4BDFA

Fragment-based screening identifies a new area for inhibitor binding to checkpoint kinase 2 (chk2)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
304
structure length
285
Chain Sequence
b'MSVYPKALRDEYIMSKTLGGEVKLAFERKTCKKVAIKIISKNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Fragment-Based Screening Maps Inhibitor Interactions in the ATP-Binding Site of Checkpoint Kinase 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 285
sequence length 304
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bdfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bdfA01
4OBQA 1YHWA 3IQ7A 4H1MA 1YHSA 2O63A 5EHYA 3A62A 4DYMA 3U6IA 5AP3A 3DBDA 4AU8A 4DCAA 4O84A 2J51A 2WU6A 2FUMA 2YISA 3AMYA 4GH2A 3BGZA 4PMTA 5E8ZA 3S00A 2YA9A 5HE0A 3MB6A 1B6CB 2QONA 2W4KA 4UB7A 4AA5A 3DXNA 4PWNA 3F66A 1SNUA 4GJ3A 2OW3A 4GU9A 3CR0A 4I21A 2BAJA 2OBJA 3LXNA 4YC8A 5HU9A 4RIXB 3EKNA 2F7EE 4DLIA 3HKOA 3FMLA 5EKNA 2YABA 4N6ZA 5HTBA 3K5VA 3HV6A 1M2QA 5DEYA 4FNYA 4MQ2A 4UMTA 3MVLA 3SC1A 3TNQB 3UYSA 4BIEA 2DUVA 4FTKA 4I6FA 5DRBA 5G1XA 4UBAA 4HZSA 1PXKA 3EQBA 3VBWA 5A4CA 3VBTA 3NR9A 4TYIA 4JDHA 1RJBA 4QNYA 5CAVA 3IW8A 3V04A 1OKWA 3E88A 4YSMA 3QF9A 1AGWA 1ATPE 4E5BA 2YCSA 4E4LA 3AXWA 4HW7A 3LVPA 3KMWA 4C7TA 3OY3A 3PLSA 2V55A 2C6IA 4EK5A 4ZY5A 4TNBA 2QU6A 3D83A 5CAPA 1CSNA 3NAYA 2PZIA 3KL8A 4FODA 4F70A 4BCPA 3BEAA 3R2BA 4RWKA 2RFSA 2B0QA 3OS3A 4CRLA 1R78A 4LOQA 5IA4A 3ACKA 3AMAA 4HNIA 4USEA 2KULA 3QTQA 4QQ5A 4JAIA 5E9EA 4FTMA 4UYNA 3CJFA 5AP4A 3HV7A 5CSPA 4RVLA 1I44A 4AGUA 3DOGA 1Z57A 3DK6A 4GYGA 2XRWA 4OLIA 4CFXA 3PUPA 4LL0A 2OKRA 3S1HA 5JZNA 5HIEA 2WMBA 4LV5A 4ZIMA 4ZJJA 2G9XA 5E8WA 4ZZOA 2QHNA 5FBOA 4AOTA 2JKKA 3THBA 4FV6A 4WA9A 3T3VA 4F7NA 3QKLA 4TY1A 4PQNA 2X8EA 2VAGA 4BDJA 3F6XA 4EZ7A 4M14A 4D0WA 1YOMA 4A9YA 2C3KA 1JKSA 2W1HA 3NRMA 2FYSA 4MWIA 3QRUA 4M13A 4S2ZA 4YHJA 3BWFA 1YVJA 2R0UA 4YNEA 4BDBA 4USFA 5EDRA 4O91A 4U6RA 4KIKA 3W2OA 5F9EA 2XEYA 3CY3A 3HRFA 3EZVA 4EQUA 1TQIA 5D41A 4O7LA 1WBTA 3FPQA 3VRZA 4EK6A 4LGGA 4LGHA 5HKMA 2XIKA 3QU0A 4ASZA 5I9WA 2ETMA 2UW3A 4R1YA 5CYIA 3TKUA 4F7JA 1PJKA 1ZRZA 2GQRA 4N6YA 5IEVA 4LG4A 4S34A 3NUXA 3TL8A 3UPZA 5J9ZA 4EOLA 4RA5A 3TG1A 5B2KA 1NA7A 3B2TA 3NUNA 3NWWA 4JI9A 3KY2A 4XV9A 4BBFA 5HHWA 3EN4A 5J1VA 5EYDA 4C4FA 1M2RA 3QRJA 4EH9A 1YI4A 3SW7A 4B0GA 5IQBA 2PYWA 3ORZA 4PDPA 3LCSA 3EQFA 3EMGA 4UY9A 4IX4A 3Q9WA 3UIMA 3HAVA 5LCKA 2ZM3A 2VO0A 2ZV9A 3QTUA 4G6OA 5FP5A 4WG5A 5K5XA 3TZMA 2I0VA 1GZNA 4FR4A 3FKNA 4ZS4A 4ACCA 3UO6A 5CWZA 4NIFB 3VW6A 3DZOA 4BF2A 5JKGA 1SMHA 2A27A 2XNGA 3LXKA 4IFGA 3E92A 4NKSA 1LP4A 5D12A 4FIEA 4YZBA 2R64A 3TCPA 2FO0A 2C5VA 4QTBA 5C9CA 3K54A 4LRJA 4CLIA 2UUEA 4W9XA 3C1XA 3IW7A 2WTWA 3ENHA 1Q8YA 3QBNA 3VS7A 4GEOA 4I5HA 1KE9A 4YO4A 2RSVA 4OTPA 1H1SA 4FI1A 2WTCA 3LFNA 5IG1A 1KSWA 3EFJA 5ANIA 3DAKA 3TNIA 3UO4A 2X0GA 4Y95A 4FIIA 5HG5A 5HCZA 3BEGA 3KULA 4OTDA 4ZEGA 2OXDA 3TKIA 4L3PA 1O6KA 3V8WA 3MW1A 4H58A 4K9YA 4XOZA 3RPRA 5T6KA 4I92A 2CN5A 4K1BA 4JX7A 5E8YA 4YNOA 5C27A 5HX8A 4Y46A 4AW1A 3LPBA 4X3FB 4G9RA 3AOXA 1DAYA 3NS9A 3AT4A 1OECA 5CNNA 3ORIA 3LCKA 5EM6A 4BFMA 2YM6A 4QP6A 4RPVA 5E92A 2BRMA 3VBYA 3ZO4A 2UVZA 4I20A 5IQCA 3PSBA 3OWLA 5FXRA 2VTHA 3LHJA 4M0YA 5CXHA 3COKA 4G31A 3MA6A 1PHKA 2WIPA 2W0JA 5HG9A 5AA9A 1BUHA 1BYGA 5FGKA 2OZAA 4PP7A 4X0MA 3PVGA 4R5SA 4BI0A 5A4LA 3V5LA 4HJOA 1R0EA 2WMTA 5ETFA 4EOQA 1U54B 3R22A 4ITHA 3R6XA 3M1SA 4R6VA 4BDAA 1SVGA 4D5KA 4UX9A 4MNFA 3TTIA 4O0SA 2QOBA 4TT7A 3BHTA 5CANA 2ESMA 4YHFA 4GT3A 3FE3A 3FLZA 1WFCA 3N9XA 3GU6A 2X8DA 5F95A 5AM6A 4BDHA 2XB7A 4L46A 3EIDA 2LGCA 1XJDA 5GINE 4MK0A 4WUNA 3GUBA 3G6GA 4J99A 4EOKA 4CMUA 4KKHA 4EKLA 3FXZA 4Y73A 1S9IA 1OKZA 4JAJA 5FG8A 4EOIA 3I7CA 1KOBA 4GG7A 1Q4LA 4XYFA 3E8CA 3COIA 4Y5QA 4KNBA 4RIYA 4WUAA 5C1QB 2HWPA 5EM7A 5EG3A 3BHHA 5CF5A 3F3WA 3S4QA 2V62A 5ACKA 4OW8A 2BTRA 3FBVA 3CGFA 4AN2A 4RGJA 3TM0A 4V0GB 4UMUA 4CEGA 3W2CA 3LW0A 4YJNA 4XS2A 4YO6A 4EH4A 2R4BA 2VWWA 1NW1A 2YITA 4DEEA 2ZDUA 1J7UA 4A07A 3GC0A 3ORNA 3DJ7A 3RKBA 4AE9A 3VUMA 2JDSA 1PXNA 3QRKA 4G9CA 3PA5A 2P2HA 1EH4A 4EYJA 4FT5A 4IXPA 4JG7A 4RIWB 4F0FA 4D4YA 4M67A 4E1ZA 5A6OA 3UG2A 5M07A 2BHHA 3UBDA 4I22A 1J7LA 4KRDA 3VJOA 3ANQA 4AN9A 4J97A 3W10A 3KEXA 3VUIA 4EBVA 4F09A 2GFSA 2VX1A 4ALVA 3CJGA 4LGDA 1UNLA 5TE0A 5DHJA 5KNJA 4IAIA 3DB8A 3GOKA 4YUQA 4CFUA 2VTTA 2G01A 2J4ZA 5D1JA 3SOCA 1RQQA 4AS0A 3L8SA 2PUIA 3EH9A 4MF1A 3ZUUA 3A2CA 2BALA 1WZYA 3QD0A 4OTHA 1QPCA 4XP0A 3QAME 2OF2A 1DM2A 4EK3A 2R2PA 3P23A 4WG3A 5DBXA 5E7RA 3W1FA 3QZFA 4PL3A 4EUUA 2PVJA 5CEPA 2YCQA 3ETAA 3TT0A 3ZXZA 4HGEA 4BTFA 3REPA 5JMSA 4CG8A 4XG6A 3VS4A 3PY3A 4RWLA 3SQQA 2J50A 4IWDA 4C61A 3OXTA 4FKIA 3UOLA 3F61A 3KMMA 3QWJA 4HVIA 3FAAA 4CKJA 3ZONA 2PMIA 5CU4A 1TKIA 4D55A 1JKLA 4UXLA 1UU8A 1FGIA 3VWAA 4XBUA 5LVNA 1YWNA 3QTXA 1H0VA 3LCTA 3P1AA 3TNPC 4UYAA 3UZTA 5LMKC 3TV6A 2YIXA 4WD5A 4EKKA 3EQGA 2OJIA 2WB8A 4R1VA 4F1TA 3UOHA 1R1WA 5EHOA 3ODZX 1CKJA 4FNWA 5JFXA 5AV3A 3CGOA 4IX3A 5LMAA 3ZC5A 1M7QA 5DFPA 5IA3A 3Q6WA 5J9YA 2CLXA 5GJGA 4BDKA 3CD3A 2BDJA 2I1MA 3LOKA 4NKAA 3EYHA 5CALA 4TPTA 5CU2A 3QA8A 4RC2A 