4BDFA

Fragment-based screening identifies a new area for inhibitor binding to checkpoint kinase 2 (chk2)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
304
structure length
285
Chain Sequence
MSVYPKALRDEYIMSKTLGGEVKLAFERKTCKKVAIKIISKNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Fragment-Based Screening Maps Inhibitor Interactions in the ATP-Binding Site of Checkpoint Kinase 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 285
sequence length 304
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bdfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bdfA01
5JRQA 4EH2A 5HI2A 4AP7A 2WMAA 3PVGA 5BPYA 3GU6A 5J9LA 4CFUA 4B99A 5E4HA 5CY3A 1E1XA 3PXKA 4M67A 1ZY4A 2Q0NA 3TZMA 3WZJA 4U44A 4X2KA 2C5OA 3ZM4A 4RRVA 1XWSA 2UZVA 2QOIA 3IECA 3JYAA 4WG3A 4ACGA 4O82A 2VV9A 2WTDA 2BZJA 4HVDA 4PUZA 4HVGA 3ALOA 4EK5A 2HYYA 3MFSA 5TO8A 2C0TA 3G0EA 5HIDA 3RALA 3WE4A 1PMUA 5IMXA 4PDSA 5LMBA 3FEGA 3BHTA 3EJ1A 3EL8A 3DKOA 3Q9ZA 3UYTA 2QOKA 4ZZNA 4K33A 3KMWA 4YZCA 4A9UA 2YA9A 5M51A 2GFSA 5HG5A 4KNBA 3W2OA 3F5XA 2HK5A 4FKGA 4E8AA 3PRFA 5HVYA 3MPMA 1XJDA 4DLIA 1FMOE 2E2BA 4DGOA 5CI7A 3F82A 2QO2A 4JIAA 4DF3A 3QTIA 3BLRA 4D4VA 1M52A 5B7VA 2X8EA 4CMTA 4W9XA 3PIYA 2I0EA 4W4VA 1J91A 5K4IA 5IH6A 3RWQA 5FTOA 3COHA 5AIRA 4ZTQA 3TEIA 4I41A 4O2PA 3BU3A 1WBNA 2YERA 3WF9A 3NAXA 3I6UA 3QTRA 1TKIA 3FI2A 3UO6A 3CTQA 3DLSA 4M3QA 4LL5A 3OWLA 5DRDA 4JXFA 4U0IA 5L4QA 4RIYA 4NIFA 2YITA 2XZSA 4AGCA 4BKYA 3ELJA 2ZVAA 4GMYA 4O1PA 3VBQA 2NNWB 3F3TA 5CSVA 4EZ7A 4U43A 4AF3A 4QMPA 3H9OA 1YQJA 2OGVA 5CX9A 5E8SA 4UB7A 5JGAA 4F1TA 5AWMA 3EZVA 3I1AA 1VYWA 3GCSA 4IAAA 5M57A 1MQBA 3JY9A 1YI3A 3NUYA 2YISA 5FEDA 3HP2A 2IZTA 3N51A 5HVJA 5JFSA 4R8QA 3DAJA 4PMMA 4XCUA 3RZFA 4BVUA 3AC4A 4JBOA 4KWPA 3Q2JA 4F0FA 3BYVA 4MD7E 4DGNA 4QYFA 1XH5A 1JSUA 4TYEA 4JG8A 4BKZA 1WBPA 2YM5A 3WBLA 5HU9A 3EQFA 2OIBA 3G90X 4GSBA 1YXXA 4GIHA 4QT1A 3V5QA 3UPZA 4IEBA 2PMNX 3HLLA 1B38A 4C35A 4M7IA 4S31A 2E9NA 3LMIA 2OLCA 4ZSLA 5AR5A 2BILB 4ANLA 4C3RA 4N4SA 1JSVA 5I5ZA 3IOKA 3AC1A 4H3BA 4ZMFA 4D5KA 1J7IA 3ORTA 4RVMA 2VWVA 2GCDA 5E8XA 3SW4A 4ZAUA 4PMTA 4USEA 2BCJA 3DK3A 3HL7A 4JX3A 4PF4A 4F1OA 2I0HA 3KVWA 4FZAB 4MXCA 4BDKA 2BRHA 1GIIA 3NNVA 3IOPA 4GCJA 4JR3A 3UP2A 1JKLA 4DLJA 4E4MA 4GEOA 2X9FA 4GK4A 5EYMA 5L3AA 5LOHA 1H25A 2NO3A 2UW4A 2W1DA 2XYUA 3AMAA 4PTEA 2PVFA 3E87A 1LUFA 2VRXA 4J96A 3DS6A 3ZZWA 5HX8A 2HZ0A 4CZYB 3TXOA 4J53A 2CMWA 5CEOA 3QTQA 4YO4A 2VWZA 4FV1A 3PFQA 3MSSA 4EOOA 1FMKA 4YU2A 1QL6A 2WKMA 3S4QA 3F6XA 3QWKA 4OTWA 3HRFA 2CHLA 5E8ZA 3VQHA 4RX5A 4R78A 2RFNA 2QO7A 5E1EA 3VS2A 3QGYA 2WQBA 3M1SA 2GMXA 4R5SA 4ZJJA 3PWYA 4PRJA 4BKJA 3EH9A 4BWPA 5AEPA 5DH3A 3EYGA 4IQ6A 4PMSA 5FWKK 4MD9E 4QMZA 4ZTMA 2GNLA 4YJVA 1WMKA 2JKQA 5CWZA 4YP8A 4ZMEA 1ZOHA 5FG8A 3UVRA 3OF0A 1PXLA 5IH4A 2UW3A 3Q4CA 3LMHA 2Z8CA 4CNHA 5CAUA 5IA3A 4QO9A 4YR8A 3TUDA 4DCAA 3NW7A 4NUSA 3DFAA 4AFJA 4QPSA 1PXNA 4BCQA 4K11A 5AV4A 2R3IA 3GOKA 5D12A 5IU2A 3GP0A 4USDA 2Z02A 2F57A 2ZV8A 5FBOA 3GC7A 3KXHA 4G9RA 1ZYDA 3BHUA 4RWJA 1VYZA 5DA3A 4PV0A 2HY0A 1PXPA 4IJ9A 4I92A 4CZUA 3R04A 5HG9A 4BWKA 5HKMA 3DDPA 4I20A 4D2TA 3P1AA 3NYVA 5K5NA 3CGFA 3S1HA 4KIKB 2GS2A 4TYIA 5DT0A 4OTDA 3ZO3A 4WG4A 3UODA 3MN3A 4ACCA 5CASA 4JG7A 4LYNA 2XBAA 2ZYBA 3BPRA 5EYCA 3WARA 3IO7A 4G3GA 5D11A 2VTIA 4QQ5A 3KB7A 4TY1A 1G8AA 5BUIA 4CGAA 4QMVA 5L6WL 3EQHA 2W1EA 2ITQA 3ORPA 4IMYA 4CV8A 4CG8A 3LCKA 4EH6A 5K0XA 3BGPA 3Q6UA 4AW5A 1OKYA 4AUAA 3RAKA 2XNOA 2PVRA 1W82A 3F9NA 3K3JA 3LAUA 4R1YA 4Y95A 3WF5A 4FIEA 1L8TA 2QOFA 1GZ8A 3QLGA 4U3YA 4U8ZA 4D2SA 4NM3A 2UZLA 3F7WA 3ZZEA 3CSVA 4YZBA 4BTJA 3HV5A 1ERKA 3DT1A 4G17A 4YNOA 3ZS5A 4BL1A 2BKKA 1M2RA 4RFYA 1PXIA 4J8MA 2EWAA 3VS4A 3W32A 4LUDA 3FC2A 3VUHA 4ZXTA 4F64A 2W0JA 4F0GA 4RGJA 4O2ZA 1KOAA 2O8YA 4FSRA 4QP6A 4AN2A 1WCCA 3C4EA 4H3QA 2BRGA 4D55A 4C37A 4LG4A 3KULA 3IW4A 2B7AA 4XP0A 3U6HA 1S9JA 4FKIA 5CXHA 4DFNA 4N6YA 1HCKA 4ZSAA 3O50A 4O81A 4TRLA 3VS5A 1UWHA 2OH4A 3QTUA 4HGSA 5CU2A 3T9TA 3DXQA 1SM2A 4E4NA 2ITUA 4IBMA 3LW0A 2BMCA 2WEIA 2Y6OA 4AGUA 4F65A 3DTWA 4DEEA 2IVTA 4DYMA 3Q3BA 4YZ9A 3LXKA 5AP5A 5KMMA 3NNXA 4X2GA 5A46A 4C33A 4EK4A 5AUYA 2Y4IB 3QBNA 4LRKA 4U41A 5GZ8A 5IQBA 4MQ2A 3A7GA 2VTSA 2BAJA 4IHPA 2OO8X 2UUEA 4AT5A 3GCUA 4JIKA 2AC5A 3R7IA 3CD8A 5B2LA 2QLUA 4IWPA 2B0QA 4O0YA 5IQAA 4HVIA 3BEAA 4DTKA 2F49A 4AA5A 2CSNA 3VS3A 5I9VA 3MPAA 3MFTA 2XNNA 4QTEA 4G3EA 5H2UA 5JN2A 5ANKA 3PY0A 3NVKI 1H8FA 4ANMA 3KXGA 3EHAA 3ROCA 4GT5A 4YLKA 2PZYA 5FUTA 3VC4A 4ENXA 3DK7A 3ORLA 2VTJA 5L2QA 4IC8A 4EONA 1REJA 1KV2A 1DI9A 1QMZA 3Q2MA 4FIJA 4RC3A 4AW2A 3GBZA 4UXLA 4CT1A 3PXZA 3EB0A 3ULIA 4Q5HA 4WUNA 5A3XA 3A99A 2HW7A 5ANDA 3EQDA 2B9FA 3QD3A 5BVOA 3Q96A 5CT7A 5E8YA 3HNGA 5C26A 2X6DA 4OTGA 4XJ0A 1WBVA 4K6ZA 4C58A 4RA4A 5CNNA 5ANOA 3NUUA 5EYKA 3BWJA 5IA5A 3N4VA 5DN3A 4CLIA 2XP2A 4YC3A 3SV0A 4UYNA 3TKHA 4ZLZA 1PHKA 3OEFX 5AAEA 3A60A 3WZDA 4N57A 3OVVA 3NYNA 5EK7A 3RPOA 3GC0A 4F7LA 1DS5A 1UNLA 4FV7A 3IDCA 4YLLA 3MDYA 1H4LA 3R8LA 1JKSA 3S95A 3MH1A 4ORKA 2Y8OA 5C4LA 3ORKA 3BELA 3IS5A 3E7OA 3FV8A 5IKWA 4QMUA 2QOBA 2UW9A 4ZOGA 2HW6A 3DBCA 5IMEA 