1XJDA

Crystal structure of pkc-theta complexed with staurosporine at 2a resolution
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
Knots found
sequence length
320
structure length
280
Chain Sequence
IEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNFCGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRWLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPQNMFRNFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein kinase C, theta type
publication title Catalytic domain crystal structure of protein kinase C-theta (PKCtheta)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 280
sequence length 320
other databases KnotProt 2.0: S -31
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2004-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1xjdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1xjdA01
2C6MA 2BRMA 3DXNA 4RGJA 3SG8A 2RFNA 5CT7A 4C33A 5AUVA 2WMRA 3Q9ZA 3LE6A 2X8EA 5DA3A 4I23A 3SVVA 3JS2A 4BCKA 2I0HA 4UZHA 4R7BA 4WSYA 4WG4A 4WNPA 4YZCA 1H26A 2HY81 2XCHA 4C35A 4O7YA 2YABA 1JSUA 3BU3A 5TOZA 4BBFA 3F69A 2PVMA 2VU3A 2X4FA 3FLQA 3OWJA 5HU9A 4F7NA 5HG8A 1CSNA 1VEBA 4GJ3A 4C37A 2WTKB 3MS9A 2F4JA 2QU5A 4RJ5A 4R1VA 3GCPA 4PV0A 1QMZA 4DEHA 3U51A 2YA9A 3LFQA 2ITNA 4LL0A 3FKLA 5IZFA 3R7OA 4D0WA 3RWPA 5B2KA 3FZPA 2W1GA 3QA8A 3MSSA 1WBVA 1Y91A 4FT0A 5E91A 3VQUA 4EHZA 3FYKX 3IG7A 3JVSA 2Y6MA 4G31A 4MKCA 5CF8A 4C3RA 2GS7A 5KHWA 2XNMA 3NNXA 4EONA 2QODA 3QKKA 3N4UA 1Q41A 5H8GA 3MVHA 3MY5A 2UZUE 2ZJWA 4XMOA 5JMSA 1WBOA 3VS4A 4TL0A 1XH6A 3D7TA 1B6CB 3R0TA 3S1HA 3GQIA 3MN3A 3NR9A 2G2HA 1OPKA 2XK4A 3O96A 4F9WA 1FGIA 4J7BA 5BNJA 1QPCA 4IMYA 3HAVA 3EQIA 4FUXA 3QWKA 1VJYA 3DGKA 1W0XC 3ZM9A 3R71A 4F99A 2B9HA 5I3OA 4UBAA 3EWHA 5D9HA 3G33A 3ZLYA 1E1XA 3AD5A 4H3QA 4RT7A 3UIUA 2JIIA 4Y72A 3A2CA 1Q97A 4IB3A 4HVDA 3JVRA 3PP0A 1YWNA 4KA3A 2YLFA 3PRIA 3POZA 2XIRA 2ZB1A 3NAYA 4BCQA 2R3QA 3AQVA 4QMYA 1U5QA 4LYNA 2OJGA 2W17A 2G9XA 2J90A 2R3KA 4FTLA 4L7FA 4AWIA 2VTQA 2GHLA 4ZSGA 4RJ6A 4ENXA 2FYSA 3UC3A 1YOLA 4E20A 2JAMA 5ANGA 4BB4A 3R7UA 4XCUA 3DAEA 4G6LA 5DR9A 3TG1A 3C5IA 1PXIA 3Q4CA 2Z7LA 2O65A 2XK6A 3LFNA 4ZMEA 4M66A 2WIPA 3I79A 1KE7A 3DBCA 4O0WA 4O6EA 4QNYA 4AG8A 2C6TA 4DCEA 4CKIA 5J9YA 4DH3A 3TNQB 2QOCA 3SW4A 3FE3A 2IW8A 1YDRE 2E9UA 4YHFA 4HYSA 2VO0A 4O84A 1ZYJA 4DTBA 3GB2A 4I4EA 2EVAA 4FTKA 4PRJA 3P9JA 4HZSA 1OKVA 4U43A 4ITHA 1Q5KA 5DEWA 3U4WA 4O7TA 1OPJA 4XG8A 3TKHA 3ZCLA 3ZUTA 2VD5A 3IW5A 4C4HA 1CM8A 2VGPA 2IPXA 4DA5A 1J1BA 2YDKA 3TNHA 2Z02A 3JXWA 1LEZA 3QTZA 3HMIA 5BYLA 5ANEA 2JC6A 4WSQA 4X2FA 3MB6A 3TT0A 1OM1A 4AE6A 5LARA 3F2RA 3DB6A 2UZVA 2VX1A 4DFYA 4HOKA 3G6HA 4BGGA 3QBNA 3HP5A 4X21A 4PDYA 4G9CA 3QX4A 4I24A 4M84A 1U59A 5HIEA 3Q60A 4APPA 2NNWB 3KC3A 3OTVA 2QD9A 4FR4A 4XG2A 3PSBA 5HVYA 1UKIA 3VBQA 1Z57A 4J98A 3H9RA 2VTTA 5DWRA 3ZXTA 5KX8A 3BLRA 2X8IA 1ZOHA 3RK7A 3QQFA 4RBLA 3UIXA 3C4XA 4DCAA 2VO7A 3DKFA 3NWWA 1REKA 3R21A 3QHRA 3OWKA 5CF4A 3JY9A 3DV3A 4Z7GA 5HX6A 3D4QA 4K8AA 2CN5A 4IC7A 4IWQA 3DDQA 4YO4A 4CZUA 4DGLC 1LUFA 1YQJA 4I22A 4U97A 4DTAA 3G6GA 4FOCA 2VUWA 5FBOA 5T68A 4IVBA 4NK9A 2HZIA 4QTBA 3I6WA 2IZUA 3PXRA 4QP6A 3EZRA 3OY3A 4X2GA 3UQGA 4MBIA 2VTJA 3FKOA 1BX6A 5AP1A 5JGAA 1YOJA 2GMXA 2C4GA 4DHFA 5L3AA 3LVPA 5L2WA 4IZAA 3S0OA 2FVDA 3KF4A 3QQJA 4BI1A 3V8WA 5LWMA 4CG8A 2VRXA 5AA9A 3R9RA 4FGRA 1LP4A 4M8TA 3F5UA 3F3VA 3Q9YA 3KXNA 4UB7A 5A4LA 3RNYA 2WTVA 3DQXA 4J1RA 2IZSA 2X7FA 3MA6A 3N4VA 3F9NA 5EDRA 4F08A 3TTJA 5HLWA 5A6OA 2Y0AA 5HO7A 3NNWA 4L00A 5CWZA 5A6NA 5CU0A 2WKMA 1MUOA 3AC8A 3SXRA 4FTCA 2Z2WA 2ZV7A 4HVHA 1P4OA 4BDJA 4TWPA 3IK3A 3O51A 2EUFB 3BI6A 3ZHPC 3E3PA 3VRZA 3ZRLA 2Z7QA 1YKRA 4OR5A 3HEGA 1TKIA 2CSNA 5EW8A 4ZJVA 1V0PA 1ZY5A 3LCSA 3MGYA 3OVVA 4FTJA 3GUBA 4K2RA 4QD6A 2GHGA 2B7AA 5HX8A 4USDA 5EI6A 3FI4A 3FLNC 3F3ZA 4A9UA 3SX9A 5KBRA 2QG7A 5IQIA 1O9UA 2NRUA 5CF5A 4D1SA 1AGWA 5LXMA 4I5HA 3LFEA 2PVJA 4JDKA 5HBHA 5JEBA 4NU1A 5H8EA 3M11A 5TT7A 3RALA 3LM0A 4E26A 4RWJA 1IRKA 4GYIA 5HLNA 2IO6A 5KHXA 5I9UA 3SOAA 2R64A 2VWIA 2W4KA 3CY2A 3DB8A 3NDMA 5EHYA 3IW8A 3AOXA 4IAIA 3L9LA 4PTGA 5F20A 3OCSA 4D2SA 1B39A 2B55A 2QC6A 4BDIA 1JQHA 5AJQA 4DEBA 3TUBA 2C0OA 4FKTA 1W7HA 4I93A 3W1FA 5LVNA 1OITA 4YGAA 1GJOA 1MRVA 4ANOA 3RPYA 2XNEA 3C50A 2PULA 4ORKA 3DTCA 4EBVA 4FV3A 3DJ6A 4F1MA 4PL5A 3LOKA 2GSFA 1V0OA 5EQYA 4I1ZA 3NNUA 3GT8A 4ZSLA 3R63A 4FSUA 4G6NA 3QCQA 1AD5A 4HYIA 5IQEA 2CN8A 3Q53A 3MVLA 5T6KA 5ETIA 4ANSA 1PXLA 3HV3A 3MFSA 5M51A 3BRBA 1R78A 3CJGA 4IJ9A 3L8XA 4O1OA 1SVHA 5EI8A 4F1OA 4BY9E 4FT9A 3I60A 5HNIX 3POOA 3BE2A 5CEMA 1ERKA 4OLIA 4X3FA 4CQGA 1SNXA 3TZ9A 2XUUA 2GPHA 3GQLA 4ARKA 1DAYA 1H1QA 4E8AA 4ERWA 4I6FA 3ZO4A 5IQFA 3KXMA 3PXYA 3HMMA 5AR4A 5J79A 2W7XA 2F9GA 1OIYA 1H1RA 2I6LA 2X8DA 4CV9A 1ND4A 4HCVA 3F82A 4EH4A 4FICA 1K3AA 5JQ8A 1L3RE 5CNOA 3AMYA 5IQCA 3BCEA 4EEVA 3GEQA 2XK9A 1R0PA 3RPSA 4BDCA 4BYJA 3W2SA 3QU0A 3K54A 4FKOA 1V1KA 4C4GA 2VX0A 4DEDA 1KE6A 2X6EA 5M56A 1Q4LA 3DZOA 3I1AA 3SQQA 5HBEA 2W5AA 4NTSA 3FSFA 4EUTA 1DM2A 2Z7RA 4NW6A 3C4ZA 2DS1A 3HMOA 5JH6A 1U54B 4W9WA 4YJOA 5EHOA 3E62A 3DFAA 4BCFA 1GZKA 3AC4A 3GGFA 3OBJA 4UWBA 1BI7A 3LXLA 4OBQA 