3SD0A

Identification of a glycogen synthase kinase-3b inhibitor that attenuates hyperactivity in clock mutant mice
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
350
structure length
350
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a Glycogen Synthase Kinase-3b Inhibitor that Attenuates Hyperactivity in CLOCK Mutant Mice
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Glycogen synthase kinase-3 beta
total genus 107
structure length 350
sequence length 350
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3sd0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3sd0A01
3JVRA 3Q6WA 3DBFA 4UN0C 5IZFA 4IJ9A 2DS1A 4B9DA 2J5EA 3PLAE 3Q5ZA 4KIPA 4R8QA 1HCLA 1SVEA 5AJQA 5E8UA 4C4JA 4F64A 2E9NA 4FODA 2RG5A 3I5NA 3Q9WA 5C9CA 4E20A 3SG8A 4IB0A 3DKOA 1YW2A 2R3IA 4I4FA 3MESA 2IZUA 4RFYA 2X2MA 3NWWA 2W06A 2UZLA 3P23A 5DRDA 3ZTXA 3QUEA 1FMKA 3UMWA 3QWKA 4EKKA 2JBOA 3CC6A 3NUAA 4DC2A 1FQ1B 4DE4A 3L9LA 2XP2A 5IU2A 1IRKA 2CGXA 4U44A 3KMUA 4MQ1A 4J96A 3OP5A 4RVTA 3MN3A 3DAEA 5AEPA 4CFMA 4C7TA 2CN5A 4FZ7A 3RNYA 3CCNA 4FKQA 5J7BA 2VWWA 2QURA 3EQBA 4A06A 4J8NA 5IQAA 4BDJA 4O22A 4RC4A 4KSQA 4CG8A 3D5UA 5HX6A 4Y46A 5IUGA 2F7ZE 4ACDA 4RLLA 4FZFB 5FEDA 5CX9A 4QMPA 3TV6A 3QL8A 3CY3A 3F5UA 4YJSA 4R1VA 3W2OA 3R7EA 1S9JA 2EUFB 4AGCA 3G15A 4YJNA 4O81A 3HV6A 4NK9A 1O6LA 2DQ7X 3FMNA 4WG4A 5IA0A 2JEDA 3KY2A 3KF7A 4AW5A 4B4LA 1Z5MA 3C4WA 4CKJA 2WMWA 2C3LA 3QZIA 3C5IA 3UTOA 3LXLA 5AUTA 3FLSA 1Q97A 5HG9A 4EZ7A 2HXLA 4FZ6A 5ANGA 4X2JA 4HNFA 1YVJA 1OL2A 5CEQA 3GI3A 3IDBA 3UNKA 4FG7A 3UVPA 4F99A 4WG5A 3EOCA 3FHIA 1ZY4A 5FGKA 5TE0A 3TKUA 3AT4A 3O8PA 4FTQA 3OXIA 4FKJA 4CT1A 4UWYA 4ZLYA 4QQJA 4FNXA 2UZBA 4C59A 4RX8A 4ZSAA 3MVMA 2BKKA 4UBAA 2PVKA 1ZLTA 3F3TA 3D5XA 4KA3A 4GU9A 5H8BA 5BUIA 5LVLA 2H96A 1QPEA 3GEQA 3F61A 5AV2A 2IN6A 4J95A 5CEIA 3RPOA 3ZOSA 4ASDA 5JK3A 5M08A 4C4GA 4ALVA 5FP5A 2YM7A 3BIZA 4MAOA 3QTZA 4KINA 1M14A 2OGVA 3BYSA 4QYHA 4ZTHA 4FSTA 3FL5A 4PNIA 4BYIA 4EOJA 4BYJA 4EK4A 3KULB 4M14A 4MD8E 2Y6MA 4JBVA 4MYGA 5F20A 4QYFA 4EEVA 5FXRA 2JDTA 4FA2A 2QO2A 4QNAA 4MNEA 4K33A 2GNHA 5HVYA 3LFEA 4FICA 4IAKA 4U97A 1DI8A 1YOMA 3Q4TA 2Y9QA 3Q4ZA 4C2WA 3MYGA 3VBTA 4C4HA 3LXNA 2WOUA 3DY7A 1YQJA 3OROA 4ZZMA 4DH7A 3UBDA 3R1NA 4H58A 3UE4A 4ACHA 3FBVA 5J5SA 2PMNX 4TNDA 4QYGA 2XNMA 4L7SA 4UWCA 4BDBA 4RVLA 4AA5A 4YPSA 5EQPA 3WF5A 2VX1A 4L6QA 5AA9A 5CALA 4X3FB 1FVTA 2Z7RA 4X21A 2NO3A 3IOKA 4I1ZA 4FR4A 1WVYA 4XLVA 2H9VA 4IWOA 4LFIA 5CF5A 3GU7A 3R7UA 4GV1A 1X8BA 3EQHA 2OH4A 4PTCA 2EXCX 2OO8X 3FMJA 3Q2MA 4FK6A 4G6OA 4O6EA 3ZXTA 4DEEA 4RIYB 4DYMA 4E5WA 4PMPA 5CF4A 4ID7A 4JBOA 3QTUA 4FNZA 1Q8ZA 4NKSA 5AIKA 4C36A 5F94A 2QU5A 4U80A 1YWVA 2XIKA 4ZTLA 1J1CA 4X2FA 3HUCA 4FV6A 5CT7A 4DBXA 3EWHA 1REJA 4GUBA 2WQNA 5DBXA 2F4JA 3FI4A 3V04A 1Y8GA 4BZDA 4AZTA 4JIKA 3CSVA 5DR9A 3K2LA 4CYJA 3R9RA 5EM8A 1SNUA 3BGPA 5FTQA 5CQWA 1Y57A 3W2CA 3VS7A 2PTKA 4QMMA 4R77A 3DA6A 2P33A 4AGUA 4DH5A 5LMKA 2JDOA 2R9SA 4G1WA 4KIKB 4YPDA 4YNEA 2UVZA 4EH4A 5AP1A 4H36A 4DGOA 5H2UA 2BDWA 4F63A 3ORNA 4FBXA 4BWXA 4MXAA 3T9IA 3OCGA 3GVUA 2CKQA 1F5QA 2B1PA 2W99B 2C3IB 3FKOA 3NIZA 3IW8A 3FY0A 2F57A 3PJCA 3QRKA 1OKYA 4BDDA 4HVHA 3LLTA 4OTQA 2GQSA 5EG3A 5C8MA 3A8WA 3H9OA 1OUYA 3FZRA 3PG3A 2C1AA 4ZSEA 5K9IA 2YDIA 4JXFA 3OWKA 2XKDA 4XHKB 3OG7A 4JDIA 4XYFA 4EHVA 3CIKA 2VAGA 3C4CA 5IF1A 2YM3A 4O7TA 3ZUVA 2XK3A 1YI6A 4WD5A 4BHZA 1AGWA 1W8CA 4E6QA 4ZAUA 4BCQA 3R02A 2OSCA 4OTHA 3KFAA 4FUYA 4FF8A 4UYNA 1PMVA 4KRCA 4BWKA 3P7CA 2R3MA 4Y5HA 3TUBA 4FT7A 4USDA 3QTQA 4IFGA 5CSWA 2WMQA 4R6VA 2UW8A 2YFXA 5E92A 4HZRA 4U79A 3MIYA 4YNOA 5BUEA 2EWAA 3V5QA 4X2KA 4CLIA 3KXNA 2CMWA 4D2WA 3QD3A 2BDJA 5M4FA 2PSQA 2UW5A 3TT0A 3EIDA 3HMNA 1GOLA 3SHEA 4ZMFA 2PMOX 4WHZA 4P5ZA 5GJGA 4NM0A 4HPTE 4XRLA 5AV1A 4B8MA 4BGQA 4EORA 3OVVA 4UALA 4L7FA 4CVAA 2ITVA 2NPQA 4R3PA 4FZDB 3QKLA 4RA4A 2YN8A 2XCKA 5CAQA 3DNDA 5E91A 3ALNA 3L8SA 3EQRA 3HEGA 2PVRA 3ORXA 4H1JA 1WAKA 5FG8A 2QVSE 3DT1A 3Q6UA 4MD7E 5ANIA 5M51A 2OXDA 5AR3A 3OWLA 2XNEA 3Q2JA 2YCRA 4FC0A 4IVAA 3PY1A 4UXLA 4YBJA 3MDYA 4AFJA 4D0WA 2O8YA 2UUEA 2QOLA 3W32A 4BHNA 5A4QA 4WG3A 5FTOA 4YZ9A 3QXOA 4KABA 3RI1A 3QWJA 4I21A 1W0XC 4O86A 2R3RA 3KU2A 2DUVA 1CTPE 3QYWA 4WOVA 3PWYA 2XIXA 5GZ8A 3ENMA 4EHEA 2ITXA 1W98A 3HL7A 3ROCA 2VWVA 3UP7A 4TPTA 1YI4A 3SW4A 1JSVA 3UDBA 4YJTA 2X8IA 3BBTB 4F4PA 2IG7A 3HA8A 2NRYA 3M2WA 1URCA 1P5EA 2VTAA 5HZNA 4P90A 1YXTA 5CU2A 4QQCA 4D5KA 3K54A 3D7ZA 3EQDA 2I7QA 5CSPA 1Z9XA 1RDQE 2CKEA 2GCDA 3MTLA 5IA5A 4Y95A 3DKGA 2VTMA 4JIAA 3NNVA 4XG2A 1WVWA 4F0IA 3SVVA 3C0HA 3ORLA 4BBMA 1ATPE 2W1CA 4K6ZA 3PTGA 2ITUA 2V22A 1PF8A 5E9EA 3FYJX 4Q5HA 5LWMA 5KBRA 3U51A 1KOAA 2YA9A 2R3GA 1E1VA 3ET7A 4MTAA 2YACA 1WBWA 4YJUA 4K0YA 5FWKK 1XBCA 4IAYA 4XV9A 4YZBA 3AMYA 3VUIA 3OHTA 3PP1A 3VC4A 3BV2A 2RGPA 3PDTA 3KMMA 3VRYA 3A4OX 3KQ7A 2HCKA 1R1WA 1PXKA 4G3DA 4WBBB 4NH1A 3P7AA 5CQUA 1YWRA 1ZYSA 2ITWA 3DLSA 4EOKA 4M68A 4MF1A 3OFMA 4IB3A 5EDPA 4QTAA 4M8TA 3BHVA 3G90X 4XNEA 3W16A 2O64A 3CTHA 5AADA 3EB0A 3MIAA 5BYLA 4KIKA 2XF0A 3OBGA 5EK7A 3R7OA 5C01A 2GPHA 4GG7A 4EH3A 1XH5A 2X9FA 5H9BA 4DEHA 1W84A 