1XJDA

Crystal structure of pkc-theta complexed with staurosporine at 2a resolution
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
Knots found
sequence length
320
structure length
280
Chain Sequence
IEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNFCGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRWLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPQNMFRNFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Protein kinase C, theta type
publication title Catalytic domain crystal structure of protein kinase C-theta (PKCtheta)
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 280
sequence length 320
other databases KnotProt 2.0: S -31
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2004-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1xjdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1xjdA01
3NDMA 4J99A 2E9PA 5L2SA 3F9NA 5ANIA 4TWPA 2VUWA 5E4HA 4EORA 4DG0E 1CKIA 3MI9A 4K11A 2B9HA 5CEPA 3TWJA 4L7FA 1OPKA 4QYYA 3WZJA 4FZFB 2RFEA 4BI1A 3FLZA 3HL7A 3QTXA 4L6QA 4XP2A 3L9MA 2PL0A 4A9YA 4EK3A 1JWHA 3FLNC 5JRSA 5HU9A 3QRKA 3WIKA 4QMSA 2X9EA 2W0JA 1PXOA 4S32A 3WYYA 4FT0A 1Y6BA 3D9VA 4EH4A 2VTMA 4IZ5A 3MPTA 3EN5A 4DEIA 5TR6A 5C27A 4K2RA 2RG5A 3RPOA 5DR2A 3SKCA 3UP2A 5BVEA 3QALE 5JGDA 1EH4A 1JBPE 4GYIA 2YM3A 3RHKA 5I3RA 1W7HA 4O2ZA 4BBFA 3QRUA 4KIQA 5AUXA 2H9VA 4FNZA 3VW6A 3PUPA 2HZ0A 4BDCA 3VJNA 4C59A 2IW8A 5L4QA 2XS0A 3PXKA 4JG7A 2JD5A 3VS1A 3ZM4A 1URCA 2QKWB 3MVMA 4MBIA 3S95A 3K54A 4P90A 3MY1A 4W4YA 2J4ZA 4QP2A 3QCXA 5HCZA 5I4NA 2HZ4A 4G16A 5I5ZA 2UW5A 4M7IA 3DJ6A 3TDVA 4GRBA 5G6VA 4S33A 2J0MB 2VO7A 4GK2A 4C58A 5IUGA 4FTIA 1REKA 1PY5A 3W2PA 2VNWA 3GI3A 2ZV9A 3OOMA 1XKKA 2UZBA 3QQJA 5L8LA 2BRHA 2XJ0A 3PRIA 3HRBA 3EB0A 3FC1X 4KAOA 1CKJA 3OCTA 2QOQA 3H3CA 2BALA 1XR1A 2HXLA 2E9NA 1H0WA 2J0LA 2VX3A 3BGQA 4FT7A 5CSXA 3ZUVA 4RWLA 3EL8A 1H1PA 2JFLA 3U87A 3PJ1A 3ZRLA 4ENXA 1G3NA 4QYGA 5AA8A 3R8UA 3AD4A 3GGFA 4AZEA 1FVTA 3MY5A 2EXCX 3GCVA 3H9RA 4KBCA 3GC7A 4HVGA 3UVQA 3ORNA 3MWUA 4ASXA 3DJ7A 1QPEA 1UVRA 3R9NA 5AP0A 1YKRA 4O0UA 4PDOA 3W18A 3A7FA 3R1SA 1KOAA 3HA6A 5L8JA 5BMMA 3SOCA 5FDXA 2WEVA 4FTQA 5HVKA 2XKFA 3UG1A 4X2FA 1MRYA 3KN6A 4JQ8A 4D2PA 2O65A 5DRDA 2PVYA 2WOUA 2Y9QA 5HORA 3QTRA 4ANBA 3Q4TA 4ASDA 1YQJA 2B9JA 4CFUA 4EH5A 4L52A 4EWHA 3ET7A 1NW1A 5AM7A 4UY9A 4WT6A 3F66A 2RFSA 4FTTA 4ZSEA 4LOOA 4DF3A 1H26A 3ERKA 4UV0A 3PJ8A 4AG8A 4WRGA 4EBWA 2WIPA 2JEDA 5LMKC 4WNPA 2XIXA 1Q5KA 3E88A 4J8NA 2QOCA 5AP6A 4ZJJA 2FB8A 4EK6A 1SVEA 1OKZA 3P7CA 4XV2A 4PMSA 4V0GB 3R04A 1GZNA 3MB6A 5D12A 3NAXA 2X8DA 2QOHA 3IG7A 4G3EA 4ZSGA 4L8MA 4RFYA 2QG7A 4P4CA 4YPSA 1BI7A 3ROCA 3IOKA 4AN2A 4R7IA 3MGYA 3R8LA 2IZRA 5IQAA 3Q5ZA 3F3TA 4RFZA 2ZV8A 3SAYA 1W84A 2X8IA 3UOJA 1NVSA 3F3UA 3QTSA 3TV7A 2YCQA 3AQVA 1L3RE 4XG8A 3OUNB 3QA8A 2P0CA 4KSPA 4AXAA 1NA7A 2R64A 5M4CA 3D5UA 3FY0A 4AZSA 5D10A 2R3GA 5AV4A 3DBDA 4EJNA 3GB2A 5IA5A 3GENA 3PPZA 4BTJA 5ANOA 1JSVA 4O0YA 2RKUA 2F7ZE 5KMMA 3UPZA 4QYHA 4YJTA 3BLHA 4BDDA 2QODA 5HOAA 2G2FA 4FKVA 3DDQA 1OITA 4IAKA 4TYEA 4FOCA 1MRVA 4CYIA 3ZLWA 3OBGA 2J51A 3I6WA 5EM7A 4FC0A 2YZAA 4C2WA 1YWVA 5CAOA 1ZWSA 3FZRA 3LFEA 4HNIA 4MXXA 3PXQA 2VWWA 3R1NA 3TUCA 5M4UA 1HCLA 3R28A 3BYSA 2W7XA 3G51A 1AQ1A 4RQVA 1A48A 4FKJA 2YIXA 4KINA 5JFVA 2IZSA 3Q3BA 4L3JA 4NTSA 4BZDA 4ZLOA 1IAHA 3ZSHA 3HEGA 3QL8A 3OY1A 4BKYA 4EH8A 3LXPA 1JKLA 4XG9A 1FGIA 4K33A 4A06A 5D1JA 5C8KA 2IO6A 2VV9A 2OJ9A 5B0XA 3W8QA 4L00A 3G6GA 4FE2A 4F1TA 5EYDA 3L8XA 4AGWA 1IASA 4TTHB 3H0ZA 5K9IA 2Q83A 1W83A 5F1ZA 3FMNA 3Q6UA 3QRTA 2KULA 4FI1A 4TYJA 1B39A 5LMAA 5CU6A 4ZY5A 3DA6A 3FZTA 2XH5A 3I79A 3LFQA 3UIMA 4A9RA 2J90A 2Y7JA 1XQZA 3EQCA 3KCKA 3LOKA 5HLNA 3H9FA 3WF5A 3R7OA 3MB7A 4IB3A 2YIQA 2JLDA 1M17A 4DFYA 4USFA 2UZOA 3MFUA 4IBMA 4D2TA 1FGKA 2OI4X 5DIAA 1J3HA 2G2HA 5A46A 3CJFA 4K77A 2BKKA 4NWMA 4TNDA 4Y46A 5FEQA 3NVMB 4QTEA 1UNHA 3ANRA 3O8TA 4G3DA 4U42A 5AWMA 2PZRA 4DN5A 2EB2A 3LCSA 4HGLA 2P3GX 5E8WA 5CVGA 4FK6A 5J1WA 4QP1A 2X81A 3GFEA 2YERA 4PPBA 1ZYJA 3NCZA 2H8HA 3IDBA 3ZRKA 3NMUF 1MP8A 3BQRA 4RRVA 2WQOA 3W16A 5TE0A 5BMSA 4CKRA 4WBOA 5GZ8A 5FTQA 4O27B 1XO2B 2XIZA 3OTVA 4EH3A 5L2IA 3A7IA 3COKA 5HG7A 2C0IA 3UVPA 3PLSA 3PJ3A 5ANKA 1YW2A 3ZEPA 2QOFA 2HWOA 3HUCA 4UXQA 3CJGA 5D41A 4BDGA 1FMKA 3DBQA 5I9UA 5FXQA 4CT1A 1ZAOA 3CEKA 5KKRB 1REJA 4DHFA 3LXNA 2QOOA 4FV8A 5CI6A 1VZOA 2F2UA 2VTIA 3GFWA 3QHRA 2Y4IB 4HYIA 4XV3A 3FSFA 5IUIA 2ACXA 3E8DA 1ZOEA 3LE6A 1HCKA 1SMHA 4ENYA 5KE0A 2WKMA 4NFNA 4QP9A 3SGCA 3R8ZA 3FZPA 1RE8A 2XZSA 4YJUA 3W33A 1H24A 2OG8A 1NXKA 3B2WA 4GV1A 2QNJA 2I0EA 3NYVA 4L9IA 4CEGA 5IEVA 3KEXA 2IZTA 3ZC5A 3DKFA 3FQSA 3D0EA 5CY3A 3UP7A 1LP4A 4MAOA 1UKIA 4AGDA 2BRGA 3HV6A 4NK9A 4EYJA 5CALA 3Q53A 3R7YA 4QTCA 4F6UA 2ETRA 4P5ZA 5CYIA 5ICPA 3HECA 4G9CA 3QTZA 2B1PA 3UOHA 3F7ZA 5HEZA 5G1XA 2ITPA 4TYHA 4BZNA 4EH2A 3VIDA 1YOJA 4CMTA 3GQIA 3POOA 4IB1A 3HMPA 4YBJA 5L6OA 2W1DA 5BNJA 3UODA 4D4RA 2HZNA 4K6ZA 4LUEA 2Q0NA 3BHTA 3SOAA 3V5PA 4FG9A 3UMWA 2GNHA 3ZDUA 1OPLA 5DHJA 1OBDA 2IVUA 4JG8A 5DT4A 3IO7A 5AR8A 3V01A 2GNFA 1P14A 2XNGA 4CKJA 3PA3A 3QXPA 3N4UA 4M15A 3BLQA 2OW3A 2UW7A 2J0IA 3QQGA 5AIKA 