4EL9A 5B2LA 3KXMA 4H05A 2VWIA 4CCUA 1BX6A 2JAMA 4CT1A 1Y8GA 4QTDA 1X8BA 4AZSA 3C4FA 1GIHA 4E5WA 4CGAA 3FMNA 5LJJA 1VYWA 4W4YA 4OTQA 5AP5A 1OGUA 4YHTA 2X39A 1S9JA 4BB4A 2OG8A 3C7QA 4B7TA 5EYMA 4CKRA 3R02A 4R5YA 2GFCA 1OPLA 2HY0A 5HBHA 3QC9A 4GVAA 4GSBA 3PPZA 2QVSE 5K3YA 4YURA 3O7LB 2QNJA 4U9AA 4I23A 2Z2WA 4O6LA 1P14A 4TRLA 1H24A 3BE9A 4P5ZA 3IGOA 4BCIA 5C8KA 1IAJA 4X6RA 2LAVA 4GKIA 2ZMCA 3BV3A 3D5VA 4TWCA 1NXKA 3LFSA 3KVXA 4RX9A 3GC8A 3F2RA 4ZAUA 3UP7A 2WD1A 3VF9A 3WZEA 2VUWA 2JAVA 2P3GX 5DE2A 2B9IA 1M7NA 2VU3A 4IM0A 4Z9LA 2IZSA 3TI1A 5AUVA 5CU6A 4MBJA 4IW0A 1Q3DA 4CKIA 4DFUA 4QNAA 1NVQA 4QMYA 3ITZA 4FZFB 4ZTMA 4O21A 4E4MA 3QRIA 5DNRA 2GNIA 3EQDA 2J0LA 4L3LA 4KBCA 3TDWA 4DT8A 1DI8A 2P33A 4E7WA 5KUPA 2B9JA 4JL9A 4NM0A 4AUAA 4G3GA 3DFAA 2QOCA 3NEWA 4JLCA 3BHYA 3CTJA 3ID6C 1ZYCA 3PXKA 1ZWSA 4MKCA 3PSCA 2XIZA 5HLWA 4OT5A 4ALUA 3DQXA 3R00A 4GG5A 5BUEA 3HAMA 5HCYA 2EVAA 3ROYA 5IUGA 3QWKA 5AUXA 4ANBA 2BZKB 3I4BA 4C4JA 1R0PA 2ITTA 2W7XA 3I0QA 4HZRA 3U9CA 5AEPA 4W8DA 4LRKA 4MF0A 4EWHA 1KE7A 1ZOGA 4F64A 5H3QA 3NPCA 5KZ0A 4AGWA 4X2KA 4OTWA 3RBWA 3O8UA 3UPXA 5IQFA 2WIHA 1URWA 4I6QA 5CEIA 4M15A 4BYIA 2QKWB 4WHZA 2PPQA 1O6LA 2WTDA 2XK4A 1KE6A 3C0IA 4BCQA 4E4NA 4F7LA 4R77A 3E8DA 4CYJA 3VS2A 1XBBA 2UZBA 4FUYA 3GC9A 1DS5A 3NUYA 4RA4A 5E91A 2X2LA 5H8GA 4GT5A 3QHWA 4YTHA 4C57A 3ZO3A 1JLUE 4FMQA 3OMVA 1J3HA 4PMSA 3QZIA 4IX6A 3SD0A 3HMPA 4F0GA 4QT1A 3VQUA 2JC6A 3BYOA 5H8EA 1G3NA 2PTKA 2R3PA 5JZJA 3AC3A 3CEKA 2ZV7A 3E8NA 4M69B 5ETCA 4CT2A 4I4EA 2WMWA 5C26A 3KXNA 2XK3A 4D2RA 4FKQA 1FVVA 2B1PA 5IPJA 2OIDA 3HMNA 3KF7A 3F3TA 5GZ8A 3MSSA 3ZM9A 5F20A 3VW8A 3UG1A 4R7BA 4FVRA 4ITJA 3UQFA 2WKMA 4IIRA 2A0CX 3S3IA 1GZ8A 1PF8A 3K5UA 3ZYAA 4FTOA 2QOIA 5L6PA 5A6NA 3N4VA 2E9OA 1YOLA 4KIKB 3QQHA 4CFWA 4NUSA 5CT0A 3H10A 3O8TA 1ZMUA 4TYGA 2Y6MA 4DH1A 5J87A 4NM5A 3QA0A 3TIYA 3DZQA 3C0HA 4WT6A 3ACJA 1PYEA 4NM7A 2W1GA 4NEUA 1Q8UA 2VTSA 5EOBA 1IAHA 2J7TA 4S31A 4U8ZA 3C4XA 2UW6A 4O96A 4QYGA 3SXRA 3F5XA 5K4JA 3OBJA 3HV3A 2YZLA 1ZOEA 2IW6A 5IISA 4LI5A 5LQFA 3GCPA 2FGIA 3E5AA 4MXAA 4DT9A 2QG7A 2UV2A 3FMDA 3QCSA 3RK9A 4U97A 3U54A 3VS3A 4YJVA 4YZCA 2HYYA 2W1ZA 3R04A 3W2RA 3I1AA 4E93A 2NNWB 3C50A 3I7BA 4FIGA 2PVKA 4QD6A 4TYHA 5AIRA 2G15A 3SRVA 4QTEA 4IJ9A 3A4PA 5BYYA 3N4TA 2PHKA 2ZOQA 2HW7A 1PMEA 4EC8A 2BROA 3NGAA 4EOOA 1TQPA 2GNJA 1T45A 3QQLA 4F6SA 3ERKA 3OCTA 3CY2A 3OXIA 2J0MB 1GZOA 5AIKA 4I0TA 4Z16A 3WARA 3DJ6A 4XLVA 3OHTA 5HG7A 2BR1A 4RMZA 3PXYA 4DTAA 2R3JA 2E9VA 4FV7A 4RG0A 4FZ6A 5LVPA 4E6QA 3A4OX 3PDTA 5K4IA 2IW8A 4GL9A 3BGQA 3MA3A 1WMKA 2UZUE 3TXOA 4YSJA 3DJ5A 3L1SA 4G34A 4KKGA 4DN5A 2PZRA 3Q2JA 2OLCA 5IMEA 3UVQA 2XKDA 5AUWA 1H1WA 5L8LA 1UKHA 5AV0A 4L7SA 1G8SA 3UC4A 3MH3A 1KUTA 3PXZA 4PPCA 4S30A 4I5MA 4IDVA 5FBNC 5BVOA 3KK9A 3OTUA 2OXYA 1NT2A 3UP2A 5HNIX 4FIFA 4MBLA 4EJ7A 5CAOA 1V0BA 2WAJA 3TZ8A 2X2MA 3V8SA 5HQ0A 3GXLA 3D5WA 3ULZA 2WMVA 3DTWA 2DS1A 3FC1X 3R1SA 1KWPA 1P5EA 4PRJA 5CVGA 2GTNA 2OICA 2YM3A 3UVRA 4DH3A 2YWVA 1UWHA 3H9FA 3P7BA 3LZBA 2W1EA 3FZ1A 4L44A 1IR3A 2I6LA 2Q0BA 4FT9A 5EFQA 2YDJA 1LEWA 5EM8A 1YXSA 2OZAB 1OPJA 3Q4UA 3FXWA 3R9NA 4BKYA 3MDYA 2WXVA 3TJCA 4AG8A 1W7HA 5HNGA 3TZ7A 5JGBA 3OFMA 3PSDA 5CTPA 3AQVA 4U81A 3KN5A 4BDIA 5HESA 5K9IA 4WNOA 3NNVA 2XH5A 1OIUA 5JQ8A 3LMGA 4ENYA 4UWCA 3FDNA 3A7IA 3F88A 2ZB1A 3FQEA 1Y91A 2OJGA 3I79A 3P9JA 4NJDA 3V6RA 2ITNA 5FUTA 4RZVA 1NVSA 3BQCA 4FIHA 3GCSA 4ERKA 2WTIA 3IW5A 1IA8A 2QKRA 3AC5A 2BIYA 3QD4A 2C5YA 2R7BA 4O38A 4RFZA 4YPDA 2XJ2A 2BMCA 4PNIA 3AG9A 4QMLA 5TKDA 1K2PA 2E2BA 2P4IA 5TR6A 4FL2A 4L3JA 3MVMA 3PXRA 2YAAA 1ERKA 3ALNA 3EQRA 3SAYA 1XH9A 5JEBA 3NIZA 3LKMA 1OIRA 2JEDA 3CKXA 1ZYJA 2I0HA 3JY9A 2ZM4A 3MI9A 1Q61A 2GS7A 2ZAZA 3Q9XA 4O0VA 5J1WA 3VJNA 1CKIA 5CT7A 2PVYA 4C3PA 4JT3A 1H1PA 3MTFA 5DLSA 3QZHA 2GHLA 2BKKA 4R3CA 5HVYA 5EYCA 3DKCA 3PWDA 5FD2A 5JN2A 4JXFA 4FOBA 3KREA 4ACHA 4CD0A 2WOTA 3POZA 3DGKA 4F99A 3LLTA 5C01A 5G6VA 4DH7A 3RPYA 3MY1A 3BU3A 3UMXA 3MFRA 1PXMA 2BAKA 1LUFA 4Q5EA 1JPAA 2QODA 4FSQA 4UALA 3WE8A 5M4FA 4U79A 4BI1A 3VO3A 4DFYA 4FSTA 3VS5A 3OZ6A 2J0KA 5DWRA 1FGKA 3PPKA 3QUEA 5C8NA 2X7GA 3QQKA 4MXOA 4TYJA 3OWKA 3KU2A 3GI3A 4IZ7A 4W4WA 2HENA 3SXSA 3OT8A 5IDPA 3QD2B 5CENA 3VF8A 5HI2A 3LMIA 4O7VA 3SGCA 1JSTA 5L2TA 4KIPA 3R8ZA 4II5A 1KE8A 4F9CA 4X2GA 3O7LD 3ROCA 1WBPA 3GU4A 2JDVA 4DEHA 4EH6A 4ARKA 4GKHA 2OH0E 5IU2A 4DE4A 5EQYA 2HZIA 2C6LA 3QALE 4PPBA 3QLFA 1W84A 3HP2A 2OIQA 4FKPA 4IEBA 1CKPA 4EHZA 3QQFA 2C0IA 4O0XA 3II5A 4AE6A 5AAEA 2EB3A 4FT3A 4RQKA 3ZS5A 4KBKA 4YZDA 3LXLA 3RAIA 4M84A 4AFEA 2YIWA 2VX3A 2NO3A 5L2WA 4O83A 4DGMA 4FYOA 4NM3A 3TNWA 3VVHA 4KS8A 3IOKA 3BGPA 3G5DA 1J91A 3IKAA 4CFNA 3ZOSA 2C6KA 3V5QA 5AJQA 1JBPE 1NY3A 2VTMA 3DDPA 4PTCA 3R9HA 5BX0A 1PXLA 3KC3A 2VD5A 4WG4A 4PMPA 3FZSA 4KUJA 3WF8A 4O0YA 4JQEA 4AZTA 5EI6A 4U3YA 5D7AA 4EUTA 3DXPA 4FKJA 3VHKA 3GGFA 4FKUA 4BY9E 3FV8A 3K3IA 3P7CA 3BWJA 4RSSA 5AAGA 3PJ1A 2VWVA 3LE6A 2VWXA 3W8QA 4BCFA 2UZEA 4FSZA 1V1KA 3SKCA 2F7XE 3AGMA 3R8PA 2VWZA 5KMNA 4WIHA 1MRYA 5J8IA 4D2PA 4L01A 3FI4A 5EW8A 1OL2A 2WQBA 3UOKA 4CTBA 4YJUA 4CZTA 5K0XA 2QO2A 4APPA 5AV4A 1A48A 2PE1A 