1ZZ2A 5FTOA 5LOHA 2OLCA 4G1WA 3ZFMA 3W2PA 4YMJA 2XF0A 2GNIA 4MXXA 4IZYA 2YITA 3ET7A 4FGBA 1FVTA 3VF9A 2ITWA 4X6RA 5CENA 3FZTA 4RWIA 3KK9A 2UZBA 2ZM3A 4KIPA 4C59A 4AW1A 3NUAA 3BHVA 3CIKA 2HAKA 2WEIA 2GDOA 3RZFA 4GH2A 3FPQA 3SAYA 5FWKK 3GFWA 2QLUA 4OTDA 5JT2A 4S33A 1OL7A 2OO8X 3E8CA 4JX3A 3V04A 4B8LA 4MHAA 1JAMA 5F95A 1JKLA 2VNWA 4EOKA 3QUPA 3ZYAA 3A62A 4UWYA 4D4RA 4EOPA 3LMGA 3FLZA 1OL5A 2ERZE 2HYYA 3ZLXA 4WRGA 3QQHA 5J9ZA 3N51A 3COMA 1X8BA 1I44A 1MRYA 2RGPA 4LGHA 4AGDA 3KULA 4FV6A 3FZ1A 4IVCA 3VNTA 4ZS4A 3IDBA 4CZYB 5GJGA 4IZ7A 4YBKA 4JNWA 2VTOA 4YC3A 4CYIA 2XIXA 4DFZE 5L6OA 2ETMA 4WO5A 5M4UA 2YM8A 4AUAA 3I7CA 3R01A 4FL3A 4L01A 4FIGA 3VVHA 2VTAA 3QCSA 4FT7A 3K3JA 3CQWA 3NPCA 2ERKA 5BVFA 3A4OX 2WOTA 3R28A 4ZTLA 2WB8A 4AA5A 5DG5A 2B1PA 2XM8A 2W5HA 1OKWA 4RA5A 4MXOA 4U8ZA 3PE2A 2FB8A 4QPSA 4C4FA 5A54A 5K9IA 4F9CA 1UNHA 4KS8A 5KMKA 2C3IB 2O3PA 3FMHA 3KXGA 2EWAA 2O2UA 5HE1A 5BVNA 3BGQA 4TNBA 3WZDA 4FEUA 2RSVA 3U8WA 4D1ZA 1L8TA 3EN4A 1WVWA 5CLPA 4O82A 1M17A 2OW3A 4FSMA 5AV2A 3NUYA 2BRHA 4CT1A 2C68A 4U41A 4BI2A 3D83A 3UO6A 4RIWA 5F1ZA 4FV4A 3FPMA 3SXSA 2WMTA 4HYHA 2C5YA 1MQBA 1Y6BA 5EM6A 4NT4A 3HMPA 4HGEA 5KUPA 2C3KA 3EZVA 2J51A 2VTIA 2ZB0A 4GIHA 4J71A 4M7IA 4TN6A 5A46A 5AR2A 1NY3A 5HIDA 3BWJA 1NA7A 2CPKE 3CD8A 2H8HA 2OGVA 5E8XA 4O96A 5AUXA 5GZ9A 1YHVA 3PE1A 4JI9A 4YLJA 3H30A 3PXFA 3FBVA 4ALUA 3EIDA 3ZM4A 4BHNA 5IU2A 1ZWSA 2CLXA 2R3NA 3G0FA 3O17A 4W4VA 5L8KA 5HTBA 4Q5EA 4FKPA 4PDPA 1OUYA 2YIRA 4USFA 3NVMB 4BFMA 4I92A 4JBVA 2W1DA 2YIXA 4XLIA 3R9NA 3VJOA 1APME 1SZMA 2XNNA 3UYTA 4FV9A 4ZLYA 4KUJA 3BHUA 2BVAA 2DWBA 3TACA 1IA9A 4IZ5A 3V5QA 5TKDA 4TY1A 4YNEA 4A06A 3QFVA 4DGGA 4KIKA 2B4SB 4PL3A 4CLIA 4Z3VA 4RWLA 4BTJA 3PPKA 4IXPA 4TZRA 4AGCA 1YDSE 2C6IA 4DLJA 3KMUA 5ACBC 2HY0A 2H34A 2OU7A 4ZEGA 3ZO2A 3ORLA 1PY5A 4D2WA 3K3IA 3GU7A 4J97A 4TYJA 4QTEA 2GS6A 3V01A 4N0SA 5IA4A 3BYUA 3JUHA 2PHKA 2QOBA 2W05A 1IASA 2R2PA 3Q3BA 2VTSA 3WOWA 4D5KA 5AAEA 3TZ7A 4ZTSA 2UW7A 3LCKA 4IWPA 1H00A 3OEZA 4HGLA 3QD2B 5GIPE 4MXAA 5AIKA 5CS6A 3IQ7A 4CGAA 4RQKA 2UW8A 4HCUA 4GYGA 5AR3A 4FIHA 1H1PA 3FDNA 4GEOA 3E3BX 3MH3A 4MCVA 4O0RA 4NCTC 3QTSA 4WNOA 4ANNA 4DH7A 1CMKE 2XA4A 3M42A 4UMQA 3LMHA 3NUNA 2W9FB 4IW0A 2UVXA 4YJNA 3TUDA 4BIDA 4QMPA 1ZMWA 5C8KA 2H96A 2RFSA 1ZAOA 2HELA 5EG3A 1ZY4A 3FZOA 4X2KA 3UJGA 4M69B 4CV8A 3DK6A 5ANIA 3CSVA 3N4TA 4FL1A 3PSCA 2WIHA 4YP8A 5H3QA 5LCKA 2PZ5A 3W55A 4EK4A 3HAMA 3MW1A 4DFNA 1OL6A 3ZBFA 5IF1A 1H07A 4TKSA 5HHWA 2OG8A 1Q99A 5AAFA 3ZEPA 1TQMA 3CKWA 3OW4A 4CLJA 3PLAE 4QP8A 4ZZMA 4EH8A 4GKIA 2XIYA 5DGZA 3SRVB 1ZYDA 5DI1A 5E8YA 3GU6A 2A27A 2EB2A 3NZ0A 3PSDA 3R73A 1Z9XA 4E6QA 1WBSA 3C9WA 4PPCA 4RQVA 4BZOA 5J7BA 1NT2A 5AV3A 2CNUA 4BDKA 5LCJA 3QGYA 2ITXA 2R3FA 3NCZA 4TWCA 3ZSIA 5HE2A 3MH1A 4AZFA 2OZAA 4BDAA 3MBLA 3HLLA 4KINA 2X2LA 2V55A 2QHMA 2I0VA 3FMLA 3KFAA 4PTEA 4WHZA 4RJ8A 5HESA 2VWZA 3EFWA 3KXXA 1Y8GA 3RGFA 3S4QA 4FNZA 5DT4A 4D1XA 3DAKA 1M14A 2OIBA 3VC4A 5I9WA 2BIKB 4YC8A 4XRJA 4RX7A 2C6DA 4ALWA 4ASZA 3H4JA 3GVUA 4TYEA 2QI8A 2QURA 3CGOA 3Q6WA 2C3JA 5DT0A 5KMNA 3CC6A 4K33A 5D12A 3ENMA 5EKOA 4C3FA 4CD0A 4CMOA 4DEEA 3QTWA 4EOSA 4CRSA 4JDJA 5CI7A 2WEVA 3P7CA 3MPAA 2CKEA 2V22A 2W99B 3UP7A 3FV8A 3E5AA 1MQ4A 3LJ2A 4ACDA 4FC0A 5CEIA 3U87A 4UX9A 2JAVA 4YSJA 5KNJA 4QOXA 4FNYA 5IUIA 4ZJIA 4QMMA 3UG1A 1NW1A 2W5BA 2BRGA 3VS0A 3DOGA 2WU7A 5IQHA 1PYEA 3VUIA 4ZLZA 5A4TA 4KABA 3LXPA 1DI9A 2QO2A 4CFUA 3GOKA 4QPAA 3VHKA 3CE3A 4DH5A 3VUKA 2PZYA 4XRLA 5EH0A 4AW5A 4QYGA 4BZDA 3KEXA 4EYMA 2WMXA 2W1FA 1WFCA 2E9PA 3DCVA 3VS1A 3BHTA 3DFCB 3F6XA 5CT0A 4LOQA 4BDFA 4DH1A 2F57A 2J5EA 2C69A 4HGSA 2BFXA 4FK6A 4D4VA 4XG6A 1JKTA 3GCUA 3OCTA 3RPOA 5LMAA 5IH4A 3NVKI 4YTIA 4MNEB 3NYVA 2ZDUA 5DIAA 2E9NA 5ANOA 4R78A 2ONLA 4RLLA 3ZLWA 2IZRA 3NW5A 3QUDA 4M15A 1MP8A 4AP7A 3UOKA 2E9VA 2HZ0A 4J52A 3ZRMA 2W4JA 4FTUA 4LMNA 3SDJA 4C58A 3C13A 3MV5A 2DYLA 2XEZA 3BE9A 2PSQA 3EFKA 3FXWA 2PVLA 3HECA 2WQBA 4L52A 3REPA 4QMQA 3A4PA 4QYEA 2Y9QA 1PHKA 3LZBA 5GNKA 2ZAZA 1H25A 4RIYB 4EH3A 5JZNA 4F65A 3SHEA 3BGPA 2BZKB 5L2SA 5HORA 1ZRZA 4IB0A 1H1SA 3HX4A 5HEZA 3D2IA 4E4MA 4EC8A 2PZIA 4GV1A 3SC1A 4DLIA 3TNIA 3R9HA 2XIKA 5DRBA 3FL4A 3UPXA 4U45A 2C6KA 4I6BA 5C1QB 3FQHA 5EOBA 3CEKA 5FEEA 1GAGA 2J5FA 4AT3A 2AC3A 3KRRA 4WG5A 5AR8A 3B8QA 4K18A 3PG3A 4FSNA 3UBDA 4FV7A 5HTCA 2P2HA 4YLKA 5GIOE 3PPZA 2BTSA 5EQPA 3G9LX 3R8UA 3RI1A 3CLYA 3QCXA 4XEYA 2ETKA 4YC6A 5CNNA 2FUMA 2O64A 4QQCA 4QQ5A 4C62A 4DG0E 4FYOA 3VBXA 1OB3A 1FPUA 1M52A 1IEPA 3RM6A 1NVRA 4YJPA 3UMXA 4XBRA 5BYZA 3G5DA 4CT2A 3MTFA 3E64A 3TEIA 1QCFA 3PY1A 2C5XA 2GNFA 3ZSHA 3LKMA 4KD1A 3FZSA 5E8WA 5TO8A 3PIXA 3IW4A 4G5PA 2OFVA 4NL0A 3R30A 1W83A 1XHAA 4GL9A 3IOKA 3GXLA 3HUCA 4NZWB 2JKOA 4Y5HA 4GU6A 3ZO1A 4CCUA 3QD0A 4QMNA 2HENA 1Q62A 1YVJA 5CU2A 3TXOA 3MH2A 4QMOA 1H1WA 1GIIA 3R7EA 4FEWA 1W98A 5J1WA 5CASA 4RPVA 3E7OA 3KK8A 2X39A 3GU8A 4O27B 4C3PA 2PMOX 1OMWA 5KBQA 3BIZA 3DLZA 1FVVA 3VS6A 2RIOA 1R3CA 4RFYA 3TIZA 2XM9A 1FVRA 3V5JA 3ORZA 3EL7A 3LFBA 1CKPA 5DBXA 3G15A 5KMLA 2O0UA 3MY0A 3GI3A 3AMAA 4L9IA 4FV0A 4OBPA 2A2AA 3EHAA 4PQNA 3R04A 4EK3A 5IEXA 4JQ8A 3K2LA 4JQ7A 4FKJA 4CMTA 3F7ZA 4XYFA 