3DS6A

P38 complex with a phthalazine inhibitor
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
349
structure length
343
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Discovery of highly selective and potent p38 inhibitors based on a phthalazine scaffold.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 343
sequence length 349
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ds6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ds6A01
3Q52A 3S95A 3BQRA 3OW3A 5IQHA 3BHUA 3UO6A 5D7VA 3E87A 4N57A 4IIRA 3BGZA 4NFMA 4PPCA 2XK7A 4Y8DA 4BBMA 4D1SA 3KVWA 3KREA 4R7BA 2QVSE 4MH7A 2JFLA 3NCGA 4XG2A 4EH2A 5F9EA 1SVEA 3EQDA 2H6DA 4X3FB 4WUNA 3ZSGA 4MQ1A 3ZRLA 3Q5IA 4UEUA 4K0YA 3BU6A 2XBJA 2UZBA 1YRPA 1HOWA 3O51A 2J0JA 1H1PA 2EU9A 3V5JA 4AOJA 5CY3A 1FQ1B 1PXIA 4A07A 5L6PA 2QOLA 4ANNA 4ZZOA 4YO6A 5J9LA 2YABA 3HGKA 3AMYA 5E92A 5DBXA 2FSMX 3UPXA 2XK8A 3CPCA 4ZLYA 3QQKA 4FIHA 4UXLA 5L3AA 3ZBXA 1S9JA 4YPSA 5J7HA 4O82A 3QHWA 3C4ZA 4F9WA 4YBJA 4WRSA 3VHKA 1DM2A 2WMBA 4C62A 4R78A 3CBLA 3W2CA 3QGWA 4YZBA 1OM1A 3LAUA 3TKHA 1OIRA 4AGDA 2QLQA 3WYXA 3C4FA 2VTLA 4FZAB 4QQJA 5BVKA 3SHEA 2VTOA 4UYNA 2R3FA 3F2NA 2YZAA 3M11A 4I4EA 4ZY6A 3P1AA 3R8LA 4JBVA 4AZTA 4BCJA 1M2QA 4YNEA 5E8XA 3HP2A 3LJ2A 5DVRA 5HESA 4JQEA 4ZP5A 1Z57A 4U79A 5ANEA 3QLGA 4AN3A 4BCKA 4BKYA 3R2BA 1BL6A 1Q41A 3EN9A 3SA0A 4WUAA 3R9HA 3V04A 2Z60A 4RFZA 5TT7A 3GFWA 3K54A 3W8LA 4WNPA 3ZS5A 3GT8A 1KOAA 2JDSA 5E8YA 1WFCA 4HVIA 2PZYA 5ITAA 1OL1A 2C1BA 2C6MA 2ZV9A 3IDCA 3HNGA 2J6MA 3OWKA 3QC4A 4NM3A 4WNOA 3AC5A 5AAEA 3VS6A 4EOQA 3G0EA 2QOQA 2WNTA 2JIVA 2WEVA 4XRJA 3LJ1A 3AMAA 3CQUA 3EQBA 4JIKA 4OW8A 5TR6A 4BCNA 2YWVA 2WU7A 1M2RA 5AX3A 3WF8A 2F57A 3BELA 4CTCA 2DYLA 4I0RA 1CSNA 3KVXA 4WSQA 1JOWB 4FODA 2XIXA 5DRBA 3DB8A 4BI1A 3KK9A 4YJRA 2BFXA 3FMJA 1SNXA 3Q2MA 5A6NA 3LQ3A 4K9YA 2X6EA 3VHEA 1GY3A 2VGOA 3OUKA 5I4NA 1H27A 1YHWA 3D5XA 1R0EA 3GGFA 3VC4A 2OIQA 4II5A 3DK7A 4X3JA 4FR4A 4IAFA 4EKKA 3A4OX 3MJ1A 2W1ZA 1IAHA 1H26A 3TIYA 3U4WA 4TYJA 4XEYA 1H8FA 1QL6A 3FHIA 5AV4A 2VN9A 3E8DA 4M12A 4TKSA 2C5OA 3VBQA 4BKJA 4FK3A 1OKVA 4FKTA 3HAMA 1H4LA 5HCYA 1YI6A 3DPKA 1JAMA 1FVTA 2IJMA 4I94A 4OTIA 3Q3BA 2BVAA 4X2FA 4AA5A 2H96A 3COHA 3RHKA 3D7TB 3V5WA 4XLIA 1R3CA 2VTSA 4Q5HA 3HLLA 5J5TA 4A9YA 2R2PA 2CNVA 4FBXA 4D55A 4PNKA 1XQZA 4R77A 3CS9A 5E7RA 3FLWA 2XEYA 3Q32A 2CGVA 2VO7A 3PJ8A 1O6LA 4BFMA 3T3VA 3NLBA 2ESMA 1ZOEA 2W06A 4FTRA 3BYSA 4LRMA 3EKNA 4CMTA 1QCFA 2DWBA 4E5WA 4F70A 5E4HA 4O21A 1ZYLA 5CU4A 3DGKA 3R8ZA 4TZRA 3OY1A 5M57A 5CF8A 1I09A 5LMKC 5EDPA 3QD0A 4WNKA 5DR9A 1FGKA 3P7BA 4J53A 4GKHA 5KMKA 3IK3A 4O1OA 4H1JA 3OC1A 3ZUUA 2OZAB 3ZO1A 4TWPA 3EIDA 2B9FA 1KOBA 1TQIA 2OU7A 4D2PA 2QI8A 3C0IA 3OXTA 4BZOA 3KCKA 5K9IA 3PXKA 3GC7A 3CIKA 4BDDA 1IASA 4YU2A 3RCDA 1W98A 3NUPA 4MNEB 4PL3A 3SOCA 4EQCA 5C8NA 5JGBA 5LVMA 3PXZA 3NNVA 1Q5KA 2UVXA 3VS0A 4C2WA 4D4VA 3NVMB 4L53A 3OXZA 3QYWA 4BL1A 3EQGA 3B2TA 3DTWA 5I9UA 3TXOA 5DLSA 2W4JA 5DT4A 1H0WA 3KXXA 4IM0A 4DFZE 1WVYA 2QKRA 2O3PA 5AR7A 4FG8A 3RP9A 2VTJA 3UVQA 4EOSA 5ANJA 4CCBA 1BI7A 4O7VA 4RVKA 3D4QA 4FNZA 1NXKA 4NJ3A 3O7LD 1ZOHA 5JKGA 2YIYA 4F4PA 3VF9A 5AUXA 4LMNA 4EHGA 1FOTA 1F3MC 2YDKA 4FK6A 3L9PA 4QMSA 2WEIA 4KKEA 4TYEA 5ANKA 5AR8A 4DT9A 3U6JA 5CEMA 4MK0A 4F1OA 4CG9A 4N4SA 1W82A 5AP6A 2JEDA 3W16A 3P0MA 2FSTX 3GNIB 3LQ8A 3QXPA 4U43A 5AP3A 4G3CA 4ZJJA 4OBOA 2ONLC 2PZ5A 2V62A 3Q5ZA 5HQ0A 4CQGA 4OUCA 3O71A 1Y57A 4YLLA 5IUIA 5FWKK 1KE6A 5AV0A 3EYGA 4ZJVA 1U4DA 3GC9A 4XG6A 3DAEA 3QTQA 5EW9A 4HNFA 3R9OA 3GU5A 1Q8WA 3PPJA 4YHFA 3O8TA 4F7NA 2C3LA 3FSKA 1IEPA 4S30A 2GS2A 3BGPA 3MPMA 4BDHA 3A60A 4NZWB 2NRYA 3QTUA 4DH8A 2OJFE 4BCGA 3LCDA 5D1JA 3F6XA 4FOCA 5LWMA 2AYPA 5TF9A 1OL6A 3ITZA 4R6VA 2VWYA 1YOJA 4GV1A 4QP3A 3ZSIA 2YIRA 4QMUA 4C7TA 1H1SA 1U54A 4FV7A 1YOMA 2ZV8A 1WBOA 2J2IB 4NK9A 2UZWE 4WIHA 2QG5A 5AM7A 2WMSA 2X7OA 5G6VA 3CPBA 3E7OA 4KABA 4ZTSA 5H8BA 5ANGA 5LCKA 3VIDA 3FYKX 4DITA 4EOMA 3LMIA 1JKSA 3AD6A 3RALA 3FUPA 2Z7LA 3TT0A 1G8SA 2YISA 3TNQB 4BDJA 3ACKA 3A7HA 4JR3A 4O7ZA 2VRXA 3UZPA 4DH5A 5FP5A 4WNMA 3VULA 1BLXA 5I9ZA 3LLAA 2Y8OA 4NU1A 5B7VA 4RZWA 1R1WA 2PE1A 2QLUA 4JT3A 3E93A 4UB7A 3FAAA 3WE8A 4MVFA 1ZARA 4XP0A 2X8IA 2PVYA 2OH4A 3NIEA 2JDOA 1W0XC 4YHTA 5HNBA 5FM3A 3CGFA 3CKWA 2CKOA 3QBNA 4FKIA 3HV3A 2QO2A 3DKFA 3VBWA 4BGGA 5HVKA 3C4CA 1XH5A 5FTOA 3DOGA 4OR5A 5DT0A 1XJDA 4X6RA 3QYZA 5DHJA 5EKNA 3DJ5A 4HVHA 3F66A 3ZLXA 3PY0A 3KN5A 3ODZX 2Y7JA 2YLFA 3G9LX 3KXMA 4FKPA 1WVXA 4JG8A 4QNAA 4QYFA 3JS2A 4O6EA 3BHVA 3D9VA 5KCVA 3COKA 1Y8GA 3QCXA 3SRVB 4LRKA 3H10A 2PWLA 1VYWA 4L3JA 5AP7A 3VBXA 3UDBA 3LLTA 4RPVA 4RIWA 3ZDIA 4CZTA 3DA6A 3O8PA 3RHXA 4AGCA 5AUUA 3TIZA 4E1ZA 4OTGA 3UC3A 2IG7A 5EYMA 1NA7A 3V5TA 2HELA 3CC6A 3I81A 4KSPA 3BWFA 3VBVA 1Q62A 3DCVA 3KMUA 4QMOA 1PXJA 1YHSA 2RFDA 3RPOA 2HCKA 3CE3A 4AW0A 4F64A 3WF5A 1UU8A 5EHLA 5CNNA 2BDFA 4CFNA 5LQFA 3HMIA 4EJNA 4ALVA 2CHLA 4FIJA 2WMXA 3UODA 2YDIA 1WBVA 4ITHA 4BDBA 4PMSA 3UOJA 3VNTA 4ZS4A 3GBZA 3QQUA 2Z8CA 5LMKA 2QG7A 3LKMA 5EQEA 3FSFA 4W4WA 3SAYA 3IECA 2VO3A 4CZYB 1H28A 3QLFA 4AXAA 3QKLA 4FKVA 