4L53A 3TTIA 5HIBA 4D28A 3OCTA 4D9UA 5K4JA 1KE8A 3D4QA 4O0VA 1OECA 3RCDA 5HNIX 1WMKA 2ZM3A 4N0SA 3G6GA 5BMMA 5JMSA 2VV9A 3RZFA 2C6TA 3N4UA 5JRSA 3REPA 1P4OA 3GC7A 3RHXA 5AUYA 3IK3A 2BHEA 4D4SA 4O0RA 3W10A 3PA5A 2OW3A 4M0YA 1YHSA 3EN9A 4WNOA 4RWKA 2C5XA 4WA9A 4NFNA 4JT3A 3A61A 1OB3A 2QO9A 1Q3WA 3O51A 4OTGA 5JH6A 3DK7A 4H39A 4GKIA 5AIRA 5EM5A 4TWOA 3F3UA 3GENA 5CSHA 4BI0A 3ZONA 2OFUA 4EHGA 2Z02A 3IKAA 1ZYJA 4FL3A 3SA0A 4AOTA 4GFMA 3QRIA 3NCGA 5HCYA 5IPJA 3QC9A 1ZMVA 4PL4A 3LMGA 4QTCA 1RJBA 5J9YA 3O8UA 4Z7HA 5LVPA 3EQGA 3OF0A 5ANOA 1K9AA 4IW0A 3SX9A 2BRMA 3K5VA 4M3QA 4DTKA 1R78A 2I0VA 4GFOA 4LYNA 2C6LA 4FKOA 4MK0A 4RPVA 3R01A 3ERKA 1W83A 3LFCA 4RA5A 2IZSA 4V01A 2Q0NA 4L45A 4ZJIA 3Q9ZA 3CEKA 5AX3A 2WU7A 3FUPA 2QO7A 5KBQA 4FEXA 4FVQA 2R0UA 4KS8A 4ALWA 3KRRA 5FXSA 4HVSA 3GU4A 1H0WA 3FLZA 5L2QA 3R30A 4ZIMA 2HOGA 2QONA 2YZAA 4QTEA 3QD4A 4G3GA 4F09A 5JFVA 1YKRA 3FQHA 4EJNA 4KAOA 1G8SA 1BKXA 4PP7A 1H1QA 2X81A 5AP6A 3IQ7A 2CN8A 4PPBA 1M7QA 3COMA 3DCVA 5IQEA 4WKQA 4ZK5A 3CKWA 2X6EA 3UGCA 1OPKA 3L9PA 3D0EA 3BEAA 3SC1A 4BCKA 4C2VA 5AV0A 1BL6A 3IDPA 4PL5A 2WIHA 1CKIA 4E7WA 2Y7JA 2W1GA 5L8KA 4LRJA 2R64A 1XBAA 1YI3A 3RALA 5F9EA 3E62A 2X4FA 1PYEA 2WNTA 2C3JA 4YHFA 2XRUA 4I93A 3TNQB 5J5TA 5DH3A 4RQVA 3AC5A 3UNJA 5LXMA 3I0OA 2VX0A 2EVAA 1JNKA 4JI9A 5BYZA 3TKIA 5BX0A 3UPZA 3MA3A 4HYSA 4AE9A 4A9TA 3QLFA 3FLYA 5CSVA 3NUSA 4AN9A 2H34A 3QRJA 4F08A 2XKCA 4FTIA 3AC3A 3PLSA 4EUUA 2AC5A 5DRBA 4ENXA 2BZJA 2WKMA 3UOKA 2VGPA 3EQFA 4DEDA 3QZFA 3KA0A 1STCE 2WMRA 3CQWA 5ETCA 2VWBA 3E7VA 3MY0A 2V0DA 1JKLA 4QTDA 3RVGA 4USEA 3O50A 3QTRA 4MCVA 2R3KA 2XBJA 5JSMA 4J53A 2GSFA 2YLFA 2QI8A 3HA6A 4KWPA 4FKVA 4D9TA 2YIXA 3OXZA 4BZNA 4NJ3A 1GZOA 3OW4A 4MNFA 2ITYA 3DNEA 4XBRA 5HG7A 2JLDA 3OY1A 2OJFE 5ANJA 1OKZA 1UVRA 3O71A 3LJ0A 2QNJA 4O2ZA 1H0VA 3F5GA 4O0XA 5DEYA 3CTQA 5E8VA 2CCHA 2Y4PA 4IXPA 4M0ZA 5CS6A 5A4CA 2G9XA 1KE7A 3LQ8A 4NW5A 2WQOA 4IZ5A 4KB8A 3RK5A 4BDCA 2YDJA 2PE2A 1MRYA 4GT4A 3IOPA 4MBIA 3UOLA 5BYYA 4RIWA 2B9IA 2VTQA 4W8DA 3VS0A 2J2IB 2QD9A 5GIPE 3BX5A 4TYGA 2OZAA 3Q5IA 1WFCA 3DDPA 2HAKA 3FL4A 4DFNA 3H9FA 4ZSLA 2HELA 3R2BA 3BLRA 3UNZA 1H26A 1Y6AA 3G0FA 4EH9A 3FV8A 4D2VA 4FK3A 3CE3A 3ZLYA 2E9OA 4QMUA 5L2SA 3D7TB 5GZ9A 3UC4A 4U81A 4EK3A 4ZTSA 3PVGA 2YIQA 4PDYA 4FKTA 4ITIA 2BMCA 4FEUA 2JDSA 2X8EA 4GFGA 4AGDA 3OCBA 4BR3A 5E1EA 4GCJA 3UYSA 4F7LA 2PZYA 3QQLA 4I23A 3TUCA 3V5TA 3Q32A 5CT0A 1QPDA 5HOAA 4F1TA 3NUUA 5LJJA 3MB7A 5HLPA 4RBLA 4QPSA 4B0GA 5JGDA 3HX4A 2GHMA 2YCQA 3F3VA 4KBKA 4PP9A 1JSTA 4G6LA 3QALE 4U43A 3PVBA 5IQFA 4FV9A 4RIWB 2NNWB 5K4IA 4IWDA 1T45A 5JRQA 1ZYDA 1UA2A 3R7GA 1YOLA 5D12A 1VJYA 3B2TA 2WIPA 3POZA 4EOSA 1P4FA 2XK9A 3R71A 4XV2A 2RIOA 2YM6A 3WF7A 2HZ4A 5FLFA 2PVMA 2VUWA 3SD0A 4KUJA 4O6LA 4WRSA 5LMKC 3SGCA 2P2HA 1Q8YA 3HMOA 3LFFA 5CI7A 4QMZA 4C62A 4X3FC 4LRKA 1WBTA 5AA8A 5JKGA 2YIYA 2GQRA 4TRLA 3AG9A 1H28A 4JVGA 4XV1A 4DGGA 3OEZA 5A4TA 5EM6A 2KTYA 2QU6A 4TYHB 4C4EA 5KHXA 2JGZA 3MBLA 4EH5A 4HCUA 4DFUA 2JKMA 5L6WL 3UIMA 2J0IA 2ZM4A 3K3IA 4JDHA 4AXAA 4QQTA 5HBJA 5BVEA 5EI6A 2QHNA 3V5LA 2F2UA 4BCHA 4QP9A 2GMXA 2C68A 3F5PA 1KSWA 4IH8A 3P5KA 2XRWA 1VYWA 3LKMA 3BQCA 4RX7A 5EQYA 3H30A 4YJOA 3OXTA 4D0XA 3EL8A 4F65A 1YWNA 5L2TA 2QR7A 5EYDA 3NUXA 3PVWA 4LOQA 4E5BA 4LOOA 3NVKI 2PUIA 3ZUTA 3U87A 4DF3A 2ZMDA 3A60A 4M69B 4MXYA 2VO3A 4L42A 3RM7A 5FM3A 3FXWA 3WZKA 4ANOA 5HTIA 3NCZA 5IKWA 1XQZA 2OG8A 4AU8A 5KMMA 2X0GA 3C0IA 4IM0A 5AP0A 2J4ZA 3F82A 5TT7A 4DG2E 4FVPA 4AZSA 5BPYA 3DJ7A 2EB3A 3JS2A 4XP3A 2BFXA 3O0GA 3AC2A 2B53A 5AAEA 4CFXA 4CMTA 5HLNA 4WO5A 2ERKA 4LUEA 4IHPA 3I1AA 3G6HA 2PZPA 3HGKA 2ZOQA 3FMDA 2A4LA 2QCSA 1PYXA 1ZRZA 2OFVA 4QMOA 3RAKA 3G0EA 3PXKA 4A4XA 1RE8A 3UO5A 4NT4A 4TW9A 2RL5A 3DTWA 2XIRA 3FAAA 3TACA 1OMWA 1JVPP 2BRHA 5IEXA 2AC3A 5ACKA 3L1SA 3TDVA 1R39A 3VUTA 1MP8A 2HZ0A 3WE4A 3FWQA 2LAVA 4O7SA 1M2QA 3QA8A 4TNBA 2W5HA 4YZCA 4O83A 1PKDA 5EDRA 4WRGA 5IISA 4XMOA 3NUPA 3U54A 3KXXA 1U54A 4I92A 5FBOA 4E73A 2O65A 4G17A 5HO8A 2AYPA 4P7EA 2BAQA 5AX9A 5JT2A 2ZDUA 4H3BA 3UO4A 3BRBA 3FQEA 2WTVA 3VW6A 1AQ1A 1UU8A 2Z7QA 3FKNA 1PY5A 4GT3A 4U3YA 5AR8A 4QMQA 2JAMA 2OJJA 3LJ2A 3E5AA 3DBQA 2VWXA 5J1WA 3I6WA 4I20A 3ORZA 4G3EA 4UWBA 4E4NA 2KULA 1ZOEA 1OL7A 4FTMA 2GTMA 4CMUA 3BLQA 3KF4A 4FIGA 2PULA 5FRIA 2OBJA 1OVEA 3D7TA 3P78A 3HMMA 2JDVA 5EDQA 3RWPA 3VQUA 5LVNA 4GUEA 4TKSA 3DXQA 5I9YA 4IAIA 5CI6A 2XK7A 4BDKA 3AXWA 2FSMX 4AQCA 2GTNA 2YIRA 3QCYA 4C3FA 2JIUA 2UVYA 4DT9A 2BALA 4DHFA 1PXLA 4U8ZA 1UV5A 1G5SA 4DCAA 4HYUA 2OKRA 5BUJA 4TWPA 2YZLA 3QQJA 1KOBA 3ZLXA 4GW8A 1UNLA 3PIZA 3QZHA 3BLHA 3U9CA 4CFNA 1JKTA 2JBPA 3FMEA 5DMZA 3WI6A 1FVRA 5EHLA 1IASA 3SG9A 4W9WA 2OU7A 2WMSA 4FG9A 4RWIA 5A4EA 3HV4A 4QP4A 4QP1A 4QMNA 4R7IA 5IEYA 4RFMA 3UO6A 2PUNA 5E8TA 5FQDC 1APME 3L9NA 3PE2A 2H8HA 3QD2B 2X9EA 4L43A 3IGOA 3PE1A 1PMEA 3MY5A 3O96A 2J5FA 1NA7A 3R8MA 3OC1A 3E7OA 3OW3A 4TXCA 1BYGA 3CGFA 1KE9A 1PXOA 3RM6A 3U4UA 3RPRA 4BC6A 4I0SA 4QP8A 4F0GA 3FI3A 4IANA 3N4TA 5I5ZA 4JR3A 2W0JA 3DFCB 5HE1A 4EOOA 4I24A 2OZOA 4FTUA 3VAPA 1PXMA 4TY1A 2UW3A 4F7NA 3GQLA 2XK4A 3ZUUA 5HEZA 3ZC6A 4ZJJA 5L4QA 3VF8A 