3NW6A 3RAKA 3Q3BA 1KOAA 1PMNA 2AUHA 1P2AA 2B9HA 2CMWA 4B8MA 3TUDA 3ATSA 1APME 4FSRA 4FOCA 2V22A 1IEPA 1W82A 2W4JA 5ETAA 5HBJA 2XCHA 2GHMA 4JDKA 4NT4A 2BDFA 1W98A 2VGOA 2W06A 3FLSA 1W8CA 2YIQA 4MHAA 4NSTA 3MVHA 3F9NA 3QLGA 2IVUA 4CRSA 4D2VA 3ZFYA 3C4ZA 3R7OA 3HGKA 2SRCA 4CZUA 3FY0A 2BRBA 3BBWA 3QZGA 2OI4X 4XLIA 5CSVA 4AZEA 3C51A 5EI2A 1H4LA 4G3CA 5BVFA 2OGVA 2CDZA 4BWXA 2FSMX 3E8EA 2X1NA 1K9AA 2RG6A 4BDGA 5DH3A 3RAHA 3R9OA 2R3GA 5M08A 3R63A 4XG3A 2RFNA 3FHRA 4HYSA 4QP8A 4PX6A 4AA4A 4LV8A 3EYGA 3UVPA 4I6HA 4AF3A 2CPKE 4O0RA 1FINA 4GFGA 3U6JA 1BMKA 2H96A 2ZJWA 3F7WA 2CNQA 3F7ZA 4EOJA 3E7OA 3OEFX 5EOLA 2RIOA 3CP9A 3FMEA 5BVKA 3BKBA 4NW5A 5L2SA 3IG7A 2REIA 1VYZA 2JFLA 3F2NA 2R3LA 4GV1A 2OH4A 2UZNA 1WAKA 3I0OA 4FUXA 4IZ5A 3EFWA 5BVNA 4BCHA 3H9OA 5HE2A 2G2IA 2UVYA 4YJPA 2CKOA 2R3FA 4NWMA 5H2UA 3QL8A 3H9RA 3R8VA 2XJ0A 2UZLA 3Q5ZA 3UC3A 5M53A 3ORKA 3QTIA 3RP9A 2IJMA 1U5RA 3WYXA 4GK2A 4DTBA 4KINA 2Y6OA 3V5PA 3OCSA 1H26A 3VBVA 1MP8A 1F3MC 1H1QA 2VTAA 1ZARA 2XJ1A 1K3AA 3VAPA 3FUPA 4ZY4A 4M12A 4LQMA 5F1ZA 3A8WA 4DGNA 4FZAB 1XH7A 5HORA 2GNGA 3BX5A 4BHNA 3IGGA 2R5TA 3SLSA 4AX8A 3ZRMA 1ZY5A 2BPMA 3DBCA 3W2PA 3P79A 2JKMA 3PJCA 2OK1A 4C4GA 5FDPA 4EH3A 4IJPA 3HV5A 4OT6A 4I24A 4IMYA 2Y7JA 3FY2A 3WZJA 4BR3A 1OL5A 3A7HA 4GK4A 4IB0A 1PW2A 4AQCA 4R3PA 4RFMA 3MYGA 4B4LA 5AUUA 4NW6A 5CAUA 3PY0A 3AGLA 4D4RA 4X2NA 4DFLA 1TVOA 1XH4A 5D11A 4FVQA 4N57A 4G3FA 2X4ZA 4ZSLA 2C4GA 1E9HA 1OKYA 4P7EA 5EH0A 4AOIA 3QD3A 2BZHB 5FXQA 1HCLA 1FOTA 4KD1A 3SG9A 5LMBA 4C3FA 3B8QA 4EWQA 4KIOA 5GHVA 3ZZEA 1YDRE 3OOMA 5HGIA 3ZEPA 2G1TA 4IE9A 3NUSA 5HBEA 5AP0A 4PDOA 4ZOGA 3ZLWA 3KF4A 1UNHA 3HVCA 2XF0A 2DWBA 2PUUA 1UKIA 4U45A 3RAWA 1PYXA 2H34A 2UZDA 4HCUA 3KFAA 4WKQA 3W32A 3ZHPC 2VX0A 3KRLA 4IBMA 4NK9A 4DEBA 5AP2A 5IA0A 4IANA 1SVEA 4G3EA 4IB1A 5IA1A 1DAWA 3FI8A 4NL0A 4M8TA 4OAVB 2ONLA 5HICA 5IEXA 2YJSA 4FNXA 2Y0AA 3PIXA 3LXPA 1FVRA 3R01A 3NCGA 3R0TA 4GK3A 4U80A 4W9WA 3E3PA 3RPOA 4ANNA 1Z9XA 5HU3A 2W17A 1G8AA 1JWHA 2C6DA 3I5NA 5FXSA 3TUCA 1PRYA 2Z02A 4FGRA 3SX9A 1GAGA 3TDVA 5HLNA 2YN8A 4FVPA 4PTGA 3DAEA 4O1PA 2GU8A 3JS2A 3POOA 1F5QA 3CE3A 4FG9A 4JS8A 1VJYA 3BI6A 3NYOA 5T68A 5L3AA 4LOPA 3C9WA 4Z7HA 4WSQA 1SNXA 3GOPA 5IDNA 2BHEA 4RQVA 1T46A 2C6MA 4XCUA 3GU8A 3GFEA 5FQDC 2H9VA 4TKSA 4YP8A 1MQ4A 1WVYA 2CLQA 2YACA 2QO7A 3G0EA 5CU3A 2X6EA 3EQCA 4QMSA 1U46A 2J9MA 2VTIA 3EJ1A 3AT3A 4KSQA 4QQCA 4KBAA 2GHGA 3R30A 4BKZA 2RL5A 4MWHA 3OP5A 1QL6A 2QOHA 3O17A 4CMTA 5DR2A 3K2LA 3PP1A 4J95A 3MY5A 5IQHA 1JVPP 3CTQA 4QMOA 3IS5A 3VBQA 3D7TA 3WZDA 5TF9A 2QOOA 2F9GA 3PG3A 1LEZA 2YLEA 3QUDA 1HCKA 2BFXA 2ETRA 3D9VA 3L9LA 4HVHA 4ZP5A 5IH5A 3F2AA 2JKOA 3Q2MA 5FTQA 4DA5A 3PRFA 2EB2A 4XG8A 2X8IA 4ZTSA 4EH2A 4Q5HA 5HD4A 2J90A 3GEQA 2GNLA 2PVFA 3R1NA 4AW2A 3ULIA 4NCTA 3BZ3A 3I81A 4W4XA 3MGYA 4GJ2A 3BPRA 4GT4A 4OUCA 4AT4A 3SG8A 2A4LA 4L9IA 4EQMA 1Q62A 4QQTA 5CU0A 3U55A 1J7IA 1L3RE 2C68A 4XRLA 4RRVA 4I6BA 5EW3A 4FICA 2VTRA 3HEGA 4K77A 5JFSA 3DAJA 3PJ3A 1UVRA 5GJFA 4YJRA 1BL7A 5FWKK 4FV2A 5DI1A 4JVGA 4QYFA 2W9ZB 3RM7A 3RZFA 4QQJA 4IX5A 4O2PA 4K0YA 4EOMA 4J98A 4J71A 5HCXA 2R7IA 5DYJA 5JQ5A 4FTNA 4H3QA 4U0IA 2PY3A 3PY1A 2PVLA 2B54A 2EXEA 2ZVAA 2WNTA 3MIYA 1YDSE 3PJ8A 4FTJA 4KAOA 2VTOA 4PTEA 5CX9A 3JVRA 4GRBA 3AD5A 4IWQA 3P78A 2W5AA 4MNEB 2NP8A 4FKOA 2WPAA 3BYVA 4FTTA 3C0GA 4FTQA 3VUGA 2O0UA 4DFBA 3TN8A 5J5TA 5M4CA 2R3RA 1LPUA 2JDTA 3QYWA 3ZMMA 4EK4A 4O2ZA 5ACBC 2C6OA 3NNWA 3UIUA 2QOLA 3BU5A 4FV0A 4B8LA 5KBRA 3UZPA 3WZUA 1PXPA 2B4SB 4ZMEA 3ZM4A 2CN8A 3R1QA 3TJDA 3LFCA 4MCVA 4YJTA 1G5SA 2E9PA 2X9EA 4WSYA 5E8UA 4RIXA 3RHKA 5AMNA 2BVAA 1XKKA 3RTPA 3ZSHA 1OBGA 2OF4A 3MPAA 1M14A 2C47A 5C03A 2C5OA 4F9YA 3NCZA 4YC6A 2X9FA 1H0WA 3EB0A 4CFVA 4D9UA 3H30A 4U40A 1JSUA 3F3UA 1CM8A 4PP9A 5M06A 2CCIA 5AP1A 4YZNA 4ZSGA 4CXAA 4B99A 3EWHA 4B9DA 4DGOA 4G5PA 3QQUA 4EJNA 4FV1A 3MPMA 4FV3A 4JR3A 5E8SA 2XKCA 1FPUA 5F94A 1KV1A 4G16A 2CSNA 4DC2A 2XMYA 4QPMA 3RMFA 2EU9A 3V8TA 2IWIA 1E1XA 2R3OA 4UZHA 2B7AA 4A9RA 1OL6A 4XMOA 4MXYA 4G3DA 4ANLA 2CGVA 2I0EA 3EL7A 4HYIA 2GSFA 2KTYA 4BZDA 4FKTA 4RVTA 3B2WA 4AP7A 3FPMA 4EHGA 3KA0A 4QMMA 1IG1A 4JDJA 2XK9A 2JGZA 5DT3A 4ZLZA 5IF1A 4HOKA 3OW4A 2VO6A 3HYHA 3ORXA 3UDBA 2PVNA 3ZEWA 4GYIA 1H00A 1V0OA 2WOUA 4FGBA 3R21A 5IQAA 3W18A 3LIJA 3NAXA 5KMIA 4U44A 3P0MA 2BILB 2ITXA 3PA3A 3DBEA 4ZZNA 4I94A 3FMMA 1H25A 2WMRA 2ITOA 2ZV8A 3E7VA 3QFVA 4K33A 3VIDA 5E90A 4DEGA 1YHVA 2FA2A 5FEDA 3NUUA 3B8RA 5AUYA 1YRPA 2XKFA 2ITPA 3WF5A 4WNMA 4OAUC 1FMKA 4GUEA 3PP0A 1JKTA 4RJ5A 5I9XA 4A4OA 4EC9A 3MH2A 4I41A 4FTAA 2DYLA 4X7QA 4BTKA 2J2IB 2PMOX 2VN9A 3G6HA 2F4JA 4PPAA 2OU7A 2V7OA 4M3QA 3U87A 4ACGA 5FTGA 1TQMA 4BICA 4DFXE 4ZLOA 2CNUA 4P90A 1BI8A 3QX4A 2VO7A 2HXLA 3FL5A 5ANOA 4U43A 3DK7A 4FL3A 4MXZA 2YIYA 4YPSA 4K11A 3HMIA 3LJ0A 2WQEA 3M2WA 2X4FA 3ZRLA 4F9AA 1QMZA 4BIDA 3TEIA 5CF4A 4F1MA 1YI3A 2BRGA 3D4QA 3IOPA 1ZZ2A 2R3QA 3IW6A 4KWPA 4X2JA 5HIBA 4ASDA 4EI4A 2PZYA 3RPVA 1PKDA 2X6DA 2Z7SA 4IVDA 2W1FA 3BIZA 3HA8A 4EHEA 2CCHA 3PIZA 5HTIA 1OL7A 4F65A 3Q4CA 3HNGA 4Y5HA 3DLZA 5L8JA 5HLPA 2JFMA 3M11A 4LUEA 3UIXA 3NLBA 2G2HA 4J7BA 2HZ4A 