4IAFA

Room temperature x-ray structure of camp dependent protein kinase a in complex with high mg2+ concentration, adp and phosphorylated peptide psp20
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
336
structure length
333
Chain Sequence
VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/peptide
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Insights into the Phosphoryl Transfer Catalyzed by cAMP-Dependent Protein Kinase: An X-ray Crystallographic Study of Complexes with Various Metals and Peptide Substrate SP20.
pubmed doi rcsb
source organism Mus musculus
total genus 108
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4iafA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4iafA02
2XJ0A 3WOWA 2C1AA 4FKVA 3TZ9A 4WSYA 3RTPA 4RSSA 3FLWA 2E9NA 3SXFA 3TZ7A 3WF9A 2F7EE 2PVRA 1P5EA 1FVVA 1FOTA 2QOHA 3LFBA 1REKA 3QALE 4W4XA 2VTTA 4GRBA 3W2SA 4JNWA 4XBUA 1E9HA 1UU7A 3DXNA 3QTWA 1L3RE 4XCUA 4YTHA 4FIGA 3S2PA 4AGWA 3L8SA 3Q53A 4OTWA 3FQSA 3EFKA 2HOGA 3BHYA 3GNIB 1Q5KA 4IB3A 5CVGA 4U43A 4ASXA 5EQPA 3W32A 2OXXA 4BCIA 5JKGA 3FLSA 4M8TA 4V01A 2C6KA 3PJ3A 4QO9A 4O2ZA 2EB2A 5DR2A 4L52A 3FDNA 5IF1A 5HU3A 5DG5A 5JSMA 1YOJA 4J99A 4EOQA 3DKCA 3RP9A 3BYMA 4TZRA 4IX6A 2YLFA 3EYGA 5KHWA 3K3JA 1F3MC 2R9SA 2PMOX 5H8EA 4ZK5A 4PPAA 1NXKA 5L6WL 1H01A 5KBRA 2P4IA 1H26A 2HZIA 2UZTA 4ORKA 4M15A 4FTMA 3V01A 5CXZA 2I1MA 2WZJA 3UVQA 2VV9A 3QCYA 4IE9A 4BHZA 3LKMA 5CU6A 5KKRB 4R3PA 3OWPA 3V8WA 4LGDA 3A7IA 2CGXA 5L3AA 4Z16A 3P9JA 3EN7A 4CZYB 4W8DA 3A8WA 3QWJA 4NM0A 1IAJA 1PF8A 3R28A 1PYXA 4FV8A 3V51A 2YWVA 3ZSGA 3GU7A 4FSNA 2OI4X 4FTRA 4I41A 5CVHA 3DKGA 2JDSA 2PE1A 4H1MA 3MTLA 4FKWA 1SVEA 3TNIA 4ZSAA 3QGWA 2UW5A 5M51A 4X2KA 3TT0A 1SYKA 3CD3A 3TNPC 2JFLA 4ALWA 4L7SA 3BLHA 5DRDA 5EOBA 3PY3A 3QA8A 2IJMA 4DFUA 2WTDA 2OJFE 3BLRA 2OLCA 2GHLA 3LVPA 4AA5A 3PG3A 5AP2A 5FP6A 3LIJA 4FSUA 4FTLA 5AR5A 4AACA 3FKOA 1APME 3FQEA 4UMRA 2G15A 4FKSA 3QRIA 3BU5A 4BIEA 4IDTA 3UYSA 4MKCA 4M68A 4MX9A 4MWHA 4DH8A 5JFXA 4APPA 1ZLTA 1ZYSA 2XA4A 2J4ZA 5F4NA 4BGHA 4BKYA 5HG9A 2YIXA 1OUYA 3QTXA 4LL5A 2JIUA 2UW3A 5T68A 4CFVA 4FSMA 4QMQA 5K4IA 3PIXA 2YERA 5FBOA 2UUEA 5CT7A 1GJOA 3CKWA 4O0UA 5LQFA 3QXOA 3ET7A 4AW5A 4UXLA 4WUNA 1K9AA 4K1BA 4IWPA 3Q96A 4YJNA 4HNFA 1PW2A 3HEGA 1UA2A 1V0PA 2JIVA 2J5EA 4FGBA 4TNBA 1ZXEA 5CEQA 2BRGA 2H9VA 4QTDA 3NUXA 4GVAA 3P23A 3SV0A 2XS0A 4I5PA 4MCVA 5FGKA 4C62A 4YURA 4HVHA 4A07A 3TV7A 2OJIA 4B99A 4WHZA 5KMNA 3IDPA 4FG9A 3WF6A 5I3RA 4XV3A 3NVKI 1UNHA 2ITUA 2VO3A 4TYIA 3FKNA 4LV5A 1T46A 1GIIA 2WTWA 3B2TA 3PSBA 2J7TA 4LL0A 4R7IA 5L8JA 2PK9A 3V3VA 3P7CA 4O83A 4H39A 3UTOA 4D1ZA 1KOBA 2R3GA 4K2RA 4BR3A 3CTHA 5EYCA 3LFEA 4IVBA 2C6DA 2WELA 2RFDA 2ZDTA 4ZXTA 4JXFA 4B6LA 5CENA 4QYHA 2ZOQA 4OAVB 4FT3A 5KE0A 1MQBA 3RM6A 3QCQA 1GIHA 2QU5A 3DK3A 4YO6A 4N6ZA 5D1JA 4OTIA 2WPAA 2W17A 1K3AA 4TL0A 2GQSA 4KNBA 5F95A 2BDFA 4BCKA 4ZZNA 3NDMA 4DLIA 2BZKB 4UWCA 5CNOA 2WMVA 4FYOA 2Q0BA 1Q8WA 3L8VA 2ZM3A 3LCKA 3QZIA 2B53A 1ZY4A 3I60A 4AG8A 5E8SA 2J0JA 4PMTA 3P79A 4FKQA 2GCDA 2ITVA 4ZY6A 3LQ3A 5LMBA 3R63A 5C26A 1CDKA 4KBCA 5L6PA 2Y7JA 4RMZA 4ZSJA 3VS4A 3LXPA 4IH8A 4ASDA 4FC0A 4LOPA 3FMJA 2REIA 2Z7SA 3VBWA 1PYEA 4O7NA 3OP5A 3DJ7A 4FOCA 3GBZA 2BKZA 3I79A 5CYIA 4F7JA 3A61A 5I5ZA 3RBWA 4P4CA 1GAGA 2HK5A 5JFVA 4OAUC 4YJPA 4GYIA 2HAKA 4JS8A 2IZTA 3FWQA 3WF5A 3GC0A 3NUUA 1M14A 2BTSA 2DWBA 4FT7A 2XNBA 2X7GA 5AUTA 2CN5A 4MYGA 5HCYA 2P55A 3C4FA 1UWHA 2C3IB 3AC4A 3PXFA 4BWKA 4WNKA 3V8TA 5LWNA 4P5ZA 5JEBA 4PF4A 4GU6A 1OL6A 3RAKA 2WTKC 5L2WA 1J7UA 2ETRA 3OXZA 4XP3A 5EM8A 4BGQA 2W4JA 4IVCA 4I6FA 5CI7A 3PPKA 4QP3A 4RIWA 4Q9ZA 4E8AA 1UKIA 3BV3A 3VS2A 2VNYA 3EZRA 5EYMA 3HAMA 2BMCA 4YJVA 5HBHA 3BQRA 4A06A 3P1AA 2CGWA 3DAJA 4H3QA 3EKNA 2XEZA 3IOPA 4GIHA 5IA5A 2VX1A 3QTSA 2CKQA 4C33A 4JG6A 4A4XA 3IONA 3ACJA 4O82A 3W2PA 2XK6A 3JY0A 3M1SA 4NEUA 4O0TA 4U3YA 5AJQA 5IUIA 4RJ3A 4EHEA 4B8MA 2ITQA 4FKJA 4MF0A 5DFPA 5FXSA 3CQEA 3Q2JA 4KWPA 3CTQA 1V1KA 4DYMA 4CQGA 4EEVA 4AN2A 4DGLC 4QMVA 3O96A 2JEDA 2E9OA 3LFNA 2WMUA 2CJMA 4RVTA 3HNGA 1GY3A 5DN3A 1AD5A 1J7IA 4TYGA 4Z9LA 4EZ7A 1NVSA 4O0SA 2O8YA 4BDAA 4DLJA 5B0XA 4FG8A 4EH3A 5CALA 4G3GA 2F49A 3DQWA 3U55A 2QOLA 5HE0A 5AM6A 1Y57A 2YLEA 3BX5A 4YJRA 4C61A 5EQEA 2F4JA 3EQHA 4RX7A 4MHAA 2RSVA 3VS6A 4KIPA 3ZFMA 4AGCA 4BWXA 3LMHA 3G9NA 1PXOA 4DG3E 3AQVA 4IB0A 4HZRA 5JRSA 4OUCA 3OBJA 2VTPA 4XHKB 2XKDA 1Z57A 4FV9A 4G3FA 5CS6A 3EQGA 5I3OA 2HY0A 2CNQA 3U6IA 3R7GA 3DAKA 4L67A 4UZDA 4BGGA 3AXWA 4TYEA 5BVOA 4ZTMA 2WMAA 4KKGA 2C3LA 4EHZA 2Y9QA 5CSWA 3R8VA 2FSLX 3R8LA 1PMUA 4FTTA 4FTKA 4CNHA 3OCSA 2ITNA 3PA4A 2YCRA 4JG7A 1L8TA 2R5TA 4XUFA 5AAFA 4L7FA 4RJ6A 1Q8ZA 2VWZA 4IHPA 3RK5A 3PDTA 5M06A 2R0IA 3UP2A 5HG7A 4K77A 4WG4A 4CRLA 3TDVA 2ZDUA 4FNZA 3ZC6A 1ZZ2A 1R1WA 2ERKA 4FTAA 4O0RA 1CKJA 4DHFA 3RKBA 3I5NA 5IH5A 4RIXA 2B4SB 4YHJA 3DU8A 4F70A 4DTKA 2JKQA 2ZB0A 4OW8A 1GIJA 2Q0NA 4X6QC 1R3CA 2QD9A 5HG8A 1HCLA 1ZYDA 3RINA 4C37A 3HYHA 2EVAA 3E3PA 3DS6A 4BDCA 4DTAA 4EI4A 3HA8A 3OCGA 4EYMA 1XQZA 3R9OA 4J95A 4NW6A 3RAIA 3VS5A 4A9YA 2QOQA 1Q3WA 2GS6A 2IZRA 4FOBA 4MTAA 1SMHA 4BZOA 4W9WA 3GXLA 