3DS6A

P38 complex with a phthalazine inhibitor
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
349
structure length
343
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Discovery of highly selective and potent p38 inhibitors based on a phthalazine scaffold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 104
structure length 343
sequence length 349
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ds6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ds6A01
4RJ5A 3TXOA 2ZDTA 5AR7A 2WHBA 3CKWA 5IKWA 3QUEA 3PTGA 5AV3A 1YDSE 5FUTA 4AN2A 5LMKC 2IZTA 2XZSA 3DKFA 3A4OX 2F7EE 1M7QA 2X4ZA 4PUZA 3CD3A 3S4QA 2FSOX 2PE1A 2E9OA 3NX8A 1Q99A 1Q8UA 2C6TA 2B9HA 4WBBB 2WTKC 4XMOA 3BYOA 5FEDA 3MJ1A 3R7GA 3UG2A 1ZAOA 3KRXA 3ZCLA 1U4DA 3UP7A 1NXKA 3NUSA 4JBPA 3POOA 2GNFA 4F6WA 3ZXZA 2J0IA 4DTBA 3HMOA 5DG5A 3A4PA 5I0BA 4W8DA 5BYLA 5KMKA 3UYSA 5CU4A 2ZYBA 3ALNA 1NW1A 4GG7A 2J5FA 1Q8TA 3UMXA 2CPKE 4RPVA 1J3HA 2BKZA 4IAFA 3HA8A 4JT3A 1YRPA 4F9BA 3LXLA 3GQIA 4R1VA 4YJSA 2ETKA 3BQCA 5AJQA 3OUNB 4EHEA 4EH4A 5A9UA 1WBOA 3DJ6A 3U6IA 1OBGA 1OIUA 3ZM4A 1VYWA 4DFLA 1CKPA 2NPQA 4YZNA 2JEDA 4F99A 1M7NA 2ZV8A 4FVQA 5B0XA 2C3KA 4I21A 4O0SA 4LGHA 2BTRA 3ORNA 4I5PA 4O96A 4J71A 4IDTA 1H00A 3ITZA 3C4FA 4C57A 3ZO3A 3A61A 1G3NA 3KMWA 4HW7A 1P5EA 4FNXA 3EFLA 4DGGA 3C4XA 4A9YA 3D7TA 5CAUA 2UZOA 3E92A 1SVGA 1OUKA 2BALA 2UZLA 4TY1A 4D0XA 4BCIA 1YOLA 3NAXA 4U97A 3Q2MA 1LP4A 2DUVA 2GNHA 3IPHA 2Z7QA 4HOKA 3D94A 3AD5A 3BHTA 4EH5A 1H1QA 1X8BA 2IVVA 3CKXA 4WBOA 4WO5A 4X2KA 3ZO1A 4F7SA 4N70A 4U80A 3ZMMA 4V01A 2W05A 2W1DA 4IB0A 4EH7A 3FL4A 5AV2A 4CFVA 5BQ0A 5C8KA 4M13A 2JBOA 2KULA 4N4SA 2C3LA 4RBLA 4TNBA 5L4QA 5CANA 4FTAA 5HTCA 3GGFA 4LOQA 3NW7A 4DFXE 4I20A 1YXXA 2BILB 4AN3A 3ZOSA 3FLYA 2GHGA 4QT1A 4KIOA 5CENA 3F3VA 4YO4A 2DS1A 2CMWA 4GFGA 4H39A 3FZ1A 1H0VA 3IW6A 4ONAA 5ANKA 4EOIA 3CGOA 3B2WA 4AA5A 2WNTA 1VYZA 3ETAA 4CFFA 4DITA 4E73A 2WQOA 4K33A 3D15A 3KVXA 5I3RA 4NM5A 4APPA 1PKDA 3COMA 3T3UA 3ZU7A 2PVMA 3FY2A 5H2UA 5IUGA 2VWWA 3R8ZA 4EORA 5CEOA 4I0SA 5EM6A 1WVWA 3IECA 3QRKA 3VQUA 5C26A 2YDIA 3LMHA 3TZ8A 5B2LA 4F0FA 3F61A 3DFCB 4F1TA 3VUGA 3SXSA 2QC6A 4QP2A 5JQ5A 4IZ7A 3O0GA 5CSHA 2HZ0A 5LJJA 4I5HA 1QCFA 5HLNA 5EYDA 4ZTHA 3DGKA 3DBEA 3P9JA 1O9UA 5ANJA 2H34A 3UDBA 4FNYA 3RGFA 2P2HA 3FZOA 5LQFA 4QMXA 5A14A 1ZOHA 5L8JA 4HVSA 2VTNA 2RFDA 4DEGA 3F5UA 4EOSA 4LUEA 3ORMA 4O1PA 3MI9A 4YGAA 3R7IA 1JKLA 1YWVA 4EUTA 1MRYA 3GCQA 4RJ4A 5LMBA 4NKAA 2OJ9A 4WRGA 2YM5A 3GP0A 5E8YA 3ZONA 2BIYA 4LI5A 3LMIA 4FTOA 4HCTA 2P55A 4DFNA 3NVMB 3I7BA 5I5ZA 2ZM1A 4GT5A 3ZZEA 3R8UA 4L00A 3GU6A 4L7FA 4PX6A 3NSZA 5ANDA 3VF9A 1L8TA 1J1CA 1REJA 3F7ZA 4G16A 4JG6A 4OBOA 4IB5A 4P4CA 5DWRA 4EC9A 4BGHA 2G15A 2JKQA 4F7LA 3ZRKA 4KIKB 3LQ5A 4KBCA 3KMUA 3MDYA 4E5WA 3EN6A 3DAJA 3W2OA 4JRNA 3C4WA 4XV3A 3SXRA 3VS1A 1G8AA 3MFUA 3SRVB 1VZOA 4K6ZA 4LV8A 4WUAA 4D9TA 5FGKA 3BWFA 2WQMA 3R01A 4RMZA 3RAHA 3V5PA 4AE6A 4C3RA 4RQKA 4YTCA 2PZPA 4FEWA 5IA4A 1BLXA 2J0LA 4G3DA 2Y4IB 3TEIA 5C8NA 3QA8A 2XEYA 4ZAUA 5AV4A 4RVLA 2VD5A 4RVTA 3CEKA 4FMQA 2CKOA 4TT7A 3PP0A 3C50A 3CR0A 3UPXA 4OAVB 3GU5A 4ZZOA 2W4KA 4DF3A 4C38A 4KIQA 2B4SB 4BKYA 3PSBA 4J96A 5K9IA 2F7ZE 2YM4A 4CXAA 5DYJA 3FYJX 2HZ4A 3H4JA 2Q83A 1OGUA 4ZS4A 4PDSA 4K9YA 3T3VA 3R04A 4EK8A 4CKRA 1JOWB 1NVQA 2ZV9A 3KN6A 4O0VA 2FSLX 2WXVA 2H6DA 3NDMA 5L2SA 4NT4A 2PZYA 2XJ2A 3FLSA 3V51A 4DH5A 3LFSA 4GCJA 1K3AA 2O65A 5AA8A 4NL0A 4O83A 1YWRA 2YJRA 4DEHA 3VS4A 2XF0A 3OW4A 3VS6A 3PP1A 5BMMA 3HAVA 4D1ZA 3I0OA 2BDWA 5IQEA 4A07A 3QRUA 2KTYA 3ODYX 2C4GA 2QURA 4D4RA 3PXFA 2CDZA 2QG5A 1YI4A 3ENMA 1F0QA 4FA2A 2XKCA 5EH0A 2I7QA 2QU5A 4GK4A 2YIQA 3ZUTA 3QHRA 4LGGA 2QOCA 4ZTRA 5L2WA 2JAVA 4QMQA 1E1XA 4FBXA 2WD1A 3P4KA 4MWIA 2VO3A 3EIDA 5A4EA 3GB2A 2UV2A 4F0IA 5ANIA 2OXDA 2V7AA 4KBAA 5E7RA 3EFKA 4FIGA 1XHAA 2XCKA 5FQDC 2WO6A 4J98A 4NH1A 5CS6A 2OSCA 2J50A 4FTLA 4IX6A 1LEWA 2BZIB 2ITTA 3II5A 5I4NA 5K0XA 3WF7A 2YDKA 4FE2A 4I4EA 4C0TA 2XIRA 4PMTA 2OKRA 2PVNA 2ZB1A 3G6GA 3PRIA 4FSZA 5GZ9A 3AC2A 4MBIA 2I0VA 1H1PA 2JD5A 3GI3A 3MH1A 5ACKA 4EBVA 2QU6A 1J7UA 3C9WA 3EH9A 3MFTA 1HCKA 4PF4A 5JKGA 3ET7A 3QTXA 1OITA 4IVAA 4O1OA 2IW8A 4YZ9A 2R3GA 4DGOA 1W98A 4DT9A 1UU9A 3OCGA 4Z3VA 4IJ9A 4F9CA 5IQIA 2Y6MA 3R22A 1SYKA 4BZNA 3QUDA 4JOAA 3MY0A 2NO3A 4U9AA 4UMQA 4I5MA 5EM7A 3GC0A 3W1FA 2PUNA 3MPMA 4I3ZA 3ZSHA 4IB3A 3M11A 3TN8A 3V8SA 3WZUA 3R1YA 1NY3A 4RLKA 3U54A 2GQGA 3I81A 3IGOA 1OL2A 1U5RA 1JWHA 2R3OA 5ACBC 4CSVA 5KUPA 3Q9WA 3TJDA 5LVOA 3EZVA 3PZHA 4NK9A 4BTMA 1ZOGA 3Q52A 4ZY5A 3HP5A 2WTWA 4XG3A 1GZNA 3DB6A 1OZ1A 1ZLTA 4FKUA 2C30A 5C8MA 4M8TA 4F1OA 4X0MA 4BDKA 3NAYA 4MBJA 3ZLSA 4FTJA 4A9UA 4KWPA 5EW8A 4FTUA 5H3QA 2OZAA 1OKVA 3NPCA 4RFZA 3N4UA 2ZMDA 3PPKA 2RL5A 2OGVA 4FKLA 4AZSA 3CSVA 1KV2A 3FI2A 4FV6A 3BLHA 2P0CA 4FYOA 5JFWA 5E9EA 5DEWA 3RTPA 1H8FA 1KE7A 5E91A 4CV9A 5L3AA 3O8TA 3DBQA 3MH0A 5BVOA 3NR9A 4FSUA 4A9RA 3L9MA 4L45A 3ZHPC 3NNVA 4HGLA 3QRJA 1SVEA 2YHVA 3R0TA 3C5UA 1RQQA 2XS0A 4FV0A 4PMMA 4XOYA 3O51A 4QMMA 2ZMCA 4JG7A 3UPZA 4RX8A 3LFEA 4NSTA 3SD0A 3HKOA 3FBVA 1YKRA 2WPAA 4CQEA 5HIBA 5I9VA 