZTA 3QLGA 1V0OA 4RX9A 4GFGA 1ZZLA 4OTWA 3LAUA 4WNKA 5E90A 4CFMA 1S9JA 4F9AA 4K18A 1Q8YA 2VX3A 3ZMMA 3VUDA 4FL3A 3GC0A 3LMGA 4CSVA 5JQ5A 1URWA 3EJ1A 3D14A 4NYEA 4NIFB 3AMYA 5E4HA 4IWDA 2J4ZA 3CJGA 4J8NA 2PVFA 4QMYA 4RFYA 5EQYA 3S0OA 4YJTA 3RZBA 2WMQA 1JKSA 4FT9A 2OF4A 4U8ZA 3ORKA 1GIHA 4RJ6A 3LXKA 1DS5A 1LPUA 4FEXA 2YIXA 5CU4A 1YXXA 1BLXA 2WOUA 4M0ZA 3E3PA 2YABA 3LQ8A 4JBVA 3EFJA 4IC7A 4QP4A 1H24A 3MDYA 3NVKI 2R7IA 1YHVA 3O7LD 3E8CA 1OIUA 2AC3A 4DH8A 4L8MA 5DT0A 5BVOA 4EK5A 4RJ8A 4B8LA 2F7ZE 4IBMA 2CSNA 3ROCA 2VGPA 4BZDA 4AP7A 3KULB 4I93A 5FG8A 2F9GA 2G2IA 3I7CA 4II5A 3Q4TA 5L2SA 1Q97A 4F1MA 1CTPE 3BV2A 4D0WA 4IWQA 3LXLA 1P5EA 2OIQA 3IOKA 5HX6A 3HRBA 4IE9A 4XH6A 2VN9A 3IKAA 1H4LA 4M69A 1MQ4A 5ETFA 4ZLZA 3IG7A 3KGAA 4PNIA 2PZRA 2R7BA 3QWKA 4XV3A 5HI2A 4RBLA 4DCEA 2PHKA 2R2PA 4JIAA 3QRJA 4KSQA 4G3CA 3I60A 4JQ8A 4EZ7A 3LE6A 3DXNA 5FP6A 3CP9A 5DR6A 2ZMCA 3R01A 4RZVA 3VIDA 4UEUA 4BWPA 2E2BA 1JWHA 4I4EA 5KZ0A 3MVJA 3SOAA 3ZFMA 3Q2MA 4ZS4A 3U54A 3QXPA 2CLXA 3FQHA 4PPCA 4U42A 4YPSA 4EKKA 5IA1A 1ZXEA 4G31A 4IZ7A 4O0SA 3QUPA 5HTIA 2O8YA 4ZSGA 2XJ2A 3RWQA 2IZRA 4IB0A 1Q62A 1WZYA 3UYTA 3RPRA 5IPJA 3ZOSA 4XEYA 3BHUA 2R3RA 4QTEA 2GHGA 1V1KA 2PSQA 5B0XA 4JR7A 1NVQA 2QC6A 5KKRC 1XH9A 2QCSA 1PRYA 3EQHA 3DFAA 4MQ1A 2WU6A 1JQHA 3MH1A 3PG3A 4U40A 3LJ2A 1ZMWA 3EWHA 3EQFA 4L67A 4XP0A 5DFPA 2WMBA 3W18A 4FTKA 4X2GA 4DFYA 5FTQA 4OTHA 3W2OA 4UMQA 1M7QA 4DBXA 4HOKA 2J6MA 2VD5A 1GNGA 1TQPA 4L53A 4GG7A 5ANEA 2UW5A 4ZS0A 3R8LA 4C33A 4YR8A 5IU2A 1G8AA 4AN3A 2J0JA 4KSPA 4FGBA 1Q3DA 3PPZA 3GP0A 3R9HA 4ZLYA 4G5PA 2OK1A 1WBSA 3OVVA 2BTRA 2DUVA 4FVPA 4G1WA 1ZY4A 3HX4A 3QCYA 4G6OA 5CWZA 3NW7A 3QZGA 4G6LA 4I6FA 3VVHA 3W32A 4AZVA 5FRIA 3ATTA 3PY1A 2OBJA 4R1VA 4C02A 1PMEA 3DB8A 4HNFA 3DK7A 3KL8A 4IDTA 2E9OA 5H9BA 3Q9XA 4DINA 5HIEA 4EZ3A 4IADA 4A4XA 5JKGA 3R00A 3EFKA 3O8PA 4D2SA 3GCSA 2JDRA 2VTIA 2X8DA 1CSNA 2WHBA 2P33A 1GY3A 1VJYA 2QO2A 1BUHA 4O6LA 4EWQA 3PDTA 2J2IB 4GFOA 3QTUA 4FTTA 4Z9LA 3L9LA 1YOLA 4RWIA 2DYLA 4IX6A 5K4JA 3FL4A 3RVGA 4JI9A 4M15A 3S3IA 4O7WA 5EYCA 5AUTA 4W9XA 1J3HA 1SZMA 1IA9A 4RJ7A 3GCUA 4R1YA 1OGUA 5AR7A 5JRSA 5EOLA 4IZYA 3L1SA 5AIKA 2GNIA 3PJ1A 3F69A 3PRFA 4M66A 4EL9A 2VO3A 5EYMA 3RK9A 2R9SA 4YGAA 4GEOA 4FC0A 4FNZA 2VTQA 4L00A 4QNYA 1OB3A 2IZUA 3BYVA 4I22A 5KMJA 5GJDA 3FLSA 3L8VA 4BCOA 2YDKA 1MQBA 1QL6A 1H25A 5A6NA 1R0EA 1Y6AA 3ZZWA 5M55A 5EQPA 2HYYA 2XIYA 4PPBA 3WYXA 3NUPA 2C3KA 4NFMA 3TIYA 2QO7A 3Q9YA 2ZMDA 5EDQA 3DXQA 4O81A 2VX0A 2ZV2A 3KXHA 4Y85A 5HU9A 2HY0A 5HE1A 3BI6A 2V22A 3R8VA 2R3OA 3PFQA 4F6WA 1VZOA 3WIGA 2WOTA 2O0UA 2BDFA 4D0XA 5M08A 3CCNA 3KCFA 3ZFYA 4DG0E 3QTSA 5EW9A 2RGPA 3QYZA 4EBVA 5LMKC 4MTAA 5HD7A 3LCOA 2IW8A 3LFSA 4FSNA 3O51A 3A7GA 3VHKA 3QRKA 4IAFA 4BHNA 5CT7A 2VTJA 4FTNA 5AUVA 2FSTX 3VULA 2YCFA 4UBAA 3UIXA 5IUHA 3EQDA 5EYKA 3DQXA 2Y8OA 5DLSA 4HZRA 1JAMA 3KY2A 2E9NA 3Q9ZA 5EI6A 1IEPA 3ZC6A 4F9YA 2V7OA 1O6LA 3O0GA 4BIDA 2E9PA 2BR1A 3PSDA 4WA9A 2FGIA 2BZJA 3H0YA 1ZWSA 3FKLA 4MVFA 2X7GA 4M69B 4AAAA 4LGGA 3V8WA 4O91A 3F2RA 3A7JA 5CQUA 3ZM4A 4KIKA 2YM8A 1I09A 5HX8A 5GZ8A 3UP7A 4FKUA 4OW8A 4F0IA 3C5UA 5KBRA 4RJ4A 3PJ3A 4YLLA 3UVPA 5B2LA 2ZV9A 2PVLA 3MPMA 4RSSA 2YISA 4FV0A 5CQWA 3RMFA 3DB6A 2QLUA 1R39A 3QTIA 1PHKA 3Q4UA 3IPHA 5FXQA 4AW0A 5CAPA 1IG1A 3BBTB 2HWPA 3PUPA 5HVJA 3TZ7A 2YIWA 3OD6X 3ZEWA 2BFYA 3FY0A 4ID7A 4MBIA 2R3HA 5HBHA 4FKLA 4D2PA 4Z7HA 2BRGA 3FZTA 2RFSA 4RVMA 5DHJA 4CG8A 4ZJJA 2QOHA 4J53A 3AC2A 4RIWA 5AP1A 3ITZA 5TO8A 4ACHA 1H00A 3FLQA 5A46A 3L8XA 3EMGA 5CI6A 4CMUA 4M97A 3MA3A 1UA2A 4ITIA 4QP2A 4WBOA 3P9JA 2WQEA 3NZ0A 3BX5A 4KKHA 5CVGA 3VS2A 2PULA 1P2AA 2CCIA 4XBUA 3DAKA 3QCQA 3AD4A 2VGOA 2XCHA 3ATSA 3MB7A 4TXCA 4E4NA 3FMHA 2YEXA 5D9HA 4ACMA 3Q5IA 2JKQA 2WTVA 2XB7A 3QKKA 3JY0A 1ZMUA 4O0UA 3QTZA 4PP7A 4PP9A 3OCTA 3T9TA 2UW7A 1V0BA 2X8IA 5EKNA 2UW4A 3RWPA 5E7RA 3IGGA 2EB3A 4QP1A 1J7IA 1UNHA 4X21A 4XV1A 3UQGA 2Y9QA 4H58A 4LRMA 4RZWA 3W2PA 3PE1A 2RG5A 5HO6A 1OKYA 4I0TA 4F65A 4B99A 3KK9A 2YCSA 4RC4A 3UC3A 4DEEA 4IDVA 2PZ5A 3DDPA 5EI2A 2X4FA 5A3XA 2WTKB 5DE2A 4GG5A 3C4XA 5FM3A 4EOQA 2XNGA 4IIRA 4ENYA 4BGGA 2Z02A 4BBEA 3HEGA 5KMLA 5KO1A 2F4JA 4D4VA 4KB8A 4ZTNA 2WKMA 4F7NA 1OIRA 3WOWA 5I9ZA 2XS0A 1BMKA 3F3WA 5ANDA 4BDGA 4M14A 3TNQB 4CZUA 5IQBA 4U81A 5J79A 3HZTA 2PY3A 4GK4A 4F9WA 5K4IA 2I1MA 1XH6A 5LVPA 2EUFB 5FEQA 2CGXA 1KE6A 3GNIB 4E5BA 2R3GA 4UX9A 3A7HA 3PPKA 2R64A 3H9OA 4EH9A 4K77A 4OTDA 5CAQA 4M67A 3DKFA 5G1XA 5L6OA 3GU4A 5LCJA 3ACKA 3LXPA 3R7GA 2OU7A 2NRYA 2OI4X 4AS0A 1IA8A 3VUGA 3EQPA 4RGJA 4XCUA 1ZYCA 3NDMA 3NYNA 3U87A 2JLDA 4XMOA 5K5XA 3RPYA 2CGVA 1F0QA 4GSBA 3ZUVA 3A99A 2AUHA 1M2RA 4GYGA 5CLPA 1G3NA 2HW7A 1YDSE 4O0VA 5CF4A 