1YWNA

Vegfr2 in complex with a novel 4-amino-furo[2,3-d]pyrimidine
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
302
structure length
279
Chain Sequence
LPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLTHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDIKDPDVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel 4-amino-furo[2,3-d]pyrimidines as Tie-2 and VEGFR2 dual inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Vascular endothelial growth factor receptor 2
total genus 92
structure length 279
sequence length 302
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1ywnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1ywnA01
2PY3A 3SV0A 1YDTE 1L3RE 2CKOA 4DCAA 4BHNA 4DBNA 2I0VA 2X39A 3HV7A 4JVGA 2UV2A 3BI6A 5AAFA 4BBEA 3LOKA 3NIEA 4FTCA 3ZO1A 4F6SA 3UIBA 4OTPA 2W1FA 2PSQA 2QOQA 2YIWA 3NNWA 3R04A 2HAKA 4IVDA 4UB7A 4PDPA 4W9XA 3LMHA 4CNHA 3TACA 2ERKA 4FKWA 4IX3A 2XKFA 2I40A 4E4NA 4EWQA 1DM2A 4IC7A 3RAKA 1WBVA 4CXAA 3TV7A 3W16A 3LM5A 3KCFA 5DH3A 3I6WA 4QNYA 4B9DA 4E6DA 4FNXA 2EXMA 3HMMA 4XEYA 3HV4A 1OBDA 3UQGA 4KIQA 3QKMA 5EYKA 3AC3A 4RT7A 2C3IB 4GRBA 1V1KA 2WOUA 3FI8A 2R3GA 3K3JA 4O6LA 2X2MA 4D2SA 3FLYA 4P5ZA 4CKJA 4APPA 1PXNA 2CHLA 3SOAA 3QUEA 1H26A 5DGZA 5JKGA 5L8KA 3GQIA 4FT5A 3VUTA 3QD4A 3SX9A 5E90A 2W1DA 3AQVA 1FMOE 1WVXA 4L7FA 5CSWA 3BEAA 5HE3A 5TT7A 4G3DA 5IMEA 5CI6A 2BZJA 4ZJIA 1P4FA 4FK6A 4I22A 4UMRA 4KWPA 4BWXA 4EOKA 2QONA 2Y4PA 2X9EA 4FT9A 1YVJA 3LFCA 4CFNA 3BKBA 2UUEA 4FX3A 3FZSA 3R9HA 2FO0A 1FMKA 3A8WA 4ENYA 4EYJA 2BRBA 3IKAA 4RJ7A 4XG3A 4F99A 4I6QA 3E87A 1TQMA 3POOA 2J2IB 3U9CA 2NNWB 2IVUA 1H1QA 4HCVA 2XJ2A 4MF1A 5CXHA 3HX4A 4UMUA 2WIPA 1SVGA 1H27A 5HE0A 4BCFA 