3SD0A

Identification of a glycogen synthase kinase-3b inhibitor that attenuates hyperactivity in clock mutant mice
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
350
structure length
350
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Glycogen synthase kinase-3 beta
publication title Identification of a Glycogen Synthase Kinase-3b Inhibitor that Attenuates Hyperactivity in CLOCK Mutant Mice
rcsb
source organism Homo sapiens
total genus 107
structure length 350
sequence length 350
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3sd0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3sd0A01
5HESA 3ZRMA 4CV9A 4EH2A 3F2AA 1WBPA 2QOLA 2F9GA 3QLFA 3LJ0A 3HRCA 2PVMA 3H9OA 3SXRA 1F5QA 4QPSA 2G01A 4IAAA 2X6EA 3R02A 3L8VA 3VF9A 2WMBA 4FSTA 4U3ZA 3VO3A 3IW7A 4NZWB 3UVRA 4FNZA 3KREA 3PFQA 3QF9A 4UWYA 5B2KA 1PMUA 3O7LB 4KSQA 4NWMA 4MNEA 4M13A 4UMUA 3QLGA 4DH8A 4E4XA 2W05A 2VTMA 4BI1A 2DQ7X 2R9SA 4L68A 4ZP5A 3V51A 4LOOA 3VW8A 3A7JA 4X6QC 4OTGA 4NCTA 2P55A 3CIKA 4D2SA 1F3MC 2O2UA 2CPKE 5I9YA 4QQCA 4FG7A 1ZZ2A 1A06A 1PXLA 3K3JA 4G31A 4BWXA 3SG8A 5AADA 2WOTA 4KINA 4HYIA 1PY5A 1YXVA 4FSWA 4OBOA 5FM2A 3D9VA 2ZYBA 2C3IB 1H0WA 1ZXEA 4ANSA 4IJPA 4PNIA 2CMWA 3OT8A 3R7YA 3F3UA 5IA0A 3TTIA 3U9CA 4LGGA 3MTLA 3NYOA 4C37A 2HW6A 3LXKA 4BI0A 3QBNA 2PVJA 3A4PA 3L9LA 2LGCA 2J5EA 4KBKA 2QHNA 4RC4A 4M8TA 3FMLA 1JKSA 4W4YA 2YEXA 2QLQA 2WFYA 4RIXB 2VTTA 4DFXE 4MBJA 1P4FA 4FBXA 4O7VA 1VEBA 2F7XE 2ZMCA 2O64A 3VULA 3D5UA 4OTPA 5I3RA 2PE0A 4UMQA 1UNLA 3I7BA 4O38A 4D2TA 4DC2A 5C26A 5JMSA 4AGDA 2IO6A 3AG9A 5AV4A 5LMAA 3HEGA 2BDJA 4IACA 4XBRA 2WHBA 4N4SA 4O2PA 4DTBA 3GXLA 1ZAOA 2HOGA 3DNDA 4AOJA 2VGOA 2PZYA 3F2NA 3GC8A 3KFAA 4U41A 3WZDA 5BUJA 3C0IA 2DWBA 4FKWA 3MB6A 3QKKA 5EYDA 4BBMA 1J1BA 4DCEA 2ZM4A 4FG9A 5HTIA 2A0CX 3ZM9A 5DIAA 3SC1A 4EZ5A 3AC1A 2B9HA 3D2KA 1WBTA 4NTSA 3R8MA 4OTQA 4ZTMA 1FMOE 4FT9A 4YBKA 5CEOA 3H30A 2DYLA 2RFSA 3FKNA 3QWKA 4FC0A 4FI1A 4U45A 5DR2A 5JFSA 5DA3A 5E8TA 3GB2A 4LRKA 4P4CA 1OITA 2VWIA 5AV0A 3C51A 5CASA 5IUIA 3TV6A 1YOLA 2R2PA 3QQUA 3M2WA 5AUZA 3ZDUA 4JG7A 2XM9A 4DEIA 1BI8A 3SHEA 1APME 2CGWA 2XKDA 3CY2A 3R01A 4XMOA 2HXLA 5CZHA 4EBVA 4O7YA 2WTWA 5EQYA 2FSTX 2OK1A 4C0TA 3OWPA 4IWOA 3ORLA 4QTCA 1JNKA 5HCZA 4DE4A 1A9UA 3MVJA 5CVGA 2YFXA 2WQMA 4I0SA 3VWAA 3R22A 4FYOA 5BYYA 3RBWA 4GG7A 3MPMA 2BFYA 2C6IA 3GC9A 3VUGA 1O9UA 5FWKK 1FGKA 1SVEA 4G2FA 4PV0A 2ZMDA 5LARA 3LVPA 3GCPA 2UW4A 3PY0A 2IZUA 4KS7A 3LCTA 4P2KA 1DAYA 5FUTA 5IPJA 4EKLA 4OAUC 4A06A 1WBWA 2XNPA 3ORTA 1BL6A 5HORA 3SA0A 1QPEA 4J96A 2YHVA 3V5LA 5K0XA 4FIGA 4FKVA 2QLUA 3LMHA 5M55A 2G2FA 3KKVA 4N6ZA 4YZBA 4PL4A 4BGHA 2BPMA 2XIYA 3GI3A 4WHZA 3VS0A 4ZS0A 2QOBA 4RA4A 5AWMA 1H24A 5L2SA 4BCMA 3ORPA 2YM3A 3TNPC 3ACJA 4QP9A 2YA9A 4FGRA 4PL3A 5FDPA 5TT7A 4S34A 3BE9A 3AC4A 1H27A 3FYJX 2C6DA 5ANKA 2UZVA 3NNUA 4FVRA 3ZZEA 3G2FA 4RQVA 2Q83A 3ZMMA 3CQUA 4MNEB 5CU4A 5CI7A 4UEUA 3UP7A 1JWHA 2ETKA 4BIBA 1OBDA 5FGKA 3N51A 4YSMA 4F65A 2WTJA 4II5A 4CZTA 2HZNA 1WVXA 4F0GA 4CRLA 5CAVA 3GFWA 4RIYA 3COIA 4E26A 3GU7A 4C4GA 4EH5A 2ITOA 2Y9QA 4XG7A 5HX8A 5A14A 1Q41A 3O0GA 3SW4A 2HAKA 3DBDA 4L3JA 3LZBA 3NIEA 1UV5A 2OO8X 5CALA 4YJTA 1XO2B 4MWIA 4EOMA 4DBXA 3FMNA 1WCCA 5J95A 3PRIA 4FNWA 4E3CA 1UU7A 3DQXA 1BI7A 5H8BA 1XBAA 3CQEA 4IFCA 2IJMA 4K1BA 2EB3A 2W4OA 3ELJA 4G3FA 4M66A 3UBDA 4EK4A 1RW8A 1VZOA 4FKGA 3PXYA 3W2QA 1WBSA 4U5JA 4RSSA 3AMYA 4PQNA 1G8AA 4IHPA 1DS5A 1JKTA 4IANA 4C4IA 2XJ1A 4FT7A 3HVCA 4F9AA 2PMOX 3P1AA 2VTRA 3DAJA 5HVJA 5IEXA 4S32A 2BDFA 3UG2A 4H39A 3UO6A 5E8WA 4BN1A 3B8QA 5C01A 3IW6A 4V0GA 5D10A 3NCGA 1RQQA 3L9NA 4HGSA 2W5BA 4E5WA 2OSCA 4P5ZA 3HV7A 2RSVA 3MSSA 4QP4A 5EQPA 4C35A 4CYJA 3I5ZA 2I0VA 3ZH8A 1LEZA 3OD6X 4IFGA 2OIQA 4ZSJA 5ACBC 3LXNA 4FEUA 3PY3A 4AZEA 5DRBA 4EUUA 4K33A 2UZTA 3NNVA 3FLSA 4OR5A 4R5YA 5B7VA 4USEA 1BYGA 3BHHA 3KRJA 4ENYA 4FT5A 1R39A 3NW7A 4D2WA 4E93A 3MA3A 3NPCA 3GC7A 2B1PA 3EFWA 5A54A 1L3RE 2WMAA 2BVAA 4YZNA 4IDTA 4QOXA 3AC3A 3R7UA 3U8WA 3UIMA 3BBWA 4MK0A 3E8EA 4BGGA 5LMBA 3LJ1A 3MH3A 3U9NA 4F4PA 5FQDC 3DKCA 3EL7A 1SVGA 4YC8A 2UZLA 3WF7A 1O6KA 4I23A 4I5PA 4YZCA 5AR5A 3TKHA 5EW8A 5IDNA 3ZSIA 4FSQA 3F3VA 5EDPA 4C8BA 4BTMA 3HLLA 5CAQA 2QODA 5EYCA 5H8EA 3QCQA 3UZPA 3C5UA 4HGTA 2EVAA 1NVRA 4ASXA 5J79A 2KULA 3IW4A 3P79A 4F7NA 3FZTA 3PXFA 2BTRA 4GFGA 5JK3A 3LMGA 5BMMA 1VYWA 5HX6A 5HBHA 3WBLA 1FQ1B 2XK7A 3L1SA 3Q9YA 4FGBA 3LCOA 2W06A 4F0FA 3MFSA 4JQ8A 4AFEA 3U6JA 4TWPA 5EG3A 4DFZE 1ZYSA 1M17A 1PXMA 5IA4A 4PDSA 3MBLA 3FAAA 1QMZA 2J4ZA 2C6MA 4EOQA 4DCAA 2FVDA 3QZFA 3GU4A 2VO3A 1MUOA 4DH3A 1W83A 3FSKA 3S00A 4Q9ZA 4G5PA 3R8ZA 1Q24A 1XKKA 2WTIA 2CHLA 4M7IA 4WSYA 3AOXA 3P7AA 3RZFA 4AXAA 3MFRA 3ZLSA 5AUUA 4YJNA 5JGDA 4LL5A 5JH6A 2J0KA 3A8XA 5AM7A 2W0JA 5HTCA 2IZRA 2RFDA 4FV4A 3LHJA 3V6RA 5J5SA 2JIIA 2W1ZA 3LFSA 3Q4ZA 2PVHA 2H8HA 2VTLA 3BEGA 2A2AA 4H58A 4A4OA 3EJ1A 4RIYB 4X0MA 2NO3A 4O83A 5KMIA 3R6XA 3FC1X 1PF8A 4J52A 4AN2A 1QPCA 3NRMA 4EOIA 2PPQA 4ID7A 5EDQA 4CKIA 2CGUA 3UYTA 1Q4LA 4BI2A 3QRKA 5AV3A 3R7IA 2JGZA 3MV5A 4IVCA 1OVEA 2J51A 2UW5A 1H26A 2UZEA 3U55A 2XRWA 3CE3A 3VAPA 3A99A 