3EB0A 5JFWA 3VAPA 3MV5A 2PYWA 3F5XA 5K9IA 5AV1A 3NNWA 2YM5A 3WI6A 4RX8A 4OTFA 2VTSA 4Z7GA 2CPKE 3DBDA 4OGRA 5C9CA 3D0EA 3OTVA 2GS6A 2BUJA 3KRWA 4C0TA 4TWOA 2OH0E 1UKHA 4X0MA 5JGAA 5IA4A 4ZMEA 3FUPA 4BGHA 1XH7A 5IQIA 3NWWA 4O0WA 2WQBA 4F4PA 3AC3A 3BBWA 4OR5A 4BDEA 5IH6A 4NM7A 4R77A 3P08A 4LG4A 3ZXTA 4D9UA 4YTCA 1GZKA 3D83A 4PDPA 4XX9A 5AP4A 4O86A 3GCVA 3ORIA 4EK4A 4UWBA 1KV1A 4NKSA 2C6TA 4FV2A 2QI8A 1FPUA 2C5XA 3I79A 4FI1A 2UZBA 3D2IA 3V6RA 3W2SA 3AOXA 4AWIA 4EK6A 3IW8A 5DI1A 4ZY5A 5KE0A 4CFUA 3PXRA 2NNWB 4XV9A 5CU2A 2VTRA 5DNRA 2CN5A 3O8TA 5CF5A 1UWJA 5AR4A 3PRIA 1YRPA 3PA3A 5TF9A 3Q2JA 3CPBA 4KIKB 5CYIA 5H8GA 3QU0A 3K3JA 4QP6A 2NPQA 2XNNA 4NSTA 2JDTA 3AG9A 2BKKA 3ZXZA 2FSOX 5CEMA 5LMKA 2X2LA 1PXIA 4FTJA 4GCJA 4RRVA 3DOGA 3ORNA 5AM6A 5AX9A 4EQUA 3D2KA 4DTBA 3A7FA 2XJ0A 3TDVA 2ITXA 2ZDUA 3UG2A 5FEDA 1H1RA 3H10A 4RX5A 3H9FA 4EBWA 2JDOA 1P14A 1HCLA 3B8QA 3UPXA 4ORKA 3H9RA 3POOA 3BEAA 3MTLA 3O2MA 1KE9A 4BYJA 5CENA 3UODA 3VQUA 2V5QA 3QBNA 4RIWB 1BKXA 1OBDA 1H0VA 2QQ7A 3KB7A 2W9ZB 2XJ1A 2H9VA 4RWJA 4KAOA 2VWXA 4PNKA 4ZEGA 4K9YA 3V8SA 4O83A 4QQ5A 2RFNA 3PSBA 3W10A 2REIA 2Z2WA 1P4FA 3G6GA 4EEVA 4GMYA 1YKRA 2HWOA 4K11A 3Q6WA 1R1WA 4EONA 1Q3WA 4L3JA 1KOAA 4UWYA 3MFRA 1OI9A 3SRVA 1S9IA 4QTAA 5CSXA 5ANGA 3V5JA 1KE7A 4DGMA 4AOTA 5KUPA 4RC3A 4CVAA 1YI4A 3MTFA 5EHLA 4BDFA 2YERA 2JDVA 3ZO1A 4AW5A 3MH0A 3D5WA 2C4GA 3DZQA 3G2FA 3QC9A 3GFEA 4XG8A 2JKKA 2R3IA 3QAME 4N0SA 4LMUA 5FDXA 3QGWA 3R1QA 4F08A 2GNFA 4GU9A 1BL7A 4FIIA 4Q2AA 3SV0A 4CKIA 4N57A 5ANKA 4K8AA 1PMUA 4JBQA 3ORMA 2QHNA 3KN5A 4PF4A 2BZHB 5CZIA 3GU8A 1GJOA 4A07A 1Z57A 4J95A 4U6RA 3NW6A 4IAYA 3DBEA 3DNDA 3II5A 4HYSA 5L2TA 1ZYSA 5CI7A 3QA0A 2X7FA 4IM0A 2BILB 3UO4A 3FLZA 1XQZA 3FWQA 4F7SA 2FSLX 3PA4A 3TNHA 4PTEA 4FUYA 3DDQA 2ZOQA 4JDHA 3W8QA 4FMQA 3BGPA 3G9NA 4PWNA 3ZRLA 2OJIA 4BCQA 4E4LA 2J7TA 4YLKA 1GZ8A 3VS0A 4EORA 3DU8A 2ITYA 4C3PA 3OUNB 3FZOA 1LEZA 2WMXA 3Q5ZA 5IEVA 3SD0A 4DEBA 1M2PA 2GS7A 2CCHA 3B2TA 5CSVA 1VR2A 1MRYA 3JUHA 3KRJA 5AIRA 5I9WA 2F2CB 2C0TA 3E8NA 2WMUA 4RVTA 4FKRA 4OBOA 4NTTA 3WF7A 4E26A 2YM4A 1ZY5A 3BGZA 3NCGA 3IS5A 3UPZA 3ETAA 5AMNA 3DBCA 3LLAA 4QMPA 2BZKB 4LL5A 4OAVB 4M12A 3BU6A 5AP0A 4BZNA 3K54A 2UZOA 2UW9A 3FSKA 5A4EA 1ZYJA 2GHMA 4A9UA 5IA2A 4ZSLA 5I9YA 4FV6A 2VO7A 3EOCA 3O23A 5EI8A 3MY1A 4EH2A 4X3JA 3KMUA 4LRKA 5JSMA 2ZVAA 4MD9E 2C5YA 2ZJWA 4RX7A 3ZSIA 3GT8A 1BL6A 5M57A 5IZFA 2B53A 3EN4A 3PLSA 5I3OA 1LP4A 3JPVA 1CKIA 5FP5A 2IW9A 2ZAZA 3FLWA 2G2FA 2JAVA 4FOCA 3E7OA 4BYIA 4AGUA 4FYNA 3WILA 5LMAA 4FV8A 4IVAA 4U43A 3NIZA 3HKOA 2WELA 3BRBA 3OCBA 2X8EA 4LUDA 4K33A 3LPBA 3TV6A 2Z8CA 4CCUA 3CC6A 3LFQA 4FG7A 5AP6A 5E1SA 3TI1A 4HJOA 4C2WA 3GC9A 1DAWA 4TYHA 4XHKB 5EYDA 1O6YA 3CS9A 3WARA 2YWVA 4BR3A 3P0MA 4DH1A 3MIYA 4FTLA 2XRUA 1MUOA 1UU7A 4KABA 5FBOA 3M1SA 3P78A 4I92A 4DHFA 5I5ZA 2NP8A 4QYFA 2YJRA 3D5VA 4F70A 4D9TA 5A54A 3HGKA 4HGTA 3ZSHA 4D28A 4RJ3A 4FKIA 3F61A 2C1AA 3W2RA 4U79A 2BRHA 4XOZA 5EW8A 3FEGA 4K6ZA 4FKQA 4NTSA 4USDA 3V5PA 1XH4A 4BDJA 5C8NA 1U59A 2IWIA 2W9FB 2W4KA 4IZAA 5IA0A 4O7VA 1XBBA 2CGWA 1JKTA 3BE2A 5DGZA 5FLFA 5IEXA 4YZCA 3MI9A 5HTCA 3TZMA 3TT0A 5LMBA 5F1ZA 2XVDA 2C6KA 4QMOA 4XV2A 1UWHA 4EUUA 2C5OA 3DV3A 4I5PA 4NWMA 4W4XA 5I9UA 3EQGA 4JAIA 2WFYA 1YWRA 2PVRA 1ZOEA 5H8EA 5IA3A 5DA3A 3UMWA 4DGLC 4X2FA 4DFZE 3D94A 4XP2A 3PWDA 4UXLA 5AP7A 4QPMA 2Q0NA 3COIA 5EFQA 1Q8TA 2CKEA 2OH4A 5HNBA 2YM6A 3BIZA 5LARA 3VBVA 5A4QA 4FICA 4H1MA 4MF1A 4O21A 3CKWA 4MYGA 4AE9A 3PA5A 2Y0AA 3HA6A 3KXZA 2UVZA 3P23A 2QONA 4ERWA 4CT1A 5CALA 3ZLYA 4F63A 3SRVB 4JDJA 3BLHA 4X2KA 3AQVA 4J1RA 5ANOA 1OZ1A 4CFFA 3E8DA 2HW6A 2HZ4A 4Y46A 3TV4A 5BNJA 4G17A 4PUZA 1Y8YA 4DFLA 1LUFA 3D7TA 4YZ9A 3R04A 4U3ZA 4RVKA 4DBNA 5DOSA 4YC8A 1M2QA 1OL6A 3OY3A 2GCDA 1H1QA 2B9HA 3AC8A 3BV3A 4JXFA 4EQMA 3S4QA 3LCSA 4QMTA 4IFCA 4PQNA 3L9PA 3RPOA 1WCCA 3F3ZA 3NYVA 3ZHPC 4DLIA 4D58A 3R21A 5HVYA 2BTSA 1NA7A 3G0FA 2OZOA 4GS6A 4X2JA 3C0IA 5C01A 3G5DA 4TL0A 4L45A 1Q5KA 4LGDA 2PVMA 3UJGA 4PX6A 5D10A 4E8AA 2B54A 3D15A 2IVSA 4NCTC 4I3ZA 3P86A 3F5PA 4M84A 4XUFA 1AGWA 3FE3A 2UUEA 2VZ6A 3CD8A 3CQUA 2XK3A 4B8MA 4E5WA 4E6DA 3T3UA 3I0QA 2RF9A 3FMEA 5JN2A 3BYMA 2CNUA 3PSCA 4RJ5A 1VYWA 3CGFA 2C5VA 4AZTA 3PXKA 1V0PA 4EUTA 4IAIA 3FLNC 4X3FC 4EH7A 3NUXA 4FZ6A 5EH0A 3CGOA 4DFUA 3WZKA 5TE0A 4CYIA 3S00A 1U46A 3UE4A 3VC4A 3VUIA 4J52A 4KRDA 2X1NA 4EJNA 3IGOA 2W99B 2O64A 4QMZA 3NVMB 3MPAA 3TDWA 4BCHA 4BI1A 3VBTA 4HVDA 3BHYA 5LVNA 1Q41A 1WBVA 2HCKA 2WTJA 3NSZA 3WE4A 3M2WA 5CSHA 4KWPA 4YJOA 3F3TA 2J5FA 1YQJA 3KXXA 3TG1A 3I81A 4MXAA 3V5WA 1OPKA 2J90A 5DWRA 2WNTA 3NNVA 5EM5A 3VS7A 5CU3A 4BFMA 4FTUA 2IPXA 1XH5A 2NRUA 3FXXA 3P1AA 4H3BA 1A9UA 1G5SA 