4ZLYA 3UNJA 1Q61A 4OTWA 1J7LA 4E20A 4D2VA 4YC6A 4JG6A 4GUEA 4B0GA 4EOLA 4F9BA 3BKBA 5CU0A 3NR9A 3CGFA 3W2RA 3VUGA 2CPKE 2CGWA 2UZTA 3DDPA 4EHZA 2FSLX 3DTWA 3R2BA 1KV2A 5FQDC 1H0VA 4IVDA 3V04A 5LMKA 3FL4A 1L8TA 3VBWA 5LVMA 5LARA 4DTBA 1GZKA 3R00A 3CE3A 3SLSA 1UV5A 4F7SA 3IW8A 3DV3A 3F5XA 3WILA 5EM5A 5DMZA 2C6LA 3MFTA 3NEWA 4FTOA 1H01A 2VWIA 3CY3A 5EDPA 4M84A 4ASZA 4KABA 2P2HA 4JI9A 3ZMMA 3CBLA 1NT2A 5KMJA 3CIKA 2OXDA 4GT5A 5LCKA 4CVAA 1YOMA 5CVHA 2A0CX 4WHZA 3PY0A 1YDTE 5KZIA 4R3CA 3B2TA 5CQWA 4B9DA 3PP0A 4RJ6A 1FINA 4IE9A 2ETMA 4YTFA 4QPMA 1URWA 4HOKA 4C7TA 2FYSA 4XG2A 4IZ7A 2PMIA 3R63A 3DAEA 3TIZA 2ETKA 4KIKA 3QD3A 3I1AA 4LL5A 3TNPC 4TXCA 4I5PA 4QMTA 2PMNX 3R73A 4CV8A 4Z3VA 5HBJA 4LMNA 3NUXA 3TZ8A 4JS8A 5IKWA 3ZS5A 4I0TA 5FLFA 4BC6A 3FWQA 3KB7A 3PRFA 3K5UA 2WMBA 3D5VA 5EK7A 4QMNA 3ALNA 4KKHA 2WIHA 3M11A 2J9MA 1G8AA 2ZM3A 5J7HA 4O7NA 4KIPA 2ITTA 4JNWA 4L3LA 4CG8A 5AAEA 3KC3A 3HDNA 3EQPA 2J0JA 5HNBA 4I21A 1YXUA 2PUUA 3KVWA 4IVBA 5A4EA 3ELJA 5ETAA 3GU5A 4KS8A 1JPAA 2B9FA 4IAAA 4FYOA 2VTTA 4M12A 5AR7A 1H1RA 2VWUA 4C36A 4RWKA 4EOKA 2QU5A 4BFMA 2X2KA 2CGXA 2XYUA 3A61A 3COHA 2A27A 4H36A 1BLXA 4Y83A 4NEUA 4GJ2A 4GMYA 5ANEA 3VF9A 1XH5A 4IFGA 4N6ZA 1BL6A 3PA5A 3Q96A 3C5UA 1F5QA 2BRNA 2ERZE 1YVJA 3DOGA 2W1IA 4QMVA 5HE2A 2BRMA 1DI8A 5CWZA 3ZOSA 5CAPA 3CXWA 2YAAA 4BDIA 2JDRA 3FMKA 2BTSA 3EN4A 3PXZA 3O71A 2X4ZA 4JR7A 3FL5A 2YLFA 2XCHA 4KKEA 4DH7A 3QLGA 3ZM9A 3RWQA 1O6KA 2PZIA 2XIRA 3ZU7A 2JBPA 4I93A 4AOJA 1KV1A 3Q4UA 4I1ZA 3S0OA 2OK1A 1OPJA 4YJSA 4DFZE 3IDPA 4OAUC 1ZMWA 4E7WA 3UZTA 2OO8X 4QQJA 3WF7A 4FV3A 4YURA 1KE8A 3OXZA 4K1BA 3OD6X 4WBBB 5AUVA 2BAJA 3BHUA 4GU9A 3OHTA 1NY3A 3E87A 3W8LA 4WIHA 3P78A 4L42A 2LAVA 4PTEA 4KNBA 2VN9A 3UNKA 4TY1A 3VHEA 2QO2A 2BUJA 4RIXA 3U9NA 1UU8A 4EI4A 5HCXA 4EOPA 4FKTA 3QX4A 4A9TA 4BDEA 3HRFA 4DEEA 4F70A 5I9YA 2YM4A 4RZWA 5K0KA 4JAIA 5CU4A 3EQGA 4FA2A 3HNGA 2FA2A 2BDWA 4I4FA 4LFIA 3E7VA 4MKCA 5JEBA 3LQ3A 3NLBA 4S31A 5DR6A 2XNOA 4TYHB 4YR8A 4BIEA 1PXMA 2BFXA 3C51A 4XYFA 5BVOA 5M07A 3C4WA 1Q8YA 1M7QA 2BAQA 2J5FA 4XH6A 3VUHA 2GNGA 5E8YA 5A4QA 3K3IA 4Y85A 2R2PA 4IC7A 4M66A 4BKZA 3FJQE 5GJDA 3Q52A 2PYWA 2PE2A 4KB8A 4WRSA 2CLQA 4ITIA 4X2GA 3RI1A 5KO1A 1GY3A 3MW1A 2XBJA 5M09A 3ZZEA 2BR1A 5D7VA 4E6CA 3HZTA 1Y8GA 4FK3A 4I6HA 4AW2A 4ZZMA 3G90X 5TO8A 5C8MA 4BDBA 2OH4A 3GNIB 3KQ7A 3P79A 3R7IA 3Q60A 4JXFA 3TKHA 4FNXA 4G34A 3TUBA 4WNOA 1R78A 1KE6A 3DAKA 4LUDA 1WBWA 3F5PA 3NIZA 3GU8A 4R3RA 5L2QA 4C4FA 4BCNA 3OW3A 3QTUA 2OZAB 3FI3A 1O6YA 3NYXA 4ONAA 3R0TA 4FKRA 4J95A 4LV5A 3FI4A 4PMTA 3F5GA 5CSWA 4NSTA 3V8TA 4HVIA 3TKIA 4DYMA 5AFVA 4GKIA 3SDJA 3WIGA 5EW3A 3UBDA 3NX8A 4B6LA 4FIEA 2PULA 4GIHA 3QYZA 1I44A 1V0BA 4NM3A 1OI9A 3BRBA 2J50A 4BCGA 3TTIA 3WOWA 2YDJA 2C47A 4IB5A 4HZSA 1GOLA 1OZ1A 5EW9A 4BIBA 2C6EA 5IQGA 4AFJA 4X2JA 4UWCA 3W10A 2G2IA 2OIBA 3R30A 4KIKB 4PMMA 4XRJA 4ZMEA 3PTGA 5EM6A 3UZPA 3QF9A 5CI7A 3QBNA 3C5IA 4GUBA 5CU2A 4JIKA 3ZLXA 3O51A 3NVKI 4FL2A 3F88A 5IISA 3AXWA 4UMTA 4H39A 4OLIA 3F2AA 3G9LX 2HWPA 4BVUA 5GJGA 5KZ0A 3RCDA 3ZBXA 3QCSA 4DLIA 2QO7A 1V0PA 3RAHA 5CF8A 4M69A 2HK5A 3QD0A 5CZIA 2R0UA 1IG1A 3EQRA 4H1MA 2GMXA 2I7QA 2R3PA 4F63A 3EJ1A 5FM3A 3TJCA 3BGPA 2W1FA 3FMHA 3OS3A 5CLPA 3ZDIA 4FOBA 4EK8A 5JN2A 3CCNA 4YSMA 4ACHA 3EZRA 3AMYA 3H9OA 1KWPA 3PE2A 2GNJA 4R7BA 3ZUUA 5TKDA 5JRQA 4D55A 4Z16A 2B9IA 1FVRA 2NP8A 4MEDA 5FXSA 5HGIA 5ANDA 3TNHA 2YDKA 1F3MC 3LMGA 5CSVA 3AOXA 3MJ1A 3OOGA 2XK3A 4MNFA 5M08A 2H34A 2C68A 5C01A 4RJ7A 4JL9A 3LM5A 4K8AA 4ACGA 5M4FA 3HAMA 1TQPA 2PK9A 2I0VA 4IANA 5HICA 3KRRA 4EWQA 4O86A 1V1KA 4Z7GA 4UALA 4E4MA 2UV2A 1H08A 3RALA 2OZOA 4KRCA 3PIXA 5E91A 5FRIA 3ZHPC 4OGRA 3I5NA 1QPCA 5AR2A 4BDHA 1KOBA 4UN0C 4I0RA 4NKSA 4QMLA 4TWOA 4C3FA 2B55A 2PUNA 3C0GA 3NUAA 4PDYA 1ZZLA 3I5ZA 4HGSA 4D4SA 2V7OA 5JK3A 2ITVA 1AGWA 5J9YA 4GK3A 3HV7A 2XNMA 2OGVA 4WUAA 3UQGA 3V8SA 3G15A 4QP3A 4D58A 4O81A 2C4GA 4YTIA 4FT3A 3DXNA 4CFNA 1YHVA 1U54B 3HYHA 4FTJA 3GQLA 3OT3A 3HMIA 4RIXB 5AR4A 4AP7A 4FIGA 1DAWA 3UOKA 4R7HA 3CY2A 4BGQA 1WBVA 3KN5A 4EHGA 1OIQA 2C0TA 4ALWA 3HV5A 1M2QA 3V6SA 3JVRA 3ZO2A 4KS7A 4C0TA 2C6KA 5IA1A 4RBLA 3U51A 4BGGA 5L3AA 4I22A 4L68A 5AP3A 4GIIA 2W99B 4U3YA 5HG5A 4O38A 2C1AA 4E3CA 4IM0A 2XVDA 2FSTX 4JLCA 2CJMA 5BYLA 2ITNA 5F94A 3Q4CA 4GVAA 4KUJA 3PIZA 1T46A 4I94A 4P2KA 5CANA 3W2CA 4EUUA 3NUYA 4E5BA 1J7IA 2UZUE 4AZWA 4XG3A 1WVWA 2P2IA 2YM5A 2UZEA 4HNFA 1FPUA 1ZYLA 1R39A 2C3LA 1ZLTA 2GNLA 2F7EE 4AE9A 4PRJA 1VJYA 4AOTA 4EK5A 4RG0A 5BVDA 5K4JA 3EZVA 2QU6A 4U9AA 5CSPA 3EYHA 4FSWA 4OW8A 3OW4A 5DVRA 3G5DA 3QQLA 4YC8A 3VHKA 4YJNA 3FZOA 3G33A 3VNTA 3E7OA 2Y6MA 1BUHA 4ZAUA 4OT5A 2XKEA 5LWNA 5L6WL 3HKOA 4D1SA 4C2VA 2RG6A 3TV6A 2RL5A 4QYEA 3JPVA 3SHEA 4FKPA 4AN3A 4DFUA 1E9HA 1XWSA 4FKOA 2C6TA 4JIAA 3SVVA 2B54A 3GVUA 3Q32A 4ANOA 4DGMA 5EQYA 5HO8A 2VWYA 2W4OA 2WXVA 3BX5A 4JDIA 4QMWA 1OIUA 3OTUA 3VRZA 1PRYA 3R7UA 4LRJA 3I4BA 4EQUA 1UA2A 2WMAA 3PXFA 4AW0A 4IAIA 4IZAA 2H96A 3MFSA 2O64A 4FZDB 4BCIA 3OWPA 3EQHA 2BCJA 4N6YA 4I24A 2XRUA 4RX8A 4MXCA 2OU7A 3KXXA 1GZ8A 2X6DA 4FL1A 3TEIA 5E8SA 4S34A 3W1FA 1WBSA 2PZYA 3LCTA 4IH8A 4DFNA 1IA8A 3RGFA 1A06A 3LAUA 1MQBA 