2YERA 3UVPA 5IA1A 3BGPA 4UV0A 4A9SA 1OPJA 3ODYX 4J1RA 3KVXA 4FSUA 5IQIA 4JIKA 5JT2A 2HWPA 3MFTA 5HO8A 2GQSA 1OIYA 4R8QA 2QU6A 5AMNA 5D11A 1H28A 4NKAA 2Y7JA 3DFAA 3W2PA 3P5KA 3F9NA 4GKIA 2QVSE 4C61A 2WMSA 3P86A 3QRUA 3I5NA 3QKLA 4I4FA 4WG5A 1YRPA 4JX7A 2RG6A 5J7BA 1NXKA 5F9EA 3IDCA 5EM5A 1CTPE 4DYMA 4FNYA 2VTIA 2C0TA 3O8PA 1WZYA 1UU9A 4LMUA 1BLXA 3TNWA 4V0GB 3FZOA 2XMYA 2W99B 2F7ZE 2PVLA 3A8WA 2J0LA 3VJOA 2RL5A 2UW8A 4JDKA 1H1QA 4IAYA 3MIYA 4L3LA 4F7SA 5L8LA 3R8PA 4E5BA 3FI4A 2H34A 2W96B 3AC5A 4YTIA 1Y6BA 4XH6A 5EHOA 4F0IA 3PXRA 3RWPA 3LQ8A 4L53A 5ETAA 3R8UA 3PZHA 5C1QB 4KRDA 2YM4A 4MTAA 1G3NA 4USDA 4YJVA 3KCKA 2XRUA 2H9VA 4AF3A 3IK3A 4C62A 2NP8A 4AE6A 3BU3A 4F9BA 4IVBA 4ZOGA 4DGLC 4CMTA 3OEFX 1YI3A 2VX0A 3FKLA 4RVLA 5I9WA 3KN6A 3FHIA 5DT0A 3V5JA 4AW5A 3MA6A 2YAKA 4BGQA 4YO6A 2IZSA 3R0TA 3WF6A 2CKEA 2HK5A 3VHKA 3WF8A 2JEDA 3OOGA 4TY1A 4QYHA 4YZ9A 3PZEA 3IQ7A 4ERWA 1V0PA 1NY3A 4BWPA 2ERKA 2I40A 3A7IA 2QOFA 4C2WA 4W8DA 4JT3A 5IUHA 4FV0A 1PHKA 2A19B 1HOWA 1SZMA 4RBLA 2XJ0A 4AG8A 2WB8A 5AIKA 4GKHA 2YCQA 4ZSAA 4CTCA 1U5RA 2Y8OA 3WOWA 4PL5A 1CSNA 5KBQA 4Y73A 3V5QA 2HZIA 4FSMA 3P0MA 4FT3A 3EQRA 2QOQA 5AP2A 1WMKA 4D4RA 3CD8A 3GQLA 4E6QA 3E3BX 4QPAA 4ACHA 2CKQA 2A4LA 4GVAA 4QMOA 4DF3A 3ZO1A 2WTKB 4I41A 2X7OA 3PG1A 3FMKA 3KF7A 4L46A 3VIDA 4YHJA 3VNTA 3VBYA 4G6OA 4CEGA 3OTVA 4J99A 2NRUA 3Q9XA 1F0QA 4I1ZA 4C3RA 4WBBB 2B9FA 2YIRA 3HYHA 3L9MA 4MQ2A 5IMXA 1L8TA 4O86A 1YHSA 4EHZA 4BHNA 4ZXTA 4YLKA 5BNJA 3GU8A 4Y5QA 2UVYA 1ZYCA 2Q0NA 3QL8A 5JRSA 5M07A 3SG9A 3PSCA 4EZ3A 3NUYA 4ZY5A 3ZFYA 3EYHA 2BMCA 4PP7A 4OTDA 3CD3A 3RWQA 4UX9A 5C8NA 3D94A 3ZLWA 4QMZA 4AZSA 3ZRKA 3ET7A 1J7IA 4E20A 2ZAZA 4ZZMA 1XHAA 5I9ZA 4G3GA 5E7RA 2PMLX 4D0XA 3DXPA 3JXWA 3ZTXA 5CANA 1XR1A 4H3BA 5EFQA 4FUYA 5E92A 3F3WA 4CFNA 4D0WA 1ZY4A 4DEEA 3TUCA 2UW0A 1GNGA 5HKMA 2PVKA 5CEMA 3C7QA 4UALA 4JLCA 3D7ZA 4E6CA 4EK6A 3Q32A 4G3CA 4YNEA 4YHTA 3Q60A 5FDXA 2IWIA 2R4BA 3S3IA 5JGAA 4IX5A 4XOZA 5CF6A 5AP5A 4TT7A 2FGIA 3GEQA 2ZV7A 3OXTA 4RWLA 2H6DA 4FIJA 3BBTB 2J0MB 4ZTLA 3KK8A 4EKKA 1M14A 5M08A 1ZOEA 4D4VA 5LQFA 1ZWSA 2PZPA 2UZNA 4ASZA 3HAVA 4O91A 3BYMA 1OIUA 5CU0A 1H1WA 2WMQA 4D1XA 1Q99A 2EXMA 1IG1A 3VBTA 4YZDA 4OTWA 3M1SA 2ITVA 3S2PA 5EYMA 2YWVA 4TKSA 5HIDA 3F2RA 3ERKA 3F3TA 1K3AA 4H05A 3G6HA 1U54B 3UNJA 2WMUA 4LL0A 4NH1A 5EI2A 5L2IA 3TJDA 5M06A 5T6KA 2WQNA 4FV5A 2X6DA 2CNUA 4FKRA 4RIOA 4TPTA 3PP0A 3WI6A 4CT1A 4U42A 2R3FA 3CXWA 5EI6A 1J1CA 3L8SA 4TYGA 3U4UA 4IM2A 3F88A 3EQCA 3Q2MA 2J7TA 3GT8A 3OMVA 3ZRLA 2AC5A 3LW0A 2YM6A 2GNIA 5E8XA 1UA2A 4WKQA 3OF0A 1UNGA 4J71A 4C3FA 4AZVA 2HY81 3QCSA 2VV9A 4C02A 2ITQA 4G6NA 3DK6A 3KK9A 3OTUA 4O0WA 1ZY5A 4K18A 3EQPA 5LVOA 4EC8A 3UPXA 4IAFA 3ZS5A 3PJ8A 3T3VA 5KBRA 3E5AA 5GZ8A 2X4ZA 2XK6A 2YIXA 5BQ0A 4QMSA 4MD7E 2XUUA 4EBWA 2WIHA 4JNWA 3FI3A 5ETIA 4YJSA 4QP1A 5CQWA 4Z3VA 4YTCA 2Y6MA 3RI1A 5EDRA 3V01A 4FR4A 5EM8A 1ATPE 2CN8A 4QP7A 5C4LA 4BTKA 2GPHA 2C6OA 2W7XA 3UNZA 5L8KA 2UW9A 4ARKA 3E8CA 4TYIA 4YGAA 3D5WA 3VBWA 3EFJA 4ACCA 1VJYA 2GDOA 2J0JA 1WVWA 2R3HA 3LLAA 2WD1A 2QO9A 2YJRA 3QFVA 4ENXA 1DI9A 4L3PA 4NK9A 4QPMA 4PF4A 2VN9A 3NUAA 3NCZA 5DI1A 2F7EE 2PTKA 3F5PA 5F95A 3BI6A 1TKIA 5FM3A 2HXQA 4E73A 4UN0C 1YWNA 3AT4A 3SDJA 5CT0A 1YI4A 5ACKA 4FA2A 4PUZA 1CKPA 2XB7A 3MIAA 3QU0A 4B4LA 2EU9A 4R3PA 3I6WA 4FEQA 2C5OA 4XHKB 3HRBA 4MAOA 5CSXA 4B99A 4C3PA 2R3GA 3FXWA 2XKFA 4RJ6A 1OPKA 4AA5A 3LKMA 5JFVA 4M69A 4EH6A 2CKPA 4RA5A 4MQ1A 5DLSA 1GZKA 2BILB 2R3PA 3TUBA 2VWBA 5KE0A 4AT5A 4MCVA 3R7OA 4BWKA 5A4CA 4CFFA 4YC6A 4FKJA 4FTQA 4JXFA 2RFEA 3R9RA 4I94A 4KA3A 1H25A 1WBNA 2CLXA 4NSTA 4F1MA 1IA9A 3CGFA 4OW8A 1ND4A 2E9OA 4RLLA 1IAJA 3F7ZA 2W1GA 3TL8A 4EHGA 2BKKA 4PDPA 2JFMA 1WBVA 4NUSA 3LQ5A 3MFUA 5FEQA 4BCKA 3JPVA 4I0RA 5IQHA 2QKRA 4ASEA 1IRKA 4QO9A 2XBJA 3KN5A 1MRYA 1M52A 3CPCA 2XNOA 4L6QA 2R3IA 4WNOA 4O7SA 2ZB0A 4CFWA 2VWWA 3K3IA 5E90A 5E8VA 2YISA 3C4WA 3OW4A 4GYGA 4M97A 4R7HA 2CCHA 4EL9A 5IISA 2YCRA 5ITAA 5AR4A 2OIDA 2QONA 4K11A 4L9IA 3TDWA 3JY9A 3CC6A 2E2BA 1GIIA 4DGNA 4GL9A 4YJQA 3MGYA 1W84A 3EB0A 4H36A 4CG9A 4YJOA 3PJCA 4OAVB 3ZSGA 3UQCA 3P9JA 2ITPA 1H1SA 5LVPA 4IZAA 3MY1A 3D14A 4O27B 3V04A 4FSZA 4QMTA 4BDHA 4CFVA 3MESA 1MQBA 3I81A 4IJ9A 5ANOA 2C1AA 2FSLX 3FL4A 3HV4A 3KY2A 5CQUA 5E8SA 5TO8A 3E7OA 3FWQA 5DBXA 2C6LA 5HE1A 3LAUA 5FRIA 3C4CA 5DR9A 4PPCA 4WA9A 5AV1A 5GZAA 3GOPA 4F6WA 5AA8A 1DM2A 4O0XA 4KKGA 4EJNA 5HCXA 4XNEA 1WBOA 2HYYA 1K9AA 3FV8A 4L7SA 1A48A 2WTDA 1CMKE 5T68A 1Q61A 4Y85A 3RPVA 5JKGA 3VRZA 1XJDA 2V62A 5HNGA 1WFCA 3P7CA 3V6SA 4L01A 5DFPA 3QC9A 4X3FC 2V7OA 3PPZA 2W1CA 4MXYA 4FVQA 1ERKA 4L00A 4XP0A 3LMIA 2GSFA 2QG5A 4JVGA 2X2KA 5EK7A 4QMWA 4EOLA 5CNOA 3SGCA 2VRXA 1PMEA 2PHKA 2PY3A 2UZUE 5HNIX 4QTBA 3T9TA 2BHHA 3RGFA 3OOMA 3V5WA 2I7QA 3TZ8A 2J50A 4NFNA 1YKRA 3BLQA 3ZEWA 3NUSA 3ORMA 4U6RA 1BX6A 4WRGA 4DLIA 4O84A 1BUHA 4PY1A 4R7BA 2ZV9A 2VAGA 2XCHA 4GCJA 3BPRA 4FTNA 5CNNA 4BCFA 2PVRA 5C4KA 5CF5A 5L8JA 4O0RA 1FVRA 5C8KA 4FZFB 3D0EA 4ITHA 1IASA 1UWJA 4XG2A 4XV9A 3W2CA 3PA5A 4DEDA 3RHKA 5FD2A 3C1XA 4DFYA 3EMGA 4WNKA 1YWRA 4F1OA 3I6UA 4JDIA 3MH2A 5A4EA 4JQ7A 3R8VA 3UP2A 