5AP7A

Naturally occurring mutations in the mps1 gene predispose cells to kinase inhibitor drug resistance.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
286
structure length
263
Chain Sequence
GTENLYFQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMEWGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPVGTVNYMPPEAIKDISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords MONOPOLAR SPINDLE KINASE 1
publication title Naturally Occurring Mutations in the Mps1 Gene Predispose Cells to Kinase Inhibitor Drug Resistance.
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 263
sequence length 286
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2015-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ap7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ap7A01
3VUMA 3UDBA 3KCKA 4IM3A 4IC8A 4O91A 3MS9A 4A7CA 2F7XE 4F08A 5BVNA 5CEPA 4XCUA 4W9XA 1IG1A 4CG8A 1WZYA 3AC2A 3UJGA 3DS6A 1P4OA 4NKSA 3BBTB 1Y91A 2R3LA 3SX9A 4EYMA 5M06A 5JGDA 1OMWA 4OR5A 5I9VA 4OAUC 4YZMA 4AE6A 2P0CA 5DIAA 4MQ2A 2JLDA 4FV4A 4PNIA 4QMPA 5A4CA 5GZ8A 1TQMA 3SXFA 2BROA 3QHRA 5DE2A 5AX9A 2GS6A 3LIJA 5HEZA 3R7OA 4MF0A 5T3QA 1R39A 4TWCA 4FIGA 3IW4A 3ZFYA 4GFMA 5EFQA 4C3FA 4WNMA 2HCKA 4F6UA 4MWHA 1J7IA 4UX9A 4KIOA 3QLFA 5DVRA 3Q5IA 1Y6BA 2J6MA 2UW8A 2ERKA 4I21A 5FDXA 4CLJA 5L2TA 1U59A 1GZ8A 2VTHA 3LCOA 4HYIA 2ITWA 2QU6A 2A2AA 1FBNA 3FZSA 3FLWA 4J71A 4MD9E 5DYJA 2C5YA 3CKXA 3MYGA 4GUEA 5F1ZA 4YGAA 3W2OA 4IVCA 1K2PA 4E5BA 4F63A 3R7EA 3FSFA 3QCYA 3OROA 3HA8A 4G2FA 5L4QA 4BCIA 4RJ7A 4CT1A 3CD3A 2WOTA 3UMXA 1YKRA 3R8UA 5AP2A 3OZ6A 4RPVA 2XIRA 2X8EA 3JVRA 4I41A 4RZWA 5FGKA 4S30A 4XYFA 3RP9A 3C51A 3ZSIA 4AAAA 1Z57A 4FF8A 1YXTA 2OZAB 4C4JA 4ZJVA 2XKFA 3QXPA 4GL9A 1OPJA 4QYEA 4R1VA 2E9UA 2R4BA 4FL2A 4N6ZA 5KMOA 3V01A 5M44A 4BTKA 4D58A 3QLGA 3OXIA 2FYSA 5FTGA 4K11A 5HGIA 3T8OA 4D0XA 4MD7E 3WBLA 3VUGA 2JFMA 3HMMA 4FV2A 3BELA 4BDBA 1IR3A 3UC3A 1G3NA 3UPXA 2Z7SA 4L8MA 3C0GA 3I79A 4L42A 4O0SA 3Q4ZA 4CKRA 5HLPA 3IW5A 4TT7A 1Q8YA 3TKUA 3OCGA 4P4CA 5EYMA 2JBPA 4QT1A 4MAOA 3GFEA 2NO3A 3GB2A 1XQZA 3PJ8A 5AV0A 4H1JA 5H3QA 4CEGA 5IQFA 4ANLA 4YO4A 4MH7A 1H27A 4NJ3A 1WFCA 3KRWA 3GCUA 4UWCA 3VBQA 2O63A 3EB0A 3T9TA 1JKKA 2JIVA 2R0IA 3R7YA 4JNWA 4A4XA 4G6LA 4IIRA 3DLZA 3ZRMA 2VTLA 2XNPA 4W4XA 2XNOA 4GT5A 4XP0A 5BUEA 4OT5A 4TNBA 3E8NA 4XG6A 5E8XA 4EK8A 5AV3A 4IVDA 4PQNA 4UALA 5JGAA 2PK9A 5AP3A 3FKOA 4S31A 3PIZA 3LXLA 2C3JA 1JLUE 4G5PA 3HP2A 4FKPA 3B2TA 2W5BA 3TZ9A 4U79A 3H4JA 1IA8A 4FTIA 3OBGA 4EORA 2YWPA 4RQVA 5IKWA 3C4CA 2WTVA 4O0RA 4L7SA 2WKMA 4JOAA 4DH5A 4M12A 5CNNA 3PY3A 3V04A 3FWQA 2PYWA 3LFNA 3W8QA 4IW0A 3GQIA 4BY9E 2BRBA 3VS4A 2NP8A 4A9RA 3FI4A 1L8TA 3NZ0A 2E9OA 4AW2A 5BVWA 2I0HA 4NTSA 3V5TA 3FV8A 4BBMA 1M52A 3EYGA 3AXWA 1ZMVA 5GJFA 1Q8ZA 5EHYA 5KZ0A 3DCVA 4E1ZA 2W1EA 4KWPA 5M55A 2X0GA 3DT1A 5L2WA 3E92A 4BCHA 3K2LA 4YPSA 3TN8A 4DFXE 3EQGA 4H58A 4RVMA 4YTHA 4OTHA 2QOQA 3MI9A 4E7WA 2VTJA 3BV3A 3F5UA 1Q8TA 2FSOX 4S2ZA 3LMHA 3AC1A 4AA5A 3FYJX 1W0XC 3MPAA 5J8IA 4CXAA 3ATTA 3O96A 3KVWA 3FEGA 1B38A 2YM5A 3TNQB 2QI8A 2Z02A 3LFEA 4O7VA 3V6RA 2Q0BA 3VUKA 5CTPA 4MTAA 5L3AA 2XP2A 2V0DA 4ZTRA 2IVSA 2QQ7A 2UZTA 2BZHB 3JYAA 4NSTA 4FIHA 4GEOA 3DJ5A 3K5UA 5J5SA 5BVOA 1W83A 3FC2A 3OW3A 5KHXA 4WA9A 5A6NA 1PXLA 4I4FA 4UV0A 5HIEA 5EQEA 5KKRB 4B7TA 4IEBA 4M15A 4XG8A 3Q9XA 1ZARA 1ERKA 3DXPA 2V7OA 2X8IA 3TV7A 3AD4A 4J8MA 3R63A 3CC6A 3ERKA 3DXQA 2PVKA 2OG8A 2B9FA 4S32A 3PJ1A 4BL1A 3S95A 4FKLA 4FTTA 1OKVA 1OL6A 3BLHA 4FSYA 5CLPA 2CJMA 5EHLA 5AA8A 4UXLA 5HLNA 3KCFA 3GGFA 1O6YA 4APCA 3U54A 5BYZA 1W7HA 2R3QA 3NDMA 4PV0A 4BDEA 5DR6A 4EZ7A 1QPCA 3VRYA 3OWKA 3R1QA 4DF3A 3HV6A 3ZLWA 3PXRA 4KINA 3UO6A 2VRXA 5CS6A 3HUCA 4LRKA 3RM7A 3QTSA 4BZNA 3CCNA 4J8NA 3DTWA 5IQBA 5AR8A 4QQ5A 4DT9A 4IM2A 5AV4A 4Q5EA 3Q6WA 4YZBA 2W1CA 1HCLA 2OJGA 2WMUA 2YCQA 3DKOA 3PE1A 1DI8A 3MY1A 3MESA 2GNLA 4DBXA 2B9HA 4E6CA 3PUPA 4FTOA 5LVLA 2R3FA 4AFJA 2CKOA 2WB8A 2GNGA 4XUFA 4O38A 5BVFA 2GQGA 4NFNA 2ZV2A 5LMBA 3CJFA 4WG3A 3QKLA 4EUTA 3ANQA 3QQLA 2JAMA 3ODZX 3IOKA 2ZVAA 4IADA 4P2KA 3V51A 3O0GA 4QP4A 1OUKA 5A6OA 4LFIA 4GVJA 4WSQA 2WTDA 4Y72A 3DBFA 2C6DA 4DH1A 1LEWA 3DAEA 4TWPA 4GIHA 3I1AA 5E8WA 5HKMA 3ZONA 2X4FA 3HX4A 4O27B 4WG4A 3FMDA 3HA6A 4CD0A 1G8AA 3FY2A 4BTMA 3SW4A 3WZKA 4FZAB 4X7QA 2F7EE 5ITAA 5B2KA 3R1SA 4YTFA 4MBJA 2XK6A 2PVRA 4CSVA 5AR2A 5HE1A 4DEHA 1KUTA 4I5MA 2XK9A 5IH6A 1J1CA 3NUXA 2QVSE 3AGLA 4U45A 4YJNA 5HU3A 3OCSA 2W9FB 2ESMA 2Y6OA 4TN6A 4FMQA 4X6QC 5AP5A 2XNMA 3CP9A 1XWSA 4TY1A 4YZNA 1VYZA 4WRGA 5FWKK 3SC1A 2HK5A 1F0QA 3K54A 3M42A 5ETAA 3UVRA 4FE2A 4EJNA 3VQUA 5BX0A 4MBLA 5EKNA 1U5RA 2J5EA 5IU2A 4ASZA 2XKEA 3EQDA 3FMKA 3UBDA 5IA5A 5I5ZA 5LWNA 3RBWA 2EXMA 3L9PA 3O7LD 4IZAA 3VUIA 1YW2A 4XG4A 5AR5A 5HG7A 3NS9A 3FMLA 3FZPA 3RK5A 3FBVA 3DTCA 5F95A 4E4XA 3IO7A 3QGYA 4NEUA 3NVMB 3C0IA 4LV8A 3BU6A 5HE0A 3FJQE 4M0YA 3P1AA 3PE2A 1IRKA 3PYYA 4WUNA 2QC6A 4RT7A 2BCJA 3POZA 3RHKA 4DINA 4AA4A 1J7UA 2PL0A 1MRUA 4G3GA 3RJCA 4LGHA 3TZ8A 4LOPA 2GQRA 4Y5HA 4FNXA 3R8PA 2ETKA 4F9AA 2WTKB 2NRYA 5EM5A 2R3NA 3TNIA 4BB4A 4USEA 2YM4A 1WBTA 2OH0E 2C69A 2WMQA 5EDPA 1RQQA 