4BDFA

Fragment-based screening identifies a new area for inhibitor binding to checkpoint kinase 2 (chk2)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
304
structure length
285
Chain Sequence
MSVYPKALRDEYIMSKTLGGEVKLAFERKTCKKVAIKIISKNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Fragment-Based Screening Maps Inhibitor Interactions in the ATP-Binding Site of Checkpoint Kinase 2.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 285
sequence length 304
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bdfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bdfA01
3K3JA 3ZRKA 2C6KA 4BCNA 4U79A 2P2HA 5IQHA 3P1AA 2PE0A 4YO4A 3RPVA 4QNAA 3VUKA 1Q5KA 5KBRA 5TO8A 3CTHA 4FTIA 4O0VA 4NSTA 4F6UA 1RDQE 3FMJA 1Y6AA 3KULB 4BWKA 1LPUA 2IN6A 1P4OA 4FF8A 5LCKA 3RHXA 2ITXA 4BIEA 4DFZE 1OL7A 3LZBA 4FEQA 2J0KA 3MYGA 3QQHA 4GMYA 4XG2A 2C0TA 1KV1A 3RPYA 1YHWA 2VWZA 2ITVA 3L1SA 4H05A 2E2BA 2XK9A 3BYOA 3DBCA 4UMQA 5HICA 3A7JA 5HD7A 2CNUA 2JDTA 5HO8A 4E5AX 1ZLTA 4F99A 3Q6WA 4O7LA 4FIFA 1H28A 3L8VA 4OR5A 2XIZA 4F7SA 2QU5A 3E87A 3TN8A 5GZ9A 4EKKA 4EC8A 3EQGA 3T3VA 3T9TA 3VIDA 5J7BA 2X39A 2B7AA 3QKLA 4PL3A 3FZSA 5EKNA 5IF1A 3P08A 4FC0A 1OBGA 5HKMA 3VUMA 4I6HA 3PJ2A 4O0SA 3TZ8A 4Y46A 4QTAA 2XYNA 3RKBA 4RJ8A 3UC4A 3NGAA 3LFFA 3WARA 3Q6UA 5JEBA 4KIKB 3EIDA 5EW8A 2R3OA 3DDPA 4EWQA 2BTSA 2VTLA 2XYUA 2EU9A 2F49A 2BKKA 1CMKE 4GU6A 3QLFA 5FD2A 2FSOX 5L6PA 1LUFA 4BDCA 4XG8A 3F5GA 3PXZA 2ACXA 2JAMA 4ZJJA 1ZYDA 5E4HA 5JFSA 3F3UA 4ANNA 4CTCA 2H6DA 4EQMA 3IDPA 3PVUA 2UZTA 4KKGA 3VHKA 2BRNA 3GENA 5DH3A 4KA3A 4KIOA 2BFXA 5C9CA 2IJMA 4MBLA 5D10A 3CQWA 5E91A 4ZSLA 5KE0A 3R28A 3P7AA 2BAQA 3HP5A 4JDHA 1IEPA 3OUNB 1Y8GA 4IB3A 3UO5A 3KK9A 4ZK5A 5A9UA 3VAPA 3R2YA 2B9HA 3AC2A 1F0QA 4LOOA 5F20A 3UIUA 4F1OA 4HW7A 5KMKA 3NAXA 3FHRA 4YJTA 3BBWA 4O83A 3OZ6A 1A9UA 4J98A 4HVDA 2W1HA 2XKFA 4OBQA 3E93A 5B2KA 3FPQA 5C1QB 4G6NA 3GP0A 3RAIA 4JG6A 4CCBA 4IM3A 2C6EA 3EYGA 2Y6OA 4P7EA 5CZIA 3S1HA 3QZIA 2VTPA 2BDFA 2IVSA 4K0YA 3SW7A 3TIYA 4BRXA 1ND4A 1CDKA 3BYVA 3QTUA 4CKIA 5FTQA 2HY0A 2XK4A 4EK8A 2IPXA 5IEXA 2PVLA 5FP6A 2B0QA 2CKEA 4U8ZA 1B38A 2GNHA 4QYEA 4BCHA 4DLJA 4L43A 4E93A 4XNEA 5IA5A 4F7JA 3W2CA 2VTTA 3FAAA 2OJGA 3DBQA 4J71A 4LRKA 4YJPA 1M2QA 4K9YA 4EKLA 5M09A 3BE2A 4FL2A 1JNKA 4PX6A 4UEUA 5E7RA 3W2SA 4F6SA 3TUDA 4FEXA 3ERKA 4RC3A 5IQDA 3R0TA 4BL1A 4L6QA 4BDKA 3GCQA 4V0GA 3DQXA 4JAIA 2R3PA 5DE2A 2NRUA 3PPZA 4HYUA 5F9EA 3W55A 4FOBA 3E7VA 3WF8A 1H0VA 1F3MC 4JRNA 5E1SA 3UDBA 3I5NA 5EK7A 2YCRA 5EQEA 4FKVA 2QOFA 4MAOA 2XNEA 3G6GA 4LUDA 4WG5A 4XHKB 1ZOGA 4D55A 3EB0A 3FMHA 4MD9E 4IWOA 1O6KA 4O86A 3PP0A 3QAME 4CCUA 3ZXTA 1OBDA 4C2VA 5DN3A 4IACA 3C1XA 4FVQA 2ITPA 5DT4A 5E8YA 2CCHA 2QR8A 4UZDA 4GK4A 2EB3A 4AN9A 4HGEA 4AW0A 3UVRA 4O7SA 1PYEA 4FX3A 3U4UA 3N4VA 3PJ1A 3JXWA 2X7FA 4P4CA 2OW3A 5H9BA 3OTVA 2P55A 2HCKA 3SA0A 4RIXA 1WVYA 3IGGA 4S30A 5TKDA 4ANLA 4BZNA 4EHEA 2X8IA 4F08A 4ORKA 4HNFA 2BAKA 3ZOSA 1HOWA 1H26A 4L46A 4AA0A 5IQGA 1G3NA 3RJCA 2PZIA 3ZSGA 4ZTNA 1I44A 5BYLA 1Y8YA 2GHLA 2J7TA 4KABA 5IQBA 5LVOA 1BI8A 3PP1A 1O6LA 4UMUA 4XBUA 5I9WA 4H3QA 4E6QA 2FUMA 4ITHA 2PK9A 4A9SA 4OT6A 5ANDA 3OCSA 4IFCA 4FMQA 4EK3A 1RQQA 1A06A 3C50A 4V01A 1J3HA 3COHA 3CS9A 3HKOA 4IDTA 4U7ZA 4BCFA 3KREA 3N4UA 1IG1A 3D5UA 1Q61A 2YM4A 4FSTA 1YQJA 4L3LA 2V7AA 5JGBA 5FGKA 2IG7A 3UYTA 5LVNA 3SKCA 4YO6A 4WD5A 3WF6A 4XOYA 3NSZA 4XV9A 2WQMA 4AGUA 4D4YA 5CYIA 2VN9A 5HORA 4C3PA 1RE8A 5IPJA 3UNKA 3UZRA 1YKRA 3LCOA 3TUCA 3CQUA 2W5BA 4FIIA 1XBCA 3DTWA 3QTIA 3R8VA 5I9YA 4BR3A 3S4QA 2FB8A 2OZAB 5JGAA 2BHHA 4D2SA 4EQUA 1V0BA 3QXOA 2HZ4A 3TKIA 3PLAE 3R73A 5A14A 3OMVA 2EUFB 5K4JA 5DMZA 2QOIA 3OP5A 4HYIA 4FEVA 1SVGA 2ZOQA 3R9RA 4ZY4A 3P5KA 2BZJA 4Z55A 3E63A 2GFCA 4FTKA 3MVHA 5IZFA 1O6YA 2JKOA 3LQ8A 4OTWA 3UIBA 5LXMA 3LXPA 3QFVA 3FJQE 5IDNA 1H8FA 4C34A 3P7CA 5LARA 3MH3A 4DH7A 4WUAA 3KULA 4OTIA 4U42A 3REPA 4M7IA 4CKJA 2C69A 3CP9A 3OHTA 3TUBA 1SZMA 5KMMA 3ANQA 4FYNA 4EYMA 4GCJA 4AA5A 1ZOEA 2WMSA 2O63A 3PSCA 5JQ5A 1ZRZA 2R3NA 4AOTA 4C3FA 3W8LA 5L2WA 2HAKA 2WEVA 3ORLA 4JBOA 3TZMA 3UTOA 4F0GA 4OAUC 3LQ3A 4J8MA 2QOQA 3TNHA 3Q60A 1JKSA 3R63A 2OICA 5E90A 5HVKA 2X7GA 3QTSA 4FEWA 5AUVA 4RX9A 2ESMA 4YLKA 3ORTA 3GGFA 3JPVA 3NLBA 2RGPA 4QMMA 4CFNA 3BU5A 5BVNA 2XA4A 3DAKA 3FQSA 2V7OA 3C5UA 2VTSA 3OBJA 4QOXA 4FIHA 4LM5A 3D4QA 1CKPA 2QKWB 4APPA 2GDOA 4KIQA 5GIPE 3UMWA 3BWFA 1L3RE 5EQYA 4H1MA 1KSWA 2PVFA 3FL5A 4ONAA 2RFSA 2C5YA 5J9YA 2A27A 5KZ0A 3S00A 4R3PA 5HEZA 4J99A 4JL9A 2E9NA 4EI4A 3UQFA 2GSFA 2UZWE 3P7BA 5D11A 3DK3A 4FK6A 4G6OA 3S2PA 4FKUA 3VF8A 5A3XA 2PMOX 4B8MA 4ZMFA 1B39A 4EK5A 4Y72A 5DT0A 3VW6A 1FMKA 4O6LA 2A2AA 4Y8DA 4YU2A 3FSFA 4NTSA 2WOUA 4XG7A 4CV9A 2ZMCA 4V05A 3G0EA 3LCTA 4ENXA 5I9XA 5M4CA 2QC6A 3PWDA 3R21A 3NPCA 4HZSA 3PSDA 4FR4A 2GNJA 4TXCA 4ANOA 4BIDA 3AC8A 5HD4A 3EZVA 5J1VA 4L00A 4ZS0A 2YLFA 4L3JA 3MWUA 4U97A 1WVWA 4CKRA 4AT5A 2GQSA 3DAJA 4BCGA 3RAKA 3S95A 3NCGA 2CMWA 2PMLX 2ONLC 2X6EA 2W1IA 5B7VA 4DG2E 4G9CA 4JI9A 3GCSA 4IC8A 2E9UA 4OTRA 3EN7A 4U43A 3VULA 4AFEA 4MF1A 4BHZA 3MGYA 2X8EA 2W0JA 1SM2A 2UW8A 2XP2A 2WMRA 