2QOKA 4FTRA 4JNWA 5LOHA 4PDYA 2J6MA 1XHAA 3Q6UA 3C4WA 3NSZA 5C8MA 5HO8A 1ZMWA 3FZTA 4E26A 4FK3A 1ZYDA 4G1WA 3P4KA 5ANDA 1XQZA 2B55A 2XRUA 4UXQA 4KSPA 3NX8A 4FL1A 4X2FA 4C4HA 5A54A 1L8TA 4RFYA 2HCKA 5LARA 2WQOA 4PNKA 3LFQA 4L45A 1YKRA 3V5JA 3GQLA 2X7FA 3PE2A 4QYYA 4AGCA 1NVRA 5EQPA 4P5QA 2P0CA 4MD7E 5AM7A 3MV5A 3QGWA 4K18A 3WIGA 4QP4A 3ZUTA 1I09A 4BC6A 3FXXA 2RFDA 4NTSA 4J8NA 4DEAA 3ZO1A 3VULA 5KKRB 4ASEA 3S2PA 4GUBA 3WI6A 2OWBA 4D5HA 3DNDA 3PXFA 2YAKA 2WQNA 2YHVA 3TV7A 5M51A 2BRNA 4ZS0A 5AR8A 4X3FA 1PMVA 3SW4A 2GS6A 4J52A 3OWJA 4C02A 4EH5A 1WBOA 3R73A 2FSTX 2VZ6A 3GVUA 3ZH8A 2Z7QA 4IC8A 4FEUA 4C3RA 4NTTA 2JDOA 3MPTA 4L6QA 3PZHA 2J5EA 4O7TA 5JFVA 4FG8A 4DBXA 1UA2A 4U42A 2B52A 3CPBA 2RF9A 2RGPA 2C5NA 2QQ7A 4J8MA 4YJSA 5KHXA 4JBQA 4FTLA 4CSVA 3TZ9A 5A4QA 1U54A 4FV8A 3RINA 1GIIA 3O2MA 4R3RA 4HCVA 4F9WA 3ELJA 3QC4A 4YTIA 3TTJA 1UU9A 2EXCX 4ASXA 3LM0A 1U4DA 4ZSAA 4F1OA 2WZJA 3FC2A 4XP2A 3G90X 3LFAA 4QMTA 5FM3A 4A4LA 4FEWA 3UZRA 4AZWA 3GBZA 3E64A 3HUBA 3RK5A 3SA0A 3UGCA 5BQ0A 2CGWA 3ZO2A 3FJQE 3FLNC 3NUPA 3PJ2A 2Z7LA 4LMUA 2X81A 3CQWA 3ZDUA 4CQGA 2PE0A 3FSFA 4DTKA 4JBPA 2UZWE 1H8FA 2Z60A 3AD6A 2C6TA 3MESA 2C1BA 4BN1A 3EL8A 3ORMA 4OR5A 5M55A 3ZZWA 3GCUA 4LL5A 1GZKA 4BBEA 2WGJA 3F69A 2P55A 3QQJA 3FQHA 2QR8A 1H1RA 5BVEA 5E1EA 3R8UA 3MJ1A 2C30A 2PMNX 3PVWA 3H0ZA 5AR3A 4D1XA 2PMLX 4HGLA 4A9SA 4XBRA 3S95A 1H01A 1ZY4A 4IFCA 5JK3A 3MN3A 3EQHA 3FLQA 4V0GA 4XJ0A 3FQSA 4TWPA 2ERZE 4BDEA 3BHUA 4GIHA 1UNGA 4QP9A 2IG7A 2C1AA 1BL6A 3CKWA 3MTLA 3OCGA 4C8BA 3KULB 4L42A 2CHLA 5H8BA 3RWPA 1YDTE 5L2IA 4BRXA 2YFXA 3JXWA 2BKZA 3E62A 2WEIA 4RIWA 3SVVA 5LWNA 3UQCA 4QYEA 3ZSIA 4DH5A 5A14A 4HNFA 2C3IB 2XK8A 2VTJA 4CV9A 3JUHA 4RIOA 4U7ZA 5AP6A 5BMMA 5I9ZA 4QMNA 1A9UA 3FL4A 2VO3A 3GCVA 5HG8A 4APCA 5I9YA 3HDMA 2J5FA 5J7HA 3OC1A 4K8AA 2JIIA 3ZU7A 1WVXA 2VRXA 4HYUA 4I5CA 4AW5A 1YW2A 4ORKA 4J1RA 4BCMA 3QYZA 2Y9QA 5CSHA 2E9UA 3FHIA 1YOJA 2XKEA 3QTZA 2YCRA 3F3ZA 3IW4A 3D2KA 2QOQA 4U3ZA 4A7CA 2ZYBA 5CSWA 5E8TA 2XVDA 5B2MA 3OEZA 4F9BA 3L8XA 4RJ4A 3EKKA 3WF9A 2YLFA 4DCEA 5EI8A 2W1DA 4BCKA 4RWIA 3QKKA 1XH8A 4FYNA 3V6SA 5IZFA 3W55A 4ZJVA 5FEEA 3NW5A 3IECA 2Q83A 4O22A 1UU7A 2ITVA 3TNHA 5BVDA 3I60A 4AFJA 3HX4A 1P4FA 3Q60A 3KXHA 4WBOA 3RJCA 3LLAA 2OJ9A 5HE1A 4FBXA 5A3XA 2ZV2A 3U51A 3UNKA 5CEKA 4G6LA 3W2QA 4CCBA 3LJ2A 4GCJA 3OUNB 3R71A 1XWSA 4FNZA 4RIYB 3RI1A 4O7RA 4RLLA 3T9IA 3NYVA 1Q3WA 4C38A 2O5KA 1CDKA 1YXUA 4GFOA 4TTHB 5EDPA 5CEQA 3L9PA 2QD9A 2GNFA 2PZPA 4QP2A 5DRDA 4UWBA 3RVGA 3WBLA 3TUBA 2WMXA 3HMMA 4H3PA 1Q8ZA 3D7TB 1XR1A 3G2FA 1OZ1A 2WEVA 4AZVA 4JBVA 1SM2A 2WO6A 3WOWA 4CFMA 5DG5A 4BL1A 4WOVA 5CS6A 3OCBA 4WNPA 1Q99A 1Q8TA 3VN9A 3ZFXA 4MTAA 1SZMA 1OMWA 2VWUA 4H36A 4IAZA 3DU8A 3ZCLA 5D7VA 4DG0E 3Q52A 4DF3A 5GIPE 4ZTRA 4F0IA 4LMNA 1MQBA 3D15A 4GMYA 4TW9A 3IDPA 4D28A 3ZUVA 5GZAA 2AYPA 5E1SA 4HGSA 4XNEA 5L6WL 4IM3A 5C4LA 2VTQA 4FKGA 4X3JA 2XA4A 3WYYA 3NVMB 1JNKA 5BPYA 3WILA 1Y8YA 3L8VA 4DLJA 2V5QA 1ZYSA 3DLSA 4KIQA 3DCVA 3JVSA 4TN6A 4WBBB 5FLFA 4J53A 1YWRA 3MWUA 3EQIA 4ZZMA 3VQHA 3Q96A 4FA2A 3WIKA 4FKWA 1PXIA 2HAKA 2UW5A 2EXMA 3JR1A 2WTJA 3G0FA 3C5IA 3NIEA 5KMLA 3D2IA 3U6HA 3LQ8A 4Q2AA 4IDTA 1XO2B 2OFUA 4IHPA 5ANKA 4CTCA 3PVUA 3RALA 4HVDA 1OITA 4W8EA 2YZAA 3PTGA 3TACA 3HMOA 4C62A 4QMQA 3Q5IA 3FSKA 3SOAA 5KZIA 1YXTA 3DPKA 4TYEA 4IH8A 1R3CA 2GCDA 2W5HA 2C0OA 3KQ7A 4YLJA 1OB3A 1BLXA 4DBNA 5AUTA 5CY3A 4YU2A 2PVHA 1GNGA 4DG3E 3EQPA 4DINA 4MH7A 3PYYA 4GW8A 2YEXA 4PUZA 3ODYX 4I4FA 3I5ZA 4MD8E 3JY0A 4YJOA 4XV1A 4MEDA 5CEMA 1FQ1B 4IWPA 4ZSEA 5AAFA 3QTRA 2F2CB 3RCDA 2ZDTA 4BWPA 4MYGA 3FZPA 4CVAA 3VRYA 2P2IA 3KK8A 4BTJA 3AC1A 3EN6A 3ZLSA 4BHZA 2Y4IB 4FSYA 4FX3A 5L2QA 5TOZA 2C3JA 3EFLA 4HGTA 3WF6A 3E63A 4AWIA 2F7ZE 2UZOA 3A60A 5BYLA 4OTIA 2GNHA 4PL5A 2A2AA 4ZMFA 1O6YA 4YLLA 5IQGA 4GIIA 1GIJA 2FVDA 1KE5A 4HPTE 2I0YA 2XIYA 4X6QC 2YCFA 3A7JA 3DK3A 1REKA 3UJGA 4BGHA 4FG7A 5ICPA 3T3UA 1U5QA 3FEGA 2UZTA 2W1CA 3MFSA 2QU5A 3E3BX 3OVVA 5LVMA 4XP3A 4O7SA 5CXZA 4JBOA 3QKMA 4O7WA 1JKKA 4XH6A 1OPKA 4C34A 3F5PA 3HA6A 2A1AB 4JOAA 3BQRA 1OKVA 4IAKA 3KCFA 2W1IA 2BDWA 4XG9A 5E8VA 4N70A 3NUAA 5J79A 5B0XA 2CGUA 4M69A 5AV2A 2Y8OA 4ACMA 5M4UA 4F6UA 3DXQA 2VWBA 5HZNA 4A06A 4L00A 2C6EA 2V7AA 2R3IA 2PL0A 3DS6A 3QUPA 5JT2A 5JH6A 2GS2A 3VUKA 2ZMDA 3LMHA 3ORLA 3QTWA 4XV3A 4YLKA 3VS0A 2PUNA 2F2UA 1WVWA 2R3MA 3AMBA 4M97A 3WZKA 1VEBA 4FKLA 2WQMA 4D9TA 2EWAA 3VUTA 2XCKA 4ID7A 2GQSA 1GJOA 3U9NA 3LFDA 1WBVA 1Q41A 2BTSA 5L6OA 3PFQA 4BVUA 5K5NA 2XNBA 4NFMA 2FH9A 1DI9A 3COMA 3ZLYA 5I4NA 3H4JA 4RC3A 2XNMA 4DAWA 5KO1A 5GJDA 3VUHA 3ORPA 2IZUA 3UOJA 2R3KA 3HP5A 4C0TA 3PIYA 3VHEA 2AC5A 4RJ6A 2BZJA 4O7YA 5E4HA 2XUUA 3KXZA 2JKQA 4JIKA 3DY7A 5HVKA 2J0JA 5HO6A 2JBOA 2GTMA 5I3RA 2PU8A 4GVJA 4CZYB 4U5JA 3R7EA 3T8OA 3F5UA 4FC0A 4DGGA 4EOSA 1YXVA 1QCFA 2O64A 4PF4A 4DGLC 1WCCA 3R83A 2PVMA 2XM9A 3PE1A 3CCNA 4TWOA 5EM5A 4CFFA 3S0OA 1OIYA 3HRBA 3MFTA 1WBSA 3DNEA 4QTCA 4PMMA 2ZB0A 3TKHA 3FYJX 4EZ5A 3KXGA 3QXOA 2W5BA 3CPCA 3GU7A 3D5XA 5H9BA 4O6EA 1IA9A 4C33A 4FKVA 5ANJA 2UVXA 5AR2A 4IADA 2EUFB 4V04A 3DDQA 3KRXA 4UZDA 4EHVA 5IKWA 4S33A 3UTOA 3FI2A 