4O7SA 5IQHA 3TN8A 4ARKA 3LFFA 1PYEA 3C4ZA 3V01A 3EQCA 1UA2A 2R3NA 4CTBA 2OJGA 3VQUA 3E8CA 5EW3A 4IC7A 5FLFA 4R3RA 2J50A 1U5QA 3HRCA 4MYGA 3QRIA 1H00A 3R9NA 1OMWA 2WMQA 3PLSA 3ZM9A 3R63A 5HBJA 4H1MA 3VBXA 2JBOA 4IANA 5E1SA 1B39A 3LJ1A 4ZTSA 4JDKA 4EH9A 1W7HA 1XH9A 3DTCA 4PMPA 2HWPA 4F9BA 2IN6A 2WTKC 3CC6A 5HNIX 5ITAA 5FTQA 3FY0A 5JFWA 2BRMA 2WMTA 3AMYA 5IA1A 4FEWA 1XBCA 3BLHA 5DFPA 1W84A 1OI9A 3KF4A 5C8KA 1GIJA 4FL3A 4RJ4A 2C3JA 3W8QA 3G6HA 3NDMA 1YVJA 1UU3A 4TWCA 1OPKA 2V7OA 2WXVA 4RX8A 3ACKA 2JFLA 1XH6A 2WTJA 3C50A 3ZBXA 2UZUE 5B2MA 4WKQA 2YCRA 3ZRKA 5EI2A 1Z5MA 5EW9A 3PPKA 3KQ7A 1XHAA 3Q5IA 1A48A 4J1RA 3TZ9A 3PA3A 3NCZA 4DTBA 2HXLA 3R9HA 2EUFB 3ZONA 4AA4A 2CDZA 3WYYA 3GFWA 3UVQA 3DQWA 4KSPA 4O7LA 1BL6A 3FJQE 5CSHA 3UOLA 4AGWA 5CAOA 2C6MA 4XRLA 5C03A 1XO2B 3Q4UA 4YGAA 5F9EA 4DH8A 4G3DA 4RIOA 4UZDA 3VS7A 1H28A 4AS0A 4FL1A 4QMOA 3QQFA 1OIYA 2CNQA 3OWJA 3D94A 2VTPA 3EOCA 3F3WA 4FUXA 3CEKA 4I5MA 2VZ6A 4MF0A 1K3AA 1ZWSA 2OF2A 5IQIA 3TV6A 5EYDA 3QXPA 4PL5A 1URWA 2WOTA 2IG7A 5M06A 1XH7A 5C4KA 3RI1A 4L45A 4BGHA 2AC3A 4LOOA 2QD9A 2RGPA 4AA0A 5EM5A 3RM6A 5BVFA 3N4UA 4CG9A 4RVLA 4Z7HA 3DY7A 3FMNA 3FMLA 4I5HA 1NA7A 2XNGA 3FLSA 3WE8A 4QMTA 1GZKA 3K5VA 3VF8A 3AT3A 2IVVA 1OECA 2R64A 2XEYA 5EHLA 2C3IB 3ZSIA 4A9SA 3L8XA 1O6KA 4BZDA 4DEHA 5I4NA 4O0WA 1IAHA 4G2FA 2HOGA 3VS6A 5FP6A 1J1CA 4DG2E 4PPBA 5IH5A 1YOMA 4R7IA 1OBGA 4ZS4A 4XEYA 2JBPA 2X0GA 2OU7A 4LGDA 1TVOA 1H26A 1O6YA 3FI8A 5HTCA 4NW6A 3HGKA 4F63A 3VW8A 3ZXZA 5KMOA 5ANIA 1KOBA 2GTNA 1BX6A 2C5VA 2QC6A 2YEXA 4EH4A 5JKGA 2H34A 3UIXA 5JFVA 2P33A 5J95A 4XG7A 3VRZA 1IR3A 4YZMA 3MY1A 4RC2A 3FKLA 1GIHA 4YJRA 3GU7A 3R7UA 5FXQA 4PTCA 3BI6A 1DM2A 5M07A 3BBWA 2PUPA 2EVAA 3GOPA 2PPQA 2OIDA 2W4JA 3C0HA 4WNOA 1UNGA 1ZXEA 1JKTA 2PVNA 3O8UA 1MRYA 4Y72A 4Q9ZA 4YSJA 5LCJA 2JDSA 3FWQA 3EN5A 4EL9A 4RJ6A 4U42A 5GJDA 1M7QA 3HDNA 2ETRA 2ZV9A 4M68A 3GC8A 3HV4A 3OTVA 4UXQA 1CSNA 5BVWA 4GL9A 4D2VA 3E93A 3D2KA 5M53A 3DZQA 5ETIA 4BIEA 5IDPA 2O65A 2XKEA 4QP8A 5DIAA 4AT4A 3QYZA 2FGIA 3PP0A 3C4FA 4ANBA 2PL0A 2C1AA 4AG8A 3UQCA 3EQRA 3SX9A 4N70A 4JDIA 3LFAA 3HA8A 3SKCA 4EI4A 2BVAA 3ZO4A 3P23A 3DDQA 3G6GA 5CF6A 4MEDA 4D4YA 3LVPA 5E8TA 5HLNA 3MGYA 2VX1A 2UW6A 1LEWA 3I5NA 4DGGA 3QA8A 4JBPA 4JT3A 2QQ7A 5IQFA 3EFKA 5IDNA 5JQ8A 1URCA 3TG1A 3R0TA 4F0IA 2VWWA 2R0UA 1IEPA 1MRVA 1OB3A 4RIXA 3JS2A 5AM7A 3ZRLA 4F1MA 2ITWA 4FSZA 5HNGA 2P4IA 1BYGA 4O0RA 3A8WA 4ZTNA 1YHWA 3G2FA 1PXKA 2PE0A 2PWLA 4XH6A 5HE0A 2YN8A 5FQDC 3P7AA 4E93A 4FEUA 2FB8A 5C01A 3WIKA 3QF9A 4IZAA 5F4NA 2ZM3A 4RJ7A 4I5CA 2BRBA 3D2IA 3IKAA 4E5BA 2ZJWA 4C36A 3D7TB 1Y8GA 3IW8A 4RZVA 1U59A 3V5PA 4ITHA 4JQ7A 1S9IA 5E7RA 2BHHA 4MWHA 5CEIA 3TTIA 3WF8A 2KTYA 4C4EA 2ZM4A 2ZMDA 1KUTA 2PUNA 4NK9A 5E8UA 2R7BA 4F09A 1JVPP 2ITVA 2W99B 5KBRA 3V6SA 4HGTA 4XOYA 1SVGA 3VBWA 2OICA 2XNPA 5AX9A 2CNVA 4PNIA 1YDTE 2B4SB 5AUXA 3KMUA 1PW2A 5GINE 3AT2A 1AQ1A 1U54B 1F3MC 3B2WA 5HCYA 4AFEA 3HECA 4FSYA 1TQIA 2BZHB 3RINA 1O6LA 4D9TA 5L2SA 3POZA 4EBVA 2I0YA 2XNMA 3OTUA 2R3HA 2OZOA 2WEVA 2LGCA 3R73A 4FYNA 3U4WA 3VJNA 2QOLA 4KRDA 5IZFA 4A06A 2JFMA 4DEIA 3O0GA 5EM7A 4BCKA 3SG8A 4L9IA 3A7FA 3KA0A 5D10A 3CKWA 5CF5A 4CV9A 3Q4TA 2GNHA 2ZB1A 3KVXA 3DJ5A 4XX9A 3DFCB 4U79A 4M13A 2WU6A 1G3NA 3FQHA 2DWBA 3LQ5A 4IWDA 4NM0A 4U80A 5KZ0A 5A4EA 1OKWA 3VBYA 2E9UA 1M17A 4BDBA 4E3CA 2PVMA 2PMIA 4UALA 4OR5A 4J71A 2OJFE 3VBTA 3NMUF 2JDRA 3FMDA 2NP8A 4ACHA 2WQOA 2OXXA 4HW7A 3HMIA 3C13A 3KK9A 4PP9A 4U45A 4AQCA 3RHKA 4AZFA 1MUOA 3HA6A 5GJGA 3VULA 5D1JA 4D2PA 2F7ZE 4FV6A 4OGRA 4KBKA 5IG1A 1V1KA 1LEZA 1Q8YA 1CKPA 2V5QA 2BPMA 2PUIA 2C6TA 4PDYA 3O7LB 3PJ2A 3FXZA 3UMWA 5HD4A 3EFLA 4O86A 4EZ5A 3OCGA 5J5TA 1ZZ2A 2OF4A 2JKMA 3CS9A 4S34A 4QTCA 2PUUA 4W4WA 4HPTE 4I4EA 4LQMA 5BYYA 4DBXA 3SHEA 3SQQA 2CGXA 2EB2A 2J0KA 2G2FA 4EK8A 2W1GA 3QAME 4FIIA 5JZNA 4I6QA 4AZWA 4QNAA 4ALUA 5BX0A 1CDKA 1JNKA 3VS1A 2FSTX 2JKOA 3QGWA 3MTFA 3A62A 4QP9A 5KE0A 3FZSA 3SDJA 2C30A 2H96A 1CKJA 1OM1A 3AD5A 1IAJA 2QG7A 4ZTHA 2WFYA 4J7BA 1ZMVA 5CZIA 4D0WA 5KX8A 3UZTA 1JKKA 2VTOA 2Y4IC 5EDQA 5EQYA 4I24A 3TV4A 4O7WA 4FEXA 2HELA 3DKGA 2UZBA 3I5ZA 1Y91A 1WFCA 4X3FB 4BTKA 1WBSA 3LJ0A 4NCTA 3NNWA 1SZMA 4DEGA 4FSQA 4RQVA 4CFXA 3QCXA 2FUMA 1GY3A 4ZY4A 5IQGA 2BALA 3Q60A 4FICA 5TOZA 3RCJA 3TNHA 4EQMA 3ROYA 2FSLX 5LVLA 3ZBFA 5M08A 1YKRA 3KEXA 4UYAA 3LQ8A 4MH7A 2XKCA 4FSMA 4J52A 3KXMA 3ZSGA 4TNDA 2R2PA 4S32A 4A9YA 4YHJA 4FTUA 2ZOQA 2A27A 3D5WA 3HMMA 4RWLA 2O5KA 4EJ7A 5JZJA 3D4QA 4G5PA 2FVDA 4XV3A 4UMQA 3BLQA 5J8IA 2A19B 1IASA 3UO4A 4GG5A 3DBEA 3L9MA 4AE9A 3OXIA 3PPJA 5JH6A 3CXWA 5EFQA 5BVEA 3Q6WA 4QMSA 3SW7A 3RVGA 3I79A 2W4KA 5CVGA 3TZ7A 3S0OA 1SMHA 3E92A 2PE2A 5TKDA 3OG7A 1Q62A 5FDXA 5AR7A 4DAWA 1PRYA 3HUBA 2WD1A 4DFUA 2IZUA 1UU8A 2RSVA 4FI1A 4IM2A 4IAIA 4EUTA 4O83A 4FK3A 4LOQA 1SNUA 4C0TA 2XB7A 3PSBA 4NFMA 3EQPA 5ETAA 5A9UA 4JNWA 3RM7A 4A9TA 4FKSA 4BCIA 1K9AA 3PA5A 3UPXA 4APCA 3P79A 4NCTC 4GVAA 2PHKA 3DKFA 3LCSA 4QTAA 5CU4A 3W10A 2JIUA 2QO9A 1YXUA 4K1BA 3RHXA 3NX8A 4FNYA 4C02A 4CFNA 4F70A 2C0IA 3F5UA 4E7WA 2R3MA 3VWAA 2Q0BA 3LHJA 4L7FA 4I22A 5IEVA 2HENA 4I6BA 5IA4A 2QU5A 