3FQEA 4X0MA 4EZ5A 4P5ZA 5L8JA 4EHZA 2Y4PA 4K8AA 4FIJA 3OD6X 5I9VA 3HAMA 4I5HA 3W33A 1JWHA 4N70A 4I5CA 3QCYA 4IAZA 3VUGA 2Y9QA 1VZOA 2YEXA 3AMAA 3F3ZA 4I23A 4ITJA 4Z7GA 3UC3A 1V0PA 4LL5A 2YM7A 3TKUA 1HCLA 2B9IA 2XKEA 3MN3A 4ACCA 5BVKA 2CSNA 4PMTA 3OF0A 4FNYA 4EHGA 1H1RA 3I79A 5DA3A 1NW1A 4O6EA 1GIJA 3F2NA 4QMPA 3LFNA 2O2UA 5KBQA 3SV0A 4DF3A 5LCJA 4FV3A 2JDOA 4BGQA 4C4IA 2JDVA 3AGMA 5FRIA 4FV5A 1I09A 4CT1A 4EH5A 4FI1A 1GZOA 3LHJA 1GIIA 4UXLA 4AZWA 2XRUA 3R8LA 5E8WA 4WNMA 1FOTA 3Q32A 4RMZA 3DZOA 5IUHA 1IAHA 5T68A 2P4IA 3HRCA 2HELA 4A7CA 4APCA 3C4EA 3GI3A 3PIXA 4KBCA 2BZKB 3PXRA 3ACJA 4Q5EA 3UG1A 3ZS5A 4EOSA 1YI4A 1YXVA 3PA4A 3HMIA 5A4TA 5J79A 4TWPA 4FE2A 1IRKA 1OKVA 3O17A 3GU4A 5K9IA 3Q9WA 1GY3A 1ZMUA 5C8NA 4FKOA 3ZM9A 4LGGA 5EHLA 5CX9A 3V5QA 5CF8A 1VYWA 1PXNA 2JBOA 3QZHA 3ROCA 4I21A 1WFCA 1JQHA 4D5KA 2XBAA 1J91A 3TEIA 4B6LA 5K0XA 2PMNX 3BPRA 3MFTA 3VNTA 4QMQA 5AX9A 4DT9A 3GU5A 3A7FA 3QBNA 4ZSEA 2Z8CA 3RZFA 4CQEA 1YOMA 4FZFB 2B9JA 3D2KA 3GCPA 4MWHA 4E4XA 4OAVB 4XBRA 4G3DA 3JVRA 4USEA 2WMTA 4EK4A 4L01A 4IAIA 3EQRA 3ZRMA 4AT4A 4GT4A 2VU3A 4A4OA 2QHMA 4CFXA 3CY3A 2XVDA 3WF5A 5J1WA 3RNYA 2GHMA 4CFMA 5IA1A 3DS6A 2CJMA 2J5FA 2J90A 2QOBA 2R3GA 2X6DA 3CKXA 3QYZA 4NK9A 4RWKA 3E92A 5H8EA 5HNBA 3RHKA 4CTBA 5AV3A 2F4JA 5HCXA 1KWPA 3TG1A 5KCVA 5F1ZA 4K77A 4QD6A 4FVRA 3MH1A 4IVCA 2YWVA 1PMUA 2IZRA 2GNFA 4NU1A 2CGVA 1OPLA 2XM9A 1OPKA 3I1AA 4LUEA 1ZMVA 3Q4TA 4QMUA 3UE4A 3EN6A 4RWIA 2DQ7X 4YTFA 4QP6A 3OFMA 3QQGA 3AD4A 5G6VA 2KULA 2BRGA 4IWPA 3EFLA 4FODA 3NZ0A 3QUPA 2CN8A 3LJ0A 4UXQA 4CG9A 5EDQA 3W2QA 2FSMX 2OZAA 2WOTA 5J87A 4ZS4A 3F3WA 4JS8A 4Q5HA 4MWIA 2P3GX 5GINE 1JAMA 1EH4A 3NYXA 1TVOA 1BUHA 2QURA 4MKCA 5FEEA 3TTJA 1OECA 4H3BA 3BQRA 4I6FA 3MY5A 5DEWA 3RAHA 4EC9A 3SG9A 4GYIA 2O64A 4AACA 2Q0NA 5BVEA 3RP9A 1ATPE 3IOKA 3NIZA 3VRZA 5KMJA 5LMAA 1E1VA 2W4JA 4Z16A 3DXPA 3ORKA 2PVYA 3QKMA 3RVGA 1Q41A 3D7TB 4YHJA 4YLLA 1UA2A 2CHLA 1YHSA 2WMVA 2I6LA 4X2NA 5IQFA 4ERWA 3QQKA 2WQEA 3IDBA 4G31A 4MXAA 4YJNA 2O3PA 4AP7A 3HDNA 4DFYA 2RSVA 3O23A 4Y83A 1GOLA 2OWBA 3T3UA 4TWNA 2YWPA 4QTCA 4EYJA 5IMEA 2Y7JA 4FL3A 3S3IA 1R0PA 3HMMA 2JFMA 5EM5A 4F70A 3OEZA 4A9YA 3C5IA 1PXJA 5KUPA 3DXNA 2UZOA 4EJNA 4YZDA 3IOPA 4E4LA 3FXXA 4MX9A 1UWJA 4PTEA 4XG6A 4FKSA 4QTDA 3BHYA 3KXXA 3CD3A 1KV2A 2V62A 3RI1A 4C35A 5KHWA 4YLJA 4ZOGA 4FT9A 3NIEA 3KC3A 5TR6A 1IA9A 4O0UA 2FSTX 3CGFA 3LFQA 3FMLA 2IWIA 2WEIA 3V6SA 4ZTSA 3DTCA 2JKMA 3LXNA 4G16A 4PMSA 3W8QA 1H1PA 2EXMA 2Y4IC 3EN4A 3MPMA 5JQ8A 3A7HA 3V5LA 3NUPA 3DDQA 1M2PA 2G2FA 1MQ4A 3PUPA 3OC1A 1AD5A 1DM2A 3OOGA 3QGYA 3OCTA 3AT4A 2UW6A 4MBJA 4HGTA 1WBVA 2BKZA 1YWRA 2O65A 4I93A 3O96A 2ITTA 4XG4A 5I9ZA 5M53A 3ATTA 2X1NA 5HG9A 3BU3A 1E1XA 3NYNA 1OVEA 5AAFA 4JXFA 3GXLA 2BROA 1KOAA 3WILA 5CAQA 4GV1A 4O7NA 4PTCA 3BLRA 4TW9A 2I0YA 3HV5A 4ANSA 3ORIA 4OLIA 4ARKA 5KMNA 3E8EA 5IQIA 4NWMA 4TWCA 5BQ0A 1UU7A 4M14A 4WA9A 5IEYA 5KZIA 3GQLA 3BYSA 3WZDA 2JBPA 4F9CA 4O7RA 1UU3A 1DS5A 5FDPA 5IMXA 5CAOA 3KCFA 5FM2A 2YAKA 5CNOA 4WNPA 1GJOA 4YJSA 4NIFB 3UP7A 2OO8X 4M0ZA 2RKUA 4CZTA 3NMUF 5HIDA 1H1QA 3RAWA 4CMTA 2OSCA 5CF5A 4FV1A 3HA8A 3PXYA 4CG8A 5IH4A 2YIYA 2CKPA 3MFSA 4AN3A 2XK3A 3EOCA 5CNNA 2JITA 1UWHA 3H3CA 4J1RA 5AM7A 5J8IA 5CQUA 2WQOA 4G3FA 4RA5A 4B4LA 3HA6A 4E4MA 4M13A 4KD1A 3THBA 3ZEPA 3KMMA 4IWDA 1YWNA 3HUCA 4PF4A 5CSWA 4IQ6A 3TACA 3NRMA 4BDIA 4CD0A 3FLQA 4AX8A 5G1XA 3DJ5A 5KHXA 4NW6A 3R1QA 4YJUA 3R8UA 3F69A 3QCQA 1QCFA 4AU8A 2VGOA 1OB3A 3DV3A 5HBJA 2VAGA 4CQGA 5C01A 2BIYA 2HK5A 2GHGA 2G15A 3A8WA 3I4BA 4FTCA 2YIQA 4CYIA 3OTUA 3HGKA 4L52A 3F2AA 3BIZA 4FSNA 4TKSA 1GZNA 1PMNA 2YCSA 4NL0A 3KL8A 4IAYA 3ZZWA 4R5SA 3FLSA 4RJ6A 2WIHA 3I7BA 2Z7LA 5KNJA 4C8BA 2PU8A 4QTBA 4CRSA 4G3GA 4HPTE 3NUYA 1XR1A 4O91A 2H8HA 3LM0A 3QHWA 1GNGA 1SYKA 3OY3A 3D2IA 4F9BA 3OUKA 5BNJA 3DOGA 4MVFA 5JZNA 2XB7A 3HLLA 2XH5A 4BDEA 4KWPA 5M08A 5FXSA 5TE0A 2QVSE 4U3YA 3L8XA 4ZSGA 4FKGA 4RBLA 5H2UA 3ZEWA 4FGBA 2HYYA 3ZSIA 4UYAA 5AA9A 4QYYA 4FTUA 4M12A 3TWJA 4W8DA 4D28A 5CU6A 4TYGA 5M4UA 4GVJA 2C4GA 2WMUA 2GNLA 2IZUA 2PMIA 2WZJA 3I5ZA 3PE1A 4TYJA 4BDBA 3VUTA 4PL5A 4AE9A 3BHUA 4D1SA 1WAKA 4EH8A 4BWPA 3NNUA 5HLWA 4CLJA 2BFYA 2FH9A 3NNWA 1FQ1B 1ZY5A 3SC1A 1CTPE 1CKJA 5AMNA 5ANEA 5IQEA 5CEQA 2RF9A 2Z7RA 4RGJA 4FSWA 5DHJA 3KRRA 5AR5A 5L2TA 2J0IA 2XBJA 3KXGA 4PPAA 3MTFA 4II5A 3LFDA 1Q8UA 1RJBA 3H10A 2VTMA 3R9DA 1ZWSA 5J9ZA 5BVOA 4IXPA 2OH0E 3BLHA 4XV2A 4H39A 1UNHA 2IVVA 1K9AA 4O1OA 1Q99A 3KQ7A 3LVPA 3PZHA 4R1YA 5AR8A 4FNZA 3LFAA 4I0RA 1SNXA 3VS3A 4BBFA 3COKA 3FXWA 4CT2A 4EJ7A 3VS2A 4WT6A 1YWVA 4V04A 5C27A 5C03A 3LMIA 4XS2A 3BGPA 3HMOA 1S9IA 3VUIA 5ANKA 2XK7A 4DGLC 3CTQA 5CSHA 3G0FA 3HV3A 3TV7A 4TL0A 5K4IA 4G5PA 3SGCA 3R7IA 5JT2A 1CM8A 4C4GA 2PHKA 3ZC5A 2ZVAA 4FA2A 3F3TA 5AV0A 3UIXA 3ZBFA 4YC8A 4BWXA 3Q9YA 5AUXA 1PXIA 4YBKA 4IZAA 4BF2A 3P86A 3QHRA 4L3PA 1GZ8A 2CGXA 4WSYA 3VBWA 2XNGA 4ENYA 4NM5A 4GYGA 2B52A 1WBTA 5A4CA 3CPCA 5AP7A 1JSUA 4WHZA 3D7TA 4HCTA 5JFXA 5C4LA 2C3LA 3D0EA 3KVXA 1T46A 1FGKA 4FSUA 4BYJA 2ZM1A 4R3CA 3VF9A 5KMLA 3F5XA 3N51A 1Q8TA 3ENMA 4MBIA 5DVRA 4UY9A 4DBNA 5IG1A 5IA4A 4R8QA 3PPJA 4IZYA 