3KRJA 3PSBA 4F70A 4FT3A 4C4JA 1MQ4A 3RTPA 4D58A 4XP2A 4IVCA 5IEVA 2XRUA 2XNOA 4PP9A 5H8GA 5EG3A 4E5WA 3HLLA 4I6HA 4S2ZA 5A46A 4CGAA 3HAMA 5M4FA 4L8MA 3WE8A 2PE1A 4CTBA 3OP5A 4OLIA 1Y6BA 4JNWA 2A2AA 5CY3A 1Q8WA 5DT4A 2OJGA 2BDJA 3OCTA 4PRJA 4WO5A 5B2LA 2OICA 3P08A 3FZRA 1R1WA 4PDOA 3CXWA 4Z7GA 4X21A 4GU9A 3R9RA 3NNUA 1Q8UA 3FLZA 3QWJA 3P4KA 4FIHA 4RJ5A 3PXYA 1M2QA 4FKGA 2B52A 4LOOA 2HYYA 4IC8A 4JBPA 5T3QA 4XLIA 5HBJA 2PUUA 2VWVA 4L53A 4EBVA 4Y95A 3R83A 3EJ1A 4FZAB 3F3UA 4NKAA 2W96B 3I0OA 4G6NA 4GV1A 5EH0A 3K3IA 1S9JA 3CC6A 3GNIB 4PP7A 4IE9A 4PQNA 3AMYA 5A4QA 4XV2A 4BCOA 4DFLA 4L52A 4FZFB 4C02A 5BYYA 3WI6A 3BLRA 4XX9A 4A4OA 4FVRA 5GJDA 3WF5A 2Z02A 3VUDA 4D4RA 5CVGA 4DFZE 3OBJA 4JIKA 4MBIA 4PF4A 4QMYA 2PMOX 3W2SA 5CU0A 3AD6A 1UNHA 3C4FA 4ALWA 4CZYB 3QXOA 3FQEA 4IM2A 1GY3A 2VWUA 5DEWA 4EWHA 4L3JA 2CSNA 5C8NA 2VX0A 2P4IA 4AOTA 5F4NA 2GFCA 2OJIA 3F61A 3G0EA 4CTCA 3MIAA 2F7XE 5CXZA 1JSUA 4D5KA 4BBMA 5LVMA 2YM4A 1PW2A 1ZOGA 4R77A 3U55A 3HMPA 3LCDA 3H9FA 4IDTA 4WHZA 4YZBA 5B0XA 5LQFA 3U6IA 5ACBC 1JSVA 3R8MA 4FE2A 1BLXA 2RFEA 4O84A 4EJ7A 3KL8A 3BZ3A 4GYGA 4KSQA 3CQUA 3ORNA 1YRPA 4FV4A 5CF8A 4OBPA 4BCKA 1XO2B 4Z55A 4FKQA 4NFMA 2BKZA 2OJFE 3UIUA 1Q4LA 3DKCA 1H07A 2QQ7A 2RG5A 2V22A 4WUNA 3RVGA 5HVKA 2BDFA 2BTSA 4A7CA 4N57A 3A8XA 1HCKA 4H3PA 4LRJA 1VJYA 3DLZA 1OUYA 2YM8A 4NFNA 4FR4A 3RCDA 5JH6A 1V0PA 3P9JA 3A7GA 1WCCA 3QRJA 3DLSA 5KX8A 3W32A 3ZYAA 2LAVA 2WHBA 5AV1A 2OXDA 3OOGA 4HYIA 3GC8A 1JLUE 4JG8A 1Q5KA 2ONLA 3OCSA 4LMUA 3S0OA 5ANEA 3F5UA 4FI1A 2IW8A 5FP5A 2QG5A 5EHLA 4OBOA 3NNVA 5HIDA 3EQHA 3WZKA 3EN6A 3LKMA 4DC2A 4QTAA 3AMBA 1JOWB 3H0ZA 5C27A 5AFVA 3ALNA 4FKJA 4F0IA 3TUDA 2QOLA 5C4KA 4G17A 4PMMA 5EQEA 1XBCA 4A4XA 3ZDUA 