3QD2B 2O63A 4AFEA 5DLSA 4C4JA 4RT7A 3ZO1A 4N57A 5GINE 1QMZA 4G6OA 4RFMA 5EDQA 2QURA 4OBQA 3C7QA 4AA4A 3LJ2A 2IW6A 2V22A 4YTHA 1H25A 2VRXA 3P9JA 3VRYA 3OBJA 3E92A 3ORLA 4RSSA 4IAFA 4ZTQA 1R1WA 2HZIA 4BTMA 4F65A 5IA4A 3R22A 2C6IA 4I92A 5DT3A 3V5JA 2I40A 4AACA 4ANSA 4FZ6A 5CF5A 3VS7A 3ZO3A 3KVXA 3PSCA 4R6VA 2VO3A 4UMRA 3C0HA 1JOWB 1W8CA 4M69B 4DEDA 2WB8A 3DFCB 3NCGA 5FGKA 2RFDA 3QKMA 2WMSA 2BILB 4O0SA 4K18A 3T9TA 5KMOA 4BR3A 1Q3WA 3UOLA 4PDPA 3TCPA 2E9VA 1ZY5A 2BFYA 4O1OA 1GZOA 3W2OA 3U6JA 3FXWA 5HIDA 4MF0A 5DEWA 3GEQA 3OG7A 3DZQA 1Z9XA 4QMPA 5E1SA 3TNQB 3IKAA 2OF2A 4BF2A 1UWJA 3BBTB 3NPCA 5CX9A 3LFBA 3FQHA 4G3GA 3PSBA 3KREA 4GJ3A 4NCTC 3NUNA 4D1ZA 4NUSA 4UYNA 4FIHA 4QQCA 3DNEA 4AX8A 4MNEA 2YEXA 4J8MA 4ALUA 4AU8A 2XNBA 4PNIA 2R7IA 1K3AA 2XNPA 4FSTA 4MQ1A 1Z5MA 3PP1A 4LL0A 4QQ5A 2C5OA 3RNYA 5M56A 5KMLA 4FF8A 4Y5HA 3PZHA 4ANQA 1BKXA 3I7BA 4FV1A 3OF0A 3FAAA 4JBQA 2WGJA 4FV2A 4YZDA 3VO3A 4NU1A 2C3KA 2HY0A 2W4JA 4OR5A 2XKCA 4I4EA 2VTNA 3CQUA 4M97A 3GCUA 4XV9A 3VUKA 1UKHA 2X1NA 4YZBA 4HW7A 4EKKA 3HV4A 3MTLA 3I0OA 3JXWA 3OUKA 4RWJA 4ASEA 5CXZA 2PY3A 4XEYA 3QQUA 5DFPA 5CTPA 4CQEA 4F7LA 5AV1A 2GSFA 1YRPA 2W96B 1XH6A 4JRVA 5EFQA 3UO4A 2VX0A 3THBA 4DEGA 4XS2A 2PE1A 2Y4PA 3C4FA 1Y8YA 4G31A 4FKWA 3RK5A 4DGGA 4YJVA 5AJQA 4J97A 4LM5A 4BTFA 5HIBA 4EOMA 3IW4A 4ACMA 1E1XA 1K2PA 5HNIX 3BV2A 4GFOA 4FSNA 4I5MA 3QD4A 4ANNA 5EYKA 3ZXZA 4FVRA 1GIJA 3FUPA 5HIEA 2YN8A 5BVKA 4RC3A 3GCSA 4E93A 2WEIA 2OIQA 4FV6A 4NT4A 4CCUA 4DEAA 4NL0A 3PY3A 4FGBA 4I6BA 2VO6A 1DI9A 1WAKA 5JZJA 3NNXA 3EQBA 5I9XA 5K4IA 1SZMA 4QRCA 3W55A 2QI8A 4X0MA 4NYEA 2Q0BA 2WOTA 3AGLA 4BHZA 3D94A 4OTPA 1PXLA 4QP4A 5FBNC 3LJ1A 3IGOA 1PMUA 3P0MA 5HI2A 3ZH8A 2WTJA 3UPXA 3ZLYA 5KHXA 3ATSA 4J53A 4L3PA 4FEWA 4FKLA 4D4VA 2ZVAA 2V7AA 2E9UA 3IW6A 5KCVA 4XLIA 4CFFA 3FI8A 3MH1A 4IEBA 5FDPA 2VTAA 5TT7A 4A4LA 1H28A 3F3ZA 3DLZA 3FYKX 4IM3A 4EOOA 4JX3A 5EW8A 3I7CA 2OFUA 2XJ1A 4I41A 3UGCA 4E5WA 5HZNA 3E8CA 5B2KA 5L2TA 3LFFA 2WMVA 1VYWA 3F82A 2R4BA 2XEYA 4YC3A 3F69A 4DFBA 1JAMA 4O84A 5HESA 5L6PA 4E4XA 5IPJA 3DKGA 1DM2A 2XK7A 4ZS0A 4GU6A 2WO6A 5GZ9A 3FPQA 1IAJA 3DT1A 4AF3A 5AP7A 3BCEA 1OIYA 2F2CB 5DEYA 4MD7E 3UG2A 4F99A 4AS0A 2PZ5A 3A60A 5AAFA 3Q2MA 3VS5A 3EHAA 4CFWA 3SD0A 5KMNA 1YDRE 4O82A 2NNWB 4UMPA 3CGOA 2IVSA 4DBXA 2JC6A 5DWRA 4AW5A 2WMWA 2B7AA 1RW8A 5M4IA 3OEFX 2FSMX 3AD6A 4OAVB 3CTJA 4O7VA 5KBQA 4HVHA 4JAJA 5AV0A 4FTNA 4F0FA 1M14A 3CPCA 3P86A 4O0RA 3GXLA 2X7FA 2I0HA 5A6NA 2DUVA 1CM8A 2PVFA 3BYVA 4BDKA 2R3KA 3T3VA 4DH3A 3LFSA 3RPSA 2LGCA 2GTNA 4V05A 4GT3A 4W9XA 5AX3A 3V5WA 1M2RA 2HENA 1U46A 4FSZA 4U45A 3ACJA 5FBOA 4ZXTA 4RIWB 3RNIA 2VGOA 2BZJA 3JUHA 2I1MA 4TT7A 4CZYB 5GZAA 1H1WA 3R8MA 3KMUA 1GJOA 4RWIA 4RC2A 1H27A 2HELA 2WMXA 2XP2A 4H1JA 3F7WA 4Q2AA 5H3QA 1LPUA 4IDTA 4YBKA 5B7VA 4FNYA 5HTBA 1B6CB 4LRMA 2QOBA 4JBOA 5AUWA 4GH2A 3F3VA 2VTJA 4FKQA 5D7AA 3FMEA 4JDKA 5DT0A 3NIEA 4JDHA 4PF4A 4CCBA 3E63A 4O96A 4TPTA 3VQUA 2GHMA 4D28A 3R02A 2JDOA 4QMMA 3TT0A 2E9OA 3ULZA 1CKPA 4FNWA 3EFJA 4IW0A 3RM6A 5BPYA 2HYYA 3KK9A 3NYOA 3O8PA 3HMMA 1YHSA 2XNNA 2Z7RA 3EN7A 3FXXA 4MNEB 2ZAZA 5J9LA 4U5JA 4WD5A 3DU8A 3FI2A 3U4WA 3M42A 5F95A 2GFSA 4JBPA 4NM7A 4C37A 2X39A 3FLQA 3G0EA 5F9EA 1PXKA 1O9UA 3A7JA 3ZUTA 4AGUA 4KD1A 2BHEA 2O0UA 3QLFA 5C4LA 3SG8A 4F4PA 4W8EA 1WBPA 2CN8A 3VQHA 4C4HA 3BPRA 3ZBFA 3R01A 5JZNA 5CU3A 2WZJA 1Q4LA 2VWZA 1JKSA 4TYGA 3EQDA 3R7EA 5GIPE 3JVSA 4MXAA 5AP5A 4QPAA 4CTCA 5E1EA 4DGNA 5EQEA 5T6KA 4CD0A 3EKNA 3BELA 4GSBA 4UWBA 4GT4A 3ORMA 5CEMA 5C1QB 3UO5A 4DT9A 2PTKA 3ORZA 3UDBA 2ITOA 5E8XA 3KGAA 5FWKK 2CKQA 2BVAA 4NCTA 4HGTA 3UIBA 4FIIA 3EN6A 3LCDA 3PG3A 3RTPA 5EHOA 3FHIA 4GYGA 2XM8A 3GC9A 4GG5A 5IDNA 3ZFMA 4BIDA 2ZMCA 4BY9E 4Q5EA 3FXZA 5E90A 2WQEA 2OZAA 4ZOGA 3TG1A 4R8QA 5FTGA 2C1BA 3D5WA 5DI1A 3D15A 3Q9XA 4QMXA 4MTAA 4UB7A 1WBNA 3RZBA 3ZTXA 2YFXA 2CNVA 3UQCA 3ZFXA 3SXSA 2IWIA 3V8WA 3E64A 4IXPA 3QUPA 2HW6A 4ZTMA 4N0SA 1U59A 4CTBA 4FL3A 1OL1A 1XH8A 4N70A 5BVFA 5CF4A 2BKZA 4M14A 4FTUA 5AADA 2F57A 2JBOA 3Q9WA 3LVPA 2R3LA 3P7BA 4YLKA 4EC8A 3LMHA 1IR3A 3LXLA 4FV4A 4IVCA 2Z2WA 3DS6A 1J1CA 3DY7A 4QTDA 4A7CA 5A6OA 4TL0A 4W4VA 5AUYA 5A4TA 3LLTA 2PPQA 2GHGA 4FKUA 3KL8A 3DZOA 4FYNA 2YM8A 1YXXA 3IGGA 3GT8A 1YXVA 2QLUA 2XYNA 4LGHA 3TZ9A 4JDJA 2HCKA 3ZZWA 2R7BA 4YLJA 4JQEA 4ZSJA 3EMGA 3TV4A 4GCJA 4GK4A 4DCEA 2X7OA 3UC4A 2VO0A 3BU3A 4NJDA 4A9UA 1JVPP 4LQMA 5I0BA 4U97A 4Q9ZA 4D1XA 2QG5A 3MVHA 3CP9A 2C3JA 4MD9E 4A07A 5E8VA 4FIJA 2ZOQA 2YDIA 1Q8WA 2ITUA 5EHYA 3QA0A 4FG8A 4E6AA 4HYUA 5E8TA 4O91A 4AWIA 3Q5IA 3V3VA 3QUDA 2PUIA 2A19B 3R6XA 1PXIA 2E2BA 2FSOX 3A8XA 5ETFA 4FTLA 3MH3A 2O5KA 3BV3A 4CMOA 4GVJA 4DTAA 3EIDA 4WA9A 4TRLA 3HP5A 2OSCA 4H3PA 1W82A 2GTMA 1R0PA 3AC8A 5DPVA 4FBXA 1JKTA 4FSYA 1OUKA 4MXYA 3R71A 4YHFA 4BCOA 5IMEA 3L9LA 5BVNA 4X3FC 3FMDA 3BEAA 3SA0A 3PVGA 4XOYA 3PDTA 3L8SA 2YCFA 3ANQA 4NJ3A 2EXMA 1J1BA 4O6EA 2IG7A 4RZVA 4TN6A 1BX6A 4IX6A 3ORPA 4FUYA 3DXQA 4PMPA 4Q9SA 3D14A 5FM2A 5J9ZA 2UW0A 3MA3A 2Y0AA 3RAKA 3UJGA 3S1HA 1OB3A 4FEUA 2J2IB 1H1SA 3KF7A 5DOSA 5KHWA 4HYHA 1JLUE 3LQ8A 3MSSA 2EVAA 4NM0A 4PQNA 4QNYA 4R77A 5LXMA 3W2SA 3V5QA 4IX3A 4UX9A 3UVRA 