5AUWA 2J2IB 5FM3A 3PVGA 2PUPA 1ZYLA 2VRXA 1ZARA 4PV0A 4DFLA 3IPHA 2BILB 4LG4A 3R00A 1TKIA 5BUIA 4USFA 3GOPA 4O2ZA 4FKJA 2W5HA 5AUTA 3EJ1A 5IA2A 3SG8A 3EYHA 4QP3A 2Q83A 1OIQA 5J9LA 5CTPA 2YM6A 3O71A 3U4WA 1ZYJA 1OIRA 4NKSA 3O50A 4BCMA 4ZLZA 5KMOA 4DBXA 1LR4A 4Q9ZA 4GS6A 4IX3A 1R1WA 4L68A 4NM7A 3MESA 2C6TA 4UBAA 4AF3A 4E5WA 2X9FA 2QI8A 2XUUA 3DBDA 3ZYAA 3A61A 4FTJA 5CAPA 4CSVA 4AZEA 3FLWA 1DAYA 4IC7A 4MH7A 4QQTA 2GPHA 3V5JA 3MDYA 4TYIA 4EOKA 4FV2A 1H1SA 3ODZX 3MSSA 1R78A 5HE1A 2YIWA 1L8TA 3RM6A 5GJFA 5JSMA 2ITNA 1NA7A 4JIKA 3H4JA 3F61A 2YZLA 2C0OA 4AE6A 2ZMDA 4JG7A 3PXKA 3UGCA 3FY2A 4IZ7A 4WG4A 3PSBA 5LVPA 5L8LA 4ALWA 2WXVA 3U54A 4L8MA 3NUNA 2ZDUA 3ROYA 4AW2A 1JSTA 4GH2A 3VJOA 2IO6A 3DFCB 3JUHA 4ZSJA 4ZTLA 4FICA 4FKLA 3DZQA 2VX0A 2B4SB 2EB2A 3QC4A 4YUQA 4RQKA 3V5TA 5IUIA 2W06A 3SQQA 2YHVA 4P5QA 3OXZA 1ZZLA 2VTQA 4YSJA 3ZM4A 5EYKA 4UX9A 4TNBA 1XHAA 2ZYBA 3JS2A 4I92A 2I40A 2UZUE 4NIFA 5FBNC 3OCBA 2BCJA 2J0JA 3EN5A 3R1SA 4WBOA 3BE9A 3MTLA 4FTQA 3LM5A 3UQCA 4KAOA 2OGVA 4BI0A 1PJKA 1QPCA 3NDMA 3ZLXA 2WD1A 3R1NA 3KCKA 4TPTA 5DLSA 4EOMA 5I5ZA 3ANRA 5HI2A 2WTIA 4WG3A 4Y73A 2OFVA 2CKOA 4NEUA 4TRLA 3FKNA 1U46A 2BMCA 3ULIA 2BVAA 1WZYA 3Q52A 4FOCA 4IIRA 2XNOA 5BMSA 1YDRE 3TI1A 3SOCA 3QUDA 3NVKI 2HZNA 5JGDA 3F7ZA 1U54B 4AAAA 4RJ4A 5BMMA 4QP2A 2X4ZA 4JNWA 1J1CA 4C02A 5A4QA 4BI2A 4DTAA 5D41A 4GT3A 2GMXA 4PTGA 4UN0C 3VVHA 5EYMA 3S0OA 2W7XA 3I6UA 3IW6A 3QX2A 4G5JA 3T9IA 1WBOA 2UZBA 4RVMA 2WMXA 4YC3A 4NJDA 4UV0A 4C2WA 4EH9A 1JSVA 4F65A 3HL7A 4U9AA 5FLFA 3WZUA 4GSBA 5EW3A 2QU6A 3RWPA 3KMUA 4QMWA 1YHVA 4AZTA 1E9HA 2X8DA 3WYYA 2IZSA 4XOZA 3GNIB 3E8NA 4I3ZA 4EWHA 5HCZA 1P5EA 3M1SA 4OW8A 4K1BA 2Z7QA 3DLSA 3FQHA 5EYDA 4U40A 4ZTMA 2UW7A 5E1EA 3WZEA 5DNRA 2DUVA 3PTGA 3TV4A 5BUJA 5AUZA 2UV2A 2ZB1A 4NM3A 4WRGA 3HV6A 1V1KA 5ETFA 4FZ6A 3CD8A 4U3ZA 4AZVA 4ZSAA 4XV3A 5JMSA 4IM0A 1SMHA 3QQFA 4MNEB 1YXUA 3DKFA 5DRDA 3MPAA 1DI9A 2JEDA 2IW6A 3TDVA 3M42A 3GVUA 4QMTA 1W8CA 4LRJA 5ITAA 2UZNA 1P14A 2H9VA 4RJ7A 5D7VA 1WBSA 3BX5A 4KBKA 5IEVA 3MIAA 5JRQA 2XKCA 1BX6A 3G90X 3KMWA 2PVRA 5HG5A 4GL9A 3FZPA 5HIBA 5BYZA 3BYUA 5IQAA 2YJRA 1WBPA 3FYJX 3ORNA 3P9JA 4QP7A 4IVBA 5LWMA 2EVAA 3GBZA 3FLYA 3L9MA 3WF9A 2OI4X 1BMKA 3FYKX 3UOLA 3MIYA 2PYWA 4YZCA 2ZAZA 3UVQA 1VR2A 3DJ7A 4MD7E 2J9MA 5BVWA 3RGFA 5AAGA 2UW4A 3ZU7A 2LAVA 4U80A 1OL5A 3C4FA 4KSPA 4RSSA 3R7OA 2F7XE 3MH0A 3KRXA 3SW4A 3HP2A 4EUTA 3MY1A 4I41A 3WI6A 3QGWA 3MVMA 5A46A 4ANQA 5AFVA 2WNTA 3LCDA 2ZDTA 3Q5IA 3DGKA 4AXAA 2WMQA 5HVJA 3R9OA 5ACBC 4DEHA 3LLAA 1QL6A 3LFSA 2XIXA 3KEXA 4IB1A 5AP2A 2OF2A 1PMVA 4P2KA 4D4VA 4QQCA 4EL9A 4ZY6A 2UUEA 2HIWA 2GQRA 1CKIA 4BTFA 3C7QA 3UOHA 4FKIA 4XLIA 4X3FC 4EOIA 3MI9A 3FSKA 3HV7A 3BHHA 2JGZA 4FL1A 3W2PA 5B0XA 4ANBA 5IU2A 3NUAA 5HNIX 4KUJA 3F6XA 1H07A 4FT3A 3BV3A 4RLLA 1R0EA 3HDMA 3QX4A 2VGPA 4S32A 4UWBA 4RVLA 4I4FA 3QRTA 5BYYA 3U8WA 4DEIA 2Y8OA 3HAVA 4R7HA 3OOMA 4EQCA 4PPBA 5CAUA 1KOBA 3HMNA 3OWJA 2G1TA 1QPJA 4JRVA 5CEOA 1UNGA 3Q4CA 3NUXA 2VTHA 3DB6A 2PWLA 2O0UA 3RK9A 5GNKA 4C33A 5EDRA 3KU2A 4E7WA 5F4NA 4GKIA 1OUYA 2NO3A 3BRBA 3PZEA 1M17A 2F57A 2V22A 2X0GA 2IVTA 2FO0A 2R0IA 1UVRA 3SXSA 2OG8A 1U59A 3FDNA 4AUAA 5L2IA 2PPQA 3W2RA 3SAYA 5BVFA 3EQFA 2R3FA 3NWWA 3OVVA 3BU6A 3F88A 4QMZA 4CRLA 2YLEA 4ZAUA 2G2IA 5CENA 3RPOA 4NM0A 1UKHA 1GAGA 4HNIA 4O22A 4QP4A 3K5VA 5CZHA 4BDJA 4BHNA 2PSQA 2X4FA 1REJA 2DWBA 2GFSA 4UWCA 5TT7A 5DGZA 3FXZA 4DAWA 1OPJA 2F7ZE 5HOAA 3NUUA 4A9RA 4NFNA 5EKOA 4BY9E 3C4ZA 3QC9A 3WIGA 4DH8A 4NT4A 4RLKA 1YRPA 3O8TA 4WIHA 1IA8A 3FKLA 3Q5ZA 1ZAOA 4YJRA 3A7IA 3BGZA 1IAJA 1PF8A 3SXFA 1APME 4YMJA 2BDJA 5JFVA 2F7EE 3MJ2A 3ALOA 5DOSA 5GJGA 2YM5A 2X2MA 3PY3A 3E7OA 3D5WA 5EDPA 3IW4A 2W05A 3BZ3A 3O51A 3QL8A 3G9NA 3UP2A 3RNIA 5FUTA 4BN1A 1Q24A 4BCQA 4DA5A 3LCKA 1PW2A 4PNIA 2OJJA 2UW9A 1NVSA 4YPSA 3UOJA 2GQGA 4D2PA 4ALUA 4M15A 2W5AA 4FSYA 5L3AA 5LQFA 1J7LA 2YCQA 2G01A 3QQUA 4HGSA 4BTKA 5CF4A 4C4EA 3FMNA 4Y85A 1PXKA 5FDXA 4A06A 4XH6A 4M66A 3PYYA 3OT8A 3PE2A 3EFKA 3WYXA 1SVHA 4QPAA 5IKWA 1PKGA 3EMGA 4DFXE 2VUWA 2PL0A 4FVPA 4R7IA 3KRLA 3K2LA 4GK3A 5FQDC 3E3BX 4ZJIA 1VJYA 3DT1A 3PWYA 3QF9A 5ETAA 1AQ1A 4CMOA 3PDTA 4EOPA 3V5WA 3ZO1A 1OKYA 3NAYA 3EKNA 2PE1A 3H0YA 2HWPA 3EQHA 4KB8A 5DR9A 4IWQA 2VO7A 2R3RA 4G17A 5JH6A 1H24A 4RX7A 3R01A 3LQ5A 1WMKA 2VWUA 4NCTA 4JBQA 4NH1A 2WTKC 4U6RA 2CDZA 2WFYA 4AW5A 4BBEA 5ICPA 2R64A 5JK3A 2BALA 1U54A 4H3PA 5GZAA 2WTJA 4XV1A 3Q2JA 3ITZA 3KKVA 4TYEA 4RRVA 4R3RA 3Q9ZA 4L44A 5GJDA 4DLIA 3ORXA 5C8KA 4XG3A 3KRJA 1GIHA 3KB7A 3LCSA 5EOLA 3V3VA 3DNEA 3VHEA 5CI7A 3LPBA 3MB6A 2C3IB 4M3QA 3UZPA 2R3QA 3ZFXA 2IW9A 4AGCA 4FKPA 4GUEA 5CY3A 4F9YA 3DPKA 5HG8A 4ZJVA 4F1TA 5C4KA 4CZYB 3IS5A 3UBDA 4QYHA 4FV8A 4XCUA 3WZKA 4JR3A 2AC5A 4I0SA 1XH9A 3NS9A 4FIEA 3ZLYA 5KX8A 3D94A 4ZY5A 4U41A 3BQCA 4FUYA 4GFGA 4LMNA 4YJVA 1XBAA 3ZHPC 4QMXA 2X7OA 4HVHA 3RPSA 5LVMA 4F1MA 3O2MA 4I6QA 4EBVA 3GEQA 3O7LD 4WO5A 3ENHA 1WBWA 3R30A 3KY2A 4DT8A 4MNEA 5AV1A 2VTRA 3AMYA 2PE2A 5AAEA 3OW3A 4FGRA 1JPAA 2GS7A 4IVDA 4O1PA 5ANJA 4C37A 4DH5A 4IE9A 3RINA 1OITA 2YERA 3G5DA 3B2WA 3LKMA 1H27A 2BUJA 3OY1A 4FT5A 4AGWA 