4BTKA 3F66A 3QHRA 4FE2A 1WVYA 1B39A 2WTCA 3KEXA 1SVGA 5E8WA 3EFWA 4IX4A 4FGRA 4FTUA 5CY3A 4WRGA 2GTMA 2R3LA 3CQUA 3NNWA 5EDRA 2WHBA 4ID7A 2PTKA 5AR2A 4RPVA 1UNGA 4BI0A 4N0SA 4RIWB 4CVAA 4GG7A 4R1YA 3MA6A 2UZUE 5LMAA 4BTFA 3D0EA 2XM8A 3I6UA 3VHEA 4Y95A 3QCSA 1Q8UA 3L9MA 4IAIA 4RBLA 4AZWA 4FIIA 1YXTA 5AX3A 3SG8A 3FE3A 4ACCA 5KBQA 1YWVA 4ALVA 2VZ6A 4YNOA 4D55A 5JQ8A 4FEVA 4CFFA 4PRJA 4XV9A 3BYUA 2WTVA 3V5PA 4GKIA 4QYGA 4I0TA 5AV2A 4XG7A 4F7LA 3DA6A 4S30A 2ZV7A 3A7JA 4FZ7A 3UPZA 1GZKA 3G5DA 5DLSA 4EUUA 4QMZA 3RZFA 4BCHA 4PL3A 4ENYA 3Q6WA 3EN5A 2W05A 3MTFA 1E1XA 1BUHA 4HZSA 4QYYA 4BYJA 5AV3A 4EKKA 4XG2A 4ANBA 2VTOA 2ITOA 2OW3A 4M13A 4AA4A 1W8CA 4ZAUA 5ICPA 3W2RA 4BKZA 1FBNA 3MGYA 4Z7GA 5A46A 4YZBA 2VUWA 2BAQA 2UV2A 4FK6A 3F5GA 2ETMA 2JC6A 3NYXA 2UW7A 4O81A 3ZCLA 2C30A 3R71A 3V6RA 2QODA 5EDQA 4CD0A 3PVGA 2VU3A 3OTUA 4QMUA 1PKDA 4XOYA 3DDPA 2XK8A 2VO0A 2WMWA 3VUTA 4MBIA 2ZYBA 4BTJA 1BI7A 1J91A 4WT6A 5HBJA 2WMQA 1W84A 4RLKA 4F7NA 4NFMA 2JGZA 2VTSA 2G2IA 1GZ8A 5ETIA 4KIOA 5HCXA 4DH3A 3U6JA 4NM3A 4UEUA 4ZTRA 3PIYA 2OSCA 3QTUA 3ZFYA 1OIQA 3H9OA 2PMLX 4EJ7A 4O27B 4ALUA 1SVHA 4G9RA 3RNYA 4EUTA 3SW7A 2R3HA 3OROA 4FKIA 3OF0A 2PVHA 4FNYA 3FHIA 3GB2A 4X3FC 4FTIA 4GEOA 3R8UA 3FL4A 3IK3A 1QPEA 4ANOA 2PL0A 2HXLA 3V5LA 4EYJA 2AC3A 5F20A 4DF3A 3FYJX 3O0GA 3K3IA 3VAPA 4MQ1A 4PMSA 4CSVA 3HRBA 2E2BA 1W98A 4UYNA 3KF4A 1B6CB 3MFSA 4AOIA 4DFBA 3G9LX 2PMIA 1YWNA 2RL5A 4V0GB 3R8PA 2FYSA 3POOA 4QYFA 4YMJA 4O22A 4I6QA 3VHKA 1ND4A 3ORTA 3ZSHA 3A4OX 5IKWA 3TEIA 3VBVA 4ITHA 2JLDA 4B0GA 3R9DA 5DT4A 4FZFB 4IM3A 2C5NA 3O7LB 3QAME 4LRMA 3COMA 1YWRA 3LM0A 5M57A 2QO9A 3UE4A 3KVWA 4RWIA 3OXTA 2XNOA 5DWRA 3CQWA 5EI8A 5KO1A 3FZOA 1H1PA 2BAKA 2VTJA 4IQ6A 3NLBA 4E6QA 1AQ1A 1PXKA 2WEVA 4QQCA 4TWPA 5FTQA 4BC6A 4EH6A 2J6MA 5AUVA 3NUAA 4I1ZA 4PUZA 3T3VA 3ULIA 4EOSA 4F08A 3TNQB 2JIIA 3VS3A 5A6OA 5DPVA 3Q5ZA 3DV3A 2GNHA 5LVNA 4MQ2A 1JAMA 4LMUA 4CTCA 4F0FA 2CKEA 1F0QA 2ZMCA 2YIYA 1V0BA 4NUSA 2B9JA 4TT7A 4X3FA 3CR0A 2W1ZA 4FTQA 4V05A 1XO2B 3FLZA 4PP7A 4ZZOA 2X7FA 3I5ZA 1FMKA 3KK8A 5F9EA 2JAMA 4DEIA 1BL7A 2YDKA 4U41A 5CVFA 5HD4A 4UMQA 1Q97A 2WOUA 3UP7A 3O8TA 4PL4A 2O5KA 3KCFA 3L1SA 2BRNA 2BUJA 1M17A 4C7TA 4XG3A 4IM2A 4ANLA 3Q5IA 4NZWB 2WMBA 5GZ8A 4UMTA 2GSFA 4R78A 5EKNA 4I5MA 3LCTA 5BMMA 3SAYA 3D9VA 3TM0A 4HYHA 1KV1A 2VTLA 3GUBA 3NUYA 3Q4UA 3S00A 3D94A 3NYVA 3NW7A 2VGPA 3O17A 2H8HA 2W4KA 3BHHA 4NIFA 3D5UA 1WBWA 4IAYA 2NO3A 3CJGA 2R7BA 4F1MA 3UG2A 3MW1A 3ZZWA 4CFUA 4USFA 2OF4A 2YM8A 2Z7LA 4KA3A 5E92A 4AXAA 1PMEA 5CASA 4LQMA 2OFVA 3NUNA 5HE2A 3DNDA 2OK1A 3W1FA 4LM5A 4M0ZA 2E9VA 2NRUA 1M7NA 4ZTHA 4C35A 1OITA 4JAIA 5GJDA 3ZRLA 2C6TA 1Y6AA 3CS9A 1FGKA 3U9CA 3PLSA 3KFAA 2RG5A 3DCVA 1KSWA 3AGLA 4E26A 2C4GA 2X2LA 3PZEA 4JL9A 5HVJA 5LCKA 3WYYA 4IB1A 3TWJA 4C4IA 3HECA 2YM6A 3F5XA 5FLFA 3BKBA 3BYVA 3VBQA 2YZAA 3GGFA 2GNFA 4ITIA 2OG8A 1TKIA 3AC5A 4EWHA 4F6SA 4UV0A 1G8AA 2UVYA 5DT3A 4OTQA 4RFYA 2QOOA 5DR9A 3VUGA 4YTCA 2GS7A 4JDKA 3W10A 3WZKA 2VD5A 3M42A 1H24A 3ZMMA 5BVEA 3H9FA 2RF9A 4B7TA 3QUPA 4FUXA 4FVQA 1H4LA 3OOGA 2FUMA 4U81A 4UMPA 3HV3A 4MBLA 3RVGA 4E4LA 4JQEA 5DRBA 5AX9A 5DIAA 5EG3A 2WIPA 4FIJA 4RJ7A 4FODA 5ETAA 3AT4A 3OS3A 4EKLA 4TYHA 4EH2A 2RFSA 2XKCA 2FGIA 4IFGA 2IVUA 4BBEA 4E20A 3FMDA 4ENXA 3M2WA 4BTMA 1Y8GA 1UWJA 3R2BA 5E7RA 5HKMA 2EU9A 2XRWA 2WO6A 2Y4IC 4FV4A 4ASEA 3PYYA 1FQ1B 5JN2A 4GT4A 2XBJA 3U8WA 1URWA 4IDVA 3JVSA 4JBVA 1H1QA 2UZNA 4FL2A 3R1SA 4WA9A 2BPMA 5GJFA 4EWQA 3IGGA 5ANIA 3O8PA 2X8DA 4EZ5A 5A9UA 5J95A 3RK7A 5I9VA 3CKXA 3Q9WA 5HLWA 5FM3A 1W0XC 2OICA 3GCQA 5H8GA 3LAUA 1YRPA 3NX8A 3VS1A 3KK9A 2V7AA 3HV5A 3EHAA 3QQLA 5DGZA 2R3QA 4BICA 3FMEA 5CSHA 4E6AA 1WBTA 3KRXA 4AN9A 2YIQA 3KC3A 4R7BA 5AIRA 4EOJA 5B2MA 3D15A 5JGDA 4DA5A 3H10A 4P90A 3P4KA 3OUKA 3RK9A 5KCVA 3SVVA 4EK6A 3UNKA 5CQWA 5B7VA 2QONA 2YCQA 2UW4A 4MWIA 3R9NA 3TJCA 5A4CA 2C3KA 5HQ0A 5J9ZA 4F6UA 4K0YA 4TY1A 3HUCA 5CU0A 2XK7A 3LMIA 2X6EA 2PE2A 5IQBA 5DE2A 5KHXA 4AT4A 3KF7A 5CSPA 4PTGA 2V62A 2WU7A 3QKMA 1ZY5A 2J90A 4ZTSA 4JQ7A 3C4CA 3S1HA 3WIKA 4XS2A 4OTPA 1YXVA 4GUBA 3VJOA 3SGCA 2XMYA 5GHVA 3ZLWA 4EBWA 5FDPA 3NYOA 5L2SA 3LXNA 4FTCA 2WD1A 2WOTA 4FYNA 4IZAA 3AC3A 4MXXA 3F2RA 2CMWA 3NS9A 1OB3A 5HNBA 5AM7A 5JK3A 3LMGA 3OEFX 4LG4A 5HIBA 4Z3VA 1XH5A 4CKRA 5HEZA 1FPUA 3D2KA 4ERKA 2WQEA 5CF4A 4MK0A 4C57A 2ITYA 3ZZEA 5LVOA 1ZOEA 2KTYA 5AUYA 2R0UA 3DB8A 4OBOA 3ALOA 4XP0A 4W8EA 4LUEA 2CCIA 4I21A 3RM7A 5HORA 4LUDA 4ITJA 1OL7A 4C2WA 4IMYA 4IXPA 2C1BA 2YDJA 4PTEA 2RFNA 3UC3A 4BL1A 3LOKA 3HRCA 2V55A 2IO6A 2QNJA 4NFNA 4F6WA 3F3VA 3WZEA 2C47A 5E1EA 4UXQA 2OKRA 5CTPA 4DEHA 3DDQA 3I6WA 5CSVA 4A9RA 4CGAA 4HJOA 4FV2A 3EFLA 3A2CA 3MVHA 4BCMA 4YSMA 4B9DA 4KB8A 5E8TA 4E4NA 5KMOA 2VGOA 4C36A 4O0YA 4ZJIA 4O2PA 5K4JA 4RA4A 5BYLA 4DTBA 3F2NA 1XBAA 4P2KA 3QC4A 3TIYA 2OJJA 2W1CA 1LR4A 3WE8A 3FLQA 3GU8A 1PMNA 4LMNA 2QC6A 4QT1A 4RZWA 4BKJA 5D12A 3AMYA 4XRJA 1H8FA 5A6NA 4IW0A 5IUHA 1KE6A 3L8XA 4EBVA 3MB6A 3ZEWA 1YHWA 1YXSA 5JQ5A 4D4VA 2CN8A 3F7ZA 1U4DA 4CG9A 4QTAA 2VAGA 2GFCA 2G2FA 3PPJA 3FQHA 3TJDA 1Z5MA 2ITXA 3DOGA 2WQNA 3RAHA 3FXWA 4E5AX 4R1VA 4CG8A 3VWAA 2P3GX 3IDCA 