3KXNA 1OUYA 2FGIA 3QAME 1Q3DA 4AZFA 2WFYA 1JKKA 1U54A 2XIKA 3DPKA 4UZDA 3Q2JA 4Y95A 4L53A 4D0WA 4CFMA 5JSMA 3QQFA 5CAVA 4XV1A 1QPJA 4TWNA 4FKGA 2PE0A 4F6SA 2JIVA 3BIZA 2GS2A 3UYSA 5IQCA 1SM2A 3EKKA 3ZSGA 4O2PA 4I20A 2WMUA 5GHVA 4AE6A 5M53A 4RJ5A 5AP2A 4QNAA 3KXMA 2QR8A 4G5JA 1PXPA 4X3JA 5HTCA 4BTKA 2ESMA 3PLAE 2GNIA 3EQIA 3LKMA 1IEPA 2GCDA 4QQTA 5CENA 3VS3A 4APPA 1APME 5IU2A 1JSUA 2WPAA 3ZRMA 4I0SA 4JJRA 2EB3A 3N4TA 3TL8A 4W4XA 4UBAA 3TZ7A 1H00A 2XB7A 1WZYA 3ID6C 4IFCA 2ZDUA 2WAJA 4IAYA 2IPXA 1Q8TA 3JY9A 4DG3E 5M51A 1U5QA 2JIIA 3HRCA 4C34A 4BWKA 3TZMA 5J5SA 2G1TA 4IM2A 3ZONA 4PWNA 4LGDA 4BGHA 5KUPA 3FSKA 3H10A 4DA5A 3MPMA 4DFXE 4KBKA 3WZDA 5HD7A 3C0IA 3Q9YA 4P7EA 4D2RA 2UW3A 4DCAA 1E1VA 3WF8A 3OWJA 4YU2A 3RP9A 3PVBA 4B8LA 3JYAA 4II5A 3UTOA 4F0GA 3DK6A 2A1AB 5EYMA 3LCKA 3TXOA 2PU8A 3A99A 2QONA 5DYJA 4FVQA 3N9XA 4C4IA 4HJOA 3M2WA 4YJPA 1YI3A 3CLYA 3OEZA 3ZC6A 5CAQA 2ZB0A 3UQFA 3U9CA 3OCGA 4H05A 1YOLA 4PL5A 1M2PA 3DKCA 5E7RA 3C4XA 4FTCA 3PXRA 4FUXA 3O2MA 4PV0A 3COIA 1H4LA 3BYOA 3C50A 3SRVA 3VS4A 4AT5A 4A4OA 1XBBA 3MBLA 4FSUA 4MBJA 4CT2A 4XBRA 4JQ7A 1QCFA 2FVDA 2J0KA 1TKIA 2F4JA 5CZHA 2DYLA 1GIHA 3AC3A 3C9WA 2WELA 1S9JA 4LOPA 4M67A 3AC4A 1XJDA 5KMKA 4F7JA 3M1SA 3SXRA 4D5KA 2YISA 3RAIA 2VTOA 3GBZA 3BHYA 2XBAA 3KXZA 2NO3A 1Q62A 4FTMA 3TDWA 4PP9A 5ETIA 3SW7A 4TNBA 4E6DA 4FTAA 4ZTLA 1SYKA 1RQQA 2CN5A 4UMQA 2QOLA 1CSNA 5K3YA 3VBXA 4X6QC 2PZPA 5FG8A 4DH8A 4ZZNA 1S9IA 4FTKA 4XG7A 3Q6WA 4L7SA 3K5VA 2PVJA 2AC5A 2QO9A 3EH9A 4EEVA 3DJ5A 2R9SA 4J1RA 4RLKA 4N4SA 4F9CA 2B0QA 2W5HA 3OCBA 2XK4A 5IH5A 2JDSA 1KE7A 2BDFA 2YAKA 4YPDA 5GIOE 4X6RA 4C62A 4S30A 2OJIA 1H8FA 5DE2A 5A9UA 4IJ9A 3DCVA 3IPHA 2ZDTA 1YWRA 4RC4A 3MIYA 2EWAA 3GCQA 3CTQA 3OXIA 4FV9A 5AMNA 3IOPA 4OTHA 4X2NA 3S2PA 4AGCA 4FEVA 2Z7SA 3ZYAA 4IWQA 2VTLA 1YI6A 3OY3A 3RPRA 3PG1A 4I3ZA 4XNEA 2JDTA 2X2MA 4QO9A 3DK3A 5HLWA 3MH2A 4DH5A 3LFNA 1K9AA 4H3QA 3F2RA 2GS6A 1Q8ZA 3DAJA 3U54A 4HZRA 2CKEA 4HPTE 4ACCA 3L9NA 4WUNA 3A2CA 4OTGA 5CEQA 1PXJA 1T45A 4HGEA 4W4WA 4C57A 4CXAA 3VW8A 3NNWA 5EI2A 4R5SA 5IH4A 5KX8A 1UU9A 2YCSA 4HPUE 4BRXA 4G5PA 4EH9A 4IVAA 4IWDA 2R3OA 4E26A 2QHMA 5ITAA 3FZSA 4FEXA 2C6DA 3CKWA 5EOLA 3RBWA 3RM7A 3ACKA 3E3BX 3E8EA 1KE5A 4XP0A 2VU3A 5I3OA 1ZMUA 4H3BA 1OL7A 5ANGA 3SQQA 3IQ7A 3EWHA 3H30A 3MN3A 2CHLA 5CQUA 5AAGA 3QZIA 4MQ2A 2YJSA 4LI5A 4XLVA 3WZEA 2BROA 4PL3A 1W98A 4XOZA 3A4OX 4O0TA 3MIAA 4D2WA 4E1ZA 2GU8A 3R9HA 4X3FA 4G17A 5JGAA 5EI8A 2B52A 5H8GA 4AT3A 5EM8A 3U6IA 3QRJA 3S4QA 2XEZA 2B4SB 4ZTNA 3TNIA 3QGYA 2G15A 3BU5A 4UXLA 4I6QA 5E9EA 2V55A 3E3PA 5FP5A 3MY0A 4I5HA 5DBXA 5JFSA 1OKYA 3FV8A 2CNUA 2C5NA 4X2KA 1BL7A 2R3JA 3GP0A 4QMZA 5KNJA 4ZMFA 4EK4A 1WCCA 3OWKA 1ZYDA 2RIOA 4IACA 3SX9A 4O7WA 1PF8A 3QTWA 2W9FB 2UW8A 3VS6A 4ZS4A 4ZJVA 4RIYA 3DXPA 2UW9A 3AC2A 3QZFA 3R9OA 3NW6A 5H8EA 3HX4A 3OMVA 4YZCA 4BCKA 4QYFA 4M3QA 5AR3A 4IJPA 3QX2A 4FZAB 5J8IA 2VZ6A 5F20A 4DTKA 5H2UA 2HXQA 3C13A 3BGZA 3I60A 1WBTA 2JKMA 2VTPA 2YM6A 2P55A 4ZJIA 2RF9A 4A9SA 4BBMA 5H8BA 2XF0A 5FUTA 1MQ4A 5CXHA 2C6MA 3GC0A 3VF8A 5A3XA 4E73A 2OF4A 4WG3A 3T3UA 4IB0A 3A4PA 4EOQA 2XCKA 5LVOA 2IZUA 3R2YA 4FSMA 4QP8A 3IECA 5CEOA 3NWWA 4YHJA 1TQIA 1JSTA 2JITA 2WD1A 1GIIA 3NUUA 3K2LA 4QT1A 4RIOA 4TYIA 4XUFA 5ACKA 3SRVB 4I6FA 2C0OA 2G9XA 4O22A 3FHRA 3B8RA 3MESA 2A4LA 4NIFB 3D7TA 2BTRA 3F3WA 3II5A 5IG1A 1XH9A 2OJFE 5C26A 4R78A 2R3RA 4E8AA 3ODYX 3B8QA 2R3QA 3F61A 4QMYA 4FSRA 5CT7A 2QCSA 1FQ1B 5EKOA 1FBNA 3R9RA 3ZFYA 4QMQA 5D9HA 3R8VA 4L67A 2PMLX 3KA0A 2BRBA 5HG8A 3UE4A 3HP2A 4AUAA 4MYGA 2X9FA 4XBUA 4L44A 3QC9A 3LLAA 3H4JA 2YIYA 4AW1A 2GHLA 4J52A 4O0XA 2WQBA 5CNOA 4U40A 4CNHA 5JH6A 2AYPA 3FLSA 3VS2A 1PXNA 2UW4A 3BI6A 4U80A 3OZ6A 3RZFA 4R5YA 3T9IA 4BHNA 5LJJA 1KE9A 4CYJA 3QCYA 5FEDA 1FVVA 4C38A 4W8DA 5IQDA 3QUEA 4ZIMA 4KWPA 3TM0A 4H58A 4O1PA 4G1WA 4O0VA 1I09A 2YA9A 4PPCA 1XBAA 1ZARA 4YNOA 4AQCA 4F7NA 5IZFA 5LWMA 1ZRZA 2XMYA 4M0ZA 4RIWA 4RVLA 3ZXTA 4O7ZA 4U41A 3BE2A 4W9WA 5IUHA 3CR0A 1ZZ2A 4YLLA 1ZYCA 1U5RA 5EQPA 2BAKA 4CLIA 1VEBA 4RA5A 4C35A 2W1GA 4EC9A 4ZZOA 4A4XA 2CCIA 2J7TA 3DBCA 3OROA 4R1YA 2RGPA 5HVJA 1YWNA 4ERWA 5IQBA 3OWLA 3ZEWA 4NM5A 4O7TA 4B4LA 4YNEA 2Y8OA 5DNRA 5DRBA 3RVGA 1QL6A 2ZV7A 3LPBA 3C1XA 4QMOA 3DQWA 4PTCA 4MF1A 3TUDA 5L2WA 3BYMA 3JY0A 2O2UA 2XK8A 2ZM4A 4BWPA 4FSQA 4IQ6A 5HLPA 5T68A 2PVNA 3O17A 3LMIA 4D5HA 2V62A 2C5VA 3KCFA 3CS9A 4B99A 5FXRA 3FQEA 3IW5A 3P1AA 4FVPA 3UYTA 3FDNA 3KXGA 3NUSA 3VBTA 2YIWA 3QWJA 5B2MA 1YDSE 1IA9A 1Y6AA 3I6UA 1A9UA 4QP6A 3PWYA 2BZKB 2W06A 3RK7A 5IEYA 2JAVA 3GOKA 3V6RA 1P2AA 5BQ0A 2ZM1A 4EH7A 3BYUA 5EOBA 4ZTRA 3PVUA 5FD2A 3QGWA 3UZRA 2VNYA 4X21A 3R1QA 5K5NA 4DGOA 3BWJA 3HDMA 3UIXA 3NNUA 2HIWA 4Y5QA 3CPBA 4C02A 5BYZA 3UNZA 2OLCA 2QOKA 3RPYA 1X8BA 4BDFA 2WNTA 2OICA 3FY2A 5AV3A 3ORKA 4G3CA 3TN8A 4X3FB 5ACBC 3QXOA 2PVKA 1FMOE 2VTRA 4RQKA 1WFCA 4AA5A 2BIKB 3Q4ZA 4PY1A 4YZ9A 3UO6A 2QC6A 3VC4A 4D2SA 3CTHA 3RKBA 3WZKA 2C6OA 3S00A 2YWVA 1STCE 2UZVA 3LIJA 2ERKA 4E5AX 2CKPA 4U6RA 5FTOA 4YO4A 2H6DA 4F09A 3DBEA 4FV0A 4JR3A 2CNQA 3DTCA 4RGJA 3CQEA 3COMA 4YZNA 4EQMA 4YSJA 4BDAA 4ZEGA 2XA4A 4LV8A 5BVWA 3QZHA 3FPMA 3MPAA 3DFAA 4MWHA 4RIYB 