3WARA 2YABA 3HECA 2ONLA 5JZNA 4C58A 1KV1A 4LMNA 4EH6A 1VZOA 1Y6BA 5HG5A 2UW4A 2X4ZA 3VVHA 3NZ0A 5AP2A 3WIKA 1IEPA 1A48A 4GMYA 2ZVAA 3KRWA 4RFZA 4JRNA 3D94A 4PX6A 3UPXA 4P4CA 2QLQA 4HVDA 5CEKA 3PY0A 5DVRA 2OF4A 3V6SA 3C4ZA 4IEBA 1Q8UA 3F3WA 4BICA 1YXVA 4I4EA 4YLKA 4WIHA 2NP8A 3OS3A 4BGGA 1H1RA 4FI1A 3JY0A 2ERZE 3I5ZA 4HJOA 3RPSA 3FJQE 4U7ZA 1PHKA 5DIAA 3LQ5A 5IA4A 4OAUC 4FL2A 2Q83A 2ITPA 2UW9A 4B99A 4EOLA 2IVSA 4DH3A 3DDQA 5CLPA 4AS0A 1Q3DA 2VU3A 3CBLA 1VYZA 1XH8A 2O3PA 3R2YA 3C13A 4JJRA 2IVTA 3FMHA 3QTSA 5J95A 5AV3A 4AF3A 4EONA 1YXXA 3QKKA 3RK7A 5LQFA 2ITNA 5M06A 2HY0A 4IM2A 2CKPA 3OY3A 4D1SA 1RQQA 3TNHA 4PY1A 2UV2A 4AOJA 4G5PA 3SRVA 1GIIA 2IVUA 4DGLC 5CZIA 4YHTA 2PVNA 4MHAA 4DFXE 2VTSA 1H25A 5A9UA 1FGIA 3E8NA 4EH8A 4JAIA 2CJMA 1GIHA 3I6UA 4PWNA 3FZOA 5DG5A 2GNLA 3HYHA 4DFYA 3NDMA 3SXSA 3ZO3A 3GT8A 3ACJA 5D10A 3HRBA 4PV0A 3P7BA 2JIVA 3DXNA 5C03A 5DT3A 4C4IA 3IW7A 3Q4UA 4KKHA 1NVSA 2JDRA 4UMUA 3POOA 5TOZA 5HICA 5KMNA 1R3CA 3VS3A 3ZRKA 2YLEA 1WBVA 1JKSA 5CEPA 1OIYA 3TTJA 4LV5A 3S4QA 5BQ0A 5B7VA 2FSOX 2X7FA 3FC2A 3UZRA 3ORTA 4I6HA 2IPXA 3TJDA 2JIIA 2VTHA 3TZ9A 2CPKE 2C4GA 3VUMA 5I9WA 3KK9A 2YAAA 2R5TA 1NXKA 3VBWA 4O27B 1WBOA 3MPTA 3ZO1A 2UZTA 4IJPA 4ASXA 3VBVA 2GHGA 4EC9A 5TO8A 5FEQA 4F9WA 5JEBA 4HPUE 4YR8A 3MTFA 3DQWA 4QNYA 3G9LX 5CEOA 5E8YA 1OUKA 3DQXA 4F0FA 3ORIA 2SRCA 4TYEA 4NL0A 2C0OA 2G2IA 5EW9A 3R21A 2OJIA 4R78A 4NTSA 3T8OA 3QQKA 4RJ5A 3HRFA 2F49A 5AR2A 2C6OA 2REIA 2ACXA 4I3ZA 3PUPA 4LL5A 4JG6A 3R8LA 4P5QA 2PHKA 2QQ7A 3VIDA 2G2HA 2W1IA 3KRJA 3ZZWA 3R04A 3LM0A 4O0WA 3PXFA 4H3PA 5IUHA 1Q4LA 4QMTA 4L00A 3BYMA 5D9HA 4D58A 3MFRA 4J7BA 3CQEA 2PVYA 5HKMA 1NY3A 5LVOA 1PXPA 4YJVA 2QLUA 3NYVA 4OBPA 1JAMA 2ZDTA 5I9ZA 4CSVA 1ZY5A 2E9VA 3TL8A 3R9OA 3ORKA 2XIYA 3A8XA 2W05A 3RPYA 4YGAA 4V0GB 2W5BA 3K5UA 4DG0E 5IQHA 3SXFA 3MJ2A 2C30A 2XNNA 3UQGA 3GC8A 4JAJA 2XJ2A 4FEQA 4XUFA 4BIEA 4F6SA 3SOAA 4QYYA 4IVBA 2YM4A 3AT3A 2C5NA 3OT3A 2XNPA 4RWJA 3SXRA 2PWLA 1SNXA 5LMBA 4CLJA 5DI1A 3D14A 4MKCA 4OT6A 5EH0A 3QXPA 3TG1A 3ZEPA 4XG8A 4IB1A 4ZS0A 5FBNC 4JBQA 3W33A 4APCA 4HVIA 3GOKA 4L3LA 4ERKA 5CAUA 4ASEA 1GAGA 5HBEA 4C61A 5HE2A 2E9UA 4DTBA 3P86A 1WZYA 3QD0A 4FSMA 4FOCA 4IIRA 3ZRLA 4AG8A 4JNWA 2C6IA 3GC9A 3KK8A 1XJDA 3AGMA 3WZJA 2VZ6A 3CGOA 5K0XA 4BDGA 1IAHA 3LIJA 3EYGA 3W18A 3HDMA 4MXOA 5I9UA 3EYHA 5IH6A 2PL0A 2BRBA 3DZOA 4GJ3A 5HBHA 3RAHA 4UEUA 3F7WA 3DBCA 3VJNA 5EI8A 3F2NA 2E2BA 4PPAA 5AAFA 5FDPA 2WO6A 1XR1A 2VN9A 1OKVA 3FZSA 3DBEA 3E3BX 3IW4A 4YJPA 3KVWA 4IQ6A 2RFSA 1J3HA 3F2AA 5A6OA 4N70A 4RGJA 1LR4A 4AZEA 3KGAA 5IMEA 4XBUA 5DYJA 2UZVA 1BLXA 2QC6A 3SRVB 1IG1A 5KX8A 2ZV7A 4RJ7A 5CF6A 4Y72A 4IWQA 3PG1A 4GEOA 4QP2A 4QMYA 5FTGA 3UQCA 4TN6A 2BHHA 4ZY6A 4HW7A 3RCJA 3DAJA 3PA4A 4DH1A 3ZM9A 3VULA 3AC1A 3CTJA 5L3AA 4O0SA 2A1AB 1Q61A 4HGSA 4C37A 4XG9A 1M2RA 2C1BA 3KVXA 3OZ6A 3BHUA 5HX8A 2XBAA 3LW0A 3VHKA 5IDPA 3BHTA 4ZTRA 4BDEA 1H1WA 1YRPA 3HZTA 4YZNA 3KRXA 3R73A 3ANQA 2PVHA 5EOBA 4A9SA 3N9XA 2ZV8A 3PRFA 4RIOA 4D1XA 2C0TA 2XJ1A 1MQBA 3D5WA 1M2PA 3G5DA 4IAZA 5C4LA 3PJ3A 4GYIA 4Y73A 4A4LA 2W1ZA 4FV5A 4LV8A 4YSJA 4TYIA 4W4WA 3E63A 4X3JA 4YBKA 1KE6A 4QYEA 4FKUA 1XO2B 4XG6A 3FKLA 2XB7A 4NFMA 3ZZEA 3KCFA 4WBOA 5CXZA 4MF0A 4APPA 4R7BA 3UP2A 3PPKA 4F1MA 4YZMA 2R3HA 4RQKA 5ANDA 4IX4A 4C34A 2VTRA 2I1MA 3HDNA 3OT8A 4UMQA 2WMTA 5HQ0A 3DZQA 2VNWA 2J6MA 4J98A 4KIQA 1PMUA 5M4CA 5JQ8A 4J71A 3R8ZA 3AQVA 5B0XA 5LVMA 4GG5A 2R2PA 3C4EA 4QPMA 3VS2A 3ZHPC 4F9AA 3V5PA 4RJ4A 1YHWA 4EZ3A 2YIWA 5M53A 5IQGA 2WTJA 3I7BA 3MPMA 3FDNA 4AX8A 4D4VA 4IWPA 2IZTA 5C4KA 3GCUA 3TEIA 3H9RA 4CMOA 2YCSA 3PZEA 3TNWA 5CAPA 2O0UA 2ITOA 1MQ4A 3COKA 4NW6A 3NW7A 4PTEA 3UJGA 3NYNA 3MI9A 3N4VA 2XJ0A 3UIBA 3EHAA 4QPAA 2V7OA 4KRDA 1W82A 4I0RA 4FT3A 3DTCA 3D2IA 2BROA 3ZC5A 1JKKA 1UKHA 1A9UA 1SVHA 4XG7A 4YTCA 3QA0A 5EW8A 4LM5A 3ORMA 2CNQA 3BYOA 1H1SA 3UVRA 2RG6A 4X2GA 3CD3A 4NM5A 4IZ7A 5C26A 4Z7GA 3PA3A 1LUFA 2Z7LA 3KRLA 4CFFA 3CKXA 4HGTA 3QQHA 1A06A 4UY9A 3F7ZA 1BMKA 4AAAA 1ZZLA 5JFSA 3A99A 5M57A 3O8TA 2ZM1A 3II5A 2HIWA 3FLNC 4L01A 1ZYCA 3UG1A 3VS1A 1E9HA 1NVRA 4FSWA 4IZAA 4O7WA 3GNIB 2UVXA 2DYLA 3HNGA 3PWDA 4FTJA 3L9MA 1K3AA 2P2IA 2YERA 3TI1A 4QOXA 5HI2A 3JUHA 3LFBA 4BCJA 4FT5A 1JQHA 1EH4A 2HENA 1YXUA 3VS4A 3LXKA 3SKCA 3UODA 2LGCA 2RFNA 3ITZA 4WT6A 3KXGA 5M56A 5D7AA 5DLSA 4EUTA 4E4LA 3ZS5A 2BRNA 4JQ7A 2PVJA 2YM8A 3DS6A 2QOOA 3RBWA 3UIXA 4MXZA 3IONA 5L8LA 4FV1A 2UZWE 4FE2A 4RZWA 3G9NA 4F1OA 1FMOE 4M69A 2BR1A 2P55A 3ZFXA 5JFWA 3NNUA 3BE2A 1OGUA 3RNIA 5ANKA 4QO9A 4NWMA 4EWHA 2FSLX 2XMYA 4DITA 3WIGA 3EFJA 4S32A 4UYAA 5HNBA 3U6IA 4ZLOA 4KKEA 5EHYA 4I5HA 2OH0E 4TYJA 5HTCA 2R7BA 1ERKA 1UU9A 1YDSE 3KL8A 3I7CA 4FIEA 4A4OA 5BVDA 3I0QA 2AUHA 5KMLA 5EQEA 3NMUF 2PVFA 3LZBA 3E88A 3HUBA 4PMTA 2EU9A 4BIBA 1U5RA 4O0YA 4AZWA 3F9NA 1V0PA 3KMWA 1FOTA 3FMMA 4BDFA 3ETAA 4ZY4A 1CKJA 1SZMA 5EOLA 4AW0A 3E92A 4L3PA 3FYKX 1UKIA 4BBEA 2V7AA 2IW9A 4A07A 1WCCA 2X2KA 3GCQA 5L8JA 3OCSA 1DM2A 5E8WA 4BDIA 1PXIA 4K2RA 5HIDA 4ZZOA 3QLGA 4FTTA 4DEBA 1PXNA 3LVPA 4QP3A 2UW0A 3O2MA 3HP5A 5HHWA 4X6QC 5HU9A 3Q04A 4RX9A 1Q41A 3RZBA 3I60A 4FV3A 4KBAA 4X0MA 