3POOA 5DPVA 3TV6A 3MVLA 4RX5A 5LMKC 5E9EA 1MRUA 4F4PA 4EORA 2IZTA 4CLIA 3DY7A 3F7WA 5ANIA 2V0DA 1Q3DA 2J6MA 2XCKA 3IQ7A 3VBYA 4DCEA 3UG2A 4BKJA 2UZVA 1Q4LA 4GEOA 2HWOA 5HX6A 2PVNA 4U45A 3UO4A 4RFZA 3JR1A 4X7QA 4O21A 4CZUA 1ZOHA 4O0XA 4D4SA 4L53A 4UB7A 3DNDA 1YXTA 4DINA 3ZDUA 4J96A 4M8TA 4RFMA 2W4KA 1WVXA 3M11A 3IW7A 4G2FA 4OUCA 3EFJA 2RG5A 4HPUE 1YOJA 4FUXA 1W98A 5A4EA 4IH8A 5HTBA 3TNIA 2ZJWA 4RIWB 4N57A 3VBTA 3FLZA 2R3HA 3NVMB 3EWHA 2J5EA 5M44A 5FEQA 4L7FA 5L2SA 4JOAA 3U6JA 3CSVA 4YC6A 4UALA 3FMEA 4BKZA 3V5PA 1G8SA 4ZMEA 3PG1A 1W82A 3NUSA 2HY81 3UODA 1MRYA 2HXLA 4YPDA 3PXQA 4NW5A 4RWLA 3IGOA 4DFNA 4Y5QA 4R77A 3LMHA 5HE0A 3UNZA 1YXXA 2NRYA 4QO9A 1OGUA 3LFEA 4AGDA 2WTDA 4IVAA 2CNVA 4DCAA 3DQWA 3QWKA 4KKHA 3OWKA 4ZXTA 3QRUA 2VTOA 3AC4A 5DFPA 2XM8A 3Q4ZA 3COMA 5AM6A 3LXLA 3VUHA 3AMBA 3FI2A 4UYNA 4YHTA 4LGHA 1SNUA 4I24A 4GW8A 4IW0A 4YZBA 2KTYA 4BB4A 5CASA 4CVAA 3UPZA 5A6NA 1FVVA 5D12A 4F9WA 5AADA 2PVHA 3OT3A 3TL8A 1VYZA 4WNOA 2JC6A 4KBAA 2RFEA 3A7GA 2GTNA 5GHVA 4XEYA 3JY9A 3MVJA 4E1ZA 3W2OA 1XH8A 3AT2A 2W9ZB 3ATSA 4RA4A 2BDWA 4RQVA 4TT7A 3G2FA 2OXXA 4MEDA 3TZ9A 5DIAA 1B6CB 2C5XA 2W17A 3PIYA 1XO2B 2G2HA 1Z9XA 3CBLA 3DFAA 3EH9A 2YISA 2R3LA 1ZYCA 2GS2A 2BRHA 4F0IA 2JKQA 4ZTRA 3F66A 5HTCA 1X8BA 3U55A 3ZONA 1YOLA 4EH7A 4D9TA 2XJ1A 3CPBA 2YM8A 3BEAA 3IDCA 2R2PA 3AD6A 3LE6A 4GJ2A 5EFQA 4ZTQA 4I0TA 4GJ3A 5CI6A 3DA6A 2XJ2A 5JZJA 3D5XA 3CJFA 4C59A 5EM7A 2RFDA 2RIOA 3PG3A 4K33A 4LV5A 4X2KA 4NTTA 2QHNA 2YABA 1JVPP 5EI6A 2UVYA 2BRMA 4YSMA 4H36A 2WO6A 4ZP5A 4D9UA 4N0SA 3A4PA 2BRBA 2QODA 5CXHA 5KKRC 1NXKA 4BC6A 2C68A 2C3KA 3O7LB 3GCVA 2ITUA 4IM2A 4C62A 5J5TA 3G15A 5AR3A 3GC7A 1BL7A 3I81A 3COIA 2Z02A 1HCKA 3T8OA 1KE5A 4IAFA 4J97A 3LFCA 4FV9A 1W83A 2B55A 4IHPA 4GG5A 4BGGA 4PP9A 4KRDA 5CSVA 3ZZEA 2C6IA 4XX9A 3WZJA 1H01A 2Z7SA 3ZUVA 2I7QA 1KE8A 3UZTA 3VWAA 4L42A 4IB0A 2Y0AA 2QLQA 4FSRA 4IMYA 1URWA 4MYGA 4LMUA 4CYJA 4YTCA 4F0FA 1OIUA 4C0TA 5IH6A 3QXPA 3CLYA 4L45A 5ETIA 2OJ9A 4Q9SA 4CFFA 4CV8A 3MS9A 3P78A 4DEDA 2OKRA 3KN6A 3BBTB 3E8DA 1FVTA 4E6CA 2P0CA 5AP5A 3SD0A 1XQZA 4JT3A 3WIKA 4FG9A 2WB8A 2BR1A 3V8TA 4DITA 3V6RA 2I0HA 4LRMA 5F95A 2ZV9A 1T45A 4YP8A 2Y6MA 4IAKA 4PDSA 4UMPA 4M67A 3IONA 5AP0A 5F94A 4HOKA 4ACHA 5K5NA 4F63A 5HQ0A 3UQGA 3PFQA 3FMMA 5AUUA 1OKWA 2CLQA 5DEYA 3BHTA 3PJ3A 2UZLA 3EQIA 3LIJA 3TZ7A 4WKQA 3C9WA 4C3RA 3R04A 3VJNA 5E8XA 3MFUA 5A6OA 1UU8A 4MCVA 2B53A 3GC8A 3NR9A 4KIPA 4RIYB 4QP1A 3QA8A 5DT3A 3R9NA 4J7BA 3V01A 4G1WA 1OZ1A 4EEVA 4YZMA 4DH1A 3VBXA 3FI4A 2B54A 3LXKA 4LI5A 2ZV7A 5ETCA 1ZY4A 3GC0A 1PYXA 3II5A 3QRJA 4HVGA 4RX8A 3ZH8A 3LLTA 2XZSA 3VBVA 4EHVA 3NNXA 4K2RA 2WQBA 4LGDA 2O5KA 3HECA 2H34A 4BDGA 2PZYA 5L8KA 3FMKA 4X3FB 4JBPA 2EWAA 2QOKA 2JIIA 2UVXA 1U5RA 3O8PA 4XP2A 4YZ9A 1JKTA 4FTAA 3BWJA 3HUBA 1BKXA 2CLXA 4QYFA 3UPXA 4DEEA 3D83A 3GFWA 2PZ5A 3B8QA 4M97A 1SVEA 3PRFA 4W4XA 3TKHA 1UV5A 2VV9A 2XNPA 4JLCA 3H30A 4U5JA 2WIPA 5IA0A 2R3JA 5K3YA 2A19B 5HVYA 4F6WA 2XMYA 4QNYA 2VTIA 3EZRA 4PNKA 4QP9A 3K5UA 4E73A 4K6ZA 4RZWA 3HRBA 4Q2AA 2ZB0A 4YNOA 2QOOA 4PDOA 1OL1A 4QPMA 2OIDA 3KXHA 3C51A 3ZFYA 4RWJA 4W8EA 4DGNA 3DJ6A 4KSQA 3H9OA 4E20A 2UW0A 4IDVA 2PTKA 2ZV8A 3PXFA 4S33A 4BICA 5LWNA 4BCPA 3DCVA 4ID7A 3VN9A 5CVHA 3TCPA 2VWIA 4X2JA 5HO7A 3A99A 4HJOA 4FV7A 2BAJA 3HMPA 3RCDA 4C38A 2QD9A 3AGLA 2NNWB 1WBNA 1OM1A 1P4FA 4FTOA 3AG9A 3OXIA 4KINA 2ETKA 1BI7A 4RIWA 1OMWA 3ZDIA 2BPMA 4S31A 3HV4A 1XJDA 3K3IA 4R1VA 4BCIA 3Q3BA 4YJOA 5TF9A 2RG6A 3NYVA 3F9NA 2VTAA 3ORMA 2VD5A 1WCCA 3L9NA 4X3JA 1MUOA 3TM0A 2CGUA 3KFAA 4DN5A 2E9OA 2JLDA 3FEGA 2ZM4A 3AQVA 2F9GA 5CAVA 5CU3A 2C1BA 1Q8WA 3V51A 2QG7A 4XG9A 1MRVA 5CU0A 4YTIA 3BGQA 3EQDA 3RZBA 4D2RA 4J53A 4BTJA 4QPSA 2XK8A 4OTFA 4KNBA 5FTGA 2JDSA 3TDWA 3BCEA 1STCE 2ZV2A 1NVQA 5E8VA 4JX7A 3ZTXA 4O7WA 5CWZA 1QMZA 4FT0A 4O7TA 3AD5A 2IW8A 3OBGA 4OBOA 3CQEA 5AP4A 2JAVA 2JFLA 4FZDB 4GRBA 5FP5A 4MXZA 2RFNA 4O96A 4LV8A 3ULZA 3W10A 4ASZA 4GT5A 2A0CX 3QRIA 5AP1A 2BHEA 4C61A 1M2RA 3ZSHA 4C4JA 5M57A 3AT3A 3FI3A 2Z2WA 3CIKA 3OG7A 5HE3A 4CFWA 4A07A 4QYGA 3FY0A 3QALE 4FYOA 5CU4A 3R7UA 4FIGA 3VS0A 5CS6A 2QQ7A 2QO7A 3QKKA 2R0UA 5LVLA 4B8LA 3UIMA 3AC5A 2Z60A 3QTWA 3OXTA 1CSNA 4O0YA 5HBHA 3HRFA 1PXPA 3MA6A 5D9HA 3FPMA 3HNGA 2E9PA 1W84A 1GZKA 3DKGA 1YXSA 3HZTA 4OTQA 5BUEA 5IQCA 4BKYA 5K0KA 4D2VA 4N6ZA 5GZ8A 3C4XA 4O7YA 2W4OA 1BLXA 4TN6A 5H8GA 2QOHA 3VRYA 3VUDA 4RJ5A 5AV4A 3E8CA 3VS6A 4DYMA 4J8NA 5EI2A 2VWYA 4I94A 3R9HA 2WTKB 2HZIA 4FTRA 2R5TA 4HVIA 3C13A 3GU6A 3MW1A 3SDJA 3QLGA 5CF6A 4QP8A 5J7HA 1M52A 4YHFA 4HZRA 3SXRA 1G8AA 4I22A 5CQWA 3SRVB 3WOWA 2OLCA 4O0RA 5I4NA 3L9LA 3EL8A 1ZXEA 4AS0A 4JX3A 3LMGA 4JJRA 3ODYX 4O38A 4LFIA 4K11A 4PQNA 1JKLA 2A4LA 2ETMA 3OROA 4XYFA 4B0GA 3F3VA 4O0TA 5AA8A 5M55A 4FTLA 3OCGA 2GU8A 4EH2A 4F7LA 4Y95A 3ZBXA 4DHFA 3EL7A 4J95A 3H9FA 4JQ8A 4F9AA 1YI3A 3I0OA 4L7SA 3KXMA 4QRCA 5CEKA 1H25A 2OFUA 2WQNA 4W9WA 4XRLA 2WMBA 4GFOA 3EQBA 5FBOA 2AYPA 2IVUA 3R2BA 3R7EA 1FGIA 2OK1A 4GIIA 1W0XC 4H58A 4IB5A 5EYCA 2XRWA 5L4QA 3R7VA 5L6OA 4IEBA 3D9VA 4OTPA 3U51A 2X9EA 5FEDA 4CXAA 4DH3A 5HCYA 2QG5A 3RK5A 5CXZA 1QPDA 3CR0A 2QCSA 4L9IA 