3DS6A

P38 complex with a phthalazine inhibitor
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
349
structure length
343
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of highly selective and potent p38 inhibitors based on a phthalazine scaffold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 104
structure length 343
sequence length 349
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ds6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ds6A01
3E8NA 3PDTA 3ZSIA 3AMAA 4MEDA 4FSMA 1OKYA 4ITIA 4B8MA 5IA0A 1BKXA 2R3IA 3NYXA 2J0IA 1YQJA 2QKWB 2PVNA 1OBDA 3UG2A 3A8WA 4XS2A 3L9NA 4RWLA 2BIYA 1CSNA 4BDJA 4DEGA 5JH6A 2PULA 2HAKA 4FICA 2P0CA 4JXFA 4MHAA 4U44A 4FEQA 4BKJA 4CCBA 2VWZA 5M4IA 4JDIA 5HVYA 4HGLA 2EXCX 4U97A 3F61A 3TJDA 4O0SA 3NCZA 3BELA 2I0YA 3QRUA 2QO7A 4O0TA 3TNPC 4X2GA 3FHRA 3OS3A 2Q83A 4UMRA 3PSCA 3CCNA 3GU7A 4I5MA 3V3VA 2QU5A 5BVEA 4RGJA 4CEGA 4RIXA 5JEBA 4ZS4A 5KMNA 1YOJA 2W4OA 2I40A 2ZV2A 1H07A 3IW5A 3R00A 4WNOA 2W1HA 5DFPA 3I4BA 2WEVA 5KMKA 3A2CA 4FOCA 4N70A 1UVRA 5CNNA 4XHKB 3LQ5A 3R1SA 4MX9A 5EI2A 3F3ZA 5CVGA 2ACXA 4XG8A 4XP2A 5EK7A 2E9UA 2BIKB 3C0IA 3QZGA 4JAIA 5DPVA 1OBGA 3CD8A 3IECA 2WGJA 5AR5A 1TVOA 5CT0A 4MF0A 3DV3A 3NAYA 1LUFA 2GHMA 3FHIA 2X9FA 3ACJA 5CASA 3SQQA 2R7BA 1XR1A 1PKGA 4YURA 2WOTA 3TDVA 2BDFA 2VU3A 3PJ3A 4GJ3A 5BPYA 3PA4A 3HX4A 3NUUA 4X0MA 1OIQA 2OIDA 3QUPA 5CSWA 4ZP5A 3ZFYA 3PLAE 4G6NA 2VAGA 4ZTSA 4NJ3A 4UV0A 3SLSA 5M44A 3HLLA 3KK8A 4YJSA 3ZFMA 3VF9A 4AAAA 3WE8A 2XJ1A 4U5JA 4O7ZA 3C4FA 4U3ZA 4F9AA 2IWIA 5IEXA 3EQCA 4AZWA 2PE1A 3VUGA 4LRMA 3LLTA 3Q5IA 4LGDA 4IDTA 4BCQA 1NW1A 4DT9A 4XG4A 4WNKA 3C9WA 4ANQA 4ANNA 3MPAA 3PY1A 1PXLA 5EKNA 3N4UA 2ITXA 5CY3A 4DGMA 1YDRE 2X4ZA 1V1KA 4ZK5A 1JLUE 3VULA 3ORPA 4J97A 4EBVA 5IEYA 2QG7A 3JVSA 3KXXA 5ACBC 5FQDC 3SKCA 1M7NA 3CPBA 3FKOA 3UZTA 5D10A 3G6GA 3DFCB 4CV9A 3AMBA 4EHVA 5EW3A 4K9YA 3CS9A 1MRUA 4KWPA 3PE2A 4D4YA 3VBXA 2C68A 5LJJA 4YC8A 1UNGA 3RK9A 3NUYA 2ZOQA 2QOLA 4XG9A 2W1ZA 4G6LA 5A4CA 5FM3A 4DEAA 1QPJA 4RJ4A 3RZFA 5DRDA 5KMJA 4M15A 3KY2A 5EI8A 3UMWA 3NGAA 5CWZA 4XOZA 5ANEA 5HTIA 3FYKX 5HBEA 4QYEA 2R0UA 3BE2A 3Q6UA 4CXAA 3BYMA 3LQ8A 5JZNA 4CMUA 2YA9A 4BIEA 2WFYA 1S9IA 3ODZX 1J7LA 3NUXA 5D12A 4IMYA 5FEEA 2ITUA 4Z3VA 4C3PA 3OEZA 3SV0A 4AW0A 4K33A 5HD4A 3V5TA 4K1BA 5JQ8A 3LHJA 2RFSA 4LFIA 5AAGA 3FI4A 2VX1A 3F69A 3BI6A 2PHKA 3PXKA 2C6DA 2J0KA 5HX6A 3HDNA 3HMNA 4WSYA 3VS7A 4HVDA 3QGWA 4U40A 2OXXA 4PDOA 2C6EA 2ITOA 3CQWA 2JIVA 3PRIA 1HCKA 1OPJA 3I1AA 3NEWA 4TTHB 3RJCA 2NP8A 4X3FB 3CSVA 2HIWA 5HIDA 3Q2JA 4R7BA 3OWPA 3ZLWA 1HOWA 2QOIA 4NM5A 4YNOA 4RQVA 4M0YA 2PVLA 3IDPA 4G9RA 5DT3A 3PVWA 5IH6A 3QRIA 3KVXA 2YIWA 5EOLA 4U79A 4O0RA 4NWMA 4O86A 3AC1A 4CZYB 4F08A 1RDQE 4WNMA 1Y91A 2RFDA 4W4WA 2YFXA 5HG9A 3R0TA 4AWIA 3R6XA 4BYJA 5IA2A 4JQ8A 2Q0BA 3E5AA 3QYWA 3ET7A 3OF0A 2H96A 3MVHA 4K6ZA 4TZRA 3PRFA 4CKJA 3SXRA 4JQEA 3LIJA 3Q4ZA 5HCXA 4FV2A 2VTQA 5GNKA 3G9LX 3LCSA 5BMSA 2O2UA 4QMXA 1VJYA 3FQEA 3I60A 3LM5A 2IZRA 4LL0A 3MH2A 1OIYA 3OP5A 4IB1A 3ZRLA 3ULZA 4I24A 4FSRA 2WEIA 4QQJA 2V62A 2VZ6A 2JFLA 4XLVA 3RWPA 4M67A 5IKWA 1ZOGA 2A27A 4D1XA 1CMKE 3LXKA 4UZDA 3R7EA 3P4KA 3FMDA 4FV9A 4XBUA 4L3LA 2BRBA 4GMYA 4DEDA 3CGFA 5GZ8A 4DFXE 5K0KA 3NNUA 2IVSA 4AGUA 5IISA 4JBQA 5M51A 3WYXA 3LPBA 4L3JA 3W2CA 3UVPA 3D7TA 4WKQA 3R83A 1KV2A 3UMXA 1E1XA 4ZSLA 2WMQA 4QP7A 4HGTA 4P7EA 3FZPA 2QOQA 3BGQA 5AA8A 3FPMA 2X2KA 4C3RA 2GU8A 4TYIA 4M97A 1FVRA 2WMVA 3V8WA 4BVUA 3FI2A 4FVRA 3EH9A 3HEGA 4OTHA 4TPTA 4CLIA 2VTNA 4CTBA 3R21A 3EQFA 3FC2A 5JMSA 2Y6OA 3NVKI 1OGUA 4MQ2A 4XNEA 3DU8A 3EB0A 3QHRA 4YNEA 5DLSA 3C51A 3ZXTA 4QP4A 5FDXA 3TKHA 2WTDA 2PUUA 4MXOA 4UXLA 4WBBB 4AOJA 4RJ3A 5HVKA 4HZRA 3AT2A 3BKBA 3FL5A 3NW5A 2G1TA 2X6EA 4FT9A 2XNGA 5E90A 1KE5A 4PPBA 4FTMA 1J7IA 3RALA 3CEKA 3F2AA 4IM0A 3GCVA 4OR5A 4IB0A 1KE8A 2VO7A 4QO9A 2B55A 4E6AA 3II5A 4XUFA 3C0HA 4AT5A 3D0EA 4AXAA 3KULA 3ITZA 2F7EE 2UZNA 2X9EA 4UMQA 5L6PA 3B2WA 1BX6A 4L52A 4AZFA 3GBZA 1UWHA 2WU7A 3OTVA 3AD5A 3DGKA 4JG8A 5E8YA 2VTIA 5AUXA 3P7AA 4FIEA 4EQUA 4XP0A 3UBDA 1H24A 1PMNA 4DC2A 4FKPA 3D7TB 2OK1A 4ALWA 2E9NA 2H8HA 3GQIA 5FGKA 3VRZA 3ZSGA 5KHXA 1O6KA 4D1ZA 5LCJA 3GP0A 2YAAA 2C3LA 5C1QB 4IAZA 4Q5HA 3ZXZA 3H9FA 5DR2A 4UWYA 2J0MB 3F7WA 4A9UA 3EWHA 1ZYSA 2JKOA 4NEUA 2LAVA 3FEGA 4NM3A 3IGOA 4HGEA 3JR1A 4ZSGA 3P78A 2ETRA 3AC4A 4OTPA 2ONLC 2JKKA 4RMZA 4AW5A 3FI3A 3MWUA 4I20A 4OTQA 4YSMA 2JFMA 2CCHA 4FODA 4H39A 1TQMA 2BFXA 2IN6A 2Y8OA 5DE2A 4C02A 1H1RA 4WBOA 4ENYA 1OMWA 2V55A 4JR3A 3TZMA 4KBAA 1G8SA 5C01A 3QCYA 3BWJA 5AAFA 4C59A 4RFYA 2Z2WA 2G01A 3CY2A 3ZC6A 2W4JA 5A54A 2BHEA 4YHTA 2X1NA 2R4BA 4AUAA 2WMBA 3QUEA 2RKUA 4CQGA 5C27A 2WQMA 5AA9A 4O84A 4F1OA 4PMSA 3RI1A 4L8MA 3HRCA 4PP9A 2YWVA 4FNXA 5JK3A 3DCVA 3VS1A 1GZKA 4WUAA 3QQGA 3KL8A 4ALUA 2BTRA 2QR7A 4JIKA 4YZBA 2B9HA 4YO6A 4EJ7A 4V01A 4C34A 3PVUA 5HNGA 3IW7A 4MBIA 3PXZA 3POZA 5B2KA 2BDWA 1NT2A 3MBLA 3TKIA 3W18A 2NRYA 5FUTA 4BWXA 3U9NA 2J6MA 5H8BA 1P14A 3UQCA 2FSLX 3QCXA 4ZSAA 3QD4A 3VJNA 3ALOA 1BUHA 2REIA 3RPSA 2PTKA 4O22A 3FXWA 3VS3A 3DXPA 3L8VA 2GS2A 2R7IA 