4FL1A 3CS9A 4D1XA 2OGVA 4USDA 3E8EA 4QNYA 4KKEA 2YZLA 3KXHA 1FPUA 1PKDA 3CR0A 4HYSA 5IQCA 5FXQA 3BLRA 4OGRA 4IB1A 3VO3A 3R9OA 1R1WA 4I4EA 3FZOA 2JDVA 4E20A 5CAUA 2VWZA 3ATSA 5JFXA 5M4UA 4GS6A 3HRCA 3R8VA 3QD2B 3E8CA 4IC7A 3QXOA 1OZ1A 5CF6A 2PE1A 4PMMA 4L44A 4UMPA 5FTOA 2C6OA 3ORTA 4DHFA 3VBVA 5AUZA 4WHZA 2C68A 2YFXA 3IDCA 4W4YA 4ZK5A 2I0VA 4X3FB 3PVGA 1BUHA 3DBQA 3QBNA 2BZIB 3V5PA 2XBAA 2IZTA 2XCKA 4FSRA 4H36A 4KKGA 3NIZA 4XOYA 4PPAA 3OG7A 2XK3A 4LRMA 3Q9YA 3F3TA 4QTDA 4L43A 4ITHA 3ZXZA 2OXDA 5HLWA 3W2SA 5L6OA 2QCSA 2ONLC 4P90A 4PY1A 5JFSA 1JSVA 2XK4A 3QTUA 3IKAA 3IDPA 4WUAA 5J7BA 2QO7A 4RJ5A 2ITQA 3BLQA 4DH3A 5HIBA 4RA4A 2WTCA 5AP7A 4QPAA 3LMIA 3PRIA 4FSUA 4HPUE 2BKKA 4GSBA 4O84A 3BZ3A 4JR7A 4V0GA 3T9IA 3LQ8A 3VHEA 4EH9A 3ZC5A 4EHZA 4ZZNA 3F5XA 3SXRA 4A4LA 4RIYA 4E26A 4QQTA 2XCHA 5LVOA 3DZOA 1ZYDA 1STCE 4UEUA 2EWAA 5CSPA 1U54A 4ZS4A 2R3JA 3QZGA 3KU2A 2R3HA 1YXXA 5JGBA 3PZEA 1WBSA 1PXIA 4EOSA 3HAMA 3ITZA 4E73A 3P08A 2BKZA 3L9LA 2PZIA 2CKEA 3V8SA 1XHAA 2J9MA 3FLYA 3L9MA 3PY1A 3MIAA 4JG7A 3U4WA 4YP8A 2BHEA 4NM5A 4TYJA 4U43A 4GVAA 4I6BA 3NW5A 4RJ4A 3QZFA 2YDJA 3I7BA 2CNQA 1RDQE 3EQFA 3HV7A 2PVJA 2WGJA 1PF8A 2UUEA 4FV5A 3C7QA 3NAYA 4TZRA 3FLSA 4JRNA 1OL7A 2WTJA 3BHTA 5HBHA 5ETFA 2HXQA 1H24A 4IVBA 1R0PA 4FZ7A 5CX9A 5D1JA 4NM3A 2W4OA 2I6LA 5GHVA 5DGZA 5EYKA 4ASDA 4JAIA 3UG1A 4YR8A 3LPBA 2Z7QA 3HRBA 3NUPA 4QPMA 5E7RA 5HNBA 4EOKA 3H9FA 2PHKA 5K4JA 3SRVA 2Z8CA 5EW9A 4ANSA 4J95A 2H34A 3R1NA 4LMNA 3NNVA 4OUCA 4M13A 3RI1A 3R2BA 2YA9A 3ANRA 3BE9A 5DLSA 2B4SB 2VWIA 4B4LA 1IAHA 3TNHA 3C4ZA 4FT3A 1UWJA 4AZEA 4C36A 1OL2A 5CEIA 4N4SA 4KBAA 4PPBA 5ANKA 1QPEA 3PA4A 4CMOA 4RGJA 4V04A 3QKKA 3OTUA 4IJ9A 5CENA 5HCYA 3AT4A 3TTIA 3U6JA 4RMZA 4G34A 5IA1A 2CCIA 3UZTA 5LXMA 1GIHA 4RA5A 5DN3A 2XUUA 1P2AA 1A48A 4PL4A 3SQQA 3FE3A 5A4LA 3DK6A 2QU5A 2CN5A 3NRMA 3WIKA 2CN8A 3BQRA 4GYGA 2O64A 2WPAA 4KSPA 3EL8A 3SDJA 4JX3A 2P3GX 4W8EA 3VS2A 2AUHA 3I5ZA 4AS0A 3QRIA 5B0XA 4ANNA 1CMKE 1JKTA 2JKOA 3H9OA 2IPXA 4LM5A 3V3VA 2RFSA 4WG5A 5AR4A 4RZVA 4MBIA 4C02A 5BYLA 5M56A 2BAJA 2XJ1A 3IS5A 5DRBA 1ZOEA 4DFBA 4IXPA 3AOXA 5I9XA 2QLQA 3LFDA 4FV9A 2OIQA 4A4OA 5IH5A 2YCRA 4ERKA 1OB3A 2PMIA 3MFSA 5H8EA 3RKBA 2J0MB 5L8KA 2JKMA 5CU2A 4I22A 4K9YA 2O5KA 4JAJA 4O6EA 4HVHA 2B52A 5ACBC 5A4QA 3ZZEA 2YISA 3FLZA 2WOUA 4G6OA 5AV2A 4CTCA 2WNTA 3LLAA 5EG3A 4ZMEA 4Y46A 2CNVA 2VTRA 4XOZA 2F49A 4U5JA 5AM7A 1OM1A 3ZC6A 4LV5A 2VUWA 2X9EA 4MKCA 5AUWA 5KE0A 3PZHA 4BCFA 4FVQA 4R78A 3UYTA 2OIDA 4MWIA 3NLBA 3KL8A 3OWPA 1DS5A 5M08A 3CQUA 4RWIA 2BRNA 4MXCA 5HIDA 4GKIA 4ZSAA 3BU3A 2YEXA 4YC8A 5LMKC 2OF2A 5HQ0A 3Q04A 3ZO2A 2WMBA 5FRIA 3C5IA 1H25A 4A06A 1FVRA 2VV9A 4KABA 4UXQA 2QR7A 3TKIA 3VUHA 3AMBA 3Q9ZA 1WAKA 2GHGA 4FG7A 5DWRA 3UOHA 3BPRA 3A7FA 4ACMA 4XLVA 1OIUA 3A4OX 2QNJA 4TYHB 5AP6A 3ZH8A 4RC2A 5A4TA 5DFPA 2XVDA 4DGOA 2XS0A 5H2UA 3GCQA 3MFRA 4UMUA 3WF5A 4RBLA 4EZ3A 3TWJA 3GCVA 5M4IA 2PE2A 3BYUA 5CT7A 3EN9A 3ZS5A 4PF4A 2W99B 3Q2MA 5IQDA 4ZLZA 5HX6A 3HECA 4FTRA 2HW6A 3VS7A 4OTDA 1NXKA 5KMJA 2CHLA 4HZRA 4Z9LA 1V1KA 4RFMA 4CCUA 4G6NA 3NMUF 5E8YA 3DBCA 4TWOA 4U9AA 2C0TA 4GU6A 3Q4TA 2R7IA 5IQIA 1YDSE 1KE8A 2VX1A 5HD7A 4E93A 5CY3A 3G6HA 4JX7A 4RX7A 3RAWA 4AN3A 2ITYA 5BPYA 3LLTA 5M51A 3C13A 1URWA 2WMXA 4B8LA 2BHHA 3MVJA 4J7BA 4ZOGA 1VR2A 1U5QA 3ORNA 4CTBA 4FGRA 4TYGA 3CJGA 1KWPA 3EN6A 2GS7A 2BDJA 4O2PA 4YBKA 4ZSLA 4AGUA 2BRGA 2G15A 3U6HA 3U6IA 5FXSA 5D10A 2XJ0A 2ZMCA 2RG5A 1Q62A 4UBAA 3ACKA 2OZAA 2F9GA 1OECA 2XA4A 3R8LA 4XP2A 4RG0A 3EQPA 4IAYA 2B54A 2O0UA 4IAAA 3GENA 4IZ5A 4ASEA 4BHNA 2IG7A 4U7ZA 3B8QA 1YOMA 2X1NA 3R21A 3UE4A 4F9CA 2Q83A 4KSQA 2RGPA 2ETMA 4PP7A 4F1MA 3IPHA 4FTKA 3GP0A 4CZTA 2FVDA 5HO7A 4G31A 3ULZA 2W7XA 3CGOA 4QQCA 5FEEA 2VTTA 2OF4A 3PXZA 5D11A 5T68A 4RX9A 3LAUA 3ORMA 4IWDA 3VBTA 5HU9A 4FIJA 4C58A 4RC4A 5KMLA 2NPQA 3KMUA 5LQFA 3ZO1A 4XV2A 3PXFA 5FG8A 3IW7A 2IW9A 3ZMMA 1YHVA 5EM6A 5K3YA 5GZ9A 5T6KA 2UW4A 3NAXA 4AOJA 4BYIA 5HZNA 4DFNA 2WMRA 4XRJA 1VYWA 4CNHA 5G6VA 5JEBA 1CKIA 3WZUA 5M4FA 3ACJA 5HICA 3QTIA 4R7IA 4Y83A 3ROCA 3DV3A 4QP8A 2V5QA 3U4UA 5B7VA 3RHXA 4DC2A 3OS3A 3KEXA 4PNKA 4QP9A 1XBAA 4YJSA 3ZXTA 5KUPA 5LVMA 4ALUA 5AM6A 3D0EA 3ZBXA 2BTRA 4EK5A 2ZM3A 4BDJA 5CSWA 3FI8A 3S3IA 5IA0A 4TL0A 3GU5A 3S00A 2YCFA 3K3JA 1JVPP 3Q4CA 2GS2A 4QMLA 3R7UA 4F1TA 2GPHA 3OOGA 4AT5A 3SVVA 2C1AA 4FIFA 4R1YA 2IO6A 4U42A 3TUCA 3OY1A 4QPSA 4CV8A 3R22A 2HAKA 2PULA 3OF0A 1WVWA 4E5WA 1QL6A 4Z7HA 2CLQA 3LKMA 5I3OA 2J4ZA 5BNJA 4R7BA 1HOWA 5JFWA 4BGQA 3O71A 2PMLX 4DEBA 4IWPA 3UC4A 1CDKA 3AGMA 2PU8A 2R7BA 3DFAA 3ROYA 2F57A 3MB7A 4FBXA 3PY0A 3ORXA 5H8GA 1AQ1A 4A07A 2YLEA 3U9CA 2C5NA 4M3QA 3ULIA 2HELA 2ITZA 5CAOA 5AUUA 4KS8A 3I81A 4BBEA 5EQYA 2O3PA 1YVJA 4J53A 2OJFE 3QCXA 3GQLA 3CLYA 2UZBA 3FXWA 3JY0A 2UVXA 3KQ7A 3ELJA 4ZS0A 4M69B 5C03A 3KXMA 3BEAA 1XJDA 3FPMA 4L9IA 4TXCA 3R9NA 4FTCA 4U0IA 4FT0A 4AZTA 4RX8A 3NUUA 5F9EA 1NVSA 4MXYA 5FEQA 1SNUA 2JAVA 3BX5A 3G33A 3BHVA 4MXXA 3K3IA 3BYOA 1OBDA 3N9XA 3A60A 1GJOA 3FL5A 3QFVA 5BUIA 1MQBA 4AN2A 5BMSA 1BI8A 4J98A 3DQWA 4F4PA 3V8WA 4G16A 3PPZA 4E6DA 3QKMA 3LXNA 4F0IA 1F5QA 3QRJA 3I0OA 3ZRKA 2WELA 5K5NA 2QG5A 1PXOA 2BILB 