2JKOA 4IAKA 5CXZA 5E4HA 4X6RA 4XV1A 3GC9A 4CGAA 1TQIA 4RWLA 3UIXA 4USFA 2W1CA 2C6LA 1SZMA 2PVHA 3G5DA 3LCSA 5K0KA 5G6VA 2ZJWA 4L46A 1SMHA 1IA9A 4NCTC 5JFVA 4L3JA 3R8LA 4D58A 5J79A 3DXQA 2GNJA 1PYEA 3UNZA 5BYYA 5EOLA 3OY3A 4FTTA 4WA9A 4EQUA 2YCRA 4J1RA 4O6EA 4HZSA 5GHVA 5HIDA 3GU8A 4I0RA 3ZZWA 4FV4A 2B0QA 3DB8A 4RWIA 2XBAA 5IDNA 2PUPA 2C1BA 3QX2A 3CC6A 5CU6A 3VS5A 5FLFA 3V5TA 3CJFA 5K5XA 4Y8DA 4TL0A 5AM6A 4TWPA 4UWYA 2R2PA 2UZVA 3HMNA 4I0TA 4F70A 5C4LA 2Y7JA 5FWKK 4NU1A 1UV5A 4KKEA 4U0IA 4HVIA 2P4IA 4TW9A 5CQUA 2BRHA 3CXWA 2PUUA 4ALWA 3WF9A 5BYZA 2X9EA 5EW9A 5HVJA 4C33A 2FB8A 3SAYA 2PUIA 5CXHA 2XA4A 3LFBA 3FYKX 5GJFA 2BMCA 4B8LA 5AUZA 3BU3A 4I22A 1OI9A 3ZTXA 3NNWA 2XKFA 4L3LA 4O0RA 4OTPA 2PHKA 4S2ZA 2JFMA 4AT3A 4ZMEA 1PKGA 2JFLA 2QOFA 2WMUA 3QXOA 3KU2A 1QPJA 3OWKA 4IX3A 5KBQA 2HZIA 2GQRA 4DE4A 4OUCA 1Q24A 4M3QA 3VUDA 4IWOA 1CMKE 3IDBA 1OIRA 3I5ZA 4CT2A 4FKJA 4JQ8A 2OH0E 3RK7A 1W8CA 4EOJA 3NMUF 3SX9A 2FA2A 3BYVA 3KK9A 4X2GA 1UU7A 2OW3A 2B53A 3BZ3A 4QNAA 4YSMA 3PJCA 4O86A 4DEAA 3VW8A 5HLPA 4D4VA 2FVDA 2I0YA 3SG9A 3LE6A 4KAOA 4I6BA 5HTIA 3OEFX 4BWKA 3OXZA 3TTJA 4F09A 3O7LB 3CLYA 2B7AA 2NRYA 2RG5A 4Y95A 3BWJA 5EKOA 3HX4A 4CMTA 1FVVA 5M4CA 3G90X 2W1HA 3GFWA 2YN8A 3QRTA 4U40A 2GFCA 5ANEA 2JDSA 5JRSA 2W99B 2Z2WA 3A60A 1SM2A 4PDYA 2X8IA 3PPJA 2BRGA 4IQ6A 2J6MA 1PYXA 3BHUA 2HYYA 4MF1A 4CZUA 1KE8A 3NLBA 4K8AA 2BVAA 4BICA 4CNHA 2ETMA 3R7OA 3G9LX 4E4NA 1IEPA 1CKJA 2CGXA 4M97A 4V0GA 5CSPA 4M14A 3LCKA 3LFCA 4ZSAA 5IA0A 2BRNA 4CLIA 3G0FA 5E90A 2QONA 3MVMA 3NZ0A 5HG9A 2QD9A 3BHYA 3KXMA 4YZDA 4BIEA 4FL3A 4JBVA 4DFZE 2OJIA 4HJOA 4X7QA 4O0YA 2AYPA 4FKTA 2AC5A 4J97A 2C47A 2XVDA 1EH4A 3L8SA 2VGPA 2C5OA 4GYGA 4C62A 3K3IA 2XM9A 2XNNA 3NYVA 4KSPA 4AZVA 2IJMA 3EKNA 3OS3A 3TUCA 1YXVA 3BEGA 3UTOA 4QPAA 4BYIA 2OLCA 2VWYA 3D83A 3NUPA 2PWLA 2GS6A 3PG3A 4RSSA 3O23A 4H3BA 3ZFMA 1Q4LA 2QOHA 4I41A 2YWVA 4LUDA 4AX8A 2XNEA 5CAVA 2O8YA 4HYIA 3NS9A 2VWBA 4G3GA 4ZSJA 5TO8A 4NWMA 3RM6A 2EWAA 4CT1A 5GZAA 2V5QA 3SHEA 3TDVA 3Q4CA 4BFMA 4O22A 4DEDA 3VVHA 3VUKA 5HU9A 3HV4A 4I94A 4F63A 3PVBA 3QC9A 2X39A 3FHIA 4RT7A 3Q32A 4YP8A 5CY3A 3WZJA 2ZV7A 2ETRA 2QO2A 3QXPA 3MTFA 4L44A 4EOLA 5AM7A 5IISA 4CCBA 5IEVA 2VTMA 3VW6A 4DEIA 2OJGA 4MTAA 4TWNA 5DEYA 2YJSA 3THBA 4QQJA 2X9FA 3FMDA 3PXZA 4MYGA 4PV0A 4EONA 3QTRA 2YERA 2QOOA 5IA5A 4GIHA 3VBXA 3MIYA 4HZRA 3NW6A 3U9CA 3A62A 4CTCA 3PY1A 4YZBA 3ZH8A 3ZUUA 2A4LA 2VNWA 3HRFA 4KA3A 4DHFA 2WIPA 1LUFA 1Y6BA 3QD3A 4C2WA 4KBKA 3PA4A 4NCTA 5IA2A 3R63A 4WT6A 5DR6A 3AMYA 5IQHA 4XOZA 4RC2A 3EYHA 2X7OA 4KIPA 4B6LA 3UO4A 5IUHA 4ITJA 3DU8A 4YNEA 1KOAA 5DPVA 2QOQA 3UVPA 4BI1A 4DG0E 2GTNA 2C6KA 2O5KA 4X21A 1OMWA 4IB1A 5FP6A 2F2UA 3JPVA 3AC1A 4FZ6A 3ZLYA 2GTMA 3PWYA 3QCYA 1H07A 4M66A 2X81A 1UNGA 3VQHA 4NJ3A 3DZOA 4JDIA 4OTWA 5FEEA 4WNOA 2YIWA 2J9MA 4JL9A 2G9XA 2V22A 3W2PA 1Y91A 4UEUA 4LL5A 4EH2A 1WBNA 3MA6A 4IAYA 4MBLA 4E26A 3LOKA 4Z16A 1SNUA 3QYZA 1MP8A 2VNYA 4AOJA 3E64A 5K4IA 3SVVA 5BMSA 1IG1A 4D2TA 3UQGA 4O84A 3R83A 3NNUA 4IFGA 3CY2A 3PXYA 4XBUA 3QALE 4BCQA 4ZSGA 2R3RA 4JBOA 1G5SA 5I9YA 2XMYA 5BNJA 5J5TA 5J7HA 4PL3A 2RSVA 2EVAA 3EN4A 4XBRA 1MRUA 2XK3A 3DQWA 4DCEA 4HCUA 4Q5EA 3LXKA 4YMJA 2O2UA 3F3ZA 5KMOA 2IN6A 3AOXA 2ZOQA 4GIIA 1R39A 2UZTA 2XYNA 4GMYA 4RA4A 4YC6A 3TV6A 3T9TA 2C68A 5L8LA 5AUYA 1KV1A 4YU2A 4OBQA 1JKKA 5IQFA 5EG3A 5CEPA 5IQDA 3JY9A 1CKIA 3FI8A 4M15A 5CAQA 2WTIA 3AT4A 4P5QA 5T68A 4GT4A 3IS5A 3QQKA 3U51A 5EI2A 3W8QA 4X2JA 3V6RA 3QD2B 3W2RA 1LPUA 2G2IA 4OAUC 3W2CA 5KX8A 2PTKA 4RIOA 5EOBA 1YDTE 4Y5HA 5L2TA 4D2WA 4ALVA 3RINA 3GFEA 4RIWA 3S00A 3UP2A 4TYEA 1U54A 4R6VA 3DT1A 4M67A 3HMIA 4MXOA 2OK1A 5DLSA 4EUUA 5KCVA 3BGPA 3Q6WA 3QKMA 4FT0A 1S9JA 4D5KA 4NTTA 2XK7A 5KHXA 3LPBA 4IEBA 4ZY6A 4E4MA 2XJ0A 2C3JA 3ERKA 3DXPA 2XBJA 5JEBA 4O0UA 5HE0A 4N6YA 1Q8WA 3TM0A 4XP3A 1TKIA 1JAMA 3NW5A 3PXQA 5AR4A 2Z02A 4ZP5A 4CMUA 5JFXA 4YNOA 5KMIA 1XH6A 2AC3A 2I40A 4FK6A 5CTPA 3ZO2A 2UVXA 2FYSA 3NNXA 4AAAA 1YHVA 1XBAA 4PP9A 3B8RA 3JUHA 4D1XA 4O82A 3BRBA 4C36A 2OIBA 2VGOA 5E8SA 3MVJA 3CGFA 5D1JA 4ZLZA 3R8PA 3R8MA 4FSMA 4MX9A 3KGAA 5I3OA 4ANSA 4AT5A 4K11A 5C1QB 4AACA 4GU6A 4D4SA 3WE4A 2WTJA 4NFNA 3RNYA 3WILA 2ITNA 1PHKA 3U55A 4G9CA 4B7TA 3OXTA 2C69A 4BTKA 4AT4A 1WBWA 3MJ2A 3S3IA 2QG7A 2GCDA 3ULIA 5TOZA 3CTJA 4I24A 3F9NA 1HCLA 1V0PA 3AGLA 4YSJA 2PZRA 3U9NA 3VS3A 4UB7A 3VUMA 2F57A 4BZOA 2YEXA 4Y83A 3RI1A 4EHGA 3QQHA 3UNJA 5BVDA 4BL1A 5HX8A 3IKAA 1GAGA 4W8EA 2Y9QA 5HG7A 4EOOA 3F82A 3COHA 4IMYA 4TYJA 3GOKA 5J9LA 3TNPC 3M1SA 4J53A 3LMGA 1VEBA 5M56A 2W5AA 1QMZA 3PY3A 3HV6A 4QTDA 4WIHA 3VRZA 2BDJA 4W4WA 4CFUA 1BX6A 1XQZA 1REKA 3DOGA 3Q9YA 4JG8A 4LGDA 1BKXA 3L8VA 5KMLA 1PMNA 2BRMA 4QPMA 4E6AA 2VTJA 5CAOA 5HVKA 2WELA 4AZEA 4YBJA 2NP8A 4CYJA 5GIOE 2G2HA 3D5WA 3ZM9A 2CKEA 4D9UA 3VHEA 2A19B 3HEGA 1Y6AA 5B2MA 3ORIA 3JVRA 3HV7A 4FVPA 3E8DA 2Z7LA 2HW6A 4FV1A 3EOCA 5KE0A 4C4IA 4EH9A 3PLSA 1BI8A 4DFBA 1WAKA 3EQIA 1OPJA 2PE2A 3Q4TA 3Q60A 5EK7A 3VAPA 2QO9A 4NM3A 4F6UA 4ANLA 1H08A 2CCIA 2YIRA 5HX6A 3QWJA 4CKIA 5CT7A 3LLAA 5FXRA 3TG1A 3C51A 4YHFA 3VBTA 2YM3A 2YAAA 4O2ZA 4WD5A 