2VO6A 5M4IA 1J7UA 2J50A 5CU4A 1FVVA 5T3QA 5TF9A 5BMSA 2QOCA 2BTSA 3M1SA 2B55A 4NM7A 3BZ3A 3V8SA 3AD6A 2R7IA 3R7YA 2VTOA 4F9YA 2VWYA 4EOQA 4RMZA 3T3UA 2CNUA 5JN2A 2CHLA 2WEIA 3ZSHA 2W1FA 2B4SB 5ETAA 2X1NA 3A2CA 3ULIA 4BTMA 1ZAOA 1NVQA 2C5YA 2YM5A 5GJDA 5H8EA 4HYIA 4LUDA 2OF2A 3OUNB 2JFLA 2CLXA 2VO0A 3RGFA 4XP2A 4D4YA 2CNVA 3E8DA 2FYSA 4FIFA 4PMMA 4YC6A 4NM3A 4F70A 3AD4A 4JOAA 3MVLA 3QQGA 3F66A 1U59A 4ONAA 3F5XA 1SVGA 4E3CA 4FV7A 2Z60A 3ROYA 5JQ5A 2G1TA 5HE3A 4CQGA 5EFQA 2YITA 3OBJA 3UVQA 4EQMA 5LCJA 5KNJA 3GB2A 4IX3A 5K5NA 4OTPA 1OM1A 3VBQA 5CVFA 4DGMA 4AWIA 1L3RE 3UG2A 4DCEA 1KE5A 3RJCA 2FSTX 3GC0A 3ATSA 2XNGA 4CKRA 2W9ZB 3Q96A 1CSNA 4I0TA 5CWZA 5DN3A 3ACKA 2W1EA 3EH9A 3H4JA 4BN1A 1LP4A 3TKHA 4DA5A 3E93A 4FIJA 5CXHA 2C47A 4ALUA 3U6JA 2F9GA 5LCKA 3R9HA 3OOGA 4E4XA 1NW1A 3IGGA 4NSTA 1GJOA 3ZDUA 4CZUA 4FGBA 3BHYA 4HZSA 5A4LA 4FTKA 4EOIA 1IAJA 5I3RA 5BNJA 3U55A 3WZDA 3V51A 5J79A 2BZHB 5D7VA 4FEWA 3QTIA 4G9RA 2J9MA 4PMSA 1UNGA 5DR6A 2WTDA 4DTAA 3NLBA 1DAWA 4PF4A 3R7VA 5IDNA 5E4HA 4IAAA 4USFA 4MQ2A 3C4FA 3C1XA 1Q99A 3KULA 3MPAA 5J9LA 2FGIA 2QOQA 4ASZA 5M44A 1ZYLA 3DB6A 3O23A 4RIXB 3TM0A 1I09A 3VJOA 3BE9A 4QT1A 5IH5A 4TZRA 3KN5A 2A19B 2VGOA 3ULZA 5HIEA 1MRVA 4EZ5A 1CM8A 3KC3A 4O91A 4WNMA 5KO1A 3CY2A 3R83A 5HNGA 2IW8A 4BFMA 2XZSA 3PZHA 4DLIA 5B2MA 3MY1A 4OBQA 4ANBA 4PNKA 4MNEB 1UU7A 2IW6A 1QL6A 4FT9A 4CYIA 3MH0A 4UMPA 4U9AA 4L52A 3TDWA 2WMBA 3FE3A 2OXYA 3QZGA 3FPMA 1OBDA 3RWQA 3ZO2A 1V0BA 4S2ZA 4PRJA 1FGKA 3G51A 3GP0A 4IC8A 3UOJA 4O0TA 4J99A 2BRGA 2W1HA 3DXPA 1WBNA 4IZYA 2QG5A 2G15A 3D5VA 4FTRA 4YSMA 3QQUA 2GNFA 5EW3A 3MH2A 5CVGA 2XS0A 4D5HA 2J90A 2BIYA 3GUBA 4EJ7A 2OK1A 3WZUA 1JOWB 3PRIA 4Z16A 3O17A 4GS6A 3PXRA 1XHAA 4HYHA 3Q52A 4I6FA 2F7EE 5DOSA 4Y8DA 3TNPC 3W2RA 2XNOA 3H0ZA 1ZOHA 2OIBA 3CPCA 5CZHA 4BGHA 4EHZA 4NU1A 4ZXTA 4OAVB 3CPBA 2YCFA 4O7YA 4DT8A 2BTRA 2I0HA 3NSZA 3OD6X 4DFZE 4O21A 4WUNA 5HO7A 1CKPA 1UWJA 1ZXEA 5CU3A 3R9DA 4BRXA 2PZ5A 4RVMA 4F9BA 3VS5A 4G3FA 4CFVA 5A14A 1IA9A 2J0LA 3LFDA 5C27A 4FIHA 2BZIB 3CJFA 5L6OA 5M09A 4YTFA 2QKRA 3H3CA 4O1PA 3S2PA 3FQSA 1SYKA 3DV3A 4GH2A 3HV5A 4CGAA 2UW7A 1LEWA 4LOPA 5IA1A 4FV2A 4F9CA 2WQEA 1BX6A 3MS9A 2XUUA 2JD5A 2PY3A 1NT2A 4JG7A 5DFPA 3ZMMA 3CLYA 5C8KA 3EL7A 3GU8A 1F0QA 4CFWA 4AW2A 3HP2A 4MWIA 2QOBA 4U0IA 5G1XA 4BCOA 4CTCA 5KKRB 2ETKA 4X6RA 3EQIA 3NYOA 4GVJA 4AACA 3BGZA 4IE9A 4I5PA 2ZV2A 2ONLC 2ETMA 2OJ9A 5TR6A 4MBJA 4PL3A 5KZIA 3EN7A 4E6DA 4E8AA 1Q5KA 2Y0AA 4MH7A 4DINA 2RFEA 4FOBA 4FSUA 4YTHA 2YAKA 3PSCA 3M42A 4BF2A 5EM7A 5E8SA 4ZTQA 4GK2A 2WQBA 1F3MC 3MFUA 5KE0A 4PDOA 3VHEA 5LOHA 2HWPA 2O2UA 4CZYB 2V62A 2VWIA 4O82A 4C38A 1JBPE 3G2FA 3PXQA 4F6WA 4FEVA 3PJ8A 1VR2A 3LFNA 2X7OA 1UWHA 4U5JA 5DA3A 1R0EA 4YP8A 4C0TA 5CF8A 4LI5A 5J7HA 1OI9A 3FPQA 3HV7A 3LFQA 3LFSA 4NIFB 3C0GA 2XEYA 3F69A 4FKLA 3IG7A 3HAVA 5DT0A 3ZEWA 1XKKA 2WQMA 3H10A 3KXHA 2UZNA 4BZOA 3DKFA 3LM5A 5CNNA 1XH6A 2I0YA 2WOTA 1CMKE 4OBOA 4AW1A 3GCPA 3WF8A 2ESMA 4E6AA 3E87A 3MA6A 3A7JA 2GNIA 2OLCA 3FEGA 2B9HA 4O7RA 3VNTA 3QHRA 1OIQA 2GU8A 3P9JA 4UZDA 4XOYA 4UXQA 3R8PA 2WB8A 4AT5A 2Y8OA 3E8CA 5ANEA 3ZXZA 3CJGA 5F1ZA 1R0PA 4FTAA 4FZAB 2B7AA 3TCPA 1PRYA 4BKZA 3QTWA 3WE8A 4RJ8A 5D1JA 1OL5A 1OL1A 1OIUA 3NGAA 3OEFX 4QMVA 3WYXA 4G5JA 4U41A 1CDKA 3OTUA 2GS2A 1XH9A 5J8IA 4MBLA 4G2FA 2GNGA 2W4KA 4D4RA 3SQQA 3TIZA 5GINE 4OTRA 4RJ6A 2X2LA 5AUXA 3QHWA 2XH5A 2YHVA 3CXWA 1H07A 4XP0A 3DLZA 3O7LB 1OITA 3AMBA 3DAKA 3RK9A 5E90A 3V6RA 2OJGA 2XKEA 3U9NA 5E8XA 4ZSJA 5GJFA 4NYEA 1GZKA 2ZMCA 4DBNA 3PIYA 1Q8TA 4G3CA 4FYOA 1H27A 1YDRE 1V1KA 2WU6A 3P4KA 4TT7A 4BWPA 2PUUA 3A7GA 2PZRA 4M15A 5E7RA 3R28A 4XLIA 4WSQA 3WYYA 1U4DA 2IVVA 4QTBA 3DK3A 3LMHA 3FMKA 3LMIA 2VWUA 3QCSA 3COIA 4TWNA 2WEVA 4DGNA 3TUDA 2ZAZA 1O6KA 4OT5A 5KMIA 4M7IA 4HVGA 2W1DA 3K3JA 1PXJA 2Z7SA 1BL7A 2QODA 4X2NA 5BVFA 3MJ1A 1J7LA 4MWHA 3EJ1A 1REKA 2FB8A 4EBVA 3FC1X 4EWQA 4X3FA 3R1QA 2FH9A 5ACBC 3BBWA 4TL0A 4QP6A 4AA0A 2ZB1A 1HOWA 3V8TA 2WPAA 5F95A 3W2PA 3QBNA 4ARKA 2HXQA 2V5QA 4KNBA 4JRVA 4XX9A 1MRUA 2UZUE 2WTWA 4D1ZA 3UOHA 4FSRA 4C3RA 4TTHB 5AUZA 3S1HA 4N4SA 4ACCA 3FSFA 4ENYA 2A0CX 4FSZA 4E1ZA 3ZSIA 4XH6A 1M52A 3P08A 4XCUA 5E8ZA 2BZKB 4A9YA 4BB4A 2FVDA 3NW6A 2X8DA 2WD1A 5CY3A 5L2WA 4FV8A 4EBWA 4JQEA 2G01A 5HVJA 3UC3A 3V5JA 3ZFYA 4EL9A 4K11A 3BU5A 4M67A 3HAMA 4FUXA 3DJ5A 4JG8A 4O38A 3LLAA 3NIEA 4FG8A 2WZJA 3TWJA 4N57A 2JITA 2ZYBA 3PPJA 2W4JA 3RTPA 3U8WA 3HLLA 5I0BA 3AC4A 3GCSA 3JYAA 3ZFMA 4C57A 4UX9A 2R3OA 2QHMA 2WTKB 3KN6A 5ITAA 3FY2A 3R0TA 3VW8A 1J91A 1P2AA 3BV3A 3FMLA 4JLCA 5IQIA 3NPCA 1LEZA 3NYXA 4LGDA 4WNPA 1Y91A 3OTVA 3LOKA 3R8VA 2A2AA 3QCQA 4EQCA 1H01A 3LJ1A 3S3IA 3SW7A 3LQ3A 2PUPA 5GNKA 4QMSA 4S30A 3JY9A 1GIJA 4OGRA 2GQGA 2PE0A 4C3PA 4DEIA 1I44A 4E26A 4H05A 5FP6A 3C50A 3DPKA 4DEGA 5B2KA 3VO3A 3S0OA 4CEGA 2WTIA 2GS6A 2O63A 1U46A 3BWFA 3TZ7A 3WBLA 4I41A 5DGZA 3HMIA 4BCGA 4YO6A 1PMNA 2IO6A 3ZM4A 4DEAA 3LCTA 4R1YA 4UMRA 2VTTA 3Q4CA 4K1BA 1B38A 2YJSA 2BAKA 4MX9A 4EKLA 5HTBA 3FI8A 3R8UA 3WF9A 4ACGA 4QRCA 3IPHA 4R5YA 5AP7A 4AFEA 4GIHA 3VN9A 4PQNA 2CLQA 1PW2A 5EYCA 2CCIA 4BKJA 3S95A 2H6DA 4CZTA 3V5WA 