3N4TA 2JBOA 5GJDA 5HORA 3QGWA 4K77A 3EH9A 3GU6A 4QYGA 5TO8A 3TI1A 5CAVA 4C38A 3EIDA 1NT2A 4AACA 5HTCA 2XK7A 4BTFA 5EK7A 4O1OA 2Y4IB 4BCJA 4RX5A 3VNTA 3PP1A 2C5XA 3UOJA 2VN9A 4L53A 5CAQA 3OFMA 4K2RA 3VS1A 1Q97A 3I5NA 1IEPA 3LE6A 4FNZA 4UWBA 3C4XA 3EFKA 4NIFB 1KE9A 3JVSA 4DTAA 4FI1A 4EYJA 2C3IB 2JITA 3OOMA 4BCMA 4FYNA 1JPAA 4GUBA 2J5FA 4JBOA 4U97A 4D5KA 2Y0AA 2QLUA 4DFYA 5C4LA 1G8SA 4IAIA 4FKRA 3ZHPC 3A8WA 3OY3A 4K18A 4YZCA 1WVXA 4PTCA 2YLFA 3ZEPA 3FQSA 2W9ZB 3P23A 1HCKA 3P86A 1SNXA 4RFZA 3HZTA 4Y95A 5HCXA 5ANGA 3M11A 2WXVA 4ENYA 3RK9A 3G6GA 2PVMA 3ZRLA 2J7TA 4AA0A 4IM0A 4D4SA 2AC5A 3QCQA 4EKLA 1M2PA 3AT2A 3ZUUA 4Y85A 4YHTA 3ZFXA 4GT3A 3BE2A 3DA6A 3DBEA 3P0MA 2VX3A 3GOPA 4XEYA 5CQUA 4BTJA 3VAPA 5AUTA 1Y6AA 3DGKA 4NM0A 3C4FA 1VJYA 3DQXA 2DYLA 2HZNA 5DEWA 4AT3A 5AADA 2ACXA 4O0XA 4FTLA 2DUVA 5HESA 2BIKB 5JRSA 3QC9A 4IACA 3WF6A 3WI6A 3KULA 1YHSA 2H96A 3C50A 1ZY4A 5IA4A 5CASA 2C6MA 3Q60A 1A9UA 5HBJA 3CIKA 3MVHA 1ND4A 3LFSA 2Y7JA 2XIXA 4D0WA 1Q4LA 2UZUE 3QRUA 4EOPA 3JY9A 4MXAA 5E90A 4ALWA 4D1ZA 1TQPA 4D2SA 1REKA 2SRCA 4HCTA 4CQEA 5HTBA 2WEVA 2JDRA 2XYUA 1H00A 1PXMA 3II5A 3R71A 5E8SA 5TKDA 2GQSA 3GU4A 3HEGA 4GG7A 1R78A 2JD5A 2XNGA 5IPJA 2JC6A 1YI4A 2HYYA 4WT6A 3DDPA 4YLJA 2A0CX 3IDBA 3CKWA 3FY0A 2GNHA 3BI6A 3DXNA 4F9WA 5D7VA 4NUSA 5IA3A 5H8BA 2VTIA 3A4PA 3QD3A 3QF9A 4W8DA 4RIXB 4YJTA 5JRQA 1KE6A 4AW1A 4BCGA 4B99A 4LUDA 4DGLC 3FMNA 4FR4A 4AUAA 3MH1A 3KMWA 1W84A 4O0UA 3QRTA 5IDPA 3V6SA 1TVOA 4C3RA 3BKBA 2YIQA 5KBQA 5E91A 3VIDA 5L2IA 3D7TA 4D9TA 4GK3A 4EOIA 4P5QA 2X4ZA 3TUBA 2R5TA 5ANJA 4R77A 4DFZE 5H9BA 3LQ5A 2BDFA 2OFUA 3PXQA 3QYWA 4C7TA 2RL5A 4KBCA 4F70A 4DTBA 4V01A 5HHWA 3G9LX 3ZDUA 1NVRA 2E9NA 4UN0C 3CQEA 5IF1A 1NY3A 3WILA 1JBPE 4QQJA 3VVHA 4C8BA 3PJ2A 3ZEWA 1T46A 1GNGA 1U46A 2X2KA 4GK4A 4ZSGA 4C4EA 5DT0A 4F9YA 3R00A 4DGNA 4QMQA 4NH1A 2DQ7X 2WZJA 1ZOHA 4QMOA 3UODA 1APME 4O1PA 3I7CA 4JDKA 3TKHA 4QMNA 2VU3A 2VGOA 3PP0A 5DRDA 1M2QA 3FAAA 5DOSA 4F0FA 5LCKA 3NSZA 4I6FA 3NUAA 3ZCLA 4O82A 1BYGA 2PY3A 3O2MA 4E4NA 4YLKA 2QONA 4BCKA 5EHOA 3KFAA 1Q24A 1URCA 4BVUA 5KO1A 2R3GA 4YTCA 3SG9A 4X3FA 2JDSA 4TYEA 4XG7A 1ZRZA 4USFA 2UZOA 2VWUA 3TCPA 3N4UA 3TZ7A 4BGGA 1IA9A 3H9RA 5A4EA 2RFNA 5D41A 5CALA 4DH8A 2W0JA 3PWYA 3LCKA 4BIDA 4BCNA 3VW6A 3GC9A 3HDMA 4TW9A 3MPTA 4FK6A 4EH4A 4EQCA 2YDIA 1PJKA 1Q41A 1SVGA 5AX3A 3JPVA 4HZSA 4Y5QA 5CQWA 3W1FA 5AEPA 4M7IA 2PUPA 3GCSA 3TDWA 4GKHA 3LJ0A 2HY0A 3W2CA 4O7RA 3BQCA 3NEWA 3VBXA 1WBVA 3NUNA 4FOBA 5A9UA 2FSMX 3EMGA 2ZM4A 3VUDA 4EH2A 3D9VA 1PHKA 2GMXA 4KA3A 3REPA 3F5GA 1Q61A 4MF1A 3C4WA 5AAGA 3GNIB 5CSHA 3QC4A 3KULB 3L1SA 2G01A 3FDNA 4L3PA 2YACA 3EN7A 4JDJA 4F09A 1XKKA 4DCAA 4LI5A 2HZ4A 5ANDA 4QRCA 4NWMA 4I3ZA 3UNJA 4JXFA 1DAWA 2RIOA 4I1ZA 4FYOA 5CU3A 2G9XA 3E88A 3HRFA 4U41A 1FVTA 4RQKA 3UMWA 2OK1A 2PPQA 5C8NA 5KNJA 4CZYB 3ORIA 5C27A 3WE8A 1JSTA 4OLIA 5IUIA 1J1BA 5L2SA 4MXZA 3MY5A 2G2HA 3TNWA 4JQ8A 4KS7A 4YO6A 4DTKA 4FG8A 4FX3A 3MFTA 3GU8A 4FZDB 4MYGA 4D2WA 2O2UA 1FMKA 3ALNA 3HLLA 3MW1A 4FKOA 4ONAA 3PPKA 3ENMA 3UQGA 4QMYA 2VTSA 3QRKA 4W9WA 3ZSGA 2WIHA 3W18A 1H01A 1ZAOA 4RSSA 3AD5A 2XK8A 4M84A 1ZYCA 2Y6MA 4JDIA 3AQVA 4Y8DA 3OXZA 5CT0A 3UNZA 4BCQA 4EC9A 2A19B 5E1SA 2EVAA 3CTHA 3UQCA 3Q32A 4D2PA 3DKGA 3ORPA 3D7TB 4I24A 3RZBA 3G15A 1PYXA 2X39A 5LVNA 5CSVA 5E4HA 1H1SA 1H1QA 5AWMA 4EK4A 4C33A 1KV2A 4B6LA 3GFWA 4FT5A 1PMUA 4PMTA 3FZTA 2UVZA 3OWLA 4FSTA 4RFYA 4DG3E 4PWNA 2WIPA 4YHFA 1SZMA 5B2MA 1KV1A 3UPZA 3M1SA 1YWNA 4EK3A 4FUXA 3EFWA 3FKNA 3UIBA 3NW7A 4L00A 4BZDA 2XRUA 3Q2JA 2PSQA 2ZYBA 5AV1A 4WNOA 3KF4A 5HG9A 4U40A 4ANMA 4ASXA 2WD1A 4AGDA 2H8HA 2XIKA 4XG9A 3ZTXA 3D4QA 2YJRA 3VS6A 2JKQA 3A61A 5IMEA 4JI9A 1WBWA 2Z7LA 3P4KA 4CFMA 1GAGA 1Q3WA 3MY0A 4OBPA 5FM3A 3UVQA 3PVUA 4E3CA 2UW6A 3PA3A 2G2IA 4XS2A 2VNWA 3QZIA 3RALA 4EK6A 3ZOSA 4CFWA 2GFCA 3DKFA 4FEVA 2QO9A 3KXZA 4JR3A 3BRBA 3F3ZA 5EM8A 4HPTE 4Z55A 2G2FA 2IW8A 3S1HA 3H0YA 3P78A 4IHPA 4CRLA 4GV1A 4O7WA 5CVFA 3BWJA 3ORLA 3DU8A 2R3OA 4FK3A 1XH4A 4XG3A 4UYNA 3BV2A 3TL8A 3VJNA 4FT9A 1PKGA 2F2UA 3NPCA 5EW8A 5AFVA 3TG1A 2XIYA 3MTLA 3LM0A 5JMSA 5HNGA 4GFGA 2PUIA 3CY3A 1I44A 2W1HA 4CRSA 4UMTA 3SGCA 5CF4A 3QTXA 3RNIA 3H3CA 4C35A 4JVGA 3RCJA 1H26A 4BDHA 2QKRA 2C3KA 5I9YA 2WMVA 1KOBA 4IJPA 4C4HA 2FB8A 5IA2A 3JS2A 5DT3A 3Q3BA 4RWKA 4EOJA 2HZIA 3PWDA 1Z5MA 4ACGA 4RJ3A 1JAMA 4JRVA 3S2PA 3QTWA 3DJ7A 2BTSA 3HMIA 2VWWA 3O51A 4K6ZA 4XBUA 3O23A 4ZIMA 4AOTA 4KUJA 2Q0NA 3FZ1A 4TPTA 4CVAA 4TYHA 2QD9A 1BL7A 4O7NA 1QCFA 3MH2A 5EOBA 3THBA 4IQ6A 3FXZA 4FV6A 2QHNA 4GRBA 4FTUA 4APPA 3FHRA 3MN3A 4L01A 4ZLOA 3WE4A 4ITIA 4U6RA 5KMNA 2VGPA 2XKDA 3VS3A 2WMTA 3EQCA 3MGYA 5HO8A 5IEXA 2CMWA 2HOGA 3RK7A 4N57A 3VBYA 3G90X 4GCJA 4C3PA 3B2WA 3D83A 4FVPA 4HGSA 2X7OA 3OT8A 5CEQA 4NT4A 4OBQA 3QWJA 5ANIA 2QO2A 2CLXA 2FA2A 2GTMA 2PUNA 3RAHA 4K1BA 3L8PA 3PVWA 4ERWA 4I0RA 4IMYA 4P5ZA 3R01A 5HOAA 1UA2A 2PZPA 3PJCA 4OTQA 4LQMA 5CWZA 1JQHA 2W4JA 3Q9WA 3QTRA 5E92A 2C30A 2W1FA 4FV8A 4F0GA 1OKYA 4W4WA 4HGEA 5IISA 1BKXA 3F7WA 4PDYA 4ANQA 5E9EA 4ACDA 3HMNA 4MD8E 4Q9ZA 3NYVA 3UVPA 3D2IA 3OUKA 4PMPA 2ITOA 3NYOA 2PMOX 4FKJA 4N70A 3E3PA 3DPKA 3ZFMA 1PRYA 2VO0A 4ZAUA 