3LMHA 5FXSA 1H8FA 5BYZA 2XBJA 4GK2A 3NRMA 5HHWA 2BHEA 5HE3A 5T3QA 3R8PA 4XYFA 2I40A 1J1CA 3DZOA 4W4WA 3WYYA 4S31A 2XMYA 2YFXA 4EHEA 1T46A 2PZYA 4B7TA 2HY81 3W16A 4XG4A 1H08A 2PU8A 3QTQA 3E93A 4LYNA 5ANIA 1JLUE 2V62A 2VTAA 5HO7A 4TYHB 3OZ6A 5GIPE 5AUWA 2WPAA 3NW5A 3R73A 4BN1A 3OCGA 1ND4A 4FL2A 3FLYA 4O7ZA 1GZOA 3AD6A 3F9NA 3LVPA 1DM2A 4K2RA 3NUAA 2A1AB 2W1ZA 3NCZA 3G33A 4GKHA 4D4YA 2HAKA 3C4CA 3PIZA 4FODA 4EH4A 3MPTA 5DT3A 4FZDB 4U0IA 1UV5A 2ITNA 2WIHA 2X9FA 3SAYA 3FI3A 2CDZA 4ZSAA 1R3CA 2G15A 3ORZA 4Y8DA 5A4CA 3RHKA 1BI7A 4GYIA 2YIRA 4MD7E 5IQFA 1PMVA 4FTCA 4RWKA 4W4VA 5BVKA 3SOCA 4EOLA 3NPCA 3DY7A 3DBQA 4E5AX 5J5TA 4XLVA 5E92A 3O17A 4USEA 5DT4A 2XNBA 5CTPA 2X9EA 4E3CA 3E7VA 4ASEA 1W0XC 2IVTA 1OL1A 2W17A 3LCDA 4JBOA 5ETIA 5HOAA 4XG9A 2FUMA 3OEFX 3A4OX 3EQIA 3QL8A 5KMNA 2PPQA 1PYXA 5AEPA 3ZZEA 3R0TA 4EK3A 3U9NA 2CKQA 2A19B 2JIVA 4Y73A 3TKHA 2ONLA 3KCKA 3FXWA 5L2IA 5ETCA 4FVRA 3O7LB 3PLAE 2CGUA 5IA5A 3AT3A 3QX4A 3SXRA 5M06A 3AMAA 3Q6UA 1ZRZA 4FZFB 4I6HA 3VW8A 3OF0A 4EZ5A 2PMLX 5FWKK 3KXNA 3BYUA 4HGSA 3RGFA 3RTPA 5HD4A 1BYGA 3IW4A 5AAFA 3TJCA 2KULA 2PL0A 4JX7A 4LUEA 3H4JA 4YJPA 1O9UA 1RW8A 3BLRA 4CLIA 5G6VA 2P2HA 4D2VA 3E63A 4F64A 3IW5A 1LR4A 2LAVA 1QCFA 4Y95A 3LW0A 4NM5A 4ACGA 1M7NA 1E9HA 2JDSA 2O65A 1GIJA 2JIIA 4FBXA 3HA8A 4YZDA 3D7TB 2BAQA 5CZHA 4KS7A 3OWLA 4YJRA 2ERZE 2XK7A 2Y4IB 5L3AA 1H1SA 3MY5A 2V0DA 4GFMA 1FGKA 4FKOA 4N4SA 2ZDTA 3R7YA 3T8OA 4AW2A 3V3VA 3QLFA 4PL3A 2VTHA 3R9OA 3B2WA 3ZDIA 4CV8A 4KIQA 2WGJA 5DIAA 3TWJA 3ZLWA 2OFUA 3PXZA 4WUAA 4CFNA 5EDRA 1RE8A 4AUAA 2XNEA 4ZTSA 3QUEA 3RNIA 4P90A 4BTMA 4QYEA 1PY5A 2I0YA 3NUNA 4L6QA 2C0IA 4F0FA 4YC3A 5EHOA 2OIBA 2A0CX 3A61A 2VTPA 3ZS5A 3ZU7A 4C62A 3CSVA 5IQCA 5HZNA 4ZSEA 1UVRA 3RK7A 2QOFA 2XNOA 4IM2A 4IW0A 5HIBA 3UQCA 2WQNA 3LHJA 3FZPA 3ZFXA 3RCDA 4F6UA 5AX3A 3EFLA 4QYGA 2W7XA 2WMVA 1W8CA 2F7XE 4E4MA 5CXHA 2VWZA 3GC7A 3F2AA 4WNMA 1GOLA 4YHFA 5TOZA 4FV1A 4QP8A 4AACA 4C3FA 3ACJA 1E1VA 3NR9A 4R3RA 1OPJA 2WMRA 4LOPA 4MWIA 4C4FA 5KNJA 4AU8A 2QOOA 1XH8A 4BGQA 2PMNX 3BELA 5T6KA 2C30A 3CTHA 5ACBC 2XCKA 4AZEA 4FIFA 3R9DA 4C4HA 5JZNA 2WQOA 3QD2B 4M3QA 3DNEA 4UN0C 3TNIA 3D5XA 4D55A 4YJVA 2W4JA 4F1TA 2CNQA 3QRIA 3QZHA 4X3FA 3P4KA 2B9FA 2C3LA 5HG5A 2QOQA 2UZNA 4WUNA 2GHLA 2GU8A 4FIHA 1PXLA 5IMXA 4FT3A 3OXIA 3FZ1A 4BL1A 3V51A 4P5ZA 4C35A 1H0WA 2YLEA 3QC4A 4G2FA 4F09A 3ZO2A 1UNLA 4ZJIA 5C4LA 2R3FA 4OTGA 3UZPA 1WBWA 4XS2A 4HYUA 3FXZA 2P3GX 3UNKA 4L3PA 2XNPA 3LJ1A 4OTPA 4GVJA 3VBXA 3HYHA 5L4QA 3TJDA 4EHGA 4FKVA 3QCSA 3NEWA 1Q61A 3F7ZA 3FQSA 4KBKA 3E8EA 2GPHA 3ZLXA 4JS8A 3TUBA 2XRWA 3FYKX 1PXKA 3R9NA 2JAMA 3KC3A 2PUUA 3KF7A 3NLBA 3W2CA 4AFEA 4H3QA 4QMMA 4TW9A 4O96A 2WO6A 4FA2A 1YXVA 2BHHA 4M7IA 4FIEA 1M52A 3OT8A 2W1EA 4QTDA 3ORLA 3L9MA 5L6PA 3F5UA 3PY3A 4U44A 5HEZA 1DAYA 3GU6A 3E64A 4RPVA 5C26A 3OWKA 1J7LA 4FSZA 5KZIA 3KF4A 4U80A 3QTRA 2JC6A 3C4WA 3WZUA 4NW5A 4MBLA 4YBJA 5AR8A 4EH3A 2B1PA 1JOWB 4EH6A 2WZJA 4FSYA 1FOTA 3OROA 2YA9A 4MAOA 1NW1A 3VBQA 2W05A 3COHA 4QRCA 4NJ3A 4CFXA 4ZLOA 1W83A 4BDCA 3DLSA 2B52A 3R83A 4AOIA 5BYLA 3UIUA 2IW6A 3TKUA 2Z60A 5BUEA 4BRXA 3F66A 4MK0A 3PZEA 1RDQE 2PK9A 3VO3A 4CQGA 2HZIA 3TUDA 5K3YA 3KK8A 1OIQA 1PXPA 4IVDA 4U5JA 3GB2A 4FIGA 3OUKA 2QD9A 4JDIA 3VS3A 3UO6A 3QALE 5J7BA 3W2QA 4FE2A 4DFNA 3AT2A 2QNJA 3R9RA 3VNTA 2QKWB 4QMWA 4HPUE 4FIJA 3ZO3A 2C6DA 1APME 4OLIA 4C61A 5L2WA 3SVVA 5KX8A 2OLCA 5TT7A 1NVRA 2UZVA 3GC8A 3KA0A 4LV5A 3VUHA 3KMWA 3AXWA 4C59A 4LL0A 3BQRA 4KKGA 3BYSA 3OW4A 3VJOA 3HV4A 3ALNA 3TZ9A 4M0YA 5LVMA 5LQFA 4BDHA 3KRXA 4S32A 3UMXA 3HMOA 3EZVA 3LFEA 3OP5A 3ZEPA 5AM7A 4FK6A 1CM8A 2P2IA 4ARKA 4ANNA 3HMMA 4O7NA 4EC9A 2X39A 5AV0A 3AT4A 3A8XA 4JDKA 5HIDA 3PZHA 1GZNA 2VAGA 5DH3A 2YHVA 5KMKA 4QTCA 3LJ0A 4RIYA 3QWJA 5JT2A 4YP8A 3QRTA 2QU6A 3V6SA 3LQ5A 3P79A 4TRLA 3FKOA 3HP2A 3AGLA 1XR1A 4FZ7A 3ZONA 3QKMA 4BCGA 3QQFA 2VTMA 3QF9A 3VHEA 5BX0A 2BAJA 4FL1A 5JFSA 3BHVA 2ZM1A 1XBCA 3A60A 3TIZA 3PXFA 4R7IA 5CT0A 1FMOE 4Z55A 3QHWA 1FINA 4NW6A 2VNWA 4QPSA 4KKEA 4FSTA 3Q60A 5HESA 4XG7A 2R3NA 4TY1A 2EVAA 3QQKA 4JBPA 5CVHA 2VTTA 2JITA 2F49A 1IASA 1PYEA 2QOKA 3QFVA 4J98A 4QMXA 3GXLA 3SGCA 5KCVA 5KMIA 4LOQA 4GH2A 4JAJA 2UW6A 2X0GA 4ANSA 2Q83A 3FSFA 2WTWA 5AR5A 4FV4A 4EWHA 4BF2A 1KE5A 4G3GA 4OTQA 3Q96A 3WBLA 3LFFA 3FBVA 1SVGA 2R3PA 1JNKA 4MHAA 3HMPA 1YW2A 5J87A 3W1FA 4UMUA 2J0MB 4X3FB 1QPDA 3R6XA 1FVVA 3HV3A 5GJFA 4RWLA 5HLWA 4ZSJA 3ODZX 4ANLA 3SA0A 1K2PA 3U4WA 3UNJA 4AZWA 3BE9A 5FQDC 3LKMA 2W1GA 4Q9ZA 3GGFA 4A9SA 5IH4A 5LXMA 3JY9A 2XF0A 1KWPA 3VUTA 4BHZA 1PJKA 4GJ2A 2PTKA 4FG8A 5E91A 4C2VA 3PJ8A 2VO0A 1YWNA 3LFNA 1CKJA 3EN9A 1UU8A 3DK6A 4CXAA 5HBJA 2B9JA 3L9NA 2BDWA 2WEVA 3WF8A 