3MDYA 3WF9A 4E5WA 3UOHA 5BUEA 3VW6A 4JAIA 2YZLA 3RTPA 4LI5A 2G15A 4TYIA 4FTTA 1H8FA 4BCHA 2B9IA 3Q52A 3QZGA 3D5UA 3I0OA 4IJPA 4MQ1A 4R1YA 3IONA 2PE1A 2WTIA 3E7VA 4JG8A 1S9IA 4R77A 1H01A 3UP2A 3QZIA 3EQGA 5EYCA 3KRWA 5EW9A 1JVPP 2WMUA 3V8TA 3SKCA 2IVUA 2OH4A 2HWPA 3OP5A 5M09A 4CFVA 5DH3A 4B4LA 3OBGA 2C47A 3UIBA 3G51A 3PFQA 5IG1A 1P2AA 3I81A 5FTGA 2YZAA 2V0DA 2ZV8A 4FYNA 4FG7A 4BBEA 4QYFA 4F7SA 1P5EA 2ITZA 4C61A 2Z60A 2B0QA 2IVSA 2LGCA 3LXKA 2GFCA 5ANKA 3FMEA 4OTGA 4B6LA 2P55A 2WMQA 4YJVA 4FV5A 1OIRA 3LQ8A 5ANJA 2QCSA 5DVRA 5LMKA 4OW8A 2FGIA 4X2NA 3LFCA 1WVXA 2J9MA 4PMMA 3FAAA 3MPTA 4U79A 3O8UA 3DY7A 4QP4A 3PZHA 5C8NA 2BR1A 3PJ3A 1Y57A 4A9RA 5GJDA 2GQSA 3FUPA 1SYKA 4GRBA 2VO3A 2GFSA 2RL5A 3UDBA 1OBDA 4ACHA 4C34A 4U0IA 4BI0A 3EQDA 4K9YA 3TKIA 3ZLSA 2NPQA 4I5MA 1F3MC 4J53A 1YWRA 3T9TA 3L1SA 1H0WA 1G8SA 4BWXA 4PY1A 2IJMA 4HVSA 2GCDA 4JXFA 5DRDA 4S31A 4GVAA 3NYNA 3QQKA 2VTHA 2OKRA 4B8MA 3RKBA 5IA1A 2O63A 2PZRA 2V7AA 1YHSA 2ZV9A 3ETAA 4BCMA 4J95A 4MH7A 2X9FA 1YOMA 5HLPA 4HPTE 4J96A 3I5NA 4I94A 3ZOSA 3OHTA 1BL7A 5HCYA 3TM0A 3IKAA 5LVLA 2EXEA 2CKOA 3HVCA 2R3MA 4YZNA 3EQRA 3HNGA 4E6DA 2VNYA 4P4CA 3CPCA 1U4DA 3FKNA 1ZOGA 4JX7A 4RMZA 5IDNA 3FZRA 1MRUA 2FSOX 2WGJA 1M7QA 1OIQA 3FXXA 1UWHA 5AX3A 3FLYA 3PVBA 4NM5A 4PF4A 4FZAB 4WUNA 2E2BA 4JS8A 4YJRA 3UZPA 2JIUA 2QOFA 1XBAA 4GFOA 1A48A 2YM4A 4CSVA 4DT8A 4BKYA 2YISA 3GP0A 5IDPA 3S00A 3R1QA 4DEIA 3EQCA 5JZJA 3G2FA 5L8LA 4QYYA 4WBOA 2UZNA 4MQ2A 4RWKA 5JFXA 5FP6A 3O50A 3NRMA 4IDTA 3OG7A 4W8DA 3TJDA 1XO2B 4FT3A 4G3GA 4ZZNA 5IISA 4FTQA 4BF2A 1ZYSA 4QMTA 4YTHA 5HBJA 3HGKA 4U44A 3RK5A 2PUPA 5DOSA 3A61A 2QO9A 2PVFA 3ORXA 4YZDA 4UYAA 4LOPA 4MAOA 3GC8A 4RLKA 4V04A 4CXAA 1ATPE 1K2PA 4E3CA 1IR3A 2PVHA 5CEQA 4LUDA 5IA3A 2FO0A 3OFMA 2G2FA 3H9FA 3R1YA 3AC5A 3C1XA 3DNDA 4QQTA 4KNBA 2Q83A 3QRIA 3KRLA 5DFPA 3OOGA 3WI6A 1JKSA 2QQ7A 3SD0A 4AU8A 3T9IA 5AUTA 2VWUA 2WQEA 4APCA 3PZEA 5GHVA 3QD3A 3G90X 4FKLA 4E4NA 5A14A 1TQIA 2OICA 3FHRA 4Q2AA 3TV7A 3TNWA 5B2LA 4O7NA 2YAKA 2BHEA 3ZMMA 4MBJA 4FV2A 4QP7A 2XJ0A 2CGVA 3H3CA 2P33A 3QRJA 4L46A 3GOPA 4EHVA 4PP7A 2OBJA 5M06A 5CYIA 3FMDA 4FT5A 1SNUA 3LCOA 3ZONA 5K0XA 3Q6UA 3QALE 2OH0E 3RM7A 3EMGA 4C2VA 4Q9ZA 4CKJA 5IUHA 4O7ZA 3Q5IA 2YIQA 2B9FA 4J8MA 3LHJA 4TPTA 5DR2A 1FGKA 2RFDA 4A7CA 4YJTA 3NCGA 4K77A 4QTAA 3R8MA 4BDEA 3GC0A 3BBWA 3DU8A 4MVFA 3ZUVA 4NWMA 1YRPA 5AMNA 3MYGA 1JBPE 2BFYA 4FZDB 4RFMA 5IMEA 2QVSE 3ANQA 4Q5HA 1M2RA 5G1XA 4MD8E 3F5XA 4BGQA 3ZC5A 3QTUA 4LOOA 2R7IA 2YHVA 1O6LA 5E8VA 5I4NA 2OF4A 2VN9A 4V0GB 1QL6A 1R1WA 2NO3A 3CP9A 3HV4A 3JYAA 3ZRKA 1YXXA 3C0GA 4O86A 1REJA 3DKCA 5E9EA 2PU8A 3E93A 5FEDA 2Y4IC 5GINE 2CHLA 3UC4A 3EN9A 3R83A 1BLXA 4C4EA 2HXQA 2QOQA 2WQNA 2Y8OA 1Z5MA 4QTDA 5I9ZA 2PZPA 4U5JA 2A19B 5CZHA 3EKNA 4OT6A 1URCA 3BPRA 2WMWA 2QU6A 2JD5A 4OBOA 2VZ6A 3AC3A 3GENA 2HOGA 4Y83A 3HV7A 5EYMA 3ALNA 4CFFA 2R0UA 4MD7E 4U40A 3W2OA 3OXZA 2WPAA 4W4XA 5CZIA 3UYSA 1GIJA 1F0QA 5CSWA 2YJSA 5AM7A 4PDSA 4WG3A 3H10A 4JG6A 4EOQA 1G3NA 1BUHA 5KKRC 3BLQA 3RAHA 4GU9A 3RVGA 5KZIA 4CEGA 4ERKA 4NM3A 4IIRA 4RSSA 5KO1A 4DFUA 3RAIA 3Q5ZA 3LJ0A 3M2WA 4GUEA 5BVEA 2YIYA 5IPJA 3UVPA 1UNLA 4CTBA 4F4PA 1GIHA 2X7OA 4RC4A 3Q2MA 4GW8A 4A9TA 1BMKA 4G2FA 4QP3A 4WBBB 4CFXA 4ZTNA 3A7FA 5JGBA 1ZMVA 3ALOA 4M3QA 4EKKA 3V51A 1PKDA 5EQEA 3FSKA 1CTPE 4EWQA 5C8MA 1FOTA 4EJ7A 4RZWA 4IVAA 3UVQA 5L2TA 3PJ2A 2XNBA 4AOIA 3WARA 4BCOA 4LM5A 3D9VA 4G3FA 3R6XA 5E92A 1Q8YA 2P2IA 4O91A 4EC9A 5LVMA 5DE2A 5AP6A 2VWXA 1YI4A 1UU8A 1U54A 4EUUA 2JKQA 1BKXA 2QOLA 4HGTA 3HL7A 4PDOA 3U9NA 3C5UA 1WBPA 2CKPA 2QO7A 5BUIA 3TZ8A 4O0SA 5IA2A 5HE3A 4DBXA 3LXNA 3OWPA 2VTRA 4TTHB 3TV6A 4BTKA 2Q0BA 3Q4UA 1OVEA 5BVOA 5E4HA 5FM2A 4C4IA 5FUTA 4ASDA 3MFRA 3QQGA 2XNPA 3EQBA 5AP3A 3P78A 2J7TA 1XH7A 2FSMX 4IE9A 2BDFA 4MYGA 5AADA 5DMZA 4JAJA 3COIA 5DN3A 3VAPA 5FLFA 2REIA 3TDWA 4F6WA 4FIEA 4TYHA 4L8MA 3LFFA 2XJ1A 3C4WA 2XYNA 3GU5A 4CYJA 4F0GA 3JR1A 2YCFA 4N70A 5EM8A 5JN2A 3WZEA 3VS3A 4IAZA 2C6OA 4A4XA 3PRFA 3MIAA 5AA8A 4JL9A 4RVKA 2BZHB 3PP1A 4AZWA 2YAAA 4KBKA 3P5KA 5C26A 3BV2A 5CI6A 1XH9A 4QP1A 4UZDA 3KXHA 3IW7A 4LFIA 4IAAA 5CF6A 2B9JA 2RKUA 3SW7A 5DLSA 4CQEA 3F2AA 4BR3A 3OXIA 4M13A 1WZYA 1STCE 3OWLA 4NW5A 4AGUA 4FSYA 4FKSA 2NP8A 3QLGA 4N4SA 3PJCA 4PTCA 4NM7A 2WTCA 3DAJA 4FKWA 4XV2A 1U5RA 1GZ8A 3PA3A 3RAWA 3DBDA 2YDIA 4QQJA 2ITVA 3GU4A 5EHLA 5AAGA 4DE4A 2G1TA 4BCIA 3SA0A 4XG9A 5BVKA 2BHHA 2WMBA 2PL0A 1S9JA 3NSZA 5A4QA 5HZNA 2X7GA 5C03A 3QQLA 5M4FA 3ORKA 2IWIA 3OXTA 1PXJA 2QR7A 2YCSA 1JOWB 1ZLTA 2JKKA 2J0KA 2OWBA 3BYOA 4HNFA 4I4FA 1G5SA 1PMNA 4QYHA 2XYUA 1PMUA 2PE0A 4IAFA 5BX0A 5IQAA 3V5LA 2CJMA 3QYWA 4FKGA 4G16A 2UW6A 3C4CA 2YM7A 1SM2A 4Y85A 4ALVA 1YXUA 5JFVA 3PG1A 3FY0A 4QMVA 4CFWA 3VO3A 4F6UA 4O7SA 4ZSEA 4FKRA 3D94A 2G2IA 3O71A 3TUCA 3AC2A 3BKBA 4H1JA 3NUSA 4MF1A 4G3EA 2JIVA 3D15A 4X2JA 4G9RA 3ZZWA 4JRVA 4LMUA 3IDCA 3R22A 3A7GA 1W82A 3E88A 3F5PA 5F94A 3VIDA 5E8TA 2XEYA 4BVUA 1BI8A 5LJJA 3PA4A 4O7RA 5AM6A 2HW6A 3TIYA 4TWOA 3UQFA 3QCYA 3U55A 3ZO3A 3Q9WA 4UALA 1Q3DA 3HRBA 4PWNA 3QC9A 3OUNB 1VR2A 3H0ZA 5ETAA 1A9UA 4LQMA 2ZVAA 4F63A 1M2PA 3CJFA 3QRUA 4RIWB 1OKZA 4M14A 4IFGA 2VAGA 3D5VA 