2UV2A 4RVTA 1PYEA 4QMWA 2B55A 1WVYA 4EONA 3MFUA 4I6HA 4IVAA 2W1ZA 3OD6X 2QG7A 3FYKX 3E93A 1OIYA 1UU9A 3IONA 3LJ1A 4QP2A 5CEOA 2BUJA 4LL0A 4EOQA 3KVXA 3G5DA 2CNUA 3BYMA 3LW0A 4YHJA 3F6XA 3WYXA 4NJDA 3TIYA 3UG2A 3WF9A 2XH5A 3G2FA 1KOAA 5M09A 3F3UA 3BEGA 3CXWA 2UW5A 3BIZA 3QQGA 4B0GA 1PW2A 3EJ1A 1XH7A 4L6QA 4ORKA 4FKUA 1ZYLA 2XKCA 1H8FA 3FMEA 4JIAA 4WO5A 2UW9A 3DY7A 3KN6A 4FG9A 4NCTC 4CV9A 2HENA 2XNBA 4XV1A 2YHVA 2ITXA 2A4LA 2XJ2A 3PXYA 4BIBA 5JN2A 3OXTA 5JK3A 4CG9A 3PG3A 2A27A 1ZZLA 1VEBA 4XG2A 5HD4A 3SV0A 5LMKA 2GU8A 4RJ8A 5M4CA 3FC1X 2R3PA 5AUVA 4CFVA 5AMNA 1SVHA 4G3DA 2FO0A 3DB6A 2JIUA 4CFXA 2WU6A 5IQHA 5I3RA 3GU7A 5HE3A 2YN8A 4DG0E 2P2HA 4R5YA 4ZTNA 4I0TA 3AT3A 3RPRA 3T3UA 3RINA 4BDCA 1XO2B 1AGWA 3WF7A 1PXPA 4LRJA 3EQBA 2LAVA 1CKJA 3RWPA 3VF9A 3KC3A 1PXNA 4I23A 3F2RA 4ZY5A 4M68A 5I9UA 4F7SA 3CGFA 4BI1A 2PVHA 3EKKA 4J99A 5LWMA 4NYEA 2LGCA 5BYYA 5I9WA 3DNDA 4DGMA 4BGHA 4BR3A 4GK2A 2J51A 3MPMA 3R28A 2W05A 3OVVA 3PG1A 4FIEA 3W55A 4BI2A 5F94A 1Q5KA 4C4FA 3QQHA 5EI6A 2OWBA 4EH3A 4I94A 4NKAA 4K0YA 3VRZA 3LOKA 3UQFA 3QU0A 3C0HA 3QALE 3BYSA 2OJ9A 4YJQA 1OPLA 2FSTX 3D94A 3O8TA 1E1VA 3ID6C 1XBBA 3D5WA 3HYHA 3NR9A 3GXLA 3GBZA 3UO5A 3ETAA 2XMYA 3CPCA 2W96B 4M69A 3O7LB 2JDOA 3G9NA 5AAEA 1PY5A 3RAIA 4FSQA 2A1AB 4QNAA 3DDQA 2IVVA 5EOLA 2OXYA 4G17A 4E8AA 1LR4A 1TQIA 4PTEA 4WIHA 3ZO3A 4D4VA 2YCSA 4O0VA 3G0EA 3G51A 1P5EA 4AWIA 4PDSA 4YZDA 2GNFA 3TUDA 5KCVA 2R3KA 3R8ZA 3SLSA 3SOCA 1T45A 4E4MA 4EEVA 4PDPA 4ZP5A 5CF8A 3R73A 1Y8YA 2WFYA 5DMZA 2O65A 2HXLA 3UO4A 4BKJA 4EC8A 1JNKA 4J52A 4DE4A 1W82A 5IQGA 4K33A 2YDKA 2OH4A 5K5XA 3DNEA 2ERZE 1E9HA 5E8TA 1REJA 4FTNA 4IX6A 1LPUA 3LFAA 5DT4A 4YNEA 4O96A 3MTFA 1ZOGA 2EXCX 2OU7A 3QTZA 3FL4A 4FEQA 3AC8A 3SW7A 4DH7A 3QUEA 5GINE 4D4RA 2YIRA 3R9RA 3CTJA 4EKKA 4HGLA 3UOKA 3I6UA 3DLSA 3GC7A 4PUZA 3WZJA 2VD5A 3MJ2A 4NIFA 3JUHA 1BX6A 3WIGA 4F99A 4HVDA 2X8DA 4IANA 1XBCA 3C5UA 1WBOA 1ZZ2A 4IWQA 4FKVA 2OXXA 4CFNA 3PRFA 2CGUA 5CSXA 3TTJA 4KRCA 4DN5A 3MV5A 4EUUA 4IE9A 4NTTA 1IASA 2VTQA 3EN5A 5D12A 2RSVA 2C3LA 2WQBA 2XZSA 4FGBA 2OJJA 4HVGA 4TNDA 3QQKA 2ZV7A 4B9DA 4HCVA 3P7BA 3FKLA 1RJBA 5EDQA 5KHWA 4J1RA 2CKQA 3NCZA 4CYJA 3NVKI 3GUBA 4X6RA 3WZDA 3CPBA 3VC4A 3NUYA 3C4EA 4R5SA 5LJJA 4RIWB 4L45A 4X2GA 3SKCA 4BKYA 5L2QA 2ZDTA 4J96A 3H10A 4PP9A 3WF8A 1NW1A 1W8CA 3KMMA 1O6KA 2O8YA 4LGGA 2WU7A 3EKNA 5ETCA 4EBVA 1J7LA 3E7OA 4R6VA 2GFSA 3QYZA 1GIIA 2F2CB 4KB8A 2CGWA 5CNOA 2FUMA 1O9UA 2Y4PA 4OBOA 4ZXTA 4Z16A 3U55A 2B53A 2VNYA 2CGXA 2C5VA 3A2CA 3HUBA 3IK3A 5FQDC 1Q8WA 3RGFA 2Z7RA 4AP7A 3QX4A 3F88A 3QL8A 3EZRA 3WYYA 4AOIA 3N51A 4LMUA 3FLNC 3QD0A 4IAZA 3IW8A 4HW7A 1FMOE 4QTAA 5ANEA 5HG5A 2X6EA 4O21A 3EFJA 3W10A 4EQMA 4KIKB 2C4GA 2X2LA 2FH9A 3LCSA 3PA5A 1MP8A 3OUNB 3VS0A 2E2BA 4F6SA 4TRLA 2W17A 1OIRA 4R3RA 2YABA 3M2WA 5K4IA 2ZOQA 3LXPA 2YERA 4R3PA 4HYHA 1CKPA 4L3LA 4ZTLA 5M07A 3TDVA 1H1RA 3NX8A 3P79A 4RIXA 5AIRA 4FV0A 3NNWA 4UMQA 4ZZMA 3BWFA 2BFXA 4HYUA 3RMFA 1U4DA 3HV4A 4PMSA 4UZHA 3FMMA 4QMTA 5HG8A 4YJRA 1WCCA 3OEZA 4AZFA 4RVLA 4DLIA 2YWVA 2BAKA 4RIOA 2I1MA 4CKIA 1Q99A 4D4YA 3ZLSA 4EOLA 3KXXA 3NIEA 4ZTHA 4W4VA 5JZNA 4YUQA 4MNEB 4OTPA 2OZOA 4X2NA 3EZVA 2I7QA 3BGQA 1J3HA 4FL3A 4M14A 4E6QA 4WBOA 3PLSA 3A7GA 4FTJA 5LARA 3BYVA 4IX3A 4E6AA 4FKGA 2ITVA 3MA3A 1W98A 4X2JA 3RPYA 3ZM4A 3PSBA 5BVKA 5E1EA 5C8MA 3JXWA 4O7TA 3HMPA 3QAME 1JOWB 4DEDA 1OL5A 5AR7A 2IWIA 5E8ZA 2HWOA 3LFBA 3GVUA 3LCTA 4TWNA 1OI9A 1YDRE 2HZ0A 3EYHA 3P9JA 2BRMA 2YIWA 5FP5A 4ZJJA 3ZUTA 2UZEA 1H1PA 5AUXA 2OKRA 5KMIA 3SA0A 2VTMA 4X2KA 3PDTA 1GOLA 3NWWA 4BHZA 5I9ZA 4X2FA 5BVDA 1ZYSA 3T3VA 1UU3A 3FUPA 3OTVA 3PIYA 5HI2A 3TV6A 4DITA 2W1IA 3HAVA 3KN5A 2UZNA 3ZZWA 2HIWA 3FXXA 2WQOA 5J9YA 3PIXA 4BCPA 3UP2A 4FEUA 2DWBA 2JEDA 4J97A 5L6WL 3LMGA 4ZTSA 5HVYA 1CM8A 1OL1A 3P7AA 5G1XA 1R3CA 3IGGA 3ZBFA 2VO6A 3QA8A 3K5VA 5KKRC 4O83A 4BYJA 3I4BA 3E8DA 1XH8A 3QUPA 3MVLA 5EI2A 4EHGA 4Z7GA 5IZFA 1M7NA 3EOCA 4Q2AA 4WSYA 4AXAA 2C6LA 5D7AA 3DBDA 4CLIA 3UOLA 1FINA 1ATPE 2VWBA 3HV3A 5DG5A 1Z9XA 3CY2A 1OPKA 3DKCA 3IOPA 3LZBA 2ITUA 4Q5HA 4O7ZA 4FSWA 4S33A 3QQFA 4RRVA 4D2RA 5A54A 3CTQA 5CZHA 3SAYA 4D55A 4C37A 1WBNA 3TV4A 3GEQA 5KZIA 2NRUA 5IMXA 5GJGA 2PVFA 4O81A 3EQIA 3F82A 5J1VA 2GNJA 3BGPA 3QCSA 2VTPA 3GOKA 4X0MA 4FV1A 4XJ0A 4QP1A 2YM8A 4G3EA 3GT8A 3TT0A 4IZ7A 5EQPA 1LP4A 2Z2WA 3E3BX 2C6TA 2IN6A 5EDRA 3V5JA 5HX8A 4K8AA 4MCVA 4BDKA 1K9AA 4RJ6A 4CMUA 2V62A 2R3IA 2UW0A 3EQRA 2VZ6A 3N4VA 2BFYA 4FKWA 2CCHA 4QTBA 5DR9A 4BDDA 2ITNA 4FA2A 3RTPA 2WMSA 4ENXA 5DNRA 4A9UA 2GSFA 5KBRA 2CSNA 2C0IA 1GZOA 3IECA 4IAKA 4BC6A 2P33A 3GCPA 4DEEA 1YI6A 3WOWA 4D9UA 2XEYA 4EH5A 3RPVA 2WTIA 3QUDA 3ZO4A 4UWYA 3IW6A 2OBJA 5DPVA 3ZU7A 3A62A 1ZLTA 3Q96A 1V0OA 2BR1A 3F9NA 5J95A 4D1SA 2XRWA 4F7NA 1CTPE 4HGTA 4P7EA 2UZWE 2AC3A 3R83A 4BI0A 1FGKA 5CYIA 5DBXA 5ETIA 2WTWA 3DFCB 3F3WA 3F61A 3UP7A 2IVTA 2QOKA 5EH0A 3BBWA 4DA5A 4LGDA 4MEDA 4EOOA 1UV5A 3UZPA 2WQNA 3ZUVA 5A3XA 4EWHA 4O7LA 3OCTA 2REIA 2QOLA 4NZWB 3KKVA 4CFFA 1V0PA 2OSCA 4U80A 1LEZA 1Q3DA 3VW8A 4FSNA 4FEXA 5IEYA 2QOFA 1YWVA 3W33A 5IEVA 1H4LA 4R8QA 4U44A 4JL9A 4YU2A 3R8MA 4KKHA 1UKHA 4X3JA 3RAKA 2DS1A 3PSDA 4U3YA 4O0YA 