4CFMA 3UPXA 1QPDA 4TL0A 5TE0A 5AP0A 2ZV7A 5IA5A 1AD5A 4F0IA 3H4JA 2F49A 3NSZA 5IDPA 4I93A 3E92A 4NTTA 4A9TA 2BMCA 2PY3A 2Y4PA 2ZB0A 4D0XA 3QLGA 4L7SA 2GNIA 2ZV8A 2R9SA 3MDYA 2F2UA 4RFMA 4WG4A 3WYYA 4DGGA 4FOBA 5BX0A 1IAJA 1VR2A 4CG9A 2BRNA 3B8QA 4RC4A 3QKLA 2FO0A 1J7UA 4I6HA 1YW2A 3G90X 3EQGA 4XG6A 5HG8A 5BVWA 2JLDA 5CF5A 3BIZA 4DA5A 1WBNA 4TYEA 1Q8YA 3NUSA 4E1ZA 4NZWB 3QTQA 3DTCA 2OSCA 4E4LA 3NYOA 4XEYA 4BDHA 2YJRA 1SZMA 3QQLA 4RIOA 3BU6A 5J87A 3RNYA 2A1AB 2DWBA 3COIA 3UP2A 3B2TA 2OWBA 3FLQA 5AX3A 2J0LA 3R7UA 4AA5A 3O50A 1PYEA 3Q04A 4O7SA 1R0EA 2XNEA 5DNRA 4BGQA 3P5KA 4EYMA 3V01A 3U55A 1H08A 1QMZA 4IM3A 2E9VA 1A48A 4I94A 3ZRKA 5AJQA 5LMKA 4RIXB 4ITJA 4PDYA 4YJOA 1IA8A 4YC3A 1UU7A 5C4KA 3PXRA 4RWJA 5HESA 5CU3A 5CEQA 4X3FC 4EC8A 3DTWA 2ZJWA 4RA5A 5ETFA 4ACMA 3ZU7A 4EOJA 5LXMA 3WZEA 4OTWA 4C37A 4L42A 5CVFA 5CF8A 2QG5A 3S4QA 5BVFA 2JD5A 2XNNA 4EBWA 2QOCA 2CLXA 2J9MA 1Q8UA 5J7HA 3TACA 5K4IA 1AQ1A 1TKIA 3FZ1A 3F3UA 3UOJA 3VS4A 3LM0A 4H3PA 3C0GA 5HGIA 2B54A 2PE2A 3UO4A 3ZSHA 5KMMA 3EFLA 1JVPP 3E3PA 4L7FA 2H34A 4DH3A 3ZM9A 5KKRB 3A61A 4MD7E 3DAJA 3RMFA 4BN1A 1CKPA 2BVAA 4QQCA 5IUHA 3RVGA 3BYSA 3PXQA 1F3MC 1WMKA 3ZFXA 2ZAZA 3DQXA 3MIAA 4FTLA 1W82A 3KCFA 3HYHA 2ETKA 2J90A 3OG7A 5EM8A 4CFWA 1SMHA 1YOLA 2C1AA 2JDRA 2VX0A 2VTHA 2WTJA 3MH0A 5AP6A 3SW4A 3VBYA 4CRSA 1MP8A 4FKLA 4IEBA 3OUKA 3T9IA 3S1HA 4FF8A 2XKEA 3T9TA 3JYAA 2J51A 5BVDA 4RQKA 4FVQA 4FKQA 4BDDA 5AP4A 2Z60A 5EH0A 3PTGA 5FP6A 2VGOA 3DAKA 1WVWA 5I9ZA 4BDCA 3LFBA 2G15A 2F2CB 5AP3A 4E4NA 4MYGA 5CU2A 2HZ0A 4JR7A 5EQPA 3LVPA 3PE1A 1OKWA 5DN3A 1APME 4IX6A 1QPEA 1YXXA 4F1TA 4JT3A 1UU3A 1DI9A 3MGYA 2ETMA 4MXZA 4X6RA 4EORA 4ERWA 2VX3A 4F4PA 4L6QA 2BRGA 4FV3A 3G51A 1BL6A 1VZOA 2WMUA 2ZM4A 3MPTA 2ITTA 4D4SA 3UP7A 3DAEA 3D5VA 3H30A 4FSUA 2XM9A 2WIPA 4FNYA 4WO5A 4BIDA 3MVLA 4RLKA 3PVBA 4CFNA 1BMKA 5CU4A 5M4UA 1O6LA 3FQSA 4O96A 2YCFA 4FIHA 3DS6A 5DRBA 2VWYA 4IAAA 4KKHA 5J95A 3SXFA 2PVMA 4GFMA 5FEDA 5IF1A 4BY9E 1Q61A 3CR0A 4WUNA 5KO1A 1DS5A 1XBAA 2GNGA 3NYNA 5AUYA 3ZLSA 4CFUA 2BR1A 3KVWA 3LOKA 3DBQA 4KRCA 5AP5A 3TCPA 1EH4A 3L9PA 4RWKA 3ATTA 4D2WA 5EDQA 3UOKA 5CNOA 2QU6A 1OIUA 2ZB1A 3GU8A 3MFUA 3R28A 4PWNA 3REPA 3I81A 3ORMA 3NNVA 3RCDA 3PA5A 4JBVA 4YTHA 4EK6A 3V6SA 2ITZA 2C5NA 5L6OA 4GK2A 2DS1A 4I22A 4A4XA 4PL5A 4IWQA 4JVGA 2NO3A 2Z7SA 3BCEA 4ASZA 3QTRA 1XHAA 1FVVA 3MTLA 5I4NA 4X3FA 4G31A 1V0PA 2OH0E 4KBKA 1XH4A 2W17A 4L3PA 4AW2A 4FNWA 5KMIA 5M07A 3F2NA 3W8LA 4R3CA 2WTVA 2RG6A 3TDWA 5A3XA 2W96B 3FZRA 2XKDA 4FK3A 3C4EA 2I0EA 4S31A 4RRVA 2VNYA 4LQMA 2UW9A 3G9NA 5FXRA 3DBDA 3QD0A 3VWAA 2XJ0A 1L3RE 4YJUA 5TO8A 5EI6A 4FG7A 5CU6A 3DXQA 5KBRA 3SX9A 3RINA 5ANOA 2CMWA 2HENA 2RG5A 2HOGA 5GZAA 2B52A 3HV5A 1M17A 4DGNA 3HAMA 4MCVA 4QPAA 1JSTA 1KV1A 3LKMA 3ZMMA 4FV8A 1YWNA 5CF6A 3TNHA 4AU8A 4QPSA 2B9IA 4GU6A 3MS9A 1K3AA 3SAYA 4IXPA 5DWRA 3NIZA 3ZUTA 3FXXA 4H36A 4J7BA 5IU2A 4YJPA 4IC8A 4B0GA 2VTLA 3AD4A 4EOQA 2EWAA 2R3KA 2QOKA 3Q6WA 2C0TA 1LEZA 2AC3A 3IW8A 1AGWA 2GTNA 3V5PA 3WARA 4D5KA 3POOA 1H1WA 2C3IB 1VEBA 2R0IA 3OTUA 3QCQA 4IJPA 4I5HA 4YBJA 2W5HA 3OW4A 1W83A 1WBVA 3KN6A 3QL8A 1YXUA 4A7CA 2Y9QA 4N6ZA 2QOBA 1PXPA 4FKOA 4JX3A 3EQDA 4O0WA 4IFGA 4CNHA 5HTCA 3KXMA 2GQSA 3R8LA 2X7GA 3CKXA 3CY3A 4O83A 3QD2B 4O91A 3PXYA 4FZDB 3VW8A 4FNZA 4IHPA 2UZDA 4RSSA 1KOBA 2C4GA 5A4QA 3BLHA 3QKKA 5M06A 3EL7A 4K0YA 3HV3A 3UO6A 4C36A 5CSPA 3VUHA 4BTFA 3PYYA 1H1QA 5AV0A 1OB3A 2OBJA 4F65A 4R1YA 4E4XA 1Y8YA 2GDOA 4QTAA 2A19B 3NNXA 3ZS5A 2JC6A 3UYTA 2C30A 5HE0A 3VBVA 4UXQA 3A62A 5KMLA 4BBFA 4ZLOA 1FOTA 4OUCA 4O7LA 1YOMA 3IW6A 3BQCA 3E8CA 4G3DA 2BUJA 4TYHB 5ETCA 5TT7A 3S0OA 1Q3WA 4FV5A 3EQBA 3VW6A 5AR2A 3OFMA 3BHUA 4BKYA 3N51A 4Q9SA 1OL6A 1F0QA 3KXNA 3D94A 5AR8A 4AA0A 4FGBA 2XZSA 2CGXA 2QI8A 5CSVA 4NL0A 3NDMA 3U4UA 3R02A 4ZTRA 4A07A 3MESA 3RBWA 2UW3A 3QRJA 1SVEA 1XH5A 3NAXA 5JFWA 2XYUA 4X7QA 4H58A 4O21A 5F4NA 4NH1A 3LFEA 5E8TA 3E87A 5IMXA 1JBPE 3SDJA 3R2YA 2IO6A 4I6BA 3U6HA 3WZJA 4C58A 3MY1A 4WRGA 5GZ9A 3NW7A 2UW6A 2PUPA 4IANA 5CU0A 4C57A 4G16A 3JUHA 3R1YA 4Y85A 3DKOA 2OZAB 4U6RA 4I1ZA 3UC3A 4IAFA 3HKOA 4S33A 4L53A 2B4SB 3RPYA 4M8TA 4AGDA 4AS0A 4EEVA 2B9JA 4S34A 3BU3A 3L9MA 4ANOA 2OJ9A 3T3UA 5GJGA 4FX3A 3F82A 3MW1A 2UW5A 4FMQA 4FKUA 3KMUA 2X8IA 1J1BA 5AP2A 3ZRMA 5LWMA 2W06A 4LUDA 4QP3A 4TW9A 4JBOA 3TZ8A 4BR3A 3Q4TA 4MKCA 5JRSA 4WG3A 3P08A 3UDBA 2VWVA 4RJ8A 3F3TA 2ITWA 3ANRA 5EOBA 4D2VA 2ZDTA 4F9CA 3W10A 3I5NA 4BCMA 4O2ZA 4AOIA 4OAVB 1YDSE 4HCTA 4J52A 3HRBA 5JFVA 3VUMA 5AUWA 2OFVA 2I1MA 4BCNA 1LPUA 1O9UA 4FTJA 3V8SA 3R1QA 4I23A 2CKPA 3GT8A 5EHYA 3ZEWA 1URWA 2C6IA 4DFYA 2GQGA 4IADA 3VN9A 3GC7A 5IQBA 5H3QA 2Z7LA 2C5VA 4HYSA 2HWPA 1PJKA 3PWYA 4U80A 3OCBA 2HW6A 4FSTA 4ASEA 2OU7A 3C4WA 4X6QC 3Q5ZA 3VS6A 1HCLA 2X0GA 3BHYA 5AV1A 1WFCA 1XQZA 2XIXA 3HA6A 3BLRA 3OZ6A 3PXFA 3ODYX 4H3QA 3QLFA 3P86A 4YPSA 4JI9A 4ORKA 3MB7A 3FE3A 2IJMA 3FDNA 5I3OA 4HW7A 3BLQA 4I4EA 3ANQA 4L45A 4UEUA 3UNZA 3EOCA 2FSTX 3TTJA 4BHZA 2NNWB 3AG9A 2Y7JA 5EYDA 2CNUA 3SRVA 4RFZA 3C5IA 2R3PA 2OW3A 4LI5A 3VNTA 4FTQA 4YU2A 3ENHA 2YABA 2B9FA 3H3CA 3M1SA 3QAME 1W98A 