4ANMA 4EOKA 4YTIA 2VWUA 2CGUA 4M69A 5J5SA 2EB3A 2R3OA 1KE7A 2BCJA 3II5A 4IX3A 5K0XA 4QP7A 2C6EA 4YLKA 5AV1A 1DAYA 2I40A 3QKKA 4IAKA 4CYIA 3DAEA 5EH0A 2PYWA 4AFJA 4ZTNA 3ZM9A 3A62A 4O0VA 4YU2A 5C8KA 2R3PA 3OWKA 5E8UA 2RIOA 2JAVA 1TQMA 2ERZE 5BMSA 4O96A 4E5WA 5AR8A 2XNMA 3BRBA 3ENMA 5ANJA 3CPBA 3D5XA 4BCGA 5IUGA 2XRUA 5D9HA 2BRBA 3ORZA 5FEDA 4ZY5A 3CC6A 2OXYA 5AP1A 4XMOA 4XYFA 5AR7A 1PRYA 2PPQA 5DI1A 3BWFA 4AN3A 3MESA 3NMUF 3R30A 3EQFA 4KUJA 3G15A 4LOQA 4QP8A 4O84A 1OGUA 2ZB1A 5KNJA 4IIRA 3RPYA 1SZMA 4NJ3A 4NU1A 2IN6A 3REPA 4NTSA 1RW8A 3KA0A 1OKZA 5DOSA 5ANKA 3G51A 5BVFA 2VWYA 3JPVA 3UIXA 5E90A 4C4JA 5EM5A 4O86A 3R6XA 4YJTA 5CAOA 2IW9A 3KCKA 5HVKA 3LZBA 5IQHA 1OL1A 2VNWA 4S31A 4O7SA 2O64A 4ACHA 3RWPA 5JFSA 2A0CX 3HX4A 3QLGA 5CEKA 4O7ZA 1DI9A 1YQJA 3FY0A 3D7ZA 3FMMA 2YISA 4BCQA 5JZNA 4MVFA 4BZDA 3E3BX 3PLAE 4GUEA 2YJSA 4BIDA 2PWLA 5DNRA 1XBCA 4YHTA 4E5BA 5AWMA 3QKLA 4YZDA 4WUAA 2J0KA 3TKIA 2VTNA 2KULA 3QD0A 3ZO1A 4U0IA 2VWXA 3BZ3A 2IPXA 3N51A 3E92A 3L9NA 3VRYA 4QMPA 2QKWB 3C4WA 3KULA 1R0PA 5BVDA 3QA0A 3UJGA 5IA4A 2X39A 3DZOA 3LFFA 3C50A 3F3UA 1BKXA 1S9JA 4IADA 1OL5A 3KN6A 2HW7A 3MH0A 3R00A 2XJ2A 4HGTA 5M56A 4DN5A 2UZBA 5L2IA 1Y8YA 1Q61A 3R7OA 4DFLA 3FEGA 2X4ZA 4XH6A 2X8EA 3OZ6A 3E8DA 2GQRA 2B1PA 2J50A 4C4HA 2XF0A 3Q60A 3GVUA 3UOKA 5AAGA 4W4VA 3BEGA 4IAFA 1OKVA 3JXWA 3V5WA 3VUKA 3IGOA 2YZLA 3SKCA 3ZH8A 4BCOA 2W1EA 3GC8A 4D2TA 4XV1A 3LQ5A 4Y8DA 5CAQA 2G1TA 5IISA 3MYGA 2W7XA 3M11A 2GQGA 1VR2A 1X8BA 3KRJA 3ZDIA 2BHEA 3S4QA 3SX9A 4QQTA 2BDJA 4JJRA 1W7HA 4YPSA 2PZYA 4OBPA 4FL3A 2ZJWA 2VX0A 1GZOA 3Q32A 3CJFA 3A7HA 3F2AA 4PDOA 4Y72A 2QKRA 3NW5A 3LHJA 3GC9A 1JPAA 4PP9A 4UX9A 4F7SA 2ZV2A 3PVUA 3UZTA 4MBJA 3UOHA 3LQ8A 4HYSA 4ZLYA 5BUJA 3D5WA 3FI3A 4M69B 4AOTA 2BVAA 3F88A 2Z7QA 4EOIA 2QU6A 3LE6A 3VBXA 3MB7A 2C5XA 3VIDA 4YZCA 4U9AA 1MP8A 4WOVA 5CSXA 4UWYA 5EW3A 4XP2A 4FEUA 3E87A 2PVNA 4G5PA 4USDA 2PUPA 3H0YA 3B2WA 3TIZA 4A9SA 3SXRA 4F99A 2QG7A 5GIPE 2OZAA 4Z7HA 3G6HA 2FVDA 2QOFA 3H9RA 2I6LA 2WKMA 3IW7A 4CKJA 4QMXA 2FO0A 3QBNA 4FX3A 4L3LA 4K11A 2NNWB 3Q2MA 4RZVA 3OG7A 4FSQA 3MVJA 4BDFA 2GMXA 3E62A 2QQ7A 4KIQA 3EL7A 2XH5A 3AD5A 2G2HA 5HLNA 3ANRA 3PTGA 2QVSE 5I9UA 3QD4A 3BPRA 3BYOA 4OGRA 3ZSIA 1OKYA 4F9YA 5LXMA 4J53A 1IR3A 4DGNA 2PZRA 4DINA 3BIZA 3DXPA 5TE0A 4KABA 3W55A 1M2PA 5HNGA 4L01A 5HD7A 3U51A 2XK9A 4EHVA 4APCA 3TDWA 4EC8A 5L8LA 5LARA 1DAWA 4JVGA 4Y5QA 5HX8A 2B54A 3GCVA 2XEYA 3GOPA 2XIZA 3F3TA 5HTCA 4PX6A 4UB7A 3QQJA 4L43A 4M97A 5J9LA 3Q4TA 4LFIA 3Q6UA 4AW1A 4MF1A 5ETCA 3H4JA 5JGAA 2W1IA 3GFEA 4Q9SA 3WF7A 3BI6A 1WAKA 2E9UA 3C1XA 3QX2A 5IQGA 1WVXA 1YXUA 3Q3BA 4FZAB 4FKUA 3EQPA 3SRVA 3PWYA 4M84A 3UG1A 4DGMA 5DVRA 4NCTC 4GFGA 2Z60A 1YI4A 4RVMA 1JQHA 2XBAA 3CE3A 3KQ7A 4B8LA 3GEQA 2CPKE 4JOAA 5JFWA 3HMOA 1PXPA 4CFNA 3QTIA 3UO6A 2X9FA 3KULB 5I9YA 2UZOA 3L9PA 2W9ZB 4EH7A 4RJ8A 2PU8A 4TWNA 5IQAA 5KMLA 1EH4A 3UODA 4GFOA 3SW4A 5DR6A 1XWSA 3N4UA 4QNYA 4O7RA 3QRKA 3SQQA 4O7LA 4BDJA 2F2UA 5C27A 1PMVA 2Y0AA 3FSFA 4U80A 5H2UA 3GC7A 4OTDA 5HESA 1VEBA 3O50A 5J1VA 3KN5A 5C01A 3NNXA 2W1GA 3R01A 2BDWA 4QTCA 4QMYA 4EOMA 3AMAA 1Y6BA 4HPTE 3ZO3A 2YM4A 4YHFA 4PWNA 4RT7A 1W82A 2B9HA 3DGKA 4OBQA 3A60A 4FV5A 3HAVA 3A99A 1MRUA 5HNIX 2X2MA 4A9UA 2RFEA 3E8EA 4TPTA 4RJ5A 2XCKA 3G6GA 5AUZA 4ANQA 2XM9A 4G2FA 5T3QA 4CLIA 5C1QB 1NT2A 4TWOA 1JKSA 1CKPA 2O63A 3O8UA 3ITZA 2OH0E 2WQBA 5M07A 2F57A 4D58A 5IA0A 5AUWA 3EWHA 3CGOA 3KXHA 5C8MA 3EKKA 3IO7A 3UGCA 4PV0A 2CDZA 3DJ6A 2Z2WA 3C4XA 4Y5HA 3OOMA 3PJ2A 4P7EA 3ZRKA 4DG0E 1J1BA 2BIYA 2BRHA 2QR8A 1YOLA 4QP4A 4BWPA 2JBPA 4I6BA 4O7YA 2J5FA 4G1WA 3FBVA 4JDIA 3EN9A 4TW9A 3VBYA 1YVJA 5HI2A 4C59A 2VWBA 5A14A 4JAJA 3Q4ZA 2XYNA 3DKFA 3FMLA 4EK4A 2WMRA 5IQEA 4KS8A 5AA9A 4HW7A 3R2YA 3V6SA 3PUPA 3MI9A 4RJ4A 3ID6C 3ZLSA 2HZ4A 4EC9A 3C4ZA 4LI5A 2QO2A 5BVWA 2YCFA 2UW8A 3QWKA 4JIKA 5CWZA 2OZAB 3SDJA 1VZOA 3L9LA 5DA3A 3ZXZA 3TUDA 2IVVA 1WBPA 2VTRA 3ORKA 3CSVA 3DBEA 1Z9XA 4E7WA 3GT8A 1KE9A 4II5A 5HZNA 3HUBA 4G9CA 3UIUA 4DE4A 4J8MA 4AT3A 2WQMA 1DS5A 3LJ1A 3ZYAA 4K9YA 4U97A 5HO7A 4YO4A 5M4FA 5AFVA 5C4KA 2VWIA 3EYHA 2W99B 4GVJA 4YZ9A 3NR9A 4O38A 4HVDA 2C68A 2X2KA 4DG2E 1OECA 4EZ3A 3DXQA 3PRIA 4QTBA 2UZLA 4M67A 5D41A 1O6YA 1QPDA 4RGJA 2B52A 4HYUA 3BCEA 3FI4A 5EI6A 4I20A 4FG7A 2J0LA 3E88A 3R04A 4JDHA 3IDBA 2Q83A 5FM2A 3Q9YA 1MUOA 2YM5A 2Z8CA 2IZSA 1GZNA 3QQFA 3DLZA 4C2VA 1OPKA 1PXMA 3MY0A 3RGFA 2W1DA 3CPCA 4U44A 4OT5A 4D1XA 2R3RA 3K54A 4H36A 3LW0A 4FKOA 1FINA 2WTKB 3SOAA 3DLSA 1IEPA 3BHVA 4A4LA 2H96A 4U79A 4YZNA 3C4EA 3IW5A 5DH3A 2YAKA 3A7FA 4LRJA 4BDGA 3FZTA 1YOMA 4YZMA 4C3PA 3QZGA 2WTJA 4O7VA 2IZUA 3SRVB 3QHWA 3HP2A 4DAWA 2WMXA 2BFXA 1PY5A 5AUXA 4NM7A 4ZY4A 4DH5A 2X4FA 4BI1A 4F1OA 4NW5A 2XP2A 3LFSA 3O71A 5KZ0A 2YDIA 4MD7E 1ZWSA 4G3CA 1NA7A 3VS7A 3WYXA 3WZDA 3KVXA 3FI8A 3Q9ZA 4U40A 4BY9E 5HX6A 4QMSA 3T8OA 4XRLA 3UQGA 3ATSA 2I0VA 3VS0A 3PVWA 3UZRA 2OZOA 4L68A 3EH9A 4JR7A 3HV6A 4H1JA 3AT3A 2UZDA 3LCOA 4WBOA 2VN9A 4QQ5A 4Y83A 1WVWA 1OIRA 2F2CB 4A4OA 3HKOA 4RIXB 4FSYA 4YJOA 1REJA 4RA5A 1H0VA 3OTVA 4YGAA 5A4LA 5ITAA 4JBPA 3TNHA 2HXQA 1V0OA 3KRWA 4M3QA 2OWBA 4XV2A 4WNPA 3CCNA 