4XV2A 3NVKI 5AV0A 5FXSA 3MW1A 3Q4UA 4H36A 3DAEA 2YACA 4J99A 2R3JA 4LOOA 2IO6A 3PA5A 3Q4ZA 4L6QA 3EQCA 4HGSA 4AZWA 5HBJA 4GSBA 2YA9A 3W55A 1OUYA 2WTDA 3AD4A 4X2FA 2XB7A 5HO7A 3QTQA 1BL7A 3PA3A 3HV5A 5JQ8A 1IAJA 2C6EA 3IO7A 3LQ8A 2V62A 2JDVA 2J0JA 3D7TB 4IX4A 4D4YA 5AP5A 4U41A 4AGWA 5CU0A 3LJ0A 5FM3A 3TNHA 4TXCA 5IH6A 5DT3A 3QRIA 3D2KA 5HI2A 3BELA 3OW3A 4ZK5A 3E63A 4DN5A 4IVBA 4DCAA 4FKPA 4KRCA 3ZC6A 4LMNA 5AP4A 3V01A 3NUXA 5EHLA 2NNWB 2REIA 3PIZA 3CPBA 3EL8A 2VTSA 5D41A 3OOGA 3FUPA 4M12A 2BHHA 2E2BA 4FV3A 3GENA 1IAHA 2IVTA 1UNLA 1OVEA 4XHKB 4YHTA 4BWPA 5ITAA 4MQ1A 5IPJA 5FTQA 5BUEA 2ITQA 3A7JA 4QO9A 4BHZA 2X8DA 4KSQA 3FPQA 4FT3A 1WVXA 1PXLA 4DBNA 3GU7A 4ZY4A 4ENXA 4H1MA 3QZIA 4ZJVA 2IW9A 3VUTA 5KZ0A 4CQGA 3DDPA 2XRWA 3BV3A 3P7AA 3K5VA 3P0MA 1BL6A 3POZA 3LM5A 4R5YA 4FV2A 4FT7A 2XNMA 3BQRA 2UW9A 4UY9A 4GJ2A 4UZHA 3CIKA 2YCFA 5J8IA 1MRVA 4L52A 5BVKA 4BCHA 2B54A 4FTKA 1ZZLA 5HGIA 1YVJA 4GK3A 5CEQA 4UMUA 4JR7A 3E8CA 2BZKB 2BZJA 2G2FA 1J7IA 3FXXA 5DE2A 3VWAA 1P2AA 3P5KA 2YCSA 3UYTA 4RGJA 5FBOA 3BEAA 3UJGA 4DH7A 4G5JA 4C7TA 4M68A 1ZRZA 4EKLA 4ORKA 5M09A 1OPKA 4RZVA 3RK5A 4UXLA 3N4VA 4MXZA 3OOMA 3KCKA 4H3QA 5DVRA 4DH1A 1A48A 2IPXA 3EN5A 3RM7A 3GVUA 3E3PA 5KKRC 1U59A 1SVHA 4OGRA 3UVRA 3FZTA 1PY5A 3P08A 4B4LA 2Z7SA 2OXXA 2HZNA 2W5HA 3I5NA 4KRDA 3UMWA 5F1ZA 1W83A 2UW7A 4QP6A 3RNIA 2C6IA 2V55A 3TT0A 4C4EA 3R71A 1YWNA 2YLFA 4P2KA 3GEQA 1FINA 3TUBA 3Q5ZA 3QWKA 4BCFA 2IZUA 4RQVA 4UMTA 4YBKA 2JLDA 4FIHA 1XR1A 3HDMA 4YHJA 5CEMA 5LMKA 3KULA 4BBEA 5DA3A 1KE6A 4JR3A 3CQUA 3HUCA 3VUHA 4ACGA 2W4OA 3LFFA 2WAJA 1Q62A 4LOPA 2WTCA 4UWBA 1RJBA 2P2IA 2YISA 4WKQA 3VO3A 2CGVA 4FIJA 4FZAB 4X3FC 5LVLA 1H27A 4PL5A 3HYHA 3BIZA 2UW3A 4FOCA 1PXMA 1LR4A 3R1QA 2WQNA 1ZMUA 3FMLA 1XH5A 4XX9A 2CJMA 4RJ6A 4EHZA 4W9XA 3ROCA 5JSMA 5LWMA 4TKSA 2Q0NA 4O7LA 2A0CX 3AMAA 2HXQA 2VO7A 4BDJA 4QP4A 2RFSA 1KOBA 4IVDA 2E9UA 3G9NA 4BDCA 3HMPA 5H8EA 3DK3A 5GIPE 3WARA 2QKRA 3KXGA 3BI6A 2VTAA 2H8HA 3NUUA 4UZDA 4D2RA 5A46A 3L9NA 5F4NA 2IZSA 5I9UA 1R0PA 4RFMA 4RWJA 2JAMA 1XJDA 3L8PA 3TTIA 3KULB 4QNYA 3E7OA 2QLQA 2BAQA 2UZBA 4M0ZA 4A4OA 5F95A 4KKGA 3JYAA 3R73A 1Y8GA 2JIIA 2UW4A 5HNBA 1KWPA 4NZWB 4LMUA 3OCSA 3OTVA 4GEOA 3KEXA 3KF7A 4DGMA 4O7WA 3LVPA 4MAOA 4XLIA 5A4QA 3DLSA 4TNDA 1GJOA 2YDJA 5EM8A 4CYIA 1OM1A 2BAKA 3EYGA 3EQPA 4J95A 2HW7A 1I09A 5HOAA 5L6PA 2UW6A 3KXNA 4YO6A 4QP3A 1JSVA 2RG6A 4LRMA 3WF5A 2XNBA 4JI9A 3DNEA 1WBSA 3LW0A 4R5SA 5AUXA 1ERKA 2GNGA 2F49A 2RKUA 3EFWA 3UGCA 4YJQA 3V8WA 5IMEA 5K5NA 4TYGA 3AMBA 2UVYA 5DOSA 3QKLA 2I6LA 1WVYA 3IDCA 3IOPA 5HG8A 3W18A 5J95A 3H0YA 3NRMA 4M69A 2UW8A 4G1WA 1Q3DA 4OR5A 5E8XA 5AP6A 1TQPA 3OT8A 2E9NA 4FKGA 3DQXA 3FLQA 5ETAA 2OF2A 4OTIA 2VRXA 4MKCA 4YC8A 4EK6A 3R7VA 1T46A 3ZRLA 3EN7A 4U42A 5L2IA 4F6SA 3TNWA 3MBLA 1PXPA 2ITYA 3ZYAA 3R9RA 1JSUA 5CU2A 4F9YA 4DFUA 2WMXA 3KB7A 2UW0A 4LQMA 4E4LA 4DG3E 3LQ3A 2ONLC 3MESA 3UIMA 2QHNA 3F2RA 3CTHA 4C34A 4FNWA 2J5EA 3PE2A 4XG4A 3ZUVA 2V7OA 3S0OA 2B1PA 4G34A 3DJ7A 5AR3A 3UQCA 1XWSA 3R9DA 1GOLA 4XP2A 4IE9A 3LJ1A 4KB8A 3PYYA 4IC7A 3BU5A 4JIAA 3K2LA 2ERZE 3VS7A 5LOHA 4C4GA 3ORXA 4NW6A 3ZSIA 3PJ2A 4BCOA 3E62A 3TZ9A 3Q5IA 4FSTA 4LRJA 5M07A 2LAVA 3BBWA 5FEQA 4BN1A 5HVYA 3KRRA 4B99A 4YJOA 3ANQA 3OBGA 4ZIMA 2YM7A 3BYUA 2OI4X 4Y5QA 4NUSA 5DRDA 3CY3A 2YZLA 5CSXA 3LM0A 3QBNA 3DPKA 3FQHA 3RKBA 5EW3A 4O0XA 2OBJA 5AFVA 4QMTA 1UA2A 3H9RA 3ORTA 3R2BA 2OJJA 3QA0A 3ULZA 4RIYA 2PVFA 5TKDA 4B0GA 4IZAA 3V04A 4A9TA 3D7ZA 4CTBA 4QMVA 3GC8A 3RAIA 4UMPA 2CHLA 4USEA 4AS0A 3ZS5A 5CF4A 1ZWSA 3U4UA 3TV4A 5LVPA 1QL6A 4KUJA 1UWJA 4MCVA 1XO2B 4FKRA 5CVHA 4AW1A 3JS2A 5L8KA 4R7BA 3R9NA 3GC7A 4KS8A 3NWWA 1OECA 4MNFA 1FGIA 4D1SA 3DAKA 1P4FA 2I0HA 3RK9A 4ASXA 1GZKA 2XK6A 1DI8A 2JKKA 3E3BX 3F88A 5CWZA 5ANGA 5AUWA 2OZAB 3FAAA 2PMLX 3O7LD 3GCPA 5ETCA 5HCXA 3QYWA 4IFCA 4A9SA 5FDPA 5HKMA 3JR1A 2OO8X 4MH7A 3ORPA 2I1MA 5ANOA 5M4UA 5C27A 3T8OA 4IACA 3PIXA 2R5TA 4EI4A 2WMRA 3V3VA 1Q3WA 1V1KA 2Q0BA 4TZRA 3FXZA 3WIGA 3DY7A 3F6XA 4Q2AA 5A3XA 3PLAE 5HORA 2ZDUA 3EQGA 4NFMA 5HE3A 2PVJA 2EXEA 4TN6A 4FC0A 5A54A 5CEIA 1YW2A 5F20A 5DI1A 1WBPA 3WE8A 3C0GA 3VRYA 5EI6A 3FEGA 3FC1X 3BHVA 4XG7A 5H9BA 5FDXA 4X3FA 4HNIA 3KVWA 5CI6A 2ESMA 3W2SA 2ZM4A 5FTGA 5I9XA 3FMNA 4W4VA 4ALUA 1AGWA 4FKQA 3PUPA 3CQWA 1CSNA 3NYNA 3C5IA 3VBYA 2FSMX 3VUIA 4CRSA 5BVFA 2OU7A 4GVJA 4CFMA 2GPHA 5C9CA 3COKA 2WMAA 3UOHA 2JDRA 4MXAA 2O63A 5M51A 2A1AB 4FR4A 4C3FA 3TACA 3EL7A 3FQEA 2PY3A 3AC8A 2JDOA 2IG7A 1RE8A 5M4IA 3C0HA 1M14A 4GFOA 3F5PA 3H9OA 3OY1A 4FGRA 3FLZA 5I9WA 4YPSA 1PXNA 3QQFA 3ZO4A 2PYWA 4L53A 3BCEA 2WMSA 1G8SA 4YJTA 2YM8A 4YJNA 1JBPE 3LZBA 4DYMA 5A4LA 3U6HA 5BVEA 5FP5A 3BLQA 4OTGA 3TJCA 2QR8A 4W9WA 2YAKA 2XIXA 5A4CA 3GCUA 3MGYA 4QMLA 3A2CA 4WNKA 1GY3A 4AFEA 4D0WA 5CI7A 3F3TA 4QMPA 4S30A 4ZJIA 4UN0C 1B39A 3I6UA 4R7HA 2ZM3A 4WG3A 4XYFA 3UODA 2GS2A 3KXZA 4G3FA 3UVQA 2QHMA 1ZYSA 4RA5A 2EXMA 1OL6A 2EU9A 2RGPA 4OW8A 5HU3A 4FI1A 4GFMA 1Z5MA 5AP2A 3FZPA 4EQCA 4FT5A 3LCOA 2R3LA 4FSYA 3O2MA 3TV7A 4EK4A 4MD8E 5DBXA 4ERWA 4H1JA 3D4QA 2HY81 3QCSA 5IDPA 4O7ZA 1ZY4A 3Q96A 2WZJA 5DFPA 4BDDA 