4AA4A 2OGVA 2BROA 4JQEA 3KRRA 5J5SA 5KHWA 1I44A 1STCE 4DYMA 1KSWA 5CEKA 2PE2A 4YZMA 3GBZA 4EOOA 4NZWB 3EHAA 4HGEA 4JLCA 4AGCA 3KQ7A 2PVKA 4MH7A 2BIKB 3PG1A 3ORPA 4KINA 1U5RA 5EG3A 4F7JA 2F57A 2CKOA 1KV2A 4B6LA 4EOMA 3GOKA 3R7IA 3S2PA 4AF3A 3UZTA 5GINE 3UOHA 4O2PA 4AT4A 4TYJA 3WZDA 3FPMA 2OXYA 1OL5A 4LGHA 4DGOA 2OW3A 2IZSA 2BAKA 3NGAA 5IQEA 4QQTA 1YHWA 3OEZA 1AD5A 3GCPA 1ERKA 3ELJA 4DH3A 2XK9A 4QT1A 3G9LX 3T3VA 4HVHA 4AW1A 2Y6OA 4CCBA 4A06A 2W5BA 3OW3A 2CJMA 2BVAA 5HICA 3DTWA 3F6XA 3KN6A 3MVLA 3MYGA 4L46A 4JVGA 4WNPA 4E6AA 3R7UA 4D5KA 5L8KA 4EOSA 3RAHA 1URCA 3VF8A 5E8ZA 3V04A 4BCFA 4I5CA 4B4LA 3E3BX 4WBBB 4CFVA 1SYKA 4LFIA 5AP3A 5IUGA 4L44A 4IX3A 4AA0A 2WXVA 4ANQA 3UTOA 1PXOA 4L7SA 2A4LA 4TYEA 5K5NA 4CKJA 4L43A 4NEUA 4ZTMA 1X8BA 1H1PA 1BI8A 3FL5A 3FI8A 3U8WA 4S2ZA 3ZUUA 4O0RA 1NY3A 2FB8A 2GFSA 4W4YA 3DAJA 3DKOA 2W4OA 3OS3A 3Q4CA 4CRLA 1F5QA 2YACA 4FNXA 5HG7A 4JRVA 1FMKA 1WAKA 2AC5A 4E93A 2O3PA 2C6OA 3A8WA 1P4OA 1Q8WA 2X4ZA 2C6MA 3IDBA 2V7AA 3LXNA 2ERKA 4BCKA 4YU2A 5KKRB 1R78A 4AE6A 2BFXA 5K0XA 1HOWA 2UZUE 3LZBA 3C50A 3UVRA 3MH3A 5M4CA 2P0CA 3CPCA 2R0IA 4GT4A 3HV5A 4WSQA 3KKVA 4BBMA 3LIJA 2BZIB 2OKRA 3PY0A 4BCJA 2XBAA 3F88A 1PXNA 3O96A 1KOBA 1NVSA 3UZRA 3NAYA 4R7HA 4BKYA 2CLQA 4R3CA 4BIEA 3BPRA 4C7TA 4AXAA 2C3IB 5DEWA 5K0KA 2BPMA 4D1XA 3D7ZA 4FEVA 2QOIA 4F1OA 2OJFE 4BC6A 5DN3A 4RC2A 4WKQA 5EHYA 4EOJA 4QMLA 3IQ7A 4RIYB 4WG5A 3IDPA 4C4JA 4KS8A 4TWPA 2J9MA 4UYAA 3WIKA 2QODA 4IMYA 2HK5A 1YVJA 3NUYA 3LMIA 4RVLA 4WOVA 3O71A 2YLFA 3CY2A 4YURA 1CMKE 2PVJA 4OUCA 5H8BA 3UG1A 4FSRA 4D5HA 4NUSA 2PZPA 3EN6A 5C03A 2XUUA 5HVKA 3FZSA 3KFAA 4J99A 1SNXA 1WVYA 3QA8A 5CS6A 3ZLSA 3W33A 4C57A 3FMMA 3G6HA 2BMCA 1YXSA 4Q5EA 5AAGA 1FVTA 2C6IA 2EXMA 3CR0A 3OBJA 5FEEA 5HCZA 1OPLA 4IX4A 5IQGA 3LM5A 5D7AA 3VN9A 4O0YA 4AT5A 2QKRA 1XBAA 3ORTA 5E8UA 4HVSA 3BU3A 2VV9A 1ZMVA 2R3QA 1OUYA 1BX6A 3DJ6A 3HP5A 2PUPA 4Q5HA 3GU5A 1OKZA 5EW3A 3ENHA 5M53A 4AZSA 2A27A 4QYHA 4BTJA 4S34A 3DCVA 4WO5A 4ZZNA 2GNJA 4KD1A 4PMMA 2JBPA 4P7EA 4TWCA 5HKMA 3L8PA 5EM8A 5CY3A 3M42A 2CKPA 3PP0A 5CASA 3EN5A 3EKNA 3QQJA 3ZDUA 2UVYA 3C13A 3BQCA 3A4PA 4BTKA 1ZYDA 1JBPE 3ROYA 3CXWA 1H26A 1XWSA 3ANQA 2R3MA 4FNYA 4FUXA 4USFA 4PDSA 2GTMA 4IZ5A 2QOLA 4I24A 3MVMA 4BTFA 2GTNA 4RA5A 4FEQA 3C4ZA 5DPVA 3QTXA 5DRBA 1VYZA 4FSUA 4YO4A 3P7CA 4I21A 2X2MA 5AA8A 5ITAA 5JGDA 4EKLA 3NUSA 1GIIA 2J0LA 2X2KA 3FI2A 4TN6A 3EQRA 2IZTA 3IW7A 3JYAA 4YJQA 5EOBA 2QURA 4HYIA 2O63A 3NX8A 3VW6A 2EB2A 4L3LA 3QGYA 4RG0A 4FTMA 4C3RA 1F3MC 1ZYLA 2ITUA 4RLLA 4U45A 5DVRA 1L3RE 2YCQA 5FM2A 4X6RA 3V8TA 4O82A 2RIOA 4I6BA 3UC4A 4ACDA 4GT5A 4APPA 2DS1A 4BDIA 3LFCA 2F7EE 4LRJA 4O22A 5I9VA 4UV0A 4GRBA 2B9IA 2X6DA 4PDYA 5FUTA 5I9XA 3Q52A 2H8HA 2YWPA 3TTJA 1OMWA 3TCPA 4A9TA 3GQLA 4IFGA 5BVWA 4EHVA 3HV7A 3ZUTA 4CEGA 2HXLA 4BICA 3WE8A 3TUCA 4XRLA 5J8IA 1VEBA 4ZTLA 2ITTA 2ETRA 1Y6BA 3ENMA 5E8VA 3SLSA 1W84A 5FD2A 2RFEA 2QR8A 3ZBXA 4JG6A 3KXMA 4DEIA 3CQWA 2CNVA 3SQQA 4UXQA 4BWXA 2JKMA 4AX8A 3C4EA 2BIYA 3H3CA 4KIOA 5KHXA 3MBLA 5F95A 5L2QA 4MNEA 3VQHA 3JXWA 4H1JA 5C27A 3Q32A 4A9RA 4DGGA 4V01A 2LGCA 2WMSA 4M8TA 5BVEA 3GENA 3OFMA 3R2YA 5CNNA 3HRCA 3NIEA 4BI2A 3BCEA 4C4IA 5DRDA 5M4FA 4HPTE 5M07A 5KMOA 1DI9A 4AN9A 4WRGA 3K5VA 5L8JA 4S33A 5B2MA 5J9LA 3DPKA 5JEBA 2R4BA 2YM3A 1U54A 4MXOA 3FDNA 3FMNA 4FK3A 3NUUA 3LFAA 5H3QA 3DGKA 4YMJA 4LQMA 3JVRA 3U9CA 3SG8A 3CJFA 5KMMA 3TXOA 4ENXA 2YDJA 4D2WA 3VUKA 4FKPA 4PPAA 5A6OA 4MEDA 5E8WA 1YDRE 2HZ0A 5E9EA 3BLQA 2ZV7A 1Q99A 4MWHA 3RP9A 4U9AA 2KTYA 3R30A 3R8UA 2IVUA 3CQEA 4FTQA 4MBJA 4XG2A 4PL5A 3ID6C 4ZY4A 4CQEA 4ZXTA 3HUCA 5HLPA 1Y91A 5M51A 2ITOA 2OZAA 2WTDA 1FGIA 2XIZA 5JMSA 4EJ7A 5L8LA 3QQLA 5HCYA 3RJCA 4HZSA 3FY2A 4G3DA 4FSWA 3L8SA 4FKTA 2QOBA 3NS9A 4I20A 5HNGA 2ETKA 2J50A 3HUBA 5HQ0A 4BI0A 4DG3E 2B0QA 1U4DA 4EOKA 2P4IA 3EL8A 5BVDA 3DJ7A 4CKRA 5AFVA 3ZC5A 3PYYA 2OJJA 5BUIA 2P55A 4FV3A 3S95A 3VS5A 5J1VA 2EXCX 5AP2A 5IISA 1PKGA 4YUQA 5I0BA 3MS9A 4OTIA 4ZP5A 4E4XA 3DFCB 5A9UA 2OG8A 3GI3A 3QD0A 4ZZOA 3MB6A 1JKLA 1OKWA 2VWIA 4JG7A 2H34A 3TKIA 4PV0A 4AFJA 4MD8E 2ITPA 4EQCA 3BYOA 3ORXA 1H28A 1OL7A 2RG6A 3C4FA 4IAAA 4K0YA 2RSVA 2B4SB 3MW1A 2WTCA 4MQ2A 3Q3BA 3ALOA 3C7QA 3EFWA 1Y8GA 3EQCA 4I0RA 3QUDA 3P5KA 4GVAA 4RA4A 1OUKA 3RK5A 5EQEA 3F3UA 3UGCA 4EC8A 2WEIA 3ZBFA 5LVOA 4I5MA 2JFMA 3SXFA 5IQDA 3FQEA 4V04A 3PP1A 3AC4A 5AUYA 4A9YA 4FSMA 5D41A 3RPVA 3HNGA 1MRVA 4CTCA 2B7AA 4PMPA 5CXZA 2W5HA 4BWKA 5HNIX 4R78A 5C8MA 2OJGA 3V01A 4DEAA 3TM0A 3OCSA 3HECA 4I4FA 4PRJA 4YO6A 3AGMA 4ALVA 3FMJA 2OJ9A 2OXDA 3OXZA 2GQGA 2O2UA 4TYIA 3TACA 4GUEA 2QO9A 3MFSA 1UU9A 2I0EA 2UVXA 4L01A 3FC2A 1K9AA 5DG5A 3ULZA 3OC1A 3GUBA 4ZTQA 5C4KA 3POZA 