2VWZA 1RJBA 5EM5A 3RPRA 3QQGA 5BYZA 2I0HA 5M4CA 5J87A 4QYFA 3QRUA 5TOZA 4IAIA 5CSHA 1J1CA 2PYWA 3VHEA 5HE2A 5CEQA 4U81A 2J4ZA 3LFQA 3MIYA 2YACA 3HAVA 3ROYA 3GENA 3KULA 3UYSA 3UGCA 3B8RA 3H3CA 2JDVA 2YDIA 4FEQA 5DA3A 2UW6A 4I0TA 4DINA 5IEYA 3FLWA 4JT3A 3K54A 2Z7LA 3NR9A 3SW7A 4ASXA 1XR1A 3GFEA 4TZRA 2QU5A 5FEEA 4G3EA 4IVBA 3HA6A 4GFGA 5CSPA 2R2PA 4CSVA 4BDKA 4IJPA 2HZIA 3R01A 4S34A 4AT5A 2GCDA 3H30A 5EHYA 3PA3A 3W8QA 5DOSA 1SMHA 2XB7A 3BYOA 2W1GA 3OXTA 2VO3A 3GVUA 2YM7A 4EOSA 3KY2A 1V0OA 4MYGA 1A9UA 2R0IA 5AIRA 4AZEA 3BV2A 1FVRA 5ICPA 1UVRA 3ZFMA 3TNIA 2PUPA 1A06A 4BY9E 4EUTA 1IEPA 1UNGA 4FF8A 5IA3A 3V5JA 1B38A 1UU7A 3P7AA 1OBGA 3ID6C 4IAFA 3VBWA 5CNOA 5IUIA 4QP8A 5LMBA 5E92A 4AU8A 4AGDA 1P14A 4MWIA 4XH6A 4AS0A 3DAEA 1U54B 3CIKA 1GZKA 4QNAA 5FD2A 4YJTA 1OVEA 3CTHA 4FVQA 4LGGA 4LM5A 4V04A 4BGQA 3QU0A 2PULA 4EH3A 5M53A 5DFPA 5LARA 4KS8A 1VZOA 3IW6A 2PMIA 2W9FB 3R7IA 2ZMCA 3D5WA 4K8AA 3RK7A 4AOJA 5M4IA 3ANQA 5C01A 2VTRA 4IFCA 3DXNA 5J7BA 3EL8A 4L42A 3WF7A 2ITWA 4JS8A 4N6YA 4RVTA 4IAAA 5AV2A 5FDPA 4XMOA 2C6LA 3A99A 1M2PA 4J95A 4C3PA 3IONA 4KUJA 4H05A 2ITOA 2ZM3A 2VUWA 3PIXA 4R6VA 3TIYA 2GTNA 2ZV2A 4YO4A 2R3JA 4HGSA 3UIXA 4GUEA 2YM6A 5E91A 4AACA 3LJ0A 4M8TA 3QZGA 4CLIA 4JQEA 4ALUA 5L3AA 3DU8A 4UN0C 3QYWA 2QODA 5KMKA 2JIUA 1K9AA 3Q9ZA 3PSDA 4GFOA 4BTKA 1BX6A 5A9UA 4FSZA 4O0TA 3O2MA 2XNBA 1KV1A 3TKUA 2EWAA 5GINE 4F64A 4IWDA 4S31A 2VO0A 1WVWA 1W8CA 3O8PA 2W4OA 3R8VA 3DTWA 3G9NA 3FQSA 4FKRA 1ND4A 2J5EA 3L1SA 4J8NA 2Q83A 5D41A 4O21A 2HENA 3SXFA 1H1WA 3OCGA 3E62A 2W5AA 3PZHA 4JQ7A 3JXWA 3O8TA 4A9TA 3N4VA 4O0XA 5FRIA 4ERWA 3GB2A 2VO7A 1PJKA 3ELJA 3F5GA 4ASEA 2R0UA 5KKRC 3NUAA 2Y6MA 1H1PA 3VS3A 4YUQA 4ENXA 3KXXA 5CZHA 5FTQA 