4NM0A 4O86A 4MXCA 2RFSA 3ATTA 4QP8A 2YCFA 3F88A 3CP9A 2B52A 2BKZA 5E90A 3C7QA 3PLAE 4NYEA 4O7RA 3LMHA 3EFWA 3LVPA 5GIOE 3H9FA 3COMA 1R39A 1Q8YA 2ZYBA 4NW6A 5HCXA 5E8WA 4E4XA 5EW8A 4EWHA 5AIKA 3R30A 1JBPE 5AADA 3FZTA 2VO0A 5BQ0A 3UYSA 5JQ5A 3U54A 4I6HA 2YM8A 2IN6A 5C01A 2LAVA 4FV4A 2R64A 3FY2A 4FOBA 4EBVA 4U0IA 5H9BA 2P55A 2HZIA 3QD3A 4F9CA 4GT5A 4F9YA 5BPYA 2VAGA 5EM8A 1VZOA 4FSRA 5K5XA 5IF1A 4PP9A 3DQXA 4EQUA 2PSQA 5CF6A 5IEVA 5HD7A 3NUSA 3R2YA 2YHVA 1JQHA 2HZ0A 5FEQA 3IGOA 5F4NA 5M51A 2O64A 3TWJA 2A4LA 2BHEA 4PP7A 3DY7A 3GOKA 2VX3A 3D5VA 4D4RA 2XYNA 5IQCA 5JQ8A 1S9IA 1XHAA 4FKUA 4JRVA 4RWLA 3VUGA 5HNIX 3EKKA 4UV0A 2BDJA 1G5SA 2C6LA 4USDA 2H8HA 4QPAA 4MF0A 3R63A 3SV0A 2ONLA 4PTGA 4EOJA 4H05A 5HD4A 4RJ7A 4FYOA 4R3RA 3S1HA 4CNHA 5JFXA 4M14A 4H3BA 2Q83A 4GVAA 5EFQA 3K3IA 4FV8A 2B53A 3HAVA 1DS5A 4ZEGA 4BR3A 4RG0A 3UO5A 1REJA 2XNNA 3KULB 3NX8A 4FSQA 4MKCA 4QQ5A 3SQQA 4Z7HA 2Z02A 5D10A 3BGQA 3IW6A 3MPAA 1P4OA 4ITIA 5IA2A 4QMLA 2W4KA 4G9RA 4LOPA 5F95A 4C3RA 3A7JA 4CT2A 2HW7A 5ICPA 3DNDA 4RIYB 4TT7A 1MP8A 4BICA 2GNGA 4BCFA 4D2SA 1PHKA 2HY81 4NL0A 4DG0E 4CYJA 5KBRA 1Q3WA 2BAJA 2HZ4A 4S34A 3VBTA 1WVWA 5T6KA 1OKWA 3TJCA 3OF0A 3TV7A 3HRBA 4YJSA 4CKIA 2X4ZA 3IG7A 1OB3A 4RJ8A 4RVMA 3VS5A 2VU3A 3JUHA 3F3UA 3TZ8A 4FKQA 1VR2A 4AACA 3DS6A 4HYIA 3CY2A 3Q60A 1UU9A 2FSLX 2UVYA 3W8QA 1PXPA 3QZIA 1XH6A 3CJGA 2CLQA 4J8NA 4EH6A 3R28A 2PMIA 2WXVA 4FMQA 1YDRE 3HA6A 4YJTA 4F99A 4HGTA 5HKMA 3KRWA 3NNXA 2QOHA 4P5ZA 5CSXA 4PX6A 3ORLA 2HWOA 2GDOA 2A1AB 3BYUA 4QMXA 2RG6A 4ENYA 3KRXA 5IDPA 3QUEA 4O27B 3ORNA 1XBAA 1STCE 4I92A 4B99A 3JY9A 3MSSA 2ZB0A 4GFMA 5HO7A 2Y0AA 4WHZA 4AW1A 1XBCA 2EB3A 3GP0A 4RBLA 4GKIA 4I23A 4NIFB 3RK7A 2C5NA 2UW0A 4G9CA 3QZHA 3LFQA 4MBIA 4O0YA 3KF7A 4FEXA 4EHVA 4BI2A 3DDPA 1B38A 2ITTA 4O91A 1ZMUA 5K4JA 1PW2A 3QUDA 4BHNA 4QYYA 5IA0A 5LVNA 3QKKA 3KL8A 2HZNA 1WBWA 1YHVA 2WTCA 4AGWA 1Q61A 4S31A 3W32A 2PHKA 2ETMA 4JQ7A 3KRJA 3H0ZA 2PL0A 3HMPA 3OUNB 4UWBA 4A9TA 4TL0A 5CAQA 5K5NA 2XNOA 1FGIA 2HK5A 1CMKE 2QCSA 3OD6X 3QD2B 5CI6A 1SVHA 3BLRA 3CGOA 3LFNA 4L7FA 4RIXB 3NW7A 4DYMA 2YM5A 4QMYA 4XBUA 3UMXA 3WOWA 4AZFA 5LJJA 5M4IA 3KA0A 4EH5A 4RC3A 4C4GA 3LFAA 4C33A 4DN5A 4B8LA 3A7GA 3AT4A 1ZMWA 2R3RA 4YJOA 3BHYA 5LOHA 1OIQA 3E88A 5EQPA 4OTQA 3VRYA 4A4OA 1WBNA 1BUHA 5A46A 1FPUA 3CEKA 1FVVA 3QA8A 4WD5A 4ALWA 3ZFXA 2XNPA 3K3JA 5M53A 4I5HA 2X1NA 4J71A 3ZOSA 3C1XA 3QRIA 1YXUA 5FM2A 4IJ9A 3Q04A 3QTSA 3S2PA 4YO4A 4GW8A 2WB8A 4GFOA 5L2IA 2CDZA 4BN1A 3PFQA 4AZEA 5J1VA 3L1SA 4JBQA 3FKOA 5AWMA 3KULA 1YXTA 5KMOA 5EHOA 4YLKA 4FL1A 3AD5A 3CD8A 3N4UA 4BF2A 4B6LA 1OPJA 3QFVA 4BCQA 2V0DA 5A14A 4L01A 3EFLA 3EQCA 5D7AA 2XJ2A 2UW3A 3VQUA 3RAIA 4PNIA 4DLIA 4F0IA 4I5MA 3TDVA 3EZVA 3P23A 4IWDA 4TNDA 4XYFA 2E9UA 2C0OA 2XM9A 4PV0A 4DLJA 4HVDA 2C69A 3W2QA 4ANOA 4A9UA 4NM7A 4DINA 4KUJA 3NVKI 5GNKA 2I0HA 3QCYA 3DT1A 3FMLA 2G2HA 4K77A 4NH1A 3FJQE 4U5JA 4O0TA 1GIIA 2IW9A 5A4TA 4DT8A 2GNHA 1NVRA 3PUPA 2UW8A 3SXRA 2NRUA 2WFYA 2JAVA 4G3EA 2UW6A 3MTLA 4UWYA 4IJPA 3R8UA 5B2MA 5IQAA 3DAJA 3LXKA 2X39A 4FGBA 3DNEA 2XK9A 5HOAA 2QQ7A 4FVPA 2B9HA 3BKBA 3GOPA 3SVVA 4IC7A 4FSZA 4UMQA 4XG3A 3FLZA 3SOAA 4ACMA 4G6OA 4HYHA 4OTFA 4AT3A 5A9UA 2G01A 5C4KA 3PVWA 2FH9A 3ET7A 3L8PA 3PA5A 2HAKA 4ANMA 3BV3A 3M42A 3RKBA 5EOBA 1L8TA 3GCVA 3KXZA 4KRCA 5FG8A 5FGKA 3SD0A 5LMBA 4HGLA 3TUCA 4MF1A 3DXPA 4QTBA 1UU7A 3R02A 4IEBA 3HDMA 5AR5A 5ETAA 3ZLYA 3LZBA 3GEQA 3AC8A 3VS4A 3V3VA 3LQ5A 3MIYA 4UYAA 1H08A 5CXZA 5AEPA 1ZOGA 2HXLA 3VUKA 5KE0A 4ASXA 3GU8A 2C5XA 3R6XA 5KZ0A 2BHHA 3QTZA 4QMWA 2WPAA 2W96B 3D83A 3E7VA 4FSMA 3RAWA 3RZFA 4R5SA 3CQWA 4CCUA 4USEA 3ROYA 4ITJA 3CJFA 2G2IA 4KKHA 1IA9A 3UVPA 5FP6A 3D15A 3F7ZA 4UMPA 3IQ7A 1XR1A 2X81A 4BB4A 3OWPA 3HMMA 3MW1A 3S0OA 4XV2A 3UYTA 2V5QA 5GZ8A 3PVUA 3QZFA 3AOXA 3HKOA 5AP0A 4CFMA 2P0CA 5IEYA 2F9GA 3P79A 2PVHA 3NUNA 2E9OA 2NP8A 1G3NA 5M4UA 5HEZA 3KXNA 1QPCA 5AR3A 5AA8A 4CKRA 2W4OA 3ZO2A 4E8AA 5HICA 2CCHA 4KNBA 4LGGA 3VAPA 1L3RE 3V8SA 1Q8TA 3DK6A 4L46A 4OTPA 3BLHA 1LEWA 5HI2A 1R78A 4U9AA 5DN3A 4YP8A 5KZIA 4JAIA 5FQDC 2VO6A 1PXLA 1UWHA 4FKOA 3UNZA 1RW8A 5HG8A 4PDSA 2FUMA 4KRDA 3FMMA 4NTTA 2ZM1A 4V04A 4EK6A 4KSQA 4F9BA 4TWOA 2XBAA 4KS7A 4O0VA 3R83A 4YZMA 4A4LA 4J7BA 4BDKA 1E1XA 3G15A 3T9TA 1M52A 4YSMA 3EL8A 2GQRA 4ACGA 4ZS0A 3O96A 4D58A 4ZMEA 2ITYA 1TQPA 5AUTA 1SZMA 2BRGA 4F0GA 3WILA 5C8KA 1PF8A 4IVCA 3FLNC 3OCGA 1XH4A 2XRUA 4JX3A 4C4HA 3HUBA 3FKNA 3L8XA 3DLSA 4GJ3A 4FSWA 5DIAA 4EZ7A 4FG9A 3VN9A 4BBFA 3L8VA 3SG8A 2WAJA 2XKCA 4GUEA 3FBVA 3P5KA 1PJKA 1OUKA 3KCFA 5C1QB 3MFSA 3QALE 4D5KA 4J98A 4O83A 4L9IA 2RSVA 3IPHA 3PVBA 4CD0A 4DTKA 1OL5A 4R1VA 4N6ZA 3MV5A 5DWRA 2VTNA 2DQ7X 4PDYA 2EB2A 3R8VA 1Y8YA 2VNWA 3G33A 4XX9A 3OHTA 1V1KA 3P08A 3VVHA 4EOIA 2XIZA 4RFMA 5A54A 4XNEA 2PVKA 3H0YA 2PTKA 4KIQA 5E1SA 4BC6A 3PZHA 3QCSA 4YJNA 4K33A 1A9UA 1XH8A 3QRJA 3F5UA 3LMGA 4GIHA 4U3YA 3TDWA 4F1MA 3QXOA 3QRKA 3JVSA 4FICA 4XG9A 4C3FA 3UQCA 2R0IA 4FEWA 3SG9A 1GIJA 4BDAA 4H1MA 3DTCA 3PJCA 3PRIA 4NKAA 4G31A 3KB7A 2XM8A 1OBDA 5FUTA 4FNYA 4JBOA 2OFVA 3NUXA 4YURA 2PMOX 3POZA 4LGDA 4QYEA 4AE6A 