4L42A 1ND4A 4GVAA 1GNGA 4CEGA 3W8LA 4EOQA 3LXPA 5LMAA 4FV7A 3PWDA 5A6OA 2BKKA 1OL5A 3QZFA 2VTRA 4FG7A 1H24A 2F9GA 3DK7A 3KRWA 2CN8A 4YC3A 2ACXA 3MB6A 4RIXA 2XH5A 3QQLA 3SDJA 1VJYA 3MY1A 5FBNC 3PPZA 2XK9A 4NIFA 2W9ZB 3RJCA 3ZFYA 4XRJA 4FVRA 1ZY5A 5E8VA 4YR8A 2HY0A 3QQJA 3EJ1A 2ONLA 2BROA 2HWOA 2PMOX 5LCKA 5BVNA 2W96B 3OUKA 2GFSA 4PMPA 5D10A 2VTOA 3TKUA 3KQ7A 3LLTA 2WIHA 2Z60A 4YLLA 3QHWA 3CS9A 3OROA 4QPSA 2WTVA 4EL9A 4LYNA 4I93A 4II5A 3UOLA 5CLPA 2CLQA 4FTNA 1WMKA 1MQBA 3DDQA 3MTLA 4FNZA 4Q9ZA 2WMVA 3FMEA 3VNTA 4C61A 4EBWA 4EYJA 3EZRA 3B2TA 4FZFB 3FHRA 3P7BA 4F65A 1UKIA 3QGWA 4MF0A 4BTJA 2CNQA 3KREA 4V0GB 2UW5A 2V0DA 1FQ1B 3ANRA 1R1WA 3KY2A 4JIKA 4DEEA 4GW8A 5BX0A 2EB2A 4JLCA 5AAEA 1W82A 2R3IA 3PJ8A 2BAJA 2NRUA 2YM6A 2Z8CA 4OTQA 2LGCA 2X6DA 3KC3A 4F9AA 2OFUA 3DZQA 4YTIA 2PL0A 4W4YA 4Z7GA 3DA6A 4MD7E 4IZYA 1OKWA 1IASA 4GU9A 5AIKA 3JXWA 2PVRA 3F2NA 4QTAA 4G2FA 1T45A 3OCTA 3S1HA 4LFIA 3NCZA 3K54A 4QTBA 3QD4A 4IXPA 5AMNA 5HBHA 4EWQA 2E9PA 4BY9E 4F1MA 3W10A 1YHSA 3NCGA 1CDKA 2ZVAA 4DG2E 3R1SA 4UYAA 2GNLA 2WMWA 4WNMA 5HNIX 2XIYA 2XKEA 3BU6A 4MWHA 2W1IA 3HA6A 4V04A 3FKOA 1BMKA 3L1SA 4BB4A 4C59A 2HIWA 2E9VA 3RCJA 3GCSA 3P23A 2W0JA 4U81A 3OEZA 4ZZNA 3VBQA 4B9DA 2VN9A 1XH9A 2QKWB 3IK3A 4JQ7A 4CD0A 1PF8A 3ROYA 2ITUA 4O2PA 3AT3A 1NT2A 5JT2A 1O6KA 5M44A 4FKWA 2JBPA 3R21A 4G17A 5TR6A 1BUHA 4D5HA 3ZBXA 2JKMA 3FJQE 4FTIA 4FTRA 4RG0A 3VIDA 2GQSA 4I6FA 2PZ5A 3WI6A 4R3CA 1O6YA 2FGIA 3NYOA 4J7BA 2DQ7X 2GDOA 2ITPA 3PG1A 5EYMA 5FD2A 2O64A 1L3RE 3BE2A 3FV8A 1WFCA 3QZGA 4ID7A 1Q97A 1DS5A 4GT3A 5F94A 2XCHA 4K1BA 5E8WA 1XH4A 3WZKA 2ITXA 2C5VA 4XP0A 4O7VA 1Z57A 1UU8A 3KMMA 4P90A 4LM5A 4AGUA 3EMGA 4ASZA 4BCJA 3QZHA 5EM5A 4W4XA 3UG1A 3MPAA 4IM3A 5IF1A 3U87A 2HK5A 3EN9A 4FUXA 3OBJA 4QMZA 3RHKA 4BIBA 4GH2A 5DHJA 3TUDA 3ACJA 4XG8A 3P1AA 2VZ6A 2CGWA 5DH3A 3A7HA 3OD6X 2GNIA 1Q5KA 4TYIA 3VF8A 4HGEA 4PPAA 5IU2A 1NVRA 4E7WA 3OG7A 1ZZ2A 4MD9E 3Q2JA 5CU3A 3KRLA 4IVCA 5IH4A 4O7TA 1W84A 5JFSA 2X8EA 3PXRA 4PDOA 3KXXA 3ORLA 3AQVA 4HYUA 2OXYA 3C7QA 4U3YA 4QQ5A 3R30A 5AP7A 1J91A 1XBBA 4PTGA 5CYIA 5GINE 3FMHA 4EKKA 1KE9A 3BV2A 4EHVA 2WOTA 3H10A 4U45A 3RPRA 4KINA 3I6WA 2PVKA 3E93A 4N6ZA 4IHPA 4QMYA 4RJ8A 4RVMA 4U79A 5IG1A 3UO5A 5LVNA 4AW5A 2VAGA 2XKDA 3ENHA 4C37A 3EQFA 3LAUA 4IH8A 4BBFA 3CCNA 4TYHA 2W4JA 5HQ0A 3R1NA 2VTTA 4C02A 4WRSA 3AC5A 2XUUA 3FZRA 3QTWA 5F9EA 2PVYA 2Y4IC 4O7SA 1UWHA 4CZYB 3IOKA 4I23A 1YXSA 3OWJA 4RZWA 1ZOEA 4PNIA 3HUBA 5JMSA 4S32A 4CG9A 4RFYA 1OB3A 2J7TA 2DYLA 3QLGA 4ZTMA 1YI3A 1H25A 4K18A 1K9AA 5HESA 3N9XA 1O6LA 2X4FA 4APCA 3SA0A 3O96A 4WUNA 4G6OA 1DI9A 4NJDA 4G6LA 2WQEA 4GS6A 1ATPE 4RIWB 3UC4A 3BYMA 5JGDA 3KK8A 4IBMA 1J1BA 1U54B 4CMOA 4XEYA 3MN3A 4XV9A 5GZ8A 3ZDIA 3U6JA 4AG8A 3SKCA 2RFNA 4ACHA 3UNKA 2OH4A 3H3CA 4NW5A 4PMSA 5JRQA 4TYHB 5BUJA 1OIYA 3BBTB 2FH9A 4ZOGA 4QYEA 4HVDA 5IUIA 2GHMA 4PWNA 2FSTX 2RFEA 4O7YA 2QR7A 4BGGA 4JDHA 3ZXTA 4Z9LA 3M42A 3NUNA 3D14A 5IEYA 3F66A 5CVFA 3OC1A 4X6QC 1H1WA 3A8WA 2XNOA 3FL5A 4BGQA 4ACDA 4TPTA 4KNBA 2F4JA 4AN9A 4E4XA 1V0BA 3LFQA 4G3EA 3I7CA 4PQNA 2BFYA 1JPAA 2G1TA 5M57A 2A27A 2C5XA 4MVFA 4QMNA 5E92A 5DN3A 4A4LA 3UZRA 5CNNA 4A7CA 3AT2A 3ZBFA 3AD6A 3OTUA 3OXIA 1BYGA 4JX3A 3HGKA 3TIZA 2EUFB 3F3UA 4XCUA 2HAKA 4QYFA 4BI0A 3S2PA 4PL4A 2HENA 3KCFA 2QOKA 3SW4A 2F2CB 3HRCA 4ITHA 4YJRA 4F0GA 4YPDA 4CV8A 4ZSEA 2WFYA 3FLWA 4UV0A 5EHOA 4CZTA 5TT7A 3W33A 4AA0A 4BDBA 2WMBA 3HVCA 4QTCA 2BCJA 4JS8A 3EKKA 3IW5A 4BDAA 1WCCA 4ZS0A 4F64A 4HYHA 2R3KA 5KBRA 2PVLA 4RC4A 4M7IA 3ODZX 4OLIA 3N4TA 2UZNA 4BDIA 4TTHB 3WOWA 4P5ZA 2VTQA 4BI2A 2CNUA 3UE4A 3F5GA 3MFRA 4EH3A 1QPCA 1Q8ZA 1QPEA 3L9LA 3IW7A 5M55A 2WMQA 1RDQE 5HEZA 5CZIA 3TL8A 3A7GA 4CG8A 2P33A 2XNGA 3KL8A 3MH2A 1XH7A 4BCMA 3R9OA 1DAYA 3MV5A 4AGDA 4RC3A 3C13A 1UNHA 2GSFA 4FYNA 2R3NA 4IDVA 4QQCA 4GJ3A 1UKHA 3SOAA 1TQMA 4I92A 3MSSA 4IW0A 3R2YA 1JKSA 4C58A 3LJ2A 5AP3A 1Y8YA 4OTDA 1GIIA 1XBCA 5JH6A 1PXKA 3CQEA 3UIBA 4OTFA 5AR8A 3Q9XA 3SQQA 3KN5A 2VTPA 5BPYA 4QYHA 2QI8A 3E8NA 4QP8A 5IA1A 4DA5A 3FE3A 4DINA 4E93A 4XUFA 3GUBA 1UU3A 1CM8A 5L6OA 3TNQB 4JAJA 2BRBA 2VX3A 4IM0A 2J0MB 1KE5A 4EZ5A 4N57A 4ZEGA 2W06A 3DBFA 3R28A 4QTEA 2XEZA 3MYGA 3D2IA 3NEWA 2WMTA 3JY0A 1OIQA 2QOLA 3PRFA 4QRCA 5EYKA 3FMKA 4ENYA 4ASEA 4C4JA 4P7EA 4DTKA 1JSTA 4QYGA 3WIKA 3BE9A 4YJPA 5AP1A 2WB8A 3OWLA 4ZZMA 1PXIA 3FI3A 3EWHA 4G31A 5ETFA 4PPCA 4ZTSA 4I4FA 2OICA 2ZV2A 3C0IA 4R7IA 4EJNA 3REPA 4DH8A 1FPUA 2YITA 4GK2A 3C4CA 3GBZA 4FODA 4S31A 4ZJJA 4AU8A 1H0WA 5FM2A 4G9RA 3I4BA 3HMMA 3BX5A 5AUTA 4U43A 4KIKA 4ANOA 5LARA 1U5QA 4FGBA 2X2LA 4AW0A 4EK5A 5HHWA 4IZ5A 3VS2A 4AZTA 2OIQA 3SRVA 2WOUA 4R78A 1SNXA 3MY5A 4L67A 4UYNA 3RWQA 3W2QA 4V05A 4IIRA 3C4EA 4R3RA 3LKMA 2W1FA 3P78A 2HOGA 4FKOA 2VO6A 4AF3A 4LRKA 3WBLA 3TNIA 4CFWA 5CALA 3CBLA 4FG9A 1W7HA 5EQPA 4ANNA 3ORZA 4R3PA 1VR2A 3NUYA 2OJFE 2R4BA 2YFXA 1URCA 3DKOA 3RZBA 5IQBA 3HV3A 3GCVA 4Z55A 4JAIA 2WEVA 4FIEA 4GRBA 5IA3A 4XH6A 3ZC5A 4F9WA 4QMWA 4A4XA 3W16A 4E3CA 5HCZA 3FKNA 4PP7A 4D2PA 5HZNA 2JDTA 5FXQA 2R7IA 3E8EA 1FVTA 5J7BA 4D28A 3QUPA 3V5WA 3SLSA 5G1XA 5D12A 3FZSA 4BDGA 