4W9XA 4IX5A 3GCUA 2YDKA 1OUKA 3E5AA 4O81A 5CEMA 5EM8A 4DE4A 5AP6A 1DI8A 2W1FA 4WUNA 4D58A 2ERKA 5C26A 1M7NA 3D15A 3NX8A 3FWQA 3ETAA 4E6DA 4UZHA 4DG0E 4TWOA 4RIOA 5T3QA 3UVPA 4BTMA 1KE7A 3MY0A 3NW7A 3CC6A 5HO6A 2LGCA 2PZRA 3CKWA 5K5XA 2PUIA 4JDJA 3FMDA 1M14A 3KGAA 4TY1A 4BCJA 5AIKA 5CU2A 5KO1A 3VW8A 2A1AB 3CEKA 4JIAA 3TT0A 4LYNA 4JG8A 4O0WA 2SRCA 1KE6A 3B8RA 5CEIA 5LJJA 4GFMA 3F82A 3M2WA 4FV4A 3L8SA 3R02A 2QOCA 3L9PA 3F5PA 3TTIA 3HX4A 5FG8A 4RIYA 3W16A 4S2ZA 5EH0A 3R8PA 1H00A 3GU8A 1NVRA 5CALA 4AA4A 4MXXA 5DBXA 4ZIMA 4E26A 4D0WA 4PP7A 2PVJA 3A62A 4DFUA 5DYJA 4X2GA 1PXLA 2B1PA 4YBJA 3PIZA 3FL4A 3LOKA 5CSXA 2WMWA 3SX9A 5FXRA 3QD2B 3SVVA 4WBBB 4X3FA 1PRYA 2J0LA 4FT7A 5DWRA 3GFEA 4IX4A 4A4XA 4ACGA 3A2CA 5HLPA 4BYIA 3QQJA 4GUBA 4Y5HA 2VNYA 3WE8A 4PDYA 4PMPA 3R8MA 4I4EA 2F2UA 1RW8A 2QKRA 2OJFE 3MBLA 4MXCA 4JBVA 5AIRA 5EG3A 4BCOA 4C7TA 4YR8A 4BZDA 4DC2A 4FTMA 2HW7A 2C6OA 3DKOA 3QCXA 1TQIA 4EOQA 3Q53A 4KS7A 5IUGA 1JKKA 5HESA 2W1ZA 3IW8A 5T6KA 3E88A 3RBWA 4BIBA 2H96A 1IR3A 4RJ3A 3UOKA 1LP4A 1REKA 4CNHA 3D14A 3N4TA 4A9UA 4AOIA 2Y4IB 3UMXA 3OW4A 4FTTA 5AX3A 5I3RA 4D2WA 3B2TA 5M4IA 2QLUA 4IJ9A 1H1WA 1XKKA 2PVMA 4XJ0A 4ACMA 4DG3E 1URCA 3BELA 3TNWA 5ANGA 4EOLA 3VBQA 2B9FA 3PLSA 3MPTA 4GG7A 4LOQA 4DTKA 2WHBA 3PPKA 5D7AA 5DG5A 2AUHA 3AC1A 4QQJA 3KXNA 5EOBA 2C6LA 4HYHA 3R71A 5FXQA 4NZWB 1NT2A 3FZRA 3QA0A 1Q62A 1JBPE 4P90A 5HGIA 4EOJA 3I0QA 1K3AA 5HTIA 4E4NA 1ERKA 5KMIA 2EXCX 3ALNA 4M0YA 1Q3WA 4PWNA 4N6YA 4ZEGA 3ZXZA 1YDSE 3QD4A 3V8WA 1G5SA 1MP8A 3C0GA 5HE2A 2REIA 5M06A 3W1FA 3FBVA 3DAEA 4RC4A 4R5YA 2ONLA 4BVUA 2WU7A 4PDPA 4XUFA 4GIHA 4HCVA 2C3JA 2WGJA 5KKRB 3BYMA 2VO3A 4KKEA 2C5NA 4LOPA 2C5OA 3ORZA 4AFJA 4C36A 1FINA 2WPAA 2YIXA 1S9JA 2GNGA 2P2IA 3HEGA 4TTHB 3R7YA 3N9XA 2WTVA 2JDRA 2J4ZA 5HX8A 3KF4A 2CKQA 4PL4A 4DTBA 2C5VA 3A8XA 3G33A 3NW5A 4IFGA 1J1BA 4EBWA 4ANMA 3ZC6A 4M69B 4RVTA 2VTNA 4X6RA 3QUEA 2ERZE 3FI8A 1Q8ZA 3O0GA 4KRCA 5HIEA 5CANA 4KIKA 1FBNA 2V55A 3EHAA 2R3MA 5AR7A 3R8ZA 3FZ1A 4O7ZA 4MHAA 2QO2A 4IJPA 2PY3A 2FVDA 2OZOA 2PZPA 3ZUUA 2XJ0A 4G6LA 4EUUA 4Z7HA 3IO7A 5M07A 1YDTE 3JVSA 2YFXA 4W4WA 4IADA 3R7GA 3CY2A 1BL6A 3QU0A 3WBLA 2JIUA 3ZFMA 2NPQA 4IANA 2WKMA 3AOXA 4D0XA 3LFBA 4FV6A 2UZEA 1XH4A 3FC1X 4FNXA 5IA3A 4QTEA 2ITQA 2QR7A 5AP3A 1PY5A 2HENA 2WTCA 4EK6A 2XEZA 4TYHB 2HZ0A 4QT1A 4ZZOA 3KXZA 4DEGA 4FG8A 2W1DA 3PY0A 4RG0A 3A60A 5AR4A 4BI1A 1ZMWA 3P79A 2JIVA 1XWSA 3NNVA 3SRVA 3O8UA 5EI8A 2OU7A 2YDIA 3ZMMA 2YJSA 2C47A 2VX3A 1R3CA 4JQ7A 3MB7A 4JQEA 4MQ1A 4S34A 5A4LA 2FYSA 5B2LA 4GKHA 4DEBA 4D1XA 4MXOA 4NFMA 5CT7A 1XBBA 3R22A 4MNFA 1PXOA 2ETRA 2YCFA 4J52A 2W9FB 2WU6A 5JKGA 4OTGA 1IASA 2CPKE 2ITYA 2VWWA 3Q04A 3R6XA 2G9XA 1YI6A 2YZAA 5M56A 3P23A 2CGWA 4GU9A 1R39A 4QMYA 4C4FA 5L6WL 4XMOA 1OKZA 5TOZA 1UNLA 1TQPA 3QD3A 4G9RA 3RMFA 3VO3A 3W32A 1Y6BA 3DBEA 3ORPA 3FKOA 5IDPA 4BZOA 4GVAA 1FMOE 5CVGA 5AWMA 2R4BA 4AN2A 1ZZ2A 1BYGA 1P2AA 2FSLX 3UYSA 5LMKA 4U44A 4EONA 4R6VA 2XF0A 5BVDA 4RZVA 3C4CA 5AEPA 5CSPA 1O9UA 4NYEA 5E92A 4FZAB 4EH3A 1OIYA 2RL5A 4O2PA 3I7CA 5HZNA 5JFWA 4FSMA 5C8MA 4B99A 2I0EA 4QMVA 1U4DA 2WELA 1XH7A 4PUZA 2XIRA 3GU7A 5J5SA 4CFUA 2OXDA 4IBMA 4MF0A 2R9SA 5LOHA 1F5QA 3BI6A 3I60A 2VZ6A 5HLNA 2QOLA 4JAJA 4AWIA 2CCIA 1YW2A 1PXMA 2WTWA 3E62A 3GQIA 3FLNC 3JYAA 4MD8E 3ZCLA 3QTXA 4NJ3A 1DAWA 4B7TA 4QMSA 3DLZA 4N4SA 2OF4A 2VNWA 5EHYA 4BDDA 5BX0A 4L67A 4YZNA 3TIZA 4E6AA 1UU9A 2XIKA 4YGAA 1J7IA 1KUTA 5GIOE 3HYHA 4E8AA 4BDHA 4EZ3A 4UMTA 3RCJA 2YIRA 4QMOA 3R1YA 4DGMA 3QCSA 4QQ5A 1M7QA 4BDAA 3NW6A 3R83A 1PHKA 1XH5A 2QONA 5CT0A 3ACKA 3F5UA 3U9CA 3RPRA 5M51A 4NCTC 4RC2A 3V8SA 2XKDA 3GC9A 2VO0A 4ASXA 2UW5A 4RT7A 4BDFA 1K2PA 2QNJA 2PULA 2YN8A 3P0MA 4K18A 2GNIA 4AT3A 3OWPA 3U6IA 3H9RA 3BLQA 5EM6A 3KRWA 1PMEA 2Q0BA 4W4VA 2EXEA 5H3QA 3ZUTA 2VWBA 4D5HA 4Z3VA 5I0BA 5J95A 3ID6C 3DKCA 3ZRLA 3SLSA 1QPEA 3BHVA 3C0HA 5M4FA 5EW9A 2VWXA 3LJ1A 1JLUE 3MFRA 4XRJA 3CJGA 4HVSA 3IK3A 3G9LX 4YJQA 3CGOA 4D2TA 3VS1A 3SHEA 4O7VA 2YAAA 3G6HA 5DR2A 4YURA 1A48A 3KK8A 3UO6A 3FV8A 1VEBA 1AGWA 3RK7A 3U6HA 3KF7A 3NEWA 3PA5A 3TJDA 4XP0A 3QWJA 2XNBA 3FZTA 3OWLA 5HNGA 4BCKA 4FV0A 4EH4A 3DK6A 2YITA 1XH6A 3E64A 4NUSA 3QD0A 3QTRA 2WMAA 5E8SA 4DGGA 2XNMA 2OH4A 2OXYA 5I9UA 4DFBA 5E8TA 5L2QA 3G51A 4HCUA 1H4LA 1MQBA 3KVWA 3VQHA 1YVJA 3TXOA 3LW0A 4F09A 3TJCA 3GUBA 1PKDA 3SOAA 1Q8YA 4FKWA 3FE3A 1Z5MA 4TNDA 4G3CA 2OJIA 2DYLA 2UW3A 2XCHA 3FHIA 5AR2A 4ACDA 2ITOA 3GOKA 3RTPA 4MK0A 1OL2A 4DEAA 4I6BA 4ITIA 4HYSA 5AJQA 3ZLSA 4LQMA 3CE3A 3Q9XA 4AW1A 4NKAA 3F2RA 4HGLA 2PVKA 3H0ZA 3BEGA 2WAJA 4AZFA 4QMNA 4ZLOA 3PVWA 2GTMA 4IX6A 4I1ZA 4ZZMA 4ALVA 4ZTHA 4R78A 3IW5A 4YTHA 1FPUA 3EQPA 4PRJA 3V04A 2BZIB 2AC3A 4EZ7A 4X2FA 3MJ1A 1Z57A 3ZO2A 2R7IA 5FWKK 1Y57A 4IAAA 2HXQA 4FTNA 4M69A 5CLPA 2X2LA 5DRBA 3VC4A 3W18A 3DXQA 4MTAA 2CN5A 4Z9LA 4RPVA 4FZ7A 2ZM3A 4I20A 3QTZA 2XK6A 3GB2A 4ERKA 4JDKA 4C57A 5B2MA 2PUNA 1V0OA 2QO9A 5LMBA 2DS1A 4BFMA 3PY1A 4RVKA 2NP8A 4FBXA 3P4KA 4AG8A 4GK2A 4TZRA 5D1JA 4BBMA 2YACA 4KS8A 3EFWA 2BTRA 4WOVA 1Q97A 5HHWA 4FK3A 4FNWA 4CMUA 4U81A 2OBJA 3MV5A 3A4OX 2PUUA 4PMMA 4D4RA 5CEPA 4M84A 4TYHA 