1MRVA 4BWKA 4GT3A 2PVFA 4UWCA 3CSVA 4FEVA 3DK3A 4QQCA 2W1GA 4HYUA 3MY5A 4D2WA 4I0TA 4E5BA 1B39A 1B6CB 5TKDA 4MYGA 3IW7A 1WMKA 4L7SA 4IH8A 4ZTQA 3RWPA 5KX8A 2PY3A 5HLNA 3W10A 4I6FA 3AMBA 4C4FA 3F5XA 2BPMA 3FI2A 5CTPA 5K0KA 3UGCA 4AA4A 3ZLWA 4EOPA 1J91A 4RWKA 2F2CB 2W1IA 4EHZA 2QR8A 3AT3A 3LM0A 5CZIA 3FE3A 3RPSA 3OEFX 2G15A 2R9SA 2WOUA 2ZV2A 3FMDA 2R3GA 3UOKA 5HU3A 4QP9A 3FZPA 3EN5A 4RJ6A 4ZLZA 3U8WA 4TTHB 1AQ1A 3QQJA 1JPAA 5AR2A 1WBSA 3MH1A 2XMYA 4BHZA 1OBGA 2BAQA 4G3GA 4W8DA 3DAKA 4ONAA 2WOTA 1XKKA 1K2PA 2WQOA 4JXFA 4U97A 2GMXA 3D2KA 3NUYA 3NWWA 4AOTA 1OITA 5I5ZA 3I0OA 1OPLA 2RKUA 5C9CA 3PDTA 4XUFA 2VWWA 3PSDA 4JVGA 3UMWA 4EOOA 1P5EA 5EQYA 1OL2A 4XMOA 1UKHA 2X8DA 3TKUA 4WA9A 4L45A 2DUVA 3C5UA 4PWNA 4N6YA 1U54B 4B8MA 2OK1A 1AD5A 5J1WA 5I9WA 1W8CA 3V5PA 5CEKA 4O22A 3BZ3A 2OXDA 3BIZA 4FSTA 2FO0A 4LL5A 2C6TA 3P4KA 4QPSA 3B2WA 4RLKA 5CSHA 3R8MA 3VWAA 3HV4A 4FTKA 3NPCA 5HG7A 3OXIA 4AT4A 4L44A 3HEGA 2WMUA 3ORPA 3QX4A 4FVRA 5AIRA 5FEDA 4UMRA 3OG7A 1ZYCA 4NUSA 4U8ZA 2VZ6A 3FZRA 3OT3A 2FSOX 4ZOGA 3UIXA 5CENA 4YTCA 3ULIA 1ZLTA 3ZXTA 2H9VA 2WQNA 4A7CA 3OVVA 5CX9A 2ZOQA 4FT0A 4IFCA 4RGJA 2QOIA 4R5YA 4F0FA 3SW7A 4FEUA 5CVFA 2CJMA 5DA3A 4CXAA 2CKQA 5CZHA 3II5A 4NSTA 3PYYA 4UMUA 5EHYA 3MFUA 4OTDA 2JKKA 4MD7E 4FSNA 4MCVA 3S4QA 2F7ZE 4FTNA 1ZYSA 3AC4A 5CANA 4XP2A 3MWUA 4JR7A 5TO8A 4R8QA 5DEWA 4BY9E 5J9ZA 3MS9A 2R7IA 3R9RA 5EYDA 5CSWA 3FWQA 2WTKC 1MQ4A 5AUWA 2P4IA 5JFSA 4D1ZA 2GFSA 3BRBA 4PPAA 2IZSA 3KQ7A 2GQGA 4JL9A 3E5AA 3FQEA 3HMNA 2C3KA 3PSCA 5CF4A 2OG8A 5KKRC 3RM6A 2IO6A 3R71A 4ZMFA 2E9PA 2CMWA 2XA4A 4L43A 5BUJA 4RIWB 3QHRA 3I1AA 4JRNA 4LFIA 2YAAA 4RVTA 3WBLA 4DBNA 4UN0C 5JFVA 2ITUA 2GPHA 2X2MA 3EZRA 4IZ5A 2ITVA 2GSFA 3DQWA 4D0WA 5F94A 4YZDA 4BIEA 3ACJA 3PA4A 4CFVA 2OFUA 4PL4A 2ZB1A 4QP4A 2IVVA 4E73A 5IQGA 4GU6A 3EJ1A 4L42A 4A9RA 3RZBA 3PP1A 5C8MA 4C38A 4W4YA 5LVOA 3OCSA 2B4SB 4M15A 5CSVA 4S32A 3I6UA 3LXNA 5FRIA 4E3CA 4Y5QA 1H1WA 3MH2A 1ZYJA 4NM5A 5GZ9A 2J0MB 3QRUA 3MH0A 3QF9A 4CFWA 1GOLA 3OZ6A 3JPVA 4H3QA 2XKDA 4FV9A 3NNWA 4HCTA 4U41A 5CWZA 4E6QA 4H58A 4O7YA 3MA6A 4ZXTA 5JMSA 3UQFA 3UJGA 4R3PA 2F4JA 3PWDA 2CSNA 4MXYA 3Q4TA 2QO9A 2VWXA 3BBWA 4JLCA 4D0XA 5EDQA 2I0EA 3ZC5A 3OTVA 3OY3A 4BCMA 2OF2A 2GCDA 4IZAA 1FVRA 3A99A 4DH1A 4DGGA 4CV8A 4R7HA 2C3JA 4YUQA 4Z16A 4D4SA 3KMWA 2WTKB 5HORA 4RWJA 2A2AA 1GIHA 2B1PA 4MD9E 4EJ7A 4EZ5A 4ZTLA 5IG1A 5HTBA 1WZYA 4FKGA 3PE2A 3HRCA 5KKRB 5FTGA 4K18A 4PTEA 4U40A 2OWBA 3FXZA 1PMEA 4MWHA 3KXHA 2HW6A 3QX2A 4I5PA 3QGYA 3BBTB 2W9ZB 3UO4A 4O6LA 1BI8A 3DZOA 1U5QA 1SYKA 3UE4A 1DI9A 5ACBC 2C6KA 4DG2E 3I6WA 4E6AA 4HPTE 1EH4A 1P2AA 5BNJA 1M7QA 2UW4A 4K8AA 4FUXA 5HGIA 3WE4A 2X0GA 4O81A 4FV3A 5HNGA 3VBYA 4YTHA 5E8UA 4M13A 4PTCA 1MRYA 5IEXA 2CN8A 3D94A 4Q9ZA 3F5PA 2I0VA 3U6HA 4HOKA 2JD5A 2R5TA 1YVJA 4AG8A 1RDQE 2BUJA 2YZLA 5I3OA 2IVUA 4RX5A 3QQHA 4G5JA 4GCJA 3TNHA 4DAWA 3A8WA 3TACA 4MXAA 4P4CA 4HZSA 4IAIA 5D12A 4QYGA 4UMTA 2OBJA 3HZTA 2G9XA 4G6NA 2KULA 4OTHA 4DG3E 4X6QC 1O9UA 2BFYA 2BTSA 2JBOA 3MB7A 4XH6A 3UOHA 3NMUF 3E3BX 4W4VA 2B0QA 3ZO3A 2R3HA 4IDTA 4GMYA 4QTDA 5IUGA 4QOXA 5E8SA 4QRCA 4NFNA 1OL7A 2R3OA 5FD2A 4CMOA 2E9VA 2WIPA 4JIAA 4PL5A 4BIDA 4RQKA 3DXNA 1M14A 2WTDA 1APME 4AN9A 3CD3A 5IH4A 4QTEA 3T3UA 4KIPA 4J99A 2BZJA 3LIJA 2X2LA 5HG9A 3DBFA 3HYHA 5EYCA 3WIGA 3BWJA 3EB0A 2YCSA 4M0YA 4O84A 4GH2A 4DCEA 5JH6A 4ASDA 3ORIA 2AC3A 3CR0A 2RIOA 1NY3A 1PYXA 3QTXA 1OPKA 2OKRA 2CPKE 3VW8A 1F5QA 2OH0E 2PZIA 5EI8A 1UNGA 5T3QA 4BTFA 5BMSA 5E9EA 3EOCA 3DBQA 4A06A 3CTJA 4RQVA 4L68A 2CGWA 2P2HA 3RGFA 3PJ1A 2YM3A 4HPUE 1YQJA 4M3QA 5BUEA 2R3IA 3R00A 4IWQA 4TW9A 3MFRA 3HRFA 1URWA 3VUTA 4GSBA 2O2UA 2PZPA 3ELJA 4EOKA 3ZSHA 1V0BA 4RVLA 4UBAA 5CNOA 2PUIA 5KO1A 3TTIA 2YEXA 4ZJIA 4GVJA 5HTCA 2PVJA 1XBBA 3BU5A 3EYHA 5CVGA 4U7ZA 3O0GA 1H1RA 1ZZ2A 4CMUA 3D14A 3MYGA 4IX3A 5IQIA 2R3MA 4O0UA 5L8JA 3W1FA 4UZDA 1JLUE 4BWXA 4F09A 4EORA 1RJBA 4MX9A 4S33A 4AZVA 2CNQA 5CEIA 1JNKA 2JAMA 4FIFA 4TYHA 5AAGA 3F9NA 5M44A 1K3AA 3G90X 4JNWA 4LOQA 4FKSA 3HMOA 3K2LA 4FX3A 2QURA 3GQIA 3WF6A 4DTAA 3BE9A 2ITZA 2PE0A 2QOFA 2BZKB 3DFCB 1PMUA 2HOGA 3A7FA 3PA3A 4YLJA 3NCZA 3TNWA 2XUUA 1UVRA 5EG3A 4FT7A 4BWPA 3RMFA 3U55A 3U4UA 4E7WA 1Q3DA 5FDXA 2WTJA 3UG1A 3KK8A 2VX0A 3GCQA 4TYGA 2XZSA 4L52A 4ASEA 3FHRA 3BEGA 2CGXA 5ETCA 3G5DA 3TKIA 3C5IA 4FA2A 2UZUE 1RE8A 2YCRA 2PUPA 4C4IA 3ODYX 3F3ZA 2EXMA 2W1FA 5CT0A 2ZMDA 2W99B 4EUUA 4O7TA 4MBJA 5FXSA 4JOAA 3R8PA 2W1HA 3DB6A 5E8VA 3ALOA 4RMZA 2WMAA 1FBNA 2ZM3A 4MWIA 4QMNA 5IA4A 3BV2A 5DPVA 2R3KA 4USFA 3W2RA 5C26A 4Z7GA 4ZAUA 4LQMA 1H00A 2W5HA 4DEGA 2C0IA 5AV1A 5BVWA 2C47A 2HIWA 3F3VA 4GT4A 4GYIA 4U6RA 3AT2A 3C4XA 4AQCA 3BYMA 5B2LA 2XEZA 1W83A 4XHKB 3FQSA 3FEGA 4DGNA 3KEXA 2JFMA 3NW6A 4FL2A 5ANOA 3I60A 3MPTA 4BCHA 5I3RA 4FE2A 4IWOA 2AC5A 2R3JA 4C4EA 2QOKA 4F1TA 4CT1A 5CYIA 4TXCA 4EEVA 3EN7A 2WTVA 5AM6A 4DFXE 1H25A 3P9JA 3HP5A 3QWJA 4TRLA 3POOA 1BX6A 5AV3A 4QMZA 2FVDA 5A4EA 3TUBA 5IA5A 2IVTA 5GINE 2VTHA 2WIHA 3BHHA 2FGIA 3GUBA 3D2IA 4RT7A 2WMTA 4IMYA 5CU3A 3WZEA 3TI1A 1A06A 3H9RA 3W2PA 3OWLA 4YC3A 3U9NA 2JDTA 4U45A 3VUDA 