4OGRA 5IH6A 3FMJA 3PA4A 3GENA 3RZBA 4F7SA 4FF8A 2YJRA 2R9SA 1Q8WA 2DQ7X 5KE0A 4HYHA 3F5GA 4BCNA 4N4SA 2IW9A 4TXCA 1AD5A 5IUHA 4D1SA 5LMKA 3A7GA 2PVRA 1PKGA 3O23A 4FIJA 4O27B 5DT0A 5A9UA 1ZYLA 3L9MA 5DA3A 4EBWA 3RCJA 4M0ZA 5AFVA 2C69A 3BELA 4Z7GA 4ZTNA 5DR9A 3RM6A 4BI2A 1IRKA 3MB7A 5IQEA 4K2RA 2CJMA 2CKEA 2JD5A 5JGAA 1UV5A 4IZAA 3QTSA 4ANMA 2IN6A 1OVEA 4WRGA 3P5KA 2FSOX 4KKEA 5KHWA 3GB2A 5HX6A 3EFKA 5LCJA 3H3CA 3HUCA 3UO5A 2R0IA 1Y6BA 3N51A 4RJ7A 4EQCA 2HIWA 4FSNA 3UNZA 1KV2A 5HTCA 3Q32A 1ZOHA 4MXXA 3AC2A 1RE8A 4PL4A 1UWJA 4FV9A 2GQGA 2VTLA 4BTMA 2FSLX 2YIRA 3DB6A 4L53A 2OJJA 4TWNA 5CZIA 5HE3A 3BLRA 5M44A 2XEZA 3C4EA 3IDBA 4JJRA 4JRNA 4NZWB 3ZSGA 1B39A 4A9TA 3ET7A 3R1YA 3BYMA 5HOAA 3A99A 5D9HA 2WMAA 5AR4A 4QPAA 3FZOA 2HW6A 4L67A 2IZTA 3K3JA 3CIKA 2W05A 4TYHB 4E73A 1W83A 2O2UA 4FZ7A 3SRVB 4BCOA 2HELA 4PY1A 1F0QA 2ITYA 4GS6A 2VTNA 3AC8A 2JITA 2YDKA 5KKRC 2Z8CA 4BDDA 4O1OA 3BV2A 3WF7A 4D4SA 3MY0A 5JRQA 3SV0A 3IONA 4XV2A 3PVBA 4G6NA 4FZDB 5F4NA 4AAAA 2VGPA 1ZZLA 5DIAA 3AD4A 5HEZA 2B9FA 1M52A 5JGDA 3AC4A 5LVLA 1IASA 4S32A 5HO7A 3KRRA 5IA5A 5FRIA 4MXCA 2HZNA 3LQ5A 2XIRA 1JSVA 2O8YA 3QX2A 4QP7A 4DITA 2J0IA 2WFYA 4F63A 2PULA 4C4IA 2IO6A 3G9NA 3QCXA 4JQ7A 3QCYA 4CQEA 2NPQA 5J95A 1M17A 2YWPA 4F08A 1XBAA 3FKOA 2XS0A 1Q5KA 5DGZA 4AACA 3G33A 2Y4PA 5J7BA 1ND4A 2HK5A 4FKSA 1YXXA 3O0GA 1J1BA 3O50A 5CI6A 4OTFA 5FDXA 2HZ0A 2C5XA 4Z55A 1OBDA 4YBKA 4ALWA 3R8LA 4YTFA 3P08A 2VWYA 5LWMA 4NH1A 3KXXA 3LFBA 3CXWA 4CMOA 1BKXA 4Y85A 2QI8A 1O9UA 3CQEA 3KB7A 4V01A 2YERA 3KCKA 2XYUA 3MBLA 2WMUA 4BYJA 3QCQA 4MX9A 3LAUA 5CLPA 5JSMA 3UNJA 4RJ3A 4B6LA 1W0XC 4JG6A 3NNXA 4RX8A 2XK7A 4NFNA 5M4IA 3BRBA 3W8LA 4RT7A 4OTGA 3CLYA 5I0BA 3ORTA 4L68A 3FYKX 4I0SA 5KMKA 3R2YA 5CVHA 4CLJA 2YM8A 4FSWA 4BGQA 2QG5A 3OXZA 2H8HA 5GNKA 4EYMA 2WTKC 5M57A 2OZOA 4AXAA 3SXFA 4E20A 2OO8X 3MVJA 1SYKA 3BYSA 3OD6X 4K6ZA 4YZMA 3R7UA 1B38A 3KRWA 4BZNA 4UMRA 5GIOE 4IAYA 2XP2A 3FLWA 3G15A 1YQJA 2VTPA 3M42A 4ENXA 4Q9SA 2RG5A 3KGAA 1OL1A 3GCQA 4QRCA 3V01A 3BU6A 2XNEA 5EYKA 4IM2A 2ITUA 3GFWA 3KRJA 3U4UA 1XBCA 5T3QA 4HCTA 2W4OA 3RNYA 3ZDIA 3QXPA 4KRCA 3A7FA 3Q04A 4ZTQA 3ENMA 3FMHA 4CV8A 3OY1A 4C58A 1MRVA 1OI9A 4FSUA 4Z3VA 4ZSJA 2IZRA 4F6WA 1ZLTA 4UMQA 5BNJA 2IVTA 3JYAA 2ONLC 5CNOA 2XYNA 3EHAA 1OUYA 3LCOA 4QYHA 2XIXA 3QGYA 4O0WA 3ZBFA 4XG2A 5DVRA 3RNIA 4AZFA 4RWJA 3EN7A 4LFIA 4O0TA 3R9RA 1RDQE 4KS7A 4TL0A 5BUJA 5EHLA 3PWYA 3QRTA 3TWJA 4AOJA 5BUIA 4O82A 3IDCA 1UU3A 3D0EA 3E87A 1RW8A 2Q0NA 2QURA 5CZHA 2BAQA 5AP7A 1ZXEA 2IVVA 1JOWB 2PZ5A 5AR5A 2BRHA 2XBAA 3NDMA 1PY5A 1PXJA 4C2WA 4WRSA 2F49A 3NW7A 4G2FA 5EK7A 5I9UA 4IAAA 2IVSA 2QHMA 4JQ8A 5HD7A 2NRYA 3VS1A 4R78A 5AV1A 3KN6A 4FSMA 4X21A 5IQDA 3FMKA 2XK6A 4USDA 4ZTHA 3O51A 3V3VA 3HDNA 5IH4A 2XNPA 2CKPA 3UQGA 2OXXA 3A8XA 2WU7A 4H3BA 3VBXA 3PLAE 2ITZA 2VV9A 4JIAA 3DBFA 3R8MA 3GP0A 3ZBXA 4AGDA 4ZLYA 3W2SA 4UV0A 5M09A 2ZM1A 2W9FB 5AA8A 4IC7A 2QR7A 2JIVA 1QPDA 5TT7A 1FMOE 2JDRA 2C3LA 3R7GA 5HIDA 1QPJA 4AT5A 4CYIA 2XNNA 3MH1A 4FTCA 3NVKI 2QLUA 4D1ZA 4U41A 5DN3A 4YR8A 1Y6AA 1URCA 4N0SA 3SDJA 4EH7A 4DEIA 5AWMA 4TZRA 4JG8A 3O96A 4AA0A 3BBTB 1GY3A 2XM8A 3KKVA 3A61A 3U4WA 3RGFA 1H08A 1LR4A 1AQ1A 4ZTLA 4DEDA 2WMSA 3CC6A 4XX9A 4L7FA 3TV4A 1STCE 2GPHA 4I1ZA 4NCTC 2BCJA 1FBNA 4L52A 1JAMA 5CSXA 3ATTA 4R7IA 4QMUA 4IB5A 1H27A 4Y83A 2UZVA 3HV4A 3DV3A 3OBGA 2QO9A 3DA6A 3JPVA 3NYNA 3RPSA 4D2WA 4DG2E 3EN9A 5CASA 3GT8A 1OM1A 2GDOA 4NIFA 5HNBA 4C35A 4BDFA 5CEOA 5D10A 4IVBA 4MD9E 3HRCA 5DPVA 1CMKE 2F57A 3HL7A 4ITIA 3KVWA 4E6AA 4C2VA 3G51A 3FI3A 4FV5A 4I3ZA 4E8AA 3PPJA 3NYXA 3OTVA 4L8MA 4WO5A 4MBIA 4RVKA 4BDCA 3RHXA 5AADA 3HZTA 3UMWA 1U59A 5KBQA 3BLQA 4UN0C 3DFCB 3DKFA 5ITAA 2I7QA 2PUPA 4IWOA 4XEYA 4E6DA 1E1VA 2R3NA 5IQIA 5BYZA 4IAFA 4FT7A 4FKRA 4R7HA 4FEVA 3LQ3A 3F82A 2CKQA 3CD8A 2CNVA 4YGAA 4OBOA 1VR2A 5ETIA 3CS9A 3T9TA 2XNOA 3MS9A 4FK6A 4UWYA 3NNUA 5CF8A 4EONA 5HVJA 5CI7A 3LCDA 2BIKB 5J9LA 1H28A 2XZSA 4LM5A 2WMQA 4C36A 1XH6A 3I6WA 1YI6A 4Q9ZA 4IQ6A 2PE2A 1OIQA 4IACA 2OSCA 5CVFA 4FE2A 2Y4IC 1WBWA 3O8PA 4CNHA 3P7AA 4ZXTA 3MFUA 4LUDA 3DQWA 5EW9A 3V51A 4EORA 4YMJA 1ZMVA 2B53A 2OJFE 1GOLA 2H6DA 4FTUA 2QOFA 2VNYA 2YM4A 3OROA 4EZ3A 4RX5A 2OFVA 4ANOA 2Z7RA 2QC6A 1PXOA 4I5PA 3Q4ZA 3OT3A 2UW7A 1OUKA 2BUJA 3D14A 3LM5A 5EDQA 3PZEA 4EEVA 3BYUA 3GC7A 3EN5A 2AC3A 4QMZA 2PWLA 3PXQA 3OG7A 4QP3A 4RZWA 2WHBA 4OTRA 2JLDA 5JFWA 4QO9A 3FLYA 4JR7A 3ZC6A 3BHVA 2ERKA 4XG7A 4E4XA 4EH8A 1J1CA 4H1JA 5FEQA 4DFNA 3CTHA 4FV4A 4D58A 5A4TA 4NU1A 2UW8A 4C4EA 2V0DA 5FM2A 3QQGA 3DBQA 5KMOA 3OF0A 5DMZA 5K0KA 1H07A 3UODA 2O65A 2YM5A 2XBJA 2WELA 4LRMA 5A4EA 5L4QA 3HECA 3UE4A 4PDSA 4KA3A 3PRIA 4AN3A 4RJ8A 4BZOA 4MVFA 5C4KA 4BKJA 2FB8A 3D5UA 3IK3A 4BIBA 3H0YA 4HVGA 4FEXA 4Y8DA 2X7OA 2WTKB 4TNDA 4XUFA 4O86A 4C59A 3F3VA 3R7YA 3LFFA 4O81A 2UW4A 4ANSA 4JDIA 4O7ZA 4V05A 4YTCA 5KMJA 4DFZE 3DKGA 2JIUA 2PK9A 3VC4A 3L9NA 4QMPA 3I6UA 4D0XA 5I3OA 4R8QA 1YWVA 5AX9A 3R7IA 4AT3A 4RBLA 4O7NA 3CQUA 4J96A 5GZ9A 5TO8A 3DTCA 3FKLA 3FZRA 4QMVA 4RLKA 5IEYA 2UW9A 5FTOA 3FWQA 3OOGA 4DHFA 2YDIA 3DKOA 3EZRA 5ANGA 4A4XA 4XHKB 4EK8A 5DOSA 5L8KA 