4P90A 3UVQA 4U9AA 2UV2A 4YTFA 2RIOA 3AMBA 2OXYA 4JL9A 2C4GA 1JLUE 4AW0A 5IKWA 3F82A 4U3YA 3I60A 3RK7A 3ZZWA 1IR3A 5M4UA 1YDRE 4FV6A 5IA5A 1GZNA 4J8MA 1OB3A 2OKRA 2WEIA 5HBEA 2G1TA 4ZTHA 4AOIA 3LFFA 4PP9A 2O0UA 4KUJA 3U51A 4N0SA 4FNXA 5HG9A 2WTVA 4JI9A 4BCJA 4M69B 2PK9A 3FY0A 3ZFMA 2UUEA 3JVSA 4QMQA 3FSFA 2QO7A 4ZEGA 3LCKA 1REJA 4FIHA 2R3NA 2PWLA 3A7GA 2WKMA 3VQUA 3IW5A 4C2VA 4D2RA 3IW8A 4CSVA 1T45A 3UOJA 2BUJA 2PULA 2PL0A 5T3QA 4LYNA 2BZKB 1ZYDA 2W1FA 3IKAA 4JBPA 3FMJA 3GCQA 4D4SA 4F9WA 3NVKI 1UKHA 3TNHA 4CTBA 4I92A 4EYJA 3C0GA 3HV5A 4X2GA 1XBBA 4ZSGA 1P4OA 2X0GA 2C3LA 3UOHA 4QTDA 4HVGA 4BFMA 4OT5A 5F1ZA 3UQFA 1JKLA 4GS6A 4NM7A 4RFYA 4BL1A 5BVKA 4DGMA 1JQHA 3RMFA 3VJNA 5HD4A 4RIWA 3QYZA 3OCBA 5K3YA 1VYZA 2BR1A 4B6LA 2CJMA 3KRRA 4P7EA 1Q97A 3CQWA 1H08A 2JKKA 3ORNA 5BX0A 3HZTA 3E7VA 4X3JA 5BVOA 3RP9A 3GC0A 4I21A 3V8TA 4YR8A 2VGPA 1M2PA 4GU6A 3R21A 3C4XA 3QQJA 2ONLC 2XJ2A 4BR3A 2FSMX 3DNEA 4MF1A 3DXNA 4CG8A 4FEXA 1DAWA 3TCPA 4GEOA 4GJ3A 4O81A 4IC8A 2R3RA 1YWVA 4MXAA 1PRYA 2XZSA 3ZBFA 4GT5A 2IVTA 3TV7A 2JBOA 4IX3A 4FKQA 4B0GA 2PUUA 2Y4IB 3Q96A 3R2BA 3SVVA 4KBAA 4Q5HA 5DG5A 4F08A 3TKIA 3PVUA 4Z7GA 4BDCA 4Z7HA 4E6DA 3QHRA 2B9IA 4LFIA 2X8IA 3CBLA 5CENA 4MF0A 4AU8A 3QUPA 4O7TA 3ZYAA 2PZRA 1M7QA 3VS5A 4K77A 3TACA 3DV3A 5A46A 4AZFA 2YDKA 2R3JA 5A3XA 3R04A 4BZNA 4DEAA 4UMRA 3Q53A 3DBEA 4FZ7A 5I9VA 4Z55A 3KXHA 4N6YA 5F4NA 3V5TA 2BDWA 3CSVA 2OBJA 1KV2A 5CEKA 2B0QA 4O82A 2QI8A 3SAYA 2XK4A 5DVRA 2Z2WA 1OL7A 3G9NA 3UG1A 3ZLYA 3ZO2A 4BTFA 3SXSA 3CCNA 4C57A 4BC6A 2E9PA 5KHWA 4J95A 1OUKA 4FKIA 3UJGA 3UIBA 4NYEA 3E93A 5M44A 3H0ZA 3CKXA 4LRMA 2GCDA 3IECA 3PVWA 4O1PA 3R9HA 2HZ0A 4FOCA 4EOPA 3LM5A 4A9RA 3E92A 1UWHA 4RZWA 4ZZOA 1U5QA 3EKKA 3KQ7A 2XYNA 2C30A 4V01A 5HE2A 5J87A 4D9UA 5L6OA 3KF4A 5BVEA 1XBCA 2XP2A 3N9XA 3DKFA 3HDNA 4TNBA 4FTTA 3MWUA 3KVWA 3DGKA 3ZEPA 3A4OX 4FV1A 5FTOA 4FTOA 2RG5A 5AP0A 4AGCA 4CMUA 3WF9A 3UIUA 2NNWB 4BBEA 4F1TA 4HYUA 4W4XA 3NUUA 3ZUVA 3BHTA 3O8UA 2XBAA 2DS1A 3COHA 3EN5A 4G17A 1PKGA 5IQBA 5HICA 4BCHA 5LVNA 1GIHA 4AP7A 4UMPA 4FZ6A 3N4UA 3DAKA 3ORZA 1OM1A 3F6XA 4YSJA 2B4SB 3IO7A 4DEGA 4MD8E 4WOVA 1KE5A 3RM6A 2C3KA 4NCTC 4C4FA 3SX9A 4K0YA 1FPUA 3AXWA 3LXLA 3NW6A 3CJGA 3T8OA 4TW9A 2QG7A 2BRHA 4K9YA 3UDBA 3RKBA 3SRVA 2JDTA 4R3RA 3S1HA 3NYNA 4XG3A 2XCKA 3NYVA 1YVJA 3QALE 2I0YA 3G51A 4HGEA 1H0VA 4FICA 2UVZA 5M57A 2FUMA 2BAKA 5HEZA 2QR7A 3F61A 3FMMA 4WRSA 5CZIA 4EQCA 4RLKA 1WVYA 2G2HA 2ITUA 4LGDA 4WO5A 4GSBA 3UMWA 3II5A 3KRWA 2CLQA 2JBPA 3EWHA 3FL5A 3GU5A 3QHWA 3WZJA 2GS7A 3BZ3A 3U6IA 4EZ7A 3B2WA 3ZCLA 1LP4A 3A2CA 3AD4A 4XLIA 2VWZA 3MYGA 2RF9A 4PPBA 3R9DA 3V8SA 5LWNA 3W2OA 1BL7A 5JEBA 3QGWA 3F3ZA 4F6UA 1Q8ZA 4RIWB 5J9YA 1Q8UA 3QQGA 5FXRA 4ERKA 4MH7A 3CTJA 4CVAA 4F7JA 2OF4A 3NWWA 3DLZA 3NGAA 4W4VA 3WZKA 2VX3A 4AW2A 3D2IA 4MXXA 5CLPA 5L6PA 2Z60A 5HIEA 4QMLA 5EHLA 3H4JA 5JFWA 4YJRA 4BY9E 3HUCA 3BCEA 4G9CA 4ALUA 3R73A 5JSMA 4J98A 4NT4A 2BTSA 3GFEA 4AQCA 2R0IA 4EWHA 4A9TA 5HHWA 1OL6A 2GFCA 3UZRA 3HP5A 2P33A 5J9LA 2ITTA 2H96A 3FMHA 2NPQA 2GQGA 5LCJA 4ZMFA 3DDPA 4ANMA 5HVKA 2O8YA 3CJFA 2P2IA 4KRCA 4FX3A 3S95A 3VUMA 3VN9A 1PXIA 3GBZA 4MBIA 3I7CA 2OICA 3TKUA 3QD3A 4J7BA 4UXQA 2QCSA 3Q6WA 1SMHA 3FKOA 3TJCA 3W16A 3ZHPC 3B8RA 3W2SA 5AP4A 4JR7A 4K2RA 1HCKA 5DRDA 5DN3A 3G5DA 4LOQA 4X21A 3OUKA 3KXNA 1OIQA 3EN6A 4YO4A 4NTTA 1TQPA 4ZY6A 3HNGA 1XWSA 4YLLA 3TZ7A 3WE8A 4G16A 3NNXA 3AGMA 5A6NA 4F7LA 1UU3A 5IQDA 5EYKA 2VWUA 3QXPA 3BE2A 3L9PA 3LLTA 3QD0A 1U46A 4WUNA 4CZYB 2F49A 4I5CA 2OJFE 4Y8DA 3FQHA 3CP9A 5HVYA 3FLYA 3LM0A 2BAQA 4BKZA 5IA3A 4OTRA 1PMVA 3OCGA 4BTJA 3F66A 3R1YA 4I20A 4IADA 4RFZA 4U7ZA 5AP1A 2HW7A 3COMA 4MYGA 2C68A 4MNFA 4O1OA 4XEYA 4JOAA 2BZJA 5I0BA 3R28A 3HGKA 3NR9A 3POZA 4BDEA 4MXZA 1WAKA 3GCUA 1AQ1A 2WGJA 4ZSEA 3UO4A 5KHXA 5AX3A 3V5PA 4UYAA 2OXXA 4A7CA 4O0SA 1RDQE 3UPZA 2CSNA 3PSDA 4HCVA 3OW3A 3FLZA 4QYFA 4Y83A 5CAOA 4FVPA 4JDJA 1V0BA 2XNGA 2OJGA 4NM0A 5FXQA 3QRIA 4IVDA 2JKQA 2J9MA 4L52A 5J1WA 3EN9A 4AFJA 4ZIMA 4GJ2A 3UNKA 5AP3A 1M2QA 4AN3A 2W9ZB 4EUTA 2XVDA 1KE8A 2ERZE 2F57A 3C4ZA 5LMKA 2YIWA 1LEWA 1E1XA 1YDTE 2VWVA 2Q0BA 5ETFA 3R00A 4DEHA 4EWQA 1ZMUA 3MI9A 3QGYA 4XLVA 1U4DA 4HJOA 1JSUA 2V7AA 5K4JA 4XRJA 4H3PA 3R83A 3EFKA 3MB7A 5AP7A 5B0XA 3SRVB 4ONAA 4X2JA 4XV1A 2IVSA 4ZLZA 3FEGA 2GNHA 4NL0A 2ZOQA 3ALNA 3GUBA 3FHRA 3KXXA 1YXXA 3ODZX 4RG0A 4R6VA 4CQGA 3DS6A 3FLQA 3VBVA 4MXOA 4BDGA 4Y95A 1TVOA 4IX6A 4PTEA 3CEKA 3P7BA 3ZU7A 2YLFA 4GV1A 1MRVA 1Q5KA 5BYZA 4UMTA 5EHYA 4APCA 3O17A 4TL0A 3LFNA 4GRBA 4HOKA 5HOAA 3VUKA 4BKYA 4LGHA 3BQCA 4E6AA 4F64A 4Q5EA 2JC6A 3FMDA 3R7EA 2X2LA 5DYJA 4L8MA 2GTNA 4F9YA 5F20A 3FYKX 3P4KA 1DI8A 4S30A 3CKWA 3PIXA 4XG8A 3ROYA 5IH5A 3EH9A 2O65A 1G8SA 4I5MA 2YWPA 3BX5A 3R71A 4BCOA 2JDVA 4XP3A 2VO6A 3RCDA 3S0OA 2AYPA 2Y0AA 4FKSA 5KO1A 3K54A 4KS8A 2UZBA 3PJ3A 2OXDA 4U44A 4X2NA 3KA0A 2E9UA 4EH9A 3U54A 5HI2A 4HVIA 4BYJA 2GNJA 1IA8A 2JD5A 2XEYA 2JAVA 1H4LA 5CSWA 2PMNX 4NW6A 5IQFA 3FZPA 3F7WA 3V3VA 3SQQA 1V0OA 1GZ8A 3FE3A 4JJRA 3BLRA 4QP8A 2X39A 3Q3BA 5CY3A 4HYHA 3RK5A 4GW8A 3O71A 3PIZA 1LUFA 3PYYA 2EXCX 4QTAA 4ZAUA 1ZARA 4NFMA 