4OBQA 2WNTA 4EOOA 2FA2A 3TZ9A 4I21A 4LG4A 3RGFA 4EQMA 2XBJA 4TXCA 5L2TA 4B7TA 3FMHA 2CDZA 3R7OA 4MBLA 1BYGA 3OOMA 4YZNA 4DTKA 1OECA 2P2IA 4O0VA 2R3LA 2PZ5A 2HZIA 4Y5HA 3NZ0A 4TRLA 4KS7A 2HY81 2QHMA 3L1SA 3KQ7A 3O17A 3OT3A 3NYVA 3QTIA 3BBTB 2QNJA 5CLPA 1CTPE 4R1VA 2IW8A 4MF1A 3TG1A 1MRYA 3QXOA 5AV4A 2WHBA 4D55A 2PPQA 1IRKA 4IAYA 4PTGA 5AUTA 5KX8A 4BKZA 3MVJA 5G1XA 4A4LA 3D5WA 3PZHA 3A60A 5J8IA 3DZOA 4FIGA 2DQ7X 2Q0NA 1YI6A 2IZUA 1FGKA 3I0QA 2CHLA 2YLFA 2JIUA 3NX8A 5J7BA 2QC6A 4G6OA 4V0GB 4X2FA 2PYWA 4FEUA 3VUTA 2CLQA 2FSOX 2JAVA 5AM6A 3PSDA 4PMPA 5IQCA 2XNOA 3UZRA 2YLEA 3E88A 2C3JA 3EHAA 3QXPA 3O0GA 4F7NA 4DG0E 2BTSA 3F5XA 4I92A 4OTGA 3UYSA 1JOWB 3D9VA 5CEMA 1IA9A 4ZJJA 4QYFA 5EQEA 2F9GA 4FV4A 2BHHA 3BHTA 4KIKA 4QRCA 1MQ4A 2ITQA 3H0ZA 4Z7HA 1GZNA 4UWCA 4RPVA 3HVCA 2HWOA 2QQ7A 4AZEA 4BDGA 4FSYA 2QURA 3GC9A 4MAOA 4F70A 3OUNB 4TYHA 3BEGA 3SW7A 4D9UA 1IAHA 3TUBA 2WELA 4MXCA 3VQUA 2GQRA 3PZEA 3RAIA 3VIDA 2ERKA 4FT7A 4YJRA 4Q5EA 4EOKA 1FGIA 4WSQA 3OCSA 4USFA 4ZMFA 3FMKA 4OBOA 5J9ZA 3IDCA 1VYWA 3IOPA 4NIFB 3C4CA 4JX7A 4M69A 2YM4A 4IVAA 2FSMX 3WF7A 2QO9A 3D5XA 3IKAA 3GOKA 4CSVA 1ZWSA 2P4IA 4W4VA 4E5BA 4E8AA 3UE4A 1IR3A 3MJ2A 5K3YA 4IAIA 3TV4A 1NY3A 1PKDA 5BYZA 3TJCA 2PWLA 4IW0A 5HLWA 5HU3A 3LFNA 5TOZA 2F7ZE 1Q97A 1ZY5A 4C0TA 3PPZA 4GUBA 4DN5A 4E6CA 4EK4A 2PZYA 2C1BA 4CMOA 5CX9A 3LMGA 2OICA 3G15A 5BUEA 1I09A 2RFEA 4CT1A 2PSQA 2WTWA 4F7JA 1U54A 4IAKA 1U46A 3QA8A 4BCGA 3UZPA 4AFJA 2E9PA 3ZBXA 1DI8A 4BBMA 3SRVB 3KRLA 5LVLA 5T68A 3VUKA 4FTNA 3CKWA 2XK9A 3FYJX 5L3AA 5E8WA 4HCUA 3GNIB 4FV0A 3UVRA 2RFNA 3EKNA 4FKVA 2WB8A 2Z8CA 3CGOA 4AFEA 3R7GA 3FMJA 5KMOA 3ATSA 3PJ2A 4LV8A 2J0JA 2R3JA 5IUIA 3RHXA 2UVZA 2WQBA 3DDQA 3EQPA 3R7YA 4G9CA 4RIWA 2VO6A 2G2FA 5C8MA 4TKSA 4DYMA 1DAYA 3FLWA 3HUCA 2JKMA 3MYGA 4G3CA 4IZ7A 3MB6A 4GRBA 3R1NA 4FL3A 4J95A 4IVBA 5DIAA 3FZSA 4D9TA 4U3YA 5HBHA 2Y4IB 3WOWA 3LCOA 3MIYA 2Z02A 4GS6A 4WD5A 1GY3A 3KRXA 3SXSA 4C7TA 2WKMA 3HRFA 1JKTA 2VTPA 1QPCA 4UY9A 4ANLA 2GFSA 3N4VA 3Q9ZA 2X2LA 3K3IA 4H3BA 4DLJA 2O5KA 3MJ1A 4NFNA 4WG5A 3E64A 4FL1A 4H1MA 1M14A 3T3VA 2JDVA 2OKRA 3FV8A 2GHGA 1Z5MA 2H9VA 3DBEA 1MQBA 3Q4UA 1K9AA 5CAQA 3EFJA 3TT0A 1Z57A 2IZSA 4Y46A 3LFFA 4YZ9A 3I5ZA 3O7LB 2WXVA 4FEXA 4XMOA 1BI8A 2A2AA 2VWXA 2W7XA 3FZOA 5B7VA 5C8NA 1PMUA 4EI4A 3GB2A 2NRUA 3BGPA 1FPUA 2I0HA 2EB3A 2HY0A 2XP2A 3NS9A 4PTCA 4IX5A 4XG7A 4EUTA 5HZNA 4FT3A 3AMYA 2PL0A 5F94A 3TNIA 2CKOA 4CRLA 4YP8A 5TR6A 4CT2A 3E63A 2UW0A 3MSSA 1W8CA 4J71A 4F6WA 2XNBA 1H00A 3DXNA 3FKLA 4EH4A 3OY3A 4QTBA 3MH3A 5IZFA 4PL4A 3AD6A 3HV6A 3I7CA 2DYLA 2J5EA 4MTAA 4M68A 4R5YA 3LQ3A 2UZLA 5B0XA 2GS6A 5CEOA 2C5XA 2B1PA 4KBCA 3GU6A 1B38A 3HUBA 3OD6X 3BU5A 4FKSA 4QP2A 4BCOA 5KNJA 1XJDA 5HG7A 3DNDA 3WIGA 2WMXA 4BCIA 5EYCA 4FEWA 4AG8A 1M2RA 4EHGA 5E8UA 5H8GA 4EWHA 3ACKA 2ITPA 3LFCA 4V04A 5KE0A 3HECA 5JQ5A 2UW4A 1OL5A 4NJDA 3AT3A 4G3EA 3U9CA 2UVXA 3F2RA 5HE2A 3QTUA 1UNHA 4BCHA 2XEZA 1X8BA 1WBPA 3LXPA 3PA3A 1Q24A 2O3PA 5IA1A 1KOAA 4UWBA 1H0VA 4F99A 1KE7A 3S3IA 5EG3A 1B6CB 4AT4A 5EFQA 5JT2A 1OUKA 4O7YA 4F7LA 4W4YA 3OROA 3VQHA 2UZEA 2XRUA 4GFOA 3FXZA 4L44A 1OI9A 2X4FA 4RC2A 4PDSA 2YIYA 4LL5A 2F57A 2XK7A 4LMNA 2QLUA 4L00A 3D83A 4LGGA 4NT4A 4FIJA 5DVRA 3UG1A 2BKKA 3BV2A 1FQ1B 3A7JA 2WZJA 3LE6A 2YDJA 4EHZA 3KXGA 4BCKA 1R1WA 4M3QA 3ROYA 3C50A 2A4LA 1XBBA 2C0IA 1OPKA 3RAWA 5DYJA 1YXSA 3V5WA 4YZCA 4CLJA 1NA7A 1JPAA 3QALE 1JAMA 3QTSA 3U4WA 3W16A 5BYYA 4K18A 4XV3A 1REJA 2C3KA 3GENA 5DG5A 4X2NA 3JY9A 3F66A 3MFTA 2O0UA 4K2RA 4KABA 3BBWA 4W9XA 1WBWA 3UQGA 5AX9A 2WIHA 3W8QA 4KIQA 4C8BA 4YTIA 3ULIA 2UVYA 4AE6A 3C4ZA 3U6IA 3NR9A 4GT3A 4LM5A 5A6NA 4EK5A 1ZY4A 4QMZA 4H05A 1JKKA 3OW3A 3PWDA 3R8ZA 4OT5A 4F0FA 2IZTA 2QOHA 3HMOA 1F5QA 5HIEA 3EN9A 5ANDA 2XKCA 3UO5A 3HP2A 5F1ZA 3TNWA 4MNEA 2R5TA 5F20A 3THBA 4EK3A 2C0OA 4OW8A 3RCJA 4ZY6A 2PZRA 4JL9A 5ANIA 3VBWA 3FMNA 4F9BA 1ZZLA 1OL7A 1PW2A 2VO0A 2X8EA 1U4DA 2XK3A 3PLSA 1XH8A 3DQWA 4GG7A 4GFGA 2BPMA 4LRJA 4O0UA 4RZWA 4EHEA 3R73A 5A4TA 5CAOA 5J1WA 3AC5A 3S00A 4IWPA 4MXAA 4ZMEA 2W5AA 2YN8A 2BZJA 3WF6A 2HXLA 2KTYA 2VN9A 5FDPA 1R3CA 2QODA 2WAJA 4IX3A 4KD1A 2QKRA 4OTIA 2X7OA 3DKCA 5DA3A 4WNPA 3W2OA 4EH7A 4YTCA 5ITAA 4FT0A 3VS2A 3SVVA 2C6KA 2WMWA 4IZYA 3VC4A 3UQFA 5CENA 1J3HA 4YTFA 4I4FA 4DHFA 1GIIA 1SNXA 1YI4A 2HXQA 1KSWA 3TUCA 3LZBA 2GPHA 3QBNA 4DCEA 5CT7A 3FMEA 4XLIA 1ZYJA 2IPXA 1XKKA 4MD8E 4ZAUA 2VTRA 3WIKA 2OF4A 4C2VA 2VNWA 4XBRA 5FXSA 5HU9A 4UN0C 1XWSA 3F5PA 2R3FA 5BUJA 4AZVA 2PMOX 2Z7RA 4BCPA 5EKOA 3KXZA 3FZTA 5C8KA 3PVGA 3A4PA 4GVJA 3ZO4A 3CIKA 3AC3A 3FAAA 3OBJA 4QTDA 3QQKA 3D5UA 4EJNA 1OL1A 3OWLA 3DB6A 3QQUA 4M66A 5M08A 4XH6A 4BZNA 5GIOE 2VTAA 5E1EA 3ELJA 3O2MA 5HI2A 4B4LA 4CQEA 1KE9A 2XK6A 4ASXA 4R3RA 4ZZNA 4DH8A 5C4LA 2PZPA 1SVGA 1GJOA 2KULA 2BDJA 2XYNA 3PPKA 4P5QA 3MY5A 1SYKA 4U8ZA 5HVJA 4CFVA 2IG7A 2RGPA 4P4CA 4PUZA 5HNBA 3DK7A 3BZ3A 4GIIA 4B8LA 4C62A 1GZ8A 4X2KA 2R3OA 2VO3A 5CYIA 4A06A 4MWHA 3A99A 5CS6A 4IBMA 2PK9A 4F6UA 4FV1A 5FTQA 3OWKA 4I6QA 3S95A 3Q9XA 3L9LA 5A14A 5L8LA 3WF5A 4DG2E 2YIRA 1GAGA 2XNPA 2Z7QA 3RM7A 4EH5A 1Y8GA 2X81A 5ANJA 