3F88A 5L6PA 4DHFA 4QMNA 4FE2A 4K18A 4NYEA 4FYOA 3TM0A 3PWDA 4FBXA 4RFMA 2QOQA 4EOJA 2XS0A 4EZ3A 3HAMA 4AU8A 4GJ3A 4TT7A 5A4QA 3UQFA 3AXWA 5DR6A 5L8LA 5GZ9A 3PZEA 4UWYA 3UYSA 4F7NA 3R9OA 3R1SA 2B1PA 5JK3A 2WMUA 4C59A 3QLFA 4GV1A 4I93A 5KMKA 4ACDA 2BKZA 4A07A 4DFLA 3DBQA 3LMGA 4BC6A 4XLVA 4K9YA 4AZTA 5B0XA 3HMPA 5A6OA 5HTBA 3E8DA 5M55A 3C7QA 4WNKA 3I0QA 1H1QA 2HZ4A 3OCTA 5FM2A 4YTHA 5CEKA 4FKOA 3U51A 4ASEA 3RCDA 4RIWA 4RLLA 1Q97A 1OITA 2O63A 3FBVA 5HEZA 3NW6A 5HICA 1U4DA 2BDFA 1SVEA 3OHTA 4Y8DA 5CQWA 3T8OA 1SNXA 4MXYA 4BBEA 3SG9A 3EYHA 5C9CA 4I5PA 4CMUA 1UVRA 1YXTA 3PIZA 5H8GA 5AA8A 4QTBA 2RG6A 1XBBA 3D83A 5FGKA 4H39A 4NM5A 3R9RA 2XK4A 5DEYA 3TNQB 3PJ3A 4B0GA 2UW8A 4RSSA 3ENHA 3JUHA 3COKA 2C69A 2ONLA 1E9HA 2UZOA 4BDGA 5JT2A 4FV9A 3UZPA 5CALA 2WNTA 3TZ8A 3RAWA 5AR8A 4HGLA 4HCUA 3O7LD 5JMSA 2XA4A 2CLQA 2J51A 4GVJA 2YWPA 4TYJA 4I0TA 4YC8A 3OCSA 4K8AA 5BVNA 4O7YA 2JEDA 4EWQA 2X7FA 3DLZA 3QQHA 4X2NA 4CKIA 3VUTA 4G34A 4ZIMA 2V55A 4HYIA 4AT3A 4QPAA 1ZZLA 3RPSA 5FTGA 3F2AA 2RFDA 4CZTA 1M2PA 3OXZA 2R0IA 3E3BX 3D0EA 3FMKA 3QD4A 3DQXA 5JGBA 5DNRA 3DNEA 5LVMA 4MXOA 4JRVA 4BZNA 1ZMUA 5EH0A 3MVLA 2RFSA 2JDVA 3ZMMA 4B7TA 1H07A 4LFIA 2JGZA 2VN9A 3H4JA 3NWWA 4X0MA 4C2WA 3FMEA 3NUAA 2PZ5A 4FMQA 3NVMB 4NKAA 3HAVA 4AOIA 5AJQA 1UV5A 1UU7A 4ZSGA 1H08A 2R3QA 3QHRA 2QR7A 3VIDA 4FV4A 3HEGA 4TYHB 2C4GA 4XNEA 4FTTA 3QTZA 4V04A 4R5YA 5HGIA 2YCFA 3C5UA 3NUXA 4L7SA 2W5BA 3UTOA 4O7RA 4XP2A 2BDWA 3LOKA 3NW5A 3OC1A 2ZM1A 3DBFA 2XCHA 4O0VA 4X7QA 4A4XA 3GUBA 1PXJA 2PMOX 2PVLA 2YIQA 3NR9A 3G9NA 3QTWA 4O96A 4S33A 4TWNA 4YJSA 4CKRA 3L1SA 3ZOSA 5IEYA 2YWVA 3Q53A 4XG2A 3QZFA 2Q83A 3D7TA 3WILA 1J3HA 1YWVA 3KRRA 5LARA 2GS7A 3U8WA 2BDJA 3GGFA 1XQZA 4HCVA 5AAFA 3D14A 2YACA 4FNWA 1KV1A 4KRCA 3ZUTA 4AAAA 5JSMA 2I1MA 1NT2A 3JY0A 3UOJA 3KCFA 2OK1A 4FKVA 3N4TA 3ZDIA 1Q61A 4G9CA 4ZSJA 3UBDA 4J8NA 1UNHA 3FMHA 4BTFA 5LXMA 1V0PA 3KCKA 3UVPA 1UU9A 3FUPA 3DZOA 5GHVA 4QQTA 4IVCA 4DH7A 3AC8A 5F1ZA 5JEBA 4ZS0A 1ZLTA 2W1HA 4RFZA 4M14A 2SRCA 2VAGA 3DU8A 3MPTA 3I6WA 3IGOA 4KIPA 4RG0A 3RZBA 4YPDA 4F9CA 1OKZA 4FKPA 1U5RA 4DFXE 4QMXA 2RL5A 3BYSA 3FDNA 3W2SA 5A6NA 5CVFA 3FHIA 5LJJA 1CTPE 2W5HA 3R00A 1T45A 2ACXA 5ANEA 4O6LA 1PMNA 3MI9A 3P78A 3KXZA 4FSUA 1Z9XA 4QYYA 5DOSA 3EQGA 3QCQA 3VO3A 5AA9A 2XUUA 3DXPA 5M4IA 4BDFA 3NEWA 4CMOA 5HVKA 1PMVA 5CT0A 5IA0A 5LWMA 2UZEA 4V0GB 3UNKA 5D7VA 4E73A 2VWIA 1LP4A 3BHHA 4TL0A 1MRUA 5AP7A 5CSWA 4ZEGA 3ZO1A 4BCNA 4CFVA 4LI5A 2A0CX 3DA6A 3FZRA 4TNBA 4JQEA 5DR2A 4KUJA 2EXEA 2YABA 2R3GA 4PNKA 1APME 5CSPA 4KBCA 1QCFA 3OBGA 4E5WA 3QXOA 4WNMA 3PVBA 3QQLA 4YNEA 4BCGA 3MIAA 1YHVA 4XV2A 2DUVA 2P0CA 4NW5A 2QKWB 3SRVA 5EM8A 4ZTRA 4BY9E 1XH8A 3NLBA 4L01A 1E1VA 2YM3A 5BVDA 3CR0A 3CBLA 4XS2A 3UNJA 3VUMA 5EHOA 5L6OA 3EN7A 3ZC6A 5I9XA 2H9VA 4X2FA 4ZY5A 4L3JA 1QPDA 4U9AA 5AP4A 3BV2A 3FI3A 3NCGA 3KREA 4Q5EA 5EDRA 5CANA 5IPJA 5HCZA 2B53A 3OMVA 3ZUUA 3GB2A 1A9UA 4HOKA 4QYEA 4RVKA 3OT8A 4DT9A 4AZEA 3QC4A 3H30A 3NYXA 4DBNA 4AZVA 1NVSA 4JRNA 2XKFA 4BICA 3QX4A 3ITZA 2P55A 2XK3A 4DE4A 4MNEA 4RJ3A 3CQEA 4XG6A 4YPSA 3WF6A 1A06A 5C8NA 1OBDA 2B55A 3Q52A 4PP7A 3M2WA 1KE8A 2ZDUA 5HO7A 3FL5A 4XG4A 1BMKA 4FNZA 4C8BA 2UW5A 4OT6A 4IM3A 1XBAA 4BBFA 4EYJA 2W7XA 5LCKA 1ZARA 2QLQA 2W9ZB 5DT3A 5EM6A 3CIKA 4LUEA 4N6ZA 5H3QA 2WMSA 1RQQA 3MJ1A 4FF8A 3O96A 5FD2A 2P2IA 2F7XE 3V3VA 3ATSA 4G31A 3SD0A 1ATPE 4AOTA 4I0RA 1PXMA 3GU8A 3V51A 4E4LA 4C4GA 1XKKA 2VTMA 3WZKA 5DEWA 4OTFA 2R3RA 3PJ1A 5HD7A 4L68A 3RMFA 4F9WA 2V22A 2BFXA 4FTCA 4BIBA 3FLWA 3OT3A 2B9IA 5FXRA 5AR4A 2J5FA 4DEDA 5HZNA 4NJ3A 5AFVA 4ASDA 4NFNA 4FEVA 2F4JA 3LZBA 4JR7A 3E63A 5B2KA 3LM0A 4V05A 4EK6A 4LMUA 5H8BA 3ZLSA 4CRLA 2HCKA 3G5DA 4TWPA 2QODA 4EHEA 4EEVA 3ANQA 2I0VA 4L52A 4B9DA 4E6QA 4Z3VA 3U6IA 1VEBA 1J1BA 4W4XA 1FVVA 2WB8A 3DJ7A 4D1SA 4PL4A 4I0SA 4AN9A 3ZO2A 4Y5QA 3FZTA 1WBWA 3CPBA 3ZXTA 5HLPA 2C5YA 2GHLA 4NT4A 3PG3A 5L8KA 3LKMA 2XIZA 2ERKA 4OTRA 3ORXA 3U87A 4C61A 5J1WA 2Z60A 1OKVA 4HPUE 2JKKA 4M69B 3V5LA 3BE9A 1H1RA 2PVYA 2B52A 4D2WA 2KULA 4QYHA 2GQRA 2PU8A 3F3ZA 2O2UA 2WMVA 3THBA 1ND4A 3IW7A 3R8MA 3TUCA 3ZCLA 4NTSA 2VNWA 4IJPA 4UWCA 2OZAB 5LMAA 4NM7A 3RK7A 3Q5ZA 3R6XA 4EJNA 2OI4X 2EXCX 2QU6A 2ZDTA 1R39A 3NIEA 3W55A 3L8SA 3RAHA 3CPCA 2F2UA 3V04A 5M09A 3OFMA 5ANGA 3G9LX 1YDSE 4Q9SA 4AGDA 2J0JA 3BRBA 2R3FA 4HYUA 3OXTA 3AGLA 3R71A 4FV8A 3RBWA 4CFFA 4AZSA 4FKWA 4D4RA 4CVAA 5LMKA 3ZLWA 2C47A 4J99A 3AD4A 4KAOA 4DEBA 4M97A 5AUUA 3ZDUA 2FA2A 5TF9A 3OWKA 4GFOA 3VRYA 4FTQA 2X7GA 5LVOA 3MW1A 2NRUA 5A14A 1BUHA 2FO0A 4RX7A 3MH0A 1WZYA 2XJ0A 4IVAA 2JDTA 5CU6A 1Q8UA 4YHTA 1Y57A 3HKOA 2A2AA 5J1VA 3U9CA 2XIYA 2B9JA 3B8QA 2R3LA 1P4OA 3KRXA 3LFNA 2QHMA 2PVJA 1YXSA 4DTAA 5FXSA 5ICPA 2VNYA 3QRTA 3IONA 5CVHA 1FGIA 4JX7A 2CKOA 5IQCA 5A54A 2C3KA 4L44A 1H24A 5HLWA 1G5SA 4NL0A 4U81A 3MA3A 4X3JA 2YZAA 5FEQA 3GXLA 2JDOA 4D2RA 3UNZA 4LV5A 4AN3A 3U6JA 4PTGA 3EFWA 3NPCA 4WG5A 2PVKA 4N0SA 4FZDB 4ITIA 3Q9WA 4IZ7A 4L6QA 4M15A 5DHJA 3WI6A 4DH5A 4RIYB 5KKRB 1DI8A 2J0IA 2ZB0A 1ZYJA 2X9EA 3N9XA 5CYIA 3PY1A 4CT2A 5HE2A 4D0XA 2BZKB 4IE9A 4E4XA 2VWUA 1W83A 2R9SA 4KSQA 3OY3A 4CLJA 