3MY0A 3OBJA 5KKRB 3KRXA 5BVWA 4DGGA 4TXCA 5KZIA 3E8DA 4F99A 2LAVA 2I6LA 3KMUA 2W17A 2OJJA 5A4QA 2WXVA 3NAXA 3HV6A 4RT7A 3EHAA 5AUVA 4AGUA 1ZOHA 2ZJWA 3D15A 4KIQA 4V05A 3R7VA 4I3ZA 3FDNA 3T3UA 3QKMA 5C8MA 3WF5A 3ACKA 3HV3A 2BIYA 5CF8A 4CLIA 2W4JA 4DFLA 3SOCA 5L2TA 3JR1A 3VS7A 4YLJA 2GMXA 3IGGA 4IC7A 4PNKA 2QQ7A 5CEPA 2BCJA 3MPAA 3AQVA 5DHJA 1YXSA 1YQJA 3DJ7A 3TXOA 4DG3E 3LFCA 2EWAA 3N4VA 4O21A 5AEPA 3HMPA 2OFUA 4GMYA 4IM3A 4M0ZA 2XH5A 4ALVA 2VTOA 4ZTQA 4QMUA 3VS6A 4R1YA 4ZZNA 4OTIA 1MRUA 2X8EA 3JY0A 5IMEA 2WTKC 4IM0A 4APPA 3LOKA 5ETCA 4DINA 3GNIB 3UZTA 1R0PA 2WU6A 5L6WL 2BKZA 3L8XA 2GNGA 1Z57A 1JVPP 3DQWA 4L44A 4H3QA 4NKSA 3HKOA 4X3FA 3SD0A 4DH5A 3RAIA 3D7TA 4D2VA 3POOA 3AT3A 3FZRA 3M42A 3EQFA 4C59A 5I9XA 2BRMA 2CN5A 1Q8YA 3G90X 3H10A 4JBOA 4JRVA 4M68A 3R7GA 4DHFA 5AA9A 4OTFA 3QD2B 4JG6A 3RPOA 3LPBA 4AACA 4CYIA 1ZRZA 3QCYA 1OL1A 2XNBA 2NRYA 3LCDA 3ATSA 5KMOA 3PXZA 5C27A 1GOLA 4CNHA 4GUBA 3GCVA 3VBXA 3BYSA 4RC3A 4FKTA 4GIIA 5DE2A 3HRFA 5GZ9A 3ZC5A 2RGPA 3F5XA 4EJ7A 1E1VA 3KCFA 3E8NA 2YN8A 3NAYA 3V8WA 4LV5A 3WARA 1PXJA 2BRNA 4J53A 2YIYA 5JZNA 2AUHA 3ZM4A 4FT0A 1H00A 5CXHA 3U6HA 1JAMA 1Z9XA 2R3LA 4CT2A 5I4NA 5AR3A 4LRJA 4XX9A 4IW0A 5CEQA 4FODA 4C38A 4OBPA 5TKDA 2OZAA 2OJ9A 4IAKA 3OT3A 4XS2A 5TR6A 5EQEA 4RGJA 2CNQA 2C5VA 4WG3A 3VF8A 2R64A 4IWPA 3OXZA 3EQHA 4BVUA 3KULA 4MVFA 5FP5A 3BIZA 3FXXA 1Y57A 2IW9A 4ANOA 4B9DA 2P4IA 1CKIA 3PLSA 5E8ZA 3Q5IA 4CLJA 5DT4A 1JOWB 1GJOA 3Q52A 3EKNA 1ZYLA 4UWBA 5TF9A 5D12A 4GIHA 5FTQA 3W1FA 2HY0A 1ZLTA 3PXKA 2V0DA 4ZTRA 4O22A 2OZOA 3KXMA 4XG6A 5E8UA 4LQMA 2ZDTA 5ANEA 4WT6A 2HENA 3KL8A 3MPTA 2J6MA 3A62A 4QTEA 4QQTA 2BIKB 4EC9A 3PG3A 3A7FA 4FTKA 5H9BA 1OI9A 1V1KA 2FO0A 3E3PA 2GU8A 5HQ0A 4KABA 3MJ1A 2VTSA 1R3CA 2C1BA 1PXNA 2VTAA 5C03A 2ZM3A 4CV8A 3NMUF 2YIQA 3R9OA 3DBFA 3PP1A 3UQGA 2XYUA 4G34A 4HW7A 3BYVA 4ZTNA 4BDDA 1GIJA 4WD5A 2CGXA 1T46A 4O7NA 3Q6UA 4MD9E 4XJ0A 2C5YA 2GS6A 4RQKA 4FTUA 2A1AB 4J97A 2FSOX 4RJ4A 4I6QA 1OPLA 5E4HA 4ITJA 5JZJA 4HPTE 4GK2A 5HIBA 4PMPA 2Y6OA 3E64A 5KMLA 2ONLA 4CZUA 3DA6A 3AT2A 4RWIA 3EYGA 4P5QA 4RX5A 4KBCA 2HELA 4FK6A 2FB8A 3ANQA 4PWNA 4LV8A 2E9VA 5IH6A 1I09A 4A9UA 2G2IA 4W8EA 4ANQA 3FPQA 1KOBA 3E63A 3SXFA 4XRLA 3H9FA 3QTIA 3EL8A 3AD6A 4IB3A 3TZ9A 1Q8TA 2HIWA 4FKLA 5AFVA 2CKOA 3QZIA 2Z7LA 3EN7A 3LIJA 2C6KA 2YM7A 3OBGA 4OUCA 4RRVA 5IA2A 3C0HA 3D5VA 3FC2A 1IAHA 3VS2A 4FV2A 1FMKA 1ZMVA 4DT8A 3KC3A 3UODA 2V55A 5KX8A 4D4YA 2X9FA 4EONA 4EI4A 3EQGA 4EH4A 2KTYA 3PA3A 4MWHA 4AUAA 5FBNC 4EYMA 5M53A 2E9NA 3DTWA 4IX4A 3D7TB 4QP3A 5ANJA 4EH3A 4QP2A 5K9IA 2G15A 4X6RA 2GS2A 3QZHA 5CSVA 4FG8A 4A4XA 3HMMA 4KWPA 4EK8A 4EHEA 4WIHA 4ZLYA 5FTGA 5AUXA 3NUPA 3C4EA 4M3QA 5I5ZA 1OKZA 4B8MA 4AAAA 3SLSA 2R3KA 4EH8A 3EQBA 1YHWA 3EQIA 3IONA 5HZNA 3RJCA 4BKJA 3CS9A 4MHAA 4D5KA 3C13A 3SW7A 2XF0A 4IQ6A 4TWCA 1FOTA 3DKGA 2XNNA 5EM6A 3DOGA 4PMMA 4YPSA 3DPKA 4Z9LA 5DWRA 5J5TA 4NIFA 5CU6A 3QWJA 3VUTA 4YJUA 2UZOA 1UVRA 3EIDA 3UE4A 4PX6A 5E91A 1OBGA 3DZQA 2FA2A 3QAME 3FI8A 1FGIA 2AC3A 4A9YA 4CQEA 5GJFA 2OZAB 5HBJA 3VW6A 5EI8A 2PZ5A 3OS3A 2UVXA 3Q4TA 4ZJJA 4XG4A 2JITA 2R7IA 3OROA 2WOUA 5HE0A 4C7TA 3G33A 2QOHA 2V5QA 2XKEA 4BDAA 4HVDA 4IBMA 1FBNA 3LE6A 1CKJA 3HUBA 4H1MA 3WZUA 4B7TA 3KULB 4S31A 1M7NA 4C4HA 5F94A 4F09A 5IQEA 2J5FA 4LG4A 4U97A 4WBOA 4ALWA 4D9TA 3FUPA 1H01A 3BKBA 4CXAA 3NZ0A 5GNKA 2OWBA 5FEEA 4CGAA 1O6LA 4R1VA 4TN6A 4KKHA 4AZWA 2YABA 1E9HA 3OY3A 3TIYA 3DDQA 3ZBXA 4M14A 3UIXA 2WAJA 3AC2A 3MH1A 1W7HA 5M4CA 4KAOA 2PE1A 3RTPA 5BVDA 2B52A 5L3AA 4KD1A 3LQ3A 2QO2A 3RK9A 1PMNA 2XK8A 4TYHA 4FEWA 2CDZA 3G0FA 4FIIA 5IF1A 3MVHA 1P5EA 3ITZA 4IWQA 2A27A 3OHTA 2BRGA 3BU6A 3ULIA 4L43A 2XNEA 5C9CA 3KMWA 2QHMA 4JIAA 4ANNA 4EEVA 2PSQA 2OIBA 1SNUA 5CS6A 2VNWA 4C4EA 5B2MA 2R5TA 2UW7A 2XEZA 3FQEA 3HMNA 4FSNA 1NW1A 4RVMA 3TT0A 1PXOA 1JKKA 1QCFA 4IB5A 3OEZA 4TZRA 5EH0A 3SV0A 5L2WA 3GP0A 3S4QA 5CX9A 5EKNA 3C5IA 3DXQA 4NJDA 3ZOSA 1W98A 4HZSA 4CCUA 5ICPA 4ZY4A 2ACXA 5JQ8A 4IB1A 5JN2A 4FL3A 2JIUA 3PE1A 2C3JA 3RAHA 5K5NA 2ESMA 3MDYA 3OFMA 3G15A 3Q9WA 1Q8WA 4IH8A 2YACA 4IVAA 4BZDA 3QA8A 2OGVA 4OTHA 2ITNA 3DFCB 3P78A 2VUWA 5CU3A 1JPAA 3OWKA 4FL1A 4UYNA 2B7AA 2SRCA 1MP8A 2R0UA 5J9ZA 3QQLA 4N70A 3A7HA 4BCNA 3DBCA 4JQEA 3UC4A 2C5XA 3R30A 4MEDA 4ACGA 5KMKA 3UOKA 3QQKA 2P2HA 5H8GA 5CSHA 5AR8A 2WZJA 3AC8A 5LVMA 2Y4PA 3Q2JA 3JVRA 3EZRA 3FPMA 4KIPA 4IB0A 3LFQA 4R7IA 2I0HA 4E1ZA 1OL5A 4U79A 3C50A 4PTGA 3DY7A 5AP6A 1Q3WA 4X2KA 3MW1A 4BRXA 5D7AA 3BHVA 4FIFA 4ASDA 5BUEA 5M56A 4CCBA 4DH7A 4FV7A 3RPYA 5ANDA 3VBQA 3RAKA 2X81A 3NS9A 1S9IA 1KE9A 3QX2A 4FKUA 3VS1A 3ZUUA 5G6VA 4BF2A 2WU7A 5IU2A 2Z02A 4JR3A 3ANRA 5EW9A 4GT3A 5CTPA 5EW3A 1CM8A 1YXUA 3IOPA 3QTRA 1P2AA 3EN4A 4AW1A 2B53A 2PU8A 4NIFB 3SKCA 3LFBA 4NM3A 4JG8A 4W4WA 5AR7A 1Y6AA 2X9EA 3Q4UA 4YTHA 3Q5ZA 4QYEA 5K5XA 2YZAA 3WIGA 3OG7A 2F4JA 2BZIB 4RX8A 3QYWA 3NEWA 4LI5A 3WIKA 5DT3A 2WPAA 5HG7A 5HG8A 4BYIA 4YBJA 5DMZA 2PMIA 5DOSA 4EH7A 4IXPA 2VNYA 3ORXA 5AAEA 4O6EA 4BB4A 3Q4CA 4FSYA 4KKEA 2OLCA 3EFLA 4N57A 1XH9A 3TDVA 2UZWE 3KMMA 1IEPA 1TQMA 3B2TA 3IPHA 4G3DA 3TZMA 3BELA 4A4LA 2ZB1A 1RJBA 3PIYA 4BCIA 3QCXA 