2F7XE 4O0UA 5A3XA 2B52A 4BTJA 1GZ8A 3CR0A 3ORPA 3P79A 1U5QA 5AUVA 1ZARA 4BL1A 2R0IA 2WXVA 2C6KA 2HW7A 3ZBXA 3GFEA 3ID6C 2C5OA 2WMUA 4R3RA 1DS5A 1TQMA 2RSVA 3NR9A 3SDJA 2HZNA 2RKUA 3L8XA 3MSSA 4IB5A 5IUIA 5AR7A 4HGEA 4XRJA 2B9JA 4B7TA 4B8LA 1QCFA 3LAUA 3KXZA 1P14A 2EB2A 2XA4A 4FSNA 4Q5EA 3BHHA 5CVHA 3DBDA 2VTJA 4BVUA 3U4WA 4FIIA 4HNIA 3IO7A 2HWOA 4K9YA 4CRLA 5KMKA 5I9XA 1KUTA 4G34A 3LCOA 4DFLA 4YLLA 3VUGA 2ITZA 4II5A 3QAME 3O7LD 3VUDA 4OLIA 4XEYA 2ITQA 3R63A 3VF9A 4YZDA 3T9TA 3NRMA 3FSKA 4GK4A 4XOZA 4LG4A 4ANMA 3EQPA 3AC8A 2YWVA 1Q62A 3AT2A 3AD5A 2PYWA 3NAXA 3JPVA 3AMAA 2VTPA 5AR5A 5AV4A 4OTWA 1DAYA 5T68A 3MH3A 5L6PA 4V04A 2PK9A 2YISA 2FO0A 4L3JA 5T6KA 4Z3VA 4AGWA 4MXCA 4ZLZA 5EKNA 1U54B 4Z55A 3KB7A 2GDOA 4A9UA 4CG9A 4FKIA 2YDKA 1E1XA 4EQUA 4FNWA 5FUTA 3KCKA 4YC8A 3GFWA 4ZJVA 3D83A 3KKVA 4IAFA 4LQMA 4OTFA 4ANLA 2J51A 4O96A 4G9CA 4RC3A 2OIDA 3NX8A 1MUOA 4K18A 3KXMA 4OW8A 2BPMA 3DOGA 1G8AA 5HVKA 4OR5A 4DFBA 2W17A 2ZJWA 1BI8A 4C8BA 4J52A 4EH7A 1O9UA 4HCTA 3N51A 2JKKA 4R3CA 3NS9A 3CP9A 2YEXA 5I3OA 2RF9A 2HZIA 2YJRA 3ZRMA 4RIYA 3Q9YA 1JLUE 2R3JA 3FXZA 3PSDA 3V8WA 5HCXA 3BPRA 2J7TA 2Y4IC 4FSQA 4X7QA 2J0MB 3Q9XA 3TV4A 3UYTA 3WOWA 2C5VA 3C9WA 2HW6A 3JR1A 4FKGA 3VQHA 3ODYX 3QRTA 3BWJA 4O84A 4IX5A 2C69A 3GXLA 4H3QA 5K0KA 2XK8A 1TQPA 2ZV9A 4W8EA 5CU6A 3F88A 1PJKA 4KD1A 2XVDA 1FPUA 2FA2A 4CRSA 1Z57A 3LCKA 3ZSGA 4S31A 5GZAA 1ND4A 2I0EA 5LMAA 2JFMA 5KMOA 1YDTE 3LFAA 4MD9E 4NCTC 4NZWB 1GZNA 3NW5A 4I5CA 4M84A 3DFAA 2WMVA 3MWUA 3JVSA 4AT3A 2CKOA 3EKKA 4CCBA 2BILB 5EKOA 3VWAA 3B2WA 4LRMA 3FLWA 5GHVA 4GYGA 3C7QA 3CQUA 4B6LA 5IQDA 4O7NA 3QFVA 1UU3A 3V01A 3LE6A 4QMLA 2XNBA 2HYYA 3EFKA 4F7SA 3CD8A 3HV3A 5D11A 5CNOA 5J1VA 3ELJA 3UZPA 3F3ZA 3NEWA 4OTDA 1KV2A 2R4BA 1JWHA 4F7JA 3P0MA 2WMAA 1QMZA 2WELA 4FVRA 3LCSA 4FT0A 1IR3A 4P2KA 1Q24A 5AUWA 3UZTA 3QX2A 2QG7A 4I6BA 3NAYA 2YWPA 4NIFA 4U42A 5ETFA 3PJ2A 5A46A 3TIYA 4ZSGA 4FSYA 3PVUA 4GJ2A 1GNGA 2BVAA 2GFSA 5EHOA 3ZLSA 4BCPA 2WAJA 3A4PA 2BIKB 3QU0A 4IMYA 4BCMA 1GY3A 4Q9ZA 3GGFA 1AD5A 3U6HA 5HO6A 5J9ZA 2E9PA 2W7XA 3OWPA 5BVKA 2JKOA 1B6CB 4AOIA 1Q8WA 5IQBA 2PZIA 2FUMA 3QGWA 3DJ6A 5HD4A 3W8QA 4EK6A 4GU6A 1QPJA 3MB6A 5IQCA 2DWBA 2PMLX 3NUYA 4EC8A 3QYZA 3PXYA 3A7HA 3NVMB 3Q60A 4IVDA 4BCIA 4N6ZA 4FTNA 2WMXA 3BCEA 1V0OA 2XM8A 2G2FA 1SMHA 2W9FB 4R5SA 4D55A 1QPCA 2VNYA 1LPUA 3ZLWA 4HCVA 4LMUA 3HKOA 4BI2A 5M55A 4L67A 1J1BA 2XKFA 3LPBA 4RLKA 4TWCA 3MH1A 2BDFA 3MV5A 4G6NA 4M13A 3EKNA 4PTGA 2XYNA 2J0JA 2OWBA 3SV0A 2OICA 5HGIA 3R9NA 2C6EA 4EYJA 4DAWA 4YU2A 5M07A 3W8LA 3GU5A 5DNRA 4O7VA 3PIXA 4E6CA 1HCKA 2RFDA 5I4NA 5AR4A 3QF9A 4AP7A 2X6DA 4HOKA 4O1OA 4GSBA 4U3ZA 2QOHA 5AP3A 2VTLA 1JSUA 3HRCA 5JZJA 4JDKA 4JL9A 2NRUA 4IC7A 5AMNA 5BVNA 5AFVA 1URWA 3QTXA 3G33A 4ZTMA 1W7HA 4DH8A 2C6DA 3BU6A 4FTOA 4OUCA 2EXMA 3TV7A 3RKBA 2WTKC 4EH2A 1H00A 5DT4A 3TXOA 4K77A 3BKBA 2PE1A 4BI1A 3VBYA 4PPCA 2CSNA 4WSYA 1BUHA 4ANSA 5C8NA 4JBPA 4C02A 4CTBA 5LARA 2ITTA 4RC2A 4EOMA 4U6RA 4YUQA 1TKIA 4UMTA 3BYVA 3RAIA 2PPQA 5AM7A 3C51A 3SAYA 3QQFA 4JX7A 4RIXA 1OL6A 3ZO4A 1WBPA 4ITJA 5BVOA 4CCUA 2XEZA 1S9IA 4C33A 4AT4A 2JKQA 4FTCA 2HY81 4R7HA 5KKRC 3BELA 5DHJA 4JDJA 1XWSA 2BCJA 2XK6A 3EFLA 4KS7A 4KSPA 4CFUA 4W4XA 5KCVA 3L8PA 2R3LA 3I4BA 1Y8YA 3ATTA 3D9VA 5DEWA 3WF6A 2UZEA 4AA4A 4IACA 3L8VA 4UZHA 2VTNA 3RHKA 4ZP5A 4FKPA 3EZVA 5CENA 3V3VA 4EOPA 3RINA 3VUKA 4M12A 5HLWA 2VRXA 2Y4IB 4FKWA 3MFTA 4IBMA 3ZDIA 5FEEA 4J97A 4LL0A 4BTKA 2UW6A 2R3NA 4K8AA 4D2PA 4GKHA 4J1RA 5CANA 2WGJA 3M11A 3A7IA 3P1AA 4E5AX 3MVJA 5CTPA 2IJMA 3PFQA 3QGYA 4TYHA 4S33A 1DI9A 3AGLA 3R1YA 4FL1A 1ZWSA 2OXXA 3BYUA 1ZZ2A 4GL9A 4JS8A 5HESA 2VD5A 2GNJA 2PMIA 4GRBA 4O7ZA 2JAVA 2Y6OA 5HU3A 2QR8A 1YXSA 3FXXA 4QP7A 4DN5A 5KUPA 1ZMWA 2PU8A 5EYKA 4C35A 3SLSA 3TNIA 3PJ1A 4U45A 3COHA 3VRZA 4CKIA 4D2SA 3JXWA 5IMXA 2IWIA 2CGVA 2QOIA 2VTIA 4AUAA 2X39A 4O2PA 1OPLA 2QKWB 3PP0A 4QMWA 3R1SA 4EK8A 4FX3A 4Y85A 2W96B 1H24A 3I81A 1H08A 5CYIA 2CDZA 2XYUA 4RRVA 4NUSA 4MXXA 3DK6A 5DWRA 4NCTA 5CEMA 5I9VA 4L44A 5J87A 3FI2A 5HCZA 3WZEA 3W1FA 1OZ1A 3MVHA 1OIRA 4AN2A 4YHJA 5IA3A 2GS7A 5LWNA 3C5UA 4FYNA 3TN8A 4H1MA 1O6YA 4ZOGA 4BDHA 4FNYA 5AUUA 3EZRA 3OMVA 2B9FA 2P0CA 5CSXA 2B0QA 5B2LA 4JX3A 3RMFA 2Z8CA 1WVXA 2P4IA 4BY9E 4W9XA 4OTIA 5K5XA 3E64A 4ANQA 4LGHA 4BDAA 2Q0BA 3BEGA 3E3PA 3A62A 4RJ3A 1B39A 3ODZX 4WUAA 4Y83A 4QQ5A 4ZZNA 3VBXA 4NTTA 3AOXA 1XH7A 2Z2WA 3QKMA 4BCNA 2VWZA 4E93A 4ZMEA 4L8MA 3FZTA 4IM3A 4O7LA 1OKWA 3ZBFA 3A7FA 3I79A 4C4FA 3R22A 4GIIA 1OPJA 5F4NA 4CQEA 3ZCLA 4L46A 3FZPA 3NUNA 5M4UA 3BQRA 4ACMA 3W2SA 2BAJA 3BU3A 3QC4A 3TJCA 4XJ0A 4BIDA 4PDPA 4XS2A 4LGGA 3GBZA 4FKRA 5C1QB 3EQCA 3FLQA 1TQIA 1YOJA 3GOPA 4KBCA 3ANRA 4D2TA 3KEXA 5ETIA 3IW6A 5HORA 1H4LA 1UNHA 2WFYA 3BI6A 4AN3A 3NNWA 4KKGA 4A9RA 3LXPA 5IA2A 2R3QA 4L68A 3DU8A 3Q3BA 2R3PA 4V05A 2O5KA 3CS9A 3OUKA 5AP5A 4RWLA 5H8GA 3T3VA 2W5AA 5CAOA 4ZS4A 2J0KA 3PXZA 4CV8A 1OBGA 4UV0A 5AM6A 4YJQA 3R7IA 5KMJA 4MVFA 3H0YA 4PDSA 3F6XA 3ALOA 4YLJA 5GIOE 1VEBA 4EK5A 3IS5A 5HD7A 5HE0A 3SOCA 5IH4A 1H8FA 5IG1A 4FV4A 3C4XA 4NKAA 3ZH8A 5A6NA 1YHVA 3S00A 2IZRA 3IW5A 2EXEA 2HK5A 