2X8DA 2AUHA 3LFEA 2ITYA 4NZWB 3UC4A 4EHZA 3BYUA 4WRSA 3KY2A 4AE6A 4FV0A 4F9AA 4IH8A 4MVFA 3CY3A 4GU6A 4IADA 5DGZA 3EMGA 4O7TA 5LMKC 3LLTA 3PXYA 3F7ZA 5L8JA 4HJOA 2W17A 3UOHA 1Q8WA 2Z7RA 4CSVA 3NUNA 1VJYA 3PZHA 4PPCA 3HDMA 1H0VA 2UV2A 3ZFMA 4WBOA 2XIXA 2CKEA 4XV9A 4O0XA 5K4JA 3F5PA 4C3FA 3U54A 2YIWA 4DFYA 2UVYA 3R8ZA 5CLPA 3FQSA 2OG8A 4BCJA 5J9YA 3A8XA 1YW2A 2QVSE 2QOCA 4YMJA 3VHKA 4E26A 2XBJA 4YZDA 3GCQA 4QTDA 4IWOA 4JBVA 2WMWA 4W9WA 3OUNB 3MV5A 4FVQA 4G6OA 3I60A 5HIBA 3D5UA 4ANOA 5FBNC 3QQJA 1Q3DA 4O7NA 5AV2A 2OJJA 2ERZE 3IW5A 3HVCA 5T68A 2BRNA 5F20A 4YC6A 2F7EE 3R9DA 3SXSA 1YRPA 4DT8A 3TKUA 2GNGA 4RX9A 1FOTA 5KZIA 3ZU7A 3TL8A 3EL7A 4WD5A 2BUJA 3Q9XA 3SGCA 4IX5A 5KHWA 2OJ9A 1KSWA 3KRLA 4K2RA 3R22A 2YM8A 1UWJA 3IW6A 2J90A 4KIKA 2HWOA 4IACA 3BGZA 4IAKA 2VWYA 3PIXA 4IX6A 4BHNA 3AC5A 1RDQE 1K2PA 1OGUA 5AP6A 3R2BA 3BYOA 4FSWA 4HNIA 1GOLA 1KE7A 3E8EA 4L3PA 2I40A 5JFXA 4IAFA 1JAMA 5AP0A 2YFXA 3TNIA 3QZIA 2YJSA 3L8VA 4EHVA 4YJQA 5DI1A 1ZYLA 2CLXA 4C4JA 1OUYA 5E9EA 3GCPA 5AV1A 3GI3A 3ULZA 4FV5A 3MFRA 4H1JA 3E88A 2UVZA 3RPVA 3WZEA 3ID6C 3PYYA 1PYXA 5EG3A 2IW8A 1QPEA 2VX0A 4IB0A 3IDPA 2BHEA 4TW9A 3RPRA 5JQ5A 3FI4A 2BZIB 3HUCA 3MY0A 2W1FA 2WTWA 4LM5A 4D1XA 3NS9A 3TI1A 5KNJA 5EW8A 2Z7SA 4OAUC 4G3CA 4V01A 4EQUA 2IWIA 2YJRA 3TJDA 5C8MA 3QZHA 4V0GA 4EOMA 4APPA 3LCTA 3A4PA 3T9IA 3UGCA 4BI2A 2OSCA 3PRIA 2WMRA 4TYGA 3V8TA 4MXAA 3R01A 3ODYX 4FSTA 4XG3A 5DT4A 2J5EA 4ZZOA 3FYJX 4FTMA 3JR1A 1Y8YA 3O51A 3W18A 4F4PA 4R3CA 4LRMA 3QQUA 3FLQA 1Q5KA 2JIIA 3R7YA 4MBLA 2GQGA 1BLXA 5DBXA 4F9YA 3I0OA 3R2YA 3MTLA 2QCSA 2FSMX 2WQEA 2VWBA 3LFQA 4U7ZA 4I3ZA 4BI1A 2J7TA 3Q9YA 2W1ZA 4L67A 3ZSHA 5GIOE 5AUVA 2C6EA 4EOPA 2ITOA 3QU0A 4WOVA 3RPYA 2W06A 3V8SA 2OIQA 1PKDA 2J9MA 3SLSA 3OS3A 4UWBA 2C6KA 2CKQA 4H05A 3BQCA 1IG1A 1PY5A 3FC1X 3ODZX 5HESA 3UE4A 3NUSA 3GNIB 3DB8A 2QOHA 4RC4A 3F2NA 3W2CA 4XUFA 4HVHA 2XK9A 2HAKA 4QPMA 4DINA 4GUEA 3FXXA 4KIQA 4WO5A 3FMMA 4WRGA 4K0YA 3HMNA 4EBWA 3PSCA 3ATTA 3BU6A 1FPUA 1OVEA 2UW7A 5AAGA 3AMBA 5EKOA 4TWOA 4BIDA 3BGQA 4G6LA 1DAWA 3VUKA 2XMYA 3TTJA 2CN8A 4QMWA 4FA2A 3GQLA 2GQSA 3E62A 4QD6A 1V0OA 1VR2A 4RT7A 4FV3A 4IB3A 3PLAE 1YHSA 2X7OA 4G16A 2P2HA 3FAAA 3MYGA 5HE3A 2HZIA 4KIOA 3UIBA 4BGQA 1H1WA 4CFWA 3GVUA 3OUKA 5J7BA 3R30A 4YLJA 5M4FA 4S30A 4BDIA 4IIRA 5M44A 4Y83A 4EOKA 2XRUA 4L46A 5BQ0A 1JBPE 2UZTA 4O7ZA 4C57A 4Q2AA 3E64A 1SYKA 5CU3A 5EHYA 3EIDA 3IK3A 3PG1A 4U6RA 3AG9A 5K0KA 1M14A 4UMUA 4G1WA 1GJOA 3G51A 3LXNA 3OW3A 5ACKA 3DXNA 5FP5A 4AW1A 3C0GA 3S3IA 1F0QA 1MQ4A 3FLYA 2IZRA 3NRMA 3DCVA 2HXQA 4ITJA 4M84A 5EDPA 5AV3A 4F99A 4NTTA 1Q3WA 4X21A 2XJ1A 2IVSA 1Y6AA 4BCPA 3W16A 3CTHA 2GHGA 3ERKA 4FTRA 2J0LA 2VO0A 3R7OA 2C1BA 2QONA 3BWFA 2ETMA 4FTNA 3WZUA 4BFMA 1TQMA 2XKDA 3AT4A 3FLZA 4EHGA 4IM0A 4GS6A 2BAKA 4YBJA 4BHZA 4ERWA 3P86A 5HQ0A 4EH7A 3W2PA 1FVTA 2A4LA 1JQHA 4XG9A 3TDWA 3UO5A 2WTKB 4C34A 2QKRA 4YBKA 2AYPA 4M69A 4D9UA 1STCE 2G01A 4F7SA 2XRWA 3PXFA 4NH1A 4WBBB 4GT4A 4LMNA 4DCEA 5I9WA 3S2PA 5DPVA 3EZRA 1ZMWA 4MKCA 4FTOA 3D5VA 4P90A 2OZAA 4BB4A 3F3VA 4KKGA 3D5XA 4UY9A 5G1XA 4U40A 3WOWA 5HNBA 3FPQA 2Z7QA 4QMMA 3QL8A 5AP3A 5AUTA 3CTJA 2OFUA 4W8DA 5HG7A 5HG8A 2YLFA 5J79A 4QP4A 3F3UA 3AGMA 5DRBA 4R7BA 4Z7GA 2OW3A 5AR2A 5LVNA 4MF1A 3TKIA 5JGDA 3H0YA 1OL7A 2V62A 3R1NA 2XYNA 5CI6A 5DR9A 4UEUA 3E7VA 2OFVA 1BKXA 3FKOA 4EC8A 3LFDA 4RBLA 3CQWA 1YXVA 4EOLA 3TJCA 3GQIA 3UZRA 2XF0A 5HX6A 5CSXA 1REKA 4C3PA 3P0MA 4ZLYA 4C7TA 1KWPA 1J7UA 3MB7A 3E3PA 1IA9A 3BX5A 2DQ7X 4FZ7A 4BYIA 1OIUA 1QPJA 5BNJA 4HNFA 3BEGA 4NEUA 3TNPC 3KXNA 2WZJA 2BTRA 3EQBA 4OTPA 4FOCA 3H10A 2ESMA 2YM7A 1ZRZA 4CKJA 3OROA 3UG1A 2GSFA 2CNUA 3R83A 3PJ8A 4QNYA 5HE1A 4FIHA 4GW8A 4MAOA 4TKSA 3V5JA 2WO6A 2Y4PA 3QWJA 4FGBA 1R3CA 4IVDA 4JL9A 4O0SA 5DLSA 4XP3A 5HU3A 1FGKA 5T3QA 1OUKA 1KE6A 3DB6A 5DYJA 4XBRA 2XCKA 4CEGA 4XRJA 4EKLA 3COMA 3FLNC 3HYHA 3KKVA 3K2LA 4BBMA 2OWBA 4JDJA 3ETAA 1R0EA 4DEAA 4P4CA 4FIGA 4FT0A 3W1FA 3LIJA 4UN0C 3EQIA 1Q8ZA 1WVXA 2RF9A 5IEXA 3ORNA 1CM8A 1OIQA 3BHVA 3A7HA 3Q32A 3II5A 5HOAA 2CGVA 2OBJA 3P5KA 1U46A 2X39A 3PE1A 4DGMA 1W8CA 2VO3A 2XVDA 3F66A 2PZPA 2VTLA 4FT3A 4F08A 4XLIA 3JPVA 4UMTA 3D9VA 2OXDA 3OWPA 4X6RA 4D5HA 2XK8A 2PSQA 3BQRA 3CGOA 3CY2A 3KF7A 3ORZA 3P7BA 3RWPA 3DAKA 5HBHA 4BZOA 2G2IA 4JLCA 5LWNA 5CEPA 4FVPA 4ASXA 1CMKE 3F2RA 5I0BA 3MVJA 3RAIA 4G6NA 2R3PA 5CENA 4MXZA 2PZIA 2VTTA 3U55A 2WAJA 1FQ1B 3ZUVA 3RJCA 3PPZA 4DGLC 3MY5A 2V7AA 2WIHA 4AW0A 3NUPA 5AM6A 4LGHA 2JAMA 5A4LA 5HORA 3IGGA 3QUDA 5CAVA 2BR1A 1PJKA 2PK9A 5AMNA 4ZZMA 2UZDA 3D7ZA 5KKRC 4CRSA 5BUEA 3TUBA 2QNJA 2YIRA 4R6VA 2J0MB 2UVXA 2IZSA 3QALE 2X4ZA 3QHWA 4ONAA 4JOAA 2ZAZA 3E5AA 4BYJA 2RIOA 3A7JA 3PXRA 4IFCA 3RK5A 4PQNA 1XR1A 2IW6A 3MVHA 5DVRA 2WQMA 1KE9A 3OBJA 4WT6A 3BKBA 2VTRA 4GT3A 5CQUA 1GAGA 2WGJA 5T6KA 2C3LA 4BTMA 4O0TA 4A4OA 3GU4A 4I1ZA 4EWHA 5IQDA 3VN9A 1OL6A 3DBDA 2C68A 4BCHA 3LFBA 4IWQA 4EH3A 2Y0AA 4KS8A 1YI4A 2ITZA 4J95A 2R3OA 2VTAA 3NGAA 3RP9A 3ZYAA 4JAIA 5L2TA 3TACA 3FZOA 3CJGA 3H9RA 3QKLA 4BDCA 3P08A 1MP8A 4JQ8A 2GPHA 1ZYCA 3DGKA 3HX4A 3RNYA 2QR8A 1VZOA 2ONLC 2R3JA 5KCVA 3UJGA 3BYMA 3MBLA 4MHAA 