4W9WA 3RNYA 3U87A 1Q62A 3FXZA 4EK3A 3C4FA 2WEVA 5A6OA 2BFXA 3E87A 2C0IA 4I93A 3CTHA 3RZBA 3DKOA 2Z8CA 3VS4A 5CWZA 2WQEA 4QT1A 4KB8A 5HLNA 3NX8A 1PYXA 2GNLA 1B39A 2W1IA 2YCFA 1W82A 3D4QA 4QMPA 4FF8A 2X1NA 2QOKA 2OU7A 2P0CA 3MS9A 3BV3A 2WMTA 4J8NA 3PUPA 4YP8A 2O5KA 1B6CB 4FE2A 3R2YA 1J7UA 4F63A 1KWPA 2VTPA 3FLNC 4QQJA 4YNOA 2C0OA 2HCKA 4WNPA 2EXEA 2OJIA 5DEYA 2YDJA 4TYHB 2Z7QA 1H1PA 1J91A 4LUEA 3QTQA 2O3PA 2F2UA 5JFXA 5CSPA 4F9CA 1OZ1A 4M84A 4CFMA 4DBNA 2Y4IC 2VD5A 2Z7SA 4HVHA 5DGZA 2VO0A 4B8LA 2WMRA 4E7WA 5M4FA 5M4IA 3DBQA 3GENA 4FZDB 3PRFA 1KOAA 3FY2A 1CDKA 5AR2A 4DFNA 4AS0A 3NUXA 3WYYA 4IAZA 3DAEA 3W8LA 3E62A 2QURA 5DPVA 1BKXA 1YW2A 3BWJA 2EB2A 4JBVA 4PTCA 5BUIA 5CT7A 5GIOE 4FZAB 3RNIA 4ZTSA 3VS3A 3JS2A 4LUDA 4TWOA 5HO7A 2CCIA 2QNJA 3ZLXA 3HA8A 1KUTA 3QA0A 3VUHA 4USFA 1REKA 2GTMA 3PPKA 2PUIA 4YU2A 4FKOA 1NA7A 4D1ZA 2GHGA 3VUIA 4DT9A 2EUFB 1S9JA 5IG1A 4G5JA 5L2QA 3RVGA 2GHLA 2OF2A 2W1EA 4X7QA 4JS8A 4NM5A 5LCKA 4FUXA 4DG2E 3TEIA 5A4TA 4AWIA 3DU8A 3R1QA 3TN8A 3BU5A 3CTQA 4JX3A 4RWJA 4U8ZA 5DR6A 2W5AA 3PSBA 5ANIA 4DAWA 4YURA 5E8YA 2GNFA 3KXGA 2Z7RA 4FTRA 3CR0A 5HD7A 5I3OA 3W8QA 5LWMA 1P14A 2XK9A 3GQIA 3NUNA 4RX7A 4K6ZA 3O8TA 2P3GX 4UXLA 2XK3A 4W9XA 3CPBA 3F69A 4QMYA 5EOLA 4PMSA 4ANLA 4BHZA 4AA0A 3I1AA 3RHXA 4BBFA 4M0YA 4F6SA 4IZYA 3HMIA 2QKWB 4MX9A 3ZXZA 2XIZA 3PY1A 2JDSA 3G6GA 5D7VA 3RINA 3QTUA 4I5HA 4L45A 4XOYA 4KIKA 4BCQA 3NYXA 4YUQA 3UMXA 3PTGA 1LPUA 4FOBA 4GU9A 5HCYA 2FH9A 4WG4A 3R63A 2ZV2A 4LOPA 4O7LA 2B9JA 3QUEA 3W32A 2YLEA 5IEYA 3RM7A 3PVGA 4BDFA 2VO7A 1W8CA 1URCA 4IE9A 3MH0A 4FV3A 4CRSA 4EORA 5JRQA 4FKPA 5M09A 3G9LX 3DK3A 4RPVA 4HCUA 4G3EA 3KEXA 3OP5A 4R3CA 4JAIA 4BDBA 3DB6A 2GQRA 4CFXA 5HU3A 3QTXA 3AD5A 3BGQA 2ITYA 3FLWA 1M2RA 3QZGA 4MKCA 5AIRA 3MVLA 4IWDA 4JDHA 1U59A 4CKJA 3OY1A 4CMOA 2VX1A 3R8LA 3OVVA 2PZIA 4UZDA 5CF4A 1UU8A 2OFVA 4FTLA 4QP6A 3TNQB 5E1SA 3UGCA 2YZLA 2YAAA 4KSPA 1GAGA 2C6TA 3PVBA 2GHMA 2ETRA 3GU6A 4OBQA 3PXQA 3UTOA 4E4NA 4GVJA 4DTKA 5HLWA 4RX9A 5B2LA 3E88A 3FJQE 1MQ4A 1G5SA 2ZV8A 3IOKA 4AOTA 3GVUA 5BPYA 2F2CB 3GCSA 3ZONA 2PVFA 1FVVA 5CXZA 3HAMA 4RZVA 4QYYA 1YDSE 4XYFA 3RAWA 3ZO3A 1UKIA 4NW5A 4AT3A 4PPAA 4IDVA 5J7HA 3IDBA 3ZXTA 3ETAA 4UB7A 4WSQA 2WMWA 4AT4A 3TIZA 3FI2A 3UOLA 5AX9A 3W55A 4BDIA 2CGVA 4ZJIA 3ENHA 3H9RA 3TWJA 2R7BA 3COKA 4DGOA 3A60A 4K8AA 1YOMA 2YM8A 3TV4A 3W33A 1OMWA 4BCGA 3WILA 2C6EA 2CNVA 3OCSA 3PLAE 2C69A 3FMEA 1K2PA 3C9WA 3NVMB 3P23A 5GIPE 2HZ4A 4S33A 4PDYA 3KRLA 3MVMA 5KMMA 5J8IA 3QX4A 4FV9A 4NJ3A 3ALOA 4YZMA 3I79A 3I4BA 3QC4A 4GT4A 4YJPA 1AD5A 4UBAA 1SYKA 4ZK5A 3TI1A 1R1WA 2XIKA 2ZM1A 3DT1A 3VUDA 1XH4A 2VWXA 5CVHA 2HWOA 3QQFA 3LXPA 4XUFA 1W0XC 3WE4A 1OIRA 3ROCA 2BZHB 3O2MA 1XH6A 3MN3A 4QMMA 1R0EA 4L42A 1X8BA 1ZYJA 3M11A 1PW2A 3I0OA 3ATTA 3QTWA 5I9UA 3FZ1A 1U54A 2VU3A 2J2IB 5BVFA 3ID6C 4FMQA 4MXCA 2IVUA 4XBUA 2IW8A 2DUVA 3O50A 5D1JA 3DJ5A 3T9IA 4DH1A 3VVHA 3PA4A 4U40A 4GFMA 3QTZA 5DH3A 3MTFA 3OC1A 3VRYA 4RJ5A 5AJQA 3O7LD 5GINE 3PJ1A 3DCVA 1URWA 4RJ3A 3LJ2A 5CAUA 5GHVA 3GGFA 5CU2A 3IG7A 4OT6A 1QPDA 2JIVA 2WELA 4A07A 5LOHA 3FZSA 4LMNA 3QRTA 3WZEA 3I0QA 4RC2A 4D2PA 4EQUA 5K4IA 4FEVA 4LM5A 3TNIA 3ZDIA 3HDMA 1Q3DA 1ZMWA 4U80A 3PJ2A 3AGLA 3EQDA 3BEAA 4U0IA 5LXMA 4U43A 1PXKA 2OH4A 3NDMA 2PVNA 4KIKB 4QNAA 4XV2A 4D28A 1STCE 5CYIA 4YHFA 5AUYA 2PUPA 1YOJA 3VHEA 5EOBA 2R3OA 3JUHA 3LFEA 3THBA 1OL2A 1NVSA 2XA4A 3L8PA 4DFUA 4O0TA 3RPRA 5HLPA 2PE2A 1XH8A 4HNIA 2X2MA 2REIA 3Q04A 4EOKA 3MY5A 3BLHA 4IIRA 5A4LA 3BHUA 4O2ZA 4L7FA 5TOZA 2V22A 3CY3A 1LR4A 3FQSA 4DG0E 2BRBA 3RALA 2VTNA 4HVSA 3KGAA 1JSVA 4RFMA 4DITA 3WYXA 5KZ0A 4BZOA 4C34A 5JGBA 4R78A 4V04A 4M15A 3MJ2A 1Y91A 4O6LA 5AAFA 5JQ5A 1Z5MA 2VTHA 4G9RA 4YMJA 3FBVA 2IG7A 4Q2AA 4R77A 2QOOA 4RJ7A 3NSZA 3ZFXA 1KSWA 2YITA 2ZVAA 2YDIA 4WUAA 3CGOA 2W1DA 3O23A 4TWNA 3DB8A 5CI6A 5L4QA 2IPXA 4Y72A 4GUEA 2JKMA 4KIOA 3W10A 4Y46A 1GZOA 5GJGA 5KUPA 2WMVA 2O63A 4ACDA 1JBPE 4O0VA 5FBOA 1YI6A 4I6HA 4O0YA 1RE8A 2PVYA 2I1MA 2XS0A 2G9XA 2IN6A 4RMZA 4TNDA 4D5HA 4C4JA 1XH5A 5IDPA 3EZVA 4QNYA 1OKVA 4G1WA 4ZLOA 5HTBA 1XH7A 2BROA 2W4KA 4Z16A 4O96A 3TM0A 4IAIA 2GFSA 4E8AA 4TTHB 3HMOA 3SOAA 3OUNB 5IQGA 4FTMA 3BYUA 3QD4A 5HE3A 2FYSA 5KNJA 3U4WA 4ZJVA 4FTAA 1TQIA 2RKUA 3OWLA 4AX8A 1PKDA 1OUYA 1R78A 3R1NA 5M51A 4O7RA 4DN5A 2XM8A 1YXTA 4FYNA 3R9NA 5J1VA 1GY3A 2R3QA 2XNMA 2UW3A 3ZUTA 5KCVA 4AN9A 4I4EA 4JRNA 5AAGA 4BDJA 5E9EA 2UZDA 1QL6A 5H2UA 4FIEA 4O0UA 5K0KA 1PJKA 1BMKA 4OLIA 5AV2A 4EQMA 1SVHA 5CVFA 1OGUA 1FINA 4XP2A 5HG5A 3REPA 5KKRC 3DK7A 4FTJA 4GFOA 4NEUA 4I6BA 4EHVA 5FLFA 3DJ6A 2J90A 5GJDA 3R1SA 3HX4A 3KXZA 2BHEA 4C33A 1OECA 5EKOA 1JSTA 4BIEA 3K5UA 4EK5A 4HZRA 4IZ5A 2W5HA 4QMXA 4ACMA 3D83A 3W18A 3PPJA 3TTJA 4E4MA 4I0TA 3Q9ZA 5AUWA 1H1RA 2YM5A 3NW5A 4EOOA 4AE9A 3BGZA 5IZFA 3BYOA 2JDRA 3PWYA 3VC4A 4ORKA 3H0YA 2C5NA 3D5XA 2JDOA 3HL7A 3HP2A 5H3QA 5IQCA 4I22A 1B38A 5KMNA 4ZS4A 4DFBA 4YC3A 4CFUA 2OI4X 4DTAA 1NT2A 3ENMA 1ZOGA 3DZOA 4QRCA 1PYEA 1SM2A 3OZ6A 1KE6A 1Y8GA 4HNFA 4RWKA 4C58A 4CD0A 4TRLA 2ITZA 4AA4A 3N4TA 4E4LA 4H1JA 3JYAA 2XIXA 2W9FB 3EOCA 2W1HA 4S2ZA 5D41A 2BAJA 4HYSA 4FK3A 4PRJA 