5EKOA 3ZLXA 3W33A 4LYNA 4C37A 3NZ0A 4ACDA 5DT4A 3OUKA 3P86A 1XH5A 3V5TA 3N4UA 3DT1A 5AUZA 4M66A 5AX3A 3ANRA 4P2KA 3ZFMA 4MQ1A 1M2PA 4QTAA 4D4VA 3COHA 4BGGA 5LVOA 4PV0A 5FP6A 2R3HA 3NMUF 2NRUA 3Q4TA 4L43A 4NYEA 4RC4A 4JX3A 2CGXA 4G5JA 4OBPA 4QMXA 3KMUA 4I0RA 4UEUA 3R9DA 4UMPA 2W99B 2X2KA 3MJ2A 4E5AX 4D2TA 3UIBA 3W16A 4EOPA 4HVSA 2I40A 3AT2A 4IB3A 1SVHA 5IUIA 2ETKA 3UYTA 1Z5MA 4P4CA 1HOWA 2UW0A 4ONAA 3HLLA 4MNEA 4O0UA 2O3PA 4YJQA 4IVCA 4XG4A 3C5UA 1JQHA 2IPXA 4MAOA 3VS6A 1BI7A 3ZTXA 2C0TA 4H39A 5I9VA 4QPSA 2BFYA 3PG1A 5KMMA 2ACXA 4ZJIA 5KCVA 1MUOA 5BVWA 5M56A 5KX8A 3O71A 4NJ3A 3VNTA 4BCGA 5J5SA 5CQUA 3R28A 4JRVA 4WNKA 3OW3A 4CG9A 2JBPA 2OIBA 4QMWA 5DEWA 1ZAOA 2A19B 3GU5A 4IZYA 3TIZA 4QP1A 1V0PA 2RKUA 2HXQA 4A9UA 3C4CA 4D2SA 3D7ZA 5E8XA 2BZIB 2WTVA 1QPEA 1P4OA 3LFEA 4FT0A 3Q53A 5AR7A 5CAQA 2PSQA 2VNWA 4AW0A 3V5WA 5IMXA 3G9LX 3OWPA 2QLQA 4X3FC 3RWQA 4ERWA 1Y57A 5BMSA 1Q24A 4W4VA 5IA2A 3R7VA 1Q97A 4ZK5A 4YBJA 3BE2A 4LOOA 3WE4A 1VZOA 2GMXA 2HWOA 4F4PA 4IVAA 3U8WA 3MIAA 3SHEA 4XRJA 1PMUA 3GQIA 2E9NA 1MRUA 2ITWA 3ALOA 3EOCA 2G2FA 4G17A 5CF6A 4QOXA 5I5ZA 4Y72A 4XOYA 4BWKA 4FTIA 4GU6A 5A46A 3BCEA 3ZXTA 5B7VA 4KB8A 5DR6A 5EQEA 3LJ1A 3BLHA 3RK7A 4M7IA 2YM7A 1FVTA 2W96B 5JRSA 3IPHA 4KABA 4M68A 4GFMA 4YZ9A 3IO7A 3C13A 2HOGA 4ANQA 4HPUE 2RFEA 2ITQA 1A06A 5ANEA 4DH8A 4FEQA 3QHRA 4YC3A 3L8PA 1WBNA 3MH0A 4E3CA 3E93A 3Q9YA 3VUDA 2HY81 3ZRKA 5LXMA 4BCJA 4RVMA 4RX7A 5CQWA 4BBMA 3D94A 4ZY6A 1CTPE 1R39A 3GNIB 2QCSA 3CBLA 3Q9ZA 4I93A 4E6CA 1REJA 3CSVA
chains in the Genus database with same CATH superfamily
4OBQA 1YHWA 3IQ7A 4H1MA 1YHSA 2O63A 5EHYA 3A62A 4DYMA 3U6IA 5AP3A 3DBDA 4AU8A 4DCAA 4O84A 2J51A 2WU6A 2FUMA 2YISA 3AMYA 4GH2A 3BGZA 4PMTA 5E8ZA 3S00A 2YA9A 5HE0A 4QDEA 3MB6A 1B6CB 2QONA 2W4KA 4UB7A 4AA5A 3DXNA 4PWNA 3F66A 1SNUA 4GJ3A 2OW3A 4GU9A 3CR0A 4I21A 2BAJA 2OBJA 3LXNA 4YC8A 5HU9A 4RIXB 3EKNA 2F7EE 4DLIA 3HKOA 3FMLA 5EKNA 2YABA 4N6ZA 5HTBA 3K5VA 3HV6A 1M2QA 5DEYA 4FNYA 4MQ2A 4UMTA 3MVLA 3SC1A 4O4EA 3TNQB 3UYSA 4BIEA 2DUVA 4FTKA 4I6FA 5DRBA 5G1XA 4UBAA 4HZSA 1PXKA 3EQBA 3VBWA 5A4CA 3VBTA 3NR9A 4TYIA 4JDHA 1RJBA 4QNYA 5CAVA 3IW8A 3V04A 1OKWA 3E88A 4YSMA 3QF9A 1AGWA 1ATPE 4E5BA 2YCSA 4E4LA 3AXWA 4HW7A 3LVPA 3KMWA 4C7TA 3OY3A 3PLSA 2V55A 2C6IA 4EK5A 4ZY5A 4TNBA 2QU6A 3D83A 5CAPA 1CSNA 3NAYA 2PZIA 3KL8A 4FODA 4F70A 4BCPA 3BEAA 3R2BA 4RWKA 2RFSA 2B0QA 3OS3A 4CRLA 1R78A 4LOQA 5IA4A 3ACKA 3AMAA 4HNIA 4USEA 2KULA 3QTQA 4QQ5A 4JAIA 5E9EA 4FTMA 4UYNA 3CJFA 5AP4A 3HV7A 5CSPA 4RVLA 1I44A 4AGUA 3DOGA 1Z57A 3DK6A 4GYGA 2XRWA 4OLIA 4CFXA 3PUPA 4LL0A 2OKRA 3S1HA 5JZNA 5HIEA 2WMBA 4LV5A 4ZIMA 4ZJJA 2G9XA 5E8WA 4ZZOA 2QHNA 5FBOA 4AOTA 2JKKA 3THBA 4FV6A 4WA9A 3T3VA 4F7NA 3QKLA 4TY1A 4PQNA 2X8EA 2VAGA 4BDJA 3F6XA 4EZ7A 4M14A 4D0WA 1YOMA 4A9YA 2C3KA 1JKSA 2W1HA 3NRMA 2FYSA 4MWIA 3QRUA 4M13A 4S2ZA 4YHJA 3BWFA 1YVJA 2R0UA 4YNEA 4BDBA 4USFA 5EDRA 4O91A 4U6RA 4KIKA 3W2OA 5F9EA 2XEYA 3CY3A 3HRFA 3EZVA 4EQUA 1TQIA 5D41A 4O7LA 1WBTA 3FPQA 3VRZA 4EK6A 4LGGA 4LGHA 5HKMA 2XIKA 3QU0A 4ASZA 5I9WA 2ETMA 2UW3A 4R1YA 5CYIA 3TKUA 4F7JA 1PJKA 1ZRZA 2GQRA 4N6YA 5IEVA 4LG4A 4S34A 3NUXA 3TL8A 3UPZA 5J9ZA 4EOLA 4RA5A 3TG1A 5B2KA 1NA7A 3B2TA 3NUNA 3NWWA 4JI9A 3KY2A 4XV9A 4BBFA 5HHWA 3W0OA 3EN4A 5J1VA 5EYDA 4C4FA 1M2RA 3QRJA 4EH9A 1YI4A 3SW7A 4B0GA 5IQBA 2PYWA 3ORZA 4PDPA 3LCSA 3EQFA 3EMGA 4UY9A 4IX4A 3Q9WA 3UIMA 3HAVA 5LCKA 2ZM3A 2VO0A 2ZV9A 3QTUA 4G6OA 5FP5A 4WG5A 5K5XA 3TZMA 2I0VA 1GZNA 4FR4A 3FKNA 4ZS4A 4EH8A 4ACCA 3UO6A 5CWZA 4NIFB 3VW6A 3DZOA 4BF2A 5JKGA 1SMHA 2A27A 2XNGA 3LXKA 4IFGA 3E92A 4NKSA 1LP4A 5D12A 4FIEA 4YZBA 2R64A 3TCPA 2FO0A 2C5VA 4QTBA 5C9CA 3K54A 4LRJA 4CLIA 2UUEA 4W9XA 3BL9A 3C1XA 3IW7A 2WTWA 3ENHA 1Q8YA 3QBNA 3VS7A 4GEOA 4I5HA 1KE9A 4YO4A 2RSVA 4OTPA 1H1SA 4FI1A 2WTCA 3LFNA 5IG1A 1KSWA 3EFJA 5ANIA 3DAKA 3TNIA 3UO4A 2X0GA 4Y95A 4FIIA 5HG5A 5HCZA 3BEGA 3KULA 4OTDA 4ZEGA 2OXDA 3TKIA 4L3PA 1O6KA 3V8WA 3MW1A 4H58A 4K9YA 4XOZA 3RPRA 5T6KA 4I92A 2CN5A 4K1BA 4JX7A 5E8YA 4YNOA 5C27A 5HX8A 4Y46A 4AW1A 3LPBA 4X3FB 4G9RA 3AOXA 1DAYA 3NS9A 3AT4A 1OECA 5CNNA 3ORIA 3LCKA 5EM6A 4BFMA 2YM6A 4QP6A 4RPVA 5E92A 2BRMA 3VBYA 3ZO4A 2UVZA 4I20A 5IQCA 3PSBA 3OWLA 5FXRA 2VTHA 3LHJA 4M0YA 5CXHA 3COKA 4G31A 3MA6A 1PHKA 2WIPA 2W0JA 5HG9A 5AA9A 1BUHA 1BYGA 5FGKA 2OZAA 4PP7A 4X0MA 3PVGA 4R5SA 4BI0A 5A4LA 3V5LA 4HJOA 1R0EA 2WMTA 5ETFA 4EOQA 1U54B 3R22A 4ITHA 3R6XA 3M1SA 4R6VA 4BDAA 1SVGA 4D5KA 4UX9A 4MNFA 3TTIA 4O0SA 2QOBA 4TT7A 3BHTA 5CANA 2ESMA 4YHFA 4GT3A 3FE3A 3FLZA 1WFCA 3N9XA 3GU6A 2X8DA 5F95A 5AM6A 4BDHA 2XB7A 4L46A 3EIDA 2LGCA 4BJJA 1XJDA 5GINE 4MK0A 4WUNA 3GUBA 3G6GA 4J99A 4EOKA 4CMUA 4KKHA 4EKLA 3FXZA 4Y73A 1S9IA 1OKZA 4JAJA 5FG8A 4EOIA 3I7CA 1KOBA 4GG7A 1Q4LA 4XYFA 3E8CA 3W0MA 3COIA 4Y5QA 4KNBA 4RIYA 4WUAA 5C1QB 2HWPA 5EM7A 5EG3A 3BHHA 5CF5A 3F3WA 3S4QA 2V62A 5ACKA 4OW8A 2BTRA 3FBVA 3CGFA 4AN2A 4RGJA 3TM0A 4V0GB 4UMUA 4CEGA 3W2CA 3LW0A 4YJNA 4XS2A 4YO6A 4EH4A 2R4BA 2VWWA 1NW1A 2YITA 4DEEA 2ZDUA 1J7UA 4A07A 3GC0A 3ORNA 3DJ7A 3RKBA 4AE9A 3VUMA 2JDSA 1PXNA 3QRKA 4G9CA 3PA5A 2P2HA 1EH4A 4EYJA 