2I40A 3W2RA 3LXKA 4BKZA 4C4GA 5A46A 4H05A 4BWXA 2BVAA 3QD4A 2F7ZE 2XM8A 2KTYA 3FQEA 4DBNA 3RCDA 5TOZA 2ZM1A 3DAJA 2XBJA 5JKGA 1OBGA 4XBRA 4L68A 3R2YA 5C8KA 5CI7A 3MIYA 1K3AA 5EYDA 3UIMA 4D2TA 4OTFA 5J9ZA 5JH6A 1XH5A 5GNKA 4JT3A 4QTEA 4DEIA 4C4IA 3SD0A 2IJMA 5C01A 2XYNA 4MK0A 4ZLYA 2C6EA 4AU8A 2VWVA 4E4LA 1DM2A 2W5AA 3DAKA 4I0SA 3UIXA 3UYSA 3JR1A 4G5JA 4B8MA 4GFOA 4H3QA 4ITJA 5JQ8A 3SXSA 5FXRA 4IX5A 3LQ3A 5CU0A 5BMMA 5JSMA 4O22A 4I5CA 3KREA 2UZDA 3MSSA 2ZB1A 3S4QA 2WTKC 5CANA 4QYYA 4BFMA 4L67A 4JBQA 1O6LA 2QR8A 4ANBA 1FVVA 3VHKA 3KK8A 3FSKA 2PVLA 4I5PA 1X8BA 2ZV8A 4NW5A 4ZSJA 1MRYA 2X81A 5EW3A 5FBNC 4YJPA 5LCJA 3O8PA 4WNPA 5M53A 3R6XA 3V5LA 5EM7A 5I0BA 1YOLA 4C61A 1YI3A 4CZUA 5IQAA 4OTIA 4GJ2A 4XX9A 2YM6A 3R7VA 1Q8UA 4BBFA 4UZDA 5HE2A 4Z3VA 1YXUA 4ANOA 4BDFA 4RWJA 3L8SA 4IAFA 4EHVA 2UZLA 2C6IA 4OW8A 4M8TA 5J7HA 5KMKA 4YMJA 4CMTA 1J91A 2VWYA 1H07A 2BAQA 5TT7A 4CQGA 2V55A 5LVPA 2BIYA 4NL0A 2VTOA 2PE0A 3KGAA 3LJ2A 3KRLA 3CE3A 2PVYA 4JIKA 1LUFA 2J90A 4ZTQA 5E8UA 2C47A 5CEMA 5J1WA 2EXEA 2PTKA 4G1WA 4FVRA 2OFVA 4YJVA 2YZAA 1UNLA 1JSUA 5C1QB 3MA6A 4X3FC 2Y8OA 4XLIA 4AGCA 4EH8A 4DT8A 4E5AX 1SMHA 2J0IA 3FI3A 3R02A 4M67A 4QTCA 4V05A 5EYCA 4ACHA 5ICPA 2V7AA 3PFQA 1BMKA 3UIUA 3OEFX 3R04A 4NW6A 3WARA 1FQ1B 4XMOA 4XHKB 4AGWA 3ZDIA 4FKTA 3W32A 2IW6A 3HNGA 4PL3A 3W8LA 4AW5A 2XB7A 2CGVA 3LHJA 4FZFB 5AR3A 4DFUA 3BGZA 4G9RA 4NK9A 4A9TA 1ZWSA 5CU6A 1UKIA 4BICA 4DGGA 3QX2A 2RKUA 4IZYA 4EH7A 5FUTA 4YC6A 3HKOA 5IUHA 1SVEA 3C9WA 3F2AA 4YPDA 5CZIA 4C2WA 4XRLA 3NNXA 4A9YA 4AN9A 4IDTA 1NA7A 3NUSA 4XV3A 3W2QA 3I0QA 4QP6A 2CDZA 4QMUA 1RW8A 2W4KA 3O17A 2GNIA 4JDHA 3A7IA 4AFEA 3FMJA 4FKIA 4YSJA 5CU4A 3GC0A 5F20A 3KF7A 2BZJA 2QHMA 3AG9A 2W1DA 2EUFB 1PMEA 3HMOA 3G0FA 1DAYA 4FNWA 3MB6A 3SOAA 4PX6A 1H0WA 4U81A 2WO6A 4WKQA 4BDIA 3S0OA 3UZRA 4KAOA 5KX8A 2BALA 3EWHA 1XR1A 4RVKA 5JFVA 3KA0A 2OW3A 2WQMA 3QHWA 4QMMA 2OJIA 3SHEA 5IDNA 4JG6A 2J50A 4CYIA 3DK3A 3DZQA 3PXKA 1UNHA 2B1PA 4EWQA 2PWLA 3CSVA 2JDTA 3DOGA 3Q4UA 3QQUA 4FSMA 4O7SA 3COIA 1L3RE 4TTHB 4KIPA 3ORKA 3RZFA 3EL7A 4QMZA 4MQ1A 4F64A 4AW0A 4FTAA 2PUUA 3DK7A 1OGUA 3PPJA 4MXOA 4GG5A 5J87A 3DB8A 3RM6A 4H39A 3D5XA 1XH9A 2IVUA 4BZOA 2UVYA 2OO8X 3P7CA 2ZV9A 5HNIX 2ONLA 4HNIA 2EB3A 4YSMA 4BN1A 2PVNA 3O8UA 3VBWA 5FDPA 2RG6A 3TNPC 3LFCA 4GH2A 4D28A 3E63A 4QYFA 4DFLA 1FGIA 1IAJA 5HTIA 4LYNA 3FZRA 4DEAA 5GIOE 4TKSA 4CT2A 4C2VA 1VZOA 4H3PA 4KRDA 2QODA 4EI4A 4YTIA 4LOQA 2YIXA 2IZRA 4OTRA 1H08A 4TYIA 1SYKA 3O50A 5LMAA 2PZRA 3PTGA 4GIIA 4X21A 2BDWA 1OUYA 3COKA 1YQJA 4PL5A 3LFFA 1TKIA 2GDOA 4YLLA 5FEDA 3U87A 3ZSHA 4EL9A 4F1OA 5AAFA 4BIEA 2KULA 2R2PA 4QOXA 3D15A 3NGAA 3EHAA 3L9NA 2YM3A 4JQ7A 3VWAA 3OW4A 3HV5A 1I09A 2B7AA 5J9LA 2RFDA 2H6DA 3BHUA 1ZMUA 2UW3A 1PMNA 5K0XA 4PTGA 2VAGA 2VX0A 3E64A 3EN4A 3F69A 3ORZA 2XEZA 2CKPA 2JFLA 2VO7A 3QWKA 3OBJA 4M0ZA 4RLKA 2BPMA 4L7FA 2C1BA 5ANOA 5HCZA 3A8XA 5E8VA 2VO3A 3VJOA 4IH8A 1A06A 4XV9A 2R64A 3Q6UA 3W16A 3D14A 3D5VA 3I6WA 5K9IA 5L8LA 2XIZA 2YAAA 1BLXA 2Z60A 1UNGA 4S34A 5HO6A 2OICA 4F7JA 4AG8A 5HVJA 4JJRA 2WMAA 4UY9A 3DJ6A 1BI7A 1M17A 1R0EA 1UU8A 3IG7A 4QO9A 5DHJA 4CCBA 1UU7A 4CKJA 3QTQA 2B9JA 3TEIA 3ZLXA 1YOJA 3A7HA 3AC3A 4FODA 4G3CA 3RPSA 2JGZA 3ET7A 3MBLA 4JLCA 1JWHA 2ZB0A 1P4FA 4XP3A 4GJ3A 4FZ6A 2PMNX 4I20A 3V5QA 2UW7A 3HL7A 4EH6A 1JKLA 2E9VA 4U8ZA 2J0JA 3E5AA 5C26A 2R0UA 4YJOA 1SM2A 4IB5A 4O2ZA 4ARKA 3AC5A 4I92A 2WEIA 5TR6A 4JBVA 1ZMWA 5C4KA 1WBPA 3UTOA 2W1GA 4MVFA 4LOOA 1H28A 5FTQA 3VN9A 5AJQA 2OI4X 3TXOA 4L3JA 1V0BA 3V8TA 1ZYJA 3ALOA 4O7YA 3CEKA 3F7ZA 3NYNA 4GW8A 1OIQA 3KK9A 2BZKB 3ZLYA 4AZVA 2P4IA 3KRRA 1B39A 4NU1A 3VS5A 4RC3A 4DG2E 5GIPE 3FLQA 4CFUA 5CXZA 3EFLA 4ZZOA 3PSCA 4GYIA 5EKOA 4C62A 4FUYA 4WRSA 3GC8A 2PZYA 3FI2A 1YXVA 3AMYA 3H30A 3LM5A 4NCTA 5CXHA 3D5UA 2R3MA 3PVBA 4N0SA 4F6WA 4O0TA 2J0KA 4LUEA 2ZDUA 5AP1A 3D7ZA 4R3CA 4ID7A 4DEGA 4HOKA 4Y73A 1CSNA 3MDYA 3ZM9A 4H3BA 3H0ZA 3OP5A 5IH4A 2HY81 4ZMFA 5DR2A 3E7VA 4DCEA 3F66A 2XM9A 5JZJA 3VF8A 3LFQA 3C1XA 4FKQA 4IDVA 4WNKA 4FNYA 1EH4A 2R3RA 3KB7A 4UYAA 1MQ4A 4OT6A 5FD2A 3SG8A 2WAJA 1YXSA 3NNUA 4FICA 5CEKA 2BRHA 3OT3A 5JQ5A 3OC1A 2B0QA 4UB7A 2QOBA 3R7IA 2V22A 5A14A 3OCBA 4AF3A 3FMHA 3HDNA 4BWPA 4UMRA 5AUYA 3RWQA 4JS8A 2VTNA 4YBJA 3TIZA 1M14A 5KMMA 3U8WA 1RE8A 1FOTA 3L8VA 2ITTA 2YM7A 4N6YA 5TE0A 3UGCA 2ZMDA 4U3ZA 4AZSA 2C5OA 4KNBA 4FOCA 4RIWA 5IG1A 5EI8A 4C59A 5D9HA 4JQEA 3AMAA 3LCDA 4FC0A 1M2RA 5I4NA 4F7LA 3LVPA 5TF9A 5DA3A 5JT2A 1DI9A 4QMVA 3AC4A 2EB2A 4NFMA 1GZNA 2ETRA 4FV7A 2GCDA 3KY2A 4O6LA 3Q53A 4II5A 3TJCA 4PRJA 4ALVA 3I60A 5CF5A 2FGIA 5AP4A 3QZHA 5FM2A 2X7FA 4YNOA 4V0GB 3IGOA 2QOOA 3R0TA 1YWRA 3CQWA 4FT7A 3W2PA 4RIYB 3A99A 4XH6A 2C0OA 1YRPA 4IBMA 2C6KA 4YJUA 5CVGA 4ZJIA 1U54B 2B9IA 2F4JA 2JIIA 1H1WA 3BHHA 4FTMA 3PJ3A 4H1MA 5K0KA 4KIKA 5BQ0A 5IQEA 1QPDA 5AIKA 2YJSA 3OHTA 4G3FA 2CPKE 2OLCA 4WBBB 1KE7A 3TZMA 2GHMA 4FIIA 4EQUA 5GZAA 3KRJA 1H0VA 2VWXA 4YURA 4AZWA 3KXGA 3OWJA 3F3VA 4BDAA 1YHWA 2Y9QA 5DH3A 1YDTE 3GI3A 3R7GA 2QKWB 2X2MA 4QMSA 3CD8A 2GTNA 3R30A 4XNEA 4ZY4A 5BUJA 1GY3A 3RNYA 3RPOA 4BRXA 4HVIA 4CGAA 4KIQA 2I0EA 5FLFA 2W5HA 3COMA 4NM7A 3TJDA 5AP0A 2P2IA 