1XH6A 5EKOA 4XG8A 1SM2A 4YP8A 4D2RA 1UU3A 5I9XA 3R1QA 2WTIA 3UO4A 4GKHA 2JBOA 1H1RA 3QZFA 2ETKA 2PSQA 3BV2A 3ZDUA 2XCHA 5LVMA 4FV1A 4RRVA 3C13A 5BQ0A 2QCSA 3KMUA 4KIKA 5J5TA 4NKAA 4D2SA 5IG1A 5EDPA 4Q5EA 4YJSA 1CM8A 3F7WA 3FC1X 4YUQA 5E8XA 4RC2A 1OPJA 5EM7A 2VO6A 3PE1A 1BYGA 3P7AA 4IZ7A 4CZTA 3MN3A 2CNUA 4QP2A 4I6HA 4L9IA 4X6RA 4IM0A 2UZVA 4D1SA 4QMOA 1S9IA 5K3YA 4HVGA 3IPHA 3OMVA 2I0YA 5E9EA 3OY1A 4WBBB 2BILB 2C0IA 4U3ZA 5CEIA 3WARA 4DEEA 3DPKA 3LXLA 2OIBA 3WI6A 4DCAA 2WEIA 3D7TA 3JVRA 3P5KA 4NM5A 1NY3A 2C3JA 1OBDA 1H25A 3WBLA 4K8AA 3ZHPC 4EQMA 3UQCA 4ACGA 3OXIA 3DZQA 3HL7A 4X2NA 3I81A 1P2AA 2YN8A 5EHOA 3PA5A 4X7QA 5CQUA 3DBCA 2PZPA 5CI6A 3NGAA 1I09A 4ZLZA 3DBQA 5HBEA 4XLIA 4PTCA 3UIMA 5IA2A 4O0WA 2Y4PA 4FZDB 5E8YA 4EQCA 4D9TA 3OW4A 2DYLA 1R0EA 1O6LA 5IEVA 4YC3A 4I0SA 3GI3A 2P2IA 3MDYA 5HIDA 4USEA 3VVHA 5IPJA 3VUHA 3NCZA 4QP9A 4AGDA 5CNNA 3FHRA 3VW6A 4AZSA 3RJCA 2ITWA 3C0GA 5TF9A 1VYWA 5KMMA 3W16A 4V04A 3VF9A 2YM3A 3FYKX 4F9AA 3SOCA 1E1VA 3ULZA 4TXCA 3AG9A 5BX0A 4AF3A 2CLXA 3MIAA 3QTQA 2A1AB 4YR8A 4I24A 3QRTA 3RALA 3SLSA 2HW6A 3LFAA 5K0KA 4Z55A 1UU8A 3W8LA 5IA1A 1UU9A 2WMSA 3QUDA 3RZBA 5M4IA 1OMWA 4JX3A 3CY2A 3MH1A 3R7YA 4MD9E 4I22A 4I92A 3FPMA 3N4TA 2OGVA 2OBJA 4LGHA 4H3BA 3GU4A 5CLPA 4UALA 5KKRC 1M2RA 5AP4A 1YDSE 3PFQA 3U6HA 5I4NA 4FIEA 4PNIA 4C34A 4KRCA 4BDEA 4BBFA 1M2QA 4AOJA 5G1XA 3I4BA 1B38A 5M4UA 2JD5A 3F5PA 4DEBA 4PY1A 2PVKA 5K5XA 4D0XA 2B0QA 3UYTA 4CQEA 4KSPA 5FQDC 4E6CA 4R8QA 4ZJVA 1T45A 5FEEA 4PL5A 1J7LA 4MXAA 4KKEA 2I7QA 4O1PA 4XOZA 2OJ9A 3OBGA 4X2JA 1QPCA 2X81A 3W2QA 3LM5A 5H8BA 3NAXA 1A48A 1JOWB 3OEZA 2OIDA 1QCFA 3LFDA 2XNPA 4ZMEA 1OL2A 2CNVA 3EL8A 3NAYA 4DC2A 2A19B 1YDTE 4RG0A 3UBDA 3R83A 4M7IA 4G16A 5AV4A 4NYEA 3FL5A 4XEYA 4KIKB 2QHMA 4EQUA 2LGCA 5TOZA 4FVRA 4QMNA 3EQIA 5M53A 1QMZA 2XVDA 3HMMA 4U45A 4AP7A 3R1YA 3E8CA 4KRDA 4ACDA 4D5HA 3BHUA 3WIGA 3P0MA 4I4FA 3TZMA 4IANA 4GIIA 2WU6A 4EH9A 3DFAA 3ORMA 4HVSA 3D5VA 5E8VA 3FLNC 4XBRA 4IFCA 4BCFA 2JDTA 1NW1A 3FI2A 3KRRA 3PIZA 4GK2A 4L3PA 1TQIA 4ARKA 5GJGA 3KY2A 3OD6X 4F9WA 3ZM4A 2XNGA 1A9UA 3EIDA 3NZ0A 4QPAA 4O1OA 5KMJA 2FSMX 2JDOA 3SA0A 3KMWA 1JLUE 2GHMA 2AYPA 3QTZA 4HCUA 3FMKA 3ZEPA 3R7UA 4D5KA 2BTRA 5EK7A 4X3FB 5FD2A 5L2QA 5IZFA 3QLFA 4NTTA 3NUSA 4S34A 3VN9A 2V0DA 2CKOA 4FEXA 1YI3A 5AV0A 2GHGA 5CU4A 3VW8A 4BVUA 1G8SA 3PRFA 3E5AA 4AE9A 5B2LA 4PDYA 3OW3A 3TUCA 3JUHA 4D9UA 4AUAA 3QYZA 2O65A 3R21A 4FEQA 5A4TA 1PKGA 5EHYA 1IASA 4W9XA 2PZ5A 3C0IA 2JDVA 2R2PA 2XNEA 4XX9A 3ZO4A 2Z7RA 4BRXA 1IAHA 5AP0A 2HCKA 3LXKA 3KKVA 2PZIA 1LP4A 3E8NA 2C5OA 3A8XA 5DT0A 4CFXA 4BFMA 2W5HA 4YPDA 3NPCA 3EQDA 3OWLA 5IDNA 3R8MA 1YHVA 3Q4CA 4OT6A 4AFEA 3F3ZA 3MVMA 4FNWA 1YHSA 4L00A 3RCDA 4E4MA 3A4PA 5EHLA 1ZOHA 3ZO2A 4DGGA 2OH4A 5HTIA 1OI9A 4RC3A 3CBLA 3KB7A 4CKIA 5JZJA 2VRXA 4NIFB 3MJ1A 2P0CA 3IW6A 4ZSGA 4D2VA 3KRLA 2BALA 2W1FA 4BDBA 4F0GA 3GFWA 2B9IA 2A2AA 3O2MA 4C4EA 3KL8A 4GU9A 5BPYA 3UOJA 1HOWA 2JKMA 4JX7A 2ZV8A 4G6LA 1O9UA 4RLLA 2FH9A 3ZONA 4C4FA 1TQPA 1XKKA 2IW6A 5IQIA 4IWOA 4GYGA 5GIOE 4IWQA 3JY9A 4OTRA 5CEMA 3EJ1A 4Y85A 3IW8A 1UKHA 3V5QA 4DH7A 2UVZA 2R4BA 5AIKA 5CEOA 4F65A 3DBDA 3E7VA 4TWCA 4ANNA 3RNIA 5CAPA 3TTJA 2FB8A 4O21A 3ZLYA 3LCDA 4OTFA 4X3JA 3UOLA 4TTHB 2BFYA 3BE9A 3U4UA 2EXEA 4FICA 3B8RA 4C3RA 5H9BA 3LJ0A 3LJ2A 3QU0A 3RMFA 2RGPA 3IOKA 4EONA 3F61A 4KBKA 4ZOGA 2PVMA 3MPAA 1O6KA 5HGIA 3PP1A 3ROYA 1YW2A 4GS6A 1H28A 3TG1A 5D11A 4J97A 2PVYA 3QRUA 5HCZA 3U9NA 3P7BA 3K5UA 3PZHA 4ZTQA 4WG3A 3MPMA 1RJBA 1WBNA 4PMMA 2CSNA 2IVTA 3DY7A 4FV7A 4BBMA 1U59A 3R22A 4TRLA 1U54A 2HZ0A 4NKSA 5AMNA 4ZS0A 3W2CA 2QG5A 2IVSA 3NYNA 3QQGA 1IA8A 2CCHA 4L45A 1P4FA 4HCVA 5KMIA 4IJPA 2VTQA 3DKOA 4DEAA 3KMMA 4GCJA 4HPUE 4IVDA 1YDRE 4NWMA 1JWHA 4U8ZA 2OFUA 2XIKA 3B8QA 4D2WA 4ZP5A 4ZZMA 4FSWA 3GQIA 3HDMA 3SHEA 4TYHB 3BU6A 4E3CA 4Y73A 3NIZA 3VQUA 2YFXA 3QUEA 4N6YA 2R3KA 2PUNA 5BUIA 4EK5A 1NVQA 4JQ8A 4JR3A 1PXNA 4E6DA 3R7IA 4AGUA 1IG1A 4I4EA 4FK3A 4I94A 4PPCA 3OCTA 3UMXA 3EQRA 4NK9A 4L6QA 4QD6A 4L3JA 2WXVA 4U5JA 4AX8A 1ATPE 3OT3A 3KXNA 1OZ1A 5F94A 3C0HA 3KXGA 4EL9A 3HMNA 3W33A 3LLAA 3U54A 2BAJA 4ANSA 2OIQA 4L53A 2YJRA 2ITPA 3NVMB 3MY1A 1H0WA 4UBAA 4RX5A 3H3CA 4FR4A 4EORA 1AGWA 3FPQA 3LCSA 3DTCA 5M55A 3VULA 4AZTA 1ZMUA 3PP0A 5FBNC 3ZFXA 3TCPA 5J79A 3BHTA 2YHVA 4Q5HA 4N57A 3AMBA 5IDPA 4LOOA 1SNUA 3HRFA 3VBTA 2QR7A 3RPSA 3WZJA 5GZAA 4LRKA 3TL8A 2OJGA 3R7VA 3HDNA 2R64A 2VWWA 2GFSA 3CGFA 3PA3A 2W4OA 4PPBA 2VTAA 4FKLA 4G6OA 5A3XA 4F09A 2J51A 2WIHA 3MFRA 4GK4A 5IH4A 3AC2A 3E93A 4FKTA 5C4LA 4BDHA 4F1TA 3TUBA 3P78A 3KXXA 1JVPP 3T9TA 4TKSA 5EYKA 2GPHA 2BIKB 3E7OA 2JDRA 4WG5A 2Y4IB 3C7QA 3HMPA 2DQ7X 4S32A 5FP5A 4TYJA 3BBWA 3AD4A 3ZRMA 2YABA 1XH8A 3D83A 5E8ZA 3AGMA 2C0OA 4LV8A 5HHWA 3Q52A 5BYYA 3E64A 3ZS5A 5IEXA 5E1SA 5HG5A 2ZMDA 3I0OA 3VUIA 2XK3A 3FMHA 4WD5A 4D2PA 3UVPA 4F4PA 1ZOGA 4X2FA 5J1WA 2DS1A 2X8IA 4IAAA 4PQNA 3CTJA 3ZTXA 2B9FA 3R0TA 1RDQE 1W83A 1PHKA 5C03A 5E91A 3RHKA 4D4YA 2CHLA 4AU8A 2BZIB 2XB7A 3VO3A 3C5IA 2A4LA 4GG5A 4F9CA 3DJ5A 2W0JA 2F9GA 2JKOA 1FGIA 2R3JA 2W96B 4RIYA 5JT2A 2EUFB 1YI6A 1CTPE 1KUTA 3PSDA 5FUTA 5EFQA 4C38A 4UYAA 