4B9DA 4U0IA 3GT8A 4JR7A 2P33A 3NCZA 1JOWB 5EHOA 5EQPA 2J50A 2W96B 5E8UA 1LEWA 4FKRA 3KN5A 5E8ZA 3QRKA 2C30A 3DU8A 4FKTA 4G3EA 3AXWA 3EKKA 3Q4UA 4I5MA 5FTOA 3FC2A 2C1AA 1OL6A 4V0GB 4F64A 4C4HA 4FSZA 2BZHB 4E3CA 3QTQA 3VQUA 3DB8A 2O8YA 2FGIA 4IZ5A 3D7ZA 3PJCA 4LL0A 4JDIA 5HBEA 5I3OA 4WNKA 4C58A 4AOJA 3EQCA 3MA3A 3NYOA 4G34A 3ZO3A 5HG7A 4X6QC 2XIYA 3VS7A 4RFYA 2XNNA 5JN2A 2W1EA 5AUYA 3I6WA 3LJ2A 3UNJA 2UVZA 1H08A 3U9NA 2OIQA 1UKIA 5JRSA 1Y91A 2X2KA 4MXYA 4OBPA 3WF7A 4ASDA 4MQ2A 3PRIA 5BPYA 3JY0A 3C0IA 3BKBA 3RALA 4D1ZA 2I1MA 4AZSA 2HOGA 2R3KA 2J51A 5DR6A 5ANOA 1KE9A 3CCNA 3PVBA 3POZA 2R7BA 3BV2A 3DBFA 3KA0A 4CEGA 3MH2A 5IISA 2W1CA 2BIKB 3OEFX 4RIXB 3ZLWA 3C4WA 2FA2A 4AQCA 2JD5A 4JVGA 4BGHA 4R7BA 1ZYSA 4I5PA 2V5QA 4PY1A 2YA9A 2UZDA 3QQLA 2OIBA 4WRSA 5AV2A 3DK7A 3FUPA 2X81A 3D5VA 4UWYA 5HU3A 2GS6A 4F7NA 1TQMA 2VX1A 4O82A 4OT5A 1J7UA 3ZO4A 1W7HA 4ZZNA 3QZFA 4UMRA 2W99B 4PPCA 1NY3A 4OTHA 1FVRA 2VO6A 3VS4A 2F2CB 3ET7A 4FKQA 3Q96A 4CFVA 4ZLYA 2JKKA 2C0IA 1H0WA 4FG7A 4YNEA 3FZOA 3HVCA 3PJ8A 3OS3A 2W1GA 4W4YA 2E9VA 2I0VA 3PA3A 2R3IA 2C6MA 3LAUA 2HW6A 4EH6A 4DGOA 3AC3A 3L8PA 2VWVA 3RWQA 4X21A 4A9TA 4OTDA 2C6DA 2ITWA 3ELJA 4OGRA 4H1JA 5CVFA 5H8BA 5ACKA 3UJGA 3IECA 3QZGA 3WE4A 4O27B 4A4LA 3IKAA 5A54A 4QMLA 3QYWA 4FEUA 4WSQA 3Q2MA 4XLVA 2GCDA 4O84A 1LEZA 3CTJA 3E3PA 2XS0A 4E5BA 4USDA 2CNQA 4CGAA 3TNPC 4ASEA 5HU9A 3CXWA 3K54A 1OI9A 2ITZA 2J0MB 2XEYA 4FSQA 5IH5A 4M68A 5DI1A 2VTJA 2YDJA 3TNQB 1U5QA 3U87A 3EN9A 4XP3A 2YM3A 3RM7A 3IG7A 3VS5A 4EOOA
chains in the Genus database with same CATH superfamily
3K3JA 3ZRKA 2C6KA 4BCNA 4U79A 2P2HA 5IQHA 3P1AA 2PE0A 4YO4A 3RPVA 2XAMA 4QNAA 3VUKA 1Q5KA 5KBRA 5TO8A 3CTHA 4FTIA 4O0VA 4NSTA 4F6UA 1RDQE 3FMJA 1Y6AA 3KULB 4BWKA 1LPUA 2IN6A 1P4OA 4FF8A 5LCKA 3RHXA 2ITXA 4BIEA 4DFZE 1OL7A 3LZBA 4FEQA 2J0KA 3MYGA 3QQHA 4GMYA 4XG2A 2C0TA 1KV1A 3RPYA 1YHWA 3BLAA 2VWZA 2ITVA 3L1SA 4H05A 2E2BA 2XK9A 3BYOA 3DBCA 4UMQA 5HICA 3A7JA 5HD7A 2CNUA 2JDTA 1W2CA 5HO8A 4E5AX 1ZLTA 4F99A 3Q6WA 4O7LA 4FIFA 1H28A 3L8VA 4OR5A 2XIZA 4F7SA 2QU5A 3E87A 3TN8A 3ML1A 5GZ9A 4EKKA 4EC8A 3EQGA 3T3VA 3T9TA 3VIDA 5J7BA 2X39A 2B7AA 3QKLA 4PL3A 3FZSA 5EKNA 5IF1A 3P08A 4FC0A 1OBGA 5HKMA 3VUMA 4I6HA 3PJ2A 4O0SA 3TZ8A 4Y46A 4QTAA 2XYNA 3RKBA 4RJ8A 3UC4A 3NGAA 3LFFA 3WARA 3Q6UA 5JEBA 4KIKB 3EIDA 5EW8A 2R3OA 3DDPA 4EWQA 2BTSA 2VTLA 2XYUA 2EU9A 2F49A 2BKKA 1CMKE 4GU6A 3QLFA 5FD2A 2FSOX 5L6PA 1LUFA 4BDCA 4XG8A 3F5GA 3PXZA 2ACXA 2JAMA 4ZJJA 1ZYDA 5E4HA 5JFSA 3F3UA 4ANNA 4CTCA 2H6DA 4EQMA 3IDPA 3PVUA 2UZTA 4KKGA 3VHKA 2BRNA 3GENA 5DH3A 4KA3A 4KIOA 2BFXA 5C9CA 2IJMA 4MBLA 5D10A 3CQWA 5E91A 4ZSLA 5KE0A 3R28A 3P7AA 2BAQA 3HP5A 4JDHA 1IEPA 3OUNB 1Y8GA 4IB3A 3UO5A 3KK9A 4ZK5A 5A9UA 3VAPA 4AXDA 3R2YA 2B9HA 3AC2A 1F0QA 4LOOA 5F20A 3UIUA 4F1OA 4HW7A 5KMKA 3NAXA 3FHRA 4YJTA 3BBWA 4O83A 3OZ6A 1A9UA 4J98A 4HVDA 2W1HA 2XKFA 4OBQA 3E93A 5B2KA 3FPQA 5C1QB 4G6NA 3GP0A 3RAIA 4JG6A 4CCBA 4IM3A 2C6EA 3EYGA 2Y6OA 4P7EA 5CZIA 3S1HA 3QZIA 2VTPA 2BDFA 2IVSA 4K0YA 3SW7A 3TIYA 4BRXA 1ND4A 1CDKA 3BYVA 3QTUA 4CKIA 5FTQA 2HY0A 2XK4A 4EK8A 2IPXA 5IEXA 2PVLA 5FP6A 2B0QA 2CKEA 4U8ZA 1B38A 2GNHA 4QYEA 4BCHA 4DLJA 4L43A 4E93A 4XNEA 5IA5A 4F7JA 3W2CA 2VTTA 3FAAA 2OJGA 3DBQA 4J71A 4LRKA 4YJPA 1M2QA 4K9YA 4EKLA 5M09A 3BE2A 4FL2A 1JNKA 4PX6A 4UEUA 5E7RA 3W2SA 4F6SA 3TUDA 4FEXA 3ERKA 4RC3A 3UDSA 5IQDA 3R0TA 4BL1A 4L6QA 4BDKA 3GCQA 4V0GA 3DQXA 4JAIA 2R3PA 5DE2A 2NRUA 3PPZA 4HYUA 5F9EA 3W55A 4FOBA 4AXCA 3E7VA 3WF8A 1H0VA 1F3MC 4JRNA 5E1SA 3UDBA 3I5NA 5EK7A 2YCRA 5EQEA 4FKVA 2QOFA 4MAOA 2XNEA 3G6GA 4LUDA 4WG5A 4XHKB 1ZOGA 4D55A 3EB0A 3FMHA 4MD9E 4IWOA 1O6KA 4O86A 3PP0A 3QAME 4CCUA 3ZXTA 1OBDA 4C2VA 5DN3A 4IACA 3C1XA 4FVQA 2ITPA 5DT4A 5E8YA 2CCHA 2QR8A 4UZDA 4GK4A 2EB3A 4AN9A 4HGEA 4AW0A 3UVRA 4O7SA 1PYEA 4FX3A 3U4UA 3N4VA 3PJ1A 4FJVA 3JXWA 2X7FA 4P4CA 2OW3A 5H9BA 3OTVA 2P55A 2HCKA 3SA0A 4RIXA 1WVYA 3IGGA 4S30A 5TKDA 4ANLA 4BZNA 4EHEA 2X8IA 4F08A 4ORKA 4HNFA 2BAKA 3ZOSA 1HOWA 1H26A 4L46A 4AA0A 3KIOC 5IQGA 1G3NA 3RJCA 2PZIA 3ZSGA 4ZTNA 1I44A 5BYLA 1Y8YA 2GHLA 2J7TA 4KABA 5IQBA 5LVOA 1BI8A 3PP1A 1O6LA 4UMUA 4XBUA 5I9WA 4H3QA 4E6QA 2FUMA 4ITHA 2PK9A 4A9SA 4OT6A 5ANDA 3OCSA 4IFCA 4FMQA 4EK3A 1RQQA 1A06A 3C50A 4V01A 1J3HA 3COHA 3CS9A 3HKOA 4IDTA 4U7ZA 4BCFA 3KREA 3N4UA 1IG1A 3D5UA 1Q61A 2YM4A 4FSTA 1YQJA 4L3LA 2V7AA 5JGBA 5FGKA 1OGYA 2IG7A 3UYTA 5LVNA 3SKCA 4YO6A 4WD5A 3WF6A 4XOYA 3NSZA 4XV9A 2WQMA 4AGUA 4D4YA 5CYIA 2VN9A 5HORA 4C3PA 1RE8A 5IPJA 3UNKA 3UZRA 1YKRA 3LCOA 3TUCA 3CQUA 2W5BA 4FIIA 1XBCA 3DTWA 3QTIA 3R8VA 5I9YA 3NFFB 4BR3A 3S4QA 2FB8A 2OZAB 5JGAA 2BHHA 4D2SA 4EQUA 1XMLA 1V0BA 3QXOA 2HZ4A 3TKIA 3PLAE 3R73A 5A14A 3OMVA 2EUFB 5K4JA 5DMZA 2QOIA 3OP5A 4HYIA 4FEVA 1SVGA 2ZOQA 3R9RA 4ZY4A 3P5KA 2BZJA 4Z55A 3E63A 2GFCA 4FTKA 3MVHA 1TFFA 5IZFA 1O6YA 2JKOA 3LQ8A 4OTWA 3UIBA 5LXMA 3LXPA 3QFVA 3FJQE 5IDNA 1H8FA 4C34A 3P7CA 5LARA 3MH3A 4DH7A 4WUAA 3KULA 4OTIA 4U42A 3REPA 4M7IA 4CKJA 2C69A 3CP9A 3OHTA 3TUBA 1SZMA 5KMMA 3ANQA 4FYNA 4EYMA 4GCJA 4AA5A 1ZOEA 2WMSA 2O63A 3PSCA 5JQ5A 1ZRZA 2R3NA 4AOTA 4C3FA 3W8LA 