3A7IA 4TN6A 5BVEA 4FNWA 4CFFA 2RFNA 2VTQA 3E62A 2I7QA 3BEAA 5M06A 2RF9A 3NUAA 2BRMA 4GU9A 3PG1A 3TL8A 4ERKA 4IACA 3EQRA 3ZLSA 1Q99A 3G9NA 1YWVA 5H8GA 4ZLOA 2ZVAA 2EUFB 4OGRA 4M66A 2J0LA 4DEEA 1H1QA 3IS5A 3VW6A 5IISA 4O1PA 4FV0A 1YI3A 4ANQA 2JDVA 2I1MA 3DU8A 4GEOA 4H3PA 2UZEA 4PMTA 5J95A 5IZFA 3N4VA 3FMHA 4QD6A 5BVDA 4GIIA 2UV2A 2UZLA 3O8UA 2R3PA 3GCUA 4E93A 2J5EA 4WG3A 3ZCLA 4KAOA 3C0HA 1QPDA 4E4MA 2XNMA 5M4CA 5CALA 4PMMA 2C6OA 4PRJA 5IH5A 2A19B 3O23A 2Q0NA 3CXWA 3VRZA 3NAXA 3RINA 4AFJA 3F2RA 3PVGA 3Q4ZA 4C8BA 2X7FA 4AP7A 3LCTA 5CQWA 4E4LA 4JG7A 4C36A 5DR6A 5I9VA 5KUPA 2ZJWA 4YHJA 3ZUTA 4FV6A 1IRKA 3MY1A 5AP1A 3G0FA 4KS8A 5FXRA 3LPBA 4LG4A 5DR2A 4EC8A 4YSJA 2BAKA 2G2FA 4EHEA 4J95A 3OOMA 3IW4A 3R04A 2QNJA 2OICA 2J90A 3PE1A 2P3GX 1PRYA 1J3HA 2W7XA 2XIKA 1H07A 1H0VA 3GI3A 3NYOA 2XH5A 4X2GA 5AUYA 5HX8A 5JZNA 4LRJA 4RLLA 4QPMA 5CAUA 5HO8A 3FXXA 3BHTA 4EQMA 3OBJA 2CN5A 3GVUA 3T9IA 4BDGA 2BZHB 4IAZA 4O0SA 5JN2A 1SMHA 3E8CA 3IDPA 2PULA 4F6UA 3RPVA 3BYOA 3I5ZA 2XCHA 5EOLA 4IC8A 4E26A 3HV6A 2OI4X 4O0WA 4FZ6A 2O0UA 4C59A 4YGAA 3KN6A 4DEBA 5M4FA 2OGVA 1Y6BA 2C1AA 2VV9A 3DDQA 3E63A 5LCJA 3A62A 1ZAOA 3AXWA 4I22A 2Y4PA 4IE9A 5AX9A 2BR1A 3EQFA 5FTQA 3JYAA 1UWJA 2W1EA 3LW0A 2V7AA 2ETRA 3FL4A 2BTRA 2HWPA 4Q2AA 2W5BA 4G17A 1UV5A 1ERKA 3Q9YA 3SW4A 4C34A 4FVQA 4TY1A 4E5AX 3KC3A 4EKLA 3ZM9A 3HDNA 3MJ2A 1Y6AA 4IVAA 4NEUA 3M2WA 4YJVA 5F1ZA 2JDRA 3ZU7A 2VTTA 4R3CA 4EC9A 4GS6A 3W2OA 2V55A 2XK3A 1UNLA 2GQSA 2OJIA 2YM6A 4GK3A 4U80A 2XF0A 4B7TA 2YIXA 4OTRA 2ZMCA 3NIZA 4ZY5A 5LXMA 3NZ0A 5EK7A 2PMNX 3ZBFA 1JKKA 2XS0A 4I1ZA 4RA5A 1ND4A 4FGRA 4JDIA 2OIDA 2YERA 2CLXA 1E1VA 3TJDA 3FI8A 4KBKA 5BYZA 5BUIA 3Q9XA 1Z5MA 2PPQA 4M7IA 4O0XA 2XIYA 4EL9A 1H24A 1ZY4A 3M1SA 1I44A 4PY1A 5CVHA 3QTWA 1DAWA 1RQQA 2WHBA 2R0UA 2XRWA 3AG9A 3ETAA 2IZTA 4YTIA 1BMKA 2VWVA 5E1EA 1KE9A 5IH6A 2XYUA 3GCSA 2JKOA 4HZRA 3QWKA 5J9YA 2X9EA 4WBOA 4K2RA 3UP2A 3ZM4A 4ACDA 4IVBA 4D2RA 4HW7A 4L6QA 4V05A 5BVFA 5J5SA 5CU6A 3Q2JA 4ZSJA 5HBHA 3HUCA 3W55A 2VWUA 3PG3A 5FLFA 1PXMA 4E4NA 2ITXA 4ZSAA 4M84A 2P33A 2KTYA 4F9AA 1V0OA 3PJ2A 4APPA 3FLYA 4N0SA 4G34A 4JX7A 5I9XA 5D11A 3FLQA 4CYIA 4D2TA 4FTOA 5AAFA 4QP6A 3VJNA 4F6SA 4UY9A 2JBPA 3PY1A 4FIIA 5EM5A 3ALNA 3ZTXA 1DAYA 3F69A 4AW5A 4DBXA 2XK6A 2YITA 3DBCA 3IKAA 3NW5A 4MD8E 3JY0A 4BBEA 5J87A 1GJOA 4Y5HA 4FF8A 3GQLA 3S3IA 4JBPA 3PY3A 3VO3A 4F6WA 4E6CA 2O8YA 2RL5A 3R9NA 2F2UA 3IGGA 3MVHA 4XBRA 3UIMA 5BYYA 2XNEA 1GZ8A 4W4XA 2YJSA 4CGAA 3DBEA 4EI4A 2XVDA 4C37A 1GZOA 5HZNA 2VTRA 4J97A 3IONA 5HTIA 2ITWA 4ASZA 3FMEA 3MBLA 4JDJA 2IW6A 3ORZA 2JITA 1OIYA 4IVDA 4FTQA 1FMKA 1Q4LA 2OXYA 4WG5A 2Y9QA 4JQ8A 4XCUA 3WARA 4BGQA 4JDHA 2WTWA 3H30A 4EONA 3WI6A 2Q0BA 3R1YA 3HV7A 5HCZA 2P2IA 4QTCA 3QC9A 2F7XE 2WKMA 4MXXA 3F2AA 4XG4A 1U5RA 3R7EA 4L67A 4O96A 5F20A 1O6YA 4FIEA 3GC8A 4ZSGA 4PQNA 2PU8A 2AUHA 3VUMA 2Y4IC 3SGCA 3V8WA 5CEOA 5G1XA 2VX1A 4BKZA 3MGYA 3EN6A 4KKGA 5EM6A 4FEQA 1M7NA 1OVEA 3E3PA 2XCKA 3EQPA 2YCQA 3NUUA 3IW5A 3ENMA 4BIBA 4CVAA 3QKMA 4FSYA 4ACHA 4Y95A 3JR1A 1W7HA 5IQEA 2UZOA 4FTMA 2WO6A 4FUYA 4PUZA 3R7VA 1LEZA 3TZ7A 5CAOA 2PE2A 4QMTA 4DTBA 5DT3A 2WTIA 3EFJA 5DRDA 2C6DA 3R21A 5LWNA 4LI5A 2W9FB 5LARA 3NYXA 4XV3A 3FL5A 4G3FA 3IOPA 3QA0A 2RG5A 5FDPA 4XOYA 3GU4A 3QD4A 4D4YA 2X4FA 3SC1A 3GU6A 4GK4A 2VWBA 4D9UA 2XKEA 3LFEA 3OTUA 4HNIA 4OLIA 3ID6C 3UNJA 2J0KA 5A6OA 5CSPA 3JVRA 5IU2A 3MVLA 1GZKA 5L2WA 4RJ5A 4BTKA 4KIKA 3E92A 4AN2A 4YMJA 5IPJA 4O7NA 4KIOA 2EXCX 3FV8A 2J50A 5C4LA 2VTAA 1JKTA 4H39A 5DOSA 3HVCA 4FT3A 5DGZA 4IAYA 2J4ZA 3H9OA 4LM5A 4P5QA 2B9JA 3OFMA 1OZ1A 1YI4A 1IR3A 3UIUA 3FLSA 4Y73A 3PXRA 5M07A 1KE5A 2OIBA 3O17A 4BTMA 5L2SA 4UALA 4LOOA 3UC4A 3G6HA 3LCOA 2WQMA 2QD9A 1YKRA 3BPRA 4DEHA 5TOZA 2Y4IB 2XIRA 3P7AA 2H34A 2UUEA 3F7WA 2YACA 4YZ9A 1YDTE 4LL0A 1GZNA 4G1WA 3O7LB 4O0RA 3NYNA 4GG7A 2E2BA 3Q9WA 2R4BA 2OW3A 3R7YA 4IXPA 3IW8A 5E8TA 5C03A 3D0EA 1NT2A 3GB2A 3C4EA 4IB0A 3KGAA 4I0SA 5AP5A 4AFEA 3GENA 3F3WA 4IBMA 4EH4A 1KE7A 4IX4A 4QO9A 1KUTA 3EQIA 2VNYA 2IW8A 3ORKA 4V0GA 4CV9A 2J7TA 2BIYA 3UP7A 4Q5EA 5K0XA 2UZDA 4L8MA 5FEEA 3Q9ZA 4M97A 3I0QA 5L4QA 4KINA 5IQBA 2R3QA 4RZVA 4I41A 5ETFA 4Z55A 4XOZA 3FMKA 3GU7A 3R7OA 5M09A 4JG6A 4FZ7A 4C58A 4IM3A 1ZYDA 3S00A 4ZTMA 3RNIA 4BCIA 5JFWA 4C0TA 4CSVA 4IB1A 2QU6A 2PVRA 3V01A 4CG8A 3WIKA 2PMLX 5HIBA 5CASA 4QMVA 3WZJA 4IM2A 1UA2A 4HVSA 4AS0A 4F63A 5CEQA 4IADA 5KMNA 2F7EE 3MA3A 4C57A 3BU3A 4FG7A 5HU9A 1ZWSA 2YLEA 4XS2A 1G8AA 3W33A 1JSUA 1IA8A 4RC2A 4X3FA 3RPRA 4C3PA 3GC0A 3AC2A 4RX9A 2A0CX 5EI6A 3EMGA 3KRRA 4NWMA 5H2UA 3UQGA 1CKJA 3ZC6A 5EDRA 3QL8A 1MQBA 2BILB 1J1CA 3U9CA 3D5WA 3FZ1A 2YIQA 4IAAA 1XH9A 3ATSA 2RGPA 4GUBA 3R7UA 2IZRA 4LUEA 4XG7A 1LPUA 4ZZNA 5JZJA 3CY3A 4EZ3A 4J8MA 4P90A 3V6SA 2BZIB 5EM7A 4EH7A 4YBKA 1PXKA 4ZY4A 4O7SA 4C4JA 3ORMA 1ZRZA 4FI1A 4Q9SA 3PXFA 3FZSA 4ZTHA 2OXXA 3WZDA 2ITOA 2PVLA 3U87A 4BRXA 4XV1A 3PPZA 3THBA 3ZMMA 2B7AA 1NW1A 3PLSA 4DEAA 1OECA 3B8QA 4G16A 5CI7A 4AGUA 3FI4A 2X6DA 5CAVA 3I7BA 4X2NA 1BL7A 4AZSA 5I9YA 5HLWA 1P4FA 2CKEA 4IANA 2Y6MA 4QP1A 5HBEA 5JGDA 3IOKA 1WBPA 2UZTA 3HA8A 3QQFA 5DI1A 