4EKLA 3TIYA 4O7RA 3GU4A 1AD5A 3KK8A 4G9RA 2CGVA 3ORIA 3DQXA 3IONA 4BCFA 4RPVA 2YCRA 3P7AA 4IC8A 2WU7A 3OFMA 3W32A 2WTVA 2JKKA 2F7XE 4MXZA 4U8ZA 4DT8A 1CDKA 4HCVA 1NVRA 4BYJA 3RJCA 2NRUA 4IIRA 4BCPA 4QTAA 3DB8A 3DBFA 3P5KA 2AUHA 4L43A 5HX8A 3RWPA 4JRNA 4GW8A 3EQFA 3EYGA 4LOQA 4TW9A 3F6XA 1R3CA 2OWBA 3IDCA 4S2ZA 5CT0A 5AV2A 5HBEA 5LVLA 2EXEA 4QTBA 4G6LA 3WARA 3MJ2A 4ITHA 3AG9A 4YJRA 3R83A 5AA9A 4Z55A 2W1CA 1KUTA 4XJ0A 4J71A 4ZTSA 3NUPA 4LMUA 1PHKA 1OIRA 2DS1A 2JIUA 4BYIA 4C4GA 1BMKA 3Q04A 4BB4A 3D7TB 2HAKA 5DA3A 4L01A 4FT5A 4GG7A 4PX6A 4TKSA 3QKKA 4EONA 2GQGA 3E8NA 2J5EA 2BZIB 1ATPE 4C3PA 5IA2A 5HKMA 3FKNA 4F64A 3I0QA 2ITYA 2O3PA 1JNKA 4FODA 5DN3A 5L8KA 1JQHA 2V5QA 4QMUA 3F5UA 4EQCA 3JS2A 4U79A 2YITA 4EOSA 4P5QA 4USEA 3HMNA 3U55A 5HHWA 3FBVA 2JDVA 3NAYA 4D9UA 2YM7A 3EL7A 1ERKA 2C3IB 3PYYA 4KSQA 4MH7A 2WTCA 3E62A 4XMOA 1QPDA 2XNEA 4EBVA 4EOIA 4PP7A 3AT4A 5CEIA 4C4EA 5HG9A 2XKDA 4JOAA 3MVLA 4NTTA 1OECA 2HW7A 3AGMA 4J98A 2WTKC 1Q24A 4I5CA 1UU7A 4XHKB 3W2QA 4FKIA 4ZY4A 3VUTA 1Q97A 2G01A 3KF4A 4DH1A 5AUUA 5IQEA 1GAGA 2CDZA 2FUMA 4RVTA 3PPJA 2O8YA 5K0XA 2W17A 4OUCA 1M7NA 5KMIA 4FG7A 5J7BA 3KMWA 4DITA 5T3QA 4YO6A 5A4CA 5BUJA 2Z8CA 4EL9A 3ITZA 3LFCA 4IWOA 4UWYA 5EG3A 4ERKA 2QVSE 4HYSA 4UEUA 1PYXA 3AC1A 1ZXEA 4OTDA 4TZRA 5K5XA 4DE4A 3MTFA 5IF1A 4OBOA 4EHVA 3VUIA 2XJ2A 2ZYBA 2WTWA 3RPVA 1ZY4A 4D9TA 3OT8A 4BCHA 3PA4A 4XRLA 3L1SA 4UZHA 4RX7A 2VX1A 5DH3A 1WVXA 3VUMA 1YXTA 2VD5A 4V01A 1UWHA 1PKGA 5F4NA 5HE1A 3VJOA 3ZLSA 3BEGA 2WTDA 3PY1A 2QHNA 3ENMA 4OTQA 5AM6A 2P33A 3L8VA 2OH0E 4ARKA 4U0IA 5M44A 3O7LB 3QRIA 1HOWA 2EUFB 2X4FA 2P4IA 2OXXA 4DEHA 4CG9A 3GCPA 2ITQA 4NZWB 3LCOA 4DINA 1KSWA 1FOTA 1XHAA 2WQMA 5EI6A 3EN9A 2F9GA 5AUZA 4B8MA 4ZY6A 2Z60A 1RDQE 5HTIA 3DB6A 3KRJA 5JMSA 3JR1A 2HOGA 4FKSA 4AZVA 4BICA 2XIYA 3HLLA 4CLJA 1LUFA 3FMJA 5EHLA 4DFLA 4YP8A 3VBVA 3SW4A 4BI0A 4BL1A 3LHJA 4YZMA 2PVHA 5CNNA 3UMXA 5J79A 4C3RA 5HQ0A 2W1EA 2VGPA 4J7BA 2WMQA 3K3JA 1U4DA 3D83A 2W9ZB 2Z7QA 3O50A 3PIYA 4PUZA 5M55A 3POZA 4DC2A 5ANJA 3U8WA 3BWFA 4KIOA 2C30A 3AMAA 3QHWA 5C03A 4EOJA 2W4KA 3BBWA 3FZ1A 4AOIA 5FEEA 4U3ZA 3TTJA 5C8NA 3REPA 5LQFA 3DNDA 4AZTA 3SC1A 3EOCA 5HE3A 4QD6A 4BWXA 1G5SA 4JT3A 3L9PA 3FMLA 4DBNA 1Q41A 2ITXA 5GNKA 2NRYA 4O0WA 3ENHA 2F49A 4GFMA 5J5TA 1XH4A 5CS6A 1MUOA 5HNGA 1PMNA 2GDOA 1PMEA 2R3FA 4BI2A 4BZOA 3D2KA 4JX7A 1SNUA 1Z57A 2VTQA 5HE0A 3ZCLA 1M52A 3VAPA 4OBPA 3ROYA 3NSZA 3EFWA 4EYMA 2VTSA 3LM0A 3MDYA 4M0YA 1J91A 2IVVA 2JFMA 4MD8E 5J1VA 4OTRA 1OKWA 1Q99A 1R0EA 5EDRA 3TACA 2WQNA 3NNVA 4C61A 1OVEA 2X7GA 3HVCA 2ONLC 4U44A 5AX9A 3QU0A 1B38A 4E4LA 4JVGA 5BUIA 3E93A 2I6LA 2QKRA 3QTQA 4C8BA 4EUTA 2DQ7X 5CVFA 2C5YA 3KULA 2NPQA 4ALVA 4CZUA 5I9VA 3A7HA 3AT3A 4FR4A 3WE4A 4HCTA 4B7TA 4F9AA 3IK3A 4CFVA 4YUQA 1MRUA 5DG5A 4KBAA 1F0QA 3SG9A 2HY81 1CTPE 2C69A 2ZB1A 2XM9A 4RVMA 3ALOA 4CV9A 1RJBA 5HBHA 1LR4A 4KA3A 5IA3A 3F2NA 4X7QA 2QLQA 2AC3A 4FMQA 2WMTA 2CKOA 4G2FA 4K9YA 4BDJA 5B2LA 4WSYA 4R1VA 2R5TA 4I23A 2UZWE 5ETCA 2QR7A 5I9WA 2BDJA 4CRSA 4GL9A 4WNKA 5KBRA 2GS7A 3NRMA 2W5BA 4ZSLA 2ZMDA 3TKUA 3U6HA 4M13A 4BN1A 2PWLA 5JGBA 5DR9A 5E8UA 3G6HA 3RINA 3S3IA 4RJ8A 3KMMA 3UC3A 3AD5A 4J96A 3VWAA 1PYEA 3HMOA 1VYZA 3WF6A 4Z7HA 1WVYA 4ANMA 2VTHA 3QZGA 3I81A 4NH1A 2CCHA 2PVRA 2PMOX 5TF9A 3V5LA 5CSHA 1Y57A 3WZUA 5IDPA 3MV5A 3CD3A 4XCUA 1P5EA 2UUEA 4LG4A 2JAMA 3OP5A 4DEBA 2ZJWA 4XG6A 3BHVA 5M06A 4F1MA 1TVOA 3AMBA 1WBOA 2CMWA 5E92A 4QP7A 4Y8DA 4WOVA 4NW6A 1PKDA 2XRWA 3NYNA 2UZLA 2V0DA 2PUPA 2UVZA 4FICA 5DGZA 3RAWA 3ATTA 3H0YA 2ZV2A 3QKLA 4EZ5A 4C33A 5CEKA 4UYAA 1V0OA 2ITZA 4ITJA 5HO6A 3VVHA 4E4NA 2CGUA 2YABA 2R3HA 4Z9LA 2X8EA 1GNGA 4ZK5A 4EZ3A 3AT2A 4L46A 2DWBA 3ORTA 3Q9ZA 3OXTA 4R3PA 3EFKA 3HA8A 4Y72A 3RMFA 1O6LA 3R21A 4YJOA 2VWXA 4FTRA 3KY2A 3KFAA 3N51A 4OTFA 4NKAA 4CFXA 4D0XA 4WKQA 2YJRA 4V04A 1OGUA 4MHAA 4WNMA 3FKOA 4E6QA 5EYCA 2XUUA 5AP4A 3DK7A 2BZHB 5J95A 3C4ZA 4EZ7A 2XK6A 3DGKA 1J7UA 4O7LA 3G2FA 4O6LA 1ZOGA 3GUBA 3PPKA 4O83A 3TJDA 5AIRA 4AN9A 3QFVA 5IQFA 2JKOA 2PVLA 3PXYA 5IMXA 5IH6A 2IVTA 5AP1A 2ITWA 2R0IA 4IX4A 4XG4A 3VBYA 3FLWA 3N4VA 1OBGA 4RLLA 5HCYA 3WE8A 4YTCA 4ZTHA 2VAGA 3PWDA 5JFWA 2Z02A 3ZSIA 3EFLA 4Q5HA 5CASA 3HGKA 2FO0A 2PHKA 2B53A 2X2LA 3AC5A 3O7LD 4RJ4A 2OKRA 3FLYA 2Y6OA 3PJ2A 1OMWA 2UVXA 3CC6A 4ORKA 4CGAA 1WMKA 1IRKA 1Q8UA 5HVYA 3HAVA 4FEQA 2W1ZA 3R7VA 3CKXA 3VULA 3LW0A 4F1OA 1SNXA 2QOIA 5BX0A 2X0GA 4MXOA 4CZTA 4G3FA 3A8WA 1H1QA 3P4KA 3MH0A 3PSDA 5BUEA 3G9NA 4PPAA 3LXKA 4FV5A 3VBQA 5LVNA 3GOPA 4RMZA 4D4YA 4ANLA 4AT4A 5EKNA 3BHHA 4NW5A 3D5XA 4IDVA 3IS5A 5H9BA 2BMCA 4IADA 5JQ8A 3NGAA 1OL6A 3R8PA 2W1HA 3V5TA 5CF6A 3BQCA 2JGZA 4HCUA 3WF9A 5A14A 3KRLA 3GU6A 3KU2A 4USDA 1LEZA 4NIFA 4OT6A 2GFCA 3D4QA 4K0YA 2YZLA 4KKGA 3IW7A 4ZP5A 2IN6A 4XP3A 4MX9A 4F0IA 4AAAA 3HUBA 3PFQA 3OC1A 4IWPA 5J87A 1VR2A 1UNGA 2W05A 3R1YA 5I9ZA 3QYWA 2GQRA 2OBJA 3O23A 2UZNA 4QPSA 4BCJA 4FZ7A 3ZO4A 5IEXA 4MWIA 2YIRA 4QOXA 3ORXA 3P23A 4RX9A 4F08A 2R3NA 4ACDA 4OTIA 5C4KA 3TI1A 3NS9A 3D7ZA 3KULB 4BCMA 5JKGA 4O7YA 4U81A 3KRWA 4CKIA 3BE9A 3SV0A 4KRDA 4YJQA 2IJMA 2REIA 1Y91A 3PE1A 4CSVA 4WG5A 2VWVA 5KKRC 2WHBA 3O96A 4M68A 4APCA 