3FY2A 4IVBA 2C6IA 1YWRA 4CQEA 1R0PA 2X2LA 3B8RA 4IZ5A 3ZEPA 4UMRA 4YTIA 1CKIA 3KU2A 5CEQA 3ANRA 3ZRMA 4M66A 3BBTB 3Q4ZA 4WSYA 5F94A 4B8LA 1ZY5A 3ZFYA 1Q41A 5HHWA 2B9HA 2W1CA 3K3IA 2V0DA 2VGOA 4GK3A 4CCUA 4FSNA 4E5AX 3W2RA 2Y9QA 3QCSA 4AACA 2IO6A 2XIKA 3RNIA 1R1WA 3QD0A 3VUIA 3KRJA 5CNOA 4QQJA 4II5A 3R02A 3DAEA 3P7CA 4Y85A 5FEEA 3R1QA 4ZJIA 4R77A 3GEQA 4FG8A 4G3FA 4JDHA 4L43A 3SVVA 5FDPA 5KUPA 4DH1A 3QZGA 2DS1A 1BI8A 1JWHA 2VD5A 4FK6A 3EWHA 4KS7A 3BZ3A 2PY3A 3JVSA 3QUPA 4ZP5A 3TDVA 3AC2A 4FG9A 3F61A 3DKCA 5CAPA 2WHBA 3CJFA 4O7VA 5TT7A 2ITPA 3OZ6A 3VW6A 3DV3A 3TCPA 3K54A 1NY3A 3WIGA 1U54A 4GJ2A 4NU1A 3FPMA 4O1OA 4YJOA 2BIYA 2GNIA 4I21A 5AP1A 4E6AA 3FZ1A 2HZNA 1FBNA 2FYSA 4C38A 4NKSA 2WTCA 4PY1A 3FSFA 3H0ZA 3OY1A 4RIXB 2X6EA 4ACMA 4OUCA 4P2KA 5FM3A 3EFJA 4FT5A 2W9FB 2P3GX 3EKNA 3ZFXA 4JJRA 3PY3A 4F6WA 5J87A 2R5TA 4IW0A 4IAZA 4QP1A 4WNPA 4FTKA 4MQ1A 4NWMA 5H9BA 3F5GA 4RLKA 4E1ZA 3BCEA 3S00A 3C0IA 2G1TA 3T3VA 5IISA 4TZRA 1Q4LA 4FODA 4NSTA 5GJFA 4F7JA 2CPKE 2VUWA 3R7EA 4OTHA 4EK3A 1WVWA 3O8TA 3P4KA 3AD6A 5I9YA 1H1PA 4XV1A 4X2JA 2PYWA 2X81A 2CGUA 4JAJA 3UOKA 2ZV2A 2X8IA 4WIHA 3DK6A 4ANNA 5D41A 1WVYA 4JG6A 3NIZA 1H1SA 4QRCA 5M56A 3LFSA 3DOGA 4IB5A 3UDBA 3R21A 4FEQA 1BI7A 4IB1A 4KD1A 3QKKA 5KMIA 2XJ2A 2A1AB 3HRBA 4BDHA 4TTHB 4EOIA 1NVQA 4O91A 5L2IA 2H6DA 4FGRA 4CYIA 2J4ZA 4W4YA 1YOLA 2YHVA 4DG3E 3LXPA 4P5ZA 3VBVA 3KN6A 4QMLA 3VS0A 2F2CB 4O38A 4PDPA 5J7HA 4J97A 3V5WA 1GNGA 2BFYA 2J6MA 4MCVA 4FVRA 4BF2A 3BIZA 4YO6A 4FV2A 4BDEA 5EI6A 3FE3A 5IUGA 2W1IA 2Z7LA 3IPHA 2YDKA 2UZWE 4TPTA 4UZHA 1RJBA 4RWKA 4RMZA 1OL1A 5FRIA 5BMMA 2YCQA 4WA9A 4GKHA 1IRKA 3ZHPC 4EYMA 3MS9A 5LQFA 1SVHA 1H27A 2GTMA 3FHRA 3O17A 3GU5A 2OJIA 4QP2A 4X3FA 5AX3A 1T46A 3BHYA 2GNFA 4FC0A 4BI0A 1JPAA 2X2MA 4DA5A 4FTLA 3NYOA 5H8EA 4B4LA 4MWIA 3ZEWA 3KL8A 4FUYA 2G2HA 3A2CA 3B2TA 1AD5A 4O0UA 5AUWA 4ASZA 4QP7A 4B6LA 4OBPA 4D28A 3Q04A 3JVRA 5IA2A 5IF1A 5DWRA 4HCTA 4FKUA 5HO6A 3D15A 4UV0A 4KB8A 4EUUA 5AV0A 4JVGA 4Z55A 4PWNA 3ZTXA 4KKEA 4U97A 4LV8A 2PVHA 4Y5HA 4C4FA 5BYZA 2XNBA 4H58A 4GRBA 4ZY6A 4KABA 5AADA 3SA0A 4EORA 5CF8A 4YJPA 4R3PA 4ZLOA 4GH2A 4EQCA 3V6RA 4JS8A 5IUIA 2YZLA 5CXZA 3VUGA 1OPLA 3R1YA 5A4TA 3SOAA 2YLEA 3KK8A 4A7CA 4S2ZA 1LR4A 3OD6X 1FINA 4ALWA 2GFCA 3IDBA 2PULA 3EN9A 4AXAA 2RG5A 3P9JA 5DE2A 3VUDA 3QRJA 2Y7JA 2PZRA 5AUZA 5K9IA 1WAKA 5I3RA 2XH5A 4AX8A 4ENYA 4DC2A 4XHKB 1PF8A 2ITXA 3KGAA 1WBTA 3CP9A 4EH5A 4EH8A 3RK9A 2E9PA 1Z57A 3FMJA 3ACJA 5KHXA 4FT9A 4IAYA 4X3FC 1UKIA 5GZAA 3C4CA 2EU9A 2JIVA 3QA0A 2OH0E 3L9PA 3UIMA 5ETFA 5K5XA 1KE5A 2W4OA 1Y6BA 4GUBA 5EOBA 2VO7A 5D7AA 5K3YA 3MVMA 4DFZE 4IZYA 4RVTA 3R8VA 4F6UA 1YDRE 2ZMCA 4FTIA 3DPKA 4FOBA 5CZHA 2PMLX 4M0YA 4U5JA 3SXRA 3UP7A 2R4BA 4QP3A 2Y6MA 3AC3A 2O3PA 4CYJA 2WIPA 3OCBA 2VTQA 2YCSA 1TQPA 4RJ5A 4FKTA 4R1VA 3R8PA 1FVRA 4QQCA 3QC9A 1ZAOA 2X2KA 4GK2A 2OXYA 3ZH8A 3KMMA 3LXLA 4MBIA 3MJ2A 4L53A 2QG5A 3TIZA 5G6VA 2NRYA 3QYWA 2XM8A 3K5UA 4C4HA 2OKRA 4BCFA 4W8EA 4GYIA 4CCBA 1G8SA 3QKMA 2XM9A 3UMXA 1NVRA 3ENMA 3QTXA 4OTIA 3LE6A 2R7IA 3CD3A 3OEZA 4QMYA 3R7VA 1Q8TA 4P7EA 3GC9A 3MH2A 3W33A 3FL4A 4G5JA 4E6DA 4I6HA 2XK6A 3I7BA 3KN5A 3I81A 4YUQA 4BR3A 3MB6A 4O22A 4YSMA 1H0WA 2EXMA 4ZK5A 1O9UA 4NJDA 4HVSA 3IQ7A 4DH3A 5HO8A 2VWXA 2B54A 2LAVA 3SC1A 1JLUE 4FIFA 4BCOA 4F6SA 4YTFA 4O84A 3VNTA 1UKHA 1OL2A 1Q24A 3CQUA 2YAAA 3UG2A 2UW0A 4FL2A 3NNUA 2XNEA 4MTAA 1ZYSA 4LGGA 2JC6A 2H8HA 2QURA 4LL0A 2YM4A 3F69A 4IDTA 4WSQA 3SXFA 3QQGA 4HZRA 4O21A 4IDVA 4NIFB 2UZNA 1RE8A 3QFVA 4YZNA 4UMPA 4UX9A 5CF4A 1Q99A 2IJMA 4YJTA 4PX6A 3NSZA 3PUPA 1PMEA 3PSDA 4OBOA 2G15A 5E8VA 4OTQA 3O2MA 4OAVB 4PDOA 2CKPA 2X1NA 2ZV7A 4C2VA 2WPAA 2DYLA 2X4FA 2XEZA 3ZLXA 3RGFA 2WQNA 3RKBA 3VVHA 5KMNA 5M4CA 4ID7A 2YAKA 2YDIA 2ITTA 2RFEA 4Y46A 3NZ0A 3GFEA 4CFMA 4LOPA 2C6OA 4IX3A 3EN6A 1P4FA 4J98A 4M8TA 3VHEA 4ANQA 2REIA 2XK7A 2CGWA 3R8UA 4Z16A 2R3KA 3CCNA 1PXOA 1WBOA 2JD5A 4LRJA 2GNJA 3IG7A 4MXXA 3M42A 3QCYA 4GU9A 3UC3A 3WYXA 4MK0A 2PTKA 4YJUA 5HBEA 3H9FA 4M12A 3HMOA 4RIWB 5E92A 4JBQA 5D9HA 4GYGA 3RTPA 3GENA 3KC3A 3E8NA 4HGEA 3W2QA 4D4SA 4E6CA 3EKKA 5I9UA 3A4OX 4CTCA 4FTJA 4TYHA 3BV3A 3PDTA 5GNKA 3KXXA 3GT8A 3HV3A 4UBAA 2FSOX 1NW1A 2CN5A 2F9GA 3SAYA 1JSTA 2YM6A 5C1QB 4FKRA 4FX3A 3DJ6A 1JOWB 1P2AA 2O0UA 3DNDA 3HV6A 3HZTA 2BTSA 4YJNA 2IPXA 2IW9A 3G33A 3MFUA 2WELA 2QI8A 3QRKA 4FZFB 4ANSA 4WUAA 3O8PA 3TNWA 3C51A 3ORIA 2WU7A 4OW8A 2G9XA 2C5NA 4U3ZA 4GG7A 4P5QA 4ZSEA 3QD2B 4FT7A 2WMXA 2WTIA 4KBAA 4K77A 4MD8E 2XIRA 1I09A 3VJOA 2HY81 2NPQA 3ORMA 4KINA 2BROA 2W5AA 3MESA 3TT0A 2QHNA 5ETCA 3U9NA 3VF9A 3FSKA 5ANJA 4RWIA 2ITNA 1P14A 2C6LA 3LFCA 4OT5A 2W96B 1F5QA 5CEMA 1BL7A 2I6LA 1PKGA 3LCOA 4QMQA 3OOMA 2WOUA 3C9WA 3CLYA 2PE1A 4HYHA 3TWJA 3PVUA 5TE0A 5KO1A 3O23A 5DG5A 5JRSA 4HYSA 2GHMA 4BCMA 5CU0A 2IVUA 4GFGA 2JLDA 2GU8A 2VTNA 1XH4A 4BGGA 4CXAA 4IXPA 4FG7A 5C27A 4D58A 3AOXA 2C0OA 3G0FA 4TN6A 3TV7A 3LLAA 1OL5A 3UIUA 4GKIA 4FKQA 4IFGA 2CCHA 4AWIA 3QRUA 3WF7A 2RKUA 4A4LA 3C1XA 2VTHA 4ZTLA 3VAPA 4JI9A 4XOZA 5EOLA 3EN4A 1M7NA 3C5IA 1ZOEA 2QOOA 3G15A 4X6QC 4XBUA 4EKKA 2VGPA 3PJCA 3O71A 4R7HA 4A9RA 