1LPUA 4RWKA 3O23A 2H6DA 1ZARA 4J8NA 4HNIA 4YC6A 5CANA 1Q3DA 1XH7A 2IWIA 1U54B 1OIYA 4CMTA 3KREA 3TNWA 1G3NA 3R9HA 4AA0A 4ONAA 5AP7A 4QNAA 3DT1A 4O7TA 4J1RA 3ETAA 2EWAA 3VC4A 5CU2A 5FWKK 3MBLA 4PNKA 5KUPA 3V5JA 3R02A 2OO8X 3RI1A 1WBSA 4BZNA 1H27A 4ZSLA 3ZUVA 1H08A 1ZYJA 3L8PA 1WFCA 4G17A 3AT2A 1DI8A 2YAAA 4L46A 5L4QA 5LJJA 1NVRA 2OXDA 1ZYLA 4TN6A 4WO5A 2W06A 4I23A 2EXCX 3POZA 3RWQA 4JBQA 3COKA 3GCSA 3UNJA 4XLVA 1Q4LA 2NP8A 1VJYA 3ELJA 3OT8A 4CCBA 2R3MA 4IZYA 4BYIA 4DFYA 2PY3A 2VTIA 4EK8A 2J9MA 4HOKA 4CMUA 2JITA 4ZEGA 3IECA 2A27A 4H3PA 4MXOA 4W4WA 3QQHA 4GSBA 3QFVA 3FMNA 4XNEA 2P33A 2VX3A 4QP6A 2W9FB 2I0EA 3PJ1A 4QQJA 4NSTA 3COHA 4QTEA 2X6DA 4LYNA 4P5QA 3HVCA 4XJ0A 4YLJA 1FVTA 5GZ9A 4I5HA 2O2UA 3SC1A 4G3DA 2XIXA 5H3QA 4DFZE 5HIEA 2BR1A 4G31A 3NEWA 5E4HA 2ONLC 4IJ9A 3QTRA 3HMIA 5FRIA 1BI8A 1YXXA 3VRZA 4AW0A 4DITA 3FUPA 1BX6A 3DB6A 1BMKA 5LWMA 4S2ZA 3RHXA 1OIUA 1LEWA 3F5UA 3FSKA 4FTJA 4C0TA 3CLYA 3OCBA 4MXZA 3V04A 1PXLA 4FSTA 4CRSA 4ZTLA 3V8SA 4HGSA 2GS2A 1RE8A 1ZYCA 1JSUA 3BWJA 5C9CA 4J52A 2W5AA 5JMSA 4JLCA 4R5SA 5EOLA 2ZVAA 2GU8A 3QL8A 2PVJA 2R3NA 3R7EA 2Y6OA 4GT3A 2XK4A 2YWPA 3AD6A 3EQCA 4ZJJA 3FC2A 3ORLA 3IKAA 5DEWA 3ZBFA 1Q41A 2EXMA 3ZC5A 5LOHA 2PVFA 2WQOA 3ZBXA 3I7BA 3D14A 4FV3A 4N4SA 4A9TA 4IC7A 4DGOA 5DMZA 4DFNA 3DK7A 2QHNA 5T6KA 3W8QA 1Y91A 1PXJA 2XKEA 2PE0A 4TNDA 4RQVA 3HZTA 4GL9A 5CZIA 3UO5A 3QX4A 4A7CA 1XHAA 1BL6A 1KV2A 5F1ZA 4CT2A 1ZRZA 5D7VA 5IMXA 4AAAA 2YACA 4KD1A 3DFCB 3PE2A 4J71A 1Q99A 5I9WA 1WZYA 1YKRA 3EMGA 4IACA 2C69A 4KKHA 3BGQA 1JBPE 5DHJA 5AP6A 4DT8A 3ORPA 3H0ZA 5M4CA 3MH2A 1URCA 4RIYB 5FDXA 2IW8A 5AR3A 3NCGA 2ONLA 4IC8A 4L44A 4JIAA 4ASZA 3U87A 4ZS4A 4FT0A 3C9WA 2GNLA 1P14A 4N70A 3P08A 4PMPA 5A4EA 5L2TA 5CEPA 4FKPA 4Q2AA 4FNXA 4DT9A 4WIHA 2H34A 3SXSA 4EOLA 5CAVA 3MA3A 1JKTA 4FSRA 2XUUA 3NW6A 1OVEA 3F3WA 1STCE 2B7AA 4GMYA 4RIOA 4AE6A 2UVXA 1M7QA 4KAOA 4D0WA 5GNKA 2O3PA 4FIHA 3RPOA 3N9XA 1LUFA 4RWLA 4I3ZA 2QO7A 1Q8YA 3OHTA 2YEXA 4NL0A 4R7HA 4O6LA 4AS0A 4M66A 3FV8A 1XH4A 5DYJA 2NPQA 4WSQA 3RCJA 3QGYA 3LFQA 4FF8A 4D4RA 2QOBA 4UWBA 5CX9A 3U4WA 4XG9A 3AC1A 3IS5A 1H1SA 3BBTB 4NT4A 2PUIA 3MJ2A 4I5CA 4K33A 4R6VA 4K6ZA 3VNTA 3OUNB 4CEGA 2HZNA 5JRQA 2VTHA 5D7AA 4FSZA 1OBGA 5M08A 4FT5A 5KZIA 4ERWA 4X0MA 4IVAA 1OKWA 3ROCA 4OTGA 3PXKA 1H00A 3QZHA 1F5QA 4ZLOA 4NCTA 2YITA 3FXXA 4JI9A 4CV8A 5CZHA 4CFMA 4O91A 4NH1A 4V0GA 2QOCA 3PY0A 1Q24A 4Y46A 3NUPA 1RQQA 2X1NA 3LPBA 5EI2A 1XR1A 3MIYA 3CIKA 2AC5A 1U46A 3OVVA 4F63A 5CAUA 4RX9A 4C4GA 5HTBA 4KSQA 3DQXA 3R73A 2HY81 2ZV9A 4QYEA 2W1HA 3PJ8A 1K2PA 5I0BA 5I9ZA 3F69A 5GINE 4GJ3A 3S3IA 2QURA 3BELA 2XNNA 3RPRA 4AZEA 4BB4A 4HVIA 3BLQA 4AW2A 5JH6A 4EJNA 3TACA 4GH2A 4U6RA 4R3RA 4BCPA 3N4VA 2SRCA 3EQBA 5FXRA 4H05A 3R9RA 3HV7A 3HGKA 1JSVA 3PXYA 4U7ZA 2YCSA 3HLLA 3WF8A 4CTBA 3QQKA 4R77A 1PXIA 5CU3A 3NNVA 2BZHB 3MFTA 4DEDA 4GT5A 3RAWA 2GNGA 4YLLA 5ANDA 2JKKA 3ZOSA 5AP5A 4J7BA 5BUEA 5C8NA 5TR6A 4FBXA 1HCKA 5IMEA 3UQFA 4RVKA 3TV4A 4L8MA 3FZPA 3QD3A 1OM1A 5CF6A 2HELA 1KOAA 3BE2A 4JRNA 3K5VA 4MAOA 4FKRA 3IW4A 5AR4A 4CCUA 3BGPA 3E63A 3R1NA 4M12A 4YC8A 1WBVA 3Q9XA 4S33A 4BDIA 4CLJA 3KXZA 1Q62A 4BN1A 5IQCA 3GCUA 3MY5A 4OTHA 3D2IA 5KX8A 3WE4A 3QRJA 2YIRA 3KU2A 4JDJA 5AP3A 4AQCA 2C6MA 3S95A 3I1AA 3BQCA 4MXYA 3PXQA 4I0RA 2UW6A 3COIA 3FZSA 3P86A 2BKKA 1UNLA 1P4OA 4QOXA 5A54A 5ANOA 3QCXA 5HOAA 1J1CA 4ACMA 2G01A 2QOIA 2WFYA 4RVLA 4QPMA 4FL1A 2E9PA 3C51A 3PVBA 4WNOA 4YBKA 3THBA 3IG7A 5IQFA 2XYUA 1H1WA 1ZMVA 5M09A 3GU5A 2BROA 2I0HA 3G33A 4HGLA 4UZHA 3TN8A 3VJNA 2YA9A 5EYDA 4FIFA 2J2IB 5BVNA 5L8KA 4IEBA 3W2OA 2XIYA 1R78A 4JG8A 3QYWA 5EM6A 3G0EA 4QMTA 1G5SA 5JGBA 4BDDA 4EH5A 4CYJA 4DFXE 1XJDA 2AUHA 3QD2B 4QMWA 2CLQA 5HO6A 3H30A 1WCCA 4GJ2A 3HV4A 4RFZA 5CF8A 3ZLXA 3DK6A 4FMQA 3NRMA 1OUKA 2BHHA 3JR1A 1WBOA 2HENA 4MXCA 2HIWA 1R39A 2B55A 2PMNX 4W4YA 3NSZA 4C3FA 1JKLA 2VTMA 4FKGA 4J98A 1FMOE 3VF8A 3EN6A 3Q04A 4FA2A 4BF2A 2PVLA 3G2FA 2GNJA 4MNEA 3SG9A 2UW9A 2YIWA 2UZEA 3BGZA 4UMUA 3GP0A 1KWPA 3FJQE 3O7LD 3DNEA 4G6NA 2F7XE 3ATTA 5FEQA 3JYAA 5A4QA 4M14A 5CXHA 3GU6A 3UPXA 4C58A 1GOLA 2HWOA 3F9NA 3FXZA 4BCJA 3UNZA 5D10A 1UV5A 3ZU7A 3A7GA 4CV9A 3PWDA 3FLYA 5FTGA 4MNFA 2WNTA 4XG4A 4EOPA 5M44A 2QI8A 5CT0A 4IB5A 4X2GA 3ZUTA 4WRSA 4YTFA 3BEAA 2JFMA 3ODYX 4RC4A 2YM7A 2IG7A 5BNJA 3I7CA 3UMWA 3ZXTA 4DBNA 3AOXA 4JT3A 4O6EA 3FZRA 3MPTA 3MS9A 5HE3A 1VYZA 3I0QA 3ORXA 4BI2A 4QMMA 5BVKA 3NWWA 1MRVA 2ITTA 4YJUA 4RFMA 5HICA 4DH1A 5AEPA 2PUUA 1LEZA 4OR5A 4XG6A 3UVRA 2VWVA 1QPJA 3BU3A 4GW8A 3PSCA 4EK3A 4MH7A 5FXQA 5AUUA 5BYZA 1XH9A 4DBXA 3UDBA 4UN0C 2V22A 3K2LA 4FTNA 5AADA 4EH4A 3C5UA 2F7ZE 3AC8A 3JS2A 5J87A 2HYYA 3MWUA 4G34A 5J7HA 3ORIA 3TKHA 1PJKA 4FEWA 3FY2A 2ZM4A 2W5BA 4L42A 4B4LA 1JKKA 4CMOA 4FVPA 3T9IA 5TO8A 4RQKA 2ZM1A 3BYSA 2C5YA 4U42A 3EB0A 3MV5A 5FTOA 5K5NA 3OFMA 4PDPA 2UZWE 5DBXA 4GV1A 3F6XA 4I93A 4C02A 2C6OA 2ZAZA 3T3UA 2GDOA 2R7IA 4WNMA 1U5QA 3OC1A 2LAVA 3TXOA 3WILA 4ZIMA 3GQLA 3ORNA 5AA8A 4FZ6A 1GNGA 3VQHA 2QLQA 2WGJA 2PULA 4NJDA 4CT1A 2P2HA 1XBBA 4J96A 4CXAA 2RG6A 4E1ZA 4RWJA 3LFCA 4GFMA 2VO7A 3EN4A 4FI1A 5ACBC 5KMKA 4FV0A 2ACXA 3UIBA 4E73A 