4FT9A 1H07A 2YWPA 4ZLZA 3WBLA 3NZ0A 3MFRA 4O7SA 2Y4IC 4Y73A 4L45A 3KKVA 3PVWA 4MBLA 3CQWA 5A54A 2A2AA 2PSQA 1UU3A 4RVKA 2FH9A 2JKQA 1UNLA 1BI8A 3MA6A 1XBCA 1OL5A 2WU6A 2EU9A 4FIFA 3PZEA 2CLXA 3LFDA 2RFNA 3QWKA 3QTIA 1BYGA 1YXSA 3U4UA 4IAZA 3GU7A 2OJGA 2GQSA 1OL2A 3WI6A 5M57A 5LMBA 2R3MA 3L8PA 4U43A 2ONLA 1YHWA 4AA0A 3FMMA 1OM1A 3GC8A 1SVGA 3WYXA 5C9CA 5TOZA 3FC2A 3P08A 4LYNA 2XK9A 1XH7A 4G6NA 3LFAA 2CSNA 2X6EA 3KXHA 4PTGA 3R9DA 1OKVA 1W0XC 3MS9A 1PJKA 4LGGA 4M8TA 4WO5A 4FV7A 5FP6A 4ID7A 4DAWA 4EH6A 5CAUA 3D2IA 4DG2E 4YMJA 3CD8A 3NW5A 2WMRA 3ODZX 4MK0A 4RJ3A 4PNKA 1G8SA 2C5XA 3PJCA 4MCVA 3A62A 5IQIA 2J6MA 4UMUA 4GKHA 2UVYA 3ETAA 3HV3A 4BKJA 1P4FA 3QCQA 2I0YA 3C4CA 5LCJA 5D11A 1TQMA 4IMYA 5JFXA 3TNWA 5HO7A 3C4EA 3OCSA 5EH0A 1PMVA 3SXFA 3MYGA 1NVQA 2BPMA 2QQ7A 3BU6A 3LZBA 3NW7A 3VS0A 3DKOA 4CRLA 3O0GA 1ND4A 3RK9A 1CMKE 2IW9A 5LVPA 2GPHA 3A7GA 4EHEA 3QQKA 4FX3A 5BYYA 4DGLC 5AEPA 4GS6A 3FEGA 2YHVA 2YLEA 4EJ7A 5IA0A 2WTKB 4WSQA 3BZ3A 3UIUA 3T8OA 2R3IA 1SVHA 3E5AA 4JBVA 4GEOA 4CQGA 3MVJA 4DLJA 4TWCA 2OIDA 4BCQA 5HU3A 3QC4A 3RCJA 2VWBA 5AR5A 4PL4A 4F9YA 3CSVA 4V0GA 4U7ZA 3FKLA 5HX6A 3DLSA 4CMUA 5HD4A 2UW6A 3VUDA 3KRXA 2PVMA 2YACA 4GFGA 2OJJA 4HVSA 4HVDA 5A4LA 4F9WA 2UZDA 5JQ5A 1YI4A 4IHPA 4YHTA 4PDSA 1DS5A 5E8ZA 2SRCA 4NFMA 2BHHA 2RSVA 4FGRA 3QQHA 4BBEA 2QD9A 2OFVA 4LRKA 1ZOHA 3O8UA 4IX5A 2Z7LA 5LOHA 3ULIA 5IQHA 4RX5A 2W5AA 4F6WA 2OXYA 3LQ5A 2KTYA 5AUTA 5JT2A 3V51A 4MVFA 4YGAA 4RA4A 1ZYSA 2BIYA 3OVVA 4O21A 5GJFA 4ZSAA 1P4OA 2WTIA 4IZYA 3R7GA 4WG4A 1PW2A 1ZMVA 3FE3A 3G0FA 4XX9A 3RHXA 1LEWA 3BLRA 3FYJX 3VN9A 3LJ0A 1DAYA
chains in the Genus database with same CATH superfamily
3NDMA 4J99A 2E9PA 5L2SA 3F9NA 5ANIA 4TWPA 2VUWA 5E4HA 4EORA 4DHZA 4DG0E 1CKIA 3MI9A 4K11A 2B9HA 5CEPA 3TWJA 4L7FA 1OPKA 4QYYA 3WZJA 4FZFB 2RFEA 4BI1A 3FLZA 3HL7A 3QTXA 4L6QA 4XP2A 3L9MA 2PL0A 4A9YA 4EK3A 1JWHA 3FLNC 5JRSA 5HU9A 3QRKA 3WIKA 4QMSA 2X9EA 2W0JA 1PXOA 4S32A 3WYYA 4FT0A 1Y6BA 3D9VA 4EH4A 2VTMA 4IZ5A 3MPTA 3EN5A 4DEIA 5TR6A 5C27A 4K2RA 2RG5A 3RPOA 5DR2A 3SKCA 3UP2A 5BVEA 3QALE 5JGDA 1EH4A 1JBPE 4GYIA 2YM3A 3RHKA 5I3RA 1W7HA 4O2ZA 4BBFA 3QRUA 4KIQA 5AUXA 2H9VA 4FNZA 3VW6A 3PUPA 2HZ0A 4BDCA 3VJNA 4C59A 2IW8A 5L4QA 2XS0A 3PXKA 4JG7A 2JD5A 3VS1A 3ZM4A 1URCA 2QKWB 3MVMA 4MBIA 3S95A 3K54A 4P90A 3MY1A 4W4YA 2J4ZA 4QP2A 3QCXA 5HCZA 5I4NA 2HZ4A 4G16A 5I5ZA 2UW5A 4M7IA 3DJ6A 3TDVA 4GRBA 5G6VA 4S33A 2J0MB 2VO7A 4GK2A 4C58A 5IUGA 4FTIA 1REKA 1PY5A 3W2PA 2VNWA 3GI3A 2ZV9A 3OOMA 1XKKA 2UZBA 3QQJA 5L8LA 2BRHA 2XJ0A 3PRIA 3HRBA 3EB0A 3FC1X 4KAOA 1CKJA 3OCTA 2QOQA 3H3CA 2BALA 1XR1A 2HXLA 2E9NA 1H0WA 2J0LA 2VX3A 3BGQA 4FT7A 5CSXA 3ZUVA 4RWLA 3EL8A 1H1PA 2JFLA 3U87A 3PJ1A 3ZRLA 4ENXA 1G3NA 4QYGA 5AA8A 3W0QA 3R8UA 3AD4A 3GGFA 4AZEA 1FVTA 3MY5A 2EXCX 3GCVA 3H9RA 4KBCA 3GC7A 4HVGA 3UVQA 3ORNA 3MWUA 4ASXA 3DJ7A 1QPEA 1UVRA 3R9NA 5AP0A 1YKRA 4O0UA 4PDOA 3W18A 3A7FA 3R1SA 1KOAA 3HA6A 5L8JA 5BMMA 3SOCA 5FDXA 2WEVA 4FTQA 5HVKA 2XKFA 3UG1A 4X2FA 1MRYA 3KN6A 4JQ8A 4D2PA 2O65A 5DRDA 2PVYA 2WOUA 2Y9QA 5HORA 3QTRA 4ANBA 3Q4TA 4ASDA 1YQJA 2B9JA 4CFUA 4EH5A 4L52A 4EWHA 3ET7A 1NW1A 3AKKA 5AM7A 4UY9A 4WT6A 3F66A 2RFSA 4FTTA 4ZSEA 4LOOA 4DF3A 1H26A 3ERKA 4UV0A 3PJ8A 4AG8A 4WRGA 4EBWA 2WIPA 2JEDA 5LMKC 4WNPA 2XIXA 1Q5KA 3E88A 4J8NA 2QOCA 5AP6A 4ZJJA 2FB8A 4EK6A 1SVEA 1OKZA 3P7CA 4XV2A 4PMSA 4V0GB 3R04A 1GZNA 3MB6A 5D12A 3NAXA 2X8DA 2QOHA 3IG7A 4G3EA 4ZSGA 4L8MA 4RFYA 2QG7A 4P4CA 4YPSA 1BI7A 3ROCA 3IOKA 4AN2A 4R7IA 3MGYA 3R8LA 2IZRA 5IQAA 3Q5ZA 3F3TA 4RFZA 2ZV8A 3SAYA 1W84A 2X8IA 3UOJA 1NVSA 3F3UA 3QTSA 3TV7A 2YCQA 3AQVA 1L3RE 4XG8A 3OUNB 3QA8A 2P0CA 4KSPA 4AXAA 1NA7A 2R64A 5M4CA 3D5UA 3FY0A 4AZSA 5D10A 2R3GA 5AV4A 3DBDA 4EJNA 3GB2A 5IA5A 3GENA 3W0NA 3PPZA 4BTJA 5ANOA 1JSVA 4O0YA 1TZDA 2RKUA 2F7ZE 5KMMA 3UPZA 4QYHA 4YJTA 3BLHA 4BDDA 2QODA 5HOAA 2G2FA 4FKVA 3DDQA 1OITA 4IAKA 4TYEA 4FOCA 4QEBA 1MRVA 4CYIA 3ZLWA 3OBGA 2J51A 3I6WA 5EM7A 4FC0A 2YZAA 4C2WA 3AKJA 1YWVA 5CAOA 1ZWSA 3FZRA 3LFEA 4HNIA 4MXXA 3PXQA 2VWWA 3R1NA 3TUCA 5M4UA 1HCLA 3R28A 3BYSA 2W7XA 3G51A 1AQ1A 4RQVA 1A48A 4FKJA 2YIXA 4KINA 5JFVA 2IZSA 3Q3BA 4L3JA 4NTSA 4BZDA 4ZLOA 1IAHA 3ZSHA 3HEGA 3QL8A 3OY1A 4BKYA 4EH8A 3LXPA 1JKLA 4XG9A 1FGIA 4K33A 4A06A 5D1JA 5C8KA 2IO6A 2VV9A 2OJ9A 5B0XA 3W8QA 4L00A 3G6GA 4FE2A 4F1TA 5EYDA 3L8XA 4AGWA 1IASA 4TTHB 3H0ZA 5K9IA 1VLRA 2Q83A 1W83A 5F1ZA 3FMNA 3Q6UA 3QRTA 2KULA 4FI1A 4TYJA 1B39A 5LMAA 5CU6A 4ZY5A 3DA6A 3FZTA 2X0PA 2XH5A 3I79A 3LFQA 3UIMA 4A9RA 2J90A 2Y7JA 1XQZA 3EQCA 3KCKA 3LOKA 5HLNA 3H9FA 3WF5A 3R7OA 3MB7A 4IB3A 2YIQA 2JLDA 1M17A 4DFYA 4USFA 2UZOA 3MFUA 4IBMA 4D2TA 1FGKA 2OI4X 5DIAA 1J3HA 2G2HA 5A46A 3CJFA 4K77A 2BKKA 4NWMA 4TNDA 4Y46A 5FEQA 3NVMB 4QTEA 1UNHA 3ANRA 3O8TA 4G3DA 4U42A 5AWMA 2PZRA 4DN5A 3W0OA 2EB2A 3LCSA 4HGLA 2P3GX 5E8WA 5CVGA 4FK6A 5J1WA 4QP1A 2X81A 3GFEA 2YERA 4PPBA 1ZYJA 3NCZA 2H8HA 3IDBA 3ZRKA 3NMUF 1MP8A 3BQRA 4RRVA 2WQOA 3W16A 5TE0A 5BMSA 4CKRA 4WBOA 5GZ8A 5FTQA 4O27B 1XO2B 2XIZA 3OTVA 4EH3A 5L2IA 3A7IA 3COKA 5HG7A 2C0IA 3UVPA 3PLSA 3PJ3A 5ANKA 1YW2A 3ZEPA 2QOFA 2HWOA 3HUCA 4UXQA 3CJGA 5D41A 4BDGA 1FMKA 3DBQA 