4BDAA 4OBQA 3R7GA 4MBJA 5L2WA 2YDJA 3PA4A 4FR4A 3T3UA 1W0XC 5AIKA 5EQPA 2HIWA 3QUEA 3HP5A 5TR6A 1ZOGA 4HZSA 2C6DA 5KMLA 5E90A 3BE2A 2ETKA 4MX9A 4QOXA 1I44A 5M4UA 4I4FA 4ZJVA 5KBQA 1R78A 3C4WA 3KFAA 2GS6A 4GFMA 4YURA 3OW4A 5AP2A 1QPCA 3BU5A 3ZC5A 4ERKA 2VO6A 3GCVA 1DAYA 3A61A 5I3OA 1HOWA 3W8LA 4QYGA 5EI8A 4CQGA 5A4CA 3H3CA 3HV7A 4O6EA 2WTVA 3MA6A 4L3LA 4PPAA 4USFA 1IA8A 1YOJA 2BIKB 1OPJA 3LM5A 2BAQA 5HIEA 2FH9A 4BN1A 5HTIA 1V0BA 3A7IA 3L9LA 4DN5A 4ALVA 1OZ1A 3KRWA 3I4BA 5F95A 4L8MA 2JITA 4BDDA 3OOGA 5AR3A 2EB3A 5EKNA 1M2QA 3CKXA 4L00A 3LPBA 2YIXA 3R28A 4FNXA 4WHZA 4DG0E 3MWUA 4YTCA 3LQ3A 4XYFA 3I7CA 3OP5A 5CS6A 2E9OA 4H36A 2VU3A 4RQKA 5I9ZA 2CCIA 1OIRA 1GZNA 3KULB 3MH3A 3PVWA 3ET7A 5LVPA 3PE2A 1GZOA 4GIIA 5CTPA 3FQEA 4KA3A 4BDJA 3ZLYA 4I94A 3JXWA 4BWXA 3V5TA 4B8MA 3FZPA 2VX3A 3U4UA 5E8WA 4AOJA 1J7LA 1W98A 3REPA 3FXWA 5J9ZA 3QQKA 4O27B 3SRVB 5DMZA 4Y73A 4M0ZA 2O64A 1L3RE 4XMOA 3PXQA 1X8BA 4H3PA 4EOQA 5BYLA 3NAYA 3LCDA 5KMJA 2W05A 4TXCA 1YI6A 1YWNA 5ACBC 4RJ8A 4EC9A 4FKLA 4CD0A 3M11A 3UQGA 3L8PA 2Z2WA 4XG8A 4YHFA 1HCLA 4FZ6A 2YIYA 4RZWA 5IUHA 1RW8A 4IX4A 5BMSA 1NXKA 3SOCA 4E20A 5IQEA 3PTGA 4MNFA 1P5EA 3FYKX 3POOA 2I7QA 3C4XA 2C5XA 4Z9LA 3AQVA 3CE3A 4RPVA 1EH4A 2GDOA 3FKNA 5J5SA 3LJ2A 5HCXA 4C62A 2E9VA 4D1ZA 3QX2A 4KKHA 4EOSA 1H01A 4L42A 5E91A 4OLIA 4RA5A 2J2IB 5EQEA 4MNEB 3PP1A 5BUJA 4BRXA 5BVKA 3L9NA 1LPUA 3V8WA 4I6FA 4DITA 4FTAA 3QTSA 5GIPE 2JAVA 2CJMA 1B6CB 3MIYA 4FKJA 3ALNA 4I23A 4PL3A 2WMBA 4C4IA 3TIYA 4DFBA 5CAQA 3COIA 1AGWA
chains in the Genus database with same CATH superfamily
5JRQA 4EH2A 5HI2A 4AP7A 2WMAA 3PVGA 5BPYA 3GU6A 5J9LA 4CFUA 4B99A 5E4HA 5CY3A 1E1XA 3PXKA 4M67A 4AXDA 1ZY4A 2Q0NA 3TZMA 3WZJA 4U44A 4X2KA 2C5OA 3ZM4A 4RRVA 1XWSA 2UZVA 2QOIA 3IECA 3JYAA 4WG3A 4ACGA 4O82A 4DHJA 2VV9A 2WTDA 2BZJA 4HVDA 4PUZA 4HVGA 3ALOA 4EK5A 2HYYA 3MFSA 5TO8A 2C0TA 3G0EA 5HIDA 3RALA 3WE4A 1PMUA 5IMXA 4PDSA 5LMBA 3FEGA 3BHTA 3EJ1A 3EL8A 3DKOA 3Q9ZA 3UYTA 2QOKA 4ZZNA 4K33A 3KMWA 4YZCA 4A9UA 2YA9A 5M51A 2GFSA 5HG5A 4KNBA 3W2OA 3F5XA 2HK5A 4FKGA 4E8AA 3PRFA 5HVYA 3MPMA 1XJDA 4DLIA 1FMOE 2E2BA 4DGOA 5CI7A 3F82A 2QO2A 4JIAA 4DF3A 3QTIA 3BLRA 4D4VA 1M52A 5B7VA 2X8EA 4CMTA 4W9XA 3PIYA 2I0EA 4W4VA 1J91A 5K4IA 5IH6A 3RWQA 5FTOA 3COHA 5AIRA 4ZTQA 3TEIA 4I41A 4O2PA 3BU3A 1WBNA 2YERA 3WF9A 3NAXA 3I6UA 3QTRA 1TKIA 3FI2A 3UO6A 3CTQA 3DLSA 4M3QA 4LL5A 3OWLA 5DRDA 4JXFA 4U0IA 5L4QA 4RIYA 4NIFA 2YITA 2XZSA 4AGCA 4BKYA 3ELJA 2ZVAA 4GMYA 4O1PA 3VBQA 2NNWB 3F3TA 5CSVA 4EZ7A 4U43A 4AF3A 4QMPA 3H9OA 1YQJA 2OGVA 5CX9A 5E8SA 4UB7A 5JGAA 4F1TA 5AWMA 3EZVA 3I1AA 1VYWA 3GCSA 4IAAA 5M57A 1MQBA 3JY9A 1YI3A 3NUYA 2YISA 5FEDA 3HP2A 2IZTA 3N51A 5HVJA 5JFSA 4R8QA 3DAJA 4PMMA 4XCUA 3RZFA 4BVUA 3AC4A 4JBOA 4KWPA 3Q2JA 4F0FA 3BYVA 4MD7E 4DGNA 4QYFA 1XH5A 1JSUA 4TYEA 4JG8A 4BKZA 1WBPA 2YM5A 3WBLA 5HU9A 3EQFA 2OIBA 3G90X 4GSBA 1YXXA 4GIHA 4QT1A 3V5QA 3UPZA 4IEBA 2PMNX 3HLLA 1B38A 4C35A 4M7IA 4S31A 2E9NA 3LMIA 2OLCA 4ZSLA 5AR5A 2BILB 4ANLA 4C3RA 4N4SA 1JSVA 5I5ZA 3IOKA 3AC1A 4H3BA 4ZMFA 4D5KA 1J7IA 3ORTA 4RVMA 2VWVA 2GCDA 5E8XA 3SW4A 4ZAUA 4PMTA 4USEA 2BCJA 3DK3A 3HL7A 4JX3A 4PF4A 4F1OA 2I0HA 3KVWA 4FZAB 4MXCA 4BDKA 2BRHA 1GIIA 3NNVA 3IOPA 4GCJA 4JR3A 3UP2A 1JKLA 4DLJA 4E4MA 4GEOA 2X9FA 4GK4A 3P5JC 5EYMA 5L3AA 5LOHA 1H25A 2NO3A 2UW4A 2W1DA 2XYUA 3AMAA 4FRFA 2PVFA 3E87A 4PTEA 1LUFA 2VRXA 4J96A 3DS6A 3ZZWA 5HX8A 2HZ0A 4CZYB 3TXOA 4J53A 2CMWA 5CEOA 3QTQA 4YO4A 2VWZA 4FV1A 3PFQA 3MSSA 4EOOA 1FMKA 4YU2A 1QL6A 2WKMA 3S4QA 3F6XA 3QWKA 4OTWA 3HRFA 2CHLA 5E8ZA 3VQHA 4RX5A 1OGYA 4R78A 2RFNA 2QO7A 5E1EA 3VS2A 3QGYA 2WQBA 3M1SA 2GMXA 4R5SA 4ZJJA 3PWYA 4PRJA 4BKJA 3EH9A 4BWPA 5AEPA 5DH3A 3EYGA 4IQ6A 4PMSA 5FWKK 4MD9E 4QMZA 4ZTMA 2GNLA 4YJVA 1WMKA 2JKQA 5CWZA 4YP8A 4ZMEA 1ZOHA 5FG8A 3UVRA 3OF0A 1PXLA 5IH4A 2UW3A 3Q4CA 3LMHA 2Z8CA 4CNHA 5CAUA 5IA3A 4QO9A 4YR8A 3TUDA 4DCAA 3NW7A 4NUSA 3DFAA 4AFJA 4QPSA 1PXNA 4BCQA 4K11A 5AV4A 2R3IA 3GOKA 5D12A 5IU2A 3GP0A 4USDA 2Z02A 3NFGB 2F57A 2ZV8A 5FBOA 3GC7A 3KXHA 4G9RA 1ZYDA 3BHUA 4RWJA 1VYZA 5DA3A 4PV0A 4AXEA 2HY0A 1PXPA 4IJ9A 4I92A 4CZUA 3R04A 5HG9A 4BWKA 5HKMA 3DDPA 4I20A 4D2TA 3P1AA 3NYVA 5K5NA 3CGFA 3S1HA 4KIKB 2GS2A 4TYIA 5DT0A 4OTDA 3ZO3A 4WG4A 3UODA 3MN3A 4ACCA 5CASA 4JG7A 4LYNA 2XBAA 2ZYBA 3BPRA 5EYCA 3WARA 3IO7A 4G3GA 5D11A 2VTIA 4QQ5A 3KB7A 4TY1A 1G8AA 5BUIA 4CGAA 4QMVA 5L6WL 3EQHA 2W1EA 2ITQA 3ORPA 4IMYA 4CV8A 4CG8A 3LCKA 4EH6A 5K0XA 3BGPA 3Q6UA 4AW5A 1OKYA 4AUAA 3RAKA 2XNOA 2PVRA 1W82A 3F9NA 3K3JA 3LAUA 4R1YA 4Y95A 3WF5A 4FIEA 1L8TA 2QOFA 1GZ8A 3QLGA 4U3YA 4U8ZA 4D2SA 4NM3A 2UZLA 3F7WA 3KIOC 3ZZEA 3CSVA 4YZBA 4BTJA 3PUFC 3HV5A 1ERKA 3DT1A 4G17A 4YNOA 3ZS5A 4BL1A 2BKKA 1M2RA 4RFYA 1PXIA 4J8MA 2EWAA 3VS4A 3W32A 4LUDA 3FC2A 3VUHA 4ZXTA 4F64A 2W0JA 4F0GA 4RGJA 4O2ZA 1KOAA 2O8YA 4FSRA 4QP6A 4AN2A 1WCCA 3C4EA 4H3QA 2BRGA 4D55A 1VLRA 4C37A 4LG4A 3KULA 3IW4A 2B7AA 4XP0A 3U6HA 1S9JA 4FKIA 5CXHA 4DFNA 4N6YA 1HCKA 2XANA 4ZSAA 3O50A 4O81A 4TRLA 3VS5A 1UWHA 2OH4A 3QTUA 4HGSA 5CU2A 3T9TA 3DXQA 1SM2A 4E4NA 2ITUA 4IBMA 3LW0A 2BMCA 2WEIA 2Y6OA 4AGUA 4F65A 