4YGAA 3V8TA 4F6UA 1GZ8A 2CN5A 3GC9A 4ARKA 4EZ5A 1V0BA 4I5HA 4LUEA 4XRLA 3TZ8A 4C62A 5JSMA 5M07A 3CY2A 4UYAA 4BBFA 4EEVA 1Q3WA 5EYDA 3UG1A 2W06A 5CT7A 4S33A 4V05A 4YHJA 4R7IA 4IANA 4IW0A 4FSUA 3QTQA 3ITZA 3DXQA 2PZ5A 4TKSA 1OPKA 4D1SA 5LVPA 2IPXA 4O0UA 4QYGA 5A4LA 4D4YA 3N4TA 4E4XA 4BYIA 4DG3E 4WG3A 2C6DA 2GQGA 2VZ6A 5AP1A 5KKRB 3MFUA 3KU2A 3ZRKA 5HD4A 4YZMA 3LZBA 2RF9A 4TYHA 5GIPE 4IXPA 4KIKA 4RQVA 1NVRA 2VGOA 4QP7A 5CU6A 4CQGA 3FXXA 1U5RA 3U51A 4AXAA 3QGYA 4CRLA 1LP4A 4JQ8A 5HTCA 2PPQA 3IK3A 4V0GA 1QPDA 3BV3A 1YOMA 4C34A 4Z7HA 3HNGA 3G9LX 2J7TA 2HXQA 2YJSA 1OIUA 3LCKA 4H39A 4K33A 5CT0A 3VS5A 4D2PA 4NCTC 2C6KA 4J71A 3ZEPA 4AN9A 1JKSA 2VRXA 5CEMA 3GU7A 4RIYA 5KNJA 3E7VA 2OXXA 3TUCA 4FOCA 2WGJA 3LJ1A 3OY3A 5BMMA 4ERKA 5CAPA 1YWRA 3PA5A 2XNEA 3UG2A 4EZ3A 3GXLA 5ANJA 5HG8A 4ZTQA 2HIWA 4UMQA 1LEWA 3Q5IA 3KEXA 2UVXA 1GIHA 4TL0A 5JRQA 4JDIA 2PE0A 3TNWA 3AT3A 3EN4A 3QA0A 3ZU7A 1APME 5E8TA 4QTEA 2FSOX 4AUAA 4CT2A 3GGFA 4A9RA 2ZOQA 3R21A 4BI2A 4ZY5A 4O83A 4YO6A 5JRSA 1NT2A 4K6ZA 2WD1A 3BHYA 4MQ1A 3DB6A 4R7BA 3FC1X 2OG8A 4DGOA 3FMNA 2YCSA 2VD5A 4NUSA 4AE6A 4R5SA 4WBBB 5AEPA 2E9UA 1PRYA 1KWPA 2B9JA 4I6FA 4NT4A 4EOMA 4D2TA 3W18A 2HELA 4JR7A 4EOJA 1QMZA 4Y85A 3PE1A 3O23A 4UY9A 5DWRA 4BYJA 4DH3A 4OAVB 3MA6A 4IWPA 4CG8A 2CKQA 2UW9A 2WMSA 3ODYX 3OXZA 3QKKA 4MCVA 2WMVA 5DBXA 4NCTA 3C9WA 2W4KA 4MXZA 5HVJA 3NMUF 2QURA 3EH9A 3DCVA 4CCUA 1PXKA 3WF6A 5HX6A 5DT3A 4YC8A 3V8WA 2WTKB 3LXLA 3BHVA 2ITXA 4IMYA 4KBCA 5LXMA 5EKOA 3QUPA 5EM6A 3MGYA 4EH9A 4L9IA 3FXZA 4FZ6A 3A62A 4JIAA 5DG5A 4ZEGA 2ZYBA 1OL5A 3EKNA 4RG0A 1KE7A 3TZMA 4BGGA 1J7IA 4NM0A 5B2MA 5HESA 1XBBA 4FTMA 3VQUA 4ZIMA 2JIVA 3Q5ZA 2OZAB 5FBOA 2BAKA 2GDOA 4UBAA 2CKPA 5DE2A 