1H0VA 2F49A 4E4LA 4GS6A 4ZS0A 1T45A 2QNJA 3C0IA 3U9CA 5I5ZA 3Q04A 2EU9A 4DEGA 3C0HA 4XOYA 3ZH8A 3P4KA 4TRLA 3U6HA 4ZTQA 2X81A 3PXZA 5E1EA 5E8SA 4QO9A 2I7QA 3V8SA 4A9YA 3MI9A 2XS0A 5FG8A 4F9AA 3IW6A 4I6QA 3ZEWA 4JR7A 2W1IA 2P4IA 3LQ3A 3AGLA 3LCDA 4MX9A 5K3YA 3FYJX 3LJ1A 1LPUA 3CCNA 3FQSA 5ETCA 4XX9A 4UV0A 2CGWA 2CGXA 3T3VA 5KMIA 3UTOA 2YWPA 5G6VA 5D7AA 3GCVA 5K0KA 4RIXB 1J7UA 3PWDA 4EORA 4DF3A 3W32A 4UN0C 1O6YA 4FZ6A 4PNIA 1GOLA 4DYMA 4WKQA 4CCBA 4E5AX 2EB3A 3A8WA 1XH8A 4X6QC 4AW0A 4KIKB 3L8VA 1RW8A 3TKUA 3E8NA 4O7WA 3CTQA 5CU3A 3R8ZA 5AUWA 4BIEA 1ZMUA 4NSTA 3E92A 5JFWA 3SOCA 5JSMA 2YCRA 3EYGA 3AT2A 4B99A 2UW0A 1UKHA 2VWYA 4NUSA 3MY1A 3HMNA 2WAJA 2C5VA 4M69A 5E8ZA 2AC5A 4XP2A 1VYZA 2QG5A 2XMYA 3AD4A 3BU6A 4EH9A 4PNKA 2KULA 2ZMDA 3P79A 2HXLA 3OT3A 2W0JA 5HE0A 4DN5A 4PMPA 4ANQA 5IQGA 4FSZA 3QRKA 3QZFA 4HYUA 3VUHA 2HWOA 3SRVA 1KE9A 3PXKA 3R7GA 4BCNA 5H9BA 4H3BA 4GSBA 2JDRA 5ANDA 1OGUA 4J99A 5M44A 4IM0A 4WOVA 1Y8YA 4BDGA 5CEKA 3OMVA 2WTJA 3NLBA 4LGGA 2JLDA 4YPDA 4S34A 4H36A 4AF3A 4ZSAA 2HIWA 5KMJA 3RCJA 4L7SA 2PMNX 3R1SA 1H27A 4JIKA 4E93A 3FI8A 2F2UA 1ZYCA 4E5BA 4ZY4A 4IAKA 4UWCA 1URWA 2ITUA 4EK8A 2JDSA 3DLSA 1XKKA 4F09A 4YUQA 5K5XA 1GZOA 3QX2A 3DJ7A 3O8TA 4PP9A 1OUKA 5E8UA 3QLFA 4U3ZA 3A7JA 2Y4IB 4S30A 2WTDA 4NIFA 5A4CA 4FX3A 4QTCA 5L6PA 5FTQA 3AC1A 4NEUA 2ZV2A 4FNWA 4ITJA 3WYXA 3TCPA 2W1CA 4Y73A 4L3JA 3KMMA 3OEFX 4TWNA 3O7LD 4O22A 3W33A 2Z8CA 2UVYA 3LPBA 3C7QA 3ZFXA 3LFSA 3F66A 5FXQA 2OZAB 2X6DA 5AV1A 2JGZA 4BBMA 1KWPA 2WQOA 4RVTA 3TNPC 5HICA 5C01A 2QKWB 2CNQA 4M12A 3NS9A 4OAUC 4K6ZA 4PX6A 3VWAA 3R1NA 1DAWA 3WF7A 5KKRB 4FK3A 2OJIA 4PMSA 2A0CX 1TVOA 4GUBA 4V01A 4D4YA 4O0XA 4Y8DA 5M53A 4K0YA 1E9HA 5CX9A 4QMLA 4GFGA 3WF8A 4DTKA 3CBLA 3E87A 4YNOA 3GBZA 4Y95A 1KV1A 3RPRA 4XV1A 2W1ZA 4XP0A 3ID6C 3OCGA 4QP9A 4BCGA 3W10A 3BBTB 4D9TA 4NYEA 4L42A 5IQDA 3R02A 4CMUA 5GZ8A 2XBJA 3FQEA 4WUAA 5K5NA 4O38A 3FI2A 3K5UA 2IN6A 2WZJA 1DS5A 3GC9A 1UU9A 1AQ1A 4UY9A 3VHEA 5HKMA 4YJUA 3L9PA 4H3PA 5E1SA 3IS5A 1OI9A 1IA8A 3PUPA 3RWQA 2AUHA 1PRYA 1OL1A 3NMUF 3BX5A 4GK4A 2OK1A 3P1AA 4MNEA 5J5SA 3LM5A 4KIOA 4LRJA 4H1MA 3PVUA 5CVFA 2XRWA 2G01A 4AFEA 3DTWA 4GK3A 2W96B 3ZZEA 3DT1A 4M67A 4O7LA 2X4ZA 5AP4A 3ELJA 3PYYA 4AGWA 4YO6A 4BTFA 3CXWA 1J91A 1HCKA 2ACXA 2YEXA 4BCJA 3D5XA 4I5CA 3PLSA 4K1BA 1VZOA 5DPVA 4A4OA 4P5QA 5L4QA 4KRDA 4S2ZA 3T3UA 3V6SA 3BZ3A 4NTTA 4L3PA 1PMEA 3G9NA 2QONA 5D11A 2Y4PA 2BDJA 3NIEA 3RHXA 1EH4A 4GK2A 5HO8A 4D0XA 4RX9A 5J95A 4R6VA 3UNJA 1PYXA 4I6HA 3TI1A 4ITIA 1OIUA 3OD6X 4R3RA 3W2CA 3DA6A 4EOJA 3HA6A 4FG8A 1KOBA 2V5QA 3D0EA 5FGKA 4TYGA 4FOBA 5HO6A 4AA0A 5DEYA 1QPEA 3AD6A 4BHZA 4EH6A 3ANRA 3O8PA 5EK7A 4BTMA 4IBMA 4V05A 5BYYA 3N9XA 4I0RA 4OTWA 4N57A 4FF8A 4FKUA 5BQ0A 4S32A 1YWVA 2JFMA 3MIYA 4MBLA 1DI8A 4ID7A 4OGRA 3O7LB 3ZC6A 2OJFE 2RG6A 3QUEA 5JKGA 5CSXA 2WMSA 1PXNA 3OZ6A 3WIKA 4DFBA 5HCXA 3B2WA 4AOJA 2J2IB 3NUPA 2C0TA 4HVIA 3DBQA 4ZSJA 3ZDUA 1FMKA 2HZNA 3KVWA 4GMYA 4IDVA 2PVYA 4MWHA 4GFMA 4R7IA 3EKKA 2IW9A 4BWKA 4UMUA 3FWQA 4IWOA 4O81A 5K4IA 1E1VA 3KN5A 3TL8A 1P14A 3V5PA 1W8CA 3E63A 4LG4A 4D58A 4W4YA 4JDIA 1JNKA 4ZLOA 4MXYA 5CAQA 5M57A 3P08A 3LLTA 3Q4TA 3QF9A 3V3VA 2QHNA 4X3FC 3RINA 5GJFA 3UOJA 5FEQA 2UW9A 4LV8A 4QMWA 2BILB 5HNBA 3QTXA 3CQUA 3KA0A 3FC2A 3NEWA 1ZXEA 1NVQA 5IEYA 4IADA 3UO4A 2C5NA 3RJCA 4AZEA 1J1CA 4EOOA 4ONAA 5KE0A 5JGDA 3RHKA 4YHJA 3KN6A 4D28A 4M0YA 5EOLA 1FBNA 1OBGA 5CTPA 4P7EA 2GTMA 4CG9A 3BGZA 4RJ7A 4FVQA 4D5HA 4FKQA 4KSQA 3VBTA 5BUJA 4AZSA 3B2TA 2XKFA 3FY2A 5HTIA 5T3QA 3L8PA 4O21A 5ICPA 3NUUA 1JSVA 3FJQE 4YU2A 3H9OA 4O83A 3BQRA 3QRTA 2GNGA 2R3LA 4Y46A 3DS6A 4GT3A 2J0LA 3R2BA 4L67A 3WIGA 3RK9A 3MVJA 4NKAA 3U6JA 3UIMA 4AX8A 2X2MA 4KIQA 1OL2A 4BN1A 3D7TB 3KY2A 2E9OA 4FTOA 3W2RA 3OUKA 4ASEA 2VTPA 3C51A 1RJBA 2VV9A 4NJDA 3DKGA 2GNJA 4JRNA 5DR6A 4CFNA 4F0IA 4BWPA 2PMLX 3NYOA 4L53A 5EFQA 3ZXZA 4CTCA 2KTYA 2YM3A 2WU6A 5HVJA 5IUGA 2ITPA 1JPAA 5HG7A 4HNIA 2XKCA 2UZEA 4P2KA 2PTKA 3OTUA 4HVGA 2J4ZA 4I5PA 2XNOA 4KSPA 4EKLA 2P3GX 3CD3A 3COHA 3KU2A 4CZTA 2YWVA 5CXHA 2A4LA 2WQMA 3ROYA 1Q3WA 3R8VA 4EOIA 1G8AA 4DINA 2PYWA 4CKRA 3D5WA 1JLUE 3SXFA 4AW2A 4JOAA 2XK8A 1HOWA 1YHWA 3CY3A 4UXLA 4XJ0A 2QLQA 4D4SA 2F7ZE 3R9DA 5BMMA 5FQDC 4Z7HA 4FSWA 3UE4A 4YTCA 2YN8A 3R2YA 3LW0A 5B0XA 5I3RA 4NCTA 4FBXA 4XNEA 4YTFA 3U4UA 2OI4X 2C3LA 3PVGA 5AR7A 4XBUA 3PJ8A 4TW9A 3UNKA 3ATSA 5AUUA 3T8OA 2GNHA 4NM0A 2XZSA 4M0ZA 2WHBA 5CXZA 4KAOA 1PXKA 2PWLA 3HV6A 3QTQA 4GVJA 3VW8A 3FLWA 1F5QA 5AUYA 5LQFA 3GC7A 4GKHA 4B9DA 2IVTA 1OECA 2PY3A 1JKKA 2JDVA 4JBOA 3KXZA 4M97A 4CNHA 5FM3A 2IZTA 4AN9A 4C36A 4DG3E 4FMQA 4E4XA 4GG5A 4IX5A 4AN3A 4USEA 3PIYA 4YLLA 4O7VA 3QYZA 4EHGA 4UMPA 5EKNA 3KQ7A 5CSPA 3ACKA 3HZTA 4H58A 4FV8A 3HKOA 4ANLA 2ZM4A 4U81A 4WNKA 4EQMA 3COKA 2C1AA 4DAWA 5IMXA 3DZQA 2W1HA 4ZP5A 4OTRA 5AP5A 5JRSA 5CAOA 4F0FA 1UU3A 2CDZA 2EXCX 2I0EA 2XK3A 3FMKA 4PUZA 4YBJA 4KS7A 3I4BA 3O23A 2FH9A 4J8NA 1Q8UA 4FVRA 2AYPA 1WBTA 3QTRA 1H28A 4Y5QA 2ITTA 1Y6AA 1GY3A 3BHHA 4MXCA 5CQWA 4AZVA 2WOUA 2BZIB 4YZBA 5M07A 2ZM1A 3D7ZA 3ROCA 2PMIA 4AA4A 3VJNA 4KBAA 5L8JA 3QXPA 3BYSA 4GT5A 4K11A 2XKEA 4TXCA 3U54A 2R7BA 3FI3A 