4C0TA 3HGKA 4JG8A 4EHEA 2XNNA 4RLLA 4EBWA 1KSWA 3KRXA 4G9CA 4Q9SA 2UZVA 4MHAA 4D2VA 5AA9A 3D2KA 4PDOA 4LL5A 4HVSA 2YAKA 1AD5A 3R1YA 1Y57A 2HWPA 4I93A 2AYPA 2IZSA 3MJ1A 4MNEA 3Q52A 3COHA 4I5HA 5CAPA 4BCOA 2I0YA 5IUGA 2YIYA 1KE5A 3QQJA 2W06A 5BVEA 2YITA 2WQEA 3V5WA 2FSLX 5HBEA 3OMVA 4FEWA 3FQHA 2XF0A 5FP6A 4KD1A 3SRVB 4L52A 5L6PA 1OVEA 4HJOA 4IFCA 1GIJA 1PXJA 4ZEGA 4ACCA 4GMYA 5L8JA 4I6QA 4IWOA 3E62A 2J2IB 2PZ5A 1OKWA 2QURA 3ODYX 3ENHA 4KBKA 3R9HA 4R7HA 3U9NA 4RWLA 3ZYAA 1P14A 4FTQA 5ACKA 4FSZA 1B6CB 1ZY5A 3POOA 1G5SA 1PXKA 3RVGA 3UNKA 2HW7A 3PLAE 1QMZA 2RFEA 2X9FA 3WZEA 1JKSA 2IZUA 4AE9A 4WD5A 4YZ9A 4BDGA 3B8RA 3MH0A 3BCEA 5DEYA 4D5HA 3MWUA 2QOCA 4EZ5A 5J5TA 2P55A 3Q5ZA 1S9IA 3VUTA 4GT4A 1BL6A 2QOHA 3NYXA 3F5PA 4C57A 5HVKA 1UVRA 3VQHA 1S9JA 5B2LA 2G1TA 3R9DA 3HP5A 4O0WA 4C34A 2ZAZA 4O86A 4AT4A 1ZXEA 5FBOA 1UWHA 3AD6A 3IQ7A 4F9BA 4ZTMA 3L8XA 4YC3A 3TM0A 4AX8A 4BWKA 1XH6A 5C9CA 1E1XA 1OITA 3E87A 1PMVA 4MX9A 2XNEA 3KXNA 4WOVA 5LOHA 2X7GA 4HNFA 4A9SA 2J0LA 2OIBA 3F2NA 3QA0A 3MH3A 5CI6A 4AQCA 3NCGA 2X6DA 3FHIA 3U51A 1NVQA 1QPJA 2ZJWA 4DYMA 4F65A 4MNFA 3BU5A 2R9SA 4M97A 2WMWA 1GZKA 2EU9A 3P5KA 2Y4IC 5M57A 4ZY6A 4HCUA 2QOIA 4OTGA 1F3MC 2GHLA 4QMXA 4IFGA 3EQHA 4PPCA 4IX4A 3VULA 4ZSEA 3NW6A 4QD6A 3BHYA 3HVCA 3TACA 4DLJA 2WHBA 1OKZA 1Y8GA 4IB3A 4BF2A 1MRVA 4DAWA 4QP3A 2VTAA 4FKSA 2H9VA 2RF9A 4QYHA 3FPQA 4GU9A 4JBPA 4LG4A 4IB0A 5J79A 4OAVB 4FV3A 5CVHA 4EOMA 3CBLA 5F4NA 4M66A 4OTWA 1WMKA 4EJ7A 1MUOA 2BMCA 2E9PA 2JKKA 4QP7A 2NNWB 3A7JA 4L46A 1M7QA 2ITPA 5DI1A 3MVMA
chains in the Genus database with same CATH superfamily
3VUMA 4F78A 3UDBA 3KCKA 4IM3A 4IC8A 4O91A 3MS9A 4A7CA 2F7XE 4F08A 4AXEA 5BVNA 5CEPA 4XCUA 4W9XA 1IG1A 4CG8A 1WZYA 3AC2A 3UJGA 3DS6A 1P4OA 4NKSA 3BBTB 1Y91A 2R3LA 3SX9A 4EYMA 5M06A 5JGDA 1OMWA 4OR5A 5I9VA 4OAUC 4YZMA 4AE6A 2P0CA 5DIAA 4MQ2A 2JLDA 4FV4A 4PNIA 4QMPA 5A4CA 5GZ8A 1TQMA 3SXFA 2BROA 3QHRA 5DE2A 5AX9A 2GS6A 3LIJA 5HEZA 3R7OA 4MF0A 5T3QA 1R39A 4TWCA 4FIGA 3IW4A 3ZFYA 4GFMA 5EFQA 4C3FA 4WNMA 2HCKA 4F6UA 4MWHA 1J7IA 4UX9A 4KIOA 3QLFA 3W0SA 5DVRA 3Q5IA 1Y6BA 2J6MA 2UW8A 2ERKA 4I21A 5FDXA 4CLJA 5L2TA 1U59A 1GZ8A 2VTHA 3LCOA 4HYIA 2ITWA 2QU6A 2A2AA 1FBNA 3FZSA 3FLWA 4J71A 4MD9E 5DYJA 2C5YA 3CKXA 3MYGA 4GUEA 5F1ZA 4YGAA 3W2OA 4IVCA 1K2PA 4E5BA 4F63A 3R7EA 3FSFA 3QCYA 3OROA 3HA8A 4G2FA 5L4QA 4BCIA 4RJ7A 4CT1A 3CD3A 2WOTA 3UMXA 1YKRA 3R8UA 5AP2A 3OZ6A 4RPVA 1W2DA 2XIRA 2X8EA 3JVRA 4I41A 4RZWA 5FGKA 4S30A 4XYFA 3RP9A 3C51A 3ZSIA 4AAAA 1Z57A 4FF8A 1YXTA 2OZAB 4C4JA 4ZJVA 2XKFA 3QXPA 4GL9A 1OPJA 4QYEA 4R1VA 2E9UA 2R4BA 4FL2A 4N6ZA 5KMOA 3V01A 5M44A 3BL7A 4BTKA 4D58A 3QLGA 3OXIA 2FYSA 5FTGA 4K11A 5HGIA 3T8OA 4D0XA 4MD7E 3WBLA 3VUGA 2JFMA 3HMMA 4FV2A 3BELA 4BDBA 1IR3A 3UC3A 1G3NA 3UPXA 2Z7SA 4L8MA 3C0GA 3I79A 4L42A 4O0SA 3Q4ZA 4CKRA 5HLPA 3IW5A 4TT7A 1Q8YA 3TKUA 3OCGA 4P4CA 5EYMA 2JBPA 4QT1A 4MAOA 3GFEA 2NO3A 3GB2A 1XQZA 3PJ8A 5AV0A 4H1JA 5H3QA 4CEGA 5IQFA 4ANLA 4YO4A 4MH7A 1H27A 4NJ3A 1WFCA 3KRWA 3GCUA 4UWCA 3VBQA 2O63A 3EB0A 3T9TA 1JKKA 2JIVA 2R0IA 3R7YA 4JNWA 4A4XA 4G6LA 4IIRA 3DLZA 3ZRMA 2VTLA 2XNPA 4W4XA 2XNOA 4GT5A 4XP0A 5BUEA 4OT5A 4TNBA 3E8NA 4XG6A 5E8XA 4EK8A 5AV3A 4IVDA 4PQNA 4UALA 5JGAA 2PK9A 5AP3A 3FKOA 4S31A 3PIZA 3LXLA 2C3JA 1JLUE 4G5PA 3HP2A 4FKPA 3B2TA 2W5BA 3TZ9A 4U79A 3H4JA 4QDVA 1IA8A 4FTIA 3OBGA 4EORA 2YWPA 4RQVA 5IKWA 3C4CA 2WTVA 4O0RA 4L7SA 2WKMA 4JOAA 4DH5A 4M12A 5CNNA 3PY3A 3V04A 3FWQA 2PYWA 3LFNA 3W8QA 4IW0A 3GQIA 4BY9E 2BRBA 3VS4A 2NP8A 4A9RA 3FI4A 1L8TA 3NZ0A 2E9OA 4AW2A 1TZDA 5BVWA 2I0HA 4NTSA 3V5TA 1G8KA 3FV8A 4BBMA 1M52A 3EYGA 3AXWA 1ZMVA 5GJFA 1Q8ZA 5EHYA 5KZ0A 3DCVA 4E1ZA 2W1EA 4KWPA 5M55A 2X0GA 3DT1A 5L2WA 3E92A 4BCHA 3K2LA 4YPSA 3TN8A 4DFXE 3EQGA 4H58A 4RVMA 4YTHA 4OTHA 2QOQA 3MI9A 4E7WA 2VTJA 3BV3A 3F5UA 1Q8TA 2FSOX 4S2ZA 3LMHA 3AC1A 4AA5A 3FYJX 1W0XC 3MPAA 5J8IA 4CXAA 3ATTA 3O96A 3KVWA 3FEGA 1B38A 2YM5A 3TNQB 2QI8A 2Z02A 3LFEA 4O7VA 3V6RA 2Q0BA 3VUKA 5CTPA 4MTAA 5L3AA 2XP2A 2V0DA 4ZTRA 2IVSA 3PUFC 2QQ7A 2UZTA 2BZHB 3JYAA 4NSTA 4FIHA 4GEOA 3DJ5A 3K5UA 5J5SA 5BVOA 1W83A 3FC2A 3OW3A 5KHXA 4WA9A 5A6NA 1PXLA 4I4FA 4UV0A 5HIEA 5EQEA 5KKRB 4B7TA 4IEBA 4M15A 4XG8A 3Q9XA 1ZARA 1ERKA 3DXPA 2V7OA 2X8IA 3TV7A 3AD4A 4J8MA 3R63A 3CC6A 3ERKA 3DXQA 2PVKA 2OG8A 2NYAA 2B9FA 4S32A 3PJ1A 4BL1A 3S95A 4FKLA 4FTTA 1OKVA 1OL6A 3BLHA 4FSYA 5CLPA 2CJMA 5EHLA 5AA8A 4UXLA 5HLNA 3KCFA 3GGFA 1O6YA 4APCA 3U54A 5BYZA 1W7HA 2R3QA 3NDMA 4PV0A 4BDEA 5DR6A 4EZ7A 1QPCA 3VRYA 3OWKA 3R1QA 4DF3A 3HV6A 3ZLWA 3PXRA 4KINA 3UO6A 2VRXA 5CS6A 3HUCA 4LRKA 3RM7A 3QTSA 4BZNA 3CCNA 4J8NA 3DTWA 5IQBA 5AR8A 4QQ5A 4DT9A 4IM2A 5AV4A 4Q5EA 3Q6WA 4YZBA 2W1CA 1HCLA 2OJGA 2WMUA 2YCQA 3DKOA 3PE1A 1DI8A 3MY1A 3MESA 2GNLA 4DBXA 2B9HA 4E6CA 3PUPA 4FTOA 5LVLA 2R3FA 4AFJA 2CKOA 2WB8A 2GNGA 4XUFA 4O38A 5BVFA 2GQGA 4NFNA 2ZV2A 5LMBA 3CJFA 4WG3A 3QKLA 4EUTA 3ANQA 3QQLA 2JAMA 3ODZX 3IOKA 2ZVAA 4IADA 4P2KA 3V51A 3O0GA 4QP4A 1OGYA 1OUKA 5A6OA 4LFIA 4GVJA 4WSQA 2WTDA 1TFFA 4Y72A 3DBFA 2C6DA 4DH1A 1LEWA 3DAEA 4TWPA 4GIHA 3I1AA 5E8WA 5HKMA 3ZONA 2X4FA 3HX4A 4O27B 4WG4A 3FMDA 3HA6A 4CD0A 1G8AA 3FY2A 4BTMA 