2SRCA 3F2NA 4DAWA 4BDDA 4PL4A 4F6SA 2GNGA 4XG3A 2FA2A 3KMMA 4DITA 4EH5A 1E1XA 5FBNC 5TR6A 4CZYB 1OKVA 4W9WA 1QMZA 5J95A 3RI1A 3ZSGA 4OAUC 1Q24A 5IQAA 2YJSA 4W8DA 4G9CA 4FOBA 2OO8X 4D4SA 5CU0A 3WF5A 4YNOA 1W98A 3R1YA 4ONAA 4LOOA 3MWUA 4FKWA 4FZAB 1MRUA 4YJUA 2JEDA 3RPSA 4FNWA 5FTOA 3BWFA 5M44A 3C0HA 4OT5A 4FKGA 5M4IA 1WVXA 2R3LA 5AUXA 2FSMX 1GAGA 2V55A 2CHLA 4FSQA 3UVQA 2ZB0A 1Z9XA 2WB8A 3R1NA 4ANMA 2VRXA 2VTOA 5T68A 5GIOE 4NH1A 4NK9A 3GQIA 4L7FA 1R0PA 4CMOA 3COKA 4GIIA 3F3VA 4JL9A 3R28A 4PDOA 2C6LA 4F99A 4BB4A 3HDNA 4V0GA 1W82A 5A4TA 3FC1X 4ZK5A 5CU6A 4CD0A 2C47A 5J1WA 4E6QA 4BDKA 4MNEB 4AA5A 5DMZA 5FTGA 4X2NA 3UNZA 3GFWA 3NMUF 4RT7A 3I5NA 1JKKA 5GZAA 3FJQE 3CBLA 3LM0A 4WSYA 4Y72A 3SXSA 3GCQA 4KBAA 1L8TA 1M14A 4JOAA 5AA9A 2G01A 4IXPA 3DLZA 5IH5A 1H1WA 1XJDA 3EZRA 1J7UA 2C5NA 1U54B 4F7LA 4H05A 3RAKA 3ERKA 1WBNA 4PTCA 3TZ8A 2R0UA 3KRLA 4C37A 4NJDA 3K5UA 2PE0A 1J91A 4W8EA 4EK8A 5CVFA 5CF6A 1XKKA 2GFCA 5GNKA 4O38A 2J51A 4TNDA 4PMTA 3E62A 3MY0A 1QPJA 4QD6A 4O0TA 2HXQA 3E5AA 3DS6A 4ZY6A 4P2KA 3NAXA 5ETAA 2GNHA 4TNBA 4AGDA 3KVXA 5HLNA 2QLQA 4I41A 3PVGA 1RQQA 5E8TA 3FPQA 2BRMA 3JR1A 5M56A 4O7YA 2OZAB 4L9IA 3RNYA 5CAOA 3HLLA 1LEWA 4YTIA 3N9XA 4ERKA 5JZJA 1OIYA 4ASDA 5BMMA 3IOPA 3KVWA 5LCKA 2XH5A 2H6DA 2XIKA 4HYHA 1OECA 4NCTA 4E6CA 3U51A 1FQ1B 3F7WA 3K3IA 5EDPA 3IK3A 4WG4A 3U4UA 4I6QA 3R8MA 2JIUA 4TYGA 4UYNA 3C51A 3ZRMA 4DEGA 2BRNA 3MSSA 2J0IA 5ANJA 3PVBA 3FI4A 2C68A 2XYNA 1SNUA 3EYGA 4EYMA 5DYJA 3OG7A 5F4NA 4DH5A 3PTGA 5F9EA 4YHTA 4OT6A 4OBQA 3QD4A 2OIDA 5EK7A 3DAEA 5AR3A 3BKBA 3FHRA 1UNGA 4MKCA 4LV8A 4FG9A 1JPAA 2WMAA 4GIHA 2VWYA 3UIBA 4G6NA 2XA4A 5AR2A 4R3PA 4MXCA 5BVFA 4R6VA 4Z16A 5CAUA 5HU3A 2IVVA 3LOKA 1HCKA 2Z7LA 4P5QA 4YSJA 3BEGA 4RMZA 4FT7A 3LFDA 4NKAA 4YNEA 5D1JA 4YZBA 4FKSA 4DT9A 2XK4A 5HCXA 5IMEA 4I23A 4XG6A 4J8MA 4AN2A 3SW4A 3ET7A 2WTIA 2B55A 3PXYA 1OL2A 2WIPA 2XP2A 3D4QA 2VO6A 3AD5A 3TNWA 2YIYA 1TQMA 3CKXA 3SG9A 2QR7A 4CZTA 4RLKA 3WF9A 4TT7A 2PVYA 3DT1A 5CNOA 4BCNA 3VBWA 5AV2A 3QD3A 4PY1A 3UOLA 4S30A 2VNYA 1PXMA 5JK3A 4IJPA 2PVNA 3DTCA 2YAAA 4PMSA 5AP5A 4D2TA 5IDPA 1EH4A 2UW8A 1ZOHA 4CMTA 2VTNA 3RAIA 3C5IA 3TTIA 3NYOA 1PXJA 1OITA 2G1TA 4N6YA 4FKJA 3EIDA 4TZRA 3QQHA 2UW3A 5J9ZA 3MFUA 5J9YA 4IB1A 2QHMA 4R8QA 4NL0A 3EH9A 3OOMA 4TPTA 4YC6A 3V5QA 3KREA 2PUNA 5E8XA 4KA3A 2W1HA 3FKNA 4UMRA 3EKKA 1UKIA 4GK3A 2GSFA 3TL8A 4E73A 2ZB1A 4I94A 5J7HA 4C38A 4J71A 5BMSA 3FMKA 2YN8A 3PJCA 5D12A 3R7EA 5HTBA 3N4UA 2PMIA 4BCMA 5FGKA 3WZEA 4FGRA 2IO6A 4LI5A 3KU2A 4U3YA 3R8ZA 4ASZA 5FXRA 1KUTA 5DEYA 4DF3A 4MCVA 3ZO4A 4BY9E 4V0GB 4P4CA 1H07A 3DKCA 3EL7A 2GDOA 4QOXA 3D5UA 4TTHB 4X6QC 4EOIA 4I5HA 3V5TA 1CKPA 3TNPC 3MJ2A 2A2AA 3R02A 1TVOA 2YDIA 4UMTA 4CGAA 1H01A 4QQCA 4KNBA 2HIWA 4C36A 3OY1A 4O0XA 4MXXA 3OWJA 1J1BA 4IEBA 1JSUA 4IVCA 1SVEA 2HENA 2ZYBA 3RHXA 4UZDA 3VS4A 3C9WA 2E9VA 4ITHA 4L52A 4ZTHA 5HG9A 5CSPA 1RJBA 3AMBA 4QYYA 3W8LA 3GOPA 4MF0A 4NU1A 4XOYA 2VTLA 4K1BA 3VWAA 2YIQA 5HE0A 5C1QB 3K2LA 3OBGA 4CT2A 1SMHA 5DBXA 4DTKA 4O7RA 2ITWA 5L6WL 5IEYA 5AV4A 4DA5A 4O1PA 5KBQA 2ZV8A 4PTGA 5LOHA 3BGQA 4JR3A 4MX9A 3G15A 2JBOA 4WNOA 4A4LA 3LCKA 4CFWA 1B39A 3CEKA 5GJGA 4R5YA 3QQGA 4FV7A 4JX3A 4RQKA 4G3EA 4FTRA 5I4NA 2X81A 3MVHA 4QP9A 4D2RA 4FEWA 1SM2A 4O6EA 3QHRA 5CEPA 4DTAA 1OVEA 3UYSA 4CV9A 3ANRA 1YI6A 2AYPA 2Z7SA 1K3AA 3GVUA 4BKZA 3VF9A 3DBFA 2GQSA 3MN3A 1ZARA 4IB5A 2YZAA 2BCJA 5D7VA 1U5QA 4CLJA 4FVQA 2Z7RA 2BRBA 4YJSA 3S1HA 5B7VA 3R2BA 4I0SA 4L42A 3AC1A 4UB7A 3CTJA 3PXQA 4XLIA 1QPCA 3Q53A 2VX1A 5DR2A 4QTBA 3UOJA 1MP8A 2IG7A 2CMWA 4RIXA 4R5SA 3HMNA 3E88A 3SKCA 3BU5A 3SX9A 3PPJA 3RKBA 1Q4LA 4HCTA 2YM7A 1JVPP 4M13A 4HGLA 2IN6A 5B2KA 5BVNA 2W96B 4ALWA 4ITJA 4DEHA 2QU5A 2FH9A 1YWVA 4RQVA 5HO8A 5HORA 2W5AA 2BDJA 5E8YA 2GMXA 2WD1A 4NM3A 3ZH8A 3HAVA 1PW2A 4G5JA 3AC5A 4ZTRA 2H96A 2PE1A 5CANA 3TEIA 2HELA 3MFTA 2ITZA 4KBCA 2GQRA 4LMNA 3LFBA 4C34A 4MXZA 4YTFA 2OWBA 3IO7A 4GU6A 5CAVA 3ODYX 5ACKA 4WHZA 5F20A 3G51A 3GU7A 5ICPA 3A62A 3NYXA 4QMQA 2PVHA 1PKDA 2YCRA 3R63A 1TKIA 3O50A 2QVSE 4ANOA 1IAHA 2OSCA 2RL5A 1ATPE 4EH8A 1OM1A 1UU3A 4DC2A 2W0JA 4L68A 2J5EA 1ZAOA 4CYJA 3H30A 1Q8UA 2UZLA 2W1CA 3UP2A 2XK6A 3NNXA 4O27B 4BDAA 3U6JA 2ESMA 5BPYA 4BDBA 4IANA 5FDPA 4U41A 3ZM9A 2VWBA 4BCIA 3DA6A 4JG8A 2VWVA 3IECA 4WRSA 3UDBA 3A2CA 3HL7A 4J96A 3C0GA 3G0EA 3VUMA 3MIAA 4FV5A 2PZIA 3U6HA 3MGYA 4C58A 4JRNA 4H36A 4YSMA 4YPDA 2G9XA 5A4LA 2VWWA 3MA6A 3D9VA 2OICA 4DE4A 3LCTA 4E20A 4O1OA 2XIRA 3A7IA 5LJJA 4JQ7A 1AQ1A 3P7AA 1SVHA 4IVBA 3QKLA 4A4OA 4DFXE 4N70A 4AZFA 4F9BA 4QP3A 5BYYA 5JFXA 3M11A 2W1FA 3GEQA 1YHSA 2Y4IC 3KEXA 4YZNA 2GS2A 1Q8ZA 2ZM4A 4JJRA 4YLJA 3OWPA 1IR3A 4AT3A 2Y4PA 3IDCA 4DGNA 3ZTXA 3SC1A 1M17A 4FX3A 4AGWA 3COMA 4G9RA 2JKOA 3REPA 4BCPA 2OFVA 1WBOA 3CTQA 1NT2A 3IW6A 2EXEA 4KRCA 1WBPA 4B0GA 3R71A 3KXGA 5DR9A 2PMOX 2ETMA 4ZIMA 3RCJA 4UMPA 4HVGA 4IWPA 4FTAA 2XZSA 2IJMA 4IJ9A 1ZZ2A 3N4VA 4ZAUA 1QPEA 3DJ5A 2C6EA 3P7BA