3JPVA 4YLLA 4AW1A 4FG9A 2BALA 3W2RA 1OITA 4XRLA 4ONAA 4FGRA 2CSNA 3KGAA 3NVMB 4FTIA 4J8NA 3EQRA 1IASA 5HG5A 1PRYA 1Y6AA 4BI0A 3M2WA 4IWOA 4QMMA 4YBKA 5F9EA 5JRQA 1Q8ZA 4RVKA 2XUUA 3Q9YA 5M56A 4CMTA 4EYJA 2SRCA 5GHVA 4XV9A 4YJQA 3FY2A 2UW8A 5A46A 4R78A 3IS5A 2ZDUA 3OHTA 5B2MA 5AIKA 4RVMA 5EM5A 5FG8A 4U7ZA 3UOLA 1Z9XA 5EW9A 4DBXA 2QD9A 4F64A 4UMPA 3KC3A 3O51A 4U0IA 5I9UA 4E4MA 3W33A 5IQDA 3ZEPA 3R9NA 3W32A 1YWRA 2PMIA 3JVRA 4ZSJA 3VUIA 2DUVA 4J98A 4DFNA 1RE8A 3KRWA 1VYZA 4C4IA 4MK0A 1ZLTA 4DBNA 2WQOA 3ZO1A 4O2PA 3R7VA 4G5PA 3ERKA 3RAKA 3DJ5A 2EVAA 3OVVA 5HEZA 3RPVA 4BFMA 4JG7A 5GIPE 3EFWA 4QMTA 3ORNA 4ZY5A 4X3JA 4Z9LA 3FUPA 4U43A 4QYHA 5EM7A 4BZDA 5AWMA 4I41A 3NW6A 2WQEA 5JGAA 5AP7A 4OT6A 1RW8A 4R3PA 4U9AA 1YKRA 3FSFA 5CVHA 2C5OA 4FR4A 5ANGA 5AEPA 3D15A 3QHWA 3BWFA 4N57A 3PG1A 5JGBA 5FP5A 4FTCA 3R9OA 2GNFA 4C38A 3DK6A 5LVNA 5CEIA 2OXDA 2X39A 4WT6A 3O23A 5A4LA 3TV7A 3BYUA 4B9DA 5AMNA 3KMMA 4RZVA 1PXOA 5LCKA 1NVSA 4A4OA 4OAUC 5KKRC 3ZOSA 3GCQA 2J7TA 5K5NA 3AC2A 4PF4A 4NKSA 4D5HA 4O7VA 1OPLA 5IQFA 4LV5A 4HYUA 3DDPA 5ANKA 4A9YA 4YSJA 1YRPA 4NIFA 1Y57A 4LOOA 3UPZA 3LCDA 2VD5A 4YZMA 4Z55A 4S2ZA 4JS8A 3LFAA 2YM6A 3LMHA 4BDBA 4RVLA 1GNGA 1PMEA 2PVRA 4GCJA 4N6YA 5HLPA 3V8TA 2CNVA 4I3ZA 1RJBA 5H9BA 4RT7A 2W1CA 5C03A 5DBXA 5FTOA 5A9UA 4KKEA 5BQ0A 2P3GX 1Q5KA 3H9OA 4DEBA 4AZTA 1UA2A 2GNHA 1MRVA 5DH3A 3V6RA 2O64A 2OO8X 4FZFB 4XV1A 3WILA 5J5SA 5LOHA 4O6EA 1YHWA 3I7BA 4PRJA 4GIHA 1WAKA 4HPTE 2QHNA 5AP1A 5C9CA 1UU9A 4GV1A 3EIDA 3W2PA 2VWUA 3EJ1A 5DEWA 4HNFA 2WPAA 5E7RA 3SD0A 4D2SA 2CGWA 3VJOA 4YO4A 5CI6A 4Y83A 4XCUA 5J9YA 3ZLYA 2VTTA 4G1WA 2F4JA 4TNDA 4Y8DA 4DFBA 3U51A 3KFAA 5IEVA 2OI4X 3RK5A 4MNFA 4AGWA 4F7SA 5CF4A 4DITA 1UWJA 5FEQA 4TNBA 3ORIA 4HVGA 2CN5A 4II5A 1J91A 4BHNA 4GK4A 4RWIA 2C6LA 2QOFA 3CXWA 5M53A 4DGLC 3W2SA 1ZAOA 2YCQA 4FIIA 5HICA 2C69A 4XJ0A 4QMYA 4NKAA 2XK4A 2P33A 3L8SA 4DGOA 3R9RA 3KK9A 4HJOA 3R30A 2XKFA 2WMAA 4IVCA 3UGCA 1G5SA 5E8ZA 3FPQA 1H27A 3R04A 4IX4A 1UV5A 4FKTA 2CGUA 4BCFA 1P4OA 2XH5A 2JDOA 4O82A 2BRHA 3QTZA 1GOLA 4C61A 3ZTXA 3P7CA 4N0SA 4YMJA 2W1EA 3LLAA 3TEIA 1ZRZA 2EXMA 4DEHA 2ERZE 5BNJA 4QMOA 1P5EA 4UX9A 3EN6A 4OTRA 2PVFA 2CJMA 5IA3A 2OF2A 2PE0A 1OZ1A 4LGHA 4XRJA 4F0GA 3D4QA 3VS0A 3ZDIA 4JDKA 5JZJA 3GFEA 3MH1A 2VWWA 3VRYA 1KE6A 3E93A 5HO7A 3TM0A 4F9WA 5AUVA 1CKJA 2XNMA 3F3VA 4D1SA 4EOPA 3TKUA 2UZVA 5HCZA 2W1DA 3DLSA 3MY0A 4FUXA 5FLFA 2WTIA 3C5UA 3HP5A 3MPMA 4HOKA 1Q3DA 3K2LA 3MFSA 3G2FA 2WO6A 3PUPA 4PPCA 4AA4A 4C35A 2X6DA 2GMXA 3UVQA 3WBLA 5E9EA 4IB5A 1KWPA 3WZUA 5B2LA 3E7OA 3GCSA 3KU2A 2AUHA 2CNQA 4FL2A 2FH9A 4QMPA 4HVSA 2YM7A 4RIYA 5LMBA 3FJQE 1XBCA 2CGVA 5FWKK 2IVTA 3DA6A 3OOGA 4EOMA 1E9HA 3OXZA 4KSQA 4CZTA 4DE4A 4U45A 3UOHA 3C7QA 3GUBA 5HD7A 4DF3A 5FM2A 2GCDA 3W55A 3BV3A 4RJ5A 1W7HA 5FXQA 4ANBA 2C5YA 4ZY4A 4TY1A 5HO8A 4KIPA 3FL4A 2PZIA 4CD0A 2VTSA 2O8YA 4FKGA 4GSBA 2QR8A 4ZTQA 3HDMA 3CBLA 3R71A 1Q62A 3Q52A 4J8MA 4FSNA 4OLIA 4FTRA 4MD9E 5D7AA 5AR3A 2YERA 4HPUE 1ZARA 2X7FA 4S30A 3VAPA 5E92A 2G2IA 3H0YA 4FE2A 3R9HA 1P4FA 3GGFA 4NM7A 1WCCA 4CGAA 3CQEA 3V5JA 3CJFA 1YDTE 4CZUA 5IUGA 2QO2A 1FMOE 2YCSA 3GCPA 3OXTA 4UZHA 4XOYA 3RAHA 4RX7A 4OGRA 4BTJA 1CM8A 4M7IA 4ZJIA 4EZ7A 4GKIA 5FBNC 4G34A 5E91A 3IOKA 3DB8A 3OWJA 4FZAB 4KRDA 4M12A 4V0GA 3DT1A 2HELA 4NSTA 5ETIA 3VHKA 5AR4A 4FKJA 4M84A 4RLLA 4M69B 4ZTMA 3G5DA 3DLZA 4BDFA 3ROCA 4JLCA 3RPRA 1IG1A 4AN9A 4FC0A 1YI3A 3ORLA 3VO3A 3DZQA 1G3NA 4Y72A 1PXJA 3HZTA 3LXNA 2R2PA 3IPHA 3GVUA 3H10A 3U87A 5LVMA 3O96A 3FY0A 2ZM1A 4E6QA 5T3QA 1TQPA 2JDSA 2JIIA 4TYJA 1SNUA 5KZIA 3RK7A 4R77A 1ZOEA 4IQ6A 2W5BA 3JS2A 2OJIA 5EHOA 5AFVA 3O7LD 4PMTA 4C2WA 3QGYA 4J53A 2X8DA 4QYGA 5DEYA 5IQIA 3VS5A 4YPDA 3MFRA 5EYMA 1UU8A 5A6OA 5CI7A 5CXZA 5HLNA 5ACKA 3LCKA 3FQHA 5IA4A 4UMUA 4QYYA 3HV4A 4B6LA 2YCRA 2VTJA 2FUMA 4Q9ZA 2FYSA 4PQNA 3V5QA 4MXYA 3NRMA 3ZUVA 4D4RA 2YM5A 3R8UA 3R01A 4GW8A 5L2WA 1H0WA 2YJSA 1OUYA 2ZVAA 3R8MA 3CD3A 3TL8A 3LJ1A 1REKA 3Q2MA 4FKRA 4Y95A 5CAVA 1FBNA 3DJ7A 4LRKA 4J96A 3FBVA 4IJ9A 4AP7A 4FG8A 4GYGA 3HNGA 3LJ2A 1NVQA 5AIRA 5AAEA 5DT4A 3LXLA 4GU9A 2W4KA 5D11A 3DKFA 1MUOA 2XIKA 3ORTA 2JBPA 3SG9A 1ATPE 3PP0A 3QQJA 5K9IA 3DBFA 1UNLA 2ZYBA 2WTKB 3OXIA 1YHSA 2GS7A 4R7IA 3FLYA 4BTKA 2I7QA 4YJVA 4CG8A 5IQEA 2C6MA 4FTUA 4LMUA 4IC7A 1WVXA 3KXHA 4BYIA 3PPJA 3UIXA 4E7WA 4CYJA 5CQWA 2VGPA 1PY5A 4JRNA 3VHEA 4V05A 4Q2AA 4PMMA 4X21A 1UKHA 4BGGA 1SVHA 4BL1A 4EOSA 3OCGA 1YXVA 2BILB 4JNWA 3VUDA 4RC3A 3QWKA 4EKLA 5AV2A 4DLIA 4GYIA 4QQ5A 4IWDA 3ENMA 2ITNA 4PNKA 3ZZWA 5LMKC 4RX8A 5HHWA 4QP1A 4M13A 5CEPA 2OIQA 5IQAA 4P5ZA 3TXOA 4ZTHA 5L2SA 2Y6MA 3H9RA 2CCIA 5IDNA 4YHFA 3QWJA 4QQTA 3D2IA 3KULB 3R8PA 4QMSA 4E93A 4GKHA 4CTCA 2HZ4A 3WZDA 2IVUA 1XH6A 3F7ZA 3CPCA 3Q32A 4IVDA 4PNIA 3R7IA 2UZBA 1JKLA 1PXKA 4ZTNA 3FLSA 5L2IA 3NUNA 3UIUA 5LWNA 1LR4A 4DTBA 4YHJA 2XA4A 4R5SA 4EQCA 3F9NA 2IVVA 4HNIA 3HV7A 3RM6A 3SOCA 3EYGA 3V51A 4PDPA 3AT4A 4E73A 2J5FA 2VRXA 2W9ZB 3BEAA 4B99A 2OIBA 1W84A 2ZMDA 4FZ7A 3DY7A 1ZYCA 2EUFB 4YJTA 3RWQA 1S9JA 4RJ7A 3EFKA 4DFLA 4DEEA 4F6SA 5GJDA 1OIRA 5ICPA 3F88A 5BUIA 2EU9A 