1PRYA 2OIDA 2C6DA 2UZUE 3TWJA 2XP2A 3EQBA 4YZCA 3WZDA 4K77A 4ASDA 5J1WA 4EZ3A 5IZFA 5LCJA 1B6CB 3NIEA 2PPQA 2X7FA 3HRBA 5LWNA 5M4FA 4R77A 4GUBA 4ZLOA 4XG9A 3Q3BA 3F2AA 2RIOA 4EQMA 3G2FA 2JIVA 4HPUE 3KFAA 4J8MA 3QFVA 4TWCA 5D11A 4CVAA 2BUJA 5ICPA 3ID6C 3A99A 4NEUA 3FC2A 3G6HA 4PTEA 4QMUA 3NGAA 4IAZA 4WG4A 4CCUA 2QQ7A 1GZ8A 5E8UA 4QMOA 4NTSA 3KF4A 5GNKA 4UWCA 2HELA 4MEDA 4QP7A 4AQCA 4BIDA 2R0UA 4RLLA 2QLUA 3W32A 1B38A 3OHTA 1A06A 3LCTA 2BHEA 3FSFA 4FTCA 3QU0A 4ITIA 4EOPA 4FKIA 3R7UA 2J2IB 5E8ZA 4AZFA 3SOCA 4EWHA 4BYJA 4AP7A 5AV1A 3PVUA 4XG2A 4ARKA 2WTKB 3PJ3A 2BZHB 4IJPA 2VTLA 3F3WA 5KMNA 5JZNA 5ETIA 3MVHA 4BHNA 4HVHA 3E5AA 2J51A 4YURA 1AD5A 2Y8OA 3CP9A 1XH8A 1H4LA 3F5XA 4FSNA 4BDHA 3DXNA 3ZSGA 3VBVA 1CTPE 3DLZA 5CASA 2WQBA 4JX7A 4RX5A 4O7NA 4JXFA 1H1SA 4MQ2A 4WOVA 3LFNA 5LXMA 2BFXA 4JRVA 4B8MA 4NYEA 5T3QA 4G3CA 2J4ZA 5DR2A 4BCKA 2VUWA 4KABA 3R6XA 5CT0A 3UZPA 4GKHA 2P3GX 2GHLA 3O8PA 3R9HA 1ZYJA 5L2QA 4FV8A 2ZAZA 5I9ZA 3GNIB 3QLFA 2VV9A 3RCDA 4FV5A 3RP9A 3F7WA 3FXWA 3R7YA 1NVSA 1H28A 4L8MA 4CKJA 2Y4PA 3FPMA 5TF9A 4Z7HA 3QTIA 4BF2A 2JIUA 3TKIA 3ATTA 2OG8A 4YLJA 3V5JA 3SV0A 2JITA 4YTFA 3D0EA 2VWVA 3DTWA 4XRLA 2XJ1A 2WU6A 3P79A 3OVVA 3PJ1A 4G5PA 4KD1A 5CF8A 2R7BA 3LFDA 2B9IA 4EOKA 3MH3A 2HXLA 2CSNA 4UMRA 4HVGA 1YOJA 5EHYA 5FTOA 2W9FB 2ITWA 4I5CA 4FICA 3ZEPA 4A06A 4BR3A 4R1YA 4DTAA 2A2AA 4C2VA 2ITVA 4ANBA 2BR1A 2XK8A 3WYYA 3RAKA 3COIA 3QL8A 2W1EA 3G33A 4WNPA 5AX3A 2R3QA 3H30A 5CSWA 4EOMA 1ZMWA 3IDPA 2BDFA 1KUTA 5HTBA 1FBNA 2X2KA 5H8GA 2C6OA 4AE9A 5KNJA 4YUQA 2CKQA 1OKZA 3OF0A 4QP9A 4AOTA 3ATSA 3R00A 4USDA 4EYMA 4M69B 4I1ZA 3HDNA 4DC2A 2RF9A 3FDNA 3RZFA 3FQSA 3NIZA 4O81A 4ZSLA 3IW4A 4MXYA 3VJNA 3OT3A 1YXUA 4PDPA 5JGAA 3HAMA 3PXKA 4RJ7A 3IQ7A 2C5YA 3ZLXA 4ZMFA 2CN5A 4AGCA 3PZEA 3VS0A 4DH3A 3PY0A 2XK4A 1JLUE 4PRJA 3DBDA 5J87A 3TZ7A 2R3PA 3N51A 5DT4A 3FSKA 2FO0A 4S34A 1YI6A 1KSWA 3SC1A 4ZLYA 1H1RA 5DNRA 4CLJA 1V0OA 2R3HA 3TCPA 4FV9A 5E8TA 2ITZA 3BYSA 1TVOA 1F5QA 3CE3A 3DK6A 2B55A 2X6EA 3CD8A 4E1ZA 3R7EA 4JDKA 2F7XE 4WHZA 4YTHA 4FT9A 3RPSA 1Q61A 5FRIA 2GMXA 3C4ZA 3RAWA 3QC4A 3PVWA 1FVRA 2H96A 1PJKA 3GXLA 4GL9A 4FL2A 5CNOA 3LFAA 5CQWA 3IONA 5AUUA 3RPVA 5AWMA 2VTIA 4Y85A 3QTSA 4EC8A 2EB3A 3O50A 4OT5A 3L9PA 2PZIA 1OKYA 1M2PA 4O21A 2R64A 3HP2A 4WSQA 5AUVA 3RHXA 4BCGA 4EJ7A 4HGTA 3UBDA 3D5VA 1M52A 5HNGA 4CFXA 4XG6A 4U5JA 2VWZA 5D7VA 3WYXA 3GOPA 3BLRA 2YZAA 3D5XA 2QOIA 2XRUA 1YOMA 1H01A 5A6NA 5D7AA 1IRKA 2G01A 3LIJA 4GUEA 2YCQA 5E1EA 4RIYB 3IW8A 5H8BA 4QQTA 2O3PA 3PE1A 5EYCA 5IEXA 4IM2A 3CTQA 1ZYDA 4Y73A 4FEVA 2X2MA 4FZ7A 3QX4A 1Q8YA 3AC3A 1JKTA 3MS9A 4L43A 2HWPA 4L7SA 4ZTLA 4D2SA 2YIYA 2YIXA 3RMFA 5IMXA 2I0EA 4FG8A 4RWKA 3ALOA 4EH6A 4LL0A 2PK9A 1APME 3G51A 3R02A 5DR9A 4C4FA 5IQCA 3GU4A 3BGQA 5KKRB 4YJUA 4BCNA 2GU8A 2IWIA 4O38A 5C03A 5AADA 5CVGA 4O7RA 1Z9XA 1Y57A 3EQDA 1ZYCA 4IANA 3ACKA 4H3PA 1PMUA 3FI4A 3E7VA 4NM7A 4EZ7A 2UVZA 3Q04A 5EI8A 4BRXA 5J9ZA 2PE0A 2GS7A 5IH5A 4L3PA 4RX9A 3DBCA 3EHAA 3MA3A 5B2KA 1A9UA 4E8AA 3TZMA 1H26A 3DNDA 3DTCA 2VO0A 1YQJA 1J7LA 1ZYLA 5HICA 5IQGA 2XM8A 3HNGA 4ANMA 1ZMVA 1Q41A 2XIZA 2YWPA 3MPTA 1R3CA 5DRBA 3DJ5A 4M84A 2EXCX 5CEKA 4J52A 4HNFA 4XLVA 4IC8A 2C3IB 5AR5A 3WF6A 4FSWA 4BKJA 3MFSA 4X3FB 4E20A 3VBWA 5B7VA 4BCPA 1WZYA 3HZTA 1IA8A 2Z7RA 3ZRMA 2OFVA 4YJVA 4BVUA 2C0OA 4DFYA 1ZARA 4GG5A 4FSRA 4ANQA 3P86A 2C5NA 4IWPA 3A7IA 4PTCA 3CJGA 4OTHA 1WBTA 4BKZA 2CNVA 3KRJA 2R3FA 4EK3A 4PNKA 4FK3A 4NKSA 3EQHA 3RWPA 4EEVA 2WEIA 2JC6A 2PSQA 4TRLA 4R8QA 2WGJA 4JDJA 5AP0A 5EDRA 3RPOA 4OT6A 5HG5A 3U4WA 4AWIA 2AUHA 3ELJA 1GZOA 4FIFA 4ZXTA 3KXHA 5A4TA 1JQHA 3K5UA 2Y6OA 2X7GA 4I6HA 5AR2A 3UOJA 2WKMA 2IVUA 2QNJA 2SRCA 2QCSA 5DIAA 3QTUA 2CKPA 3OP5A 4BDFA 4JQEA 5BVWA 4XS2A 3FLNC 5HD7A 5KZIA 4U6RA 5EKNA 5D9HA 2C6MA 4MHAA 4Q5HA 2OZOA 3D5UA 3LXNA 1M2QA 2XIKA 4N0SA 4U7ZA 3DKGA 4L68A 3I0QA 3MB7A 2W1ZA 2VWIA 4FX3A 4X2NA 1M2RA 3I1AA 4Y72A 4AW2A 3TDWA 5GJDA 4XNEA 2DWBA 2W17A 2PULA 2YABA 4QOXA 4NM0A 3FKLA 5KO1A 3DFAA 3MVLA 2JGZA 2PMNX 4MNEA 3GQLA 3AG9A 4KS7A 3V5LA 3ZFXA 2QVSE 4FEXA 5LVMA 5M08A 4IAAA 4YLKA 2IVSA 3F69A 3PVGA 4S33A 1UVRA 2XNPA 3Q9ZA 5CX9A 3DS6A 5AEPA 4BZDA 4GV1A 5EDPA 2CLXA 2IW6A 3BHHA 5CF6A 4AOIA 4U8ZA 2UUEA 4UBAA 4UX9A 5CZHA 4DAWA 3OCBA 3EB0A 4ACCA 2O0UA 3QKKA 3UIUA 2WU7A 4L9IA 4RIXB 4FKSA 3QAME 2FUMA 3GT8A 1OL1A 4LV5A 4TWOA 4NIFB 2R0IA 3HECA 3A8XA 4K2RA 2BIKB 1MUOA 2J90A 2UZEA 4DEBA 1DAWA 5EFQA 4U44A 5CSVA 2OWBA 1OL7A 4IADA 3RPYA 4ERKA 3UOKA 5KHWA 3B8QA 3QF9A 3TKHA 4GKIA 3DCVA 4O0TA 4J8NA 5J9YA 1YXTA 1PMVA 4G6NA 4DLIA 4F4PA 4MNEB 4D55A 3LCDA 4F7JA 5AAGA 5EQYA 4FSQA 5DMZA 1BI7A 4WSYA 3QTZA 3QD0A 3RVGA 3P7CA 2CGUA 3U8WA 4Y46A 2W5BA 2R3MA 4FL1A 4FTQA 3O17A 4HCVA 3TI1A 4JNWA 4CRLA 3CPCA 4E5AX 2QOBA 1AQ1A 3C1XA 4PPBA 4BBMA 5IQAA 2R9SA 4MXCA 4CFNA 2OF4A 3HLLA 3UC3A 5JGBA 3TIYA 5AA9A 4H58A 3DV3A 3QCXA 3UZTA 3OFMA 2X1NA 5DGZA 2ZB0A 3FMJA 5FG8A 4QP1A 5AX9A 3V8TA 2B9JA 4QMSA 2BPMA 1I44A 1IR3A 1GIHA 1WBVA 4MK0A 5GJGA 4QD6A 3PSDA 3V6SA 4MXXA 3MWUA 3UQFA 3K3JA 4EH8A 4D2VA 4C4HA 5JN2A 3PSCA 5K4JA 3G15A 1ZXEA 3OMVA 4OTRA 5M53A 1XKKA 