2QLUA 5EW9A 4BHNA 4IX5A 1FVRA 3PXRA 3F82A 1QL6A 4MD8E 2NRYA 2PHKA 4HYIA 5LMKC 2R3IA 3ERKA 4IBMA 4FTOA 2GNIA 4KINA 1MRYA 2ESMA 2Y8OA 3DBFA 3EOCA 4ZMFA 3ZUUA 5B2KA 5HO8A 4E4XA 3GOKA 3KXMA 4C8BA 3FAAA 3KGAA 4QP1A 5CF5A 3QXPA 3MH3A 5IEYA 3NIEA 2GTNA 1ERKA 4OLIA 5ANEA 5FG8A 3UZPA 3V5TA 1OPLA 3HA6A 1JNKA 5IA3A 2XIRA 3TI1A 1I44A 3EFJA 2XZSA 5J9YA 1J3HA 4PDSA 4KS7A 4D4SA 5J7BA 4HCTA 3OWJA 4FT9A 5EQYA 4MNEB 2DUVA 5EW8A 3ACKA 4UY9A 2UW0A 3GCPA 2BZJA 3MVLA 4QMLA 1SNXA 2O0UA 5HE1A 3G0FA 3CEKA 4KBAA 5J8IA 4WKQA 1CMKE 5ANGA 5LCJA 2C6IA 4D28A 4ZSEA 2WB8A 4H58A 4DCEA 3PY1A 3TV6A 3TTIA 5K9IA 2X7OA 4IAZA 3TKUA 3CXWA 4AZFA 3MSSA 2OF2A 3CY3A 2FA2A 1DM2A 3ENHA 4JRVA 2X0GA 3PJCA 4YJQA 2WMTA 3D7TB 5DEYA 2C5VA 3CD8A 3FZ1A 1UVRA 4FV6A 4JBOA 4K18A 4AWIA 2BRMA 5L6OA 2QOKA 4HGEA 4G3EA 2C6LA 2CGVA 5ACKA 4QRCA 5HU9A 3RPVA 4G5JA 1M52A 1KE8A 3ODZX 4YSJA 2Z02A 3G90X 2OU7A 5LMKA 4EHGA 4BIBA 3GENA 4IWDA 4YBJA 4F9BA 4X21A 1IRKA 5IH6A 2J0MB 4GK3A 3TZ8A 4EH8A 1IA9A 3VUDA 2G9XA 3SD0A 2X9EA 3PPZA 1MQ4A 1A06A 4M0YA 2FSOX 1H07A 4IZ5A 1WMKA 1U5RA 5HVYA 4AT5A 3EZVA 2V5QA 3QC9A 1TVOA 5TT7A 3VUMA 3PXZA 2V7OA 4FUYA 4E93A 5AAEA 5LVPA 5LVLA 2ITZA 4RX8A 3OY3A 2CKPA 1ZZLA 3QF9A 3NNUA 4R5YA 4QPSA 1JSTA 4CZUA 3O51A 3QQUA 4R3CA 4F0IA 3LLTA 5IU2A 4CFWA 2WAJA 3DTWA 3FKLA 4YNEA 3UC4A 3W18A 3ANQA 2R3FA 3D4QA 4EOOA 4F64A 1BLXA 5IQDA 4AZVA 3R8ZA 1Q8TA 2RKUA 4LGGA 2FSTX 3MFUA 3IQ7A 5ETFA 4O7WA 2XJ1A 1ZAOA 2J0IA 2Y6MA 1ZMWA 3HP5A 5HLPA 4DEGA 3S0OA 1CKIA 2HWPA 1CSNA 3PG1A 4MEDA 4BCNA 3WZUA 3ALNA 5TKDA 4BDKA 3CP9A 2C0TA 5G6VA 1KE5A 2XKFA 4O0XA
chains in the Genus database with same CATH superfamily
2XJ0A 3WOWA 2C1AA 4FKVA 3TZ9A 4WSYA 3RTPA 4RSSA 3FLWA 2E9NA 3SXFA 3TZ7A 3WF9A 2F7EE 2PVRA 1P5EA 1FVVA 1FOTA 2QOHA 3LFBA 1REKA 3QALE 4W4XA 2VTTA 4GRBA 3W2SA 4JNWA 4DHIB 4XBUA 1E9HA 1UU7A 3DXNA 3QTWA 1L3RE 4XCUA 4YTHA 4FIGA 3S2PA 4AGWA 3L8SA 3Q53A 4OTWA 3FQSA 3EFKA 2HOGA 3BHYA 3GNIB 1Q5KA 4IB3A 5CVGA 4U43A 4ASXA 5EQPA 3W32A 2OXXA 4BCIA 5JKGA 3FLSA 4M8TA 4V01A 2C6KA 3PJ3A 4QO9A 4O2ZA 2EB2A 5DR2A 4L52A 3FDNA 5IF1A 5HU3A 5DG5A 5JSMA 1YOJA 4J99A 4EOQA 3DKCA 3RP9A 3BYMA 4TZRA 4IX6A 2YLFA 4DDGA 3EYGA 5KHWA 3K3JA 1F3MC 2R9SA 2PMOX 5H8EA 4ZK5A 4PPAA 1NXKA 5L6WL 1H01A 5KBRA 2P4IA 1H26A 2HZIA 2UZTA 4ORKA 4M15A 4FTMA 3V01A 5CXZA 2I1MA 2WZJA 3UVQA 2VV9A 3QCYA 4IE9A 4BHZA 3LKMA 5CU6A 5KKRB 4R3PA 3OWPA 3V8WA 4LGDA 3A7IA 2CGXA 5L3AA 4Z16A 3P9JA 3EN7A 4CZYB 4W8DA 3A8WA 3QWJA 4NM0A 1IAJA 1PF8A 3R28A 1PYXA 4FV8A 3V51A 2YWVA 3ZSGA 3GU7A 4FSNA 2OI4X 4FTRA 4I41A 5CVHA 3DKGA 2JDSA 2PE1A 4H1MA 3MTLA 4FKWA 1SVEA 3TNIA 4ZSAA 3QGWA 2UW5A 5M51A 4X2KA 3TT0A 1SYKA 3CD3A 3TNPC 2JFLA 4ALWA 4L7SA 3BLHA 5DRDA 5EOBA 1VLRA 3PY3A 3QA8A 2IJMA 4DFUA 2WTDA 2OJFE 3BLRA 2OLCA 2GHLA 3LVPA 4AA5A 3PG3A 5AP2A 5FP6A 3LIJA 4FSUA 4FTLA 5AR5A 4AACA 3FKOA 1APME 3FQEA 4UMRA 2G15A 4FKSA 3QRIA 3BU5A 4BIEA 4IDTA 3UYSA 4MKCA 4M68A 4MX9A 4MWHA 4DH8A 5JFXA 4APPA 1ZLTA 1ZYSA 2XA4A 2J4ZA 5F4NA 4BGHA 4BKYA 5HG9A 2YIXA 1OUYA 3QTXA 4LL5A 2JIUA 2UW3A 5T68A 4CFVA 4FSMA 4QMQA 5K4IA 3PIXA 2NYAA 2YERA 5FBOA 2UUEA 5CT7A 5BV3A 1GJOA 4O4DA 3CKWA 4O0UA 5LQFA 3QXOA 3ET7A 3NFFB 4AW5A 4UXLA 4WUNA 1K9AA 4K1BA 4IWPA 3Q96A 4YJNA 4HNFA 1PW2A 3HEGA 1UA2A 1V0PA 2JIVA 2J5EA 4FGBA 4TNBA 1ZXEA 5CEQA 2BRGA 2H9VA 4QTDA 3NUXA 4GVAA 3P23A 3SV0A 2XS0A 4I5PA 4MCVA 5FGKA 4C62A 4YURA 4HVHA 4A07A 3TV7A 2OJIA 4B99A 4WHZA 5KMNA 3IDPA 4FG9A 3WF6A 5I3RA 4XV3A 3NVKI 1UNHA 2ITUA 2VO3A 4TYIA 3FKNA 4LV5A 4DHZA 1T46A 1GIIA 2WTWA 3B2TA 3PSBA 2J7TA 4LL0A 4R7IA 5L8JA 2PK9A 3V3VA 3P7CA 4O83A 4H39A 3UTOA 4D1ZA 1KOBA 3AKLA 2R3GA 4K2RA 4BR3A 3CTHA 5EYCA 3LFEA 4IVBA 2C6DA 2WELA 2RFDA 2ZDTA 4ZXTA 4JXFA 4B6LA 5CENA 4QYHA 2ZOQA 4OAVB 4FT3A 5KE0A 1MQBA 3RM6A 3W0MA 3QCQA 1GIHA 2QU5A 3DK3A 4YO6A 4N6ZA 5D1JA 4OTIA 2WPAA 2W17A 1K3AA 4TL0A 2GQSA 4KNBA 5F95A 2BDFA 4BCKA 4ZZNA 3NDMA 4DLIA 2BZKB 4UWCA 5CNOA 3W0NA 2WMVA 4O4FA 4FYOA 2Q0BA 1Q8WA 3L8VA 2ZM3A 3LCKA 3QZIA 2B53A 1ZY4A 3I60A 4AG8A 5E8SA 2J0JA 4PMTA 3P79A 4FKQA 2GCDA 2ITVA 4ZY6A 3LQ3A 5LMBA 3R63A 5C26A 1CDKA 4KBCA 5L6PA 2Y7JA 4RMZA 4ZSJA 3VS4A 3LXPA 4IH8A 4ASDA 4FC0A 4LOPA 3FMJA 2REIA 2Z7SA 3VBWA 1PYEA 4O7NA 3OP5A 3DJ7A 4FOCA 3GBZA 2BKZA 3I79A 5CYIA 4F7JA 3A61A 5I5ZA 3RBWA 4P4CA 1GAGA 2HK5A 5JFVA 4OAUC 4YJPA 4GYIA 2HAKA 4JS8A 2IZTA 3FWQA 3WF5A 3GC0A 3NUUA 1M14A 2BTSA 2DWBA 4FT7A 2XNBA 2X7GA 5AUTA 2CN5A 4MYGA 5HCYA 2P55A 3C4FA 1UWHA 2C3IB 3AC4A 3PXFA 4BWKA 4WNKA 4QEBA 3V8TA 2XAOA 5LWNA 4P5ZA 5JEBA 4PF4A 4GU6A 1OL6A 3RAKA 2WTKC 5L2WA 1J7UA 2ETRA 3OXZA 4XP3A 5EM8A 4BGQA 2W4JA 4IVCA 4I6FA 5CI7A 3PPKA 4QP3A 4RIWA 4Q9ZA 4E8AA 1UKIA 3BV3A 3VS2A 2VNYA 3EZRA 5EYMA 3HAMA 2BMCA 4YJVA 5HBHA 3BQRA 4A06A 3P1AA 2CGWA 3DAJA 4H3QA 3EKNA 2XEZA 3IOPA 4GIHA 5IA5A 2VX1A 3QTSA 2CKQA 4C33A 4JG6A 4A4XA 3IONA 3ACJA 4O82A 3W2PA 2XK6A 3JY0A 3M1SA 4NEUA 4O0TA 4U3YA 5AJQA 5IUIA 4RJ3A 4EHEA 4B8MA 2ITQA 4FKJA 4MF0A 5DFPA 5FXSA 3CQEA 3Q2JA 4KWPA 3CTQA 1V1KA 4DYMA 4CQGA 4EEVA 4AN2A 4DGLC 4QMVA 3O96A 2JEDA 2E9OA 3LFNA 2WMUA 2CJMA 4RVTA 3HNGA 1GY3A 5DN3A 1AD5A 1J7IA 4TYGA 4Z9LA 4EZ7A 1NVSA 4O0SA 2O8YA 4BDAA 4DLJA 