5I9UA 5FXQA 4CT1A 1ZAOA 3CEKA 5KKRB 1REJA 4DHFA 3LXNA 2QOOA 4FV8A 5CI6A 1VZOA 2F2UA 2VTIA 3GFWA 3QHRA 2Y4IB 4HYIA 4XV3A 3FSFA 5IUIA 2ACXA 3E8DA 1ZOEA 3LE6A 1HCKA 1SMHA 4ENYA 5KE0A 2WKMA 4NFNA 4QP9A 3SGCA 3R8ZA 3FZPA 1RE8A 2XZSA 4YJUA 3W33A 1H24A 2OG8A 1NXKA 3B2WA 4GV1A 2QNJA 2I0EA 3NYVA 4L9IA 4CEGA 5IEVA 3KEXA 2IZTA 3ZC5A 3DKFA 3FQSA 3D0EA 5CY3A 3UP7A 1LP4A 4MAOA 1UKIA 4AGDA 2BRGA 3HV6A 4NK9A 4EYJA 5CALA 3Q53A 3R7YA 4QTCA 4F6UA 2ETRA 4P5ZA 5CYIA 5ICPA 3HECA 4G9CA 3QTZA 2B1PA 3UOHA 3F7ZA 5HEZA 5G1XA 2ITPA 4TYHA 4BZNA 4EH2A 3VIDA 1YOJA 4CMTA 3GQIA 3POOA 4IB1A 3HMPA 4YBJA 5L6OA 2W1DA 2NYAA 5BNJA 3UODA 4D4RA 2HZNA 4K6ZA 4LUEA 2Q0NA 3BHTA 3SOAA 3V5PA 4FG9A 3UMWA 2GNHA 3ZDUA 1OPLA 5DHJA 1OBDA 2IVUA 4JG8A 5DT4A 3IO7A 5AR8A 3V01A 2GNFA 1P14A 2XNGA 4CKJA 3PA3A 3QXPA 3N4UA 4M15A 3BLQA 2OW3A 2UW7A 2J0IA 3QQGA 5AIKA 4ZLYA 3UNJA 1Q61A 4OTWA 1J7LA 4E20A 4D2VA 4YC6A 4JG6A 4GUEA 4B0GA 4EOLA 4F9BA 3BKBA 5CU0A 3NR9A 3CGFA 3W2RA 3VUGA 2CPKE 2CGWA 2UZTA 3DDPA 4EHZA 2FSLX 3DTWA 3R2BA 1KV2A 5FQDC 1H0VA 4IVDA 3V04A 5LMKA 3FL4A 1L8TA 3VBWA 5LVMA 5LARA 4DTBA 1GZKA 3R00A 3CE3A 3SLSA 1UV5A 4F7SA 3IW8A 3DV3A 3F5XA 3WILA 5EM5A 5DMZA 2C6LA 3MFTA 3NEWA 4FTOA 1H01A 2VWIA 3CY3A 5EDPA 4M84A 4ASZA 4KABA 2P2HA 4JI9A 3ZMMA 3CBLA 1NT2A 5KMJA 3CIKA 2OXDA 4GT5A 5LCKA 4CVAA 1YOMA 5CVHA 2A0CX 4WHZA 3PY0A 1YDTE 5KZIA 4R3CA 3B2TA 5CQWA 4B9DA 3PP0A 4RJ6A 1FINA 4IE9A 2ETMA 4YTFA 4QPMA 1URWA 4HOKA 4C7TA 2FYSA 4XG2A 4IZ7A 2PMIA 3R63A 3DAEA 3TIZA 2ETKA 4KIKA 3QD3A 3I1AA 4LL5A 3TNPC 4TXCA 4I5PA 4QMTA 2PMNX 3R73A 4CV8A 4Z3VA 5HBJA 4LMNA 3NUXA 3TZ8A 4JS8A 5IKWA 3ZS5A 4I0TA 5FLFA 4BC6A 3FWQA 3KB7A 3PRFA 3K5UA 2WMBA 3D5VA 5EK7A 4QMNA 3ALNA 4KKHA 2WIHA 3M11A 2J9MA 1G8AA 2ZM3A 5J7HA 4O7NA 4KIPA 2ITTA 4JNWA 4L3LA 4CG8A 5AAEA 3KC3A 3HDNA 3EQPA 2J0JA 5HNBA 4I21A 1YXUA 2PUUA 3KVWA 4IVBA 5A4EA 3ELJA 5ETAA 3GU5A 2XARA 4KS8A 1JPAA 2B9FA 4IAAA 4FYOA 2VTTA 4M12A 5AR7A 1H1RA 2VWUA 4C36A 4RWKA 4EOKA 2QU5A 4BFMA 2X2KA 2CGXA 2XYUA 3A61A 3COHA 2A27A 4H36A 1BLXA 4Y83A 2AEGA 4NEUA 4QDEA 4DDGA 4GJ2A 4GMYA 5ANEA 3VF9A 1XH5A 4IFGA 4N6ZA 1BL6A 3PA5A 3Q96A 3C5UA 1F5QA 2BRNA 2ERZE 1YVJA 3DOGA 2W1IA 4QMVA 5HE2A 2BRMA 1DI8A 5CWZA 3ZOSA 5CAPA 3CXWA 2YAAA 4BDIA 2JDRA 3FMKA 4O4DA 2BTSA 3EN4A 3PXZA 3O71A 2X4ZA 4JR7A 3FL5A 2YLFA 2XCHA 4KKEA 4DH7A 3QLGA 3ZM9A 3RWQA 1O6KA 2PZIA 2XIRA 3ZU7A 2JBPA 4I93A 4AOJA 1KV1A 3Q4UA 4I1ZA 3S0OA 2OK1A 1OPJA 4YJSA 4DFZE 3IDPA 4OAUC 1ZMWA 4E7WA 3UZTA 2OO8X 4QQJA 3WF7A 4FV3A 4YURA 1KE8A 3OXZA 4K1BA 3OD6X 4WBBB 5AUVA 2BAJA 3BHUA 4GU9A 3OHTA 1NY3A 3E87A 3W8LA 4WIHA 3P78A 4L42A 2LAVA 4PTEA 2X0QA 4KNBA 2VN9A 3UNKA 4TY1A 3VHEA 2QO2A 2BUJA 4RIXA 3U9NA 1UU8A 4EI4A 5HCXA 4EOPA 4FKTA 3QX4A 4A9TA 4BDEA 3HRFA 4DEEA 4F70A 5I9YA 2YM4A 4RZWA 4O4EA 5K0KA 4JAIA 5CU4A 3EQGA 4FA2A 3HNGA 2FA2A 2BDWA 4I4FA 4LFIA 3E7VA 4MKCA 5JEBA 3LQ3A 3NLBA 4S31A 5DR6A 2XNOA 4TYHB 4YR8A 4BIEA 1PXMA 2BFXA 3C51A 4XYFA 5BVOA 1XMMA 5M07A 3C4WA 1Q8YA 1M7QA 2BAQA 2J5FA 4O4FA 4XH6A 2GNGA 5E8YA 3VUHA 5A4QA 3K3IA 4Y85A 2R2PA 4IC7A 4M66A 4BKZA 3FJQE 5GJDA 3Q52A 2PYWA 2PE2A 4KB8A 4WRSA 2CLQA 4ITIA 4X2GA 3RI1A 5KO1A 1GY3A 3MW1A 2XBJA 5M09A 3ZZEA 2BR1A 5D7VA 4E6CA 3HZTA 1Y8GA 4FK3A 4I6HA 4AW2A 4ZZMA 3G90X 5TO8A 5C8MA 4BDBA 2OH4A 3GNIB 3KQ7A 3P79A 3R7IA 3Q60A 4JXFA 3TKHA 4FNXA 4G34A 3TUBA 4WNOA 1R78A 1KE6A 3DAKA 4LUDA 1WBWA 3F5PA 3NIZA 3GU8A 4R3RA 5L2QA 4C4FA 4BCNA 3OW3A 3QTUA 2OZAB 3FI3A 1O6YA 3NYXA 4ONAA 3R0TA 4FKRA 4J95A 4LV5A 3FI4A 4PMTA 3F5GA 5CSWA 4NSTA 3V8TA 4AXEA 4HVIA 3TKIA 4DYMA 5AFVA 4GKIA 3SDJA 3WIGA 5EW3A 3UBDA 3NX8A 4B6LA 4FIEA 2PULA 4GIHA 3QYZA 1I44A 1V0BA 4NM3A 1OI9A 3BRBA 1ST0A 2J50A 4BCGA 3TTIA 3WOWA 2YDJA 2C47A 4IB5A 4HZSA 1GOLA 1OZ1A 5EW9A 4BIBA 2C6EA 5IQGA 4AFJA 4X2JA 4UWCA 3W10A 2G2IA 2OIBA 3R30A 4KIKB 4PMMA 4XRJA 4ZMEA 3PTGA 5EM6A 3UZPA 3QF9A 5CI7A 3QBNA 3C5IA 4GUBA 5CU2A 4JIKA 3ZLXA 3O51A 3NVKI 4FL2A 3F88A 5IISA 3AXWA 4UMTA 4H39A 4OLIA 3F2AA 3G9LX 2HWPA 4BVUA 5GJGA 5KZ0A 3RCDA 3ZBXA 3QCSA 4DLIA 2QO7A 1V0PA 3RAHA 5CF8A 4M69A 3BL9A 2HK5A 3QD0A 5CZIA 2R0UA 1IG1A 3EQRA 4H1MA 2GMXA 2I7QA 2XANA 2R3PA 4F63A 3EJ1A 5FM3A 3TJCA 3BGPA 2W1FA 3FMHA 3OS3A 5CLPA 3ZDIA 4FOBA 4EK8A 5JN2A 3CCNA 4YSMA 4ACHA 3EZRA 3AMYA 3H9OA 1KWPA 3PE2A 2GNJA 4R7BA 3ZUUA 5TKDA 5JRQA 4D55A 4Z16A 2B9IA 1FVRA 2NP8A 4MEDA 5FXSA 5HGIA 5ANDA 3TNHA 2YDKA 1F3MC 3LMGA 5CSVA 3AOXA 3MJ1A 3OOGA 2XK3A 4MNFA 5M08A 2H34A 2C68A 5C01A 4RJ7A 4JL9A 3LM5A 4K8AA 4ACGA 5M4FA 3HAMA 1TQPA 2PK9A 2I0VA 4IANA 5HICA 3KRRA 4EWQA 4O86A 1V1KA 4Z7GA 4UALA 4E4MA 2UV2A 1H08A 3RALA 2OZOA 4KRCA 3PIXA 5E91A 5FRIA 3ZHPC 4OGRA 3I5NA 1QPCA 5AR2A 4FJVA 4BDHA 1KOBA 4UN0C 4I0RA 4NKSA 4QMLA 4TWOA 4C3FA 2B55A 2PUNA 3C0GA 3NUAA 4PDYA 1ZZLA 3I5ZA 4HGSA 4D4SA 2V7OA 5JK3A 2ITVA 1AGWA 5J9YA 4GK3A 3HV7A 2XNMA 2OGVA 4WUAA 4DDIA 3UQGA 3V8SA 3G15A 4QP3A 4D58A 4O81A 2C4GA 4YTIA 4FT3A 3DXNA 4CFNA 1YHVA 1U54B 3HYHA 4FTJA 3GQLA 3OT3A 3HMIA 4RIXB 5AR4A 4AP7A 4FIGA 1DAWA 3UOKA 4R7HA 3CY2A 4BGQA 1WBVA 3KN5A 4EHGA 1OIQA 2C0TA 4ALWA 3HV5A 1M2QA 3V6SA 3JVRA 3ZO2A 4KS7A 4C0TA 2C6KA 5IA1A 4RBLA 3U51A 4BGGA 5L3AA 4I22A 4L68A 5AP3A 4GIIA 2W99B 4U3YA 