4E6QA 4ZTQA 1GIJA 4ZTNA 4O27B 4FEQA 4F7NA 1QPDA 2PMIA 3OWPA 3QCQA 3FWQA 1MQ4A 4BWXA 4GYIA 1OBDA 1YDRE 2QODA 3G0EA 3DKCA 4BDEA 2H9VA 3T9IA 5HBEA 1LEZA 4E5BA 5KMMA 3HL7A 3AXWA 5EQEA 4FEUA 3NUAA 3M2WA 3RBWA 4Q9SA 4HYSA 1STCE 2W7XA 4IAIA 5DT0A 1PXJA 4F08A 3FMMA 1R78A 3V5QA 2Y0AA 4JJRA 5HCYA 5T6KA 2HCKA 2PU8A 5HD4A 4C8BA 3SG8A 2C1AA 3SW7A 2VX1A 3VHKA 1DM2A 3Q6UA 3MIAA 3ORKA 4FKVA 4E6CA 4O0WA 3VJOA 3SGCA 4UALA 3VN9A 5HLWA 1P4OA 1YHWA 3FY0A 5KMJA 1P14A 4BTFA 3ZLWA 4AA4A 5C01A 3O8UA 3O71A 5L6WL 5C4KA 4UXQA 3BKBA 3PDTA 2J0KA 3I60A 2VU3A 2ERKA 3A7FA 3RALA 5JK3A 3VULA 3IGGA 2UZWE 1E1VA 2IZRA 2X0GA 4FF8A 4AXAA 3QQUA 2CCHA 4DGNA 4IWQA 4FIIA 3EFJA 1E9HA 4FTMA 4QYYA 5HO8A 5HE2A 5CF5A 5J1VA 3I79A 5E1SA 4BC6A 2W1GA 5CAPA 4WG5A 2C0TA 3ZDUA 3H0ZA 4O6LA 3PIYA 2VWXA 2C0IA 3D9VA 1W0XC 4IX5A 2UZDA 1FMKA 3H9FA 2VX0A 4RX7A 1JVPP 3KA0A 3KKVA 4U3ZA 4PY1A 3ZEWA 4C3PA 2YLEA 1PXOA 2B52A 2VTHA 4FZDB 5JZJA 4H05A 3QGYA 1R0EA 1OPLA 4ACMA 3LHJA 4I6QA 1JNKA 4AUAA 3E87A 4DT8A 5AAFA 4M0YA 3QQGA 3NYXA 4AFJA 1NA7A 1PW2A 1FOTA 4HPTE 2ITOA 4E6DA 3SXFA 4DLJA 3UO6A 3BPRA 4RVKA 2QO7A 4DBXA 2B9FA 1RW8A 1S9IA 4L01A 3VC4A 5TE0A 5K3YA 1FGKA 3E88A 1URWA 4JBQA 4YZMA 2BTSA 5BUIA 4RRVA 5M06A 4JVGA 5HIEA 1F3MC 1K2PA 3WF8A 2VWUA 3PFQA 3AC4A 4IWDA 4FOBA 1HOWA 3BGZA 3L8XA 4KKHA 4O91A 4X3JA 5AIRA 3OZ6A 3S95A 3Q53A 5HO6A 4LG4A 4C35A 5J5SA 4FUYA 1FMOE 1M17A 4XJ0A 3R8VA 5EDQA 3JVSA 4OBPA 4RJ3A 2XYUA 4DGLC 1U46A 3EQRA 3WZEA 3IG7A 5HE1A 4K0YA 1PMEA 3AGMA
chains in the Genus database with same CATH superfamily
4RJ5A 3TXOA 2ZDTA 5AR7A 2WHBA 3CKWA 5IKWA 3QUEA 3PTGA 5AV3A 1YDSE 5FUTA 4AN2A 5LMKC 2IZTA 2XZSA 3DKFA 3A4OX 2F7EE 1M7QA 2X4ZA 4PUZA 3CD3A 3S4QA 1ST0A 2FSOX 2PE1A 2E9OA 3NX8A 1Q99A 1Q8UA 2C6TA 2B9HA 4WBBB 2WTKC 4XMOA 3BYOA 5FEDA 3MJ1A 3R7GA 3UG2A 1ZAOA 3KRXA 3ZCLA 1U4DA 3UP7A 1NXKA 3W0RA 3NUSA 4JBPA 3POOA 2GNFA 4F6WA 3ZXZA 2J0IA 4DTBA 3HMOA 5DG5A 3A4PA 5I0BA 4W8DA 5BYLA 5KMKA 3UYSA 5CU4A 2ZYBA 3ALNA 1NW1A 4GG7A 2J5FA 1Q8TA 3UMXA 2CPKE 4RPVA 1J3HA 2BKZA 4IAFA 3HA8A 4JT3A 1YRPA 4F9BA 3LXLA 3GQIA 4R1VA 4YJSA 2ETKA 3BQCA 5AJQA 3OUNB 4EHEA 4EH4A 5A9UA 1WBOA 3DJ6A 3U6IA 1OBGA 1OIUA 3ZM4A 1VYWA 4DFLA 1CKPA 2NPQA 4YZNA 2JEDA 4F99A 1M7NA 2ZV8A 4FVQA 5B0XA 2C3KA 4I21A 4O0SA 4LGHA 2BTRA 3ORNA 4I5PA 4O96A 4J71A 4IDTA 1H00A 3ITZA 3C4FA 4C57A 3ZO3A 3A61A 1G3NA 3KMWA 4HW7A 1P5EA 4FNXA 3EFLA 4DGGA 3C4XA 4A9YA 3D7TA 5CAUA 2UZOA 3E92A 1SVGA 1OUKA 2BALA 2UZLA 4TY1A 4D0XA 4BCIA 3UDSA 1YOLA 3NAXA 4U97A 3Q2MA 3VONA 1LP4A 2DUVA 2GNHA 3IPHA 2Z7QA 4HOKA 3D94A 3AD5A 3BHTA 4EH5A 1H1QA 1X8BA 2IVVA 3CKXA 4WBOA 4WO5A 4X2KA 3ZO1A 4F7SA 4N70A 4U80A 3ZMMA 4V01A 2W05A 2W1DA 4IB0A 4EH7A 3FL4A 5AV2A 4CFVA 5BQ0A 5C8KA 4M13A 2JBOA 2KULA 4N4SA 2C3LA 4RBLA 4TNBA 5L4QA 5CANA 4FTAA 5HTCA 3GGFA 4LOQA 3NW7A 4DFXE 4I20A 1YXXA 2BILB 4AN3A 3ZOSA 3FLYA 2GHGA 4QT1A 4KIOA 5CENA 3F3VA 4YO4A 2DS1A 2CMWA 4GFGA 4H39A 3FZ1A 1H0VA 3IW6A 4ONAA 5ANKA 4EOIA 3CGOA 3B2WA 4AA5A 2WNTA 1VYZA 3ETAA 4CFFA 4DITA 4E73A 2WQOA 4K33A 3D15A 4AAYA 3KVXA 5I3RA 4NM5A 4APPA 1PKDA 3COMA 3T3UA 3ZU7A 2PVMA 3FY2A 5H2UA 5IUGA 2VWWA 3R8ZA 4EORA 5CEOA 4I0SA 5EM6A 3W0MA 1WVWA 3IECA 3QRKA 3VQUA 5C26A 2YDIA 3LMHA 3TZ8A 5B2LA 4F0FA 3F61A 3DFCB 4F1TA 3VUGA 3SXSA 2QC6A 4QP2A 5JQ5A 4IZ7A 3O0GA 5CSHA 2HZ0A 5LJJA 4I5HA 1QCFA 5HLNA 5EYDA 4ZTHA 3DGKA 2XAOA 3DBEA 3P9JA 1O9UA 5ANJA 2H34A 3UDBA 4FNYA 3RGFA 2P2HA 3FZOA 5LQFA 4QMXA 5A14A 1ZOHA 5L8JA 4HVSA 2VTNA 2NYAA 2RFDA 4DEGA 3F5UA 4EOSA 4LUEA 3ORMA 4O1PA 3MI9A 4YGAA 3R7IA 1JKLA 1YWVA 4EUTA 1MRYA 3GCQA 4RJ4A 5LMBA 4NKAA 2OJ9A 4WRGA 2YM5A 3GP0A 5E8YA 3ZONA 2BIYA 4LI5A 3LMIA 4FTOA 4HCTA 2P55A 4DFNA 3NVMB 3I7BA 5I5ZA 2ZM1A 4GT5A 3ZZEA 3R8UA 4L00A 3GU6A 4L7FA 4PX6A 3NSZA 5ANDA 3VF9A 1L8TA 1J1CA 1REJA 3F7ZA 4G16A 4JG6A 4OBOA 4IB5A 4P4CA 5DWRA 4EC9A 4BGHA 2G15A 2JKQA 4F7LA 3ZRKA 4KIKB 3LQ5A 4KBCA 3KMUA 3MDYA 4E5WA 3EN6A 3DAJA 3W2OA 4JRNA 3C4WA 4XV3A 3SXRA 3VS1A 1G8AA 3MFUA 3SRVB 1VZOA 4K6ZA 4LV8A 4WUAA 4D9TA 5FGKA 3BWFA 2WQMA 3R01A 4RMZA 3RAHA 3V5PA 4AE6A 4C3RA 4RQKA 4YTCA 2PZPA 4FEWA 5IA4A 1BLXA 2J0LA 4G3DA 2Y4IB 3TEIA 5C8NA 3QA8A 2XEYA 4ZAUA 4O4BB 5AV4A 4RVLA 2VD5A 4RVTA 3CEKA 4FMQA 2CKOA 4TT7A 3PP0A 3C50A 3CR0A 3UPXA 4OAVB 3GU5A 4ZZOA 2W4KA 4DF3A 4C38A 4KIQA 2B4SB 4BKYA 3PSBA 4J96A 5K9IA 2F7ZE 2YM4A 4CXAA 5DYJA 3FYJX 2HZ4A 3H4JA 2Q83A 1OGUA 4ZS4A 4PDSA 4K9YA 3T3VA 3R04A 4EK8A 4CKRA 1JOWB 1NVQA 2ZV9A 3KN6A 4O0VA 2FSLX 2WXVA 2H6DA 3BLAA 3NDMA 5L2SA 4NT4A 2PZYA 2XJ2A 3FLSA 3V51A 4DH5A 3LFSA 4GCJA 1K3AA 2O65A 5AA8A 4NL0A 4O83A 1YWRA 2YJRA 4DEHA 3VS4A 2XF0A 3OW4A 3VS6A 3PP1A 5BMMA 3HAVA 4D1ZA 3I0OA 2BDWA 5IQEA 4A07A 3QRUA 2KTYA 3ODYX 2C4GA 2QURA 4D4RA 3PXFA 2CDZA 2QG5A 1YI4A 3ENMA 1F0QA 4FA2A 2XKCA 5EH0A 2I7QA 2QU5A 4GK4A 2YIQA 3ZUTA 3QHRA 4LGGA 2QOCA 4ZTRA 5L2WA 2JAVA 4QMQA 1E1XA 4FBXA 2WD1A 3P4KA 4MWIA 2VO3A 3EIDA 5A4EA 3GB2A 2UV2A 4F0IA 5ANIA 2OXDA 2V7AA 4KBAA 5E7RA 3EFKA 4FIGA 1XHAA 2XCKA 5FQDC 2WO6A 4J98A 4NH1A 5CS6A 2OSCA 2J50A 4FTLA 4IX6A 1LEWA 2BZIB 2ITTA 3II5A 5I4NA 1TFFA 5K0XA 3WF7A 2YDKA 4FE2A 4I4EA 4C0TA 2XIRA 