5ITAA 3G0EA 2J6MA 1A06A 1XR1A 2WNTA 3I5ZA 4FIJA 4Z16A 5HD4A 2OJJA 2QOIA 4LV5A 3UZRA 2R3PA 1GZNA 1Q24A 2R3RA 4EQCA 3PIZA 4QMXA 1U46A 3EJ1A 5C4LA 2BKKA 4OTPA 1UU7A 3KRXA 3QQUA 4IX4A 4ANMA 1R39A 4YPSA 5I9XA 3E8EA 3H0YA 3PTGA 4R3PA 4JLCA 5BVWA 3QKMA 2NRYA 5EYKA 3NUXA 3W8QA 3ORMA 1KE8A 3W18A 2UZDA 2R3OA 3FHIA 3W8LA 5BVDA 1KE5A 5M4CA 3ERKA 3KVXA 4IM3A 1NVSA 4CVAA 5M4IA 3DQWA 2UUEA 1LR4A 2QKRA 4FIIA 3S95A 3VS7A 4GG7A 5LVPA 2JFLA 4BKZA 1YXSA 4EH2A 2J50A 1UWJA 3OF0A 3BWFA 5HD7A 3ORTA 4R7HA 5HQ0A 3UQCA 4I41A 2I1MA 2C0IA 2WMVA 2CMWA 3TJCA 3D14A 3EQFA 3FL5A 4JG7A 2XP2A 3A99A 4XHKB 3MH0A 4ZXTA 3ULZA 4E7WA 3PDTA 1FINA 4IH8A 3VBWA 2BDWA 3ENHA 1YXVA 3HP2A 1CKIA 1WCCA 1BL6A 2ITQA 3NYXA 3W2QA 1J7LA 4LL5A 5AV0A 4O1PA 4FL2A 3A7HA 1PMVA 3VBVA 2VWVA 2XKDA 3NIZA 4A9SA 4I0SA 3IPHA 5A3XA 3D2KA 1M7NA 1WVYA 4V0GA 2F7EE 3PXQA 3THBA 4F7JA 3OC1A 1QPJA 2BALA 3UGCA 3UMWA 5L6WL 4MF0A 3BELA 3RMFA 3F3TA 5HGIA 4EZ7A 4D2TA 5IH6A 2GQGA 2Y6OA 3TTIA 2JBPA 1UA2A 4F7LA 1JSTA 2C5OA 2R3IA 3KKVA 4Q9SA 3S2PA 3TZMA 1QPDA 2V7OA 5KCVA 3DBEA 5D41A 5CU4A 4JR3A 2HK5A 4F6SA 4Z55A 5LMKC 3KRJA 4OUCA 4AFJA 4XLVA 3DPKA 5FRIA 3KCFA 2R3JA 1PKGA 4I3ZA 4RJ4A 3ZUUA 3QGWA 3EQHA 3IOPA 4FNXA 4D2PA 1JWHA 3OW3A 3MA3A 4UEUA 5L2QA 3AT3A 5AEPA 4AN2A 2VX3A 4L44A 2XCKA 5IA5A 5IH5A 3BYMA 2OIDA 3QXOA 2WXVA 1YW2A 3A7IA 5J87A 2PUIA 1WBWA 4ZJJA 5CEOA 3HRCA 1O6KA 3ZSGA 3DDPA 1VYWA 4ZK5A 3F3WA 3CTHA 3TN8A 3AT4A 3VS2A 3AG9A 2C30A 4IEBA 3RBWA 4F64A 2XNGA 4QNAA 3NGAA 2GQRA 3HYHA 1Q8WA 2XH5A 5AX9A 3RZBA 3KCKA 4YZMA 3QD4A 2XBAA 4NH1A 5H2UA 4A4LA 1YI6A 4YJSA 3R8LA 2OZOA 4QMUA 4FIFA 3VUDA 2VWBA 5EDPA 2OXDA 5KMMA 1I09A 3RPVA 3BLHA 2R3GA 4D9UA 4BGHA 2BMCA 4X3FB 3O0GA 3F3UA 5EW3A 4BRXA 2DUVA 1ZOEA 3UODA 4JIAA 2UW5A 2JKMA 3JY0A 3R00A 4DEAA 3KREA 3TWJA 5B7VA 5TF9A 1ZYLA 4JT3A 5D7VA 4W8EA 4JBPA 3FMMA 2ITYA 4EZ3A 2DQ7X 1H4LA 1HCLA 2YERA 4BL1A 4EOMA 3P86A 4MD9E 4ZAUA 2R9SA 1IAHA 1K9AA 3DKOA 4BICA 5C4KA 2YDJA 3I7BA 2ZMCA 4WD5A 4A07A 1V0BA 4G3CA 2F2CB 4AS0A 4HW7A 3IO7A 1M2QA 2BAQA 3EN7A 4U80A 2F7XE 1SVGA 4L3LA 5BPYA 4JQEA 4DH8A 2FSLX 4HJOA 3FC1X 3WBLA 3NAXA 3DBFA 1OKYA 3L9NA 4HCTA 3VBYA 3UO5A 4FV1A 2ONLC 4MEDA 4PPAA 4R5SA 4EQUA 5AP7A 2PPQA 2Q0NA 2X0GA 2XK7A 3QWJA 4U42A 4EYJA 4FG9A 4C02A 3CGFA 4IB1A 2YCQA 3L9MA 3I6UA 4ZTRA 4F1TA 1FQ1B 2CGUA 2EXMA 1PW2A 2LAVA 3QC4A 4YURA 3HDMA 3VUMA 2ITOA 2Y7JA 5IKWA 1PXPA 4G17A 2UZTA 2CCHA 3C4FA 3WZKA 4G6OA 4AE9A 5CSVA 4FTRA 2J0JA 3MTLA 4U9AA 5LVOA 2W4OA 4MTAA 3EN6A 3MFTA 3OOMA 3ORIA 5D1JA 4FTNA 2WELA 1XQZA 2ZYBA 4TYHB 4GT4A 4QPMA 4G5JA 2SRCA 2VO6A 3LCTA 3ZDIA 4B0GA 4ACCA 4DFLA 3EN5A 4R8QA 5TE0A 2XB7A 3QKLA 1FMOE 2V62A 1H24A 3R9OA 3ZTXA 4C4JA 4BIBA 5EYDA 3FXZA 2YIWA 3VUGA 2GNLA 3EYHA 5HG5A 2ESMA 2CNVA 2UZOA 4RIOA 3O2MA 5IA0A 4FTMA 4RX8A 2W1EA 3MESA 2JBOA 5A4EA 3KULB 4DITA 4KKGA 4EL9A 2BRBA 4E6AA 5I9VA 4P90A 5F9EA 3EFJA 5LMBA 4XG3A 4KKHA 3ULIA 4IHPA 2YFXA 3UNZA 3V5TA 4NFMA 3QL8A 2O8YA 5JFSA 4UMRA 1WBNA 3ORNA 4IAYA 4D55A 1UVRA 4XG7A 4OAVB 3ZU7A 2ZDTA 2BAJA 4HPUE 4DFXE 2UZWE 2WTKC 4FSRA 4UMTA 4C7TA 4EBWA 2PK9A 2UZLA 4MNFA 4II5A 5JQ5A 2OXXA 4AQCA 2BPMA 1CDKA 4LRMA 4QP2A 4TNDA 4UXQA 3RP9A 2WTWA 5CALA 5H8BA 3LAUA 4DG2E 1RE8A 4PMTA 3CS9A 4IX3A 3DXQA 3KMWA 4QMZA 2OFUA 3HV5A 1T46A 4JJRA 1P4FA 4NFNA 1WMKA 3QA0A 4AXAA 2C1BA 5CU6A 2IVVA 1KUTA 5FXRA 3ATTA 5AFVA 4RA4A 3U6IA 1OZ1A 3ODYX 4GCJA 3HRFA 5C9CA 4E73A 4BDHA 4XV9A 5J7HA 4WT6A 4IC8A 4IWDA 5M08A 2HCKA 3DJ5A 4FEQA 4RG0A 4MWIA 2X9EA 3EB0A 4YJQA 3A60A 2W06A 5HOAA 4RC3A 1PJKA 3UPZA 4ZMFA 3QAME 4OTFA 4L43A 4L68A 4ANBA 3LFDA 4DBNA 3AXWA 3BQCA 4R5YA 5M55A 3MJ2A 2OXYA 2UW4A 4I20A 3V6RA 2RFEA 5AIRA 5F4NA 5HNGA 4EWHA 2YJRA 4DGNA 4ASXA 3KGAA 5I9YA 2ETRA 5EM7A 5JRQA 3NW6A 2C6EA 4F9YA 4WIHA 5AWMA 4D2RA 5K4JA 4OTHA 2CCIA 4RIXA 4AZTA 5FDXA 4I0TA 2PVRA 3LIJA 4L45A 4LRKA 1XH4A 4NKSA 3MVMA 2IW6A 4U7ZA 4XV3A 4FVPA 4N6ZA 3PWYA 3DNEA 4L6QA 3VUTA 3EFLA 5CSHA 4JBQA 3MJ1A 1LEWA 2J0MB 3CTJA 3PA5A 4XG4A 4AACA 2BZJA 5ACKA 4RFZA 5AV4A 2YLEA 5JK3A 1R0EA 3HUBA 5HVKA 1YXTA 5CANA 4JDHA 2JDTA 4OTIA 3IDPA 1BYGA 5AP0A 3SV0A 4O2PA 5FDPA 3SGCA 3TDVA 1TQPA 4ZZOA 3VULA 4NJ3A 4LGDA 4RJ3A 3CQEA 3VRYA 1WAKA 1GNGA 2B52A 4C0TA 5GZAA 3AGMA 3QZHA 1KV2A 5AP2A 3WF6A 2XRUA 4WRSA 3ODZX 3V5WA 4QMSA 4DT9A 4ZIMA 3UZTA 2VTLA 3B8RA 4RC2A 4UYNA 5AUZA 4EK5A 4RRVA 4O2ZA 5BMSA 3LFAA 4E6CA 3QTIA 1XBBA 1B38A 2GU8A 4FTAA 3ITZA 3R7YA 3F7WA 1XJDA 1UNGA 4DGOA 4ZOGA 3W16A 5EI2A 2ZOQA 4FTIA 5CAPA 4W4WA 3PY3A 4H05A 3KB7A 4WA9A 4IB5A 4X3JA 5DHJA 3BYVA 5CAUA 1J7IA 3ACJA 3F61A 4EK6A 4FSTA 1CKJA 3WF5A 3WYYA 2I0YA 2BIYA 4BYIA 4YR8A 4FI1A 2BCJA 3F5GA 2QOOA 3AMBA 4FKIA 3SG9A 3L8SA 4YHTA 4W9XA 1XH5A 2FSTX 1SMHA 2BAKA 2UVZA 3LQ5A 2JDOA 3EOCA 3OY1A 3BEGA 2VGOA 3C4EA 3OROA 2PUUA 4ZY5A 3P0MA 3TV4A 5C27A 3VF8A 3NNVA 2XIZA 3EH9A 3NW7A 3PY0A 4KRCA 3MWUA 4XOZA 4AAAA 5LWNA 4EH7A 3IGOA 4KKEA 3R8PA 5CY3A 5DNRA 2O5KA 4FZ7A 2QR8A 4OT5A 4EHEA 5J5TA 5HU3A 4Z9LA 2GTNA 4FSQA 2BROA 2OSCA 2QOKA 4TT7A 2IG7A 2R4BA 4IVDA 1PXOA 1ZZLA 1SVEA 2VWWA 3ZBXA 4BZNA 4IFCA 4IM2A 4I21A 2X1NA 4JVGA 4EJNA 5IQBA 2CLQA 3JPVA 2Z7SA 2R5TA 3F2NA 3FMNA 3WE4A 4CFMA 3KF7A 3FEGA 2VTNA 4FEXA 3CKXA 3OCBA 