5HNBA 1OKWA 5CEIA 3ORKA 2I0EA 4GG5A 1HCLA 3PE2A 4Y5HA 2PYWA 3NIZA 2YJSA 3O51A 4M67A 5HU9A 2ZDUA 1VR2A 3TG1A 3IGOA 3KU2A 4GYIA 2WTCA 4ZMEA 4E5AX 2QC6A 3PDTA 3H3CA 2QU5A 2XKCA 4UY9A 3VQHA 5IQAA 5LJJA 3BWFA 4QYGA 3LCSA 2JKOA 4XG9A 5LMKC 2QOIA 4MBLA 4AGWA 1O6YA 4I24A 1QPJA 2WIPA 1XQZA 3F5UA 3NNWA 4XV3A 3KB7A 5BYLA 2JAMA 3F5GA 2VWYA 4HGLA 4RVTA 2BALA 3A61A 4CKRA 2IZTA 1UNHA 4ITIA 1FVTA 4U81A 4UZHA 5HO6A 4RIXA 3K2LA 4RJ8A 3QRJA 3QTSA 4TYEA 4BICA 2WO6A 4FTCA 4IEBA 4YPDA 3ZSHA 4NU1A 4ANBA 4D58A 3RPSA 3K5VA 5DNRA 3HA6A 4QMNA 3DTCA 3LFDA 2WMXA 5IH4A 3UC3A 3BQRA 2JFLA 3P08A 5CAPA 4FV8A 4ZSLA 5FG8A 5TE0A 2RFNA 1H8FA 3ULZA 2WQOA 3NLBA 5A9UA 2PUNA 5FXSA 4QQ5A 2UW6A 2ETMA 1EH4A 3BRBA 4I6FA 4WNMA 5BMSA 4FL2A 4OGRA 2VTQA 3IDPA 2YCSA 4JAJA 4JBQA 5AM6A 4GK3A 3TUDA 5LVLA 4O7WA 4L67A 2X7GA 3IS5A 4AZTA 1OKYA 5AUTA 4QD6A 5IEVA 2ITXA 3O96A 4GH2A 4BDKA 4O7ZA 4IMYA 3BHYA 3UYSA 4D55A 5FEDA 5D9HA 5HGIA 3LFAA 2WQBA 4M12A 4PDOA 1I44A 2QD9A 5ANGA 5E1EA 4BIDA 5FP6A 3UO5A 3DLSA 2QOCA 4DA5A 3W2RA 2B54A 3ZC6A 4F70A 3GOKA 4BCPA 3OXIA 4IZ7A 1SNXA 2IVVA 3RCJA 3QUDA 1AGWA 2R3MA 2X4FA 2OG8A 4FSRA 5BVNA 2OH0E 4QMVA 4X3FB 4GK4A 3OWJA 2WNTA 3QXOA 4EOSA 4X2FA 1KE7A 5DEWA 5EM7A 4DLJA 4D1SA 2VZ6A 4EOJA 2JLDA 3ZO4A 4PMTA 4R5SA 2ITWA 2VTJA 1Y8YA 1H07A 1KV1A 2X8DA 2XIRA 4KNBA 3CLYA 4DEBA 5G1XA 3QQHA 4C36A 1J7LA 2B55A 3G0EA 4XCUA 3AMAA 1ZZLA 3OCTA 4G6LA 1NVQA 5KMJA 4HCTA 4UWCA 4HPUE 2X7FA 4TYJA 5IUGA 3BV2A 1YHVA 3HECA 2J0IA 2C47A 3ORIA 1PXPA 2QR8A 2IW6A 1J3HA 2OW3A 4FTIA 4Q9SA 4RVKA 3PWDA
chains in the Genus database with same CATH superfamily
5HESA 3ZRMA 4CV9A 4EH2A 3F2AA 1WBPA 2QOLA 2F9GA 3QLFA 3LJ0A 3HRCA 2PVMA 3H9OA 3SXRA 1F5QA 4QPSA 3W0QA 2G01A 4IAAA 2X6EA 3R02A 3L8VA 3VF9A 2WMBA 4FSTA 4U3ZA 3VO3A 3IW7A 4NZWB 3UVRA 4FNZA 3KREA 3PFQA 3QF9A 4UWYA 5B2KA 1PMUA 3O7LB 4KSQA 4NWMA 4MNEA 4M13A 4UMUA 3QLGA 4DH8A 4E4XA 2W05A 2VTMA 4BI1A 3BL9A 2DQ7X 2R9SA 4L68A 4ZP5A 3V51A 4LOOA 3VW8A 3A7JA 4X6QC 4OTGA 4NCTA 2P55A 3CIKA 4D2SA 1F3MC 2O2UA 2CPKE 5I9YA 4QQCA 2XALA 4FG7A 1ZZ2A 1A06A 1PXLA 3K3JA 4G31A 4BWXA 3SG8A 5AADA 2WOTA 4KINA 4HYIA 1PY5A 1YXVA 4FSWA 4OBOA 5FM2A 3D9VA 2ZYBA 2C3IB 1H0WA 4QDEA 1ZXEA 4LV7A 4ANSA 4IJPA 4PNIA 2CMWA 4JMQA 3OT8A 3R7YA 3F3UA 5IA0A 3TTIA 3U9CA 4LGGA 3MTLA 3NYOA 4C37A 2HW6A 3LXKA 4BI0A 3QBNA 2PVJA 3A4PA 3L9LA 2LGCA 2J5EA 4KBKA 2QHNA 4RC4A 4M8TA 3FMLA 1JKSA 4W4YA 2YEXA 2QLQA 2XANA 2WFYA 4RIXB 2VTTA 4DFXE 4MBJA 1P4FA 4FBXA 4O7VA 1VEBA 2F7XE 2ZMCA 2O64A 3VULA 3D5UA 4OTPA 5I3RA 2PE0A 4UMQA 1UNLA 3I7BA 4O38A 4D2TA 4DC2A 5C26A 5JMSA 4AGDA 2IO6A 3AG9A 5AV4A 5LMAA 3HEGA 2BDJA 4IACA 4XBRA 2WHBA 4N4SA 4O2PA 4DTBA 3GXLA 1ZAOA 2HOGA 3DNDA 4AOJA 2VGOA 2PZYA 3F2NA 3GC8A 3KFAA 4U41A 3WZDA 5BUJA 3C0IA 2DWBA 4FKWA 3MB6A 3QKKA 5EYDA 4BBMA 1J1BA 4DCEA 2ZM4A 4FG9A 5HTIA 2A0CX 3ZM9A 5DIAA 3SC1A 4EZ5A 3AC1A 2B9HA 3D2KA 1WBTA 4NTSA 3R8MA 4OTQA 4ZTMA 1FMOE 4FT9A 4YBKA 5CEOA 3H30A 2DYLA 2RFSA 3FKNA 3QWKA 4FC0A 4FI1A 4U45A 5DR2A 5JFSA 5DA3A 5E8TA 3GB2A 4LRKA 4P4CA 1OITA 2VWIA 5AV0A 3C51A 5CASA 5IUIA 3TV6A 1YOLA 2R2PA 3QQUA 3M2WA 5AUZA 3ZDUA 4JG7A 2XM9A 4DEIA 1BI8A 3SHEA 1APME 2CGWA 2XKDA 3CY2A 3R01A 4XMOA 2HXLA 5CZHA 4EBVA 4O7YA 2WTWA 5EQYA 2FSTX 2OK1A 4C0TA 3OWPA 4IWOA 3ORLA 4QTCA 1JNKA 5HCZA 4DE4A 1A9UA 3MVJA 5CVGA 2YFXA 2WQMA 4I0SA 3VWAA 3R22A 4FYOA 5BYYA 3RBWA 4GG7A 3MPMA 2BFYA 2C6IA 3GC9A 3VUGA 1O9UA 5FWKK 1FGKA 1SVEA 4G2FA 4PV0A 2ZMDA 5LARA 1TFFA 3LVPA 3GCPA 2UW4A 3PY0A 2IZUA 4KS7A 3LCTA 4P2KA 1DAYA 5FUTA 5IPJA 4EKLA 4OAUC 4A06A 1WBWA 2XNPA 3ORTA 1BL6A 5HORA 3SA0A 1QPEA 4J96A 2YHVA 3V5LA 5K0XA 4FIGA 4FKVA 2QLUA 3LMHA 5M55A 2G2FA 3KKVA 4N6ZA 4YZBA 4PL4A 4BGHA 2BPMA 2XIYA 3GI3A 4WHZA 3VS0A 4ZS0A 2QOBA 4RA4A 5AWMA 1H24A 5L2SA 4BCMA 3AKKA 3ORPA 2YM3A 3TNPC 3ACJA 4QP9A 2YA9A 4FGRA 4PL3A 5FDPA 5TT7A 4S34A 3BE9A 3AC4A 1H27A 3FYJX 2C6DA 5ANKA 2UZVA 3NNUA 4FVRA 3ZZEA 3G2FA 4RQVA 2Q83A 3ZMMA 3CQUA 4MNEB 5CU4A 5CI7A 4UEUA 3UP7A 1JWHA 2ETKA 4BIBA 1OBDA 5FGKA 3N51A 4YSMA 4F65A 2WTJA 4II5A 4CZTA 2HZNA 1WVXA 4F0GA 4CRLA 5CAVA 3GFWA 4RIYA 3COIA 4E26A 3GU7A 4C4GA 4EH5A 2ITOA 2Y9QA 4XG7A 5HX8A 5A14A 1Q41A 3O0GA 3SW4A 2HAKA 3DBDA 4L3JA 3LZBA 3NIEA 1UV5A 2OO8X 5CALA 4YJTA 1XO2B 4MWIA 4EOMA 4DBXA 3FMNA 1WCCA 5J95A 3PRIA 4FNWA 4E3CA 1UU7A 3DQXA 1BI7A 5H8BA 1XBAA 3CQEA 4IFCA 2IJMA 4K1BA 2EB3A 2W4OA 3ELJA 4G3FA 4M66A 3UBDA 4EK4A 1RW8A 1VZOA 4FKGA 3PXYA 3W2QA 1WBSA 4U5JA 4RSSA 3AMYA 4PQNA 1G8AA 4IHPA 1DS5A 1JKTA 4IANA 4C4IA 2XJ1A 4F78A 4FT7A 3HVCA 4F9AA 2PMOX 3P1AA 2VTRA 3DAJA 5HVJA 5IEXA 4S32A 2BDFA 3UG2A 4H39A 3UO6A 5E8WA 4BN1A 3B8QA 5C01A 3IW6A 4V0GA 5D10A 3NCGA 1RQQA 3L9NA 4HGSA 2W5BA 4E5WA 2OSCA 4P5ZA 3HV7A 2RSVA 3MSSA 4QP4A 5EQPA 4C35A 4CYJA 3I5ZA 2I0VA 3ZH8A 1LEZA 3OD6X 4IFGA 2OIQA 4ZSJA 5ACBC 3LXNA 4FEUA 3PY3A 4AZEA 5DRBA 4EUUA 4K33A 2UZTA 3P5JC 3NNVA 3FLSA 4OR5A 4R5YA 5B7VA 4USEA 1BYGA 3BHHA 3KRJA 4ENYA 4FT5A 1R39A 3NW7A 4D2WA 4E93A 3MA3A 3NPCA 3GC7A 2B1PA 3EFWA 5A54A 1L3RE 2WMAA 2BVAA 4YZNA 4IDTA 4QOXA 3AC3A 3R7UA 3U8WA 3UIMA 3BBWA 4MK0A 3E8EA 4BGGA 5LMBA 3W0NA 3LJ1A 3MH3A 3U9NA 4F4PA 5FQDC 3DKCA 