4BCPA 3DJ7A 4RWIA 5L6WL 4AT5A 3LFCA 4MXZA 4BDCA 2XJ0A 4BCOA 3DV3A 5IMXA 3OS3A 4MAOA 1ZZLA 2E9NA 2IPXA 1QMZA 2VTIA 4IQ6A 4M8TA 3R9DA 4ANBA 3IO7A 4ZK5A 4DFLA 3RTPA 4Z9LA 3UBDA 4G2FA 3ZDUA 4FTTA 2Y6OA 1Q97A 5HHWA 1WCCA 3HX4A 3BYVA 4ANLA 1SVGA 2NNWB 1BYGA 3P7CA 5IQFA 3DXQA 3RAKA 3V5LA 2IWIA 4FZFB 3FC1X 5KNJA 4RX8A 3KU2A 5DG5A 3TM0A 4MXOA 3NR9A 4JS8A 4O2ZA 4HGEA 3OMVA 4D1XA 1XWSA 5IMEA 2JKQA 4QP7A 2WMWA 4B9DA 3FPQA 3C50A 3DFAA 4F08A 4DA5A 4WT6A 2C68A 5KMMA 1MUOA 2C5VA 4HJOA 4NCTC 5AJQA 4FTCA 2F49A 3FKLA 5E91A 3NSZA 5KMIA 4G5PA 2WELA 2BROA 2B9IA 4QYHA 2QU5A 3O2MA 2YFXA 2W0JA 1FINA 1WBTA 2J51A 3FPMA 5D41A 5AUZA 5CF5A 1CDKA 4JAJA 5IKWA 4WBBB 5KHXA 4FSUA 5BYLA 5AMNA 4AZWA 4Y72A 4F65A 5DFPA 3NAYA 4MTAA 2V7OA 1PXOA 5A3XA 3D7TA 2XP2A 3LM5A 2HY0A 4H36A 4TYHB 5K3YA 3TCPA 4YR8A 2PVNA 3DKCA 2VWZA 5L8LA 5AR4A 4DGLC 3W2SA 4EH8A 1SM2A 4RFYA 4MBLA 4DEDA 3QRTA 3EHAA 4FV2A 5E8ZA 5LVPA 2ACXA 4NTSA 3WZKA 4DH3A 1XH7A 3ZUVA 3RI1A 4I4FA 3ZEWA 4IX5A 4RX7A 5ETIA 1YXVA 3LCSA 4O38A 1PKDA 3BCEA 1H01A 4NJDA 3TZ9A 4F7SA 2GTNA 4Z3VA 4DHFA 5EKOA 5B2KA 4TPTA 4DGOA 4ACCA 5IUHA 3L8SA 3SX9A 1M2PA 1LR4A 3HV5A 2A27A 1YXXA 3QQGA 2YM7A 4TWCA 1VEBA 3BX5A 3L9NA 1ZXEA 2VTMA 3V8TA 3P86A 3TTJA 2GFCA 3AD4A 3ZZEA 2ERKA 2OZAA 2ZV7A 3Q6UA 4IDVA 3VQHA 4YTFA 3DJ6A 5HE0A 4NW5A 2DS1A 3LFSA 1MRUA 2XNGA 3G2FA 4BVUA 4M0ZA 5CU0A 5CQUA 4EBWA 4C35A 5H8EA 5M08A 3MFTA 5ACKA 4PF4A 4I6QA 5L2TA 4E20A 4MNEA 5AA9A 3NYVA 3FXWA 1PKGA 5GHVA 3BLQA 2W5AA 5BVOA 2WU6A 4HYSA 4BZNA 4LUDA 4W9XA 2FYSA 4I6BA 1OGUA 5HBJA 5GJFA 4KD1A 1VYZA 3SKCA 4AA0A 2Z2WA 4MNFA 4YZCA 2FA2A 2QC6A 5FXQA 4APCA 3MDYA 1YW2A 1K9AA 4YPDA 2PVMA 3DKGA 3ORXA 2XJ1A 2I6LA 4HCVA 4K1BA 3UG2A 4DFNA 5CT7A 2JLDA 5I0BA 5JSMA 3FI3A 3OCTA 1W84A 2XNBA 2UZNA 2B55A 2EWAA 4OAUC 3H3CA 3R7IA 3C4WA 4FIGA 4J52A 4C02A 3GXLA 2IVSA 3A8XA 3UOLA 2C5YA 1JSTA 3ZXZA 3LFFA 1SNUA 4BGHA 4F7JA 3RK9A 4CKJA 1ATPE 2YWPA 5EI2A 5HLPA 2ZAZA 2GNIA 4FKLA 4IZYA 3A4PA 1OI9A 3MN3A 4RRVA 5IA1A 1TQMA 3DBDA 1URCA 4FT5A 1P14A 3KXGA 1DI8A 4GRBA 4ARKA 1OIUA 1R0PA 4EK4A 4A4XA 4WG4A 4EWQA 2FB8A 5HIDA 3CCNA 5CEPA 3A2CA 2J0IA 4KB8A 5A4LA 4FKWA 4UX9A 3QAME 4LV8A 4DEIA 2NPQA 3PXYA 4IW0A 4CLIA 3Q4UA 3WYYA 3OCBA 4DF3A 3RK5A 1KSWA 3UPZA 3OWJA 4DGMA 2XB7A 3R7GA 4B0GA 3Q96A 4ZSEA 2I40A 1ZY5A 3UTOA 4QMQA 2ERZE 4YC8A 3C0GA 5CXHA 3W18A 4D28A 1OKZA 3QTRA 1UKIA 1JSVA 1AGWA 2HENA 4JJRA 2ETKA 3V51A 3C13A 5A4QA 2PUUA 3ANRA 4MHAA 4QP2A 3SXSA 3TG1A 1CKIA 4ALUA 4XV9A 3IDBA 4O7WA 3FMNA 5KBQA 1JWHA 3D5UA 3R1NA 2X8EA 2BDWA 5JK3A 3R1SA 3REPA 5M56A 5DEYA 4U81A 4NKSA 5KMJA 3PP0A 4IX6A 4YJQA 4P2KA 3G51A 5BVNA 5EH0A 2ITPA 4OAVB 4RSSA 3DKOA 3AGMA 3FY0A 2GS6A 2WGJA 2HYYA 4G6LA 3D7ZA 4ORKA 3PWYA 4FL3A 5CS6A 4S2ZA 3MI9A 4L00A 4AX8A 1ZMVA 4CZUA 4ZSLA 4FT9A 5ANIA 3UNKA 2WMQA 3B8RA 4U42A 4YNOA 4DCAA 4JI9A 3SLSA 3HECA 3T8OA 2QR7A 1OUYA 4E6DA 2OJ9A 2VD5A 2YIWA 3ANQA 3MVJA 2O5KA 4QTAA 3MIAA 4YJPA 4PDOA 2QONA 1CTPE 4IHPA 2EVAA 4W9WA 5DE2A 2BIKB 4I21A 2WZJA 5LVLA 5GIPE 2QOCA 2WMVA 2XKFA 4FTUA 4RA4A 5FBNC 4ANSA 4DC2A 4EK8A 4UXQA 2V22A 1REKA 4BYJA 2Z7SA 1CM8A 5BMMA 4EYJA 4FKRA 1IG1A 2W05A 1NVQA 3UZRA 5L6OA 5A4CA 3H4JA 4GL9A 3U6IA 2OF4A 2BKKA 1OMWA 3EH9A 4J96A 4NCTA 4X2JA 2VWIA 5HIEA 3RAHA 4XLVA 1PMVA 3PPKA 2C0TA 3AC3A 4KWPA 4M67A 3VUHA 1YDSE 3CTQA 3TN8A 3TZMA 3ZRMA 5BX0A 4D2VA 3UZTA 3SRVA 3RJCA 1X8BA 2ITNA 3TEIA 2Z7QA 4RJ3A 1TKIA 4XP3A 3WF7A 4KBCA 5M55A 5JT2A 3R73A 3VF8A 4X21A 5KHWA 2ITQA 5ANDA 3ZH8A 3EN4A 5HX6A 3MH3A 4ENXA 3MTFA 1Q24A 2WQEA 4IB3A 1T45A 4FTIA 2XK4A 4CFXA 3QZGA 3KF4A 2GNLA 3ROCA 3LFDA 5CLPA 2W1DA 4I20A 3OW4A 4OTWA 4CRSA 2GNFA 2JKMA 4EOLA 2R3LA 3ERKA 3MB6A 4M69B 4BDIA 4R1YA 4DFBA 3F5GA 3N4TA 4L3PA 5T68A 4C61A 3G6GA 1Z9XA 2JGZA 4Y85A 3R22A 5TE0A 3ORTA 3VS2A 4U3ZA 5JGAA 3ZONA 4B4LA 2GHMA 3FC2A 3CTHA 3MVMA 3OP5A 1KV2A 3L9MA 3P78A 4V01A 3Q4CA 4XJ0A 5AV2A 1YWRA 4AE9A 3VS3A 2CGUA 3LHJA 4CEGA 1PXNA 5AP4A 4AOIA 4WOVA 4F7LA 1A48A 3I7CA 5HG5A 1J7UA 2BALA 2GTMA 5AP2A 2C30A 4FTLA 1Q8UA 4WSYA 3HL7A 4HVGA 5GZAA 3WZUA 4CTBA 3AQVA 3KFAA 4W8EA 4GFGA 4IWPA 3RM7A 5DMZA 3E8EA 3KRLA 4IFGA 1YXSA 2UW9A 4X7QA 3RPYA 1PY5A 3K5VA 4FTJA 2C4GA 3PIYA 3Q6WA 3E64A 1GAGA 2W17A 2X9FA 5AUVA 2BRHA 2VTPA 4ZZMA 2Z7RA 4EYMA 4QQTA 3PZEA 5LMAA 3LXLA 3LXPA 1CKPA 3BQCA 2VGPA 2QOBA 3NS9A 3KKVA 3LCKA 4PDPA 4TWNA 4OT6A 4OT5A 3TNIA 4CRLA 3N9XA 3I79A 4FNXA 4HGSA 3ENHA 5J8IA 3RBWA 2W1CA 3ULZA 4DH7A 4TYIA 3VS7A 4AF3A 4FZDB 4EH3A 5JEBA 5L8KA 4DFUA 4QT1A 4EK5A 4LV5A 3GCPA 2BRNA 4RIOA 4EUTA 4N70A 2QOOA 4QNYA 2WMRA 2O63A 5B0XA 3K5UA 2UVZA 4I93A 4OBPA 5HE2A 3QUPA 2C3IB 3FYJX 2CNUA 3U51A 1FMOE 1M17A 1U46A 4IB5A 3SDJA 3ZYAA 1YOLA 2YJRA 5K4IA 1KE8A 2QO7A 3N51A 2UW7A 4O2PA 4MQ2A 4M68A 3R1QA 3ZRKA 2I0YA 2GHGA 3LFBA 3PRFA 5GJDA 3ZEPA 3R0TA 3EWHA 2C6IA 4GYGA 4X2KA 1PMNA 4BTJA 4FV1A 4RC4A 2QHMA 4TNBA 2J5FA 2JC6A 4BDEA 5EYKA 3PIXA 3LJ0A 3NRMA 1WAKA 4ZTNA 3VUIA 2NO3A 2OZOA 3L9LA 4I5CA 3FZOA 4KA3A 2BMCA 3TV6A 4PPBA 2O65A 4RIYA 4FYNA 2PUNA 4AAAA 5JRSA 1E9HA 3KMMA 3F61A 3ZO4A 4UZHA 3NNUA 4KBAA 4XRLA 4JDKA 4J1RA 5DYJA 4L3LA 4G3DA 2YDJA 3Q53A 1QPEA 5J7BA 3KY2A 