4FT5A 4IXPA 4JG7A 4RIWB 4F0FA 4D4YA 4M67A 4E1ZA 5A6OA 3UG2A 5M07A 2BHHA 3UBDA 4I22A 1J7LA 4KRDA 3VJOA 3ANQA 4AN9A 4J97A 3W10A 3KEXA 3VUIA 4EBVA 4F09A 2GFSA 2VX1A 4ALVA 3CJGA 4LGDA 1UNLA 5TE0A 5DHJA 5KNJA 4IAIA 3DB8A 3GOKA 4YUQA 4CFUA 2VTTA 2G01A 2J4ZA 5D1JA 3SOCA 1RQQA 4AS0A 3L8SA 2PUIA 3EH9A 4MF1A 3ZUUA 3A2CA 2BALA 1WZYA 3QD0A 4OTHA 1QPCA 4XP0A 3QAME 2OF2A 1DM2A 4EK3A 2R2PA 3P23A 4WG3A 5DBXA 5E7RA 3W1FA 3QZFA 3BLAA 4PL3A 4EUUA 2PVJA 5CEPA 2YCQA 3ETAA 3TT0A 3ZXZA 4HGEA 4BTFA 3REPA 5JMSA 4CG8A 4XG6A 3VS4A 3PY3A 4RWLA 3SQQA 2J50A 4IWDA 4C61A 3OXTA 4FKIA 3UOLA 3F61A 3KMMA 3QWJA 4HVIA 3FAAA 4CKJA 3ZONA 2PMIA 5CU4A 1TKIA 4D55A 1JKLA 4UXLA 1UU8A 1FGIA 3VWAA 4XBUA 5LVNA 1YWNA 3QTXA 1H0VA 3LCTA 3P1AA 2XAMA 3TNPC 4UYAA 3UZTA 5LMKC 3TV6A 2YIXA 4WD5A 4EKKA 3EQGA 2OJIA 2WB8A 4R1VA 4F1TA 3UOHA 1R1WA 5EHOA 3ODZX 1CKJA 4FNWA 5JFXA 5AV3A 3CGOA 4IX3A 5LMAA 3ZC5A 1M7QA 5DFPA 5IA3A 3Q6WA 5J9YA 2CLXA 5GJGA 4BDKA 3CD3A 2BDJA 2I1MA 3LOKA 4NKAA 3EYHA 5CALA 4TPTA 5CU2A 3QA8A 4RC2A 4EL9A 5B2LA 3KXMA 4H05A 2VWIA 4CCUA 1BX6A 2JAMA 4CT1A 3AKLA 1Y8GA 4QTDA 1X8BA 4AZSA 3C4FA 1GIHA 4E5WA 4CGAA 3FMNA 5LJJA 1VYWA 4W4YA 4OTQA 5AP5A 1OGUA 4YHTA 2X39A 1S9JA 4BB4A 2OG8A 3C7QA 4B7TA 5EYMA 4CKRA 3R02A 4R5YA 2GFCA 1OPLA 2HY0A 5HBHA 3QC9A 4GVAA 4GSBA 3PPZA 2QVSE 5K3YA 4YURA 3O7LB 2QNJA 4U9AA 4I23A 2Z2WA 4O6LA 1P14A 4TRLA 1H24A 2NYAA 3BE9A 4P5ZA 3IGOA 4BCIA 5C8KA 1IAJA 4X6RA 2LAVA 4GKIA 2ZMCA 3BV3A 3D5VA 4TWCA 1NXKA 3LFSA 3KVXA 4AXCA 4RX9A 3GC8A 3F2RA 4ZAUA 3NFFB 3UP7A 2WD1A 3VF9A 3WZEA 2VUWA 2JAVA 2P3GX 5DE2A 2B9IA 1M7NA 2VU3A 4IM0A 4Z9LA 2IZSA 3TI1A 5AUVA 5CU6A 4MBJA 4IW0A 1Q3DA 4CKIA 4DFUA 4QNAA 1NVQA 4QMYA 3ITZA 4FZFB 4ZTMA 4O21A 4E4MA 3QRIA 5DNRA 2GNIA 3EQDA 2J0LA 4L3LA 4KBCA 3TDWA 4DT8A 1DI8A 2P33A 4E7WA 5KUPA 2B9JA 4JL9A 4NM0A 4AUAA 4G3GA 3DFAA 2QOCA 3NEWA 4JLCA 3BHYA 3CTJA 3ID6C 1ZYCA 3PXKA 1ZWSA 4MKCA 3PSCA 2XIZA 5HLWA 4OT5A 4ALUA 3DQXA 3R00A 4GG5A 5BUEA 3HAMA 5HCYA 2EVAA 3ROYA 5IUGA 3QWKA 5AUXA 4ANBA 2BZKB 3I4BA 4C4JA 1R0PA 2ITTA 2W7XA 3I0QA 4HZRA 3U9CA 5AEPA 4W8DA 4LRKA 4MF0A 4EWHA 1KE7A 1ZOGA 4F64A 5H3QA 3NPCA 5KZ0A 4AGWA 4X2KA 4OTWA 3RBWA 3O8UA 3UPXA 5IQFA 2WIHA 1URWA 4I6QA 5CEIA 4M15A 4BYIA 2QKWB 4WHZA 2PPQA 1O6LA 2WTDA 2XK4A 1KE6A 3C0IA 4BCQA 4E4NA 4F7LA 4R77A 3E8DA 4CYJA 3VS2A 1XBBA 2UZBA 4FUYA 3GC9A 1DS5A 3NUYA 4RA4A 5E91A 2X2LA 5H8GA 4GT5A 3QHWA 4YTHA 4C57A 3ZO3A 1JLUE 4FMQA 3OMVA 1J3HA 4PMSA 3QZIA 4IX6A 3SD0A 3HMPA 4F0GA 4QT1A 3VQUA 2JC6A 3BYOA 5H8EA 1G3NA 2PTKA 2R3PA 5JZJA 3AC3A 3CEKA 2ZV7A 3E8NA 4M69B 5ETCA 4CT2A 4I4EA 2WMWA 5C26A 4MUQA 3KXNA 2XK3A 4D2RA 4FKQA 1FVVA 2B1PA 5IPJA 2OIDA 3HMNA 3KF7A 3F3TA 5GZ8A 3MSSA 4O4DA 5F20A 3ZM9A 3VW8A 3UG1A 4R7BA 4FVRA 4ITJA 3UQFA 2WKMA 4IIRA 2A0CX 3S3IA 1GZ8A 1PF8A 3K5UA 3ZYAA 4FTOA 2QOIA 5L6PA 5A6NA 3N4VA 2E9OA 1YOLA 4KIKB 3QQHA 4CFWA 4NUSA 5CT0A 3H10A 3O8TA 1ZMUA 4TYGA 2Y6MA 4DH1A 5J87A 4NM5A 3QA0A 3TIYA 3DZQA 3C0HA 4WT6A 3ACJA 1PYEA 4NM7A 2W1GA 4NEUA 1Q8UA 2VTSA 5EOBA 1IAHA 2J7TA 4S31A 4U8ZA 3C4XA 2UW6A 4O96A 4QYGA 3SXRA 3F5XA 5K4JA 3OBJA 3HV3A 2YZLA 1ZOEA 2IW6A 5IISA 4LI5A 5LQFA 3GCPA 2FGIA 3E5AA 4MXAA 3W0SA 4DT9A 2QG7A 2UV2A 3FMDA 3QCSA 3RK9A 3PFYA 4U97A 3U54A 3VS3A 4YJVA 4YZCA 2HYYA 2W1ZA 3R04A 3W2RA 3I1AA 4E93A 2NNWB 3C50A 3I7BA 4FIGA 2PVKA 4QD6A 4TYHA 5AIRA 2G15A 3SRVA 4QTEA 4IJ9A 3A4PA 5BYYA 3N4TA 2PHKA 2ZOQA 2HW7A 1PMEA 4EC8A 2BROA 3NGAA 4EOOA 1TQPA 2GNJA 1T45A 3QQLA 4F6SA 3ERKA 3OCTA 3CY2A 3OXIA 2J0MB 1GZOA 5AIKA 4I0TA 4Z16A 3WARA 3DJ6A 4XLVA 3OHTA 5HG7A 2BR1A 4RMZA 3PXYA 4DTAA 2R3JA 2E9VA 4FV7A 4RG0A 4FZ6A 5LVPA 2X0OA 4E6QA 3A4OX 3PDTA 5K4IA 2IW8A 4GL9A 3BGQA 3MA3A 1WMKA 2UZUE 3TXOA 4YSJA 3DJ5A 3L1SA 4G34A 4KKGA 4DN5A 2PZRA 3Q2JA 2OLCA 5IMEA 3UVQA 2XKDA 5AUWA 1H1WA 5L8LA 1UKHA 5AV0A 4L7SA 1G8SA 3UC4A 3MH3A 1KUTA 3PXZA 4PPCA 4S30A 4I5MA 4IDVA 5FBNC 5BVOA 3KK9A 3OTUA 2OXYA 1NT2A 3UP2A 5HNIX 4FIFA 4MBLA 4EJ7A 5CAOA 1V0BA 2WAJA 3TZ8A 2X2MA 3V8SA 5HQ0A 3GXLA 3D5WA 3ULZA 2WMVA 3DTWA 2DS1A 3FC1X 3R1SA 1KWPA 1P5EA 4PRJA 5CVGA 2GTNA 2OICA 2YM3A 3UVRA 4DH3A 2YWVA 1UWHA 3H9FA 3P7BA 3LZBA 2W1EA 3FZ1A 4L44A 2XANA 1IR3A 2I6LA 2Q0BA 4FT9A 5EFQA 2YDJA 1LEWA 5EM8A 1YXSA 2OZAB 1OPJA 3Q4UA 3FXWA 3R9NA 4BKYA 3MDYA 2WXVA 3TJCA 4AG8A 1W7HA 5HNGA 3TZ7A 5JGBA 3OFMA 3PSDA 4LDTA 5CTPA 3AQVA 4U81A 3KN5A 4BDIA 4AXEA 5HESA 5K9IA 4WNOA 3NNVA 2XH5A 1OIUA 5JQ8A 3LMGA 4ENYA 4UWCA 3FDNA 3A7IA 3F88A 2ZB1A 3FQEA 1Y91A 2OJGA 3I79A 3P9JA 4NJDA 3V6RA 2ITNA 5FUTA 4RZVA 1NVSA 3BQCA 4FIHA 3GCSA 4ERKA 2WTIA 3IW5A 1IA8A 2QKRA 3AC5A 2BIYA 3QD4A 2C5YA 2R7BA 4O38A 4RFZA 4YPDA 2XJ2A 2BMCA 4PNIA 3AG9A 4QMLA 5TKDA 1K2PA 2E2BA 2P4IA 5TR6A 4FL2A 4L3JA 3MVMA 3PXRA 2YAAA 1ERKA 3ALNA 3EQRA 3SAYA 1XH9A 5JEBA 3NIZA 3LKMA 1OIRA 2JEDA 3CKXA 1ZYJA 2I0HA 3JY9A 2ZM4A 3MI9A 1Q61A 2GS7A 2ZAZA 3Q9XA 4O0VA 5J1WA 3VJNA 1CKIA 5CT7A 2PVYA 4C3PA 4JT3A 1H1PA 3MTFA 5DLSA 3QZHA 2GHLA 2BKKA 4R3CA 5HVYA 5EYCA 3DKCA 3PWDA 5FD2A 5JN2A 4JXFA 4FOBA 3KREA 4ACHA 4CD0A 2WOTA 3POZA 3DGKA 4F99A 3LLTA 5C01A 5G6VA 4DH7A 3RPYA 3MY1A 3BU3A 3UMXA 3MFRA 1PXMA 2BAKA 1LUFA 4Q5EA 1JPAA 2QODA 