4ACMA 3ZS5A 1PXMA 4E1ZA 4PL4A 5FD2A 4ZTMA 4NIFB 3CPBA 3BEAA 3DK7A 4XUFA 2UV2A 3CR0A 4WNMA 3E8DA 4IACA 2I40A 5KZ0A 3PJ1A 1OPLA 2B54A 4PPBA 4X7QA 5E90A 4FA2A 2WFYA 4C8BA 3F88A 5I0BA 4GJ2A 3VQHA 2CKQA 2C6LA 5CEPA 3ZFYA 4XH6A 2YACA 3UOLA 3FMJA 3BHYA 3RCDA 4D2VA 3OT8A 5J9LA 3GCQA 3UG2A 4BC6A 1ZARA 3HA8A 4G3DA 5B2MA 4DC2A 2BUJA 3QHWA 4KWPA 4XS2A 5HIBA 4R3CA 3II5A 4HZRA 3LLAA 3FLSA 2B53A 2WO6A 3IECA 4P5ZA 5AR5A 2XJ2A 4LUEA 5EM5A 3RNIA 3KL8A 4RZVA 3GNIB 4ZY6A 3OS3A 5CVHA 3Q96A 5FXSA 4BCPA 1IAJA 5CVGA 4ENYA 1NXKA 2UW3A 1J3HA 3EQPA 1RQQA 1YDTE 4MXZA 2HW7A 2HZ4A 3P7AA 4BDBA 5J1VA 3WILA 2BRNA 2YM5A 4QRCA 4FE2A 2PVNA 5D10A 2J0IA 1Q61A 2JITA 3M1SA 3MB7A 2WMAA 3DXPA 3Q2JA 5FP5A 2W9ZB 2YM6A 2JEDA 3SLSA 4KBCA 3GCSA 3Q9XA 1YI3A 3A8XA 3UVRA 4AT5A 1W84A 3MPMA 3MFUA 2OF2A 3ORPA 4M68A 4RIYA 4U6RA 4CRLA 4F70A 4EH5A 3LMIA 5DYJA 2H6DA 3IGGA 5KMOA 4FEVA 4N6YA 4U3YA 4ACGA 3Q32A 4C38A 1H08A 5FBNC 1Q8TA 3NX8A 4ZTHA 4EOLA 1XBCA 3K5VA 1PF8A 1IG1A 4RVLA 5A9UA 3I0QA 4O0VA 3S3IA 2A1AB 3WZJA 1UV5A 5HCZA 4YZ9A 3WE8A 2P0CA 2GS2A 4IX6A 5HI2A 4BDDA 4O0UA 3WZUA 5J8IA 4DGMA 4FUYA 3VN9A 5CAVA 4YSMA 2H9VA 4AOTA 4OTQA 5TR6A 2R0IA 3EL8A 1KOAA 4RX5A 3RAKA 2PUNA 2QOHA 2OJ9A 3P23A 4IQ6A 2X2KA 5IEVA 4RVMA 2XVDA 3GFEA 2OIQA 2WD1A 3R7VA 5CQUA 4XP3A 4G34A 5ETFA 4EZ5A 3R7IA 4B7TA 5E7RA 3PPJA 2R3HA 4QT1A 2VTMA 1XWSA 4C57A 2RF9A 2BTRA 2GHMA 1Q8ZA 5DT3A 4AT4A 5L2IA 4EI4A 4KB8A 3DK3A 2PE2A 2BKZA 2PVKA 3VS5A 4FKVA 5EDQA 4C2WA 3Q4ZA 4FZFB 4IANA 4FODA 1KSWA 4BKJA 3PVWA 4MK0A 4GIIA 4H39A 3HDNA 4X0MA 5HG9A 4F9BA 4O0YA 4O0TA 2RG5A 4O6LA 1RDQE 3P7BA 3BV3A 3BU5A 2FA2A
chains in the Genus database with same CATH superfamily
2C6MA 2BRMA 3DXNA 4RGJA 3SG8A 2RFNA 5CT7A 4C33A 5AUVA 2WMRA 3Q9ZA 3LE6A 2X8EA 5DA3A 4I23A 3SVVA 3JS2A 4BCKA 2I0HA 4UZHA 4R7BA 4WSYA 4WG4A 4WNPA 4YZCA 1H26A 2HY81 2XCHA 4C35A 4O7YA 2YABA 1JSUA 3BU3A 5TOZA 4BBFA 3F69A 2PVMA 2VU3A 2X4FA 3FLQA 3OWJA 5HU9A 4F7NA 5HG8A 1CSNA 1VEBA 4GJ3A 4C37A 2WTKB 3MS9A 2F4JA 2QU5A 4RJ5A 4R1VA 3GCPA 4PV0A 1QMZA 4DEHA 3U51A 2YA9A 3LFQA 2ITNA 4LL0A 3FKLA 5IZFA 3R7OA 4D0WA 3RWPA 5B2KA 3FZPA 2W1GA 3QA8A 3MSSA 1WBVA 1Y91A 4FT0A 5E91A 3VQUA 4EHZA 3FYKX 3IG7A 3JVSA 2Y6MA 4G31A 4MKCA 5CF8A 4C3RA 2GS7A 5KHWA 2XNMA 3NNXA 4EONA 2QODA 3QKKA 3N4UA 1Q41A 5H8GA 3MVHA 3MY5A 2UZUE 2ZJWA 4XMOA 5JMSA 1WBOA 3VS4A 4TL0A 1XH6A 3D7TA 1B6CB 3R0TA 3S1HA 3W0NA 3GQIA 3MN3A 3NR9A 2G2HA 1OPKA 2XK4A 3O96A 4F9WA 1FGIA 4J7BA 5BNJA 1QPCA 4IMYA 3HAVA 3PFYA 3EQIA 4FUXA 3QWKA 4JMQA 1VJYA 3DGKA 1W0XC 3BL9A 3ZM9A 3R71A 4F99A 2B9HA 5I3OA 4UBAA 3EWHA 5D9HA 3G33A 3ZLYA 1E1XA 3AD5A 4H3QA 4RT7A 3UIUA 2JIIA 4Y72A 3A2CA 1Q97A 4IB3A 4HVDA 3JVRA 3PP0A 1YWNA 4KA3A 2YLFA 3PRIA 3POZA 2XIRA 2ZB1A 3NAYA 4BCQA 2R3QA 3AQVA 4QMYA 1U5QA 4LYNA 2OJGA 2W17A 3P5JC 2G9XA 2J90A 2R3KA 4FTLA 4L7FA 4AWIA 2VTQA 2GHLA 4ZSGA 4RJ6A 4ENXA 2FYSA 3UC3A 1YOLA 4E20A 4AQKA 2JAMA 5ANGA 4BB4A 3R7UA 4XCUA 3DAEA 4G6LA 5DR9A 3TG1A 3C5IA 1PXIA 3Q4CA 2Z7LA 2O65A 2XK6A 3LFNA 4ZMEA 4M66A 2WIPA 4AXEA 3I79A 1KE7A 3DBCA 4O0WA 4O6EA 4QNYA 4AG8A 2C6TA 4DCEA 5BV3A 4CKIA 5J9YA 4DH3A 3TNQB 2QOCA 3SW4A 3FE3A 2IW8A 1YDRE 2E9UA 4YHFA 4HYSA 3TMOA 2VO0A 4O84A 1ZYJA 4DTBA 3GB2A 4I4EA 2EVAA 4FTKA 2IEWA 4PRJA 3P9JA 4HZSA 1OKVA 4U43A 4ITHA 1Q5KA 5DEWA 3U4WA 4O7TA 1OPJA 4XG8A 3TKHA 3ZCLA 3ZUTA 2VD5A 3IW5A 4C4HA 1CM8A 2VGPA 2IPXA 4DA5A 1J1BA 2YDKA 3TNHA 2Z02A 3JXWA 1LEZA 3QTZA 3HMIA 5BYLA 5ANEA 2JC6A 4FJVA 4WSQA 4X2FA 3MB6A 3TT0A 1OM1A 4AE6A 5LARA 3F2RA 3DB6A 2UZVA 2VX1A 4DFYA 4HOKA 3G6HA 4BGGA 3QBNA 3HP5A 4X21A 4PDYA 4G9CA 3QX4A 4I24A 4M84A 1U59A 5HIEA 3Q60A 4APPA 2NNWB 3KC3A 3OTVA 2QD9A 4FR4A 4XG2A 3PSBA 5HVYA 1UKIA 3VBQA 1Z57A 4J98A 3H9RA 2VTTA 5DWRA 3ZXTA 5KX8A 3AKLA 3BLRA 2X8IA 1ZOHA 3RK7A 3QQFA 4RBLA 3UIXA 3C4XA 1ST4A 2VO7A 3DKFA 3NWWA 1REKA 3R21A 4DCAA 3QHRA 3OWKA 5CF4A 3JY9A 3DV3A 4Z7GA 5HX6A 3D4QA 4K8AA 2AEGA 2CN5A 4IC7A 4IWQA 3DDQA 4YO4A 4CZUA 4DGLC 1LUFA 1YQJA 4I22A 4U97A 4DTAA 3G6GA 4FOCA 2VUWA 5FBOA 5T68A 4IVBA 4NK9A 2HZIA 4QTBA 3I6WA 2IZUA 3PXRA 4QP6A 3EZRA 3OY3A 4X2GA 3UQGA 4MBIA 2VTJA 3FKOA 1BX6A 5AP1A 5JGAA 1YOJA 2GMXA 2C4GA 4AXCA 4DHFA 5L3AA 3LVPA 5L2WA 4IZAA 3S0OA 2FVDA 3KF4A 3QQJA 4BI1A 3V8WA 5LWMA 4CG8A 2VRXA 5AA9A 3R9RA 4FGRA 1LP4A 2A98A 4M8TA 3F5UA 3F3VA 1OGYA 3Q9YA 3KXNA 4UB7A 5A4LA 3RNYA 2WTVA 3DQXA 4J1RA 2IZSA 2X7FA 3MA6A 3N4VA 3F9NA 5EDRA 4F08A 3TTJA 5HLWA 5A6OA 2Y0AA 5HO7A 3NNWA 4L00A 5CWZA 5A6NA 5CU0A 2WKMA 1MUOA 3AC8A 3SXRA 4FTCA 2Z2WA 2ZV7A 4HVHA 1P4OA 4BDJA 4TWPA 3IK3A 3O51A 2EUFB 3BI6A 3ZHPC 4O4CA 3E3PA 3VRZA 3ZRLA 2Z7QA 1YKRA 4OR5A 3HEGA 1TKIA 2CSNA 5EW8A 4ZJVA 1V0PA 1ZY5A 3LCSA 3MGYA 3OVVA 4FTJA 3GUBA 4K2RA 4QD6A 2GHGA 2B7AA 5HX8A 4USDA 5EI6A 3FI4A 3FLNC 3F3ZA 4A9UA 3SX9A 5KBRA 2QG7A 5IQIA 1O9UA 2NRUA 5CF5A 4D1SA 1AGWA 5LXMA 4I5HA 3LFEA 2PVJA 4JDKA 1W2CA 5HBHA 5JEBA 4NU1A 5H8EA 3M11A 5TT7A 3RALA 3LM0A 4E26A 4RWJA 1IRKA 4GYIA 5HLNA 2IO6A 5KHXA 5I9UA 3SOAA 2R64A 2VWIA 2W4KA 3CY2A 3DB8A 3NDMA 5EHYA 3IW8A 3AOXA 4IAIA 3L9LA 4PTGA 5F20A 3OCSA 4D2SA 1B39A 2B55A 2QC6A 4BDIA 1JQHA 5AJQA 4DEBA 3TUBA 2C0OA 4FKTA 1W7HA 4I93A 3W1FA 5LVNA 1OITA 4YGAA 1GJOA 1MRVA 