4F09A 5E8XA 5IH5A 4WHZA 3DBCA 3EQHA 4YUQA 5CANA 4D2PA 3FLNC 4O0XA 3M11A 5ETAA 4BIBA 3ZCLA 4E20A 3IONA 5HX8A 4O0YA 4X2JA 5HO6A 5BMMA 4FYNA 3AXWA 5EQYA 4PTEA 5AADA 3SGCA 3G33A 4C3FA 3I6UA 4IB3A 4EK8A 3O71A 2PVKA 2Y4IC 2PMNX 5J5TA 3AGLA 5LVOA 3NUAA 4O7TA 2IW6A 4CYIA 2OG8A 3CP9A 1V0BA 3R9DA 3Q4CA 3IQ7A 4QMWA 4W8EA 4UBAA 5DHJA 4ZEGA 4K77A 2BFYA 5HORA 4O1OA 3G6HA 3DFAA 5A4EA 3R2BA 5HCYA 4QNYA 3FLZA 1ZZ2A 3DPKA 3TZ7A 4DFZE 3TWJA 3AQVA 1WVYA 5CQUA 3BE9A 3OCTA 4DH5A 3DJ6A 3GC8A 2XJ2A 3E62A 3O8UA 3P79A 4L68A 4NM0A 3OC1A 4DT8A 3NMUF 3LFSA 2XS0A 1GIJA 4C4EA 2XCHA 2RSVA 3IO7A 3ZLXA 4BTMA 2PVHA 3C13A 3K5UA 3QA0A 4IFCA 2OXYA 3U8WA 4ASDA 1PXMA 3QZHA 4JDHA 5KCVA 4U81A 1M2PA 3G0FA 3RP9A 4ZLZA 4XG2A 4KAOA 4IM2A 5KBQA 5IQHA 4EH3A 5BVOA 2JITA 1YHVA 1M7QA 2XVDA 3NUPA 1M52A 3QTXA 4FTTA 3TNQB 4O1PA 3K3JA 1U5RA 4AOTA 1CKIA 3BGZA 4PL3A 3CC6A 3V04A 5EDPA 4BDIA 3GU4A 4F9YA 4BGHA 2WMTA 4UALA 4RVTA 4YLJA 1XO2B 2AYPA 2G9XA 1BL7A 2O65A 3SC1A 2EB2A 4BCJA 4N4SA 3VVHA 2CPKE 4K8AA 4C4JA 1K2PA 4EL9A 3O8PA 5I3RA 4A9SA 4UYAA 4D2RA 5DR6A 2G2HA 4G2FA 4CV8A 4CFXA 3LJ0A 1RQQA 1H8FA 2VWBA 2JKQA 1BI7A 4P2KA 4ACGA 4KIOA 4M0ZA 4O7NA 4R6VA 4DFUA 5D7VA 1ZOHA 3ALNA 4GT5A 4ZTLA 5GJFA 3EQIA 5L8KA 2GTMA 1FMKA 1JSVA 3ZH8A 3CTQA 3GCUA 4O81A 4JOAA 2J50A 3MI9A 3OY1A 4RBLA 3QTWA 4QP6A 4IIRA 4ZS0A 3PFQA 4L9IA 4EH8A 2VV9A 4J1RA 4JDJA 5F95A 5CZHA 4Z7GA 4NYEA 4G3GA 4AZSA 3TN8A 1Q99A 4RG0A 4ZLYA 2JEDA 5BVNA 2QVSE 3QZFA 4Y73A 5L2QA 3TTIA 4EC9A 5DGZA 4CKIA 1JKSA 4MNEB 5CZIA 5T6KA 3UC4A 2OJGA 3ORXA 2OZOA 4MXXA 3GI3A 2AC5A 4E5AX 1ZXEA 4QOXA 4AN2A 4KKGA 3EL8A 4C4GA 2RF9A 5JFXA 4GEOA 1B39A 2JDTA 4L01A 4FVPA 3A8XA 3CTJA 5C26A 5KUPA 3LMIA 4P90A 5D41A 2W0JA 4RIYB 5IG1A 3KEXA 3PY0A 4FK6A 2J4ZA 5L6WL 4RX9A 4HCVA 3DKGA 3BRBA 4ANSA 1ZMVA 2OFUA 4FT5A 4U42A 5LMAA 1Q4LA 1SM2A 3I6WA 4XG3A 3AOXA 2OLCA 4JJRA 3F3WA 2R3RA 3FSKA 3COKA 3GXLA 3QC9A 3PP1A 4JBPA 4XP3A 2FGIA 2YITA 3MA6A 4U41A 4RIWB 3FWQA 3BQRA 3QCSA 4ZJVA 3A7IA 5GINE 5I0BA 1T45A 1CDKA 4BDKA 2W1FA 3QRTA 5LVPA 1OKVA 4L43A 5LQFA 2XCKA 3A7FA 3R63A 1XH9A 5J9LA 3RHKA 5E4HA 1H4LA 3D14A 2BRMA 4UYNA 1IEPA 5HKMA 4ARKA 5KHWA 4TWNA 4EONA 2B53A 4FIFA 4YJNA 5JSMA 2CN8A 1DM2A 4HYIA 3I79A 3KKVA 2UW7A 3P23A 4HVIA 1OM1A 2ONLA 2CKEA 4Z16A 2XF0A 3FI8A 4FTAA 5J79A 5HNIX 4W8DA 5IQGA 3L8XA 2I6LA 2OJJA 3LAUA 4FKIA 5CSHA 2A0CX 3OMVA 5DOSA 3UIBA 4BBEA 5I9WA 4GK3A 2NPQA 3ETAA 3RNIA 4CCUA 5AV3A 1Q8TA 3HMMA 4DH7A 3KRJA 4ACCA 5H2UA 4NU1A 5M4FA 1QL6A 1UKIA 3O8TA 4FEVA 3C4XA 3UIMA 2W9FB 5D9HA 1Y6BA 5AUUA 3UNKA 1KUTA 4QNAA 5EHLA 3UJGA 4D4VA 4NFMA 1WBSA 3W1FA 4F63A 1ND4A 5AM7A 3QQHA 2IW9A 4EWQA 2GNLA 3WF8A 2BZIB 3QQFA 4ZXTA 2BKZA 2WD1A 4AF3A 2ZV9A 2RL5A 2YEXA 4L67A 3MVMA 1LEWA 3ZDUA 3BYVA 4TN6A 5M4CA 3VBQA 3B8RA 2YACA 3SG8A 1STCE 4E26A 3U54A 3QFVA 4W4XA 3A4OX 3QD3A 3IG7A 2YHVA 4I6FA 3T8OA 5HTBA 4LOPA 2R3NA 2W05A 3HGKA 3SA0A 4AX8A 1PXIA 4QPMA 1PF8A 2XM8A 3LFDA 2HW7A 3UTOA 4OBPA 3ZYAA 2BAJA 2VTOA 4YGAA 4E6DA 2W1IA 4LOQA 1YWVA 3D2KA 4JIAA 3QKMA 5I9YA 3F5GA 4F1MA 3IDBA 4JQ7A 4ALVA 2YIQA 3NCGA 1WZYA 2VWIA 4FYOA 4ZSEA 3QU0A 4AN3A 4PPAA 3RZBA 4J99A 1L8TA 3EN7A 2XEYA 4EOIA 2PUIA 3COMA 2GFCA 3GC0A 5DR9A 5DMZA 3ZM4A 1P2AA 5CXHA 1ZMWA 2GHLA 3MA3A 5BYLA 4FV6A 3KB7A 4H1JA 5M57A 2OZAA 2QONA 1FINA 3KRRA 4UB7A 3MV5A 3QC4A 4M14A 5H8EA 3PJ8A 5FBOA 4UMTA 4DTAA 2B7AA 3CLYA 4NK9A 3ZUUA 2FB8A 3WI6A 3ZHPC 2BCJA 2EXEA 1U54B 2HZNA 2FVDA 3KA0A 4WOVA 5HOAA 4HVHA 5JGDA 3EKKA 1PHKA 4IZ5A 4L46A 2XIRA 1I44A 1NVRA 3DK3A 3KN5A 4FTKA 1YVJA 3P9JA 4GH2A 3TIZA 2QOOA 5CAPA 4WRSA 3D7ZA 3PSBA 3Q53A 4FSZA 1Q41A 3I0OA 4OTDA 4BZOA 3NLBA 4AE9A 5JN2A 5I5ZA 3NPCA 2WMSA 2V22A 2YM8A 2R64A 3QRKA 4HGSA 4PY1A 2UZTA 4NW6A 4TWCA 4QMNA 3WF9A 2Y0AA 4NCTC 4EZ5A 3IGGA 3LFQA 4CFFA 1O6YA 2XK8A 2PU8A 3DNEA 3EZVA 3F6XA 4EKKA 4C4HA 4WIHA 5HQ0A 2V5QA 2OJFE 2PUNA 2XRWA 2BZKB 3KREA 1LP4A 3IK3A 4BWPA 3GEQA 4TWOA 2W1GA 4QMVA 1JNKA 4QMLA 2ZMCA 5L8JA 3R8VA 4FZ6A 3FMLA 4KA3A 5TKDA 3TIYA 3KF7A 2YISA 3L8PA 3FC1X 3PIYA 1GIHA 4I5CA 4MQ1A 3NIEA 4AQCA 5I9VA 4QD6A 4ZZOA 5IH4A 4W9WA 5JFSA 3GFWA 4FTOA 4KNBA 2C47A 1U59A 3ZO3A 1NXKA 4ID7A 4O27B 3GQLA 2PMLX 4KS8A 2WMRA 2RIOA 3QF9A 4APPA 1H01A 4ZIMA 3E8EA 4FI1A 3FMMA 4EUUA 5IPJA 1G8AA 4YR8A 4ACHA 5CAUA 1ZYLA 3C1XA 4CVAA 4KINA 1JWHA 3K5VA 5BVKA 2YM3A 1YXTA 2UUEA 4GVAA 4JRVA 4A9RA 2V7OA 3KMWA 5AUZA 4FA2A 5EYKA 1H28A 1GZOA 4D28A 5E1SA 1H26A 3ZBFA 1V0OA 4PX6A 4KIKB 4QMUA 4BRXA 3OT8A 3Q9WA 5EDRA 2LGCA 5HBJA 5EM6A 1QCFA 1ZYDA 1JQHA 3P1AA 4MVFA 3F5UA 3Q60A 2VTMA 3BHVA 3DOGA 3QYZA 5CTPA 2HCKA 2OGVA 4BDAA 4BI1A 1H25A 4ZZMA 5FRIA 2BZHB 4NUSA 3PG3A 3VF8A 5CSXA 3W2QA 4DEIA 5KZ0A 4RA4A 4EH2A 3UNJA 4EZ3A 3E7VA 1PMVA 2XB7A 3CTHA 3HMPA 4DH1A 2YZLA 5K4JA 4XX9A 3Q3BA 4ZOGA 4USDA 4XV2A 4JG6A 1T46A 4Y5QA 1R78A 4PP7A 2UZUE 3P0MA 4MBJA 4E3CA 1OVEA 3OBGA 4O7RA 2H6DA 4I5PA 4C33A 4ACDA 4ITHA 5DI1A 4IDVA 3EN5A 3G0EA 4AT3A 4BC6A 2BROA 4OTFA 3LW0A 5EW8A 4E5WA 2B0QA 4DCAA 1PXNA 2BAQA 4TWPA 4TT7A 1OKZA 1ZMUA 2HYYA 1BLXA 1DAWA 4I0TA 4QP9A 2BAKA 5E8VA 4DINA 4QTCA 4IE9A 4O6LA 5G6VA 4FBXA 2W99B 4QMQA 3MN3A 3R22A 3AC8A 1TQIA 4BDEA 1H1SA 