3SW4A 3WZKA 4FZAB 4X7QA 2F7EE 5ITAA 4DHZA 2XAOA 5B2KA 3R1SA 4YTFA 4MBJA 2XK6A 2PVRA 4CSVA 5AR2A 5HE1A 4DEHA 1KUTA 4I5MA 2XK9A 5IH6A 1J1CA 3NUXA 2QVSE 3AGLA 4U45A 4YJNA 5HU3A 3OCSA 3O5AA 2W9FB 2ESMA 2Y6OA 4TN6A 4FMQA 4X6QC 5AP5A 2XNMA 3CP9A 1XWSA 4TY1A 4YZNA 1VYZA 4WRGA 5FWKK 3SC1A 2HK5A 1F0QA 3K54A 3M42A 5ETAA 3UVRA 3NFFB 4EJNA 3VQUA 5BX0A 4MBLA 5EKNA 1U5RA 2J5EA 5IU2A 4ASZA 2XKEA 3EQDA 3FMKA 3UBDA 5IA5A 5I5ZA 5LWNA 3RBWA 2EXMA 3L9PA 3O7LD 4IZAA 3VUIA 1YW2A 4XG4A 5AR5A 5HG7A 3NS9A 3FMLA 3FZPA 3RK5A 3FBVA 3DTCA 5F95A 4E4XA 3IO7A 3QGYA 4NEUA 3NVMB 3C0IA 4LV8A 3BU6A 5HE0A 3FJQE 4M0YA 3P1AA 3PE2A 1IRKA 3PYYA 4WUNA 2QC6A 4RT7A 2BCJA 3POZA 3RHKA 4DINA 4AA4A 1J7UA 2PL0A 1MRUA 4G3GA 3RJCA 4LGHA 3TZ8A 4LOPA 2GQRA 4Y5HA 4FNXA 3R8PA 2ETKA 4F9AA 2WTKB 2NRYA 5EM5A 2R3NA 3TNIA 4BB4A 4USEA 2YM4A 1WBTA 2OH0E 2C69A 2WMQA 5EDPA 1RQQA 4FL1A 3CS9A 4D1XA 2OGVA 4USDA 3E8EA 4QNYA 4KKEA 2YZLA 3KXHA 1FPUA 1PKDA 3CR0A 4HYSA 5IQCA 5FXQA 3BLRA 4OGRA 4IB1A 3VO3A 3R9OA 1R1WA 4I4EA 3FZOA 2JDVA 4E20A 5CAUA 2VWZA 3ATSA 5JFXA 5M4UA 4GS6A 3HRCA 3R8VA 3QD2B 3E8CA 4IC7A 3QXOA 1OZ1A 5CF6A 2PE1A 4PMMA 4L44A 4UMPA 5FTOA 2C6OA 3ORTA 4DHFA 3VBVA 5AUZA 4WHZA 2C68A 2YFXA 3IDCA 4W4YA 4ZK5A 2I0VA 4X3FB 3PVGA 1BUHA 3DBQA 3QBNA 2BZIB 3V5PA 2XBAA 2IZTA 2XCKA 4FSRA 4H36A 4KKGA 3NIZA 4XOYA 4PPAA 3OG7A 2XK3A 4LRMA 3Q9YA 3F3TA 4QTDA 4L43A 4ITHA 3ZXZA 2OXDA 5HLWA 3W2SA 5L6OA 2QCSA 2ONLC 4P90A 4PY1A 5JFSA 1JSVA 2XK4A 3QTUA 3IKAA 3IDPA 4WUAA 5J7BA 2QO7A 4RJ5A 2ITQA 3BLQA 4DH3A 5HIBA 4RA4A 2WTCA 5AP7A 4QPAA 3LMIA 3PRIA 4FSUA 4HPUE 2BKKA 4GSBA 4O84A 3BZ3A 4JR7A 4V0GA 3T9IA 3LQ8A 3VHEA 4EH9A 3ZC5A 4EHZA 4ZZNA 3F5XA 3SXRA 4A4LA 4RIYA 4E26A 4QQTA 2XCHA 5LVOA 3DZOA 1ZYDA 1STCE 4UEUA 2EWAA 5CSPA 1U54A 4ZS4A 2R3JA 3QZGA 3KU2A 2R3HA 1YXXA 5JGBA 3PZEA 1WBSA 2XAMA 1PXIA 4EOSA 3HAMA 3ITZA 4E73A 3P08A 2BKZA 3L9LA 2PZIA 2CKEA 3V8SA 1XHAA 2J9MA 3FLYA 3L9MA 3PY1A 3MIAA 4JG7A 3U4WA 4YP8A 2BHEA 4NM5A 4TYJA 4U43A 4GVAA 4I6BA 3NW5A 4RJ4A 4LV7A 3QZFA 2YDJA 3I7BA 2CNQA 1RDQE 3EQFA 3HV7A 2PVJA 2WGJA 1PF8A 2UUEA 3BL9A 4FV5A 3C7QA 3NAYA 4TZRA 3FLSA 4JRNA 1OL7A 2WTJA 3BHTA 5HBHA 5ETFA 2HXQA 1H24A 4IVBA 1R0PA 4FZ7A 5CX9A 5D1JA 4NM3A 2W4OA 2I6LA 5GHVA 5DGZA 5EYKA 4ASDA 4JAIA 3UG1A 4YR8A 3LPBA 2X0QA 2Z7QA 3HRBA 3NUPA 4QPMA 5E7RA 5HNBA 3H9FA 2PHKA 4EOKA 5K4JA 3SRVA 2Z8CA 5EW9A 4ANSA 4J95A 2H34A 3R1NA 4LMNA 3NNVA 4OUCA 4M13A 3RI1A 3R2BA 2YA9A 3ANRA 3BE9A 5DLSA 2B4SB 2VWIA 4B4LA 1IAHA 3TNHA 3C4ZA 4FT3A 1UWJA 4AZEA 4C36A 1OL2A 5CEIA 4N4SA 4KBAA 4PPBA 5ANKA 1QPEA 3PA4A 4CMOA 4RGJA 4V04A 3QKKA 3OTUA 4IJ9A 5CENA 5HCYA 3AT4A 3TTIA 3U6JA 4RMZA 4G34A 5IA1A 2CCIA 3UZTA 5LXMA 1GIHA 4RA5A 5DN3A 2XALA 2XUUA 1P2AA 1A48A 4PL4A 3SQQA 3FE3A 5A4LA 3DK6A 2QU5A 2CN5A 3NRMA 3WIKA 2CN8A 3BQRA 4GYGA 2O64A 2WPAA 4KSPA 3EL8A 3SDJA 4JX3A 2P3GX 4W8EA 3VS2A 2AUHA 3I5ZA 4AS0A 3QRIA 5B0XA 4ANNA 1CMKE 1JKTA 2JKOA 4AAYA 3H9OA 2IPXA 4LM5A 3V3VA 2RFSA 4WG5A 5AR4A 4RZVA 4MBIA 4C02A 5BYLA 5M56A 2BAJA 2XJ1A 3IS5A 5DRBA 1ZOEA 4DFBA 4IXPA 3AOXA 5I9XA 2QLQA 3LFDA 4FV9A 2OIQA 4A4OA 5IH5A 2YCRA 4ERKA 1OB3A 2PMIA 3MFSA 5H8EA 3RKBA 2J0MB 5L8KA 2JKMA 5CU2A 3NFGB 4I22A 4K9YA 2O5KA 4JAJA 4O6EA 4HVHA 2B52A 5ACBC 5A4QA 3ZZEA 2YISA 3FLZA 2WOUA 4G6OA 5AV2A 4CTCA 2WNTA 3LLAA 5EG3A 4ZMEA 4Y46A 2CNVA 2VTRA 4XOZA 2F49A 4U5JA 5AM7A 1OM1A 3ZC6A 4LV5A 2VUWA 4QEBA 2X9EA 4MKCA 5AUWA 5KE0A 3PZHA 4BCFA 4FVQA 4R78A 3UYTA 2OIDA 4MWIA 3NLBA 3KL8A 3OWPA 1DS5A 5M08A 3CQUA 4RWIA 2BRNA 4MXCA 5HIDA 4GKIA 4ZSAA 3BU3A 2YEXA 4YC8A 5LMKC 2OF2A 5HQ0A 3Q04A 3ZO2A 2WMBA 5FRIA 3C5IA 1H25A 4A06A 1FVRA 2VV9A 4KABA 4UXQA 2QR7A 3TKIA 3VUHA 3AMBA 3Q9ZA 1WAKA 2GHGA 4FG7A 5DWRA 3UOHA 3BPRA 3A7FA 4ACMA 4XLVA 1OIUA 3A4OX 2QNJA 4TYHB 5AP6A 3ZH8A 4RC2A 5A4TA 5DFPA 2XVDA 4DGOA 2XS0A 5H2UA 3GCQA 3MFRA 4UMUA 3WF5A 4RBLA 4EZ3A 3TWJA 3GCVA 5M4IA 2PE2A 3BYUA 5CT7A 3EN9A 3ZS5A 4PF4A 2W99B 3Q2MA 5IQDA 4ZLZA 5HX6A 3HECA 4FTRA 2HW6A 3VS7A 4OTDA 1NXKA 5KMJA 2CHLA 4HZRA 4Z9LA 1V1KA 4RFMA 4CCUA 4G6NA 3VONA 3NMUF 5E8YA 3DBCA 4TWOA 4U9AA 2C0TA 4GU6A 3Q4TA 2R7IA 5IQIA 1YDSE 1KE8A 2VX1A 5HD7A 4E93A 5CY3A 3G6HA 4JX7A 4RX7A 3RAWA 4AN3A 2ITYA 5BPYA 3LLTA 5M51A 3C13A 1URWA 2WMXA 4B8LA 2BHHA 3MVJA 4J7BA 4ZOGA 1VR2A 1U5QA 3ORNA 4CTBA 4FGRA 4TYGA 3CJGA 1KWPA 3EN6A 2GS7A 2BDJA 4O2PA 4YBKA 4ZSLA 4AGUA 2BRGA 2G15A 3U6HA 3U6IA 5FXSA 5D10A 2XJ0A 2ZMCA 2RG5A 4AXFA 1Q62A 4UBAA 3ACKA 2OZAA 2F9GA 1OECA 2XA4A 3R8LA 4XP2A 4RG0A 3EQPA 4IAYA 2B54A 2O0UA 4IAAA 3GENA 4IZ5A 4ASEA 4BHNA 2IG7A 4U7ZA 3B8QA 1YOMA 2X1NA 3R21A 3UE4A 4F9CA 2Q83A 4KSQA 2RGPA 2ETMA 4PP7A 4F1MA 3IPHA 4FTKA 3GP0A 4CZTA 2FVDA 5HO7A 4G31A 3ULZA 2W7XA 3CGOA 4QQCA 5FEEA 2VTTA 2OF4A 3PXZA 5D11A 5T68A 4RX9A 3LAUA 3ORMA 4IWDA 3VBTA 5HU9A 4FIJA 4C58A 4RC4A 5KMLA 2NPQA 3KMUA 5LQFA 3ZO1A 4XV2A 3PXFA 5FG8A 3IW7A 2IW9A 3ZMMA 1YHVA 5EM6A 5K3YA 5GZ9A 5T6KA 2UW4A 3NAXA 4AOJA 4BYIA 5HZNA 4DFNA 2WMRA 4XRJA 1VYWA 4CNHA 5G6VA 5JEBA 1CKIA 3WZUA 5M4FA 3ACJA 5HICA 3QTIA 4R7IA 4Y83A 3ROCA 3DV3A 4QP8A 2V5QA 3U4UA 5B7VA 3RHXA 4DC2A 3OS3A 3KEXA 4PNKA 4QP9A 1XBAA 4YJSA 3ZXTA 5KUPA 5LVMA 4ALUA 5AM6A 3D0EA 3ZBXA 2BTRA 4EK5A 2ZM3A 