4D9TA 4M69A 3UIBA 4LMUA 2B54A 3EQHA 5HE3A 3JXWA 4I3ZA 4QMMA 2QHNA 2WQBA 4AU8A 3OEZA 5AFVA 2JIIA 2JIUA 4YC6A 3FQHA 4U44A 4DFYA 1BKXA 1T46A 3TV4A 3AGLA 2GS7A 2QKWB 3MY0A 4IAKA 2LGCA 3CQEA 3ZFMA 4AW2A 1F0QA 2CKPA 4FTAA 4YZNA 2GHLA 3CLYA 1LP4A 4CQEA 2YAKA 5IQDA 2X7GA 4EK3A 4XG8A 1UU3A 2CCIA 4ID7A 2UW5A 2EXEA 3AC1A 1JVPP 1KV1A 3I4BA 4GJ2A 5FBOA 5C27A 4CLJA 2G1TA 5IA3A 2OJJA 4ZIMA 3ZZWA 2GNJA 3PSBA 4KIKB 4WKQA 5DH3A 5KMLA 3SXFA 2PYWA 1JKLA 1IAJA 2OJGA 1J7LA 5HVYA 1NVSA 5DNRA 2OSCA 4BYIA 3LOKA 3A61A 1OKYA 2OLCA 4NIFA 3O50A 4FC0A 3EL7A 4X0MA 1J7IA 3C9WA 4X3FC 3PTGA 4FKJA 3PIZA 1HCKA 5HE1A 5EW3A 5L2QA 3TNPC 4A9SA 4D5HA 4ERWA 3MESA 3PJ3A 3QQLA 4IZ7A 1UNHA 2HXQA 2BCJA 3DZQA 3NEWA 1QPJA 4CFUA 2RFEA 5IDNA 3BE2A 5H3QA 4I24A 5GJGA 2SRCA 3OROA 3VJOA 3WF9A 4Y83A 2R7BA 3RVGA 1HCLA 4AUAA 2X2KA 1XO2B 3RWQA 4R7IA 1O6KA 2ZDUA 3EFKA 2IZUA 3F3TA 5HVJA 3V5QA 3NGAA 4DE4A 4FV5A 3NDMA 4ZTRA 2C6EA 3I5NA 4RIXA 3VS1A 2UZVA 3COIA 3QCQA 4K11A 3RNYA 4BI0A 3TUDA 1YWNA 4P7EA 3E8NA 1GNGA 3F82A 2VUWA 2WD1A 4GK2A 4YJUA 3QU0A 2ZM4A 3BI6A 2YA9A 5J79A 2QODA 3CKXA 4NT4A 3ZHPC 3ZFYA 4PMPA 2J9MA 3FDNA 4QMPA 5HO6A 1Q8ZA 3PXQA 3V6RA 1PYEA 4V0GB 3QTIA 2PK9A 3OBGA 3OT8A 2ZDTA 2YN8A 3C51A 2BRBA 5D9HA 4C2VA 3OOGA 4EH9A 3RCJA 4MEDA 4LGHA 2GU8A 4K6ZA 1Y91A 2R3NA 4OBQA 1LUFA 4RJ4A 1V0PA 3DLZA 4WO5A 1TVOA 2OO8X 5JRQA 2PZRA 2REIA 2YM4A 4BDFA 3GFEA 4LYNA 4WRGA 1J1BA 4BZDA 1U59A 4HCUA 5CAPA 3LE6A 1VJYA 3R01A 3UVRA 4GG5A 4O7LA 4Y46A 1KWPA 4AWIA 5CU2A
chains in the Genus database with same CATH superfamily
3Q52A 3S95A 3BQRA 3OW3A 5IQHA 3BHUA 3UO6A 5D7VA 3E87A 4N57A 4IIRA 3BGZA 4NFMA 4PPCA 2XK7A 4Y8DA 4BBMA 4D1SA 3KVWA 3KREA 4R7BA 2QVSE 4MH7A 2JFLA 3NCGA 4XG2A 4EH2A 5F9EA 1SVEA 3EQDA 2H6DA 4X3FB 4WUNA 3ZSGA 4MQ1A 3ZRLA 3Q5IA 4UEUA 4K0YA 3BU6A 2XBJA 2UZBA 1YRPA 1HOWA 3O51A 2J0JA 1H1PA 2EU9A 3V5JA 4AOJA 5CY3A 1FQ1B 1PXIA 4A07A 5L6PA 2QOLA 4ANNA 4ZZOA 4YO6A 5J9LA 2YABA 3HGKA 3AMYA 5E92A 5DBXA 2FSMX 3UPXA 2XK8A 3CPCA 4ZLYA 3QQKA 4FIHA 4UXLA 5L3AA 3ZBXA 1S9JA 4YPSA 5J7HA 4O82A 3QHWA 3C4ZA 4F9WA 4YBJA 4WRSA 3VHKA 1DM2A 2WMBA 4C62A 4R78A 3CBLA 3W2CA 3QGWA 4YZBA 1OM1A 3LAUA 3TKHA 1OIRA 4AGDA 2QLQA 3WYXA 3C4FA 2VTLA 4FZAB 4QQJA 5BVKA 3SHEA 2VTOA 4UYNA 2R3FA 3F2NA 2YZAA 3M11A 4I4EA 4ZY6A 3P1AA 3R8LA 4JBVA 4AZTA 4BCJA 1M2QA 4YNEA 5E8XA 3HP2A 3LJ2A 5DVRA 5HESA 4JQEA 4ZP5A 1Z57A 4U79A 5ANEA 3QLGA 4AN3A 4BCKA 4BKYA 1G8JA 3R2BA 1BL6A 1Q41A 3EN9A 3SA0A 4WUAA 3R9HA 3V04A 2Z60A 4RFZA 5TT7A 3GFWA 3K54A 3W8LA 4WNPA 3ZS5A 3GT8A 1KOAA 2JDSA 5E8YA 1WFCA 4HVIA 2PZYA 5ITAA 1OL1A 2C1BA 2C6MA 2ZV9A 3IDCA 3HNGA 2J6MA 3OWKA 3QC4A 4NM3A 4WNOA 3AC5A 5AAEA 3VS6A 4EOQA 3G0EA 2QOQA 2WNTA 2JIVA 2WEVA 4XRJA 3LJ1A 3AMAA 3CQUA 3EQBA 4JIKA 4OW8A 5TR6A 4BCNA 2YWVA 2WU7A 1M2RA 5AX3A 3WF8A 2F57A 3BELA 4CTCA 2DYLA 4I0RA 1CSNA 3KVXA 4WSQA 1JOWB 4FODA 2XIXA 5DRBA 3DB8A 4BI1A 3KK9A 4YJRA 2BFXA 3FMJA 1SNXA 3Q2MA 5A6NA 3LQ3A 4K9YA 2X6EA 3VHEA 1GY3A 2VGOA 3OUKA 5I4NA 1H27A 1YHWA 3D5XA 1R0EA 3GGFA 3VC4A 2OIQA 4II5A 3DK7A 4X3JA 4FR4A 4IAFA 4EKKA 3A4OX 3MJ1A 2W1ZA 1IAHA 1H26A 3TIYA 3U4WA 4TYJA 4XEYA 1H8FA 1QL6A 3FHIA 5AV4A 2VN9A 3E8DA 4M12A 4TKSA 2C5OA 3VBQA 4BKJA 4FK3A 1OKVA 4FKTA 3HAMA 1H4LA 5HCYA 1YI6A 3DPKA 1JAMA 1FVTA 2IJMA 4I94A 4OTIA 3Q3BA 2BVAA 4X2FA 4AA5A 2H96A 3COHA 3RHKA 3D7TB 3V5WA 4XLIA 1R3CA 2VTSA 4Q5HA 3HLLA 5J5TA 4A9YA 2R2PA 2CNVA 4FBXA 4D55A 4PNKA 1XQZA 4R77A 3CS9A 5E7RA 3FLWA 2XEYA 3Q32A 2CGVA 2VO7A 3PJ8A 1O6LA 4BFMA 3T3VA 3NLBA 2ESMA 1ZOEA 2W06A 4FTRA 3BYSA 4LRMA 3EKNA 4CMTA 1QCFA 2DWBA 4E5WA 4F70A 5E4HA 4O21A 1ZYLA 5CU4A 3DGKA 3R8ZA 4TZRA 3OY1A 5M57A 5CF8A 1I09A 5LMKC 5EDPA 3QD0A 4WNKA 5DR9A 1FGKA 3P7BA 4J53A 4GKHA 5KMKA 3IK3A 4O1OA 4H1JA 3OC1A 3ZUUA 2OZAB 3ZO1A 4TWPA 3EIDA 2B9FA 1KOBA 1TQIA 2OU7A 4D2PA 2QI8A 3C0IA 3OXTA 4BZOA 3KCKA 5K9IA 3PXKA 3GC7A 3CIKA 4BDDA 1IASA 4YU2A 3RCDA 1W98A 3NUPA 4MNEB 4PL3A 3SOCA 4EQCA 5C8NA 5JGBA 5LVMA 3PXZA 3NNVA 1Q5KA 2UVXA 3VS0A 4C2WA 4D4VA 3NVMB 4L53A 3OXZA 3QYWA 4BL1A 3EQGA 3B2TA 3DTWA 5I9UA 3TXOA 5DLSA 2W4JA 5DT4A 1H0WA 3KXXA 4IM0A 4DFZE 1WVYA 2QKRA 2O3PA 5AR7A 4FG8A 3RP9A 2VTJA 3UVQA 4EOSA 5ANJA 4CCBA 1BI7A 4O7VA 4RVKA 3D4QA 4FNZA 1NXKA 4NJ3A 3O7LD 1ZOHA 4FJVA 5JKGA 2YIYA 4F4PA 3VF9A 5AUXA 4LMNA 4EHGA 1FOTA 1F3MC 2YDKA 4FK6A 3L9PA 4QMSA 2WEIA 4AXFA 4KKEA 4TYEA 1W2CA 5ANKA 5AR8A 4DT9A 3U6JA 5CEMA 4MK0A 4F1OA 4CG9A 4N4SA 1W82A 5AP6A 3BLAA 2JEDA 3W16A 3VONA 3P0MA 2FSTX 3GNIB 3LQ8A 3QXPA 4U43A 5AP3A 4G3CA 4ZJJA 4OBOA 2ONLC 2PZ5A 2V62A 3Q5ZA 5HQ0A 4CQGA 4OUCA 3O71A 1Y57A 4YLLA 5IUIA 5FWKK 1KE6A 5AV0A 3EYGA 4ZJVA 1U4DA 3GC9A 4XG6A 3DAEA 4O4EA 3QTQA 5EW9A 4HNFA 3R9OA 3GU5A 1Q8WA 1TFFA 3PPJA 4YHFA 3O8TA 4F7NA 2C3LA 3FSKA 1IEPA 4S30A 2GS2A 3BGPA 3MPMA 4BDHA 3A60A 4NZWB 2NRYA 3QTUA 4DH8A 2OJFE 4BCGA 3LCDA 5D1JA 3F6XA 4FOCA 5LWMA 2AYPA 5TF9A 1OL6A 3ITZA 4R6VA 2VWYA 1YOJA 4GV1A 4QP3A 3ZSIA 2YIRA 4QMUA 4C7TA 1H1SA 1U54A 4FV7A 1YOMA 2ZV8A 1WBOA 2J2IB 4NK9A 2UZWE 4WIHA 2QG5A 5AM7A 2WMSA 2X7OA 5G6VA 3CPBA 3E7OA 4KABA 4ZTSA 5H8BA 5ANGA 5LCKA 3VIDA 3FYKX 4DITA 4EOMA 3LMIA 1JKSA 3AD6A 3RALA 