3DTWA 4DEEA 2IVTA 4DYMA 3Q3BA 4YZ9A 3LXKA 5AP5A 5KMMA 3NNXA 4X2GA 5A46A 4C33A 4EK4A 5AUYA 2Y4IB 3QBNA 4LRKA 4U41A 5GZ8A 5IQBA 4MQ2A 3A7GA 2VTSA 2BAJA 4IHPA 2OO8X 2UUEA 4AT5A 3GCUA 4JIKA 2AC5A 3R7IA 3CD8A 5B2LA 2QLUA 4IWPA 2B0QA 4O0YA 5IQAA 4HVIA 3BEAA 4DTKA 2F49A 4AA5A 2CSNA 3VS3A 5I9VA 3MPAA 3MFTA 2XNNA 4QTEA 4G3EA 5H2UA 5JN2A 5ANKA 3PY0A 3NVKI 1H8FA 4ANMA 3KXGA 3EHAA 3ROCA 4GT5A 4YLKA 2PZYA 5FUTA 3VC4A 4ENXA 3DK7A 3ORLA 2VTJA 5L2QA 4IC8A 4EONA 1REJA 1KV2A 1DI9A 1QMZA 3Q2MA 4FIJA 4RC3A 4AW2A 3GBZA 4UXLA 4CT1A 3PXZA 3EB0A 3ULIA 4Q5HA 4WUNA 5A3XA 3A99A 2HW7A 5ANDA 3EQDA 2B9FA 3QD3A 5BVOA 3Q96A 5CT7A 5E8YA 3HNGA 5C26A 2X6DA 4OTGA 4XJ0A 1WBVA 4K6ZA 4C58A 4RA4A 5CNNA 5ANOA 3NUUA 1W2CA 3BWJA 5EYKA 5IA5A 5DN3A 4CLIA 3N4VA 2XP2A 4O4BB 4YC3A 4UYNA 3SV0A 3TKHA 1PHKA 3OEFX 4ZLZA 3A60A 3WZDA 4N57A 3OVVA 3NYNA 5EK7A 3RPOA 3GC0A 4F7LA 1DS5A 1UNLA 4FV7A 3IDCA 4YLLA 3MDYA 1H4LA 3R8LA 1JKSA 3S95A 3MH1A 4ORKA 2Y8OA 5C4LA 3ORKA 3BELA 3IS5A 3E7OA 3FV8A 5IKWA 4QMUA 2QOBA 2UW9A 4AXFA 4ZOGA 2HW6A 3DBCA 5IMEA 4O7SA 5IQHA 3TN8A 4ARKA 3LFFA 1PYEA 3C4ZA 3V01A 3EQCA 1UA2A 2R3NA 4CTBA 2OJGA 3VQUA 3E8CA 5EW3A 4IC7A 5FLFA 4R3RA 2J50A 1U5QA 3HRCA 4MYGA 3QRIA 1H00A 3R9NA 1OMWA 2WMQA 3PLSA 3ZM9A 3R63A 5HBJA 4H1MA 3VBXA 2JBOA 4IANA 2IF8A 5E1SA 1B39A 3LJ1A 4ZTSA 4JDKA 4EH9A 1W7HA 1XH9A 3DTCA 4PMPA 2HWPA 4F9BA 2IN6A 2WTKC 3CC6A 5HNIX 5ITAA 5FTQA 3FY0A 5JFWA 2BRMA 2WMTA 3AMYA 5IA1A 4FEWA 1XBCA 3BLHA 5DFPA 1W84A 1OI9A 3KF4A 5C8KA 1GIJA 4FL3A 4RJ4A 2C3JA 3W8QA 3G6HA 3W0PA 3NDMA 1YVJA 1UU3A 4TWCA 1OPKA 2V7OA 2WXVA 4RX8A 3ACKA 2JFLA 1XH6A 2WTJA 3C50A 3ZBXA 2UZUE 5B2MA 4WKQA 2YCRA 3ZRKA 5EI2A 1Z5MA 5EW9A 3PPKA 3KQ7A 1XHAA 3Q5IA 1A48A 4J1RA 3TZ9A 3PA3A 3NCZA 4DTBA 2HXLA 3R9HA 2EUFB 3ZONA 4O4CA 4AA4A 2CDZA 3WYYA 3GFWA 3UVQA 3DQWA 4KSPA 4O7LA 1BL6A 3FJQE 5CSHA 3UOLA 4AGWA 5CAOA 2C6MA 4XRLA 5C03A 1XO2B 3Q4UA 4YGAA 5F9EA 4DH8A 4G3DA 4RIOA 4UZDA 3VS7A 1H28A 4AS0A 4FL1A 4QMOA 3QQFA 1OIYA 2CNQA 3OWJA 3D94A 2VTPA 3EOCA 3F3WA 4FUXA 3CEKA 4I5MA 4LDTA 2VZ6A 4MF0A 1K3AA 1ZWSA 2OF2A 5IQIA 3TV6A 5EYDA 3QXPA 4PL5A 1URWA 2WOTA 2IG7A 5M06A 1XH7A 5C4KA 3RI1A 4L45A 4BGHA 3UDSA 2AC3A 4LOOA 2QD9A 2RGPA 4AA0A 5EM5A 3RM6A 5BVFA 3N4UA 4CG9A 4RVLA 4Z7HA 3DY7A 3FMNA 3FMLA 4I5HA 1NA7A 2XNGA 3FLSA 3WE8A 4QMTA 1GZKA 3K5VA 3VF8A 3AT3A 2IVVA 1OECA 2R64A 2XEYA 5EHLA 2C3IB 3ZSIA 4A9SA 3L8XA 1O6KA 4BZDA 4DEHA 5I4NA 4O0WA 1IAHA 4G2FA 2HOGA 3VS6A 5FP6A 1J1CA 4DG2E 4PPBA 5IH5A 1YOMA 4R7IA 1OBGA 4ZS4A 4XEYA 2JBPA 2X0GA 2OU7A 4LGDA 1TVOA 1H26A 1O6YA 3FI8A 4MUQA 5HTCA 4NW6A 3HGKA 4F63A 3VW8A 3ZXZA 5KMOA 5ANIA 1KOBA 2GTNA 1BX6A 2C5VA 2QC6A 2YEXA 4EH4A 5JKGA 2H34A 3UIXA 5JFVA 2P33A 5J95A 4XG7A 3VRZA 1IR3A 4YZMA 3MY1A 4RC2A 3FKLA 1GIHA 4YJRA 3GU7A 3R7UA 5FXQA 4PTCA 3BI6A 1DM2A 5M07A 3BBWA 2PUPA 2EVAA 3GOPA 2PPQA 2OIDA 2W4JA 3C0HA 4WNOA 1UNGA 1ZXEA 1JKTA 2PVNA 3O8UA 1MRYA 4Y72A 4Q9ZA 4YSJA 5LCJA 2JDSA 3FWQA 3EN5A 4EL9A 4RJ6A 4U42A 5GJDA 1M7QA 3HDNA 2ETRA 2ZV9A 4M68A 3GC8A 3HV4A 3OTVA 4UXQA 1CSNA 5BVWA 4GL9A 4D2VA 3E93A 3D2KA 5M53A 3DZQA 5ETIA 4BIEA 5IDPA 2O65A 2XKEA 4QP8A 5DIAA 4AT4A 3QYZA 2FGIA 3PP0A 3C4FA 4ANBA 2PL0A 2C1AA 4AG8A 3UQCA 3EQRA 3SX9A 4N70A 4JDIA 3LFAA 3HA8A 3SKCA 4EI4A 2BVAA 3ZO4A 3P23A 3DDQA 3G6GA 5CF6A 4MEDA 4D4YA 3LVPA 5E8TA 5HLNA 3MGYA 2VX1A 2UW6A 1LEWA 3I5NA 4DGGA 3QA8A 4JBPA 4JT3A 2QQ7A 2X0PA 5IQFA 3EFKA 5IDNA 5JQ8A 1URCA 3TG1A 3R0TA 4F0IA 2VWWA 2R0UA 1IEPA 1MRVA 1OB3A 4RIXA 3JS2A 5AM7A 3ZRLA 4F1MA 2ITWA 4FSZA 5HNGA 2P4IA 1BYGA 4O0RA 3A8WA 4ZTNA 1YHWA 3G2FA 1PXKA 2PE0A 2PWLA 4XH6A 5HE0A 2YN8A 5FQDC 3P7AA 4E93A 4FEUA 2FB8A 5C01A 3WIKA 3QF9A 4IZAA 5F4NA 2ZM3A 4RJ7A 4I5CA 2BRBA 3D2IA 3IKAA 4E5BA 2ZJWA 4C36A 3D7TB 1Y8GA 3IW8A 4RZVA 1U59A 3V5PA 4ITHA 4JQ7A 1S9IA 5E7RA 2BHHA 4MWHA 5CEIA 3TTIA 3WF8A 2KTYA 4C4EA 2ZM4A 2ZMDA 1KUTA 2PUNA 4NK9A 1TZDA 5E8UA 2R7BA 4F09A 1JVPP 2ITVA 2W99B 5KBRA 3V6SA 4HGTA 4XOYA 1SVGA 3VBWA 2OICA 2XNPA 5AX9A 2CNVA 4PNIA 1YDTE 2B4SB 5AUXA 3KMUA 1PW2A 5GINE 3AT2A 1AQ1A 1U54B 1F3MC 3B2WA 5HCYA 4AFEA 3HECA 4FSYA 1TQIA 2BZHB 3RINA 1O6LA 4D9TA 5L2SA 3POZA 4EBVA 2I0YA 2XNMA 3OTUA 2R3HA 2OZOA 2WEVA 2LGCA 3R73A 4FYNA 3U4WA 3VJNA 2QOLA 4KRDA 5IZFA 4A06A 2JFMA 4DEIA 3O0GA 5EM7A 4BCKA 3SG8A 4L9IA 3A7FA 3KA0A 5D10A 3CKWA 5CF5A 4CV9A 3Q4TA 2GNHA 2ZB1A 3KVXA 3DJ5A 4XX9A 3DFCB 4FJVA 4U79A 4M13A 2WU6A 1G3NA 3FQHA 2DWBA 3LQ5A 4IWDA 4NM0A 4U80A 5KZ0A 5A4EA 1OKWA 3VBYA 2E9UA 2XARA 1M17A 4BDBA 4E3CA 2PVMA 2PMIA 4UALA 4OR5A 4J71A 2OJFE 3VBTA 3NMUF 2JDRA 3FMDA 2NP8A 4ACHA 2WQOA 2OXXA 4HW7A 3HMIA 3C13A 3KK9A 4PP9A 4U45A 4AQCA 3RHKA 4AZFA 1MUOA 3HA6A 5GJGA 3VULA 5D1JA 4D2PA 2F7ZE 4FV6A 4OGRA 4KBKA 5IG1A 1V1KA 1LEZA 1Q8YA 1CKPA 2V5QA 2BPMA 2PUIA 2C6TA 4PDYA 3O7LB 3PJ2A 3FXZA 3UMWA 5HD4A 3EFLA 4O86A 4EZ5A 3OCGA 5J5TA 1ZZ2A 2OF4A 2JKMA 3CS9A 4S34A 4QTCA 2PUUA 4W4WA 4HPTE 4AXCA 4I4EA 4LQMA 5BYYA 4DBXA 3SHEA 3SQQA 2CGXA 2EB2A 2J0KA 2G2FA 4EK8A 2W1GA 3QAME 4FIIA 5JZNA 4I6QA 4AZWA 4QNAA 4ALUA 5BX0A 1CDKA 1JNKA 3VS1A 2FSTX 2JKOA 3QGWA 3MTFA 3A62A 4QP9A 5KE0A 3FZSA 3SDJA 2C30A 2H96A 1CKJA 1OM1A 3AD5A 1IAJA 