5HG5A 4O38A 2C1AA 4E3CA 4IM0A 2XVDA 2FSTX 4JLCA 2CJMA 5BYLA 2ITNA 5F94A 3Q4CA 4GVAA 4KUJA 3PIZA 1T46A 4I94A 4P2KA 5CANA 3W2CA 4EUUA 3NUYA 4E5BA 1J7IA 2UZUE 4AZWA 4XG3A 1WVWA 2P2IA 2YM5A 2UZEA 4HNFA 1FPUA 1ZYLA 1R39A 2C3LA 1ZLTA 2GNLA 2F7EE 4AE9A 4PRJA 1VJYA 4AOTA 4EK5A 4RG0A 5BVDA 5K4JA 3EZVA 2QU6A 4U9AA 5CSPA 3EYHA 1G8JA 4FSWA 4OW8A 3OW4A 5DVRA 3G5DA 3QQLA 4YC8A 3VHKA 4YJNA 3FZOA 3G33A 3VNTA 3E7OA 2Y6MA 1BUHA 4ZAUA 4OT5A 2XKEA 5LWNA 5L6WL 3HKOA 4D1SA 4C2VA 2RG6A 3TV6A 2RL5A 4QYEA 3JPVA 3SHEA 4FKPA 4AN3A 4DFUA 1E9HA 1XWSA 4FKOA 2C6TA 4JIAA 3SVVA 2B54A 3GVUA 3Q32A 4ANOA 4DGMA 5EQYA 5HO8A 2VWYA 2W4OA 2WXVA 3BX5A 4JDIA 4QMWA 1OIUA 3OTUA 3VRZA 1PRYA 3R7UA 4LRJA 3I4BA 4EQUA 1UA2A 2WMAA 3NFFB 3PXFA 4AW0A 4IAIA 4IZAA 2H96A 3MFSA 2O64A 4FZDB 4BCIA 3OWPA 3EQHA 2BCJA 4N6YA 4I24A 2XRUA 4RX8A 4MXCA 2OU7A 3KXXA 1GZ8A 2X6DA 4FL1A 3TEIA 5E8SA 4S34A 3W1FA 1WBSA 2PZYA 3LCTA 4IH8A 4DFNA 1IA8A 3RGFA 1A06A 3LAUA 1MQBA 3QD2B 2O63A 4AFEA 5DLSA 4C4JA 4RT7A 3ZO1A 4N57A 5GINE 1QMZA 4G6OA 4RFMA 5EDQA 2QURA 4OBQA 3C7QA 4AA4A 3LJ2A 2IW6A 2V22A 4YTHA 1H25A 2VRXA 3P9JA 3VRYA 3OBJA 4JMQA 3E92A 3ORLA 4RSSA 4IAFA 4ZTQA 1R1WA 2HZIA 4BTMA 4F65A 5IA4A 3R22A 2C6IA 4I92A 5DT3A 3V5JA 2I40A 4AACA 4ANSA 4FZ6A 3BL7A 5CF5A 3VS7A 3ZO3A 3KVXA 3PSCA 1W2FA 4R6VA 2VO3A 4UMRA 3C0HA 1JOWB 1W8CA 4M69B 4DEDA 2WB8A 3DFCB 3NCGA 5FGKA 2RFDA 3QKMA 2WMSA 2BILB 4O0SA 4K18A 3T9TA 5KMOA 4BR3A 3AKLA 1Q3WA 3UOLA 4PDPA 3TCPA 2E9VA 1ZY5A 2BFYA 4O1OA 1GZOA 3W2OA 3U6JA 3FXWA 5HIDA 4MF0A 5DEWA 3GEQA 3OG7A 3DZQA 1Z9XA 4QMPA 5E1SA 3TNQB 3IKAA 2OF2A 4BF2A 1UWJA 3BBTB 3NPCA 5CX9A 3LFBA 3FQHA 4G3GA 3PSBA 3KREA 4GJ3A 4NCTC 3NUNA 4D1ZA 4NUSA 4UYNA 4FIHA 4QQCA 3DNEA 4AX8A 4MNEA 2YEXA 4J8MA 4ALUA 4AU8A 2XNBA 4PNIA 2R7IA 1K3AA 2XNPA 4FSTA 4MQ1A 1Z5MA 3PP1A 4LL0A 4QQ5A 2C5OA 3RNYA 5M56A 5KMLA 4FF8A 4Y5HA 3PZHA 4ANQA 1BKXA 3I7BA 4FV1A 3OF0A 3FAAA 4JBQA 2WGJA 4FV2A 4YZDA 3VO3A 4NU1A 2C3KA 2HY0A 2W4JA 4OR5A 2XKCA 4I4EA 2VTNA 3CQUA 4M97A 3GCUA 4XV9A 3VUKA 1UKHA 2X1NA 4YZBA 4HW7A 4EKKA 3HV4A 3MTLA 3I0OA 3JXWA 3OUKA 4RWJA 4ASEA 5CXZA 2PY3A 4XEYA 3QQUA 5DFPA 5CTPA 4CQEA 4F7LA 5AV1A 2GSFA 1YRPA 2W96B 1XH6A 4JRVA 5EFQA 3UO4A 2VX0A 3THBA 4DEGA 4XS2A 2PE1A 2Y4PA 3C4FA 1Y8YA 4G31A 4FKWA 3RK5A 4DGGA 4YJVA 5AJQA 4J97A 4LM5A 4BTFA 5HIBA 4EOMA 3IW4A 4ACMA 1E1XA 1K2PA 5HNIX 3BV2A 4GFOA 4FSNA 4I5MA 2A98A 3QD4A 4ANNA 5EYKA 3ZXZA 4FVRA 1GIJA 3FUPA 5HIEA 2YN8A 5BVKA 4RC3A 3GCSA 4E93A 2WEIA 2OIQA 4FV6A 4NT4A 4CCUA 4DEAA 4NL0A 3PY3A 4FGBA 4I6BA 2VO6A 1DI9A 1WAKA 5JZJA 3NNXA 3EQBA 5I9XA 5K4IA 1SZMA 4QRCA 3W55A 2QI8A 4X0MA 4NYEA 2Q0BA 2WOTA 3AGLA 4BHZA 3D94A 4OTPA 1PXLA 4QP4A 5FBNC 3LJ1A 3IGOA 1PMUA 3P0MA 5HI2A 3ZH8A 2WTJA 3UPXA 3ZLYA 5KHXA 3ATSA 4J53A 4L3PA 4FEWA 4FKLA 4D4VA 2ZVAA 2V7AA 2E9UA 3IW6A 5KCVA 4XLIA 4CFFA 3FI8A 3MH1A 4IEBA 5FDPA 2VTAA 5TT7A 4A4LA 1H28A 3F3ZA 3DLZA 3FYKX 4IM3A 4EOOA 4JX3A 5EW8A 3I7CA 2OFUA 2XJ1A 4I41A 3UGCA 4E5WA 5HZNA 3E8CA 5B2KA 5L2TA 3LFFA 2WMVA 1VYWA 3F82A 2R4BA 2XEYA 4YC3A 3F69A 4DFBA 1JAMA 4O84A 5HESA 5L6PA 4E4XA 5IPJA 3DKGA 1DM2A 2XK7A 4ZS0A 4GU6A 2WO6A 5GZ9A 3UDZA 3FPQA 1IAJA 3DT1A 4AF3A 5AP7A 3BCEA 1OIYA 2F2CB 5DEYA 4MD7E 3UG2A 4F99A 4AS0A 2PZ5A 3A60A 5AAFA 3Q2MA 3VS5A 3EHAA 4CFWA 3KIOC 3SD0A 5KMNA 1YDRE 4O82A 2NNWB 4UMPA 3CGOA 2IVSA 4DBXA 2JC6A 5DWRA 4AW5A 2WMWA 2B7AA 1RW8A 5M4IA 3OEFX 2FSMX 3AD6A 4OAVB 3CTJA 4O7VA 5KBQA 4HVHA 4JAJA 5AV0A 4FTNA 4F0FA 1M14A 3CPCA 3P86A 4O0RA 3GXLA 2X7FA 2I0HA 5A6NA 2DUVA 1CM8A 2PVFA 3BYVA 4BDKA 2R3KA 3T3VA 4DH3A 3LFSA 3RPSA 2LGCA 2GTNA 4V05A 4GT3A 4W9XA 5AX3A 3V5WA 1M2RA 2HENA 1U46A 4FSZA 4U45A 3ACJA 5FBOA 4ZXTA 4RIWB 3RNIA 2VGOA 2BZJA 3JUHA 2I1MA 4TT7A 4CZYB 5GZAA 1H1WA 3R8MA 3KMUA 1GJOA 4RWIA 4RC2A 1H27A 2HELA 2WMXA 2XP2A 4H1JA 3F7WA 4Q2AA 5H3QA 1LPUA 4IDTA 4YBKA 5B7VA 4FNYA 5HTBA 1B6CB 4LRMA 2QOBA 4JBOA 5AUWA 4GH2A 3F3VA 2VTJA 4FKQA 5D7AA 3FMEA 4JDKA 5DT0A 3NIEA 4JDHA 4PF4A 4CCBA 3E63A 4O96A 4TPTA 3VQUA 2GHMA 4D28A 3P5JC 3R02A 2JDOA 4QMMA 3TT0A 2E9OA 3ULZA 1CKPA 4FNWA 3EFJA 4IW0A 3RM6A 5BPYA 2HYYA 3KK9A 3NYOA 3O8PA 3HMMA 1YHSA 2XNNA 2Z7RA 3EN7A 3FXXA 4MNEB 2ZAZA 5J9LA 4U5JA 4WD5A 3DU8A 3FI2A 3U4WA 3M42A 5F95A 2GFSA 4JBPA 4NM7A 4C37A 2X39A 3FLQA 3G0EA 4O4CA 5F9EA 1PXKA 1O9UA 3A7JA 3ZUTA 4AGUA 4KD1A 2BHEA 2O0UA 3QLFA 5C4LA 3SG8A 4F4PA 4W8EA 1WBPA 2CN8A 3VQHA 4C4HA 3BPRA 3ZBFA 3R01A 5JZNA 5CU3A 2WZJA 1Q4LA 2VWZA 1JKSA 4TYGA 3EQDA 3R7EA 5GIPE 3JVSA 4MXAA 5AP5A 4QPAA 4CTCA 5E1EA 4DGNA 5EQEA 5T6KA 4CD0A 3EKNA 3BELA 4GSBA 4UWBA 4GT4A 3ORMA 5CEMA 5C1QB 3UO5A 4DT9A 2PTKA 1W2DA 3ORZA 3UDBA 2ITOA 5E8XA 3KGAA 5FWKK 2CKQA 2BVAA 4NCTA 4HGTA 3UIBA 4FIIA 3EN6A 3LCDA 3PG3A 3RTPA 3VONA 5EHOA 3FHIA 4GYGA 2XM8A 3TMOA 3GC9A 4GG5A 5IDNA 3ZFMA 4BIDA 2ZMCA 4BY9E 4Q5EA 3FXZA 5E90A 2WQEA 2OZAA 4ZOGA 3TG1A 4R8QA 5FTGA 2C1BA 3D5WA 5DI1A 3D15A 3Q9XA 4QMXA 4MTAA 4UB7A 1WBNA 3RZBA 3ZTXA 2YFXA 2CNVA 3UQCA 3ZFXA 3SXSA 2IWIA 3V8WA 3E64A 4IXPA 3QUPA 2HW6A 4ZTMA 4N0SA 1U59A 4CTBA 4FL3A 1OL1A 1XH8A 4N70A 5BVFA 5CF4A 2BKZA 4M14A 4FTUA 5AADA 2F57A 2JBOA 3Q9WA 3LVPA 2R3LA 3P7BA 4YLKA 4EC8A 3LMHA 1IR3A 3LXLA 4FV4A 4IVCA 2Z2WA 3DS6A