4ANOA 3RPYA 2XNEA 3C50A 2PULA 4ORKA 3DTCA 4EBVA 4FV3A 3DJ6A 4F1MA 4PL5A 3LOKA 2GSFA 1V0OA 5EQYA 4I1ZA 3NNUA 3GT8A 4ZSLA 3R63A 4FSUA 4G6NA 3QCQA 1AD5A 4HYIA 5IQEA 2CN8A 3Q53A 3MVLA 5T6KA 3NFGB 5ETIA 4ANSA 1PXLA 3HV3A 3MFSA 5M51A 3BRBA 1R78A 3CJGA 4IJ9A 3L8XA 4O1OA 1SVHA 5EI8A 4F1OA 4BY9E 4FT9A 3I60A 5HNIX 3POOA 3BE2A 5CEMA 1ERKA 4OLIA 4X3FA 4CQGA 1SNXA 3TZ9A 2XUUA 2GPHA 3GQLA 4ARKA 1DAYA 1H1QA 4E8AA 4ERWA 3VONA 4I6FA 3ZO4A 5IQFA 3KXMA 3PXYA 3HMMA 5AR4A 5J79A 2W7XA 2F9GA 1OIYA 1H1RA 2I6LA 2X8DA 4CV9A 1ND4A 4HCVA 3F82A 4EH4A 4FICA 1K3AA 5JQ8A 1L3RE 4QDVA 5CNOA 3AMYA 5IQCA 3BCEA 3AKJA 4EEVA 3GEQA 2XK9A 1R0PA 3RPSA 4BDCA 4BYJA 3W2SA 3QU0A 3K54A 4FKOA 1V1KA 4C4GA 2VX0A 4DEDA 1KE6A 2X6EA 5M56A 1Q4LA 3DZOA 3I1AA 3SQQA 5HBEA 2W5AA 4NTSA 3FSFA 4EUTA 1DM2A 2Z7RA 4NW6A 3C4ZA 2DS1A 3HMOA 5JH6A 1U54B 4W9WA 4YJOA 5EHOA 3E62A 3DFAA 4BCFA 1GZKA 3AC4A 3GGFA 3OBJA 4UWBA 1BI7A 3LXLA 4OBQA 1ZZ2A 5FTOA 5LOHA 2OLCA 4G1WA 3ZFMA 3W2PA 4YMJA 2XF0A 2GNIA 4MXXA 4IZYA 2YITA 3ET7A 4FGBA 1FVTA 3VF9A 2ITWA 4X6RA 5CENA 3FZTA 4RWIA 3KK9A 2UZBA 2ZM3A 4KIPA 4C59A 4AW1A 3NUAA 3BHVA 3CIKA 2HAKA 2WEIA 2GDOA 3RZFA 4GH2A 3FPQA 3SAYA 5FWKK 3GFWA 2QLUA 4OTDA 5JT2A 4S33A 1OL7A 2OO8X 3E8CA 4JX3A 3V04A 4B8LA 4MHAA 1JAMA 5F95A 1JKLA 2VNWA 4EOKA 3QUPA 3ZYAA 3A62A 4UWYA 4D4RA 4EOPA 3LMGA 3FLZA 1OL5A 2ERZE 2HYYA 3ZLXA 4WRGA 3QQHA 5J9ZA 4I6LA 3N51A 3COMA 1X8BA 1I44A 1MRYA 2RGPA 4LGHA 4AGDA 3KULA 4FV6A 3FZ1A 4IVCA 3VNTA 4ZS4A 3IDBA 4CZYB 5GJGA 4IZ7A 4YBKA 4JNWA 2VTOA 4O4DA 4YC3A 2XIXA 4CYIA 4DFZE 2ETMA 4WO5A 5M4UA 2YM8A 4AUAA 3I7CA 3R01A 4FL3A 4L01A 4FIGA 3VVHA 2VTAA 3QCSA 4FT7A 3K3JA 3CQWA 3NPCA 2ERKA 5BVFA 3A4OX 2WOTA 3R28A 4ZTLA 2WB8A 4AA5A 5DG5A 2B1PA 2XM8A 2W5HA 1OKWA 4RA5A 4MXOA 4U8ZA 3PE2A 2FB8A 4QPSA 4C4FA 5A54A 5K9IA 4F9CA 1UNHA 4KS8A 5KMKA 2C3IB 2O3PA 3FMHA 3KXGA 2EWAA 2O2UA 5HE1A 5BVNA 3BGQA 4TNBA 3WZDA 4FEUA 2RSVA 3U8WA 4D1ZA 1L8TA 3EN4A 1WVWA 5CLPA 4O82A 1M17A 2OW3A 4FSMA 5AV2A 3NUYA 2BRHA 4CT1A 2C68A 4U41A 4BI2A 3D83A 3UO6A 4RIWA 5F1ZA 4FV4A 3FPMA 3SXSA 2WMTA 4HYHA 2C5YA 1MQBA 1Y6BA 5EM6A 4NT4A 3HMPA 4HGEA 5KUPA 2C3KA 3EZVA 2J51A 2VTIA 2ZB0A 4GIHA 4J71A 4M7IA 4TN6A 5A46A 5AR2A 1NY3A 5HIDA 3BWJA 1NA7A 2CPKE 3CD8A 2H8HA 2OGVA 5E8XA 4O96A 5AUXA 5GZ9A 1YHVA 3PE1A 4JI9A 4YLJA 3H30A 3PXFA 3FBVA 4ALUA 3EIDA 3ZM4A 4BHNA 5IU2A 1ZWSA 2CLXA 2R3NA 3G0FA 3O17A 4W4VA 5L8KA 5HTBA 4Q5EA 4FKPA 4PDPA 1OUYA 2YIRA 4USFA 3NVMB 4BFMA 4I92A 4JBVA 2W1DA 2YIXA 4XLIA 3R9NA 3VJOA 1APME 1SZMA 2XNNA 3UYTA 4FV9A 4ZLYA 4KUJA 3BHUA 2BVAA 2DWBA 3TACA 1IA9A 4IZ5A 3V5QA 5TKDA 4TY1A 4YNEA 4A06A 3QFVA 4DGGA 4KIKA 2B4SB 4PL3A 4CLIA 4Z3VA 4RWLA 4BTJA 3PPKA 4IXPA 4TZRA 4AGCA 1YDSE 2C6IA 4DLJA 3KMUA 5ACBC 2HY0A 2H34A 2OU7A 4ZEGA 3ZO2A 3ORLA 1PY5A 4D2WA 3K3IA 3GU7A 4J97A 4TYJA 4QTEA 2GS6A 3V01A 4N0SA 5IA4A 3BYUA 3JUHA 2PHKA 2QOBA 2W05A 1IASA 2R2PA 3Q3BA 2VTSA 3WOWA 4D5KA 5AAEA 3TZ7A 4ZTSA 2UW7A 3LCKA 4IWPA 1H00A 3OEZA 4HGLA 3QD2B 5GIPE 4MXAA 5AIKA 5CS6A 3IQ7A 4CGAA 4RQKA 2UW8A 4HCUA 4GYGA 5AR3A 4FIHA 1H1PA 4AAYA 3FDNA 4GEOA 3E3BX 3MH3A 4MCVA 4O0RA 4NCTC 3QTSA 4WNOA 4ANNA 4DH7A 1CMKE 2XA4A 3M42A 4UMQA 3LMHA 3NUNA 2W9FB 4IW0A 2UVXA 4YJNA 3TUDA 4BIDA 4QMPA 1ZMWA 5C8KA 2H96A 2RFSA 1ZAOA 2HELA 5EG3A 1ZY4A 3FZOA 4X2KA 3UJGA 4M69B 4CV8A 3DK6A 5ANIA 3CSVA 3N4TA 4FL1A 3PSCA 2WIHA 4YP8A 5H3QA 5LCKA 2PZ5A 3W55A 4EK4A 3HAMA 3MW1A 4DFNA 1OL6A 3ZBFA 5IF1A 1H07A 4TKSA 5HHWA 2OG8A 1Q99A 5AAFA 3ZEPA 1TQMA 3CKWA 3OW4A 4CLJA 3PLAE 4QP8A 4ZZMA 4EH8A 4GKIA 2XIYA 5DGZA 3SRVB 1ZYDA 5DI1A 5E8YA 3GU6A 2A27A 2EB2A 3NZ0A 3PSDA 3R73A 1Z9XA 4E6QA 1WBSA 3BLAA 3C9WA 4PPCA 4RQVA 4BZOA 5J7BA 1NT2A 5AV3A 2CNUA 4BDKA 5LCJA 3QGYA 2ITXA 2R3FA 3NCZA 4TWCA 3ZSIA 5HE2A 3MH1A 4AZFA 2OZAA 4BDAA 3MBLA 3HLLA 4KINA 2X2LA 2V55A 2QHMA 2I0VA 3FMLA 3KFAA 4PTEA 4WHZA 4RJ8A 5HESA 2VWZA 3EFWA 3KXXA 1Y8GA 3RGFA 3S4QA 4FNZA 5DT4A 4D1XA 3DAKA 1M14A 2OIBA 3VC4A 5I9WA 2BIKB 4YC8A 4XRJA 4RX7A 2C6DA 4ALWA 4ASZA 3H4JA 3GVUA 4TYEA 2QI8A 2QURA 3CGOA 3Q6WA 2C3JA 5DT0A 5KMNA 3CC6A 4K33A 5D12A 3ENMA 5EKOA 4C3FA 4CD0A 4CMOA 4DEEA 3QTWA 4EOSA 4CRSA 4JDJA 5CI7A 2WEVA 3P7CA 3MPAA 2CKEA 2V22A 2W99B 3UP7A 3FV8A 3E5AA 1MQ4A 3LJ2A 4ACDA 4FC0A 5CEIA 3U87A 4UX9A 2JAVA 4YSJA 5KNJA 4QOXA 4FNYA 5IUIA 4ZJIA 4QMMA 3UG1A 4BJJB 1NW1A 2W5BA 2BRGA 3VS0A 3DOGA 2WU7A 5IQHA 1PYEA 3VUIA 4ZLZA 5A4TA 4KABA 3LXPA 1DI9A 2QO2A 4CFUA 3GOKA 4QPAA 3VHKA 3CE3A 4DH5A 3VUKA 2PZYA 4XRLA 5EH0A 4AW5A 4QYGA 4BZDA 3KEXA 4EYMA 2WMXA 2W1FA 1WFCA 2E9PA 3DCVA 3VS1A 3BHTA 3DFCB 3F6XA 5CT0A 4LOQA 4BDFA 1XMLA 4DH1A 2F57A 2J5EA 2C69A 4HGSA 2BFXA 4FK6A 4D4VA 4XG6A 1JKTA 3GCUA 3OCTA 3RPOA 5LMAA 5IH4A 3NVKI 4YTIA 4MNEB 3NYVA 2ZDUA 5DIAA 2E9NA 5ANOA 4R78A 2ONLA 4RLLA 3ZLWA 2IZRA 3NW5A 3QUDA 4M15A 1MP8A 4AP7A 3UOKA 2E9VA 2HZ0A 4J52A 3ZRMA 4AXDA 2W4JA 4FTUA 4LMNA 3SDJA 4C58A 3C13A 3MV5A 2DYLA 2XEZA 3BE9A 2PSQA 3EFKA 3FXWA 2PVLA 3HECA 2WQBA 4L52A 3REPA 4QMQA 3A4PA 4QYEA 2Y9QA 1PHKA 3LZBA 5GNKA 2ZAZA 1H25A 4RIYB 4EH3A 5JZNA 4F65A 3SHEA 3BGPA 2BZKB 5L2SA 5HORA 1ZRZA 4IB0A 1H1SA 3HX4A 5HEZA 3D2IA 4E4MA 4EC8A 2PZIA 4GV1A 3SC1A 4DLIA 3TNIA 3R9HA 2XIKA 5DRBA 3FL4A 