4PMTA 2OKRA 2PVNA 2ZB1A 3G6GA 3PRIA 4FSZA 5GZ9A 3AC2A 4MBIA 2I0VA 1H1PA 2JD5A 3GI3A 3MH1A 5ACKA 4EBVA 2QU6A 1J7UA 3C9WA 3EH9A 3MFTA 1HCKA 4PF4A 5JKGA 3ET7A 3QTXA 1OITA 4IVAA 4O1OA 2IW8A 4YZ9A 2R3GA 4DGOA 1W98A 4DT9A 1UU9A 3OCGA 4Z3VA 4IJ9A 4F9CA 5IQIA 2Y6MA 3R22A 1SYKA 4BZNA 3QUDA 4JOAA 3MY0A 2NO3A 4U9AA 4UMQA 4I5MA 5EM7A 3GC0A 3W1FA 2PUNA 3MPMA 4I3ZA 3ZSHA 4IB3A 3M11A 3TN8A 3V8SA 3WZUA 3R1YA 1NY3A 4RLKA 3U54A 2GQGA 3I81A 3IGOA 1OL2A 1U5RA 1JWHA 2R3OA 5ACBC 4CSVA 5KUPA 3Q9WA 3TJDA 5LVOA 3EZVA 3PZHA 4NK9A 4BTMA 1ZOGA 3Q52A 4ZY5A 3HP5A 2WTWA 4XG3A 1GZNA 3DB6A 1OZ1A 1ZLTA 4FKUA 2C30A 5C8MA 4M8TA 4F1OA 4X0MA 4BDKA 3NAYA 4MBJA 3ZLSA 4FTJA 4A9UA 4KWPA 5EW8A 4FTUA 5H3QA 2OZAA 1OKVA 3NPCA 4RFZA 3N4UA 2ZMDA 3PPKA 2RL5A 2OGVA 4FKLA 4AZSA 3CSVA 1KV2A 3FI2A 4FV6A 3BLHA 2P0CA 4FYOA 5JFWA 5E9EA 5DEWA 3RTPA 1H8FA 1KE7A 5E91A 4CV9A 5L3AA 3O8TA 3DBQA 3MH0A 5BVOA 3NR9A 4FSUA 4A9RA 3L9MA 4L45A 3ZHPC 3NNVA 4HGLA 3QRJA 1SVEA 2YHVA 3R0TA 3C5UA 1RQQA 2XS0A 4FV0A 4PMMA 4XOYA 3O51A 4QMMA 2ZMCA 4JG7A 3UPZA 4RX8A 3LFEA 4NSTA 3SD0A 3HKOA 3FBVA 1YKRA 2WPAA 4CQEA 5HIBA 5I9VA 2JKOA 4IAKA 5CXZA 5E4HA 4X6RA 4XV1A 3GC9A 4CGAA 1TQIA 4RWLA 3UIXA 4USFA 2W1CA 2C6LA 1SZMA 2PVHA 3G5DA 3LCSA 5K0KA 5G6VA 2ZJWA 4L46A 1SMHA 1IA9A 4NCTC 5JFVA 4L3JA 3R8LA 4D58A 5J79A 3DXQA 4AXDA 2GNJA 1PYEA 3UNZA 5BYYA 5EOLA 3OY3A 4FTTA 4WA9A 4EQUA 2YCRA 4J1RA 4O6EA 4HZSA 5GHVA 5HIDA 3GU8A 4I0RA 3ZZWA 4FV4A 2B0QA 3DB8A 4RWIA 2XBAA 5IDNA 2PUPA 2C1BA 4I6LA 3QX2A 3CC6A 5CU6A 3VS5A 5FLFA 3V5TA 3CJFA 5K5XA 4Y8DA 4TL0A 5AM6A 4TWPA 4UWYA 2R2PA 2UZVA 3HMNA 4I0TA 4F70A 5C4LA 2Y7JA 5FWKK 4NU1A 1UV5A 4KKEA 4U0IA 4HVIA 2P4IA 4TW9A 5CQUA 2BRHA 3CXWA 2PUUA 4ALWA 3WF9A 5BYZA 2X9EA 5EW9A 5HVJA 4C33A 2FB8A 3SAYA 2PUIA 5CXHA 2XA4A 3LFBA 3FYKX 5GJFA 2BMCA 4B8LA 5AUZA 3BU3A 4I22A 1OI9A 3ZTXA 3NNWA 2XKFA 4L3LA 4O0RA 4OTPA 2PHKA 4S2ZA 2JFMA 4AT3A 4ZMEA 1PKGA 2JFLA 2QOFA 2WMUA 3QXOA 3KU2A 1QPJA 3OWKA 4IX3A 5KBQA 2HZIA 2GQRA 4DE4A 4OUCA 1Q24A 4M3QA 3VUDA 4IWOA 1CMKE 3IDBA 1OIRA 3I5ZA 4CT2A 3BL7A 4FKJA 4JQ8A 2OH0E 3RK7A 1W8CA 4EOJA 3NMUF 3SX9A 2FA2A 3BYVA 3KK9A 4X2GA 1UU7A 2OW3A 2B53A 3BZ3A 4QNAA 4YSMA 3PJCA 4O86A 4DEAA 3VW8A 5HLPA 4D4VA 2FVDA 2I0YA 3SG9A 2A98A 3LE6A 4KAOA 4I6BA 5HTIA 3OEFX 4BWKA 3OXZA 3TTJA 4F09A 3O7LB 3CLYA 2B7AA 2NRYA 2RG5A 4Y95A 3BWJA 5EKOA 3HX4A 4CMTA 1FVVA 5M4CA 4QEBA 3G90X 2W1HA 3GFWA 2YN8A 3QRTA 4U40A 2GFCA 5ANEA 2JDSA 5JRSA 2W99B 2Z2WA 3A60A 1SM2A 4PDYA 2X8IA 4AQKA 3PPJA 2BRGA 4IQ6A 2J6MA 1PYXA 3BHUA 2HYYA 4MF1A 4CZUA 1KE8A 3NLBA 4K8AA 2BVAA 4BICA 4CNHA 2ETMA 3R7OA 3G9LX 4E4NA 1IEPA 1CKJA 2CGXA 4M97A 4V0GA 5CSPA 4M14A 3LCKA 3LFCA 4ZSAA 5IA0A 2BRNA 4CLIA 3G0FA 5E90A 2QONA 3MVMA 3NZ0A 5HG9A 2QD9A 3BHYA 3KXMA 4YZDA 4BIEA 4FL3A 4JBVA 4DFZE 4LV7A 2OJIA 4HJOA 4X7QA 4O0YA 5BV3A 2AYPA 4FKTA 2AC5A 4J97A 2C47A 2XVDA 1EH4A 3L8SA 2VGPA 2C5OA 4GYGA 2AEGA 4C62A 3K3IA 2XM9A 2XNNA 3NYVA 4KSPA 4AZVA 2IJMA 3EKNA 3OS3A 3TUCA 1YXVA 3BEGA 3UTOA 4QPAA 4BYIA 2OLCA 2VWYA 3D83A 3NUPA 2PWLA 2GS6A 3PG3A 2X0OA 4RSSA 3O23A 4H3BA 3ZFMA 1Q4LA 2QOHA 4I41A 2YWVA 4LUDA 4AX8A 2XNEA 5CAVA 2O8YA 4HYIA 3NS9A 2VWBA 4DHIB 4G3GA 4ZSJA 5TO8A 4NWMA 4BJJB 3RM6A 2EWAA 3W0OA 4CT1A 5GZAA 2V5QA 3SHEA 3TDVA 3Q4CA 4BFMA 4O22A 4DEDA 3VVHA 3VUKA 5HU9A 3HV4A 4I94A 4F63A 3PVBA 3QC9A 2X39A 3FHIA 4RT7A 3Q32A 4YP8A 5CY3A 3WZJA 2ZV7A 2ETRA 2QO2A 3QXPA 3AKJA 3MTFA 4L44A 4EOLA 5AM7A 5IISA 4CCBA 5IEVA 2VTMA 3VW6A 4DEIA 2OJGA 4MTAA 4TWNA 5DEYA 2YJSA 3THBA 4QQJA 2X9FA 3FMDA 3PXZA 4MYGA 4PV0A 4EONA 1XMLA 3QTRA 2YERA 2QOOA 5IA5A 4GIHA 3VBXA 3MIYA 4HZRA 3NW6A 3U9CA 3A62A 4CTCA 3PY1A 4YZBA 3ZH8A 3ZUUA 2A4LA 2VNWA 3HRFA 4KA3A 4DHFA 2WIPA 1LUFA 1Y6BA 3QD3A 4C2WA 4KBKA 3PA4A 4NCTA 5IA2A 3R63A 4WT6A 5DR6A 3AMYA 5IQHA 4XOZA 4RC2A 3EYHA 2X7OA 4KIPA 4B6LA 3UO4A 5IUHA 4ITJA 3DU8A 4YNEA 1KOAA 5DPVA 2QOQA 3UVPA 4BI1A 4DG0E 2GTNA 2C6KA 2O5KA 4X21A 1OMWA 4IB1A 5FP6A 3UDTA 2F2UA 3JPVA 3AC1A 4FZ6A 3ZLYA 2GTMA 4QDEA 3PWYA 3QCYA 1H07A 4M66A 2X81A 1UNGA 3VQHA 4NJ3A 3DZOA 4JDIA 4OTWA 5FEEA 4WNOA 2YIWA 2J9MA 4JL9A 2G9XA 2V22A 3W2PA 1Y91A 4UEUA 4LL5A 4EH2A 1WBNA 3MA6A 4IAYA 4MBLA 4E26A 3LOKA 4Z16A 1SNUA 3QYZA 1MP8A 2VNYA 4AOJA 3E64A 5K4IA 3SVVA 5BMSA 1IG1A 4D2TA 3UQGA 4O84A 3R83A 3NNUA 4IFGA 3CY2A 3PXYA 4XBUA 3QALE 4BCQA 4ZSGA 2R3RA 4JBOA 1G5SA 5I9YA 2XMYA 5BNJA 5J5TA 5J7HA 4PL3A 2RSVA 2EVAA 3EN4A 4XBRA 1MRUA 2XK3A 3DQWA 4DCEA 4HCUA 4Q5EA 3LXKA 4YMJA 2O2UA 3F3ZA 5KMOA 2IN6A 3AOXA 2ZOQA 4GIIA 1R39A 2UZTA 2XYNA 4GMYA 4RA4A 4YC6A 3TV6A 3T9TA 2C68A 5L8LA 5AUYA 1KV1A 4YU2A 4OBQA 1JKKA 5IQFA 5EG3A 5CEPA 5IQDA 3JY9A 1CKIA 3FI8A 4M15A 5CAQA 2WTIA 3AT4A 4P5QA 5T68A 4GT4A 3IS5A 3QQKA 3U51A 5EI2A 3W8QA 4X2JA 3V6RA 3QD2B 3W2RA 1LPUA 2G2IA 4OAUC 3W2CA 5KX8A 2PTKA 4RIOA 5EOBA 1YDTE 4Y5HA 5L2TA 4D2WA 4ALVA 3RINA 3GFEA 4RIWA 3S00A 3UP2A 4TYEA 1U54A 4R6VA 3DT1A 4M67A 3HMIA 4MXOA 2OK1A 5DLSA 4EUUA 5KCVA 3BGPA 3Q6WA 3QKMA 4FT0A 1S9JA 3UDZA 4D5KA 4NTTA 2XK7A 5KHXA 3LPBA 4IEBA 4ZY6A 4E4MA 2XJ0A 2C3JA 3ERKA 3DXPA 2XBJA 5JEBA 4O0UA 5HE0A 4N6YA 1Q8WA 3TM0A 4XP3A 1TKIA 1JAMA 3NW5A 3PXQA 