1PYXA 2WOUA 3ZO2A 4AACA 3N9XA 4EOLA 2R3MA 3AGMA 4S32A 2WU6A 4K11A 1OL2A 3M42A 4BB4A 2WTKC 4GL9A 5I9XA 2XIYA 3CQUA 4KUJA 5IMEA 2R3QA 4I0RA 2P55A 4BI2A 4BF2A 4ENXA 1URCA 4XYFA 3COHA 2F7XE 3E3BX 5AR7A 5HE3A 5TF9A 3SHEA 4NW5A 4D0WA 3P7BA 3EZRA 3QZIA 2ITVA 2J2IB 3ORKA 2YZAA 3TUDA 1XH7A 3CJGA 4NCTA 2ZM3A 3JXWA 3WE4A 2PVJA 1WBTA 1U5QA 4DG3E 1ERKA 1JSUA 2E2BA 1E1VA 3GOPA 3ZZEA 4CKRA 5D1JA 4QTEA 3EN4A 4APCA 2CKQA 4BWKA 4FKWA 1R39A 1W0XC 2QCSA 3PY3A 4ERKA 3OEFX 2C6TA 2JAMA 2UZOA 2GNJA 3MTFA 3QUDA 4IZAA 4GG5A 2X2MA 4JAJA 3E8DA 4D58A 5JKGA 4GT4A 5M09A 2PVYA 2E9OA 3PIXA 4KB8A 4TYGA 4DAWA 3TV6A 2ESMA 5M55A 3U6JA 2GSFA 2I0VA 3BHHA 4RJ6A 3RTPA 4WA9A 5K5XA 3VBTA 1FVTA 4G5JA 4O38A 1WBOA 1Q8WA 4R8QA 4C4FA 3QX2A 5E8SA 3EYHA 2WQNA 2C6OA 3HA8A 1R0PA 3KF4A 4PV0A 4QP8A 3K54A 3HMIA 3PJ1A 4QT1A 3ID6C 5DT0A 3A7GA 3NNWA 5FTGA 2VUWA 3BYOA 2YDKA 3PJCA 5K0XA 3TI1A 5J1VA 4IACA 2XBAA 4FSQA 3ZC5A 3EMGA 3ZONA 3NWWA 2R3GA 2JBOA 2YWPA 1J1CA 3JY0A 3S2PA 3PIZA 4YLKA 3LCTA 5FD2A 3IW4A 1A9UA 2XIZA 3A7HA 2WTCA 2HK5A 4BICA 2QLQA 4YC6A 3HL7A 4I0SA 4EH6A 4HYHA 2OH4A 5HE1A 4FSWA 4ANMA 2P2HA 4NTSA 4G17A 3RKBA 3HAVA 4D2TA 4GUEA 2UV2A 3V5LA 4KSPA 2YAKA 3RPOA 3GU5A 4HZSA 2YIXA 2R3HA 4MH7A 3UODA 5LARA 3BX5A 3Q96A 4R7HA 3N4TA 5CEKA 1H1PA 4LUEA 3CE3A 2V7AA 4O7WA 4RX5A 4YZDA 4LYNA 2UZWE 4FV7A 3QX4A 4EH9A 3KCKA 2V0DA 2XMYA 4FUYA 5CALA 1A06A 4MWIA 3WZKA 4G3FA 3FKNA 5HIBA 4USEA 2JGZA 1M2QA 3ORZA 3BPRA 5L4QA 3SOAA 2ITYA 4IH8A 2YDIA 2O63A 4AGCA 4GJ2A
chains in the Genus database with same CATH superfamily
3E8NA 3PDTA 3ZSIA 3AMAA 4MEDA 4FSMA 1OKYA 4ITIA 4B8MA 5IA0A 1BKXA 2R3IA 3NYXA 2J0IA 1YQJA 2QKWB 2PVNA 1OBDA 3UG2A 3A8WA 4XS2A 3L9NA 4RWLA 2BIYA 1CSNA 4BDJA 4DEGA 5JH6A 2PULA 4JMQA 2HAKA 4FICA 2P0CA 4JXFA 2XAMA 4MHAA 4U44A 4FEQA 4BKJA 4CCBA 2VWZA 5M4IA 4JDIA 5HVYA 4HGLA 2EXCX 4U97A 3F61A 3TJDA 4O0SA 3NCZA 3BELA 2I0YA 3QRUA 2QO7A 4O0TA 3TNPC 4X2GA 3FHRA 3OS3A 2Q83A 4UMRA 3PSCA 3CCNA 3GU7A 4I5MA 3V3VA 2QU5A 5BVEA 4RGJA 4CEGA 4RIXA 5JEBA 4ZS4A 5KMNA 1YOJA 2W4OA 2I40A 2ZV2A 1H07A 3IW5A 3R00A 4WNOA 2W1HA 5DFPA 3I4BA 2WEVA 5KMKA 3A2CA 4FOCA 4N70A 1UVRA 5CNNA 4XHKB 3LQ5A 3R1SA 4MX9A 5EI2A 3F3ZA 5CVGA 2ACXA 4XG8A 4XP2A 5EK7A 2E9UA 2BIKB 3C0IA 3QZGA 4JAIA 5DPVA 1OBGA 3CD8A 3IECA 2WGJA 5AR5A 1TVOA 5CT0A 4MF0A 3W0SA 3DV3A 3NAYA 1LUFA 2GHMA 3FHIA 2X9FA 3ACJA 5CASA 3SQQA 2R7BA 1XR1A 1PKGA 4YURA 2WOTA 3TDVA 2BDFA 2VU3A 3PJ3A 4GJ3A 5BPYA 3PA4A 3HX4A 3NUUA 4X0MA 1OIQA 2OIDA 3QUPA 5CSWA 4ZP5A 3ZFYA 3PLAE 4G6NA 2VAGA 4ZTSA 4NJ3A 4UV0A 3SLSA 5M44A 3HLLA 3KK8A 4YJSA 3ZFMA 3VF9A 4AAAA 3WE8A 2XJ1A 4U5JA 4O7ZA 3C4FA 4U3ZA 4F9AA 2IWIA 5IEXA 3EQCA 4AZWA 2PE1A 3VUGA 4LRMA 3LLTA 3Q5IA 4LGDA 4IDTA 4BCQA 1NW1A 4DT9A 4XG4A 4WNKA 3C9WA 4ANQA 4ANNA 3MPAA 3PY1A 1PXLA 5EKNA 3N4UA 2ITXA 5CY3A 4DGMA 1YDRE 2X4ZA 1V1KA 4ZK5A 1JLUE 3VULA 3ORPA 4J97A 4EBVA 5IEYA 2QG7A 3JVSA 3KXXA 5ACBC 5FQDC 3SKCA 4DHJA 1M7NA 3CPBA 3FKOA 3UZTA 5D10A 3G6GA 3DFCB 4CV9A 3AMBA 4EHVA 5EW3A 4K9YA 3CS9A 1MRUA 4KWPA 3PE2A 4D4YA 3VBXA 2C68A 5LJJA 4YC8A 1UNGA 3RK9A 3NUYA 2ZOQA 2QOLA 4XG9A 2W1ZA 4G6LA 5A4CA 5FM3A 4DEAA 1QPJA 4RJ4A 3RZFA 5DRDA 5KMJA 4M15A 3KY2A 5EI8A 3UMWA 3NGAA 5CWZA 4XOZA 5ANEA 5HTIA 3FYKX 5HBEA 4QYEA 2R0UA 3BE2A 3Q6UA 4CXAA 3BYMA 3LQ8A 5JZNA 4CMUA 2YA9A 4BIEA 2WFYA 1S9IA 3ODZX 1J7LA 3NUXA 5D12A 4IMYA 5FEEA 2ITUA 4Z3VA 4C3PA 3OEZA 3SV0A 4AW0A 4K33A 5HD4A 3V5TA 4K1BA 5JQ8A 3LHJA 2RFSA 4LFIA 5AAGA 3FI4A 2VX1A 3F69A 3BI6A 2PHKA 3PXKA 2C6DA 2J0KA 5HX6A 3HDNA 3HMNA 4WSYA 3VS7A 4HVDA 3QGWA 4U40A 2OXXA 4PDOA 2C6EA 2ITOA 3CQWA 2JIVA 3PRIA 1HCKA 1OPJA 3I1AA 3NEWA 4TTHB 3RJCA 2NP8A 4X3FB 3CSVA 2HIWA 5HIDA 3Q2JA 4R7BA 3OWPA 3ZLWA 1HOWA 2QOIA 4NM5A 4YNOA 4RQVA 4M0YA 2PVLA 3IDPA 4G9RA 5DT3A 3PVWA 5IH6A 3QRIA 3KVXA 2YIWA 5EOLA 4U79A 4O0RA 4NWMA 4O86A 3AC1A 4CZYB 4F08A 1RDQE 4WNMA 1Y91A 2RFDA 4W4WA 2YFXA 5HG9A 3R0TA 4AWIA 3R6XA 4BYJA 5IA2A 4JQ8A 2Q0BA 3E5AA 3QYWA 3ET7A 3OF0A 4F78A 2H96A 3MVHA 4K6ZA 4TZRA 3PRFA 4CKJA 3SXRA 4JQEA 3LIJA 3Q4ZA 5HCXA 4FV2A 2VTQA 5GNKA 3G9LX 3LCSA 5BMSA 2O2UA 4QMXA 1VJYA 3FQEA 3I60A 3LM5A 3TYKA 2IZRA 4LL0A 3MH2A 1OIYA 3OP5A 4IB1A 3ZRLA 3ULZA 3W0PA 4I24A 4FSRA 2WEIA 4QQJA 2V62A 2VZ6A 2JFLA 4XLVA 3RWPA 4M67A 5IKWA 1ZOGA 2A27A 4D1XA 1CMKE 3LXKA 4UZDA 3R7EA 3P4KA 3FMDA 4FV9A 4XBUA 4L3LA 2BRBA 4GMYA 4DEDA 3CGFA 5GZ8A 4DFXE 5K0KA 3NNUA 2IVSA 4AGUA 5IISA 4JBQA 5M51A 3WYXA 4O4EA 3LPBA 4L3JA 3W2CA 3UVPA 3D7TA 4WKQA 3R83A 1KV2A 3UMXA 1E1XA 4ZSLA 2WMQA 4QP7A 4HGTA 4P7EA 3FZPA 2QOQA 3BGQA 5AA8A 3FPMA 2X2KA 4C3RA 2GU8A 4TYIA 4M97A 1FVRA 2WMVA 3V8WA 4BVUA 3FI2A 4FVRA 3EH9A 3HEGA 4OTHA 4TPTA 4CLIA 2VTNA 4CTBA 3R21A 3EQFA 3FC2A 5JMSA 2Y6OA 3NVKI 1OGUA 4MQ2A 4XNEA 3DU8A 3EB0A 3QHRA 4YNEA 5DLSA 3C51A 3ZXTA 4QP4A 5FDXA 3TKHA 2WTDA 2PUUA 4MXOA 4UXLA 1XMMA 4WBBB 4AOJA 4RJ3A 5HVKA 4HZRA 3AT2A 3BKBA 3FL5A 3NW5A 2G1TA 2X6EA 4FT9A 4AQKA 2XNGA 5E90A 1KE5A 4PPBA 4FTMA 1J7IA 3RALA 3CEKA 3F2AA 4IM0A 3GCVA 4OR5A 4IB0A 1KE8A 2VO7A 4QO9A 2B55A 4E6AA 3II5A 4XUFA 3C0HA 4AT5A 3D0EA 4AXAA 3KULA 3ITZA 2F7EE 2UZNA 2X9EA 4UMQA 5L6PA 3B2WA 1BX6A 