2XCHA 3PYYA 4MEDA 4Z9LA 3RPVA 5A54A 5FXQA 2WHBA 4F6UA 3IDCA 4NEUA 2A27A 5H3QA 4YC3A 3RP9A 4ITHA 3Q53A 4ZEGA 5JFXA 3PSBA 3VUHA 4FGRA 2F2CB 4V0GA 5JGBA 3LHJA 1XBBA 4HGLA 4FMQA 4IX6A 2JC6A 1IA8A 1WBSA 4IVCA 1ZMUA 2OZAB 1ZOGA 4CT2A 4EI4A 5ICPA 1BI7A 2ETRA 4RSSA 3D2KA 4ZTNA 4ZY5A 3KREA 3R00A 2VX3A 3UIUA 4ORKA 1KWPA 4BKYA 1TVOA 3WILA 1L8TA 3NNXA 3B8RA 4GK3A 4I94A 3D15A 4RZVA 2UZDA 5TKDA 3ZU7A 4CD0A 4DG3E 1RW8A 4FKSA 2R3FA 4GT5A 4W4VA 4M97A 2C6MA 3QUDA 3FHRA 4JQ8A 2I6LA 5AWMA 5D41A 2B54A 3PY3A 5K3YA 4J8MA 2CGWA 4UB7A 2QOKA 4YMJA 5IEVA 3MW1A 4G16A 2VO7A 2I40A 1K2PA 5CU0A 3ZYAA 4NJDA 3RAWA 4WNKA 4AZFA 4CV9A 3F2RA 1XH4A 3OOMA 4IADA 4CXAA 1T46A 3EFWA 3UQFA 4XV3A 1FINA 4XG3A 4ERWA 4YTIA 3LCDA 1FBNA 4JR7A 5CAVA 3FZ1A 4IDTA 3W55A 4ANNA 4N6YA 2QOFA 3GQIA 3QRUA 4IDVA 5DE2A 2V55A 2GHLA 3QX4A 4IFCA 4YJRA 4RT7A 3QCXA 3TZMA 4CNHA 2WTCA 4EYMA 4RX5A 4FV0A 2PVLA 4W4YA 3MFSA 5CASA 4BBFA 3VS6A 1J7IA 3ENHA 4PUZA 4YURA 3DB8A 1G3NA 3EMGA 4E4MA 3PPZA 4YO4A 3UMXA 2BUJA 3GCVA 3B8QA 1M7NA 5FM2A 4AZVA 2ZB0A 5AAGA 3HMPA 2W4OA 3DGKA 4L9IA 3E8EA 5FD2A 3TZ8A 2OI4X 4RG0A 4DLJA 5BVWA 3THBA 5DR2A 5KZ0A 3QUPA 4M66A 4U40A 5E1SA 2X7GA 3EN6A 3BGQA 4KIOA 5EYMA 2C3KA 4I6QA 3GU6A 4A7CA 4I22A 2GFCA 2OIQA 4Q2AA 3IECA 4FTLA 1SM2A 5HG8A 1JPAA 2CGUA 3R6XA 4D2RA 4Q9SA 4AE6A 5DPVA 3EN5A 3EN4A 5AP4A 1PKGA 2BKZA 4G31A 2BFYA 4GVAA 4BTFA 2XM9A 3DKCA 3HVCA 4XG4A 2XIZA 2UZOA 4BCFA 5JGAA 5KHWA 4QD6A 2C0IA 5FDXA 4RVKA 4S34A 3W2QA 1M17A 2P3GX 3MGYA 3OWJA 5EI2A 1H1PA 5L2IA 4QMXA 4I5MA 5G6VA 4Y5QA
chains in the Genus database with same CATH superfamily
3JVRA 3Q6WA 3DBFA 4UN0C 5IZFA 4IJ9A 2DS1A 4B9DA 2J5EA 3PLAE 3Q5ZA 4KIPA 4R8QA 1HCLA 1SVEA 5AJQA 5E8UA 4C4JA 4F64A 2E9NA 4FODA 2RG5A 3I5NA 3Q9WA 5C9CA 4E20A 3SG8A 4IB0A 3DKOA 1YW2A 2R3IA 4I4FA 3MESA 2IZUA 4RFYA 2X2MA 3NWWA 2W06A 2UZLA 3P23A 5DRDA 3ZTXA 3QUEA 1FMKA 3TMOA 3UMWA 3QWKA 4EKKA 2JBOA 3CC6A 3NUAA 4DC2A 1FQ1B 4DE4A 3L9LA 2XP2A 5IU2A 1IRKA 2CGXA 4U44A 3KMUA 4MQ1A 4J96A 3OP5A 4RVTA 3MN3A 3DAEA 5AEPA 4CFMA 4C7TA 2CN5A 4FZ7A 3RNYA 3CCNA 4FKQA 5J7BA 2VWWA 2QURA 3EQBA 4A06A 4J8NA 5IQAA 4BDJA 4O22A 4RC4A 4KSQA 4CG8A 3D5UA 5HX6A 4Y46A 5IUGA 2F7ZE 4ACDA 4RLLA 4FZFB 5FEDA 5CX9A 4QMPA 3TV6A 3QL8A 3CY3A 3F5UA 4YJSA 4R1VA 3W2OA 3R7EA 1S9JA 2EUFB 4AGCA 3G15A 4YJNA 4O81A 3HV6A 4NK9A 1O6LA 2DQ7X 3FMNA 3NFFB 4WG4A 5IA0A 2JEDA 3KY2A 3KF7A 4AW5A 4B4LA 1Z5MA 3C4WA 4CKJA 2WMWA 2C3LA 3QZIA 3C5IA 3UTOA 3LXLA 5AUTA 3FLSA 1Q97A 5HG9A 4EZ7A 2HXLA 4FZ6A 5ANGA 4X2JA 4HNFA 1YVJA 1OL2A 5CEQA 3GI3A 3IDBA 3UNKA 4FG7A 3UVPA 4F99A 4WG5A 3EOCA 3FHIA 1ZY4A 5FGKA 5TE0A 3TKUA 3AT4A 3O8PA 4FTQA 3OXIA 4FKJA 4CT1A 4UWYA 4ZLYA 4QQJA 4FNXA 2UZBA 4C59A 4RX8A 4ZSAA 3MVMA 2BKKA 4UBAA 2PVKA 1ZLTA 3F3TA 3D5XA 4KA3A 4GU9A 5H8BA 5BUIA 5LVLA 2H96A 1QPEA 3GEQA 3F61A 5AV2A 2IN6A 4J95A 5CEIA 3RPOA 3ZOSA 4ASDA 5JK3A 5M08A 4C4GA 4ALVA 5FP5A 2YM7A 3BIZA 4MAOA 3QTZA 4KINA 1M14A 2OGVA 3BYSA 4QYHA 4ZTHA 4FSTA 3FL5A 4PNIA 4BYIA 4EOJA 4DHIB 4BYJA 4EK4A 3KULB 4M14A 4MD8E 2Y6MA 4JBVA 4MYGA 5F20A 4QYFA 4EEVA 5FXRA 2JDTA 4FA2A 2QO2A 4QNAA 4MNEA 4K33A 2GNHA 5HVYA 3LFEA 4FICA 4IAKA 4U97A 1DI8A 1YOMA 3Q4TA 2Y9QA 3Q4ZA 4C2WA 3MYGA 3VBTA 4C4HA 3LXNA 2WOUA 3DY7A 1YQJA 3OROA 4ZZMA 4DH7A 3UBDA 3R1NA 4H58A 3UE4A 4ACHA 3FBVA 5J5SA 2PMNX 4TNDA 4QYGA 2XNMA 4L7SA 4UWCA 4BDBA 4RVLA 4AA5A 4YPSA 5EQPA 3WF5A 2VX1A 4L6QA 5AA9A 5CALA 4X3FB 1FVTA 2Z7RA 4X21A 2NO3A 3IOKA 4I1ZA 4FR4A 1WVYA 4XLVA 2H9VA 4IWOA 4LFIA 5CF5A 3GU7A 4AAYA 3R7UA 4GV1A 1X8BA 3EQHA 2OH4A 4PTCA 2EXCX 2OO8X 3FMJA 3Q2MA 4FK6A 4G6OA 4O6EA 3ZXTA 4DEEA 4RIYB 4DYMA 4E5WA 4PMPA 5CF4A 4ID7A 4JBOA 3QTUA 2NYAA 4FNZA 1Q8ZA 4NKSA 5AIKA 4C36A 5F94A 2QU5A 4U80A 1YWVA 2XIKA 4ZTLA 1J1CA 4X2FA 3HUCA 4FV6A 5CT7A 4DBXA 3EWHA 1REJA 4GUBA 2WQNA 5DBXA 2F4JA 3FI4A 3V04A 1Y8GA 4BZDA 4AZTA 4JIKA 3CSVA 5DR9A 3K2LA 4CYJA 3R9RA 5EM8A 1SNUA 3BGPA 5FTQA 5CQWA 1Y57A 3W2CA 3VS7A 2PTKA 4QMMA 4R77A 3DA6A 2P33A 4AGUA 4DH5A 5LMKA 4LDTA 2JDOA 2R9SA 4G1WA 4KIKB 4YPDA 4YNEA 2UVZA 4EH4A 5AP1A 4H36A 4BTFA 5H2UA 4DGOA 2BDWA 4F63A 3ORNA 4FBXA 4BWXA 4MXAA 3T9IA 3OCGA 3GVUA 2CKQA 1F5QA 2B1PA 2W99B 2C3IB 3FKOA 3NIZA 3IW8A 3FY0A 2XALA 2F57A 3PJCA 3QRKA 1OKYA 4BDDA 4HVHA 4LV7A 3LLTA 4OTQA 2GQSA 5EG3A 5C8MA 3A8WA 3H9OA 1OUYA 3FZRA 3PG3A 1TFFA 2C1AA 4ZSEA 5K9IA 2YDIA 4JXFA 3OWKA 2XKDA 4XHKB 3OG7A 4JDIA 4XYFA 4EHVA 3CIKA 2VAGA 3C4CA 5IF1A 2YM3A 4O7TA 3ZUVA 2XK3A 1YI6A 4WD5A 4BHZA 1AGWA 1W8CA 4E6QA 4ZAUA 4BCQA 3R02A 2OSCA 4OTHA 3KFAA 4FUYA 4FF8A 4UYNA 1PMVA 4KRCA 4BWKA 3P7CA 2R3MA 4Y5HA 3TUBA 4FT7A 4USDA 3QTQA 4IFGA 5CSWA 4AXEA 2WMQA 4R6VA 2UW8A 2YFXA 5E92A 4HZRA 4U79A 3MIYA 4YNOA 5BUEA 2EWAA 3V5QA 4X2KA 4CLIA 3KXNA 2CMWA 4D2WA 3QD3A 2BDJA 5M4FA 2PSQA 2UW5A 3TT0A 3EIDA 3HMNA 1GOLA 3SHEA 4ZMFA 2PMOX 4WHZA 4P5ZA 5GJGA 4NM0A 4HPTE 4XRLA 5AV1A 4B8MA 4BGQA 4EORA 3OVVA 4UALA 4L7FA 4CVAA 2ITVA 2NPQA 4R3PA 4FZDB 3QKLA 4RA4A 2YN8A 2XCKA 5CAQA 3DNDA 5E91A 3ALNA 3L8SA 3EQRA 3HEGA 4AXFA 2PVRA 3ORXA 4H1JA 1WAKA 5FG8A 2QVSE 3DT1A 3Q6UA 4MD7E 5ANIA 5M51A 1XMMA 2OXDA 5AR3A 3OWLA 2XNEA 3Q2JA 2YCRA 4FC0A 4IVAA 3PY1A 4UXLA 4YBJA 