3EL7A 1SVGA 4YC8A 2UZLA 3WF7A 1O6KA 4I23A 4I5PA 4YZCA 5AR5A 3TKHA 5EW8A 5IDNA 3ZSIA 4FSQA 3F3VA 5EDPA 4C8BA 4BTMA 3HLLA 5CAQA 2QODA 5EYCA 5H8EA 3QCQA 3UZPA 3C5UA 4HGTA 2EVAA 1NVRA 4ASXA 5J79A 2KULA 3IW4A 3P79A 4F7NA 3FZTA 3PXFA 2BTRA 4GFGA 5JK3A 3LMGA 5BMMA 1VYWA 5HX6A 5HBHA 3WBLA 1FQ1B 2XK7A 3L1SA 3Q9YA 4FGBA 3LCOA 2W06A 4F0FA 3MFSA 4JQ8A 4AFEA 3U6JA 4TWPA 5EG3A 4DFZE 1ZYSA 1M17A 1PXMA 5IA4A 4PDSA 3MBLA 3FAAA 1QMZA 2J4ZA 2C6MA 4EOQA 4DCAA 2XARA 2FVDA 3QZFA 3GU4A 2VO3A 1MUOA 4DH3A 1W83A 3FSKA 3S00A 4Q9ZA 4G5PA 3R8ZA 1Q24A 1XKKA 2WTIA 2CHLA 4M7IA 4WSYA 3AOXA 3P7AA 3RZFA 4AXAA 3MFRA 3ZLSA 5AUUA 4YJNA 5JGDA 4LL5A 5JH6A 2J0KA 3A8XA 5AM7A 2W0JA 5HTCA 2IZRA 2RFDA 4FV4A 3LHJA 3V6RA 5J5SA 2JIIA 2W1ZA 3LFSA 3Q4ZA 2PVHA 2H8HA 2VTLA 3BEGA 2A2AA 4H58A 4A4OA 3EJ1A 4RIYB 4X0MA 5BV3A 2NO3A 4O83A 5KMIA 3R6XA 3FC1X 1PF8A 4J52A 4AN2A 1QPCA 3NRMA 4EOIA 2PPQA 4ID7A 5EDQA 4CKIA 2CGUA 3UYTA 1Q4LA 4BI2A 3QRKA 5AV3A 3R7IA 2JGZA 3MV5A 4IVCA 1OVEA 2J51A 2UW5A 1H26A 2UZEA 3U55A 3W0SA 2XRWA 3CE3A 3VAPA 3A99A 2YERA 3UVPA 5IA1A 3BGPA 4UV0A 4A9SA 1OPJA 3ODYX 4J1RA 3KVXA 4FSUA 5IQIA 4JIKA 5JT2A 2HWPA 3MFTA 5HO8A 2GQSA 1OIYA 4R8QA 2QU6A 5AMNA 5D11A 1H28A 4NKAA 2Y7JA 3DFAA 3W2PA 3P5KA 3F9NA 4GKIA 2QVSE 4C61A 2WMSA 3P86A 3QRUA 3I5NA 3QKLA 4I4FA 4WG5A 1YRPA 4JX7A 2RG6A 5J7BA 1NXKA 5F9EA 3IDCA 5EM5A 1CTPE 4DYMA 4FNYA 2VTIA 2C0TA 3O8PA 1WZYA 1UU9A 4LMUA 1BLXA 3TNWA 4V0GB 3FZOA 2XMYA 2W99B 2F7ZE 2PVLA 3A8WA 2J0LA 3VJOA 2RL5A 2UW8A 4JDKA 1H1QA 4IAYA 3MIYA 4L3LA 4F7SA 5L8LA 3R8PA 4E5BA 3FI4A 2H34A 2W96B 3AC5A 4YTIA 1Y6BA 4XH6A 5EHOA 4F0IA 3PXRA 3RWPA 3LQ8A 4L53A 5ETAA 3R8UA 3PZHA 5C1QB 4KRDA 2YM4A 4MTAA 1G3NA 4USDA 4YJVA 3KCKA 2XRUA 2H9VA 4AF3A 3IK3A 4C62A 2NP8A 4AE6A 3BU3A 4F9BA 4IVBA 4ZOGA 4DGLC 4CMTA 3OEFX 1YI3A 2VX0A 3FKLA 4RVLA 5I9WA 3KN6A 3FHIA 5DT0A 3V5JA 4AW5A 3MA6A 2YAKA 4BGQA 4YO6A 2IZSA 3R0TA 3NFFB 3WF6A 2CKEA 2HK5A 3VHKA 3WF8A 2JEDA 3OOGA 3O5AA 4TY1A 4QYHA 4YZ9A 3PZEA 3IQ7A 4ERWA 1V0PA 1NY3A 4BWPA 4LDTA 2ERKA 2I40A 3A7IA 2QOFA 4C2WA 4W8DA 4JT3A 5IUHA 4FV0A 4DHJA 1PHKA 2A19B 1HOWA 1SZMA 4RBLA 2XJ0A 4AG8A 2WB8A 5AIKA 4GKHA 2YCQA 4ZSAA 4CTCA 1U5RA 2Y8OA 3WOWA 4PL5A 1CSNA 5KBQA 4Y73A 3V5QA 2HZIA 4FSMA 3P0MA 4FT3A 3EQRA 2QOQA 5AP2A 1WMKA 4D4RA 3CD8A 3GQLA 4E6QA 3E3BX 4QPAA 4ACHA 2CKQA 2A4LA 4GVAA 4QMOA 4DF3A 3ZO1A 2WTKB 4I41A 2X7OA 3PG1A 3FMKA 3KF7A 4L46A 3VIDA 4YHJA 3VNTA 3VBYA 4G6OA 4CEGA 3OTVA 4J99A 2NRUA 3Q9XA 1F0QA 4I1ZA 4C3RA 4WBBB 2B9FA 2YIRA 3HYHA 3L9MA 4MQ2A 5IMXA 4MUQA 1L8TA 4O86A 1YHSA 4EHZA 4BHNA 4ZXTA 4YLKA 5BNJA 3GU8A 4Y5QA 2UVYA 1ZYCA 2Q0NA 3QL8A 5JRSA 5M07A 3SG9A 3PSCA 4EZ3A 3NUYA 4ZY5A 3VONA 3ZFYA 3EYHA 2BMCA 4PP7A 4OTDA 3CD3A 3RWQA 4UX9A 5C8NA 3D94A 3ZLWA 4QMZA 4AZSA 3ZRKA 3ET7A 1J7IA 4E20A 2ZAZA 4ZZMA 1XHAA 5I9ZA 4G3GA 5E7RA 2PMLX 4D0XA 3DXPA 3JXWA 3ZTXA 5CANA 1XR1A 4H3BA 5EFQA 4FUYA 5E92A 3F3WA 4CFNA 4D0WA 1ZY4A 4DEEA 3TUCA 2UW0A 1GNGA 5HKMA 2PVKA 5CEMA 3C7QA 4UALA 4JLCA 3D7ZA 4E6CA 4EK6A 3Q32A 4G3CA 4YNEA 4YHTA 3Q60A 5FDXA 2IWIA 2R4BA 3S3IA 5JGAA 3TMOA 4IX5A 4XOZA 5CF6A 5AP5A 4TT7A 2FGIA 3GEQA 2ZV7A 3OXTA 4RWLA 2H6DA 4FIJA 3BBTB 2J0MB 4ZTLA 3KK8A 4EKKA 1M14A 5M08A 1ZOEA 4D4VA 5LQFA 1ZWSA 2PZPA 2UZNA 4ASZA 3HAVA 4O91A 3BYMA 1OIUA 5CU0A 1H1WA 2WMQA 4D1XA 1Q99A 2EXMA 1IG1A 3VBTA 4YZDA 4OTWA 3M1SA 2ITVA 3S2PA 5EYMA 2YWVA 4TKSA 5HIDA 3F2RA 3ERKA 3F3TA 1K3AA 4H05A 3G6HA 1U54B 3UNJA 2WMUA 4LL0A 4NH1A 5EI2A 5L2IA 3TJDA 5M06A 2XAOA 5T6KA 2WQNA 4FV5A 2X6DA 2CNUA 4FKRA 4RIOA 4TPTA 3PP0A 3WI6A 4CT1A 4U42A 2R3FA 3CXWA 5EI6A 1J1CA 3L8SA 4TYGA 3U4UA 4IM2A 3F88A 3EQCA 3Q2MA 2J7TA 3GT8A 3OMVA 3ZRLA 2AC5A 3LW0A 2YM6A 2GNIA 5E8XA 1UA2A 4WKQA 3OF0A 1UNGA 4J71A 4C3FA 4AZVA 2A98A 2HY81 3QCSA 2VV9A 4C02A 2ITQA 4G6NA 3DK6A 3KK9A 3OTUA 4O0WA 1ZY5A 4K18A 3EQPA 5LVOA 4EC8A 3UPXA 4IAFA 3ZS5A 3PJ8A 3T3VA 5KBRA 3E5AA 5GZ8A 2X4ZA 2XK6A 2YIXA 5BQ0A 4QMSA 4MD7E 2XUUA 4EBWA 2WIHA 4JNWA 3FI3A 5ETIA 4YJSA 4QP1A 5CQWA 4Z3VA 4YTCA 2Y6MA 3RI1A 5EDRA 3V01A 4FR4A 5EM8A 1ATPE 2CN8A 4QP7A 5C4LA 4BTKA 2GPHA 2C6OA 2W7XA 3UNZA 5L8KA 2UW9A 4ARKA 3E8CA 4TYIA 4YGAA 3D5WA 3VBWA 3EFJA 4ACCA 1VJYA 2GDOA 2J0JA 1WVWA 2R3HA 3LLAA 2WD1A 2QO9A 2YJRA 3QFVA 4ENXA 1DI9A 4L3PA 4NK9A 4QPMA 4PF4A 2VN9A 3NUAA 3NCZA 5DI1A 2F7EE 2PTKA 3F5PA 5F95A 3BI6A 1TKIA 1W2FA 5FM3A 4AXCA 2HXQA 4E73A 4UN0C 1YWNA 3AT4A 3SDJA 5CT0A 1YI4A 5ACKA 4FA2A 4PUZA 1CKPA 2XB7A 3MIAA 3QU0A 4B4LA 3W0OA 2EU9A 4R3PA 3I6WA 4FEQA 2C5OA 4XHKB 3HRBA 4MAOA 5CSXA 4B99A 4C3PA 2R3GA 3FXWA 2XKFA 4RJ6A 1OPKA 4AA5A 3LKMA 5JFVA 4M69A 4EH6A 2CKPA 4RA5A 4MQ1A 5DLSA 1GZKA 2BILB 2R3PA 3TUBA 2VWBA 5KE0A 4AT5A 4MCVA 3R7OA 4BWKA 5A4CA 4CFFA 4YC6A 4FKJA 4FTQA 4JXFA 2RFEA 3R9RA 4I94A 4KA3A 1H25A 1WBNA 2CLXA 4NSTA 4F1MA 1IA9A 3CGFA 4OW8A 1ND4A 2E9OA 4RLLA 1IAJA 3F7ZA 2W1GA 3TL8A 4EHGA 2BKKA 4PDPA 2JFMA 1WBVA 2X0OA 3LQ5A 3MFUA 4NUSA 5FEQA 4BCKA 3JPVA 4I0RA 5IQHA 2QKRA 4ASEA 1IRKA 3BLAA 4QO9A 2XBJA 3KN5A 1MRYA 1M52A 3CPCA 2XNOA 4L6QA 2R3IA 4WNOA 4O7SA 2ZB0A 4CFWA 2VWWA 3K3IA 5E90A 5E8VA 2YISA 3C4WA 3OW4A 4GYGA 4M97A 4R7HA 2CCHA 4EL9A 5IISA 2YCRA 5ITAA 5AR4A 2OIDA 