4L52A 4AZFA 3GBZA 1UWHA 2WU7A 3OTVA 3AD5A 3DGKA 4JG8A 5E8YA 2VTIA 5AUXA 3P7AA 4FIEA 4EQUA 4XP0A 3UBDA 1H24A 1PMNA 4DC2A 4FKPA 3D7TB 2OK1A 4ALWA 2E9NA 2H8HA 3GQIA 5FGKA 3VRZA 3ZSGA 5KHXA 1O6KA 4D1ZA 5LCJA 3GP0A 2YAAA 2C3LA 5C1QB 4IAZA 4Q5HA 3ZXZA 3H9FA 5DR2A 4UWYA 2J0MB 3F7WA 4A9UA 3EWHA 1ZYSA 3W0QA 2JKOA 4NEUA 2LAVA 3FEGA 4NM3A 3IGOA 4HGEA 3JR1A 4ZSGA 3P78A 2ETRA 3AC4A 4OTPA 2ONLC 2JKKA 4RMZA 4AW5A 3FI3A 3MWUA 4I20A 4OTQA 4YSMA 2JFMA 2CCHA 4FODA 4H39A 1TQMA 2BFXA 2IN6A 2Y8OA 5DE2A 4C02A 1H1RA 4WBOA 4ENYA 1OMWA 2V55A 4JR3A 3TZMA 4KBAA 1G8SA 4AXFA 5C01A 3QCYA 3BWJA 5AAFA 4C59A 4RFYA 2Z2WA 2G01A 3CY2A 3ZC6A 2W4JA 5A54A 2BHEA 4YHTA 2X1NA 2R4BA 4AUAA 2WMBA 3QUEA 2RKUA 4CQGA 5C27A 2WQMA 5AA9A 4O84A 4F1OA 4PMSA 3RI1A 4L8MA 3HRCA 4PP9A 2YWVA 4FNXA 5JK3A 3DCVA 3VS1A 1GZKA 4WUAA 3QQGA 3KL8A 4ALUA 2BTRA 2QR7A 4JIKA 4YZBA 2B9HA 4YO6A 4EJ7A 4V01A 4C34A 3PVUA 5HNGA 3IW7A 4MBIA 3PXZA 3POZA 5B2KA 2BDWA 1NT2A 3MBLA 3TKIA 3W18A 2NRYA 5FUTA 4BWXA 3U9NA 2J6MA 5H8BA 1P14A 3UQCA 2FSLX 3QCXA 4ZSAA 3QD4A 3VJNA 3ALOA 1BUHA 2REIA 3RPSA 2PTKA 4O22A 3FXWA 3VS3A 3DXPA 3L8VA 2GS2A 2R7IA 4CFMA 3UPXA 1QPDA 4TL0A 5TE0A 5AP0A 2ZV7A 5IA5A 1AD5A 4F0IA 3H4JA 2F49A 3NSZA 5IDPA 4I93A 3E92A 4NTTA 4A9TA 2BMCA 2PY3A 2Y4PA 2ZB0A 4D0XA 3QLGA 4L7SA 2GNIA 2ZV8A 2R9SA 3MDYA 2F2UA 4RFMA 4WG4A 3WYYA 4DGGA 4FOBA 5BX0A 1IAJA 1VR2A 4CG9A 2BRNA 3B8QA 4RC4A 3QKLA 2FO0A 1J7UA 4I6HA 4O4BB 1YW2A 3G90X 3EQGA 4XG6A 5HG8A 5BVWA 2JLDA 5CF5A 3BIZA 4DA5A 1WBNA 4TYEA 1Q8YA 3NUSA 4E1ZA 4NZWB 3QTQA 3DTCA 2OSCA 4E4LA 3NYOA 4XEYA 4BDHA 2YJRA 1SZMA 3QQLA 4RIOA 3BU6A 5J87A 3RNYA 2A1AB 2DWBA 3COIA 3UP2A 3B2TA 2OWBA 3FLQA 5AX3A 2J0LA 3R7UA 4AA5A 3O50A 1PYEA 3Q04A 4O7SA 1R0EA 2XNEA 5DNRA 4BGQA 3P5KA 4EYMA 3V01A 3U55A 1H08A 1QMZA 4IM3A 2E9VA 1A48A 4I94A 3ZRKA 5AJQA 5LMKA 4RIXB 4ITJA 4PDYA 4YJOA 1IA8A 4YC3A 1UU7A 5C4KA 3PXRA 4RWJA 5HESA 5CU3A 5CEQA 4X3FC 4EC8A 3DTWA 2ZJWA 4RA5A 5ETFA 4ACMA 3ZU7A 4EOJA 5LXMA 3WZEA 4OTWA 4C37A 4L42A 5CVFA 5CF8A 2QG5A 3S4QA 5BVFA 2JD5A 2XNNA 4EBWA 2QOCA 2CLXA 2J9MA 1Q8UA 5J7HA 3TACA 5K4IA 1AQ1A 1TKIA 3FZ1A 3F3UA 3UOJA 3VS4A 3LM0A 4H3PA 3C0GA 5HGIA 2B54A 2PE2A 3UO4A 3ZSHA 2XAOA 5KMMA 3EFLA 1JVPP 3E3PA 4L7FA 2H34A 4DH3A 3ZM9A 5KKRB 3A61A 4MD7E 3DAJA 3RMFA 4BN1A 1CKPA 2BVAA 4QQCA 5IUHA 3RVGA 3BYSA 3PXQA 1F3MC 1WMKA 3ZFXA 4DDIA 2ZAZA 3DQXA 3MIAA 4FTLA 1W82A 3KCFA 3HYHA 2ETKA 2J90A 3OG7A 5EM8A 4CFWA 1SMHA 1YOLA 2C1AA 2JDRA 2VX0A 2VTHA 2WTJA 3MH0A 5AP6A 3SW4A 3VBYA 4CRSA 1MP8A 4FKLA 4IEBA 3OUKA 3T9IA 3S1HA 4FF8A 3PUFC 2XKEA 3T9TA 3JYAA 2J51A 5BVDA 4RQKA 4FVQA 4FKQA 4BDDA 5AP4A 2Z60A 5EH0A 3PTGA 5FP6A 2VGOA 2IF8A 1WVWA 3DAKA 5I9ZA 4BDCA 3LFBA 2G15A 2F2CB 5AP3A 4E4NA 4MYGA 5CU2A 2HZ0A 4JR7A 5EQPA 3LVPA 3PE1A 1OKWA 5DN3A 1APME 4IX6A 1QPEA 1YXXA 4F1TA 4JT3A 1UU3A 1DI9A 3MGYA 2ETMA 4MXZA 4X6RA 4EORA 4ERWA 2VX3A 4F4PA 4L6QA 2BRGA 4FV3A 3G51A 1BL6A 1VZOA 2WMUA 2ZM4A 3MPTA 2ITTA 2XARA 4D4SA 3UP7A 3DAEA 3D5VA 3H30A 4FSUA 2XM9A 2WIPA 4FNYA 4WO5A 4BIDA 3MVLA 4RLKA 3PVBA 4CFNA 1BMKA 5CU4A 5M4UA 1O6LA 3FQSA 4O96A 2YCFA 4FIHA 3DS6A 5DRBA 2VWYA 4IAAA 4KKHA 5J95A 3SXFA 2PVMA 4GFMA 5FEDA 5IF1A 4BY9E 2XALA 1Q61A 3CR0A 4WUNA 5KO1A 1DS5A 1XBAA 2GNGA 3NYNA 5AUYA 3ZLSA 4CFUA 2BR1A 3KVWA 3LOKA 3DBQA 4KRCA 5AP5A 3TCPA 1EH4A 3L9PA 4RWKA 3ATTA 4D2WA 5EDQA 3UOKA 5CNOA 2QU6A 1OIUA 2ZB1A 3GU8A 3MFUA 3R28A 4PWNA 3REPA 3I81A 3ORMA 3NNVA 3RCDA 3PA5A 4JBVA 4YTHA 4EK6A 3V6SA 2ITZA 2C5NA 5L6OA 4GK2A 2DS1A 4I22A 4A4XA 4PL5A 4IWQA 4JVGA 2NO3A 2Z7SA 3BCEA 4ASZA 3QTRA 1XHAA 1FVVA 3MTLA 5I4NA 4X3FA 4G31A 1V0PA 1VLRA 2OH0E 4KBKA 1XH4A 2W17A 4L3PA 4AW2A 4FNWA 5KMIA 5M07A 3F2NA 3W8LA 4R3CA 2WTVA 2RG6A 3TDWA 5A3XA 2W96B 3FZRA 2XKDA 4FK3A 3C4EA 2I0EA 4S31A 4RRVA 2VNYA 4LQMA 2UW9A 3G9NA 5FXRA 3DBDA 3QD0A 3VWAA 2XJ0A 1L3RE 4YJUA 5TO8A 5EI6A 4FG7A 5CU6A 3DXQA 5KBRA 3SX9A 3RINA 5ANOA 2CMWA 2HENA 2RG5A 2HOGA 5GZAA 2B52A 3HV5A 1M17A 4DGNA 3HAMA 4MCVA 4QPAA 1JSTA 1KV1A 3LKMA 3ZMMA 4FV8A 1YWNA 5CF6A 3TNHA 4AU8A 4QPSA 2B9IA 4GU6A 3MS9A 1K3AA 3SAYA 4IXPA 5DWRA 3NIZA 3ZUTA 3FXXA 4H36A 4J7BA 5IU2A 4YJPA 4IC8A 4B0GA 2VTLA 3AD4A 4EOQA 2EWAA 2R3KA 2QOKA 3Q6WA 2C0TA 1LEZA 2AC3A 3IW8A 1AGWA 2GTNA 3V5PA 3WARA 4D5KA 1ST0A 3POOA 1W2CA 1H1WA 2C3IB 1VEBA 2R0IA 3OTUA 3QCQA 4IJPA 4I5HA 4YBJA 2W5HA 3OW4A 1W83A 1WBVA 3KN6A 3QL8A 1YXUA 4A7CA 2Y9QA 4N6ZA 2QOBA 1PXPA 4FKOA 4JX3A 3EQDA 1ST4A 4O0WA 4IFGA 4CNHA 5HTCA 3KXMA 2GQSA 3R8LA 2X7GA 3CKXA 3CY3A 4O83A 3QD2B 4O91A 3PXYA 4FZDB 3VW8A 4FNZA 4IHPA 2UZDA 4RSSA 1KOBA 2C4GA 5A4QA 3BLHA 3QKKA 5M06A 3EL7A 4K0YA 3HV3A 3UO6A 4C36A 4QEBA 5CSPA 3VUHA 4BTFA 3PYYA 1H1QA 5AV0A 1OB3A 2OBJA 4F65A 4MUQA 4R1YA 4E4XA 1Y8YA 2GDOA 4QTAA 2A19B 3NNXA 3ZS5A 2JC6A 3UYTA 2C30A 5HE0A 3VBVA 4UXQA 3A62A 5KMLA 4BBFA 4ZLOA 1FOTA 4OUCA 4O7LA 1YOMA 3IW6A 3BQCA 3E8CA 4G3DA 2BUJA 4TYHB 5ETCA 5TT7A 3S0OA 1Q3WA 4FV5A 3EQBA 3VW6A 5AR2A 3OFMA 3BHUA 3W0RA 4BKYA 3N51A 4Q9SA 1OL6A 1F0QA 3KXNA 3D94A 5AR8A 4AA0A 4FGBA 2XZSA 2CGXA 2QI8A 5CSVA 4NL0A 3NDMA 3U4UA 3R02A 4ZTRA 4A07A 3MESA 3RBWA 2UW3A 3QRJA 1SVEA 1XH5A 3NAXA 5JFWA 2XYUA 