3FUPA 2Z7LA 3TT0A 1G8SA 2YISA 3TNQB 4BDJA 3ACKA 3A7HA 4JR3A 4O7ZA 2VRXA 3UZPA 4DH5A 5FP5A 4WNMA 3VULA 1BLXA 5I9ZA 3LLAA 2Y8OA 4NU1A 5B7VA 4RZWA 1R1WA 2PE1A 2QLUA 4JT3A 3E93A 4UB7A 3FAAA 3WE8A 4DDGA 4MVFA 1ZARA 4XP0A 2X8IA 2PVYA 2OH4A 3NIEA 2JDOA 1W0XC 4YHTA 5HNBA 1XMLA 5FM3A 3CGFA 3CKWA 2CKOA 3QBNA 4FKIA 3HV3A 2QO2A 3DKFA 3VBWA 4BGGA 5HVKA 3C4CA 1XH5A 5FTOA 3DOGA 4OR5A 5DT0A 1XJDA 4X6RA 3QYZA 5DHJA 5EKNA 3DJ5A 4HVHA 3F66A 3ZLXA 2X0OA 3PY0A 3KN5A 3ODZX 2Y7JA 2YLFA 3G9LX 3KXMA 4FKPA 1WVXA 4JG8A 4QNAA 4QYFA 3JS2A 4O6EA 3BHVA 3D9VA 5KCVA 3COKA 1Y8GA 3QCXA 3SRVB 4LRKA 3H10A 2PWLA 1VYWA 4L3JA 5AP7A 3VBXA 3UDBA 3LLTA 4RPVA 4RIWA 3ZDIA 4CZTA 3DA6A 3O8PA 3RHXA 4AGCA 5AUUA 3TIZA 4E1ZA 4OTGA 3UC3A 2IG7A 5EYMA 1NA7A 3V5TA 2HELA 3CC6A 3I81A 4KSPA 3BWFA 3VBVA 1G8KA 1Q62A 3DCVA 3KMUA 4QMOA 1PXJA 1YHSA 2RFDA 3RPOA 2HCKA 3CE3A 4AW0A 4F64A 3WF5A 1UU8A 5EHLA 5CNNA 2BDFA 4CFNA 5LQFA 3HMIA 4EJNA 4ALVA 2CHLA 4FIJA 2WMXA 3UODA 3TMOA 2YDIA 1WBVA 4ITHA 4BDBA 4PMSA 3UOJA 3VNTA 4ZS4A 3GBZA 3QQUA 2Z8CA 5LMKA 2QG7A 3LKMA 5EQEA 3FSFA 4W4WA 3SAYA 3IECA 2VO3A 4CZYB 1H28A 3QLFA 4AXAA 3QKLA 4FKVA 4NM0A 4O86A 4MXCA 2RFSA 3ATTA 4QP8A 2YCFA 3F88A 3CP9A 2B52A 2BKZA 5E90A 3C7QA 3PLAE 4NYEA 4O7RA 3LMHA 3EFWA 3LVPA 5GIOE 3H9FA 3COMA 1R39A 1Q8YA 2ZYBA 4NW6A 5HCXA 5E8WA 4E4XA 5EW8A 4EWHA 5AIKA 3R30A 1JBPE 5AADA 3FZTA 2VO0A 5BQ0A 3UYSA 5JQ5A 3U54A 4I6HA 2YM8A 2IN6A 5C01A 2LAVA 4FV4A 2R64A 3FY2A 4FOBA 4FRFA 4EBVA 4U0IA 5H9BA 2P55A 2HZIA 3QD3A 4F9CA 4GT5A 4F9YA 5BPYA 2VAGA 5EM8A 1VZOA 4FSRA 5K5XA 5IF1A 4PP9A 3DQXA 4EQUA 2PSQA 5CF6A 5IEVA 5HD7A 3NUSA 3R2YA 2YHVA 1JQHA 2HZ0A 5FEQA 3IGOA 5F4NA 5M51A 2O64A 3TWJA 2A4LA 2BHEA 4PP7A 3DY7A 3GOKA 2VX3A 3D5VA 4D4RA 2XYNA 5IQCA 5JQ8A 1S9IA 1XHAA 4FKUA 4JRVA 4RWLA 3VUGA 5HNIX 3EKKA 4UV0A 2BDJA 1G5SA 2C6LA 4USDA 2H8HA 4QPAA 4MF0A 3R63A 3SV0A 2ONLA 4PTGA 4EOJA 4H05A 5HD4A 4RJ7A 4FYOA 4R3RA 3S1HA 4CNHA 5JFXA 4M14A 4H3BA 2Q83A 4GVAA 5EFQA 3K3IA 4FV8A 2B53A 3HAVA 1DS5A 4ZEGA 4BR3A 4RG0A 3UO5A 1REJA 2XNNA 3KULB 3NX8A 4FSQA 4MKCA 4QQ5A 3SQQA 4Z7HA 2Z02A 5D10A 3BGQA 3IW6A 3MPAA 1P4OA 4ITIA 5IA2A 4QMLA 2W4KA 4G9RA 5BV3A 4LOPA 5F95A 4C3RA 3A7JA 4CT2A 2HW7A 5ICPA 3DNDA 4RIYB 4TT7A 1MP8A 4BICA 2GNGA 4BCFA 4D2SA 1PHKA 2HY81 4NL0A 4DG0E 4CYJA 5KBRA 1Q3WA 2BAJA 2HZ4A 4S34A 3VBTA 1WVWA 5T6KA 1OKWA 3TJCA 3OF0A 3TV7A 3HRBA 4YJSA 4CKIA 2X4ZA 3IG7A 1OB3A 4RJ8A 4RVMA 3VS5A 2VU3A 3JUHA 3F3UA 3TZ8A 4FKQA 1VR2A 4AACA 3DS6A 4HYIA 3CY2A 3Q60A 1UU9A 2FSLX 2UVYA 3W8QA 1PXPA 3QZIA 1XH6A 3CJGA 2CLQA 4J8NA 4EH6A 3NFGB 3R28A 2PMIA 2WXVA 4FMQA 1YDRE 3HA6A 4YJTA 4F99A 4HGTA 5HKMA 3KRWA 3NNXA 2QOHA 4P5ZA 5CSXA 4PX6A 3ORLA 2HWOA 2GDOA 2A1AB 3BYUA 4QMXA 2RG6A 4ENYA 3KRXA 5IDPA 3QUEA 4O27B 3ORNA 1XBAA 1STCE 4I92A 4B99A 3JY9A 3MSSA 2ZB0A 4GFMA 5HO7A 2Y0AA 4WHZA 4AW1A 1XBCA 2EB3A 3GP0A 4RBLA 4GKIA 4I23A 4NIFB 3RK7A 2C5NA 2UW0A 4G9CA 3QZHA 3LFQA 4MBIA 4O0YA 3W0RA 3KF7A 4FEXA 4EHVA 4BI2A 3DDPA 1B38A 2ITTA 4O91A 1ZMUA 5K4JA 1PW2A 3QUDA 4BHNA 4QYYA 5IA0A 5LVNA 3QKKA 3KL8A 2HZNA 1WBWA 1YHVA 2WTCA 4AGWA 1Q61A 4S31A 3W32A 2PHKA 2ETMA 4JQ7A 3KRJA 3H0ZA 2PL0A 3HMPA 3OUNB 4UWBA 4A9TA 4TL0A 5CAQA 5K5NA 2XNOA 1FGIA 2HK5A 1CMKE 2QCSA 3OD6X 3QD2B 5CI6A 1SVHA 3BLRA 3CGOA 3LFNA 4L7FA 4RIXB 3NW7A 4DYMA 2YM5A 4QMYA 4XBUA 3UMXA 3WOWA 4AZFA 5LJJA 5M4IA 3KA0A 4EH5A 4RC3A 4C4GA 3LFAA 4C33A 4DN5A 4B8LA 3A7GA 3AT4A 1ZMWA 2R3RA 4YJOA 3BHYA 5LOHA 1OIQA 3E88A 5EQPA 4OTQA 3VRYA 4A4OA 1WBNA 1BUHA 5A46A 1FPUA 3CEKA 1FVVA 3QA8A 4WD5A 4ALWA 3ZFXA 2XNPA 3K3JA 5M53A 4I5HA 2X1NA 4J71A 3ZOSA 3C1XA 3QRIA 1YXUA 5FM2A 4IJ9A 3Q04A 3QTSA 3S2PA 4YO4A 4GW8A 2WB8A 4GFOA 5L2IA 2CDZA 4BN1A 3PFQA 4AZEA 5J1VA 3L1SA 4JBQA 3FKOA 5AWMA 3KULA 1YXTA 5KMOA 5EHOA 4YLKA 4FL1A 3AD5A 3CD8A 3N4UA 4BF2A 4B6LA 1OPJA 3QFVA 4BCQA 2V0DA 5A14A 4L01A 3EFLA 3EQCA 5D7AA 2XJ2A 2UW3A 3VQUA 3RAIA 4PNIA 4DLIA 4F0IA 4I5MA 3TDVA 3EZVA 3P23A 4IWDA 4TNDA 4XYFA 2E9UA 2C0OA 2XM9A 4PV0A 4DLJA 4HVDA 2C69A 3W2QA 4I6LA 4ANOA 4A9UA 4NM7A 4DINA 4KUJA 3NVKI 5GNKA 2I0HA 3QCYA 3DT1A 3FMLA 2G2HA 4K77A 4NH1A 3FJQE 4U5JA 4O0TA 1GIIA 2IW9A 5A4TA 4DT8A 2GNHA 1NVRA 3PUPA 2UW8A 3SXRA 4DHIB 2NRUA 2WFYA 2JAVA 4G3EA 2UW6A 3MTLA 4UWYA 4IJPA 2XAOA 3R8UA 5B2MA 5IQAA 3DAJA 3LXKA 2X39A 4FGBA 3DNEA 2XK9A 5HOAA 2QQ7A 4FVPA 2B9HA 3BKBA 3GOPA 3SVVA 4IC7A 4FSZA 4UMQA 4XG3A 3FLZA 3SOAA 4ACMA 4G6OA 4HYHA 4OTFA 4AT3A 5A9UA 2G01A 5C4KA 3PVWA 2FH9A 3ET7A 3L8PA 3PA5A 2HAKA 4ANMA 3BV3A 3M42A 3RKBA 5EOBA 1L8TA 3GCVA 3KXZA 4KRCA 5FG8A 5FGKA 3SD0A 5LMBA 4HGLA 3TUCA 4MF1A 3DXPA 4QTBA 3NFFB 1UU7A 3R02A 4IEBA 3HDMA 5AR5A 5ETAA 3ZLYA 3LZBA 3GEQA 3AC8A 3VS4A 3V3VA 3LQ5A 3MIYA 4UYAA 1H08A 5CXZA 5AEPA 1ZOGA 2HXLA 3VUKA 5KE0A 4ASXA 3GU8A 2C5XA 3R6XA 5KZ0A 2BHHA 3QTZA 4QMWA 2WPAA 2W96B 3D83A 3E7VA 4FSMA 3RAWA 3RZFA 4R5SA 3CQWA 4CCUA 4USEA 3ROYA 4ITJA 3CJFA 3UDTA 2G2IA 4KKHA 1IA9A 3UVPA 5FP6A 3D15A 3F7ZA 4UMPA 3IQ7A 1XR1A 2X81A 4BB4A 3OWPA 3HMMA 3MW1A 3S0OA 4XV2A 3UYTA 2V5QA 5GZ8A 3PVUA 3QZFA 3AOXA 3HKOA 5AP0A 4CFMA 2P0CA 5IEYA 2F9GA 3P79A 2PVHA 3NUNA 2XAMA 2E9OA 2NP8A 1G3NA 5M4UA 