3MDYA 4AFJA 4D0WA 2O8YA 2UUEA 2QOLA 3W32A 4BHNA 5A4QA 4WG3A 5FTOA 4YZ9A 3QXOA 4KABA 3RI1A 3QWJA 4I21A 1W0XC 4O86A 2R3RA 3KU2A 2DUVA 1CTPE 3QYWA 4WOVA 3PWYA 2XIXA 5GZ8A 3ENMA 4EHEA 2ITXA 1W98A 3HL7A 3ROCA 2VWVA 3UP7A 4TPTA 1YI4A 3SW4A 1JSVA 3UDBA 4YJTA 2X8IA 3BBTB 4F4PA 2IG7A 3HA8A 2NRYA 3M2WA 1URCA 1P5EA 2VTAA 5HZNA 4P90A 1YXTA 5CU2A 4QQCA 4D5KA 3K54A 3D7ZA 3EQDA 2I7QA 5CSPA 1Z9XA 1RDQE 2CKEA 2GCDA 3MTLA 5IA5A 4Y95A 3DKGA 2VTMA 4JIAA 3NNVA 4XG2A 1WVWA 4F0IA 3SVVA 3C0HA 3ORLA 4BBMA 1ATPE 2W1CA 4K6ZA 3PTGA 2ITUA 2V22A 1PF8A 5E9EA 3FYJX 4Q5HA 5LWMA 5KBRA 3U51A 1KOAA 2YA9A 2R3GA 1E1VA 3ET7A 4MTAA 2YACA 1WBWA 4YJUA 4K0YA 5FWKK 1XBCA 4IAYA 4XV9A 4YZBA 3AMYA 3VUIA 3OHTA 3PP1A 3VC4A 3BV2A 2RGPA 3PDTA 3KMMA 3VRYA 3A4OX 3KQ7A 2HCKA 1R1WA 1PXKA 4G3DA 4WBBB 4NH1A 3P7AA 5CQUA 1YWRA 3DLSA 1ZYSA 2ITWA 4EOKA 1W2FA 4M68A 4MF1A 3OFMA 4IB3A 4FRFA 4QTAA 5EDPA 4M8TA 3BHVA 3G90X 4XNEA 3W16A 2O64A 3CTHA 5AADA 3EB0A 3MIAA 5BYLA 4KIKA 2XF0A 3OBGA 5EK7A 3R7OA 5C01A 2GPHA 4GG7A 4EH3A 1XH5A 2X9FA 5H9BA 4DEHA 1W84A 4L53A 3TTIA 5HIBA 4D28A 3OCTA 4D9UA 5K4JA 1KE8A 3D4QA 4O0VA 1OECA 3RCDA 5HNIX 1WMKA 2ZM3A 4N0SA 3G6GA 5BMMA 5JMSA 2VV9A 3RZFA 2C6TA 3N4UA 5JRSA 3REPA 1P4OA 3GC7A 3RHXA 5AUYA 3IK3A 2BHEA 4D4SA 2IEWA 4O0RA 3BL7A 3W10A 3PA5A 2OW3A 4M0YA 1YHSA 3EN9A 4WNOA 4RWKA 2C5XA 4WA9A 4NFNA 4JT3A 3A61A 1OB3A 2QO9A 1Q3WA 4QDVA 3O51A 4OTGA 5JH6A 3DK7A 4H39A 4GKIA 5AIRA 5EM5A 4TWOA 3F3UA 3GENA 5CSHA 4BI0A 3ZONA 2OFUA 4EHGA 2Z02A 3IKAA 1ZYJA 4FL3A 3SA0A 4BJJB 4AOTA 4GFMA 3QRIA 3NCGA 5HCYA 5IPJA 3QC9A 1ZMVA 4PL4A 3LMGA 4QTCA 1RJBA 5J9YA 3O8UA 4Z7HA 5LVPA 3EQGA 3OF0A 5ANOA 1K9AA 4IW0A 3SX9A 2BRMA 3K5VA 4M3QA 4DTKA 1R78A 2I0VA 4GFOA 4LYNA 2C6LA 4FKOA 4MK0A 4RPVA 3R01A 3ERKA 1G8KA 1W83A 3LFCA 4RA5A 2IZSA 4V01A 2Q0NA 4L45A 4ZJIA 3Q9ZA 3CEKA 5AX3A 2WU7A 3FUPA 2QO7A 5KBQA 4FEXA 4FVQA 2R0UA 4KS8A 4ALWA 3KRRA 5FXSA 4HVSA 3GU4A 1H0WA 3FLZA 5L2QA 3R30A 4ZIMA 2HOGA 2QONA 2YZAA 4QTEA 3QD4A 4G3GA 4F09A 5JFVA 1YKRA 3FQHA 4EJNA 4KAOA 1G8SA 1BKXA 4PP7A 1H1QA 2X81A 5AP6A 3IQ7A 2CN8A 4PPBA 1M7QA 3COMA 3DCVA 5IQEA 4WKQA 4ZK5A 3CKWA 2X6EA 3UGCA 1OPKA 3L9PA 3D0EA 3BEAA 3SC1A 4BCKA 4C2VA 5AV0A 1BL6A 3IDPA 4PL5A 2WIHA 1CKIA 4E7WA 2Y7JA 2W1GA 5L8KA 4LRJA 2R64A 1XBAA 1YI3A 3RALA 5F9EA 3E62A 2X4FA 1PYEA 2WNTA 2C3JA 4YHFA 2XRUA 4I93A 3TNQB 5J5TA 5DH3A 4RQVA 3AC5A 3UNJA 5LXMA 3I0OA 2VX0A 2EVAA 1JNKA 4JI9A 5BYZA 3TKIA 5BX0A 3UPZA 3MA3A 4HYSA 4AE9A 4A9TA 3QLFA 3FLYA 5CSVA 3NUSA 4AN9A 2H34A 3QRJA 4F08A 2XKCA 4FTIA 3AC3A 3PLSA 4EUUA 2AC5A 5DRBA 4ENXA 2BZJA 2WKMA 3UOKA 2VGPA 3EQFA 4DEDA 3QZFA 3KA0A 1STCE 2WMRA 3CQWA 5ETCA 2VWBA 3E7VA 3MY0A 2V0DA 1JKLA 4QTDA 3RVGA 4USEA 3O50A 3QTRA 4MCVA 2R3KA 2XBJA 5JSMA 4J53A 2GSFA 2YLFA 2QI8A 3HA6A 4KWPA 4FKVA 4D9TA 2YIXA 3OXZA 4BZNA 4NJ3A 1GZOA 3OW4A 4MNFA 2ITYA 3DNEA 4XBRA 5HG7A 2JLDA 3OY1A 2OJFE 5ANJA 1OKZA 1UVRA 3O71A 3LJ0A 2QNJA 4O2ZA 1H0VA 3F5GA 4O0XA 5DEYA 3CTQA 5E8VA 2CCHA 2Y4PA 4IXPA 4M0ZA 5CS6A 5A4CA 2G9XA 1KE7A 3LQ8A 4NW5A 2WQOA 4IZ5A 4KB8A 3RK5A 4BDCA 2YDJA 2PE2A 1MRYA 4GT4A 3IOPA 4MBIA 3UOLA 5BYYA 4RIWA 2B9IA 2VTQA 4W8DA 3VS0A 2J2IB 2QD9A 5GIPE 3BX5A 4TYGA 2OZAA 3Q5IA 1WFCA 3DDPA 2HAKA 3FL4A 4DFNA 3H9FA 4ZSLA 2HELA 3R2BA 3BLRA 3UNZA 1H26A 1Y6AA 3G0FA 4EH9A 3FV8A 4D2VA 4FK3A 3CE3A 3ZLYA 2E9OA 4QMUA 5L2SA 3D7TB 5GZ9A 3UC4A 4U81A 4EK3A 4ZTSA 3PVGA 2YIQA 4PDYA 4FKTA 4ITIA 2BMCA 4FEUA 2JDSA 2X8EA 4GFGA 4AGDA 3OCBA 4BR3A 5E1EA 4GCJA 3UYSA 4F7LA 2PZYA 3QQLA 4I23A 3TUCA 3V5TA 3Q32A 5CT0A 1QPDA 5HOAA 4F1TA 3NUUA 5LJJA 3MB7A 5HLPA 4RBLA 4QPSA 4B0GA 5JGDA 3HX4A 2GHMA 2YCQA 3F3VA 4KBKA 4PP9A 1JSTA 4G6LA 3QALE 4U43A 3PVBA 5IQFA 4FV9A 4RIWB 2NNWB 5K4IA 4IWDA 1T45A 5JRQA 1ZYDA 1UA2A 3R7GA 1YOLA 5D12A 1VJYA 3B2TA 2WIPA 3POZA 4EOSA 1P4FA 2XK9A 3R71A 4XV2A 2RIOA 2YM6A 3WF7A 2HZ4A 5FLFA 2PVMA 2VUWA 3SD0A 4KUJA 4O6LA 4WRSA 5LMKC 3SGCA 2P2HA 1Q8YA 3HMOA 3LFFA 5CI7A 4QMZA 4C62A 4X3FC 4LRKA 1WBTA 5AA8A 5JKGA 2YIYA 2GQRA 4TRLA 3AG9A 1H28A 4JVGA 4XV1A 4DGGA 3OEZA 5A4TA 5EM6A 2KTYA 2QU6A 4TYHB 4C4EA 5KHXA 2JGZA 3MBLA 4EH5A 4HCUA 4DFUA 2JKMA 5L6WL 3UIMA 2J0IA 2ZM4A 3K3IA 4JDHA 4AXAA 4QQTA 5HBJA 5BVEA 5EI6A 2QHNA 3V5LA 2F2UA 4BCHA 4QP9A 2GMXA 2C68A 3F5PA 1KSWA 4IH8A 3P5KA 2XRWA 1VYWA 3LKMA 3BQCA 4RX7A 5EQYA 3H30A 4YJOA 3OXTA 4D0XA 3EL8A 4F65A 1YWNA 5L2TA 2QR7A 5EYDA 3VONA 3NUXA 3PVWA 4LOQA 4E5BA 4LOOA 3NVKI 2PUIA 3ZUTA 3U87A 4DF3A 2ZMDA 3A60A 4M69B 4MXYA 2VO3A 4L42A 3RM7A 5FM3A 1G8JA 3FXWA 3WZKA 4ANOA 5HTIA 3NCZA 5IKWA 1XQZA 2OG8A 4AU8A 5KMMA 2X0GA 3C0IA 4IM0A 5AP0A 2J4ZA 3F82A 5TT7A 4DG2E 4FVPA 4AZSA 5BPYA 3DJ7A 2EB3A 3JS2A 4XP3A 2BFXA 3O0GA 3AC2A 2B53A 5AAEA 4CFXA 4CMTA 5HLNA 4WO5A 2ERKA 4LUEA 4IHPA 3I1AA 3G6HA 2PZPA 3HGKA 2ZOQA 3FMDA 2A4LA 2QCSA 1PYXA 1ZRZA 2OFVA 4QMOA 3RAKA 3G0EA 3PXKA 4A4XA 1RE8A 3UO5A 4NT4A 4TW9A 2RL5A 3DTWA 2XIRA 3FAAA 3TACA 1OMWA 1JVPP 2BRHA 5IEXA 2AC3A 5ACKA 3L1SA 3TDVA 1R39A 3VUTA 1MP8A 2HZ0A 3WE4A 3FWQA 2LAVA 4O7SA 1M2QA 3QA8A 4TNBA 2W5HA 4YZCA 4O83A 1PKDA 5EDRA 4WRGA 3UDTA 5IISA 4XMOA 3NUPA 3U54A 3KXXA 1U54A 4I92A 5FBOA 4E73A 2O65A 4G17A 5HO8A 2AYPA 