4BDJA 5CSWA 3FI8A 3S3IA 5IA0A 4TL0A 3GU5A 3S00A 2YCFA 3K3JA 1JVPP 3Q4CA 2GS2A 4QMLA 3R7UA 4F1TA 2GPHA 3OOGA 4AT5A 3SVVA 2C1AA 4FIFA 4R1YA 2IO6A 4U42A 3TUCA 3OY1A 4QPSA 4CV8A 3R22A 2HAKA 2PULA 3OF0A 1WVWA 4E5WA 1QL6A 4Z7HA 2CLQA 3LKMA 5I3OA 2J4ZA 5BNJA 4R7BA 1HOWA 5JFWA 4BGQA 3O71A 4DDGA 2PMLX 4DEBA 4IWPA 3UC4A 1CDKA 3AGMA 2PU8A 2R7BA 3DFAA 3ROYA 2F57A 3MB7A 4FBXA 3PY0A 3ORXA 5H8GA 1AQ1A 4A07A 2YLEA 3U9CA 2C5NA 4M3QA 3ULIA 2HELA 2ITZA 5CAOA 5AUUA 4KS8A 3I81A 4BBEA 5EQYA 2O3PA 1YVJA 4J53A 2OJFE 3QCXA 3GQLA 3CLYA 2UZBA 3FXWA 3JY0A 2UVXA 3KQ7A 3UDZA 3ELJA 4ZS0A 4M69B 5C03A 3KXMA 3BEAA 1XJDA 3FPMA 4L9IA 4TXCA 3R9NA 4FTCA 4U0IA 4FT0A 4AZTA 4RX8A 3NUUA 5F9EA 1NVSA 4MXYA 5FEQA 1SNUA 2JAVA 3BX5A 3G33A 3P5JC 3BHVA 1G8JA 4MXXA 3K3IA 3BYOA 1OBDA 2XARA 3N9XA 3A60A 1GJOA 3FL5A 3QFVA 5BUIA 1MQBA 4AN2A 5BMSA 1BI8A 4J98A 3DQWA 4F4PA 3V8WA 4G16A 3PPZA 4E6DA 3QKMA 3LXNA 4F0IA 1F5QA 3QRJA 3I0OA 3ZRKA 2WELA 5K5NA 2QG5A 1PXOA 2BILB 3N4TA 2JBOA 5GJDA 5HORA 3QGWA 4K77A 3EH9A 3GU6A 4QYGA 5TO8A 3TI1A 5CAVA 4C38A 4AQKA 3EIDA 1NT2A 4AACA 5HTCA 2XK7A 4BTFA 5EK7A 4O1OA 2Y4IB 4BCJA 4RX5A 3VNTA 3PP1A 2C5XA 3UOJA 2VN9A 4L53A 5CAQA 3OFMA 4K2RA 3VS1A 1Q97A 3I5NA 1IEPA 3LE6A 4FNZA 4UWBA 3C4XA 3EFKA 4NIFB 1KE9A 3JVSA 4DTAA 4FI1A 4EYJA 2C3IB 2JITA 3OOMA 4BCMA 4FYNA 1JPAA 4GUBA 2J5FA 4JBOA 4U97A 4D5KA 2Y0AA 2QLUA 4DFYA 5C4LA 1G8SA 4IAIA 4FKRA 3ZHPC 3A8WA 3OY3A 4K18A 4YZCA 1WVXA 4PTCA 2YLFA 3ZEPA 3FQSA 2W9ZB 3P23A 1HCKA 3P86A 1SNXA 4RFZA 3HZTA 4Y95A 5HCXA 5ANGA 3M11A 2WXVA 4JMQA 4ENYA 3RK9A 3G6GA 2PVMA 3ZRLA 2J7TA 4AA0A 4IM0A 4D4SA 2AC5A 3QCQA 2AQXA 1M2PA 3AT2A 4EKLA 3ZUUA 4Y85A 4YHTA 3ZFXA 4GT3A 3BE2A 3DA6A 3DBEA 3P0MA 2VX3A 3GOPA 4XEYA 5CQUA 4BTJA 3VAPA 5AUTA 1Y6AA 3DGKA 4NM0A 3C4FA 1VJYA 3DQXA 2DYLA 2HZNA 5DEWA 4AT3A 5AADA 1XMMA 2ACXA 4O0XA 4FTLA 2DUVA 5HESA 2BIKB 5JRSA 3QC9A 4IACA 3WF6A 3WI6A 3KULA 1YHSA 3AKJA 2H96A 3C50A 1ZY4A 5IA4A 5CASA 2C6MA 3Q60A 1A9UA 5HBJA 3CIKA 3MVHA 1ND4A 3LFSA 2Y7JA 2XIXA 4D0WA 1Q4LA 2UZUE 3QRUA 4EOPA 3JY9A 4MXAA 5E90A 4ALWA 4D1ZA 1TQPA 4D2SA 1REKA 2SRCA 4HCTA 4CQEA 5HTBA 2WEVA 2JDRA 2XYUA 1H00A 1PXMA 3II5A 3R71A 4O4BB 5E8SA 5TKDA 2GQSA 3GU4A 3HEGA 4GG7A 1R78A 2JD5A 2XNGA 5IPJA 2JC6A 1YI4A 2HYYA 4WT6A 3DDPA 4YLJA 2A0CX 3IDBA 3CKWA 3FY0A 2GNHA 3BI6A 3DXNA 4F9WA 5D7VA 4NUSA 5IA3A 5H8BA 2VTIA 3A4PA 3QD3A 3QF9A 4W8DA 4RIXB 4YJTA 5JRQA 1KE6A 4AW1A 4BCGA 4B99A 4LUDA 4DGLC 3FMNA 4FR4A 4AUAA 3MH1A 3KMWA 1W84A 4O0UA 3QRTA 5IDPA 3V6SA 1TVOA 4C3RA 3BKBA 2YIQA 5KBQA 5E91A 3VIDA 5L2IA 3D7TA 1W2FA 4D9TA 4GK3A 4EOIA 4P5QA 2X4ZA 3TUBA 2R5TA 5ANJA 4R77A 4DFZE 5H9BA 3LQ5A 2BDFA 2OFUA 3PXQA 3QYWA 4C7TA 2RL5A 4KBCA 4F70A 4DTBA 4V01A 5HHWA 3G9LX 3ZDUA 1NVRA 2E9NA 4UN0C 3CQEA 5IF1A 1NY3A 3WILA 1JBPE 4QQJA 3VVHA 4C8BA 3PJ2A 3ZEWA 1T46A 1GNGA 1U46A 2X2KA 4GK4A 4ZSGA 4C4EA 5DT0A 4F9YA 3R00A 4DGNA 4QMQA 4NH1A 2DQ7X 2WZJA 1ZOHA 4QMOA 3UODA 1APME 4O1PA 3I7CA 4JDKA 1ST4A 3TKHA 4QMNA 2VU3A 2VGOA 3PP0A 5DRDA 1M2QA 3FAAA 5DOSA 4F0FA 5LCKA 3NSZA 4I6FA 3NUAA 3ZCLA 4O82A 1BYGA 2PY3A 3O2MA 4E4NA 4YLKA 2QONA 4BCKA 5EHOA 3AKKA 3KFAA 1Q24A 1URCA 4BVUA 5KO1A 2R3GA 4YTCA 3SG9A 4X3FA 2JDSA 4TYEA 4XG7A 1ZRZA 4USFA 2UZOA 2VWUA 3TCPA 3N4UA 3TZ7A 4BGGA 1IA9A 3H9RA 5A4EA 2RFNA 5D41A 5CALA 4DH8A 2W0JA 3PWYA 3LCKA 4BIDA 4BCNA 3VW6A 3GC9A 3HDMA 4TW9A 3MPTA 4FK6A 4EH4A 4EQCA 2YDIA 1PJKA 1Q41A 1SVGA 5AX3A 3JPVA 4HZSA 4Y5QA 5CQWA 3W1FA 5AEPA 4M7IA 2PUPA 3GCSA 3TDWA 4GKHA 3LJ0A 2HY0A 3W2CA 4O7RA 3BQCA 3NEWA 3VBXA 3W0RA 1WBVA 3NUNA 4FOBA 5A9UA 2FSMX 3EMGA 2ZM4A 3VUDA 4EH2A 3D9VA 1PHKA 2GMXA 4KA3A 3REPA 3F5GA 1Q61A 4MF1A 3C4WA 5AAGA 3GNIB 5CSHA 3QC4A 3KULB 3L1SA 2G01A 3FDNA 4L3PA 2YACA 3EN7A 4JDJA 4F09A 1XKKA 4DCAA 4LI5A 2HZ4A 5ANDA 4QRCA 4NWMA 4I3ZA 3UNJA 4JXFA 1DAWA 2RIOA 4I1ZA 4FYOA 5CU3A 2G9XA 3E88A 3HRFA 4U41A 1FVTA 4RQKA 3UMWA 2OK1A 2PPQA 5C8NA 5KNJA 4CZYB 3ORIA 5C27A 3WE8A 1JSTA 4OLIA 5IUIA 1J1BA 5L2SA 4MXZA 3MY5A 2G2HA 3TNWA 4JQ8A 4KS7A 4YO6A 4DTKA 4BJJB 4FG8A 4FX3A 3MFTA 3GU8A 4FZDB 4MYGA 4D2WA 2O2UA 1FMKA 3ALNA 3HLLA 3MW1A 4FKOA 4ONAA 3PPKA 3ENMA 3UQGA 4QMYA 2VTSA 3QRKA 4W9WA 3ZSGA 2WIHA 3W18A 1H01A 1ZAOA 4RSSA 3AD5A 2XK8A 4M84A 1ZYCA 2Y6MA 4JDIA 3AQVA 4Y8DA 3OXZA 5CT0A 3UNZA 4BCQA 4EC9A 2A19B 5E1SA 2EVAA 3CTHA 3UQCA 3Q32A 4D2PA 3DKGA 3ORPA 3D7TB 4I24A 3RZBA 3G15A 1PYXA 2X39A 5LVNA 5CSVA 5E4HA 1H1SA 1H1QA 5AWMA 4EK4A 4C33A 1KV2A 4B6LA 3GFWA 4FT5A 1PMUA 4PMTA 3FZTA 2UVZA 3OWLA 4FSTA 4RFYA 4DG3E 4PWNA 2WIPA 4YHFA 1SZMA 5B2MA 1KV1A 3UPZA 3M1SA 1YWNA 4EK3A 4FUXA 3EFWA 3FKNA 3UIBA 3NW7A 4L00A 4BZDA 2XRUA 3Q2JA 2PSQA 2ZYBA 5AV1A 4WNOA 3KF4A 4DHJA 5HG9A 4U40A 4ANMA 4ASXA 2WD1A 4AGDA 2H8HA 2XIKA 4XG9A 3ZTXA 3D4QA 2YJRA 3VS6A 2JKQA 3A61A 5IMEA 4JI9A 1WBWA 2Z7LA 3P4KA 4CFMA 1GAGA 1Q3WA 3MY0A 4OBPA 5FM3A 1W2CA 3UVQA 3PVUA 4E3CA 2UW6A 3PA3A 2G2IA 4XS2A 2VNWA 3QZIA 3RALA 4EK6A 3ZOSA 4CFWA 2GFCA 4LDTA 3DKFA 4FEVA 2QO9A 3KXZA 4JR3A 3BRBA 3F3ZA 5EM8A 4HPTE 4Z55A 2G2FA 2IW8A 3S1HA 3H0YA 3P78A 4IHPA 4CRLA 4GV1A 4O7WA 5CVFA 3BWJA 3ORLA 3DU8A 2R3OA 4FK3A 1XH4A 4XG3A 4UYNA 3BV2A 3TL8A 3VJNA 4FT9A 1PKGA 2F2UA 3NPCA 5EW8A 5AFVA 3TG1A 2XIYA 3MTLA