chains in the Genus database with same CATH superfamily
4YHJA 3HRFA 4BVUA 4WT6A 4YTHA 2XKEA 4M68A 4IAZA 4D4RA 4BIBA 3SDJA 1TZDA 3W55A 5LWMA 4NM0A 3FZRA 4FTIA 4AQCA 4FT5A 4J97A 3CE3A 2F2UA 3IONA 4EI4A 2XEZA 5JGBA 4X7QA 3MJ1A 4D1ZA 2XYUA 3V5LA 5AADA 2AEGA 2E9UA 4IM3A 1FBNA 3OMVA 3DKGA 4DH7A 2OXXA 5HGIA 3UO5A 1A48A 1B6CB 4YBKA 4XNEA 4TWNA 4B9DA 4FTOA 1OBGA 1H27A 1WFCA 2O5KA 2XEYA 2XKFA 3PJ2A 2W1DA 3HV6A 3E87A 3WF6A 3NFGB 3I6UA 3EN7A 2Y7JA 4IC8A 4MXYA 4Q9SA 2Z7QA 4Z3VA 2QG5A 2GNLA 3CLYA 3FYJX 3I0OA 4FV9A 5AJQA 5M4UA 4DT8A 3OT3A 5HE2A 4O84A 4OBPA 3UBDA 2C3JA 2W1IA 2C1BA 4CTBA 3QRUA 3G90X 3I6WA 4CG9A 3R7OA 5BUJA 1YOMA 1XO2B 4RIXB 2FVDA 4DCAA 5AV3A 2OF2A 1REJA 2VUWA 1A06A 4O2ZA 1IAJA 5CEQA 3HVCA 3RM6A 2XKDA 4RIOA 2BKZA 3BHTA 2JFLA 3Q04A 4GT3A 4NIFA 4WD5A 4HVIA 4GUBA 4XP3A 2YITA 4IHPA 4WIHA 5AWMA 4WG3A 3PWYA 2FYSA 5EM7A 3CY3A 4U97A 1Z5MA 2VWUA 3VRZA 2X7OA 4ACCA 4KUJA 4ZMFA 2WQMA 2I0VA 2QG7A 3FV8A 3RM7A 2HOGA 3PE2A 5M09A 5H2UA 5CF8A 4OTRA 3W0OA 4H39A 5CEOA 3OTUA 1DI8A 4V05A 5CX9A 4IAKA 2UV2A 5F94A 3BHHA 4ZZMA 4D1SA 4XJ0A 4BJJA 4F9CA 5GZ9A 1W2DA 4ASXA 1FVRA 3BWJA 3PIXA 3QYWA 4ZJVA 4BKJA 3KULA 4IH8A 3HDMA 3CIKA 3PIYA 4FF8A 4C4EA 3EYHA 3DQWA 1T45A 2HZNA 3R22A 3UOKA 3DXPA 3O8UA 2WAJA 3R1SA 4HCUA 5TKDA 5BQ0A 4HCVA 3Q9WA 3N4TA 2XIXA 1ZOGA 3Q4ZA 2VU3A 4H3PA 4QO9A 2NO3A 2UZEA 3OHTA 5AUUA 3FHIA 4KIPA 4EYJA 3QZIA 4GW8A 3RAWA 4UY9A 1WBTA 4O7SA 2XNMA 2ONLC 3OXTA 3HAMA 3VJNA 4IX5A 2I0HA 5LWNA 2ZM3A 2XM8A 1CDKA 2X6EA 1B38A 2DQ7X 2RFDA 3QTWA 1XHAA 3QXOA 4UWCA 3WZJA 4AG8A 5D11A 3QZFA 2PUIA 4XRJA 2QOCA 4CRSA 4BBFA 4YJNA 3F5GA 5IDNA 2EWAA 2R5TA 5JFVA 4EHZA 4XBRA 4BJJB 1IRKA 4FYOA 3QX2A 1PF8A 2RKUA 3JS2A 2J0KA 3DK3A 3N51A 4G3FA 5HBEA 5HG8A 5JH6A 2C69A 4IACA 2UZDA 3MH2A 4LM5A 1JSTA 1NXKA 2FO0A 2W06A 3NNUA 3FMDA 3ZRKA 1YXTA 2DWBA 2R3JA 2WMWA 4IWOA 4JIKA 5LVLA 5EKOA 4DEDA 4C8BA 4J7BA 5A14A 3LQ3A 4QQJA 2I6LA 2WTKC 4F0GA 3PVUA 2R3KA 2XM9A 3THBA 4ALUA 2AQXA 2WMTA 2I7QA 2Y6MA 4QPAA 4TKSA 4UALA 3I7BA 2JD5A 3I4BA 5IUIA 4O7LA 4AOJA 5E8SA 2ITVA 4GJ3A 1KE8A 3H0ZA 1ZLTA 4Y5QA 4GV1A 3RINA 4IB3A 4G16A 4U7ZA 4DG2E 4BZOA 4FR4A 4E7WA 3MESA 3FAAA 4JT3A 3QCXA 4JNWA 3R7VA 3VS1A 2Q0BA 5IG1A 3LLTA 3RALA 3PVWA 4RFZA 3T9IA 3UIMA 3TV7A 4A7CA 1PMNA 3ULIA 4AXFA 4I1ZA 1REKA 2BALA 2YAKA 1WMKA 3QQUA 5GHVA 1Y57A 1WVWA 5AAEA 5C8KA 3TN8A 3BZ3A 1YXUA 5I3RA 5JQ8A 3HMIA 4ZOGA 5IQHA 4UZHA 3ZYAA 1YOJA 3B8RA 3U6IA 4DLJA 4GL9A 4O7TA 2WU7A 5IF1A 2ITQA 3U55A 3FMLA 2XK8A 4MNFA 1JSVA 2XKCA 4QMUA 4C4GA 1YDTE 4IQ6A 4GKIA 5AUZA 4FT0A 3RBWA 2C0OA 3OOGA 4ANBA 4DN5A 4NT4A 3I1AA 2EU9A 3EQBA 4G34A 4QMVA 4QP7A 4RFMA 4APCA 4HNIA 4Y83A 3VRYA 4QNAA 4N6ZA 5E1EA 4R7BA 2UW0A 4HW7A 1O6KA 3UQFA 2PWLA 1G8SA 3SHEA 2JGZA 4NFNA 4FEUA 5CEIA 4CNHA 2YZLA 1TQIA 4Y5HA 5EM6A 1YI3A 3I5ZA 4E1ZA 5JRQA 3SW7A 4EOPA 4FJVA 3C1XA 3W0QA 3JVSA 3CD3A 4QMNA 4O4DA 1W7HA 5IKWA 5CSWA 4QMSA 3E92A 2G2HA 3F82A 2ACXA 3RZFA 3VS6A 3ZCLA 2UZWE 3VBYA 2CN8A 2UZTA 3QLGA 1V0OA 4RX9A 4GFGA 1ZZLA 4OTWA 3LAUA 4WNKA 5E90A 4CFMA 1S9JA 4F9AA 4K18A 1Q8YA 2VX3A 3ZMMA 3VUDA 4FL3A 3GC0A 3LMGA 2XAOA 4CSVA 5JQ5A 1URWA 3EJ1A 3D14A 4NYEA 4NIFB 3AMYA 5E4HA 4IWDA 2J4ZA 3CJGA 4J8NA 2PVFA 4QMYA 4RFYA 5EQYA 3S0OA 4YJTA 3RZBA 2WMQA 1JKSA 4FT9A 2OF4A 4U8ZA 3ORKA 1GIHA 1G8KA 4RJ6A 3W0MA 3LXKA 1DS5A 1LPUA 4FEXA 2YIXA 5CU4A 1YXXA 1BLXA 2WOUA 4M0ZA 3E3PA 2YABA 3LQ8A 4JBVA 3W0PA 3EFJA 4IC7A 4QP4A 1H24A 3MDYA 3NVKI 2R7IA 1YHVA 3O7LD 2A98A 3E8CA 1OIUA 2AC3A 4DH8A 4L8MA 5DT0A 5BVOA 4EK5A 4RJ8A 4B8LA 2F7ZE 4IBMA 2CSNA 3ROCA 2VGPA 4BZDA 4AP7A 3KULB 4I93A 5FG8A 2F9GA 2G2IA 3I7CA 4II5A 3Q4TA 5L2SA 1Q97A 4F1MA 1CTPE 3BV2A 4D0WA 4IWQA 3LXLA 1P5EA 2OIQA 3IOKA 5HX6A 3HRBA 4IE9A 4XH6A 2VN9A 3IKAA 1H4LA 4M69A 1MQ4A 5ETFA 4ZLZA 3IG7A 3KGAA 4PNIA 2PZRA 2R7BA 3QWKA 4XV3A 5HI2A 4RBLA 4DCEA 2PHKA 2R2PA 4JIAA 3QRJA 4KSQA 3BL9A 4G3CA 3I60A 4JQ8A 4EZ7A 3LE6A 3DXNA 5FP6A 3CP9A 5DR6A 2ZMCA 3R01A 4RZVA 3VIDA 4FRFA 4UEUA 4BWPA 2E2BA 1JWHA 4I4EA 4DHIB 5KZ0A 3MVJA 3SOAA 3ZFMA 3Q2MA 4ZS4A 3U54A 3QXPA 2CLXA 3FQHA 4PPCA 4U42A 4YPSA 4EKKA 5IA1A 1ZXEA 4G31A 4IZ7A 4O0SA 3QUPA 5HTIA 2O8YA 4ZSGA 2XJ2A 3RWQA 2IZRA 4IB0A 1Q62A 1WZYA 3UYTA 3RPRA 5IPJA 3ZOSA 4XEYA 3BHUA 2R3RA 4QTEA 2GHGA 1V1KA 2PSQA 5B0XA 4JR7A 1NVQA 2QC6A 5KKRC 1XH9A 2QCSA 1PRYA 3EQHA 3DFAA 4MQ1A 2WU6A 1JQHA 3MH1A 3PG3A 4U40A 3LJ2A 1ZMWA 3EWHA 3EQFA 4L67A 4XP0A 5DFPA 2WMBA 3W18A 4FTKA 4X2GA 4DFYA 5FTQA 4OTHA 