4P7EA 2BAQA 5AX9A 5JT2A 2ZDUA 4H3BA 3UO4A 3BRBA 3FQEA 2WTVA 3VW6A 1AQ1A 1UU8A 2Z7QA 3FKNA 1PY5A 4GT3A 4O4DA 4U3YA 5AR8A 4QMQA 2JAMA 2OJJA 3LJ2A 3E5AA 3DBQA 2VWXA 5J1WA 3I6WA 4I20A 3ORZA 4G3EA 4UWBA 4E4NA 2KULA 1ZOEA 1OL7A 4FTMA 2GTMA 4CMUA 3BLQA 3KF4A 4FIGA 2PULA 5FRIA 2OBJA 1OVEA 3D7TA 3P78A 3HMMA 2JDVA 5EDQA 3RWPA 3VQUA 5LVNA 4GUEA 4TKSA 3DXQA 5I9YA 4IAIA 5CI6A 2XK7A 4BDKA 3AXWA 2FSMX 4AQCA 2GTNA 2YIRA 3QCYA 4C3FA 2JIUA 2UVYA 4DT9A 2BALA 4DHFA 1PXLA 4U8ZA 1UV5A 1G5SA 4DCAA 4HYUA 2OKRA 5BUJA 4TWPA 2YZLA 3QQJA 1KOBA 3ZLXA 4GW8A 1UNLA 3PIZA 3QZHA 3BLHA 3U9CA 4CFNA 1JKTA 2JBPA 3FMEA 3AKKA 5DMZA 3WI6A 1FVRA 5EHLA 1IASA 3SG9A 4W9WA 3W0NA 2OU7A 2WMSA 4FG9A 4RWIA 5A4EA 3HV4A 4QEBA 4QP4A 4QP1A 4QMNA 4R7IA 5IEYA 4RFMA 3UO6A 2PUNA 5E8TA 3BL9A 5FQDC 1APME 3L9NA 3PE2A 2H8HA 3QD2B 2X9EA 4L43A 3IGOA 3PE1A 1PMEA 3MY5A 3O96A 2J5FA 1NA7A 3R8MA 3OC1A 3E7OA 3OW3A 4TXCA 1BYGA 3CGFA 1KE9A 1PXOA 3RM6A 3U4UA 3RPRA 4BC6A 4I0SA 4QP8A 4F0GA 3FI3A 4IANA 3N4TA 5I5ZA 4JR3A 2W0JA 3DFCB 5HE1A 4EOOA 4I24A 2OZOA 4FTUA 3VAPA 1PXMA 4TY1A 2UW3A 4F7NA 2XANA 3GQLA 2XK4A 3ZUUA 5HEZA 3ZC6A 4ZJJA 5L4QA 3VF8A 3WARA 2YABA 3HECA 2ONLA 5JZNA 4C58A 1KV1A 4LMNA 4EH6A 1VZOA 1Y6BA 5HG5A 2UW4A 2X4ZA 3VVHA 3NZ0A 5AP2A 3WIKA 1IEPA 1A48A 4GMYA 2ZVAA 3KRWA 4RFZA 4JRNA 3D94A 4PX6A 3UPXA 4P4CA 2QLQA 4HVDA 5CEKA 3PY0A 5DVRA 2OF4A 3V6SA 3C4ZA 4IEBA 1Q8UA 3F3WA 4BICA 1YXVA 4I4EA 4YLKA 4WIHA 2NP8A 3OS3A 4BGGA 1H1RA 4FI1A 3JY0A 2ERZE 3I5ZA 4HJOA 3RPSA 3FJQE 4U7ZA 1PHKA 5DIAA 3LQ5A 5IA4A 4OAUC 4FL2A 2Q83A 2ITPA 2UW9A 4B99A 4EOLA 2IVSA 4DH3A 3DDQA 5CLPA 4AS0A 1Q3DA 2VU3A 3CBLA 1VYZA 1XH8A 2O3PA 3R2YA 3C13A 4JJRA 2IVTA 3FMHA 3QTSA 5J95A 5AV3A 4AF3A 4EONA 1YXXA 3QKKA 3RK7A 5LQFA 2ITNA 5M06A 2HY0A 4IM2A 2CKPA 3OY3A 4D1SA 1RQQA 3TNHA 4PY1A 2UV2A 4AOJA 4G5PA 3SRVA 1GIIA 2IVUA 4DGLC 5CZIA 4YHTA 2PVNA 4MHAA 4DFXE 2VTSA 1H25A 5A9UA 1FGIA 3E8NA 4EH8A 4JAIA 2CJMA 1GIHA 3I6UA 4PWNA 3FZOA 5DG5A 2GNLA 3HYHA 4DFYA 3NDMA 3SXSA 3ZO3A 3GT8A 3ACJA 5D10A 3HRBA 4PV0A 3P7BA 2JIVA 3DXNA 5C03A 5DT3A 4C4IA 3IW7A 3Q4UA 4KKHA 1NVSA 2JDRA 4UMUA 3POOA 5TOZA 5HICA 5KMNA 1R3CA 3VS3A 3ZRKA 2YLEA 1WBVA 1JKSA 5CEPA 1OIYA 3TTJA 4LV5A 3S4QA 5BQ0A 5B7VA 2FSOX 2X7FA 3FC2A 3UZRA 3ORTA 4I6HA 2IPXA 3TJDA 2JIIA 2VTHA 3TZ9A 2CPKE 2C4GA 3VUMA 5I9WA 3KK9A 2YAAA 2R5TA 1NXKA 3VBWA 4O27B 1WBOA 3MPTA 3ZO1A 2UZTA 4IJPA 4ASXA 3VBVA 2GHGA 4EC9A 5TO8A 5FEQA 4F9WA 5JEBA 4HPUE 4YR8A 3MTFA 3DQWA 4QNYA 3G9LX 5CEOA 5E8YA 1OUKA 3DQXA 4F0FA 3ORIA 2SRCA 4TYEA 4NL0A 2C0OA 2G2IA 5EW9A 3R21A 2OJIA 4R78A 4NTSA 3T8OA 3QQKA 4RJ5A 3HRFA 2F49A 5AR2A 2C6OA 2REIA 2ACXA 4I3ZA 3PUPA 4LL5A 4JG6A 3R8LA 4P5QA 2PHKA 2XAMA 3ML1A 2QQ7A 3W0SA 3VIDA 2G2HA 2W1IA 3KRJA 3ZZWA 3R04A 3LM0A 4O0WA 3PXFA 4H3PA 5IUHA 1Q4LA 4QMTA 4L00A 3BYMA 5D9HA 4D58A 3MFRA 4J7BA 3CQEA 2PVYA 5HKMA 1NY3A 5LVOA 1PXPA 4YJVA 2QLUA 3NYVA 4OBPA 1JAMA 2ZDTA 5I9ZA 4CSVA 1ZY5A 2E9VA 3TL8A 4DHZA 3R9OA 3KIOC 3ORKA 2XIYA 3A8XA 2W05A 3RPYA 4YGAA 4V0GB 2W5BA 3K5UA 4DG0E 5IQHA 3SXFA 3UDZA 3MJ2A 2C30A 2XNNA 3UQGA 3GC8A 2A98A 4JAJA 2XJ2A 4FEQA 4XUFA 4BIEA 4F6SA 3SOAA 4QYYA 4IVBA 2YM4A 3AT3A 2C5NA 3OT3A 2XNPA 4RWJA 3SXRA 2PWLA 1SNXA 5LMBA 4CLJA 5DI1A 3D14A 4MKCA 4OT6A 5EH0A 3QXPA 4FJVA 3TG1A 3ZEPA 4XG8A 4IB1A 4ZS0A 5FBNC 4JBQA 3W33A 4APCA 4HVIA 3GOKA 4L3LA 4ERKA 5CAUA 4ASEA 1GAGA 5HBEA 4C61A 5HE2A 2E9UA 4DTBA 3P86A 1WZYA 3QD0A 4FSMA 4FOCA 4IIRA 3ZRLA 4AG8A 4JNWA 2C6IA 3GC9A 3KK8A 1XJDA 3AGMA 4QDEA 3WZJA 2VZ6A 3CGOA 5K0XA 4BDGA 1IAHA 3LIJA 3EYGA 3W18A 3HDMA 4MXOA 5I9UA 3EYHA 5IH6A 2PL0A 2BRBA 3DZOA 4GJ3A 5HBHA 3RAHA 4UEUA 3F7WA 3DBCA 3VJNA 5EI8A 3F2NA 2E2BA 4PPAA 5AAFA 5FDPA 2WO6A 1XR1A 2VN9A 1OKVA 3FZSA 3DBEA 3E3BX 3IW4A 4YJPA 3KVWA 4IQ6A 2RFSA 1J3HA 3F2AA 5A6OA 4N70A 4RGJA 1LR4A 4AZEA 3KGAA 5IMEA 4XBUA 5DYJA 2UZVA 1BLXA 2QC6A 3SRVB 1IG1A 5KX8A 2ZV7A 4RJ7A 5CF6A 4Y72A 4IWQA 3PG1A 4GEOA 4QP2A 4QMYA 5FTGA 3UQCA 4TN6A 2BHHA 4ZY6A 4HW7A 3RCJA 3DAJA 3PA4A 4DH1A 3ZM9A 3VULA 3AC1A 4AXDA 3CTJA 5L3AA 4O0SA 2A1AB 1Q61A 4HGSA 4C37A 4XG9A 1M2RA 2C1BA 3KVXA 3OZ6A 3BHUA 5HX8A 2XBAA 3LW0A 3VHKA 5IDPA 3BHTA 4ZTRA 4BDEA 1H1WA 1YRPA 3HZTA 4YZNA 3KRXA 3R73A 3ANQA 2PVHA 5EOBA 4A9SA 3N9XA 2ZV8A 3PRFA 4RIOA 4D1XA 2C0TA 2XJ1A 1MQBA 3D5WA 1M2PA 3G5DA 4IAZA 5C4LA 3PJ3A 4GYIA 2XARA 4Y73A 4A4LA 2W1ZA 4FV5A 4LV8A 4YSJA 4TYIA 4W4WA 3E63A 4X3JA 4YBKA 1KE6A 4QYEA 4FKUA 1XO2B 4XG6A 3FKLA 2XB7A 4NFMA 3ZZEA 3KCFA 4WBOA 5CXZA 4MF0A 4APPA 4R7BA 3UP2A 3PPKA 4F1MA 4YZMA 2R3HA 4RQKA 5ANDA 4IX4A 4C34A 2VTRA 2I1MA 3HDNA 3OT8A 4UMQA 2WMTA 5HQ0A 3DZQA 2VNWA 2J6MA 4J98A 4KIQA 1PMUA 5M4CA 5JQ8A 4J71A 3R8ZA 3AQVA 5B0XA 5LVMA 2ZFYA 4GG5A 2R2PA 3C4EA 4QPMA 3VS2A 3ZHPC 4F9AA 3V5PA 4RJ4A 1YHWA 4EZ3A 2YIWA 5M53A 5IQGA 2WTJA 3I7BA 3MPMA 3FDNA 4AX8A 4D4VA 4IWPA 2IZTA 5C4KA 3GCUA 3TEIA 3H9RA 4CMOA 2YCSA 3PZEA 3TNWA 5CAPA 2O0UA 2ITOA 1MQ4A 3COKA 4NW6A 3NW7A 4PTEA 3UJGA 3NYNA 3MI9A 3N4VA 2XJ0A 3UIBA 3EHAA 4QPAA 2V7OA 4KRDA 1W82A 4I0RA 1ST0A 3O5AA 4FT3A 3DTCA 3D2IA 2BROA 3ZC5A 1JKKA 1UKHA 1A9UA 1SVHA 4XG7A 4YTCA 3QA0A 5EW8A 4LM5A 3ORMA 2CNQA 3BYOA 1H1SA 3UVRA 2RG6A 4X2GA <