4X7QA 4H58A 4O21A 5F4NA 4NH1A 3LFEA 5E8TA 3E87A 5IMXA 1JBPE 3SDJA 3R2YA 2IO6A 4I6BA 3U6HA 3WZJA 4C58A 3MY1A 4WRGA 5GZ9A 3NW7A 2UW6A 2PUPA 4IANA 5CU0A 4C57A 4G16A 3JUHA 3R1YA 4Y85A 3DKOA 2OZAB 4U6RA 4I1ZA 3UC3A 4IAFA 3HKOA 4S33A 4L53A 2B4SB 3RPYA 4M8TA 4AGDA 4AS0A 4EEVA 2B9JA 4S34A 3BU3A 3L9MA 4ANOA 2OJ9A 3T3UA 5GJGA 4FX3A 3F82A 3MW1A 2UW5A 4FMQA 4FKUA 3KMUA 2X8IA 1J1BA 5AP2A 3ZRMA 5LWMA 2W06A 4LUDA 4QP3A 4TW9A 4JBOA 3TZ8A 4BR3A 3Q4TA 4MKCA 2NYAA 5JRSA 4WG3A 3P08A 3UDBA 2VWVA 4RJ8A 3F3TA 2ITWA 3ANRA 5EOBA 4D2VA 2ZDTA 4F9CA 3W10A 3I5NA 4BCMA 4O2ZA 4AOIA 4OAVB 1YDSE 4HCTA 4J52A 3HRBA 5JFVA 3VUMA 5AUWA 1W2FA 2OFVA 2I1MA 4BCNA 1LPUA 1O9UA 4FTJA 3V8SA 3R1QA 4I23A 2CKPA 3GT8A 5EHYA 3ZEWA 1URWA 2C6IA 4DFYA 2GQGA 4IADA 3VN9A 3GC7A 5IQBA 5H3QA 2Z7LA 2C5VA 4HYSA 2HWPA 1PJKA 3PWYA 4U80A 3OCBA 2HW6A 4FSTA 4ASEA 2OU7A 3C4WA 4X6QC 3Q5ZA 3VS6A 1HCLA 2X0GA 3BHYA 5AV1A 1WFCA 1XQZA 2XIXA 3HA6A 3BLRA 3OZ6A 3PXFA 3ODYX 4H3QA 3QLFA 3P86A 4YPSA 4JI9A 4ORKA 3MB7A 3FE3A 2IJMA 3FDNA 5I3OA 4HW7A 3BLQA 4I4EA 3ANQA 4L45A 4UEUA 3UNZA 3EOCA 2FSTX 3TTJA 4BHZA 2NNWB 3AG9A 2Y7JA 5EYDA 2CNUA 3BL7A 3SRVA 4RFZA 3C5IA 2R3PA 2OW3A 4LI5A 3VNTA 4FTQA 4YU2A 3ENHA 2YABA 2B9FA 3H3CA 3M1SA 3QAME 1W98A 4OBQA 2WNTA 4EOOA 2FA2A 3TZ9A 4I21A 4LG4A 3RGFA 4EQMA 2XBJA 4TXCA 5L2TA 4B7TA 3FMHA 2CDZA 3R7OA 4MBLA 1BYGA 3OOMA 4YZNA 4DTKA 1OECA 2P2IA 4O0VA 2R3LA 2PZ5A 2HZIA 4Y5HA 3NZ0A 4TRLA 4KS7A 2HY81 2QHMA 3L1SA 3KQ7A 3O17A 3OT3A 3NYVA 3QTIA 3BBTB 2QNJA 5CLPA 1CTPE 4R1VA 2IW8A 4MF1A 3TG1A 1MRYA 3QXOA 5AV4A 2WHBA 4D55A 2PPQA 1IRKA 4IAYA 4PTGA 5AUTA 5KX8A 4BKZA 3MVJA 5G1XA 4A4LA 3D5WA 3PZHA 3A60A 5J8IA 3DZOA 4FIGA 2DQ7X 2Q0NA 1YI6A 2IZUA 1FGKA 3I0QA 2CHLA 2YLFA 2JIUA 3NX8A 5J7BA 2QC6A 4G6OA 4V0GB 4X2FA 2PYWA 4FEUA 3VUTA 2CLQA 2FSOX 2JAVA 5AM6A 3PSDA 4PMPA 3BL9A 5IQCA 2XNOA 3UZRA 2YLEA 3E88A 2C3JA 3EHAA 3QXPA 3O0GA 4F7NA 4DG0E 2BTSA 3F5XA 4I92A 4OTGA 2A98A 3UYSA 1JOWB 3D9VA 5CEMA 1IA9A 3UDTA 4ZJJA 4QYFA 5EQEA 2F9GA 4FV4A 2BHHA 3BHTA 4KIKA 4QRCA 1MQ4A 2ITQA 3H0ZA 4Z7HA 1GZNA 4UWCA 4RPVA 3HVCA 2HWOA 2QQ7A 4AZEA 4BDGA 4FSYA 3UDSA 2QURA 3GC9A 4MAOA 4F70A 3OUNB 4TYHA 3BEGA 3SW7A 4D9UA 1IAHA 3TUBA 2WELA 4MXCA 3VQUA 2GQRA 3PZEA 3RAIA 3VIDA 2ERKA 4FT7A 4YJRA 4Q5EA 4EOKA 1FGIA 4WSQA 3OCSA 4USFA 4ZMFA 3FMKA 4OBOA 5J9ZA 3IDCA 1VYWA 3AKLA 3IOPA 4NIFB 3C4CA 4JX7A 4M69A 2YM4A 4IVAA 2FSMX 3WF7A 2QO9A 3D5XA 3IKAA 3GOKA 4CSVA 1ZWSA 2P4IA 4W4VA 4E5BA 4E8AA 3UE4A 1IR3A 3MJ2A 5K3YA 4IAIA 3TV4A 1NY3A 1PKDA 5BYZA 3TJCA 2PWLA 4IW0A 5HLWA 5HU3A 3LFNA 5TOZA 2F7ZE 1Q97A 1ZY5A 4C0TA 3PPZA 4GUBA 4DN5A 4E6CA 4EK4A 2PZYA 2C1BA 4CMOA 5CX9A 3LMGA 2OICA 3G15A 5BUEA 1I09A 2RFEA 4CT1A 5BV3A 2PSQA 2WTWA 4F7JA 1U54A 4IAKA 1U46A 3QA8A 4BCGA 3UZPA 4AFJA 2E9PA 4FRFA 1DI8A 3ZBXA 4BBMA 3SRVB 3KRLA 5LVLA 5T68A 3VUKA 4FTNA 3CKWA 2XK9A 3FYJX 5L3AA 5E8WA 4HCUA 3GNIB 4FV0A 3UVRA 2RFNA 3EKNA 4FKVA 2WB8A 2Z8CA 3CGOA 4AFEA 3R7GA 3FMJA 5KMOA 3ATSA 3PJ2A 4LV8A 2J0JA 2R3JA 5IUIA 3RHXA 2UVZA 2WQBA 3DDQA 3EQPA 3R7YA 4G9CA 4RIWA 2VO6A 2G2FA 5C8MA 4TKSA 4DYMA 1DAYA 3FLWA 3HUCA 2JKMA 3MYGA 4G3CA 4IZ7A 3MB6A 4GRBA 3R1NA 4FL3A 4J95A 4IVBA 5DIAA 3FZSA 4D9TA 4U3YA 5HBHA 2Y4IB 3WOWA 3LCOA 3MIYA 2Z02A 4GS6A 4WD5A 1GY3A 3KRXA 3SXSA 4C7TA 2WKMA 3HRFA 1JKTA 2VTPA 1QPCA 4UY9A 4ANLA 2GFSA 3N4VA 3Q9ZA 2X2LA 3K3IA 4H3BA 4DLJA 2O5KA 3MJ1A 4NFNA 4WG5A 3E64A 4FL1A 4H1MA 1M14A 3T3VA 2JDVA 2OKRA 3FV8A 2GHGA 1Z5MA 2H9VA 3DBEA 1MQBA 3Q4UA 1K9AA 5CAQA 3EFJA 3TT0A 1Z57A 2IZSA 4Y46A 3LFFA 4YZ9A 3I5ZA 3AKKA 3O7LB 2WXVA 4FEXA 4XMOA 1BI8A 2A2AA 2VWXA 2W7XA 3FZOA 5B7VA 5C8NA 1PMUA 4EI4A 3GB2A 4BJJA 2NRUA 3BGPA 1FPUA 2I0HA 2EB3A 2HY0A 2XP2A 3NS9A 4PTCA 4IX5A 4XG7A 4EUTA 5HZNA 4FT3A 3AMYA 2PL0A 5F94A 3TNIA 2CKOA 4CRLA 4YP8A 5TR6A 4CT2A 3E63A 2UW0A 3MSSA 1W8CA 4J71A 4F6WA 2XNBA 1H00A 3DXNA 3FKLA 4EH4A 3OY3A 4QTBA 3MH3A 5IZFA 4PL4A 3AD6A 3HV6A 3I7CA 2DYLA 2J5EA 4MTAA 4M68A 4R5YA 3LQ3A 2UZLA 5B0XA 2GS6A 5CEOA 2C5XA 2B1PA 4KBCA 3GU6A 1B38A 3HUBA 3OD6X 3BU5A 4FKSA 4QP2A 4QDEA 4BCOA 5KNJA 1XJDA 5HG7A 3DNDA 3WIGA 2WMXA 4BCIA 5EYCA 4FEWA 4AG8A 1M2RA 4EHGA 5E8UA 5H8GA 4EWHA 3ACKA 2ITPA 3LFCA 4V04A 5KE0A 3HECA 5JQ5A 2UW4A 1OL5A 4NJDA 3AT3A 4G3EA 3U9CA 3NFFB 2UVXA 3F2RA 5HE2A 3QTUA 1UNHA 4BCHA 2XEZA 1X8BA 1WBPA 3LXPA 3PA3A 1Q24A 2O3PA 5IA1A 1KOAA 4UWBA 1H0VA 4F99A 1KE7A 3S3IA 5EG3A 1B6CB 4AT4A 5EFQA 5JT2A 1OUKA 4O7YA 4F7LA 4W4YA 3OROA 3VQHA 2UZEA 2XRUA 4GFOA 3FXZA 4L44A 1OI9A 2X4FA 4RC2A 4PDSA 2YIYA 4LL5A 2F57A 2XK7A 4LMNA 2QLUA 4L00A 3D83A 4LGGA 4NT4A 4FIJA 5DVRA 3UG1A 2BKKA 3BV2A 1FQ1B 1TZDA 2WZJA 3A7JA 3LE6A 2YDJA 4EHZA 3KXGA 4BCKA 1R1WA 4M3QA 3ROYA 3C50A 2A4LA 1XBBA 2C0IA 1OPKA 3RAWA 5DYJA 1YXSA 3V5WA 4YZCA 4CLJA 1NA7A 1JPAA 3QALE 1JAMA 3QTSA 3U4WA 3W16A 5BYYA 4K18A 4XV3A 1REJA 2C3KA 3GENA 5DG5A 4X2NA 3JY9A 3F66A 3MFTA 2O0UA 4K2RA 4KABA 3BBWA 4W9XA 1WBWA 3UQGA 5AX9A 2WIHA 3W8QA 3W0OA 4KIQA 4C8BA 4YTIA 3ULIA 2UVYA 4AE6A 3C4ZA 3U6IA 3NR9A 4GT3A 4LM5A 5A6NA 3NFGB 4EK5A 1ZY4A 4QMZA 4H05A 1JKKA 3OW3A 3PWDA 3R8ZA 4OT5A 4F0FA 2IZTA 2QOHA 3HMOA 1F5QA 5HIEA 3EN9A 5ANDA 2XKCA