2QG7A 4ZTHA 2WFYA 4J7BA 1ZMVA 5CZIA 4D0WA 5KX8A 3UZTA 1JKKA 2VTOA 2Y4IC 5EDQA 5EQYA 4I24A 4AAYA 3TV4A 4O7WA 4FEXA 2HELA 3DKGA 2UZBA 3I5ZA 1Y91A 1WFCA 4X3FB 4BTKA 1WBSA 3LJ0A 4NCTA 3NNWA 1SZMA 4DEGA 4FSQA 4RQVA 4CFXA 3QCXA 2FUMA 1GY3A 4ZY4A 5IQGA 2BALA 3Q60A 4FICA 5TOZA 3RCJA 3TNHA 4EQMA 3ROYA 2FSLX 5LVLA 3ZBFA 5M08A 1YKRA 3KEXA 4UYAA 3LQ8A 4MH7A 2XKCA 4FSMA 4J52A 3KXMA 3ZSGA 4TNDA 2R2PA 4S32A 4A9YA 4YHJA 4FTUA 2ZOQA 2A27A 3D5WA 3HMMA 4RWLA 2O5KA 3W0RA 4EJ7A 1W2DA 5JZJA 3D4QA 4G5PA 2FVDA 4XV3A 4UMQA 3BLQA 5J8IA 2A19B 1IASA 3UO4A 4GG5A 3DBEA 3L9MA 4AE9A 3OXIA 3PPJA 5JH6A 3CXWA 5EFQA 5BVEA 3Q6WA 4QMSA 3SW7A 3RVGA 3I79A 2W4KA 5CVGA 3TZ7A 3S0OA 1SMHA 3E92A 2PE2A 5TKDA 3OG7A 1Q62A 5FDXA 5AR7A 4DAWA 1PRYA 3HUBA 2WD1A 4DFUA 2IZUA 1UU8A 2RSVA 4FI1A 4IM2A 4IAIA 4EUTA 4O83A 4FK3A 4LOQA 1SNUA 4C0TA 2XB7A 3PSBA 4NFMA 3EQPA 5ETAA 5A9UA 4JNWA 3RM7A 4A9TA 4FKSA 4BCIA 1K9AA 3PA5A 3UPXA 4APCA 3P79A 4QDVA 4NCTC 4GVAA 2PHKA 3DKFA 3LCSA 4QTAA 5CU4A 3W10A 2JIUA 2QO9A 1YXUA 4K1BA 3RHXA 3NX8A 4FNYA 4C02A 4CFNA 4F70A 2C0IA 3F5UA 4E7WA 2R3MA 3VWAA 2Q0BA 3LHJA 4L7FA 4I22A 5IEVA 2HENA 4I6BA 5IA4A 2QU5A 3F88A 5L6PA 4DHFA 4QMNA 4FE2A 4K18A 4NYEA 4FYOA 3TM0A 3PWDA 4FBXA 4RFMA 2QOQA 4EOJA 2XS0A 4EZ3A 3HAMA 4AU8A 4GJ3A 4TT7A 5A4QA 3UQFA 3AXWA 5DR6A 5L8LA 5GZ9A 3PZEA 4UWYA 3UYSA 4F7NA 3R9OA 3R1SA 2B1PA 5JK3A 2WMUA 4C59A 3QLFA 4GV1A 4I93A 5KMKA 4ACDA 2BKZA 4A07A 4DFLA 3DBQA 3LMGA 4BC6A 4XLVA 4K9YA 4AZTA 5B0XA 3HMPA 5A6OA 5HTBA 3E8DA 5M55A 3C7QA 4WNKA 3I0QA 1H1QA 2HZ4A 3OCTA 5FM2A 4YTHA 5CEKA 4FKOA 3U51A 4ASEA 3RCDA 4RIWA 4RLLA 1Q97A 1OITA 2O63A 3FBVA 5HEZA 3NW6A 5HICA 1U4DA 2BDFA 1SVEA 3OHTA 4Y8DA 5CQWA 3T8OA 1SNXA 4MXYA 4BBEA 3SG9A 3EYHA 5C9CA 4I5PA 4CMUA 1UVRA 1YXTA 3PIZA 5H8GA 5AA8A 2XAMA 4QTBA 2RG6A 1XBBA 3D83A 5FGKA 4H39A 4NM5A 3R9RA 2XK4A 5DEYA 3TNQB 3PJ3A 4B0GA 2UW8A 4RSSA 3ENHA 3JUHA 3COKA 2C69A 2ONLA 1E9HA 2UZOA 4BDGA 5JT2A 4FV9A 3UZPA 5CALA 2WNTA 3TZ8A 3RAWA 5AR8A 4HGLA 4HCUA 3O7LD 5JMSA 2XA4A 2CLQA 2J51A 4GVJA 2YWPA 4TYJA 4I0TA 4YC8A 3OCSA 4K8AA 5BVNA 4O7YA 2JEDA 4EWQA 2X7FA 3DLZA 3QQHA 4X2NA 4CKIA 3VUTA 4G34A 4ZIMA 2V55A 4HYIA 4AT3A 4QPAA 4BJJB 1ZZLA 3RPSA 5FTGA 3F2AA 2RFDA 4CZTA 1M2PA 3OXZA 2R0IA 3E3BX 3D0EA 3FMKA 3QD4A 3DQXA 5JGBA 5DNRA 3DNEA 5LVMA 4MXOA 4JRVA 4BZNA 1ZMUA 5EH0A 3MVLA 3BLAA 2RFSA 2JDVA 3ZMMA 4B7TA 1H07A 4LFIA 2JGZA 2VN9A 3H4JA 3NWWA 4X0MA 4C2WA 3FMEA 3NUAA 2PZ5A 4FMQA 3NVMB 4NKAA 3HAVA 4AOIA 5AJQA 1UV5A 1UU7A 4ZSGA 1H08A 2R3QA 3QHRA 2QR7A 3VIDA 4FV4A 3HEGA 4TYHB 2X0QA 2C4GA 4XNEA 4FTTA 3QTZA 4V04A 4R5YA 5HGIA 2YCFA 3C5UA 4DHZA 3NUXA 4L7SA 2W5BA 3UTOA 4O7RA 4XP2A 2BDWA 3LOKA 3NW5A 3OC1A 4O4FA 2ZM1A 3DBFA 2XCHA 4O0VA 4X7QA 4A4XA 3GUBA 1PXJA 2PMOX 2PVLA 2YIQA 3NR9A 3G9NA 3QTWA 4O96A 4S33A 4TWNA 4YJSA 4CKRA 3L1SA 3ZOSA 5IEYA 2YWVA 3Q53A 4XG2A 3QZFA 2Q83A 1W2FA 3D7TA 3WILA 1J3HA 1YWVA 3KRRA 5LARA 2GS7A 3U8WA 2BDJA 3GGFA 1XQZA 4HCVA 5AAFA 3D14A 2YACA 4FNWA 1KV1A 4KRCA 3ZUTA 4AAAA 5JSMA 2I1MA 1NT2A 3JY0A 3UOJA 3KCFA 2OK1A 4FKVA 3N4TA 3ZDIA 1Q61A 4G9CA 4ZSJA 3UBDA 4J8NA 1UNHA 3FMHA 4BTFA 5LXMA 1V0PA 3KCKA 3UVPA 1UU9A 5AAEA 3FUPA 3DZOA 5GHVA 4QQTA 4IVCA 4DH7A 3AC8A 5F1ZA 5JEBA 4ZS0A 1ZLTA 2W1HA 4RFZA 4M14A 4O4EA 2SRCA 3W0OA 2VAGA 3DU8A 3MPTA 3I6WA 3IGOA 4KIPA 4RG0A 3RZBA 4YPDA 4F9CA 1OKZA 4FKPA 1U5RA 4DFXE 4QMXA 2RL5A 3BYSA 3FDNA 3W2SA 5A6NA 5CVFA 3FHIA 5LJJA 1CTPE 2W5HA 3R00A 1T45A 2ACXA 5ANEA 4O6LA 1PMNA 3MI9A 3P78A 3KXZA 4FSUA 1Z9XA 4QYYA 5DOSA 3EQGA 3QCQA 3VO3A 5AA9A 2XUUA 3DXPA 5M4IA 4BDFA 3NEWA 4CMOA 5HVKA 1PMVA 5CT0A 5IA0A 5LWMA 2UZEA 4V0GB 3UNKA 5D7VA 4E73A 2VWIA 1LP4A 3BHHA 4TL0A 1MRUA 5AP7A 5CSWA 4ZEGA 3ZO1A 4BCNA 4CFVA 4LI5A 2A0CX 3DA6A 3FZRA 4TNBA 4JQEA 5DR2A 4KUJA 2EXEA 2YABA 2R3GA 4PNKA 1APME 5CSPA 4KBCA 1QCFA 3OBGA 4E5WA 3QXOA 4WNMA 3PVBA 3QQLA 4YNEA 4BCGA 3MIAA 1YHVA 4XV2A 2DUVA 2P0CA 4NW5A 2QKWB 3SRVA 5EM8A 4ZTRA 4BY9E 1XH8A 3NLBA 4L01A 1E1VA 2YM3A 5BVDA 3CR0A 3CBLA 4XS2A 3UNJA 3VUMA 5EHOA 5L6OA 3EN7A 3ZC6A 5I9XA 2H9VA 4X2FA 4ZY5A 4L3JA 1QPDA 4U9AA 5AP4A 3BV2A 3FI3A 3NCGA 3KREA 4Q5EA 5EDRA 5CANA 5IPJA 5HCZA 2B53A 3OMVA 3ZUUA 3GB2A 1A9UA 4HOKA 4QYEA 4RVKA 3OT8A 4DT9A 4AZEA 3QC4A 3H30A 3NYXA 4DBNA 4AZVA 1NVSA 4JRNA 2XKFA 4BICA 3QX4A 3ITZA 2P55A 2XK3A 4DE4A 4MNEA 4RJ3A 3CQEA 4XG6A 4YPSA 3WF6A 1A06A 5C8NA 1OBDA 2B55A 3Q52A 4PP7A 3M2WA 1KE8A 2ZDUA 5HO7A 3FL5A 4XG4A 1BMKA 4FNZA 4C8BA 2UW5A 4OT6A 4IM3A 1XBAA 4BBFA 4EYJA 2W7XA 5LCKA 1ZARA 2QLQA 2W9ZB 5DT3A 5EM6A 3CIKA 4LUEA 4N6ZA 5H3QA 2WMSA 1RQQA 3MJ1A 4FF8A 3O96A 5FD2A 2P2IA 2F7XE 3V3VA 3ATSA 4G31A 3SD0A 1ATPE 4AOTA 4I0RA 1PXMA 3GU8A 3V51A 3W0NA 4JMQA 4E4LA 4C4GA 1XKKA 2VTMA 3WZKA 5DEWA 4OTFA 2R3RA 3PJ1A 5HD7A 4L68A 3RMFA 4F9WA 2V22A 2BFXA 4FTCA 4BIBA 3FLWA 3OT3A 2B9IA 5FXRA 5AR4A 2J5FA 4DEDA 5HZNA 4NJ3A 5AFVA 4ASDA 4NFNA 4FEVA 2F4JA 3LZBA 4JR7A 3E63A 5B2KA 3AKKA 3LM0A 4V05A 4EK6A 4LMUA 5BV3A 2XALA 5H8BA 3ZLSA 4CRLA 2HCKA 3G5DA 4TWPA 2QODA 4EHEA 4EEVA 3ANQA 2I0VA 4L52A 4B9DA 4E6QA 4Z3VA 3U6IA 1VEBA 1J1BA 4W4XA 1FVVA 2WB8A 3DJ7A 4D1SA 4PL4A 4I0SA 4AN9A 3ZO2A 4Y5QA 3FZTA 1WBWA 3CPBA 3ZXTA