4L67A 3GCVA 2QO9A 4KABA 4WNPA 3C5IA 4KKHA 3AD5A 2EXEA 2PVMA 4DLIA 5FG8A 5FUTA 2P55A 2JKMA 3A7IA 2UW7A 3ACKA 3QUDA 2X9FA 3DQWA 2OIQA 4PY1A 3FL4A 2YEXA 2B55A 2F2CB 5IH5A 4F1OA 4O7ZA 1OITA 5FM2A 1JKTA 1PKDA 2YAAA 3MTLA 4FIFA 4WNKA 3CD8A 5IQGA 2WQOA 3SHEA 2VWBA 4YJNA 5DNRA 3A60A 3U54A 2GFSA 3CTJA 1OL7A 3OEZA 4J8MA 4OTDA 3UQFA 3FEGA 3UVQA 3QZHA 4YPSA 3PWDA 3A4PA 2OXYA 4BICA 2B9IA 5E8VA 4C36A 4MKCA 1AGWA 1BMKA 1H08A 3GCQA 1J7UA 1MRYA 3W8LA 5J8IA 3CLYA 4IAYA 5LMKA 4IB0A 1T46A 4KBKA 4X2NA 2REIA 3P5KA 3KULB 4NZWB 3FMDA 5JZNA 4QMVA 1Z57A 3OUNB 4N70A 2G1TA 4GT5A 5E8ZA 4D5HA 4NW6A 5DI1A 2Y4IB 4BB4A 1AD5A 3DBDA 4QO9A 4G31A 5HE1A 3QQFA 4QYEA 3TEIA 5IQEA 4CFMA 4I21A 3DOGA 4O7TA 5AR7A 4ZSJA 3ZLSA 1IG1A 5A6OA 1K3AA 3L9PA 2JKQA 3Q2MA 3NIZA 3R8UA 2ITVA 4XOYA 4E93A 2QR7A 4FSRA 3WOWA 1PXIA 4LRKA 4AW0A 5IG1A 4ZP5A 2YN8A 4C0TA 3LMIA 4BZDA 4U97A 4F7JA 3V04A 3D94A 3LQ8A 2O8YA 3ZTXA 5IISA 3WBLA 4YBKA 2Q0BA 4LI5A 2G2HA 1ZAOA 2ZV9A 3H9OA 4TRLA 1PMNA 3F82A 4L46A 5E8UA 3KF4A 5AR3A 5B2KA 4XG7A 3I7CA 2R7BA 3LW0A 3BQCA 4YC6A 4QYHA 4PTCA 4AW1A 4BCQA 1FVTA 4HCUA 3BQRA 4FG8A 4MAOA 4FV9A 3I0QA 5AM6A 5AADA 1JAMA 1XH7A 3PLSA 3RCJA 5M57A 2C1AA 5CASA 3BHHA 3D4QA 3VRZA 4TWOA 1CMKE 1F0QA 4B4LA 5LWNA 4IM3A 2IVSA 4YP8A 4ZJVA 4KD1A 5BQ0A 3UMXA 3Q52A 1WMKA 5BVWA 4P4CA 3AC4A 2QKRA 4HGLA 5LCKA 4E6QA 1QPCA 4EHGA 4UWYA 4BWPA 2GNFA 1JWHA 3RAHA 3UIMA 2WTCA 4FYOA 4UMTA 5EOBA 2CGVA 3I60A 4FSNA 2CNUA 3RPOA 3W33A 3HP2A 4DG0E 2CDZA 2XUUA 3KRRA 1P4OA 5GJFA 2BMCA 2YIRA 5HLPA 4RLLA 3BCEA 4ZJJA 3A7HA 2ZV8A 2YERA 5EI6A 4CYIA 4XG2A 4C61A 1YXTA 4EI4A 4F65A 1Q8YA 2GNGA 4I92A 1ZARA 3ORPA 5EK7A 1GOLA 2BIYA 5IKWA 4QQ5A 4XLVA 3VW8A 5FP6A 3OT8A 3D9VA 4NIFB 4R5YA 1J3HA 4RFMA 1OECA 