3W2OA 4UMQA 1M7QA 3NFFB 4DBXA 4HOKA 2J6MA 2VD5A 1GNGA 1TQPA 4L53A 4GG7A 5ANEA 2UW5A 4ZS0A 3R8LA 4C33A 4YR8A 5IU2A 1G8AA 4AN3A 2J0JA 4KSPA 4FGBA 1Q3DA 3PPZA 3GP0A 3R9HA 4ZLYA 4G5PA 2OK1A 1WBSA 3OVVA 2BTRA 2DUVA 4FVPA 4G1WA 1ZY4A 3HX4A 3QCYA 4G6OA 5CWZA 3NW7A 3QZGA 4G6LA 4I6FA 3VVHA 3W32A 4AZVA 5FRIA 3ATTA 3PY1A 2OBJA 4R1VA 4C02A 1PMEA 3DB8A 4DHJA 4HNFA 3DK7A 3KL8A 4IDTA 2E9OA 5H9BA 3Q9XA 4DINA 5HIEA 4EZ3A 4IADA 4A4XA 5JKGA 3R00A 3EFKA 3O8PA 4D2SA 3GCSA 2JDRA 2VTIA 2X8DA 1CSNA 2WHBA 2P33A 1GY3A 1VJYA 2QO2A 1BUHA 4O6LA 4EWQA 3PDTA 2J2IB 4GFOA 3QTUA 4FTTA 4Z9LA 3L9LA 1YOLA 4RWIA 2DYLA 4IX6A 5K4JA 3FL4A 3RVGA 4JI9A 4M15A 3S3IA 4O7WA 5EYCA 5AUTA 4W9XA 1J3HA 1SZMA 1IA9A 4RJ7A 1TFFA 3GCUA 4R1YA 1OGUA 5AR7A 5JRSA 5EOLA 4IZYA 3L1SA 5AIKA 2GNIA 3PJ1A 3F69A 3PRFA 4M66A 4EL9A 2VO3A 5EYMA 3RK9A 2R9SA 4YGAA 4GEOA 4FC0A 4FNZA 2VTQA 4L00A 4QNYA 1OB3A 2IZUA 3BYVA 4I22A 5KMJA 5GJDA 3FLSA 3L8VA 4BCOA 2YDKA 1MQBA 1QL6A 1H25A 5A6NA 1R0EA 1Y6AA 3ZZWA 5M55A 5EQPA 2HYYA 2XIYA 4PPBA 3WYXA 3NUPA 2C3KA 4NFMA 3TIYA 2QO7A 3Q9YA 2ZMDA 5EDQA 3DXQA 4O81A 2VX0A 2ZV2A 3KXHA 4Y85A 5HU9A 2HY0A 5HE1A 3BI6A 2V22A 3R8VA 2R3OA 3PFQA 4F6WA 1VZOA 3WIGA 2WOTA 2O0UA 2BDFA 4D0XA 4QDEA 5M08A 3CCNA 3KCFA 3ZFYA 1XMMA 4DG0E 3QTSA 5EW9A 2RGPA 3QYZA 4EBVA 5LMKC 4MTAA 5HD7A 3LCOA 2IW8A 3LFSA 4FSNA 3O51A 3A7GA 3VHKA 3QRKA 4IAFA 4BHNA 5CT7A 2VTJA 4FTNA 5AUVA 2FSTX 3VULA 2YCFA 4UBAA 3BLAA 3P5JC 3UIXA 5IUHA 3EQDA 5EYKA 3DQXA 2Y8OA 5DLSA 4HZRA 1JAMA 3KY2A 2E9NA 3Q9ZA 5EI6A 4MUQA 1IEPA 3ZC6A 4F9YA 2V7OA 1O6LA 3O0GA 4BIDA 2E9PA 2BR1A 3PSDA 4WA9A 2FGIA 2BZJA 3H0YA 1ZWSA 3FKLA 4MVFA 2X7GA 4M69B 4AAAA 4LGGA 3V8WA 4O91A 3F2RA 3A7JA 5CQUA 3ZM4A 4KIKA 2YM8A 1I09A 5HX8A 5GZ8A 3UP7A 4FKUA 4OW8A 4F0IA 3C5UA 5KBRA 4RJ4A 3PJ3A 4YLLA 3UVPA 5B2LA 2ZV9A 2PVLA 3MPMA 4RSSA 2YISA 4FV0A 5CQWA 3RMFA 3DB6A 2QLUA 1R39A 3QTIA 1PHKA 3Q4UA 3IPHA 5FXQA 4AW0A 5CAPA 1IG1A 3BBTB 2HWPA 3PUPA 5HVJA 3TZ7A 2YIWA 3OD6X 3ZEWA 2BFYA 3FY0A 4ID7A 4MBIA 2R3HA 5HBHA 4FKLA 4D2PA 4Z7HA 2BRGA 3FZTA 2RFSA 4RVMA 5DHJA 4CG8A 4ZJJA 2QOHA 4J53A 3AC2A 4RIWA 5AP1A 3ITZA 5TO8A 4I6LA 4ACHA 1H00A 3FLQA 5A46A 3L8XA 3EMGA 5CI6A 4CMUA 4M97A 3MA3A 1UA2A 4ITIA 4QP2A 4WBOA 3P9JA 2WQEA 3NZ0A 3BX5A 4KKHA 5CVGA 3VS2A 2PULA 1P2AA 2CCIA 4XBUA 3DAKA 3QCQA 3AD4A 2VGOA 2XCHA 3ATSA 3MB7A 4TXCA 4E4NA 3FMHA 2YEXA 5D9HA 4ACMA 3Q5IA 2JKQA 2WTVA 2XB7A 3QKKA 3JY0A 1ZMUA 4O0UA 3QTZA 4PP7A 4PP9A 3OCTA 3T9TA 2UW7A 1V0BA 2X8IA 5EKNA 2UW4A 3RWPA 5E7RA 3IGGA 2EB3A 4QP1A 1J7IA 1UNHA 4X21A 4XV1A 3UQGA 2Y9QA 4H58A 2X0PA 4LRMA 4RZWA 3W2PA 3PE1A 2RG5A 5HO6A 1OKYA 4I0TA 4F65A 4B99A 3KK9A 2YCSA 4RC4A 3UC3A 4DEEA 4IDVA 2PZ5A 3DDPA 5EI2A 2X4FA 4QDVA 5A3XA 2WTKB 5DE2A 4GG5A 3C4XA 5FM3A 4EOQA 2XNGA 4IIRA 4ENYA 4BGGA 2Z02A 4BBEA 3HEGA 5KMLA 5KO1A 2F4JA 4D4VA 4KB8A 4ZTNA 2WKMA 4F7NA 1OIRA 3WOWA 5I9ZA 2XS0A 1BMKA 4AAYA 3F3WA 5ANDA 4BDGA 4M14A 3TNQB 4CZUA 5IQBA 4U81A 5J79A 3HZTA 2PY3A 4GK4A 4F9WA 5K4IA 2I1MA 1XH6A 5LVPA 2EUFB 5FEQA 2CGXA 1KE6A 3GNIB 4E5BA 2R3GA 4UX9A 3A7HA 3PPKA 2R64A 3PFYA 3H9OA 4EH9A 4K77A 4OTDA 5CAQA 4M67A 3DKFA 5G1XA 5L6OA 3GU4A 5LCJA 3ACKA 3LXPA 3R7GA 2OU7A 2NRYA 2OI4X 4AS0A 1IA8A 3VUGA 3EQPA 4RGJA 4XCUA 1ZYCA 3NDMA 3NYNA 3U87A 2JLDA 4XMOA 5K5XA 3RPYA 2CGVA 1F0QA 4GSBA 3ZUVA 3A99A 2AUHA 1M2RA 4GYGA 5CLPA 1G3NA 2HW7A 1YDSE 4O0VA 5CF4A 3EB0A 5JFWA 3VAPA 3MV5A 2PYWA 3F5XA 5K9IA 5AV1A 3NNWA 2YM5A 3WI6A 4RX8A 4OTFA 2VTSA 4Z7GA 2CPKE 3DBDA 4OGRA 5C9CA 3D0EA 3OTVA 2GS6A 2BUJA 3KRWA 4C0TA 4TWOA 2OH0E 1UKHA 4X0MA 5JGAA 5IA4A 4DDGA 3FUPA 4ZMEA 4BGHA 1XH7A 5IQIA 3NWWA 4O0WA 2WQBA 4F4PA 3AC3A 3BBWA 4OR5A 4BDEA 5IH6A 4NM7A 4R77A 3P08A 4LG4A 3ZXTA 4D9UA 4YTCA 1GZKA 3D83A 4PDPA 4XX9A 5AP4A 4O86A 3GCVA 3ORIA 4EK4A 4UWBA 1KV1A 4NKSA 2C6TA 4FV2A 2QI8A 1FPUA 2C5XA 3I79A 4FI1A 2UZBA 3D2IA 3V6RA 3W2SA 3AOXA 4AWIA 4EK6A 3IW8A 5DI1A 4ZY5A 5KE0A 4CFUA 3PXRA 2NNWB 4XV9A 5CU2A 2VTRA 5DNRA 2CN5A 3O8TA 5CF5A 1UWJA 5AR4A 3PRIA 1YRPA 3PA3A 5TF9A 3Q2JA 3CPBA 4KIKB 5CYIA 5H8GA 3QU0A 3K3JA 4QP6A 2NPQA 2XNNA 4NSTA 2JDTA 3AG9A 2BKKA 3ZXZA 2FSOX 5CEMA 4JMQA 5LMKA 2X2LA 1PXIA 4FTJA 4GCJA 4RRVA 3DOGA 3ORNA 5AM6A 5AX9A 4EQUA 3D2KA 4DTBA 3A7FA 2XJ0A 3TDVA 2ITXA 2ZDUA 3UG2A 5FEDA 1H1RA 3H10A 4RX5A 3H9FA 4EBWA 2JDOA 1P14A 1HCLA 3B8QA 3UPXA 4ORKA 3H9RA 3POOA 3BEAA 3MTLA 3O2MA 1KE9A 4BYJA 5CENA 3UODA 3VQUA 2V5QA 3QBNA 4RIWB 1BKXA 1OBDA 1H0VA 2QQ7A 3KB7A 2W9ZB 2XJ1A 2H9VA 4RWJA 3ML1A 2IF8A 4KAOA 2VWXA 4PNKA 4ZEGA 4K9YA 3V8SA 4O83A 4QQ5A 2RFNA 3PSBA 3W10A 2REIA 2Z2WA 1P4FA 3G6GA 4EEVA 4GMYA 1YKRA 2HWOA 4K11A 3Q6WA 1R1WA 4EONA 3KIOC 1Q3WA 4L3JA 1KOAA 4UWYA 3MFRA 1OI9A 3SRVA 1S9IA 4QTAA 5CSXA 5ANGA 3V5JA 1KE7A 