5L2WA 2HAKA 2WEVA 3ORLA 4JBOA 3TZMA 3UTOA 4F0GA 4OAUC 3LQ3A 4J8MA 2QOQA 3TNHA 3Q60A 1JKSA 3R63A 2OICA 5E90A 5HVKA 2X7GA 3QTSA 4FEWA 5AUVA 4RX9A 2ESMA 4YLKA 3ORTA 3GGFA 3JPVA 3NLBA 2RGPA 4QMMA 4CFNA 3BU5A 5BVNA 2XA4A 3DAKA 3FQSA 2V7OA 3C5UA 2VTSA 3OBJA 4QOXA 4FIHA 4LM5A 3D4QA 1CKPA 2QKWB 4APPA 2GDOA 4KIQA 5GIPE 3UMWA 3BWFA 1L3RE 5EQYA 4H1MA 1KSWA 2PVFA 3FL5A 4ONAA 2RFSA 2C5YA 5J9YA 2A27A 5KZ0A 3S00A 4R3PA 5HEZA 3PFYA 4J99A 4JL9A 2E9NA 4EI4A 3UQFA 2GSFA 2UZWE 3P7BA 5D11A 3DK3A 4FK6A 4G6OA 3S2PA 4FKUA 3VF8A 5A3XA 2PMOX 4B8MA 4ZMFA 1B39A 4EK5A 4Y72A 5DT0A 3VW6A 1FMKA 4O6LA 2A2AA 4Y8DA 4YU2A 3FSFA 4NTSA 2WOUA 4XG7A 4CV9A 2ZMCA 4V05A 3G0EA 3LCTA 4ENXA 5I9XA 5M4CA 2QC6A 3PWDA 3R21A 3NPCA 4HZSA 3PSDA 4FR4A 2GNJA 4TXCA 4ANOA 4BIDA 3AC8A 5HD4A 3EZVA 5J1VA 4L00A 4ZS0A 2YLFA 4L3JA 1G8KA 3MWUA 4U97A 1WVWA 4QDEA 4CKRA 4AT5A 2GQSA 3DAJA 4BCGA 3RAKA 3S95A 3NCGA 2CMWA 2PMLX 2ONLC 2X6EA 2W1IA 5B7VA 4DG2E 4G9CA 4JI9A 3GCSA 4IC8A 2E9UA 4OTRA 3EN7A 4U43A 3VULA 4AFEA 4MF1A 4BHZA 3MGYA 3W0QA 2X8EA 2W0JA 1SM2A 2UW8A 2XP2A 2WMRA 3FQEA 4X0MA 4EZ5A 4P5ZA 5L8JA 4EHZA 2Y4PA 4K8AA 4FIJA 3OD6X 5I9VA 3HAMA 4I5HA 3W33A 1JWHA 4N70A 4I5CA 3QCYA 4IAZA 3VUGA 2Y9QA 1VZOA 2YEXA 3AMAA 3F3ZA 4I23A 4ITJA 4Z7GA 3UC3A 1V0PA 4LL5A 2YM7A 3TKUA 1HCLA 2B9IA 2XKEA 3MN3A 4ACCA 5BVKA 2CSNA 4PMTA 3OF0A 4FNYA 4EHGA 1H1RA 3I79A 5DA3A 1NW1A 4O6EA 1GIJA 3F2NA 4QMPA 3LFNA 2O2UA 3W0OA 5KBQA 3SV0A 4DF3A 5LCJA 4FV3A 2JDOA 4BGQA 4C4IA 2JDVA 3AGMA 5FRIA 4FV5A 1I09A 4CT1A 4EH5A 4FI1A 1GZOA 3LHJA 1GIIA 4UXLA 4AZWA 2XRUA 3R8LA 5E8WA 4WNMA 1FOTA 3Q32A 4RMZA 3DZOA 5IUHA 4JMQA 1IAHA 5T68A 2P4IA 3HRCA 2HELA 4A7CA 4APCA 4AXEA 3C4EA 3GI3A 3PIXA 4KBCA 2BZKB 3PXRA 3ACJA 4Q5EA 3UG1A 3ZS5A 4EOSA 1YI4A 1YXVA 3PA4A 3HMIA 5A4TA 5J79A 4TWPA 4FE2A 1IRKA 1OKVA 3O17A 3GU4A 5K9IA 3Q9WA 1GY3A 1ZMUA 5C8NA 4FKOA 3ZM9A 4LGGA 5EHLA 5CX9A 3V5QA 5CF8A 1VYWA 1PXNA 2JBOA 3QZHA 3ROCA 4I21A 1WFCA 1JQHA 4D5KA 2XBAA 1J91A 3TEIA 4B6LA 5K0XA 2PMNX 3BPRA 3MFTA 3VNTA 4QMQA 5AX9A 4DT9A 3GU5A 3A7FA 3QBNA 4ZSEA 2Z8CA 3RZFA 4CQEA 1YOMA 4FZFB 2B9JA 3D2KA 3GCPA 4MWHA 4E4XA 4OAVB 4XBRA 4G3DA 3JVRA 4USEA 2WMTA 4EK4A 4L01A 4IAIA 3EQRA 3ZRMA 4AT4A 1XMMA 4GT4A 2VU3A 4A4OA 2QHMA 4CFXA 3CY3A 2XVDA 3WF5A 5J1WA 3RNYA 2GHMA 4CFMA 5IA1A 4AXFA 3DS6A 2CJMA 2J5FA 2J90A 2QOBA 2R3GA 2X6DA 3CKXA 3QYZA 4NK9A 4RWKA 3E92A 5H8EA 5HNBA 3RHKA 4CTBA 5AV3A 2F4JA 5HCXA 1KWPA 3TG1A 5KCVA 5F1ZA 4K77A 4QD6A 4FVRA 3MH1A 4IVCA 2YWVA 1PMUA 2IZRA 2GNFA 4NU1A 2CGVA 1OPLA 2XM9A 1OPKA 3I1AA 4LUEA 1ZMVA 3Q4TA 4QMUA 3UE4A 4DDIA 3EN6A 4RWIA 2DQ7X 4YTFA 4QP6A 3OFMA 3QQGA 3AD4A 5G6VA 2KULA 2BRGA 4IWPA 3EFLA 4FODA 3NZ0A 3QUPA 2CN8A 3LJ0A 4UXQA 4CG9A 5EDQA 3W2QA 2FSMX 2OZAA 3W0SA 2WOTA 5J87A 4ZS4A 3F3WA 4JS8A 4Q5HA 4MWIA 2P3GX 5GINE 1JAMA 1EH4A 3NYXA 1TVOA 1BUHA 2QURA 4MKCA 5FEEA 3TTJA 1OECA 4H3BA 3BQRA 4I6FA 3MY5A 5DEWA 3RAHA 4EC9A 3SG9A 4GYIA 2O64A 4AACA 2Q0NA 5BVEA 3RP9A 1ATPE 3IOKA 3NIZA 3VRZA 5KMJA 4DDGA 5LMAA 1E1VA 2W4JA 4Z16A 4QEBA 3DXPA 3ORKA 2PVYA 3QKMA 3RVGA 1Q41A 3D7TB 4YHJA 4YLLA 1UA2A 2CHLA 1YHSA 2WMVA 2I6LA 4X2NA 5IQFA 4ERWA 3QQKA 2WQEA 3IDBA 4G31A 4MXAA 4YJNA 2O3PA 4AP7A 3HDNA 4DFYA 2RSVA 3O23A 4Y83A 1GOLA 2OWBA 3T3UA 4TWNA 2YWPA 4QTCA 4EYJA 5IMEA 2Y7JA 4FL3A 3S3IA 1R0PA 3HMMA 2JFMA 5EM5A 4F70A 3OEZA 4A9YA 3C5IA 1PXJA 5KUPA 3DXNA 2UZOA 4EJNA 4YZDA 3IOPA 4E4LA 3FXXA 4MX9A 1UWJA 4PTEA 4XG6A 4FKSA 4QTDA 3BHYA 3KXXA 3CD3A 1KV2A 2V62A 3RI1A 4C35A 5KHWA 4YLJA 4ZOGA 4FT9A 3NIEA 3KC3A 5TR6A 1IA9A 4O0UA 2FSTX 3CGFA 3LFQA 3FMLA 2IWIA 2WEIA 3V6SA 4ZTSA 3DTCA 2JKMA 3LXNA 4G16A 4PMSA 3W8QA 1H1PA 2EXMA 2Y4IC 3EN4A 3MPMA 5JQ8A 3A7HA 3V5LA 3NUPA 3DDQA 1M2PA 2G2FA 1MQ4A 3PUPA 3OC1A 1AD5A 1DM2A 3OOGA 3QGYA 3OCTA 3AT4A 2UW6A 4MBJA 4HGTA 1WBVA 2BKZA 1YWRA 2O65A 4I93A 3O96A 2ITTA 4XG4A 5I9ZA 5M53A 3ATTA 2X1NA 5HG9A 3BU3A 1E1XA 3NYNA 1OVEA 5AAFA 4JXFA 3GXLA 2BROA 1KOAA 4F78A 3WILA 5CAQA 4GV1A 4O7NA 4PTCA 3BLRA 4TW9A 2I0YA 3HV5A 4ANSA 3ORIA 4OLIA 4ARKA 5KMNA 3E8EA 5IQIA 4NWMA 4TWCA 5BQ0A 1UU7A 4M14A 4WA9A 5IEYA 5KZIA 3GQLA 3BYSA 3WZDA 2JBPA 4F9CA 4BJJB 4O7RA 1UU3A 1DS5A 5FDPA 5IMXA 5CAOA 3KCFA 5FM2A 2YAKA 5CNOA 4WNPA 1GJOA 4YJSA 4NIFB 3UP7A 2OO8X 4M0ZA 2RKUA 4CZTA 3NMUF 5HIDA 1H1QA 3RAWA 4CMTA 2OSCA 5CF5A 4FV1A 3HA8A 3PXYA 4CG8A 5IH4A 2YIYA 2CKPA 3MFSA 4AN3A 2XK3A 3EOCA 5CNNA 2JITA 1UWHA 4DHIB 3H3CA 4J1RA 5AM7A 5J8IA 5CQUA 2WQOA 4G3FA 4RA5A 4B4LA 3HA6A 4E4MA 5BV3A 4M13A 4KD1A 3THBA 3ZEPA 3KMMA 4IWDA 1YWNA 3HUCA 4PF4A 5CSWA 4IQ6A 3TACA 3NRMA 4BDIA 4CD0A 3FLQA 4AX8A 5G1XA 3DJ5A 5KHXA 4NW6A 3R1QA 4YJUA 3R8UA 3F69A 3QCQA 1QCFA 4AU8A 2VGOA 1OB3A 3DV3A 5HBJA 2VAGA 4CQGA 2ZFYA 5C01A 2BIYA 2HK5A 2GHGA 2G15A 3A8WA 3I4BA 4FTCA 2YIQA 4CYIA 3OTUA 3HGKA 4L52A 3F2AA 3BIZA 4FSNA 4TKSA 1GZNA 1PMNA 2YCSA 4NL0A 3KL8A 4IAYA 3ZZWA 4R5SA 3FLSA 4RJ6A 2WIHA 3I7BA 2Z7LA 5KNJA 4C8BA 2PU8A 4QTBA 4CRSA 4G3GA 4HPTE 3NUYA 1XR1A 4O91A 2H8HA 3LM0A 3QHWA 1GNGA 1SYKA 1ST4A 3OY3A 3D2IA 4F9BA 3OUKA 5BNJA 3DOGA 4MVFA 5JZNA 2XB7A 3HLLA 2XH5A 4BDEA 4KWPA 5M08A 5FXSA 5TE0A 2QVSE 4U3YA 3L8XA 4ZSGA 4FKGA 4RBLA 5H2UA 3ZEWA 