4NM7A 1OIQA 4EQUA 2CGUA 3CCNA 4CFXA 2YLFA 1H0WA 3UZRA 5DR9A 3II5A 4HVDA 4OBQA 5K4JA 2JAVA 4G9RA 5E8XA 3IGGA 3SQQA 2XRWA 1IAHA 2F49A 3NCZA 3F69A 2JAMA 3EQRA 3U6HA 5FXSA 3RPYA 5CWZA 4DT9A 3KMUA 3C1XA 4OTHA 1ZMVA 1CSNA 3KGAA 3V5PA 1JBPE 5AAEA 3DT1A 4WRSA 3E93A 4MNEA 3QRTA 3TZ7A 2IZTA 3OROA 2Z7RA 3CEKA 3GOKA 3HUBA 4D1XA 3LXPA 2Z2WA 4J7BA 4QMZA 2YISA 2VWIA 3FC2A 4KIPA 3RI1A 4EQMA 2NRYA 2BAQA 3VO3A 4ZY6A 4FMQA 4XG4A 3SXSA 3UJGA 3Q4ZA 5KMLA 2UZBA 1W7HA 4FSTA 5IA5A 1KE9A 4J53A 3MPMA 3QLGA 4C2WA 3DAJA 2VTNA 4M84A 1RW8A 3UOKA 5H8EA 3R1SA 1Q3DA 2H8HA 3KN5A 3P79A 4DE4A 4PV0A 4NKSA 1SNXA 3ZO2A 3ZS5A 3KVWA 1WAKA 2GNLA 3LM0A 4AGWA 3W2CA 4CQEA 4R78A 3FHIA 3FZOA 3DNEA 2UZTA 3R02A 3R8PA 3HMIA 4GUBA 4L68A 3RINA 4MEDA 2OH0E 2GNIA 3AGMA 1B39A 2VV9A 3AC8A 3NPCA 3VUHA 2B1PA 4Q2AA 2OKRA 4U7ZA 2BZKB 4F08A 3ZO3A 2P33A 5HCYA 4C33A 2LGCA 1GZNA 5HBEA 1ZWSA 4USEA 1CM8A 2R3MA 2GS6A 5A6NA 3WYXA 5J9LA 2J6MA 5BVDA 3R00A 3TJCA 2CN8A 2VTQA 2E9PA 3B2WA 1GAGA 2VTSA 1Q99A 3WYYA 4EC9A 4DAWA 5KMIA 5EDRA 3DBQA 4E5BA 4LMNA 5LVLA 3TL8A 4Z16A 1BI8A 5AV3A 3ZXZA 4QQCA 4RGJA 5HTIA 2EUFB 2WKMA 2P3GX 3BWFA 5FXRA 3SG9A 5C4LA 5CSVA 3QTRA 4ZAUA 5ANDA 2NP8A 5EHOA 3HP5A 4I5PA 4AQCA 2C4GA 4BCIA 2OWBA 2ZDTA 3D5XA 4QMOA 4JDJA 4A06A 4JI9A 5EM8A 3R9DA 5D11A 2PU8A 2BFXA 4UXLA 5HG7A 3EQGA 2HZ0A 4JBQA 3EQFA 3UC3A 3OF0A 5EFQA 4ZOGA 5HNBA 4EYMA 2XIYA 4QMSA 4BKYA 4B8MA 5GZ9A 3TKIA 1OKWA 2XNNA 3LCSA 5AP3A 3W2RA 2C5XA 4ZZNA 5KHWA 3PPZA 4YC3A 1MRUA 2IW6A 3VJOA 4C35A 3ATTA 2X1NA 2OLCA 4TNDA 2R4BA 3UPXA 1REJA 3L8XA 3QBNA 3ACJA 3R1NA 4AWIA 3LVPA 3AC1A 3TCPA 1GJOA 2C3JA 3GFWA 4Y5QA 3DY7A 1OB3A 4EH4A 4NJDA 5I9YA 2OF4A 3T3UA 2GNHA 3HV6A 4FSQA 3DGKA 1OZ1A 3PVWA 1W0XC 1IAJA 3NYOA 3U87A 