5AR4A 2Z02A 4ZP5A 4LDTA 4CMUA 5JFXA 4YNOA 5KMIA 1XH6A 2AC3A 2I40A 4FK6A 5CTPA 3ZO2A 2UVXA 2FYSA 3NNXA 4AAAA 1YHVA 1XBAA 4PP9A 3B8RA 3JUHA 4D1XA 4O82A 3BRBA 4C36A 2OIBA 2VGOA 5E8SA 3MVJA 3CGFA 5D1JA 4ZLZA 3R8PA 3R8MA 4FSMA 4MX9A 3KGAA 5I3OA 4ANSA 4AT5A 4K11A 5C1QB 4AACA 4GU6A 4D4SA 3WE4A 2WTJA 4NFNA 3RNYA 3WILA 2ITNA 1PHKA 3U55A 4G9CA 4B7TA 3OXTA 2C69A 4BTKA 4AT4A 1WBWA 3MJ2A 3S3IA 2QG7A 2GCDA 3ULIA 5TOZA 3CTJA 4I24A 3F9NA 1HCLA 1V0PA 3AGLA 4YSJA 2PZRA 3U9NA 3VS3A 4UB7A 3VUMA 2F57A 4BZOA 2YEXA 4Y83A 3RI1A 4EHGA 3QQHA 3UNJA 5BVDA 4BL1A 5HX8A 3IKAA 1GAGA 4W8EA 2Y9QA 5HG7A 4EOOA 3F82A 3COHA 4IMYA 4TYJA 3GOKA 5J9LA 3TNPC 3M1SA 4J53A 3LMGA 1VEBA 5M56A 2W5AA 1QMZA 3PY3A 3HV6A 4QTDA 4WIHA 3VRZA 2BDJA 4W4WA 4CFUA 1BX6A 1XQZA 1REKA 3DOGA 3Q9YA 4JG8A 4LGDA 1BKXA 3L8VA 5KMLA 1PMNA 2BRMA 4QPMA 4E6AA 2VTJA 5CAOA 5HVKA 2WELA 1W2DA 4AZEA 4YBJA 2NP8A 4CYJA 5GIOE 2G2HA 3D5WA 3ZM9A 2CKEA 4D9UA 3VHEA 2A19B 3HEGA 1Y6AA 5B2MA 3ORIA 3JVRA 3HV7A 4FVPA 3E8DA 2Z7LA 2HW6A 4FV1A 3EOCA 5KE0A 4C4IA 4EH9A 3PLSA 1BI8A 4DFBA 1WAKA 3EQIA 1OPJA 2PE2A 3Q4TA 3Q60A 5EK7A 3VAPA 2QO9A 4NM3A 4F6UA 4ANLA 1H08A 2CCIA 2YIRA 5HX6A 3QWJA 4CKIA 5CT7A 1G8KA 5FXRA 3LLAA 3TG1A 3C51A 4YHFA 3VBTA 2YM3A 2YAAA 4O2ZA 4WD5A 4XV2A 3NVKI 5AV0A 5FXSA 3MW1A 3Q4UA 4H36A 3DAEA 2YACA 4J99A 2R3JA 4LOOA 2IO6A 3PA5A 3Q4ZA 4L6QA 3EQCA 4HGSA 4AZWA 5HBJA 4GSBA 2YA9A 3W55A 1OUYA 3P5JC 2WTDA 3AD4A 4X2FA 2XB7A 5HO7A 3QTQA 1BL7A 3PA3A 3HV5A 5JQ8A 1IAJA 2C6EA 3IO7A 3LQ8A 2ZFYA 2V62A 2JDVA 2J0JA 3D7TB 4IX4A 4D4YA 5AP5A 4U41A 4AGWA 5CU0A 3LJ0A 5FM3A 3TNHA 4TXCA 5IH6A 5DT3A 3QRIA 3D2KA 5HI2A 3BELA 3OW3A 4ZK5A 3E63A 4DN5A 4IVBA 4DCAA 4FKPA 4KRCA 3ZC6A 4LMNA 5AP4A 2IF8A 3V01A 3NUXA 5EHLA 2NNWB 2REIA 3PIZA 3CPBA 3EL8A 2VTSA 5D41A 3OOGA 3FUPA 4M12A 2BHHA 2E2BA 4FV3A 3GENA 1IAHA 1VLRA 2IVTA 1UNLA 1OVEA 4XHKB 4YHTA 4BWPA 5ITAA 4MQ1A 5IPJA 5FTQA 5BUEA 2ITQA 3A7JA 4QO9A 4BHZA 2X8DA 4KSQA 3FPQA 4FT3A 1WVXA 1PXLA 4DBNA 3GU7A 4ZY4A 4ENXA 4H1MA 3QZIA 4ZJVA 2IW9A 3VUTA 5KZ0A 4CQGA 3DDPA 2XRWA 3BV3A 3P7AA 3K5VA 3P0MA 1BL6A 3POZA 3LM5A 4R5YA 4FV2A 4FT7A 2XNMA 3BQRA 2UW9A 4UY9A 4GJ2A 4UZHA 3CIKA 2YCFA 5J8IA 1MRVA 4L52A 5BVKA 4BCHA 2B54A 4FTKA 1ZZLA 5HGIA 1YVJA 4GK3A 5CEQA 4UMUA 4JR7A 3E8CA 2BZKB 2BZJA 2G2FA 1J7IA 3FXXA 5DE2A 3VWAA 1P2AA 3P5KA 2YCSA 3UYTA 4RGJA 5FBOA 3BEAA 3UJGA 4DH7A 4G5JA 4C7TA 4M68A 1ZRZA 4EKLA 4ORKA 5M09A 2XANA 1OPKA 4RZVA 3RK5A 4UXLA 3N4VA 4MXZA 3OOMA 3KCKA 4H3QA 5DVRA 4DH1A 1A48A 2IPXA 3EN5A 3RM7A 3GVUA 3E3PA 5KKRC 1U59A 1SVHA 4OGRA 3UVRA 3FZTA 1PY5A 3P08A 4B4LA 2Z7SA 2OXXA 2HZNA 2W5HA 3I5NA 4KRDA 3UMWA 5F1ZA 1W83A 2UW7A 4QP6A 3RNIA 2C6IA 2V55A 3TT0A 4C4EA 3R71A 1YWNA 2YLFA 4P2KA 3GEQA 1FINA 3TUBA 3Q5ZA 3QWKA 4BCFA 2IZUA 4RQVA 4UMTA 4YBKA 2JLDA 4FIHA 1XR1A 3HDMA 4YHJA 2XARA 5CEMA 5LMKA 3KULA 4BBEA 5DA3A 1KE6A 4JR3A 3CQUA 3HUCA 3VUHA 4ACGA 2W4OA 3LFFA 2WAJA 1Q62A 4LOPA 2WTCA 4UWBA 1RJBA 2P2IA 2YISA 4WKQA 3VO3A 2CGVA 4FIJA 4FZAB 4X3FC 5LVLA 1H27A 4PL5A 3HYHA 3BIZA 2UW3A 4FOCA 3BL9A 1PXMA 1LR4A 3R1QA 2WQNA 1ZMUA 3FMLA 1XH5A 4XX9A 2CJMA 4RJ6A 4EHZA 4W9XA 3ROCA 5JSMA 5LWMA 4TKSA 2Q0NA 4O7LA 2A0CX 3AMAA 2HXQA 2VO7A 4BDJA 4QP4A 2RFSA 1KOBA 4IVDA 2E9UA 3G9NA 4BDCA 3HMPA 5H8EA 3DK3A 5GIPE 3WARA 2QKRA 3KXGA 3BI6A 2VTAA 2H8HA 3NUUA 4UZDA 4D2RA 5A46A 3L9NA 5F4NA 2IZSA 5I9UA 1R0PA 4RFMA 4RWJA 2JAMA 1XJDA 3L8PA 3TTIA 3KULB 4QNYA 3E7OA 2QLQA 2BAQA 2UZBA 4M0ZA 4A4OA 5F95A 4KKGA 3JYAA 3R73A 1Y8GA 2JIIA 2UW4A 5HNBA 1KWPA 4NZWB 4LMUA 3OCSA 3OTVA 4GEOA 3KEXA 3KF7A 4DGMA 4O7WA 3LVPA 4MAOA 4XLIA 5A4QA 3DLSA 4TNDA 1GJOA 2YDJA 5EM8A 4CYIA 1OM1A 2BAKA 3EYGA 3EQPA 4J95A 2HW7A 1I09A 5HOAA 5L6PA 2UW6A 3KXNA 4YO6A 4QP3A 1JSVA 2RG6A 4LRMA 3WF5A 2XNBA 4JI9A 3DNEA 1WBSA 3LW0A 4R5SA 2AQXA 1ERKA 2GNGA 2F49A 2RKUA 3EFWA 5AUXA 4YJQA 3UGCA 5IMEA 5K5NA 4TYGA 3AMBA 2UVYA 5DOSA 3QKLA 2I6LA 1WVYA 3IDCA 3IOPA 5HG8A 3W18A 5J95A 3H0YA 3NRMA 4M69A 2UW8A 4G1WA 1Q3DA 4OR5A 5E8XA 5AP6A 1TQPA 3OT8A 2E9NA 4FKGA 3DQXA 3FLQA 5ETAA 2OF2A 4OTIA 2VRXA 4MKCA 4YC8A 4EK6A 3R7VA 1T46A 3ZRLA 3EN7A 4U42A 5L2IA 4F6SA 3TNWA 3MBLA 1PXPA 2ITYA 3ZYAA 3R9RA 1JSUA 5CU2A 4F9YA 4DFUA 2WMXA 3KB7A 2UW0A 4LQMA 4E4LA 4DG3E 3LQ3A 2ONLC 3MESA 3UIMA 2QHNA 3F2RA 3CTHA 4C34A 4FNWA 2J5EA 3PE2A 4XG4A 3ZUVA 2V7OA 3S0OA 2B1PA 4G34A 3DJ7A 5AR3A 3UQCA 1XWSA 3R9DA 1GOLA 4XP2A 3AKLA 4IE9A 3LJ1A 4KB8A 3PYYA 4IC7A 3BU5A 4JIAA 3K2LA 2ERZE 3VS7A 5LOHA 4C4GA 3ORXA 4NW6A 3ZSIA 3PJ2A 4BCOA 3E62A 3TZ9A 3Q5IA 4FSTA 4LRJA 5M07A 2LAVA 3BBWA 5FEQA 4BN1A 5HVYA 3KRRA 4B99A 4YJOA 3ANQA 3OBGA 4ZIMA 2YM7A 3BYUA 2OI4X 4Y5QA 4NUSA 5DRDA 3CY3A 2YZLA 5CSXA 3LM0A 3QBNA 3DPKA 3FQHA 3RKBA 5EW3A 4O0XA 2OBJA 5AFVA 4QMTA 1UA2A 3H9RA 3ORTA 3R2BA 2OJJA 3QA0A 3ULZA 4RIYA 2PVFA 5TKDA 4B0GA 4IZAA 3V04A 4A9TA 3D7ZA 4CTBA 4QMVA 4AXCA 3GC8A 3RAIA 4UMPA 2CHLA 4USEA 4AS0A 3ZS5A 5CF4A 1ZWSA 3U4UA 3TV4A 5LVPA 1QL6A 4KUJA 1UWJA 4MCVA 1XO2B 4FKRA 5CVHA 4AW1A 3JS2A 5L8KA 4R7BA 3R9NA 3GC7A 4KS8A 3NWWA 1OECA 4MNFA 4DDIA 1FGIA 4D1SA 3DAKA 1P4FA 2I0HA 3RK9A 4ASXA 1GZKA 2XK6A 1DI8A 2JKKA 3E3BX 3F88A 5CWZA 5ANGA 5AUWA</