4FGBA 2HYYA 3ZSIA 4UYAA 5AA9A 4QYYA 4FTUA 3W0NA 4M12A 3TWJA 4W8DA 4D28A 5CU6A 4TYGA 5M4UA 4GVJA 2C4GA 2WMUA 2GNLA 2IZUA 2PMIA 2WZJA 3I5ZA 3PE1A 4TYJA 4BDBA 3VUTA 4PL5A 4AE9A 3BHUA 4D1SA 1WAKA 4EH8A 4BWPA 3NNUA 5HLWA 4CLJA 2BFYA 2FH9A 3NNWA 1FQ1B 1ZY5A 3SC1A 1CTPE 1CKJA 5AMNA 5ANEA 5IQEA 5CEQA 2RF9A 2Z7RA 4RGJA 4FSWA 5DHJA 3KRRA 5AR5A 5L2TA 2J0IA 2XBJA 3KXGA 4PPAA 3MTFA 4II5A 3LFDA 1Q8UA 1RJBA 3H10A 2VTMA 3R9DA 1ZWSA 5J9ZA 5BVOA 4IXPA 2OH0E 3BLHA 4XV2A 4H39A 1UNHA 2IVVA 1K9AA 4O1OA 1Q99A 3KQ7A 3LVPA 3PZHA 4R1YA 5AR8A 4FNZA 3LFAA 4I0RA 1SNXA 3VS3A 4BBFA 3COKA 3FXWA 4CT2A 4EJ7A 3VS2A 4WT6A 1YWVA 4V04A 5C27A 5C03A 3LMIA 4XS2A 3BGPA 3HMOA 1S9IA 3VUIA 5ANKA 2XK7A 4DGLC 3CTQA 5CSHA 3G0FA 3HV3A 3TV7A 4TL0A 5K4IA 4G5PA 3SGCA 3R7IA 5JT2A 1CM8A 4C4GA 2PHKA 3ZC5A 2ZVAA 4FA2A 3F3TA 5AV0A 3UIXA 3ZBFA 4YC8A 4BWXA 3Q9YA 4AQKA 5AUXA 1PXIA 4YBKA 4IZAA 4BF2A 3P86A 3QHRA 4L3PA 1GZ8A 2CGXA 4WSYA 3VBWA 2XNGA 4ENYA 4NM5A 4GYGA 2B52A 1WBTA 2X0PA 5A4CA 3CPCA 5AP7A 1JSUA 4WHZA 3D7TA 4HCTA 5JFXA 5C4LA 2C3LA 3D0EA 3KVXA 1T46A 1FGKA 4FSUA 4BYJA 2ZM1A 4R3CA 3VF9A 5KMLA 3F5XA 3N51A 1Q8TA 3ENMA 4MBIA 5DVRA 4UY9A 4DBNA 5IG1A 5IA4A 4R8QA 3PPJA 4IZYA 5AUWA 2J2IB 5FM3A 3PVGA 2PUPA 1ZYLA 2VRXA 1ZARA 4PV0A 4DFLA 3IPHA 2BILB 4LG4A 3R00A 1TKIA 5BUIA 4USFA 3GOPA 4O2ZA 4FKJA 2W5HA 5AUTA 3EJ1A 5IA2A 3SG8A 3EYHA 4QP3A 2Q83A 1OIQA 5J9LA 5CTPA 2YM6A 3O71A 3U4WA 1ZYJA 1OIRA 4NKSA 3O50A 4BCMA 4ZLZA 5KMOA 4DBXA 1LR4A 4Q9ZA 4GS6A 4IX3A 1R1WA 4L68A 4NM7A 3MESA 2C6TA 4UBAA 4AF3A 4E5WA 2X9FA 2QI8A 2XUUA 3DBDA 3ZYAA 3A61A 4FTJA 5CAPA 4CSVA 4AZEA 3FLWA 1DAYA 4IC7A 4MH7A 4QQTA 2GPHA 3V5JA 3MDYA 4TYIA 4EOKA 4FV2A 1H1SA 3ODZX 3MSSA 1R78A 5HE1A 2YIWA 1L8TA 3RM6A 5GJFA 5JSMA 2ITNA 1NA7A 4JIKA 3H4JA 3F61A 2YZLA 2C0OA 4AE6A 2ZMDA 4JG7A 3PXKA 3UGCA 3FY2A 4IZ7A 4WG4A 3PSBA 5LVPA 5L8LA 4ALWA 2WXVA 3U54A 4L8MA 3NUNA 2ZDUA 3ROYA 4AW2A 1JSTA 4GH2A 3VJOA 2IO6A 3DFCB 3JUHA 4ZSJA 4ZTLA 4FICA 4FKLA 3DZQA 2VX0A 2B4SB 2EB2A 3QC4A 4YUQA 4RQKA 3V5TA 5IUIA 2W06A 3SQQA 2YHVA 4P5QA 3OXZA 1ZZLA 2VTQA 4BJJA 4YSJA 3ZM4A 5EYKA 4UX9A 4TNBA 1XHAA 2ZYBA 3JS2A 4I92A 2I40A 2UZUE 4NIFA 5FBNC 3OCBA 2BCJA 2J0JA 3EN5A 3R1SA 4WBOA 2XARA 3BE9A 3MTLA 4FTQA 3LM5A 3UQCA 4KAOA 2OGVA 4BI0A 1PJKA 1QPCA 3NDMA 3ZLXA 2WD1A 3R1NA 3KCKA 4TPTA 3PUFC 5DLSA 4EOMA 5I5ZA 3ANRA 5HI2A 2WTIA 4WG3A 4Y73A 2OFVA 2CKOA 4NEUA 4TRLA 3FKNA 1U46A 2BMCA 3ULIA 2BVAA 1WZYA 3Q52A 4FOCA 4IIRA 2XNOA 5BMSA 1YDRE 3TI1A 3SOCA 3QUDA 3NVKI 2HZNA 5JGDA 3F7ZA 1U54B 4AAAA 4RJ4A 5BMMA 4QP2A 2X4ZA 4JNWA 1J1CA 4C02A 5A4QA 4MUQA 4BI2A 4DTAA 5D41A 3VONA 4GT3A 2GMXA 4PTGA 4UN0C 3VVHA 5EYMA 3S0OA 2W7XA 3I6UA 3IW6A 3QX2A 4G5JA 3T9IA 1WBOA 2UZBA 4RVMA 2WMXA 4YC3A 4NJDA 4UV0A 4C2WA 4EH9A 1JSVA 4F65A 3HL7A 4U9AA 5FLFA 3WZUA 4GSBA 5EW3A 2QU6A 3RWPA 3KMUA 4QMWA 1YHVA 4AZTA 1E9HA 2X8DA 3WYYA 2IZSA 4XOZA 3GNIB 3E8NA 4I3ZA 4EWHA 5HCZA 1P5EA 3M1SA 4OW8A 4K1BA 2Z7QA 3DLSA 3FQHA 5EYDA 4U40A 4ZTMA 2UW7A 5E1EA 3WZEA 5DNRA 2DUVA 3PTGA 3TV4A 5BUJA 5AUZA 2UV2A 2ZB1A 4NM3A 4WRGA 3HV6A 1V1KA 5ETFA 4FZ6A 3CD8A 4U3ZA 4AZVA 4ZSAA 4XV3A 5JMSA 4IM0A 1SMHA 3QQFA 4MNEB 1YXUA 3DKFA 5DRDA 3MPAA 1DI9A 2JEDA 2IW6A 3TDVA 3M42A 3GVUA 4QMTA 1W8CA 4LRJA 5ITAA 2UZNA 1P14A 2H9VA 4RJ7A 5D7VA 1WBSA 3BX5A 4KBKA 5IEVA 3MIAA 5JRQA 2XKCA 1BX6A 3G90X 3KMWA 2PVRA 5HG5A 4GL9A 3FZPA 5HIBA 5BYZA 3BYUA 1VLRA 5IQAA 2YJRA 1WBPA 3FYJX 3ORNA 3P9JA 4QP7A 4IVBA 5LWMA 2EVAA 3GBZA 3FLYA 3L9MA 3WF9A 2OI4X 1BMKA 3FYKX 3UOLA 3MIYA 2PYWA 4YZCA 2ZAZA 3UVQA 1VR2A 3DJ7A 4MD7E 2J9MA 5BVWA 3RGFA 5AAGA 2UW4A 3ZU7A 2LAVA 2A98A 1OL5A 3C4FA 4KSPA 4RSSA 4U80A 2F7XE 3R7OA 3MH0A 3KRXA 3SW4A 3HP2A 4EUTA 3MY1A 4I41A 3WI6A 3QGWA 3MVMA 5A46A 4ANQA 5AFVA 2WNTA 3LCDA 2ZDTA 3Q5IA 3DGKA 4AXAA 2WMQA 5HVJA 3R9OA 5ACBC 4DEHA 3LLAA 1QL6A 3LFSA 2XIXA 3KEXA 4IB1A 5AP2A 2OF2A 1PMVA 4P2KA 4D4VA 4QQCA 4EL9A 4ZY6A 2UUEA 2HIWA 2GQRA 1CKIA 4BTFA 3C7QA 3UOHA 4FKIA 4XLIA 4X3FC 4EOIA 3MI9A 3FSKA 3HV7A 3BHHA 2JGZA 4FL1A 3W2PA 5B0XA 4ANBA 5IU2A 3NUAA 5HNIX 4KUJA 3F6XA 1H07A 4FT3A 3BV3A 4RLLA 1R0EA 3HDMA 3QX4A 2VGPA 4S32A 4UWBA 4RVLA 4I4FA 3QRTA 5BYYA 3U8WA 4DEIA 2Y8OA 3HAVA 4R7HA 3OOMA 4EQCA 4PPBA 5CAUA 1KOBA 3HMNA 3OWJA 2G1TA 1QPJA 4JRVA 5CEOA 1UNGA 3Q4CA 3NUXA 2VTHA 3DB6A 2PWLA 2O0UA 3RK9A 5GNKA 4C33A 5EDRA 3KU2A 4E7WA 5F4NA 4GKIA 1OUYA 2NO3A 3BRBA 3PZEA 1M17A 2F57A 2V22A 2X0GA 2IVTA 2FO0A 2R0IA 1UVRA 3SXSA 2OG8A 1U59A 3FDNA 4AUAA 5L2IA 2PPQA 3W2RA 3SAYA 5BVFA 3EQFA 2R3FA 3NWWA 3OVVA 3BU6A 3F88A 4QMZA 4CRLA 2YLEA 4ZAUA 2G2IA 5CENA 3RPOA 4NM0A 1UKHA 1GAGA 4HNIA 4O22A 4QP4A 3K5VA 5CZHA 4BDJA 4BHNA 2PSQA 2X4FA 1REJA 2DWBA 2GFSA 4UWCA 5TT7A 5DGZA 3FXZA 4DAWA 1OPJA 2F7ZE 5HOAA 3NUUA 4A9RA 4NFNA 5EKOA 4BY9E 3C4ZA 3QC9A 3WIGA 4DH8A 4NT4A 4RLKA 1YRPA 3O8TA 4WIHA 1IA8A 3FKLA 3Q5ZA 1ZAOA 4YJRA 3A7IA 3BGZA 1IAJA 1PF8A 3SXFA 1APME 4YMJA 2BDJA 5JFVA 2F7EE 3MJ2A 3ALOA 5DOSA 5GJGA 2YM5A 2X2MA 3PY3A 3E7OA 3D5WA 5EDPA 2AQXA 3IW4A 2W05A 3BZ3A 3O51A 3QL8A 3G9NA 3UP2A 3RNIA 5FUTA 4BN1A 1Q24A 4BCQA 4DA5A 3LCKA 1PW2A 4PNIA 2OJJA 2UW9A 1NVSA 4YPSA 3UOJA 2GQGA 4D2PA 4ALUA 4M15A 2W5AA 4FSYA