2QONA 4K11A 4L9IA 3TDWA 3JY9A 3CC6A 2E2BA 1GIIA 4DGNA 4GL9A 4YJQA 4QEBA 3MGYA 1W84A 3EB0A 4H36A 4CG9A 4YJOA 3PJCA 4OAVB 3ZSGA 3UQCA 3P9JA 2ITPA 1H1SA 5LVPA 4IZAA 3MY1A 3D14A 4O27B 3V04A 4FSZA 4QMTA 4BDHA 4CFVA 3MESA 1MQBA 3I81A 4IJ9A 5ANOA 4DDIA 2C1AA 2FSLX 3FL4A 3HV4A 3KY2A 5CQUA 5E8SA 5TO8A 3E7OA 3FWQA 5DBXA 2C6LA 5HE1A 3LAUA 5FRIA 3C4CA 5DR9A 4PPCA 4WA9A 5AV1A 5GZAA 3GOPA 4F6WA 5AA8A 1DM2A 4O0XA 4KKGA 4EJNA 5HCXA 4XNEA 1WBOA 2HYYA 1K9AA 3FV8A 4L7SA 1A48A 1XMMA 2WTDA 1CMKE 5T68A 1Q61A 4Y85A 3RPVA 5JKGA 3VRZA 1XJDA 2V62A 5HNGA 1WFCA 3P7CA 3V6SA 4L01A 5DFPA 3QC9A 4X3FC 2V7OA 3PPZA 2W1CA 4MXYA 4FVQA 1ERKA 4L00A 4XP0A 3LMIA 2GSFA 2QG5A 4JVGA 2X2KA 5EK7A 4QMWA 4EOLA 3UDSA 5CNOA 3SGCA 2VRXA 4DHZA 1PMEA 2PHKA 2PY3A 2UZUE 1OGYA 5HNIX 4QTBA 3T9TA 2BHHA 4I6LA 3RGFA 3OOMA 3V5WA 2I7QA 3TZ8A 2J50A 4NFNA 1YKRA 3BLQA 3ZEWA 3NUSA 3ORMA 4U6RA 1BX6A 4WRGA 4DLIA 4O84A 1BUHA 4PY1A 4R7BA 2ZV9A 2VAGA 2XCHA 4GCJA 3BPRA 4FTNA 5CNNA 4BCFA 2PVRA 5C4KA 5CF5A 5L8JA 4O0RA 1FVRA 5C8KA 4FZFB 3D0EA 4ITHA 1IASA 1UWJA 4XG2A 4XV9A 3W2CA 3PA5A 4DEDA 3RHKA 5FD2A 3C1XA 4DFYA 3EMGA 4WNKA 1YWRA 4F1OA 3I6UA 4JDIA 3MH2A 5A4EA 4JQ7A 3R8VA 3UP2A 4P90A 3UVQA 4U9AA 2UV2A 4YTFA 2RIOA 3AMBA 2OXYA 4JL9A 2C4GA 1JLUE 4AW0A 5IKWA 3F82A 4U3YA 3I60A 3RK7A 3ZZWA 1G8JA 1IR3A 5M4UA 1XMLA 1YDRE 1W2DA 4FV6A 1GZNA 5IA5A 4J8MA 1OB3A 2OKRA 2WEIA 5HBEA 2G1TA 4ZTHA 4AOIA 3LFFA 4PP9A 2O0UA 4KUJA 3U51A 4N0SA 4FNXA 5HG9A 2WTVA 4JI9A 4BCJA 4M69B 2PK9A 3FY0A 3ZFMA 2UUEA 3JVSA 4QMQA 3FSFA 2QO7A 4ZEGA 3LCKA 1REJA 4FIHA 2R3NA 2PWLA 3A7GA 2WKMA 3VQUA 3IW5A 4C2VA 4D2RA 3IW8A 4CSVA 1T45A 3UOJA 2BUJA 2PULA 2PL0A 5T3QA 4LYNA 2BZKB 1ZYDA 2W1FA 3IKAA 4JBPA 3FMJA 3GCQA 4D4SA 4F9WA 3NVKI 1UKHA 3TNHA 4CTBA 4I92A 4EYJA 3C0GA 3HV5A 4X2GA 1XBBA 4ZSGA 1P4OA 2X0GA 2C3LA 3UOHA 4QTDA 4HVGA 4FJVA 4BFMA 4OT5A 5F1ZA 3UQFA 1JKLA 4GS6A 4NM7A 4RFYA 4BL1A 5BVKA 4DGMA 1JQHA 3RMFA 3VJNA 5HD4A 4RIWA 3QYZA 3OCBA 5K3YA 1VYZA 2BR1A 4B6LA 2CJMA 3KRRA 4P7EA 1Q97A 3CQWA 1H08A 2JKKA 3ORNA 5BX0A 3HZTA 3E7VA 4X3JA 5BVOA 3RP9A 3GC0A 4I21A 3V8TA 4YR8A 2VGPA 1M2PA 4GU6A 3R21A 3C4XA 3QQJA 2ONLC 2XJ2A 4BR3A 2FSMX 3DNEA 4MF1A 3DXNA 4CG8A 4FEXA 1DAWA 3TCPA 4GEOA 4GJ3A 4O81A 4IC8A 2R3RA 1YWVA 4MXAA 1PRYA 2XZSA 3ZBFA 4GT5A 2IVTA 3TV7A 2JBOA 4IX3A 4FKQA 4B0GA 2PUUA 2Y4IB 3Q96A 3R2BA 3SVVA 4KBAA 4Q5HA 5DG5A 4F08A 3TKIA 3PVUA 4Z7GA 4BDCA 4Z7HA 4E6DA 3QHRA 2B9IA 4LFIA 2X8IA 3CBLA 5CENA 4MF0A 4AU8A 3QUPA 4O7TA 3ZYAA 2PZRA 1M7QA 3VS5A 4K77A 3TACA 3DV3A 5A46A 4AZFA 2YDKA 2R3JA 5A3XA 3R04A 4BZNA 4DEAA 4UMRA 3Q53A 3DBEA 4FZ7A 5I9VA 4Z55A 3KXHA 4N6YA 5F4NA 3V5TA 2BDWA 3CSVA 2OBJA 1KV2A 5CEKA 2B0QA 4O82A 2QI8A 3SAYA 2XK4A 5DVRA 2Z2WA 1OL7A 3G9NA 3UG1A 3ZLYA 3ZO2A 4BTFA 3SXSA 3CCNA 4C57A 4BC6A 2E9PA 5KHWA 4J95A 1OUKA 4FKIA 3UJGA 3UIBA 4NYEA 3E93A 5M44A 3H0ZA 3CKXA 4LRMA 2GCDA 3IECA 3PVWA 4O1PA 3R9HA 2HZ0A 4FOCA 4EOPA 3LM5A 4A9RA 3E92A 1UWHA 4RZWA 4ZZOA 1U5QA 3EKKA 3KQ7A 2XYNA 2C30A 4V01A 5HE2A 5J87A 4D9UA 5L6OA 3KF4A 5BVEA 1XBCA 2XP2A 3N9XA 3DKFA 3HDNA 4TNBA 4FTTA 3MWUA 3KVWA 3DGKA 3ZEPA 3A4OX 4FV1A 5FTOA 4FTOA 2RG5A 5AP0A 4AGCA 4CMUA 3WF9A 3UIUA 2NNWB 4BBEA 4F1TA 4HYUA 4W4XA 3NUUA 3ZUVA 3BHTA 3O8UA 2XBAA 2DS1A 3COHA 3EN5A 4G17A 1PKGA 1VLRA 5IQBA 5HICA 4BCHA 5LVNA 1GIHA 4AP7A 4UMPA 4FZ6A 3N4UA 3DAKA 3ORZA 1OM1A 3F6XA 4YSJA 2B4SB 3IO7A 4DEGA 4MD8E 4WOVA 1KE5A 3RM6A 2C3KA 4NCTC 4C4FA 3SX9A 4K0YA 1FPUA 3AXWA 3LXLA 3NW6A 3CJGA 4O4BB 3T8OA 4TW9A 2QG7A 2BRHA 4K9YA 3UDBA 3RKBA 3SRVA 2JDTA 4R3RA 3S1HA 3NYNA 4XG3A 2XCKA 3NYVA 1YVJA 3QALE 2I0YA 3G51A 4HGEA 1H0VA 4FICA 2UVZA 5M57A 2FUMA 2BAKA 5HEZA 2QR7A 3F61A 3FMMA 4WRSA 5CZIA 4EQCA 4RLKA 1WVYA 2G2HA 2ITUA 4LGDA 4WO5A 4GSBA 3UMWA 3II5A 3KRWA 3AKLA 2CLQA 2JBPA 3EWHA 3FL5A 3GU5A 3QHWA 3WZJA 3AKJA 2AQXA 3PUFC 2GS7A 3BZ3A 3U6IA 4EZ7A 3B2WA 3ZCLA 1LP4A 3A2CA 3AD4A 4XLIA 2VWZA 3MYGA 2RF9A 4PPBA 3R9DA 3V8SA 5LWNA 3W2OA 1BL7A 5JEBA 3QGWA 3F3ZA 4F6UA 1Q8ZA 4RIWB 5J9YA 1Q8UA 3QQGA 5FXRA 4ERKA 4MH7A 3CTJA 4CVAA 4F7JA 2OF4A 3NWWA 3DLZA 3NGAA 4W4VA 3WZKA 2VX3A 4AW2A 1TZDA 3D2IA 4MXXA 5CLPA 2Z60A 5L6PA 5HIEA 4QMLA 5EHLA 3H4JA 5JFWA 4DHIB 4YJRA 4BY9E 3HUCA 3BCEA 4G9CA 4ALUA 3R73A 5JSMA 4J98A 4NT4A 2BTSA 3GFEA 4AQCA 2R0IA 4EWHA 4A9TA 5HHWA 1OL6A 2GFCA 3UZRA 3HP5A 2P33A 5J9LA 2ITTA 2H96A 3FMHA 2NPQA 2GQGA 5LCJA 4ZMFA 3DDPA 4ANMA 5HVKA 2O8YA 3CJFA 2P2IA 4KRCA 4FX3A 3S95A 3VUMA 3VN9A 1PXIA 3GBZA 4MBIA 3I7CA 2OICA 3TKUA 3QD3A 4J7BA 4UXQA 2QCSA 3Q6WA 1SMHA 3FKOA 3TJCA 3W16A 3ZHPC 3B8RA 3W2SA 5AP4A 4JR7A 4K2RA 1HCKA 5DRDA 4AXDA 5DN3A 3G5DA 4LOQA 4X21A 3OUKA 3KXNA 1OIQA 3EN6A 4YO4A 4NTTA 1TQPA 4ZY6A 3HNGA 1XWSA 4YLLA 3TZ7A 3WE8A 4G16A 3NNXA 3AGMA 4O4CA 5A6NA 4F7LA 1UU3A 5IQDA 5EYKA 2IF8A 2VWUA 3QXPA 3BE2A 3L9PA 3LLTA 3QD0A 1U46A 4WUNA 4CZYB 2F49A 4I5CA 2OJFE 4Y8DA 3FQHA 3CP9A 5HVYA 3FLYA 3LM0A 2BAQA 4BKZA 5IA3A 4OTRA 1PMVA 3OCGA 4BTJA 3F66A 3R1YA 4I20A 4IADA 4RFZA 4U7ZA 5AP1A 2HW7A 3COMA 4MYGA 2C68A 4MNFA 4O1OA 4XEYA 4JOAA 2BZJA 5I0BA 3R28A 3HGKA 3NR9A 3POZA 4BDEA 4MXZA 1WAKA 3GCUA 1AQ1A 2WGJA 4ZSEA 3UO4A 5KHXA 5AX3A 3V5PA 4UYAA 2OXXA 4A7CA