5B0XA 4FG8A 4EH3A 5CALA 4G3GA 2F49A 3DQWA 3U55A 2QOLA 5HE0A 5AM6A 1Y57A 2YLEA 3BX5A 4YJRA 4C61A 5EQEA 2F4JA 3EQHA 4RX7A 4MHAA 2RSVA 3VS6A 4KIPA 3ZFMA 4AGCA 4BWXA 3LMHA 3G9NA 1PXOA 4DG3E 3AQVA 4IB0A 4HZRA 5JRSA 4OUCA 3OBJA 2VTPA 4XHKB 2XKDA 1Z57A 4FV9A 4G3FA 5CS6A 3EQGA 5I3OA 2HY0A 2CNQA 3U6IA 3R7GA 3DAKA 4L67A 4UZDA 4BGGA 3AXWA 4TYEA 5BVOA 4ZTMA 2WMAA 4KKGA 2C3LA 4EHZA 2Y9QA 5CSWA 3R8VA 2FSLX 3R8LA 1PMUA 4FTTA 4FTKA 4CNHA 3OCSA 2ITNA 3PA4A 2YCRA 4JG7A 1L8TA 2R5TA 4XUFA 5AAFA 4L7FA 4RJ6A 1Q8ZA 2VWZA 4IHPA 3RK5A 3PDTA 5M06A 2R0IA 3UP2A 5HG7A 4K77A 4WG4A 4CRLA 3TDVA 2ZDUA 4FNZA 3ZC6A 1ZZ2A 1R1WA 2ERKA 4FTAA 4O0RA 1CKJA 4DHFA 3RKBA 3I5NA 5IH5A 4RIXA 2B4SB 4YHJA 3DU8A 4F70A 4DTKA 2JKQA 2ZB0A 4OW8A 1GIJA 2Q0NA 4X6QC 1R3CA 2QD9A 5HG8A 1HCLA 1ZYDA 3RINA 4C37A 3HYHA 2EVAA 3E3PA 3DS6A 4BDCA 4DTAA 4EI4A 2XARA 3HA8A 3OCGA 4EYMA 1XQZA 3R9OA 4J95A 4NW6A 3RAIA 3VS5A 4A9YA 2QOQA 1Q3WA 2GS6A 2IZRA 4FOBA 4MTAA 1SMHA 4BZOA 4W9WA 3GXLA 4BTKA 3F66A 3QHRA 4FE2A 1WVYA 1B39A 2WTCA 3KEXA 1SVGA 5E8WA 3EFWA 4IX4A 4FGRA 4FTUA 5CY3A 4WRGA 2GTMA 2R3LA 3CQUA 3NNWA 5EDRA 2WHBA 4ID7A 2PTKA 5AR2A 4RPVA 1UNGA 4BI0A 4N0SA 4RIWB 4CVAA 4GG7A 4R1YA 3MA6A 2UZUE 5LMAA 4BTFA 3BLAA 3D0EA 2XM8A 3I6UA 3VHEA 4Y95A 3QCSA 1Q8UA 3L9MA 4IAIA 4RBLA 4AZWA 1TZDA 1YXTA 4FIIA 5AX3A 3FE3A 3SG8A 4ACCA 5KBQA 1YWVA 4ALVA 2VZ6A 4YNOA 4D55A 5JQ8A 4FEVA 4CFFA 4PRJA 4XV9A 3BYUA 2WTVA 3V5PA 4GKIA 4QYGA 4I0TA 5AV2A 4XG7A 4F7LA 3DA6A 4S30A 2ZV7A 3A7JA 4FZ7A 3UPZA 1GZKA 3G5DA 5DLSA 4EUUA 4QMZA 3RZFA 4BCHA 4PL3A 4ENYA 3Q6WA 3EN5A 2W05A 3MTFA 1E1XA 1BUHA 4HZSA 4QYYA 4BYJA 5AV3A 4EKKA 4XG2A 4ANBA 2VTOA 2ITOA 2OW3A 4M13A 4AA4A 1W8CA 4ZAUA 5ICPA 3W2RA 4BKZA 1FBNA 3MGYA 4Z7GA 5A46A 4YZBA 2VUWA 2BAQA 2UV2A 4FK6A 3F5GA 2ETMA 2JC6A 3NYXA 2UW7A 4O81A 3ZCLA 2C30A 3R71A 3V6RA 2QODA 5EDQA 4CD0A 3PVGA 2VU3A 3OTUA 4QMUA 1PKDA 4XOYA 4MUQA 3DDPA 3VONA 2XK8A 2VO0A 2WMWA 3VUTA 4MBIA 2ZYBA 4BTJA 1BI7A 1J91A 4WT6A 5HBJA 2WMQA 1W84A 4RLKA 4F7NA 4NFMA 2JGZA 2VTSA 2G2IA 1GZ8A 5ETIA 4KIOA 5HCXA 4DH3A 3U6JA 4NM3A 4UEUA 4ZTRA 3PIYA 2OSCA 3QTUA 3ZFYA 1OIQA 3H9OA 2PMLX 4EJ7A 4O27B 4ALUA 1SVHA 4G9RA 3RNYA 4EUTA 3SW7A 2R3HA 3OROA 4FKIA 3OF0A 2PVHA 4FNYA 3FHIA 3GB2A 4X3FC 4FTIA 4GEOA 3R8UA 3FL4A 3IK3A 1QPEA 4ANOA 2PL0A 2HXLA 3V5LA 4EYJA 2AC3A 5F20A 4DF3A 3FYJX 3O0GA 3K3IA 3VAPA 4MQ1A 4PMSA 4CSVA 3HRBA 2E2BA 1W98A 4UYNA 3KF4A 1B6CB 3MFSA 4AOIA 4DFBA 3G9LX 2PMIA 2ZFYA 1YWNA 2RL5A 4V0GB 3R8PA 2FYSA 3POOA 4QYFA 4YMJA 4O22A 4I6QA 3VHKA 1ND4A 3ORTA 3ZSHA 3A4OX 5IKWA 3TEIA 3VBVA 4ITHA 2JLDA 4B0GA 3R9DA 5DT4A 4FZFB 4IM3A 2C5NA 3O7LB 3QAME 4LRMA 3COMA 1YWRA 3LM0A 5M57A 2QO9A 3UE4A 3KVWA 4RWIA 3OXTA 2XNOA 5DWRA 3CQWA 5EI8A 5KO1A 3FZOA 1H1PA 2BAKA 2VTJA 4IQ6A 3NLBA 4E6QA 1AQ1A 1PXKA 2WEVA 4QQCA 4TWPA 5FTQA 4BC6A 4EH6A 2J6MA 5AUVA 3NUAA 4I1ZA 4PUZA 3T3VA 3ULIA 4EOSA 4F08A 3TNQB 2JIIA 3VS3A 5A6OA 5DPVA 3Q5ZA 3DV3A 2GNHA 5LVNA 4MQ2A 1JAMA 3BL9A 4LMUA 4CTCA 4F0FA 2CKEA 1F0QA 2ZMCA 2YIYA 1V0BA 4NUSA 2B9JA 4TT7A 4X3FA 2AEGA 3CR0A 2W1ZA 4FTQA 4V05A 1XO2B 3FLZA 4PP7A 4ZZOA 2X7FA 3I5ZA 1FMKA 3KK8A 5F9EA 2JAMA 4DEIA 1BL7A 2YDKA 4U41A 5CVFA 5HD4A 4UMQA 1Q97A 2WOUA 3UP7A 3O8TA 4PL4A 2O5KA 3KCFA 3L1SA 2BRNA 2BUJA 1M17A 4C7TA 4XG3A 4IM2A 4ANLA 3Q5IA 4NZWB 2WMBA 5GZ8A 4UMTA 2GSFA 3UDSA 4R78A 5EKNA 4I5MA 3LCTA 5BMMA 3SAYA 3D9VA 3TM0A 4HYHA 1KV1A 2VTLA 3GUBA 3NUYA 3Q4UA 3S00A 3D94A 3NYVA 4QDEA 3NW7A 2VGPA 3O17A 2H8HA 2W4KA 3BHHA 4NIFA 3D5UA 1WBWA 4IAYA 2NO3A 3CJGA 2R7BA 4F1MA 3UG2A 3MW1A 3ZZWA 4CFUA 4USFA 2OF4A 2YM8A 2Z7LA 4KA3A 5E92A 4AXAA 1PMEA 5CASA 4LQMA 2OFVA 3NUNA 5HE2A 3DNDA 2OK1A 3W1FA 4LM5A 4M0ZA 2E9VA 2NRUA 1M7NA 4ZTHA 4C35A 1OITA 4JAIA 5GJDA 3ZRLA 2C6TA 1Y6AA 3CS9A 1FGKA 3U9CA 3PLSA 3KFAA 2RG5A 3DCVA 1KSWA 3AGLA 4E26A 2C4GA 2X2LA 3PZEA 4JL9A 5HVJA 5LCKA 3WYYA 4IB1A 3TWJA 4C4IA 3HECA 2YM6A 3F5XA 5FLFA 3BKBA 3BYVA 3VBQA 2YZAA 3GGFA 2GNFA 4ITIA 2OG8A 1TKIA 3AC5A 4EWHA 4F6SA 4UV0A 1G8AA 2UVYA 5DT3A 4OTQA 4RFYA 2QOOA 5DR9A 3VUGA 4YTCA 2GS7A 4JDKA 3W10A 3WZKA 2VD5A 3M42A 1H24A 3ZMMA 5BVEA 3H9FA 2RF9A 4B7TA 3QUPA 4FUXA 4FVQA 1H4LA 3OOGA 2FUMA 4U81A 4UMPA 3HV3A 4MBLA 3RVGA 4E4LA 4JQEA 5DRBA 5AX9A 5DIAA 5EG3A 2WIPA 4FIJA 4RJ7A 4FODA 5ETAA 3AT4A 3OS3A 4EKLA 4TYHA 4EH2A 2RFSA 2XKCA 2FGIA 4IFGA 2IVUA 4BBEA 4E20A 3FMDA 4ENXA 3M2WA 4BTMA 1Y8GA 1UWJA 3R2BA 5E7RA 5HKMA 2EU9A 2XRWA 2WO6A 2Y4IC 4FV4A 4ASEA 3PYYA 1FQ1B 5JN2A 4GT4A 2XBJA 3U8WA 1URWA 4IDVA 3JVSA 4JBVA 1H1QA 2UZNA 4FL2A 3R1SA 4WA9A 2BPMA 5GJFA 4EWQA 3IGGA 5ANIA 3O8PA 2X8DA 4EZ5A 5A9UA 5J95A 3RK7A 5I9VA 3CKXA 3Q9WA 5HLWA 5FM3A 1W0XC 2OICA 3GCQA 5H8GA 3KIOC 3LAUA 1YRPA 3NX8A 3VS1A 3KK9A 2V7AA 3HV5A 3EHAA 3QQLA 5DGZA 2R3QA 4BICA 3FMEA 5CSHA 4E6AA 1WBTA 3KRXA 4AN9A 2YIQA 3KC3A 4R7BA 5AIRA 4EOJA 5B2MA 3D15A 5JGDA 4DA5A 3H10A 4P90A 3P4KA 3OUKA 4AXCA 3RK9A 5KCVA 3SVVA 4EK6A 3UNKA 5CQWA 5B7VA 2QONA 2YCQA 2UW4A 4MWIA 3R9NA 3TJCA 5A4CA 2C3KA 5HQ0A 5J9ZA 4F6UA 4K0YA 4TY1A 3HUCA 5CU0A 2XK7A 3LMIA 2X6EA 2PE2A 5IQBA 5DE2A 5KHXA 4AT4A 3KF7A 5CSPA 4PTGA 2V62A 2WU7A 3QKMA 1ZY5A 2J90A 4ZTSA 4JQ7A 3C4CA 3S1HA 3WIKA 4XS2A 4OTPA 1YXVA 