3UPXA 4U45A 2C6KA 4I6BA 5C1QB 3FQHA 5EOBA 3CEKA 5FEEA 1GAGA 2J5FA 4AT3A 2AC3A 3KRRA 4WG5A 5AR8A 3B8QA 4K18A 3PG3A 4FSNA 3UBDA 4FV7A 5HTCA 2P2HA 4YLKA 5GIOE 3PPZA 2BTSA 5EQPA 3G9LX 3R8UA 3RI1A 3CLYA 3QCXA 4XEYA 2ETKA 4YC6A 5CNNA 2FUMA 2O64A 4QQCA 4QQ5A 4C62A 4DG0E 4FYOA 3VBXA 1OB3A 1FPUA 1M52A 1IEPA 3RM6A 1NVRA 4YJPA 3UMXA 4XBRA 5BYZA 3G5DA 4CT2A 3MTFA 3E64A 3TEIA 1QCFA 3PY1A 2C5XA 2GNFA 3ZSHA 3LKMA 4KD1A 3FZSA 5E8WA 5TO8A 3PIXA 3IW4A 4G5PA 2OFVA 4NL0A 3R30A 1W83A 1XHAA 4GL9A 3IOKA 3GXLA 3HUCA 4NZWB 2JKOA 4Y5HA 4GU6A 3ZO1A 4CCUA 3QD0A 4QMNA 2HENA 1Q62A 1YVJA 5CU2A 3TXOA 3MH2A 4QMOA 1H1WA 1GIIA 3R7EA 4FEWA 1W98A 5J1WA 5CASA 4RPVA 3E7OA 3KK8A 2X39A 3GU8A 4O27B 4C3PA 2PMOX 1OMWA 5KBQA 3BIZA 3DLZA 1FVVA 1TZDA 3VS6A 2RIOA 1R3CA 4RFYA 3TIZA 2XM9A 1FVRA 3V5JA 3ORZA 3EL7A 3LFBA 1CKPA 5DBXA 3G15A 5KMLA 2O0UA 3MY0A 3GI3A 3AMAA 4L9IA 4FV0A 4OBPA 2A2AA 3EHAA 4PQNA 3R04A 4EK3A 5IEXA 4JQ8A 3K2LA 4JQ7A 3UDTA 4FKJA 4CMTA 3F7ZA 4XYFA 3MDYA 3WF9A 4E5WA 3UOHA 5BUEA 3VW6A 4JAIA 2YZLA 3RTPA 4LI5A 2G15A 4TYIA 4FTTA 1H8FA 4BCHA 2B9IA 3Q52A 3QZGA 3D5UA 3I0OA 4IJPA 4MQ1A 4R1YA 3IONA 2PE1A 2WTIA 3E7VA 4JG8A 1S9IA 4R77A 1H01A 3UP2A 3QZIA 3EQGA 5EYCA 3KRWA 5EW9A 1JVPP 2WMUA 3V8TA 3SKCA 2IVUA 2OH4A 2HWPA 3OP5A 5M09A 4CFVA 5DH3A 4B4LA 3OBGA 2C47A 3UIBA 3G51A 3PFQA 5IG1A 1P2AA 3I81A 5FTGA 2YZAA 2V0DA 2ZV8A 4FYNA 4FG7A 4BBEA 4QYFA 4F7SA 1P5EA 2ITZA 4C61A 2Z60A 2B0QA 2IVSA 2LGCA 3LXKA 2GFCA 5ANKA 3FMEA 4OTGA 4B6LA 4MUQA 2P55A 2WMQA 4YJVA 4FV5A 1OIRA 3LQ8A 5ANJA 2QCSA 4F78A 5DVRA 5LMKA 4OW8A 2FGIA 4X2NA 3LFCA 1WVXA 2J9MA 4PMMA 3FAAA 3MPTA 4U79A 3O8UA 3DY7A 4QP4A 3PZHA 5C8NA 2BR1A 3PJ3A 1Y57A 4A9RA 2ZFYA 5GJDA 2GQSA 3FUPA 1SYKA 4GRBA 2VO3A 2GFSA 2RL5A 3UDBA 1OBDA 4ACHA 4C34A 4U0IA 4BI0A 3EQDA 4K9YA 3TKIA 3ZLSA 2NPQA 4I5MA 1F3MC 4J53A 1YWRA 3T9TA 3L1SA 1H0WA 1G8SA 4BWXA 4PY1A 2IJMA 4HVSA 2GCDA 4JXFA 5DRDA 4S31A 4GVAA 3NYNA 3QQKA 2VTHA 2OKRA 4B8MA 3RKBA 5IA1A 2O63A 2PZRA 2V7AA 1YHSA 2ZV9A 3ETAA 4BCMA 4J95A 4MH7A 2X9FA 1YOMA 5HLPA 4HPTE 4J96A 3I5NA 4I94A 3ZOSA 3OHTA 1BL7A 5HCYA 3TM0A 4LDTA 3IKAA 5LVLA 2EXEA 2CKOA 3HVCA 2R3MA 4YZNA 3EQRA 3HNGA 4E6DA 2VNYA 4P4CA 3CPCA 1U4DA 3FKNA 1ZOGA 4JX7A 4RMZA 5IDNA 3FZRA 4DDGA 1MRUA 2FSOX 2WGJA 1M7QA 1OIQA 3FXXA 1UWHA 5AX3A 3FLYA 3PVBA 4NM5A 4PF4A 4FZAB 4WUNA 2E2BA 4JS8A 4YJRA 3UZPA 2JIUA 2QOFA 1XBAA 4GFOA 1A48A 2YM4A 4CSVA 4DT8A 4BKYA 2YISA 3GP0A 5IDPA 3S00A 3R1QA 4DEIA 3EQCA 5JZJA 3G2FA 5L8LA 4QYYA 4WBOA 2UZNA 4MQ2A 4RWKA 5JFXA 2X0PA 5FP6A 3O50A 3NRMA 4IDTA 3OG7A 4W8DA 3TJDA 1VLRA 1XO2B 4FT3A 4G3GA 4ZZNA 5IISA 4FTQA 4BF2A 1ZYSA 4QMTA 4YTHA 5HBJA 3HGKA 4U44A 3RK5A 2PUPA 5DOSA 3A61A 2QO9A 2PVFA 3ORXA 4YZDA 4UYAA 4LOPA 4MAOA 3GC8A 4QEBA 4RLKA 4V04A 4CXAA 1ATPE 1K2PA 4E3CA 1IR3A 2PVHA 5CEQA 4LUDA 5IA3A 2FO0A 3OFMA 2G2FA 3H9FA 3R1YA 3AC5A 3C1XA 3DNDA 4QQTA 4KNBA 2Q83A 3QRIA 3KRLA 5DFPA 3OOGA 3WI6A 1JKSA 2QQ7A 3SD0A 4AU8A 3T9IA 5AUTA 2VWUA 2WQEA 4APCA 3PZEA 5GHVA 3QD3A 3G90X 4FKLA 4E4NA 5A14A 1TQIA 2OICA 3FHRA 4Q2AA 3TV7A 3TNWA 5B2LA 4O7NA 2YAKA 2BHEA 3ZMMA 4MBJA 4FV2A 4QP7A 2XJ0A 2CGVA 3H3CA 2P33A 3QRJA 4L46A 3GOPA 4EHVA 4PP7A 2OBJA 5M06A 5CYIA 3FMDA 4FT5A 1SNUA 3LCOA 3ZONA 5K0XA 3Q6UA 3QALE 2OH0E 3RM7A 3EMGA 4C2VA 4Q9ZA 4CKJA 5IUHA 4O7ZA 3Q5IA 2YIQA 2B9FA 4J8MA 3LHJA 4TPTA 5DR2A 1FGKA 2RFDA 4A7CA 4YJTA 3NCGA 4K77A 4QTAA 3R8MA 4BDEA 3GC0A 3BBWA 3DU8A 4MVFA 3ZUVA 4NWMA 1YRPA 5AMNA 3MYGA 1JBPE 2BFYA 4FZDB 4RFMA 5IMEA 2QVSE 3ANQA 4Q5HA 1M2RA 5G1XA 4MD8E 3F5XA 4BGQA 3ZC5A 3QTUA 4LOOA 2R7IA 2YHVA 1O6LA 5E8VA 5I4NA 2OF4A 2VN9A 4V0GB 1QL6A 1R1WA 2NO3A 3CP9A 3HV4A 3JYAA 3ZRKA 1YXXA 3C0GA 4O86A 1REJA 3DKCA 5E9EA 2PU8A 3E93A 5FEDA 2Y4IC 5GINE 2CHLA 3UC4A 3EN9A 3R83A 1BLXA 4C4EA 2HXQA 2QOQA 2WQNA 2Y8OA 1Z5MA 4QTDA 5I9ZA 2PZPA 4U5JA 2A19B 5CZHA 3EKNA 4OT6A 1URCA 3BPRA 2WMWA 2QU6A 2JD5A 4OBOA 2VZ6A 3AC3A 3GENA 2HOGA 4Y83A 3HV7A 5EYMA 3ALNA 4CFFA 2R0UA 4MD7E 4U40A 3W2OA 3OXZA 2WPAA 4W4XA 5CZIA 3UYSA 1GIJA 1F0QA 5CSWA 2YJSA 5AM7A 4PDSA 4WG3A 3H10A 4JG6A 4EOQA 1G3NA 2IF8A 1BUHA 5KKRC 3BLQA 3RAHA 4GU9A 3RVGA 5KZIA 4CEGA 4ERKA 4NM3A 4IIRA 4RSSA 5KO1A 4DFUA 3RAIA 3Q5ZA 3LJ0A 3M2WA 4GUEA 5BVEA 2YIYA 5IPJA 3UVPA 1UNLA 4CTBA 4F4PA 1GIHA 2X7OA 4RC4A 3Q2MA 4GW8A 4A9TA 1BMKA 4G2FA 4QP3A 4WBBB 4CFXA 4ZTNA 3A7FA 5JGBA 1ZMVA 3ALOA 4M3QA 4EKKA 3V51A 1PKDA 5EQEA 3FSKA 1CTPE 4EWQA 5C8MA 1FOTA 4EJ7A 4RZWA 4IVAA 3UVQA 5L2TA 3PJ2A 2XNBA 4AOIA 3WARA 4BCOA 4LM5A 3D9VA 4G3FA 3R6XA 5E92A 1Q8YA 2P2IA 4O91A 4EC9A 5LVMA 5DE2A 5AP6A 2VWXA 1YI4A 1UU8A 1U54A 4EUUA 2JKQA 1BKXA 2QOLA 4HGTA 3HL7A 4PDOA 3U9NA 3C5UA 1WBPA 2CKPA 2QO7A 5BUIA 3TZ8A 4O0SA 5IA2A 5HE3A 4DBXA 3LXNA 3OWPA 2VTRA 4TTHB 3TV6A 4BTKA 2Q0BA 3Q4UA 1OVEA 5BVOA 5E4HA 5FM2A 4C4IA 5FUTA 4ASDA 3MFRA 3QQGA 2XNPA 3EQBA 5AP3A 3P78A 1G8KA 2J7TA 1XH7A 2FSMX 4IE9A 2BDFA 4MYGA 5AADA 5DMZA 4JAJA 3COIA 5DN3A 3VAPA 5FLFA 2REIA 3TDWA 4F6WA 4FIEA 4TYHA 4L8MA 3LFFA 2XJ1A 3C4WA 2XYNA 3GU5A 4CYJA 4F0GA 3JR1A 2YCFA 4N70A 5EM8A 5JN2A 3WZEA 3VS3A 4IAZA 2C6OA 4A4XA 3PRFA 3MIAA 5AA8A 4JL9A 4RVKA 2BZHB 3PP1A 4AZWA 2YAAA 4KBKA 3P5KA 5C26A 3BV2A 5CI6A 1XH9A 4QP1A 4UZDA 3KXHA