4DGMA 4AOTA 5KUPA 4RC3A 4CVAA 1YI4A 3MTFA 5EHLA 4BDFA 2YERA 2JDVA 3ZO1A 4F78A 4AW5A 3MH0A 3D5WA 2C4GA 3DZQA 3G2FA 3QC9A 3GFEA 4XG8A 2JKKA 2R3IA 3QAME 4N0SA 4LMUA 3AKJA 5FDXA 3QGWA 3R1QA 4F08A 2GNFA 4GU9A 1BL7A 4FIIA 4Q2AA 3SV0A 4CKIA 4N57A 5ANKA 4K8AA 1PMUA 4JBQA 3ORMA 2QHNA 3KN5A 4PF4A 2BZHB 5CZIA 3GU8A 1GJOA 4A07A 1Z57A 4J95A 4U6RA 3NW6A 4IAYA 3DBEA 3DNDA 3II5A 4HYSA 5L2TA 1ZYSA 5CI7A 3QA0A 2X7FA 4IM0A 2BILB 3UO4A 3FLZA 1XQZA 3FWQA 4F7SA 2FSLX 3PA4A 3TNHA 3PUFC 4PTEA 4FUYA 3DDQA 2ZOQA 4JDHA 3W8QA 4FMQA 3BGPA 3G9NA 4PWNA 3ZRLA 2OJIA 4BCQA 4E4LA 2J7TA 4YLKA 1GZ8A 3VS0A 4EORA 3DU8A 2ITYA 4C3PA 3OUNB 3FZOA 1LEZA 2WMXA 3Q5ZA 5IEVA 3SD0A 4DEBA 1M2PA 2GS7A 2CCHA 3B2TA 5CSVA 1VR2A 1MRYA 3JUHA 3KRJA 5AIRA 5I9WA 2F2CB 2C0TA 3E8NA 2WMUA 4RVTA 4FKRA 4OBOA 4NTTA 3WF7A 4E26A 2YM4A 1ZY5A 3BGZA 3NCGA 3IS5A 3UPZA 3ETAA 5AMNA 3DBCA 3LLAA 4QMPA 2BZKB 4LL5A 4OAVB 4M12A 3BU6A 5AP0A 4BZNA 3K54A 2UZOA 2UW9A 3FSKA 5A4EA 1ZYJA 3TYKA 2GHMA 4A9UA 5IA2A 4ZSLA 5I9YA 4FV6A 2VO7A 3EOCA 3O23A 5EI8A 3MY1A 4EH2A 4X3JA 3BL7A 3KMUA 4LRKA 5JSMA 2ZVAA 4MD9E 2C5YA 2ZJWA 4RX7A 3ZSIA 3GT8A 1BL6A 5M57A 5IZFA 2B53A 3EN4A 3PLSA 5I3OA 1LP4A 3JPVA 1CKIA 5FP5A 2IW9A 2ZAZA 3FLWA 2G2FA 2JAVA 4FOCA 3E7OA 4BYIA 4AGUA 4FYNA 3WILA 4O4EA 5LMAA 4FV8A 4IVAA 4U43A 3NIZA 3HKOA 2WELA 3BRBA 3OCBA 2X8EA 4LUDA 4K33A 3LPBA 3TV6A 2Z8CA 4CCUA 3CC6A 3LFQA 4FG7A 5AP6A 5E1SA 3TI1A 4HJOA 4C2WA 3GC9A 1DAWA 4TYHA 4XHKB 5EYDA 1O6YA 3CS9A 3WARA 2YWVA 4BR3A 3P0MA 4DH1A 3MIYA 4FTLA 2XRUA 1MUOA 1UU7A 4KABA 5FBOA 3M1SA 3P78A 4I92A 4DHFA 5I5ZA 2NP8A 4QYFA 2YJRA 3D5VA 4F70A 4D9TA 5A54A 3HGKA 4HGTA 3ZSHA 4D28A 4RJ3A 4FKIA 3F61A 2C1AA 3W2RA 4U79A 2BRHA 4XOZA 5EW8A 3FEGA 4K6ZA 4FKQA 3O5AA 4NTSA 4USDA 3V5PA 1XH4A 4BDJA 5C8NA 1U59A 2IWIA 1ST0A 2W9FB 2W4KA 4IZAA 5IA0A 4O7VA 1XBBA 2CGWA 1JKTA 3BE2A 5DGZA 5FLFA 5IEXA 4YZCA 3MI9A 5HTCA 3TZMA 3TT0A 5LMBA 5F1ZA 2XVDA 2C6KA 4QMOA 4XV2A 1UWHA 4EUUA 2C5OA 3DV3A 4I5PA 4NWMA 4W4XA 5I9UA 3EQGA 4JAIA 2WFYA 1YWRA 2PVRA 1ZOEA 5H8EA 5IA3A 5DA3A 3UMWA 4DGLC 4X2FA 4DFZE 3D94A 4XP2A 3PWDA 4UXLA 5AP7A 4QPMA 2Q0NA 3COIA 5EFQA 1Q8TA 2CKEA 2OH4A 5HNBA 2YM6A 3BIZA 5LARA 3VBVA 5A4QA 4FICA 4H1MA 4MF1A 4O21A 3CKWA 4MYGA 4AE9A 3PA5A 2Y0AA 3HA6A 3KXZA 2UVZA 3P23A 2QONA 4ERWA 4CT1A 5CALA 3ZLYA 4F63A 3SRVB 4JDJA 3BLHA 4X2KA 3AQVA 4J1RA 5ANOA 1OZ1A 4CFFA 3E8DA 2HW6A 2HZ4A 4Y46A 3TV4A 5BNJA 4G17A 4PUZA 1Y8YA 4DFLA 1LUFA 3D7TA 4YZ9A 3R04A 4U3ZA 4RVKA 4DBNA 5DOSA 4YC8A 1M2QA 1OL6A 3OY3A 2GCDA 1H1QA 2B9HA 3AC8A 3BV3A 4JXFA 4EQMA 3S4QA 3LCSA 4QMTA 4IFCA 4PQNA 3L9PA 3RPOA 1WCCA 3F3ZA 3NYVA 3ZHPC 4DLIA 4D58A 3R21A 5HVYA 2BTSA 1NA7A 3G0FA 2OZOA 4GS6A 4X2JA 3C0IA 5C01A 3G5DA 4TL0A 1XMLA 4L45A 1Q5KA 4LGDA 2PVMA 3UJGA 4PX6A 5D10A 4E8AA 2B54A 3D15A 2IVSA 4NCTC 4I3ZA 3P86A 3F5PA 4M84A 4XUFA 1AGWA 3FE3A 2UUEA 2VZ6A 3CD8A 3CQUA 2XK3A 4B8MA 4E5WA 4E6DA 3T3UA 3I0QA 2RF9A 3FMEA 5JN2A 3BYMA 3W0NA 2CNUA 3PSCA 4RJ5A 1VYWA 3CGFA 2C5VA 4AZTA 3PXKA 1V0PA 4EUTA 4IAIA 3FLNC 4X3FC 4EH7A 3NUXA 4FZ6A 5EH0A 3CGOA 4DFUA 3WZKA 5TE0A 4CYIA 3S00A 1U46A 3UE4A 3VC4A 3VUIA 4J52A 4KRDA 2X1NA 4EJNA 3IGOA 2W99B 2O64A 4QMZA 3NVMB 3MPAA 3TDWA 4BCHA 4BI1A 3VBTA 4HVDA 3BHYA 5LVNA 1Q41A 1WBVA 2HCKA 2WTJA 3NSZA 3WE4A 3M2WA 5CSHA 4KWPA 4YJOA 3F3TA 2J5FA 1YQJA 3KXXA 3TG1A 3I81A 4MXAA 3V5WA 1OPKA 2J90A 5DWRA 2WNTA 3NNVA 5EM5A 3VS7A 5CU3A 4BFMA 4FTUA 2IPXA 1XH5A 2NRUA 3FXXA 3P1AA 4H3BA 1A9UA 1G5SA 3LMHA 5FXSA 1H8FA 5BYZA 2XBJA 4GK2A 3NRMA 5HHWA 2BHEA 5HE3A 5T3QA 3R8PA 4XYFA 2I40A 1J1CA 3DZOA 4W4WA 3WYYA 4S31A 2XMYA 2YFXA 4EHEA 1T46A 2PZYA 4B7TA 2HY81 3W16A 4XG4A 1H08A 2PU8A 3QTQA 3E93A 4LYNA 5ANIA 1JLUE 2V62A 2VTAA 5HO7A 4TYHB 3OZ6A 5GIPE 5AUWA 2WPAA 3NW5A 3R73A 4BN1A 3OCGA 1ND4A 4FL2A 3FLYA 4O7ZA 1W2CA 1GZOA 3AD6A 3F9NA 3LVPA 1DM2A 4K2RA 3NUAA 2A1AB 2W1ZA 3NCZA 3G33A 4GKHA 4D4YA 2HAKA 3C4CA 3PIZA 4FODA 4EH4A 3MPTA 5DT3A 4FZDB 4U0IA 1UV5A 2ITNA 2WIHA 2X9FA 3SAYA 3FI3A 2CDZA 4ZSAA 1R3CA 2G15A 3ORZA 4Y8DA 5A4CA 3RHKA 1BI7A 4GYIA 2YIRA 4MD7E 5IQFA 1PMVA 4FTCA 4RWKA 4W4VA 5BVKA 3SOCA 4EOLA 3NPCA 3DY7A 3DBQA 4E5AX 5J5TA 4XLVA 5E92A 3O17A 4USEA 5DT4A 2XNBA 2XALA 5CTPA 2X9EA 4E3CA 3E7VA 4ASEA 1W0XC 2IVTA 1OL1A 2W17A 3LCDA 4JBOA 5ETIA 5HOAA 4XG9A 2FUMA 3OEFX 3A4OX 3EQIA 3QL8A 5KMNA 2PPQA 1PYXA 5AEPA 3ZZEA 3R0TA 4EK3A 3U9NA 2CKQA 2A19B 2JIVA 4Y73A 3TKHA 2ONLA 3KCKA 3FXWA 5L2IA 5ETCA 4FVRA 3O7LB 3PLAE 2CGUA 5IA5A 3AT3A 3QX4A 3SXRA 5M06A 3AMAA 3Q6UA 1ZRZA 4FZFB 4I6HA 3VW8A 3OF0A 4EZ5A 2PMLX 5FWKK 3KXNA 3BYUA 4HGSA 3RGFA 3RTPA 5HD4A 1BYGA 3IW4A 5AAFA 3TJCA 2KULA 2PL0A 4JX7A 4LUEA 3H4JA 4YJPA 1O9UA 1RW8A 3BLRA 4CLIA 5G6VA 2P2HA 4D2VA 3E63A 4F64A 3IW5A