4GUBA 3VJOA 3SGCA 2XMYA 5GHVA 3ZLWA 4EBWA 5FDPA 3NYOA 5L2SA 3LXNA 4FTCA 2WD1A 2WOTA 4FYNA 4IZAA 3AC3A 4MXXA 3F2RA 2CMWA 3NS9A 1OB3A 5HNBA 5AM7A 5JK3A 3LMGA 3OEFX 4LG4A 5HIBA 4Z3VA 1XH5A 4CKRA 5HEZA 1FPUA 3D2KA 4ERKA 2WQEA 5CF4A 4MK0A 4C57A 2ITYA 3ZZEA 5LVOA 1ZOEA 2KTYA 5AUYA 2R0UA 3DB8A 4OBOA 3ALOA 4XP0A 4W8EA 4LUEA 2CCIA 4I21A 3RM7A 5HORA 4LUDA 4ITJA 1OL7A 4C2WA 4IMYA 4IXPA 2C1BA 2YDJA 4PTEA 2RFNA 3UC3A 4BL1A 3LOKA 3HRCA 2V55A 2IO6A 2QNJA 4NFNA 4F6WA 4AXFA 3F3VA 3WZEA 2C47A 5E1EA 4UXQA 2OKRA 5CTPA 4DEHA 3DDQA 3I6WA 5CSVA 4A9RA 4CGAA 4HJOA 4FV2A 3EFLA 3A2CA 3MVHA 4BCMA 4YSMA 4B9DA 4KB8A 5E8TA 4E4NA 5KMOA 2VGOA 4C36A 4O0YA 4ZJIA 4O2PA 5K4JA 4RA4A 5BYLA 4DTBA 3F2NA 1XBAA 4P2KA 3QC4A 3TIYA 2OJJA 2W1CA 1LR4A 3WE8A 3FLQA 3GU8A 1PMNA 2IF8A 2QC6A 4LMNA 4QT1A 4RZWA 4BKJA 5D12A 3AMYA 4XRJA 1H8FA 5A6NA 4IW0A 5IUHA 1KE6A 3L8XA 4EBVA 3MB6A 3ZEWA 1YHWA 1YXSA 5JQ5A 4D4VA 2CN8A 3F7ZA 1U4DA 4CG9A 4QTAA 2VAGA 2GFCA 2G2FA 3PPJA 3FQHA 3TJDA 1Z5MA 2ITXA 3DOGA 2WQNA 3RAHA 3FXWA 4E5AX 4R1VA 4CG8A 3VWAA 2P3GX 3IDCA 4ANMA 4EOKA 4YTIA 2VWUA 2CGUA 4M69A 5J5SA 2EB3A 2R3OA 1KE7A 2BCJA 3II5A 4IX3A 5K0XA 4QP7A 2C6EA 4YLKA 5AV1A 1DAYA 2I40A 3QKKA 4IAKA 4CYIA 3DAEA 5EH0A 2PYWA 4AFJA 4ZTNA 3ZM9A 3A62A 4O0VA 4YU2A 5C8KA 2R3PA 3OWKA 5E8UA 2RIOA 2JAVA 1TQMA 2ERZE 5BMSA 4O96A 4E5WA 5AR8A 2XNMA 3BRBA 3ENMA 5ANJA 3CPBA 3D5XA 4BCGA 5IUGA 2XRUA 5D9HA 2BRBA 3ORZA 5FEDA 4ZY5A 2XAMA 3CC6A 2OXYA 5AP1A 4XMOA 4XYFA 5AR7A 1PRYA 2PPQA 5DI1A 3BWFA 4AN3A 3MESA 3NMUF 3R30A 3EQFA 4KUJA 3G15A 4LOQA 4QP8A 4O84A 1OGUA 2ZB1A 5KNJA 4IIRA 3RPYA 1SZMA 4NJ3A 4NU1A 2IN6A 3REPA 4NTSA 1RW8A 3KA0A 1OKZA 5DOSA 1W2DA 5ANKA 3G51A 5BVFA 2VWYA 3JPVA 2X0OA 5E90A 3UIXA 4C4JA 5EM5A 4O86A 3R6XA 4YJTA 5CAOA 2IW9A 3KCKA 5HVKA 3LZBA 5IQHA 1OL1A 2VNWA 4S31A 4O7SA 2O64A 4ACHA 3RWPA 5JFSA 2A0CX 3HX4A 3QLGA 5CEKA 4O7ZA 1DI9A 1YQJA 3FY0A 3D7ZA 3FMMA 2YISA 4BCQA 5JZNA 4MVFA 4BZDA 3E3BX 3PLAE 4GUEA 2YJSA 4BIDA 2PWLA 5DNRA 1XBCA 4YHTA 4E5BA 5AWMA 3QKLA 4YZDA 4WUAA 2J0KA 3TKIA 2VTNA 2KULA 3QD0A 3ZO1A 4U0IA 2VWXA 3BZ3A 2IPXA 3N51A 3E92A 3L9NA 3VRYA 4QMPA 2QKWB 3C4WA 3KULA 1R0PA 5BVDA 3QA0A 3UJGA 5IA4A 2X39A 3DZOA 3LFFA 3C50A 3F3UA 1BKXA 1S9JA 4IADA 1OL5A 3KN6A 2HW7A 3MH0A 3R00A 2XJ2A 4HGTA 5M56A 4DN5A 2UZBA 5L2IA 1Y8YA 1Q61A 3R7OA 4DFLA 3FEGA 4DHJA 2X4ZA 4XH6A 2X8EA 3OZ6A 3E8DA 2GQRA 2B1PA 2J50A 4C4HA 2XF0A 3Q60A 3GVUA 3UOKA 5AAGA 4W4VA 3BEGA 4IAFA 1OKVA 3JXWA 3V5WA 3VUKA 3IGOA 2YZLA 3SKCA 3ZH8A 4BCOA 2W1EA 3GC8A 4D2TA 4XV1A 3LQ5A 4Y8DA 5CAQA 2G1TA 5IISA 3MYGA 2W7XA 3M11A 2GQGA 1VR2A 1X8BA 3KRJA 3ZDIA 2BHEA 3S4QA 3SX9A 4QQTA 2BDJA 4JJRA 1W7HA 4YPSA 2PZYA 4OBPA 4FL3A 2ZJWA 2VX0A 1GZOA 3Q32A 3CJFA 4LV7A 3A7HA 3F2AA 4PDOA 4Y72A 2QKRA 3NW5A 3LHJA 1ST0A 3GC9A 1JPAA 4PP9A 4UX9A 4F7SA 2ZV2A 3PVUA 3UZTA 4MBJA 3UOHA 3LQ8A 4HYSA 4ZLYA 5BUJA 3D5WA 3FI3A 4M69B 4AOTA 2BVAA 3F88A 2Z7QA 4EOIA 2QU6A 3LE6A 3VBXA 3MB7A 2C5XA 3VIDA 4YZCA 3TMOA 4U9AA 1MP8A 4WOVA 5CSXA 4UWYA 5EW3A 4XP2A 4FEUA 3E87A 2PVNA 4G5PA 4USDA 2PUPA 3H0YA 3B2WA 3TIZA 4A9SA 3SXRA 4F99A 2QG7A 5GIPE 2OZAA 4Z7HA 3G6HA 2FVDA 2QOFA 3H9RA 2I6LA 2WKMA 3IW7A 4CKJA 4QMXA 2FO0A 3QBNA 4FX3A 4L3LA 4K11A 2NNWB 3Q2MA 4RZVA 3OG7A 4FSQA 3MVJA 4BDFA 2GMXA 3E62A 2QQ7A 4KIQA 3EL7A 2XH5A 3AD5A 2G2HA 5HLNA 3ANRA 3PTGA 2QVSE 5I9UA 3QD4A 3BPRA 3BYOA 4OGRA 3ZSIA 1OKYA 4F9YA 5LXMA 4J53A 1IR3A 4DGNA 2PZRA 4DINA 3BIZA 3DXPA 5TE0A 4KABA 3W55A 1M2PA 5HNGA 4L01A 5HD7A 3U51A 2XK9A 4EHVA 4APCA 3TDWA 4EC8A 5L8LA 5LARA 1DAWA 4JVGA 4Y5QA 5HX8A 2B54A 3GCVA 2XEYA 3GOPA 2XIZA 4AXDA 3F3TA 5HTCA 4PX6A 4UB7A 3QQJA 4L43A 4M97A 5J9LA 3Q4TA 4LFIA 3Q6UA 4AW1A 4MF1A 5ETCA 3H4JA 5JGAA 2W1IA 3GFEA 4Q9SA 2X0PA 3BI6A 3WF7A 1WAKA 2E9UA 3C1XA 3QX2A 5IQGA 1WVXA 1YXUA 3Q3BA 4FZAB 4FKUA 3EQPA 3SRVA 3PWYA 4M84A 3UG1A 4DGMA 4AQKA 5DVRA 4NCTC 4GFGA 2Z60A 1YI4A 4RVMA 1JQHA 2XBAA 3CE3A 3KQ7A 4B8LA 3GEQA 2CPKE 4JOAA 5JFWA 3HMOA 1PXPA 4CFNA 3QTIA 3UO6A 2X9FA 3KULB 5I9YA 2UZOA 3L9PA 2W9ZB 4EH7A 4RJ8A 2PU8A 4TWNA 5IQAA 5KMLA 1EH4A 3UODA 4GFOA 3SW4A 5DR6A 1XWSA 3N4UA 4QNYA 4O7RA 3QRKA 3SQQA 4O7LA 4BDJA 2F2UA 5C27A 1PMVA 2Y0AA 3FSFA 4U80A 5H2UA 3GC7A 4OTDA 5HESA 1VEBA 3O50A 5J1VA 3KN5A 5C01A 3NNXA 2W1GA 3R01A 2BDWA 4QTCA 4QMYA 4EOMA 3AMAA 1Y6BA 4HPTE 3ZO3A 2YM4A 4YHFA 4PWNA 4RT7A 1W82A 2B9HA 3DGKA 4OBQA 3A60A 4FV5A 3HAVA 3A99A 1MRUA 5HNIX 2X2MA 4A9UA 2RFEA 3E8EA 4TPTA 4RJ5A 2XCKA 3G6GA 5AUZA 4ANQA 2XM9A 4G2FA 5T3QA 4CLIA 5C1QB 1NT2A 4TWOA 1JKSA 1CKPA 2O63A 3O8UA 3ITZA 1G8JA 2OH0E 2WQBA 5M07A 2F57A 4D58A 5IA0A 5AUWA 3EWHA 3CGOA 3KXHA 5C8MA 3EKKA 3IO7A 3UGCA 4PV0A 2CDZA 3DJ6A 2Z2WA 3C4XA 4Y5HA 3OOMA 3PJ2A 4P7EA 3ZRKA 4DG0E 1J1BA 2BIYA 2BRHA 2QR8A 1YOLA 4QP4A 4BWPA 2JBPA 4I6BA 4O7YA 2J5FA 4G1WA 3FBVA 4JDIA 3EN9A 4TW9A 3VBYA 1YVJA 5HI2A 4C59A 2VWBA 5A14A 4JAJA 4F78A 3Q4ZA 2XYNA 3DKFA 3FMLA 4EK4A 2WMRA 5IQEA 4KS8A 5AA9A 4HW7A 3R2YA 3V6SA 3PUPA 3MI9A 4RJ4A 3ID6C 3ZLSA 2HZ4A 4EC9A 3C4ZA 4LI5A 2QO2A 5BVWA 2YCFA 2UW8A 4BJJB 3QWKA 4JIKA 5CWZA 2OZAB 4FRFA 3SDJA 1VZOA 3L9LA 5DA3A 3ZXZA 3TUDA 2IVVA 1WBPA 2VTRA 4O4CA 3ORKA 3CSVA 3DBEA 1Z9XA 4E7WA 3GT8A 1KE9A