5HEZA 3KXNA 1QPCA 5AR3A 5AA8A 4CKRA 2W4OA 4O4CA 3ZO2A 4E8AA 5HICA 4DHJA 2CCHA 4KNBA 4LGGA 3VAPA 1L3RE 3V8SA 1Q8TA 3DK6A 4L46A 4OTPA 3BLHA 1LEWA 5HI2A 1R78A 4U9AA 5DN3A 4YP8A 5KZIA 4JAIA 5FQDC 2VO6A 1PXLA 1UWHA 4FKOA 3UNZA 1RW8A 5HG8A 4PDSA 2FUMA 4KRDA 3FMMA 4NTTA 2ZM1A 4V04A 4EK6A 4KSQA 4F9BA 4TWOA 2XBAA 4KS7A 4O0VA 3R83A 4YZMA 4A4LA 4J7BA 4BDKA 1E1XA 3G15A 3T9TA 1M52A 4YSMA 3EL8A 2GQRA 4ACGA 4ZS0A 3O96A 4D58A 4ZMEA 2ITYA 1TQPA 5AUTA 1SZMA 2BRGA 4F0GA 3WILA 5C8KA 1PF8A 4IVCA 3FLNC 3OCGA 1XH4A 2XRUA 4JX3A 4C4HA 1XMMA 3HUBA 3FKNA 3L8XA 3DLSA 4GJ3A 4FSWA 5DIAA 4EZ7A 4FG9A 3VN9A 4BBFA 3L8VA 3SG8A 2WAJA 2XKCA 4GUEA 3FBVA 3P5KA 1PJKA 1OUKA 3KCFA 5C1QB 3MFSA 3QALE 4D5KA 4J98A 4O83A 2XANA 4L9IA 2RSVA 3IPHA 3PVBA 4CD0A 4DTKA 1OL5A 4AXEA 4R1VA 4N6ZA 3MV5A 5DWRA 2VTNA 2DQ7X 4PDYA 2EB2A 3R8VA 1Y8YA 2VNWA 3G33A 4XX9A 3OHTA 1V1KA 3P08A 3VVHA 4EOIA 2XIZA 4RFMA 5A54A 4XNEA 2PVKA 3H0YA 2PTKA 4KIQA 5E1SA 4BC6A 3PZHA 3QCSA 4YJNA 4K33A 1A9UA 1XH8A 3QRJA 3F5UA 3LMGA 4GIHA 4U3YA 3TDWA 4F1MA 3QXOA 3QRKA 3JVSA 4FICA 4XG9A 4C3FA 3UQCA 2R0IA 4FEWA 3SG9A 1GIJA 4BDAA 4H1MA 3DTCA 3PJCA 3PRIA 4NKAA 4G31A 3KB7A 2XM8A 1OBDA 5FUTA 4FNYA 4JBOA 2OFVA 3NUXA 4YURA 2PMOX 3POZA 4LGDA 4QYEA 4AE6A 1MRVA 4BWKA 4GT3A 2PVFA 4UWCA 3AKJA 3CSVA 4FEVA 3DK3A 4QQCA 2W1GA 4HYUA 3MY5A 4D2WA 4I0TA 4E5BA 1B39A 1B6CB 5TKDA 4MYGA 3IW7A 1WMKA 4L7SA 4IH8A 4ZTQA 3RWPA 5KX8A 2PY3A 4QDVA 5HLNA 3W10A 4I6FA 3AMBA 4C4FA 3F5XA 2BPMA 3FI2A 5CTPA 5K0KA 3UGCA 4AA4A 3ZLWA 4EOPA 1J91A 4RWKA 2F2CB 2W1IA 4EHZA 2QR8A 3AT3A 3LM0A 5CZIA 3FE3A 1ST4A 3RPSA 3OEFX 2G15A 2R9SA 2WOUA 2ZV2A 3FMDA 2R3GA 3UOKA 5HU3A 4QP9A 3FZPA 3EN5A 4RJ6A 4ZLZA 3U8WA 4TTHB 1AQ1A 3QQJA 1JPAA 5AR2A 1WBSA 3MH1A 2XMYA 4BHZA 1OBGA 2BAQA 4G3GA 4W8DA 3DAKA 4ONAA 2WOTA 1XKKA 1K2PA 2WQOA 4JXFA 4U97A 2GMXA 3D2KA 3NUYA 3NWWA 4AOTA 1OITA 5I5ZA 3I0OA 4QEBA 1OPLA 2RKUA 5C9CA 3PDTA 4XUFA 2VWWA 3PSDA 4JVGA 3UMWA 4EOOA 1P5EA 5EQYA 1OL2A 4XMOA 1UKHA 2X8DA 3TKUA 4WA9A 4L45A 2DUVA 3C5UA 4PWNA 4N6YA 3W0NA 1U54B 4B8MA 2OK1A 1AD5A 5J1WA 5I9WA 1W8CA 3V5PA 5CEKA 4O22A 3BZ3A 2OXDA 3BIZA 4FSTA 2FO0A 4LL5A 2C6TA 3P4KA 4QPSA 3B2WA 4RLKA 5CSHA 3R8MA 3VWAA 3HV4A 4FTKA 3NPCA 5HG7A 3OXIA 4AT4A 4L44A 3HEGA 2WMUA 3ORPA 3QX4A 4FVRA 5AIRA 5FEDA 4UMRA 3OG7A 1ZYCA 4NUSA 4U8ZA 2VZ6A 3FZRA 3OT3A 2FSOX 4ZOGA 2AQXA 5CENA 3UIXA 4YTCA 3ULIA 1ZLTA 3ZXTA 2H9VA 2WQNA 4A7CA 3OVVA 5CX9A 2ZOQA 4FT0A 4IFCA 4RGJA 2QOIA 4R5YA 4F0FA 3SW7A 4FEUA 5CVFA 2CJMA 5DA3A 4CXAA 2CKQA 5CZHA 3II5A 4NSTA 3PYYA 4UMUA 3W0SA 5EHYA 3MFUA 4OTDA 2JKKA 4MD7E 4FSNA 4MCVA 3S4QA 2F7ZE 4FTNA 1ZYSA 3AC4A 5CANA 4XP2A 3MWUA 4JR7A 5TO8A 4R8QA 5DEWA 4BY9E 5J9ZA 3MS9A 2R7IA 3R9RA 5EYDA 5CSWA 3FWQA 2WTKC 1MQ4A 5AUWA 2P4IA 5JFSA 4D1ZA 2GFSA 3BRBA 4PPAA 2IZSA 3KQ7A 2GQGA 4JL9A 3E5AA 3FQEA 3HMNA 2C3KA 3PSCA 5CF4A 2OG8A 5KKRC 3RM6A 2IO6A 3R71A 4ZMFA 2E9PA 2CMWA 2XA4A 4L43A 5BUJA 4RIWB 3QHRA 3I1AA 4JRNA 2XARA 4LFIA 2YAAA 4RVTA 3WBLA 4DBNA 4UN0C 5JFVA 2ITUA 2GPHA 2X2MA 3EZRA 4IZ5A 2ITVA 2GSFA 4O4FA 3DQWA 4D0WA 5F94A 4YZDA 4BIEA 3ACJA 3PA4A 4CFVA 2OFUA 4PL4A 2ZB1A 4QP4A 2IVVA 4E73A 5IQGA 4GU6A 2A98A 3EJ1A 4L42A 3RZBA 4A9RA 3PP1A 5C8MA 4C38A 4W4YA 5LVOA 3OCSA 2B4SB 4M15A 5CSVA 4S32A 3I6UA 3LXNA 5FRIA 4E3CA 4Y5QA 1H1WA 3MH2A 1ZYJA 4NM5A 5GZ9A 2J0MB 3QRUA 3MH0A 3QF9A 4CFWA 1GOLA 3OZ6A 3JPVA 4H3QA 2XKDA 4FV9A 3NNWA 4HCTA 4U41A 5CWZA 4E6QA 4H58A 4O7YA 3MA6A 4ZXTA 5JMSA 3UQFA 3UJGA 4R3PA 2F4JA 3PWDA 2CSNA 4MXYA 3Q4TA 2QO9A 2VWXA 3BBWA 4JLCA 4D0XA 5EDQA 2I0EA 3ZC5A 3OTVA 3OY3A 4BCMA 2OF2A 2GCDA 4IZAA 1FVRA 3A99A 4DH1A 4DGGA 4CV8A 4R7HA 2C3JA 4YUQA 4AXCA 4Z16A 4D4SA 3KMWA 2WTKB 5HORA 4RWJA 2A2AA 1GIHA 2B1PA 4MD9E 4EJ7A 4EZ5A 4ZTLA 5IG1A 5HTBA 1WZYA 4FKGA 3PE2A 3HRCA 5KKRB 5FTGA 4K18A 4PTEA 4U40A 2OWBA 3FXZA 1PMEA 4MWHA 3KXHA 2HW6A 3QX2A 4I5PA 3QGYA 3BBTB 2W9ZB 3UO4A 4O6LA 1BI8A 3DZOA 1U5QA 1SYKA 3UE4A 1DI9A 5ACBC 2C6KA 4DG2E 3I6WA 4E6AA 4HPTE 1EH4A 1P2AA 5BNJA 1M7QA 2UW4A 4K8AA 4FUXA 5HGIA 3WE4A 2X0GA 4O81A 4FV3A 5HNGA 3VBYA 4YTHA 5E8UA 4M13A 4PTCA 1MRYA 5IEXA 2CN8A 3D94A 4Q9ZA 3F5PA 2I0VA 3U6HA 4LV7A 4HOKA 2JD5A 2R5TA 1YVJA 4AG8A 1RDQE 2BUJA 2YZLA 5I3OA 2IVUA 4RX5A 3QQHA 4G5JA 4GCJA 3TNHA 4DAWA 3A8WA 3TACA 4MXAA 4P4CA 4HZSA 4IAIA 5D12A 4QYGA 3UDSA 4UMTA 2OBJA 3HZTA 2G9XA 4G6NA 2KULA 4OTHA 4DG3E 4X6QC 1O9UA 2BFYA 2BTSA 2JBOA 3MB7A 4XH6A 3UOHA 3NMUF 3E3BX 4W4VA 2B0QA 3ZO3A 2R3HA 4IDTA 4GMYA 4QTDA 5IUGA 4QOXA 5E8SA 4QRCA 4NFNA 1OL7A 2R3OA 5FD2A 4CMOA 2E9VA 2WIPA 4JIAA 4PL5A 4BIDA 4RQKA 3DXNA 1M14A 2WTDA 1APME 4AN9A 3CD3A 5IH4A 4QTEA 3T3UA 4KIPA 4J99A 2BZJA 3LIJA 2X2LA 5HG9A 3DBFA 3HYHA 5EYCA 3WIGA 3BWJA 3EB0A 2YCSA 4M0YA 4O84A 4GH2A 4DCEA 5JH6A 4ASDA 3ORIA 2AC3A 3CR0A 2RIOA 1NY3A 1PYXA 3QTXA 1OPKA 2OKRA 2CPKE 3VW8A 1F5QA 2OH0E 2PZIA 5EI8A 1UNGA 5T3QA 4BTFA 5BMSA 5E9EA 3EOCA 3DBQA 4A06A 3CTJA 4RQVA 4L68A 2CGWA 2P2HA 3RGFA 3PJ1A 2YM3A 4HPUE 1YQJA 4M3QA 5BUEA 2R3IA 3R00A 4IWQA 4TW9A 3MFRA 3HRFA 1URWA 3VUTA 4GSBA 2O2UA 2PZPA 3ELJA 4EOKA 3ZSHA 1V0BA 4RVLA 4UBAA 5CNOA 2PUIA 5KO1A 3TTIA 2YEXA 4ZJIA 4GVJA 5HTCA 2PVJA 1XBB