4FSQA 4UALA 3WE8A 5M4FA 4U79A 4BI1A 3VO3A 4DFYA 4FSTA 3VS5A 3OZ6A 2J0KA 5DWRA 1FGKA 3PPKA 3QUEA 5C8NA 2X7GA 3QQKA 4MXOA 4TYJA 3OWKA 4AXFA 3KU2A 3GI3A 4IZ7A 4W4WA 2HENA 3SXSA 3OT8A 5IDPA 3QD2B 5CENA 3VF8A 5HI2A 3LMIA 4O7VA 3SGCA 1JSTA 5L2TA 4KIPA 3R8ZA 4II5A 1KE8A 4F9CA 1XMMA 4X2GA 3O7LD 3ROCA 1WBPA 3GU4A 2JDVA 4DEHA 4EH6A 4ARKA 4GKHA 2OH0E 5IU2A 4DE4A 5EQYA 2HZIA 2C6LA 3QALE 4PPBA 3QLFA 1W84A 3HP2A 2OIQA 4FKPA 3UDZA 4IEBA 1CKPA 4EHZA 3QQFA 2C0IA 4O0XA 3II5A 4AE6A 5AAEA 2EB3A 4FT3A 4RQKA 3ZS5A 4KBKA 4YZDA 3LXLA 3RAIA 4M84A 4AFEA 2YIWA 2VX3A 2NO3A 5L2WA 4O83A 4DGMA 4FYOA 4NM3A 3TNWA 3VVHA 4KS8A 3IOKA 3BGPA 3G5DA 1J91A 3IKAA 4CFNA 3ZOSA 2C6KA 3V5QA 5AJQA 1JBPE 1NY3A 2VTMA 3DDPA 4PTCA 3R9HA 5BX0A 1PXLA 3KC3A 2VD5A 4WG4A 4PMPA 3FZSA 4KUJA 3WF8A 4O0YA 4JQEA 4AZTA 5EI6A 4U3YA 5D7AA 4EUTA 3DXPA 4FKJA 3VHKA 3GGFA 4FKUA 4BY9E 3FV8A 3K3IA 3P7CA 3BWJA 4RSSA 5AAGA 3PJ1A 2VWVA 3LE6A 2VWXA 3W8QA 4BCFA 2UZEA 4FSZA 1V1KA 3SKCA 2F7XE 3AGMA 3R8PA 2VWZA 5KMNA 4WIHA 1MRYA 5J8IA 4D2PA 2ZFYA 4L01A 3FI4A 5EW8A 1OL2A 2WQBA 3UOKA 4CTBA 4YJUA 4CZTA 5K0XA 2QO2A 4APPA 5AV4A 1A48A 2PE1A 3NW6A 3RAKA 3Q3BA 1KOAA 1PMNA 2AUHA 1P2AA 2B9HA 2CMWA 4B8MA 3TUDA 3ATSA 1APME 4FSRA 4FOCA 2V22A 1IEPA 1W82A 2W4JA 5ETAA 5HBJA 2XCHA 2GHMA 4JDKA 4NT4A 2BDFA 1W98A 2VGOA 2W06A 3FLSA 1W8CA 2YIQA 4MHAA 4NSTA 3MVHA 3F9NA 3QLGA 2IVUA 4CRSA 4D2VA 1G8KA 3ZFYA 3C4ZA 3R7OA 3HGKA 2SRCA 4CZUA 3FY0A 2BRBA 3BBWA 3QZGA 2OI4X 4XLIA 5CSVA 4AZEA 3C51A 5EI2A 1H4LA 4G3CA 5BVFA 2OGVA 2CDZA 4BWXA 2FSMX 3E8EA 2X1NA 1K9AA 2RG6A 4BDGA 5DH3A 3RAHA 3R9OA 2R3GA 5M08A 3R63A 4XG3A 2RFNA 3FHRA 4HYSA 4QP8A 4PX6A 4AA4A 4LV8A 3EYGA 3UVPA 4I6HA 4AF3A 2CPKE 4O0RA 1FINA 4GFGA 3U6JA 1BMKA 2H96A 2ZJWA 3F7WA 2CNQA 3F7ZA 4EOJA 3E7OA 3OEFX 5EOLA 2RIOA 3CP9A 3FMEA 5BVKA 3BKBA 4NW5A 5L2SA 3IG7A 2REIA 1VYZA 2JFLA 3F2NA 2R3LA 4GV1A 2OH4A 2UZNA 1WAKA 3I0OA 4FUXA 4IZ5A 3EFWA 5BVNA 4BCHA 3H9OA 5HE2A 2G2IA 2UVYA 4YJPA 2CKOA 2R3FA 4NWMA 5H2UA 3QL8A 3H9RA 3R8VA 2XJ0A 2UZLA 3Q5ZA 3UC3A 5M53A 3ORKA 3QTIA 3RP9A 2IJMA 1U5RA 3WYXA 4GK2A 4DTBA 4KINA 2Y6OA 3V5PA 3OCSA 1H26A 3VBVA 1MP8A 1F3MC 1H1QA 2VTAA 1ZARA 2XJ1A 1K3AA 3VAPA 3FUPA 4ZY4A 4M12A 4LQMA 5F1ZA 3A8WA 4DGNA 4FZAB 1XH7A 5HORA 2GNGA 3BX5A 4BHNA 3IGGA 2R5TA 2AEGA 3SLSA 4FRFA 4AX8A 2X0QA 3ZRMA 1ZY5A 2BPMA 3DBCA 3W2PA 3P79A 2JKMA 3PJCA 2OK1A 4C4GA 5FDPA 4EH3A 4IJPA 3HV5A 4OT6A 4I24A 4IMYA 2Y7JA 3FY2A 3WZJA 4BR3A 1OL5A 3A7HA 4GK4A 4IB0A 1PW2A 4AQCA 4R3PA 4RFMA 3MYGA 4B4LA 5AUUA 2IEWA 4NW6A 5CAUA 3PY0A 3AGLA 4D4RA 4X2NA 4DFLA 1TVOA 1XH4A 5D11A 4FVQA 4N57A 4G3FA 4DHZA 2X4ZA 4ZSLA 2C4GA 1E9HA 1OKYA 4P7EA 5EH0A 4AOIA 3QD3A 2BZHB 5FXQA 1HCLA 1FOTA 4KD1A 3SG9A 5LMBA 4C3FA 3B8QA 2A98A 4EWQA 4KIOA 5GHVA 3ZZEA 1YDRE 3OOMA 5HGIA 3ZEPA 2G1TA 4IE9A 3NUSA 5HBEA 5AP0A 4PDOA 4ZOGA 3ZLWA 3KF4A 1UNHA 3HVCA 2XF0A 2DWBA 2PUUA 1UKIA 4U45A 3RAWA 1PYXA 2H34A 2UZDA 4HCUA 3KFAA 4WKQA 3W32A 3ZHPC 2VX0A 3KRLA 4IBMA 4NK9A 4DEBA 5AP2A 5IA0A 4IANA 1SVEA 4G3EA 4IB1A 5IA1A 1DAWA 1XMLA 3FI8A 4NL0A 4M8TA 4OAVB 2ONLA 5HICA 5IEXA 2YJSA 4FNXA 2Y0AA 3PIXA 3LXPA 1FVRA 3R01A 3NCGA 3R0TA 4GK3A 4U80A 4W9WA 3E3PA 3RPOA 4ANNA 1Z9XA 5HU3A 2W17A 1G8AA 1JWHA 2C6DA 3I5NA 5FXSA 3TUCA 1PRYA 2Z02A 4FGRA 3SX9A 1GAGA 3TDVA 5HLNA 2YN8A 4FVPA 4PTGA 3DAEA 4O1PA 1G8JA 2GU8A 3JS2A 3POOA 1F5QA 3CE3A 4FG9A 4JS8A 1VJYA 3BI6A 3NYOA 5T68A 5L3AA 4LOPA 3C9WA 4Z7HA 4WSQA 1SNXA 3GOPA 5IDNA 4DDIA 2BHEA 4RQVA 1T46A 2C6MA 4XCUA 3GU8A 3GFEA 5FQDC 2H9VA 4TKSA 4YP8A 1MQ4A 1WVYA 2CLQA 2YACA 2QO7A 3G0EA 5CU3A 2X6EA 3EQCA 4QMSA 1U46A 2J9MA 2VTIA 3EJ1A 3AT3A 4KSQA 4QQCA 4KBAA 2GHGA 3R30A 4BKZA 2RL5A 4MWHA 3OP5A 1QL6A 2QOHA 3O17A 4CMTA 5DR2A 3K2LA 3PP1A 4J95A 3MY5A 5IQHA 1JVPP 3CTQA 4QMOA 3IS5A 3VBQA 3D7TA 3WZDA 5TF9A 2QOOA 2F9GA 3PG3A 1LEZA 2YLEA 3QUDA 1HCKA 2BFXA 2ETRA 3D9VA 3L9LA 4HVHA 3P5JC 4ZP5A 5IH5A 3F2AA 2JKOA 3Q2MA 5FTQA 4DA5A 3PRFA 2EB2A 4XG8A 2X8IA 4ZTSA 4EH2A 4Q5HA 5HD4A 2J90A 3GEQA 2GNLA 2PVFA 3R1NA 4AW2A 3ULIA 4NCTA 3BZ3A 3I81A 4W4XA 3MGYA 4GJ2A 3BPRA 4GT4A 4OUCA 4AT4A 3SG8A 2A4LA 4L9IA 4EQMA 1Q62A 4QQTA 5CU0A 3U55A 1J7IA 1L3RE 2C68A 4XRLA 4RRVA 4I6BA 5EW3A 1ST0A 4FICA 2VTRA 3HEGA 4K77A 5JFSA 3DAJA 3PJ3A 1UVRA 5GJFA 4YJRA 1BL7A 5FWKK 4FV2A 5DI1A 4JVGA 4QYFA 2W9ZB 3RM7A 3RZFA 4QQJA 4IX5A 4O2PA 4K0YA 4EOMA 4J98A 4J71A 5HCXA 2R7IA 5DYJA 5JQ5A 4FTNA 4H3QA 4U0IA 2PY3A 3PY1A 2PVLA 2B54A 2EXEA 2ZVAA 2WNTA 3MIYA 1YDSE 3PJ8A 4FTJA 4KAOA 2VTOA 4PTEA 5CX9A 3JVRA 4GRBA 3AD5A 4IWQA 3P78A 2W5AA 4MNEB 2NP8A 4FKOA 2WPAA 3BYVA 4FTTA 3C0GA 4FTQA 3VUGA 2O0UA 4DFBA 3TN8A 5J5TA 5M4CA 2R3RA 1LPUA 2JDTA 3QYWA 3ZMMA 4EK4A 4O2ZA 5ACBC 2C6OA 3NNWA 3UIUA 2QOLA 3BU5A 4FV0A 4B8LA 5KBRA 3UZPA 3WZUA 1PXPA 2B4SB 4ZMEA 3ZM4A 2CN8A 3R1QA 3TJDA 3LFCA 4MCVA 4YJTA 1G5SA 2E9PA 2X9EA 4WSYA 5E8UA 4RIXA 3RHKA 5AMNA 2BVAA 1XKKA 3RTPA 3ZSHA 1OBGA 2OF4A 3MPAA 1M14A 2C47A 5C03A 2C5OA 4F9YA 3NCZA 4YC6A 2X9FA 1H0WA 3EB0A 4CFVA 5BV3A 4D9UA 3H30A 4U40A 1JSUA 3F3UA 1CM8A 4PP9A 5M06A 2CCIA 5AP1A 4YZNA 4ZSGA 4CXAA 4B99A 3EWHA 4B9DA 4DGOA 4G5PA 3QQUA 4EJNA 4FV1A 3MPMA 4FV3A 4JR3A 5E8SA 2XKCA 1FPUA