2JDTA 1YOJA 4CEGA 3BLHA 4YJOA 3EQDA 4W4VA 4ACGA 4XNEA 3CBLA 2E9VA 2XK9A 1OKVA 2PE2A 4IB1A 4YTHA 5AP6A 2YM3A 2CLXA 3I5NA 4RVMA 3VBQA 3TUBA 3C13A 3OG7A 2ITPA 2VTLA 4G2FA 3TN8A 3QCQA 2YAKA 1RDQE 4YHFA 3LE6A 4TYGA 4DHFA 3HDMA 2XJ1A 4XHKB 4ZSEA 4FV6A 3EFJA 3FV8A 3OWPA 1M2RA 3BE2A 5FGKA 4L3PA 4R1VA 1ATPE 4DBXA 3PUPA 2PVKA 3ATSA 3V3VA 3P86A 2YHVA 3P7BA 4H3QA 4R1YA 5L6OA 4WD5A 2R5TA 2BKKA 2FH9A 5F20A 5FM3A 5L2SA 4UWCA 2XK3A 3Q9YA 2WMBA 5HNGA 3ZFYA 4HJOA 3BIZA 3IS5A 5I3OA 4EL9A 3G6HA 2OIBA 3SC1A 4YTFA 5BUIA 2R7IA 2QR8A 4TYJA 4F9YA 2XCHA 4UALA 2B7AA 3EFKA 3VWAA 3E3PA 3GU4A 1QL6A 2CLQA 5IUGA 4EK3A 1PXJA 3A7FA 3LFBA 5LMAA 2G2FA 2J0MB 3R7UA 4M0ZA 4FVPA 4QP4A 3L8SA 2C6TA 4BL1A 1SVHA 3F3WA 2O5KA 3ZC6A 4J1RA 2OFUA 2J5FA 4KS7A 2PVLA 2OZOA 3AC5A 4RWJA 3FL5A 2VTAA 2PVFA 2UZEA 3BE9A 4MF0A 4DG2E 4Q9ZA 4BGHA 5IH6A 4O96A 5K0KA 3V8SA 2VTTA 4FT7A 3BWJA 4TW9A 4HOKA 3TDWA 2WMQA 3EB0A 2YJRA 3GEQA 2YZAA 4PMTA 2C3LA 4XP0A 3WF8A 2IWIA 5DRDA 2IN6A 5KBRA 4EZ7A 3MVMA 3U8WA 4D28A 2I6LA 2YCRA 3ZLYA 3GQLA 3R0TA 4MQ2A 5AUUA 3C4CA 4IH8A 4EH8A 4C8BA 2QOOA 4MXXA 5CEOA 5CAQA 4FZDB 3TDVA 3R22A 1U4DA 1URCA 3FMHA 3VJNA 4YZ9A 3VS6A 3G51A 4FSYA 2OBJA 3T8OA 4J52A 1OKZA 4EK4A 5IEXA 4DH5A 5LOHA 2R3OA 3W55A 5FBNC 3DJ5A 4BCPA 4DTAA 3QQJA 4U43A 4AT4A 3KREA 3MPTA 4EONA 5J95A 3V5LA 2X2KA 5AUZA 3PXKA 3IDPA 5TO8A 5H2UA 4A9SA 5D12A 3THBA 2VWYA 2J50A 3OBGA 3FI4A 5JGBA 4ZS4A 3LCTA 4IM0A 5ETCA 2X8EA 1A48A 5HO6A 2WMUA 3LCOA 5HNIX 5AP5A 3Q04A 3GU5A 1TQPA 4G5PA 4LG4A 4YJQA 3N51A 4QP3A 2O65A 2GHMA 3FMMA 4F63A 5FEDA 3KXZA 2Y6OA 4XOZA 2A27A 4JBVA 3EN7A 3ORKA 2R3IA 3SDJA 1B6CB 3CTQA 3FXWA 3GCUA 3P23A 5ANOA 4D0WA 4ZZOA 5JFVA 3NVMB 4RVKA 2R3RA 1PMUA 4RLKA 2B4SB 3UC4A 4E20A 1G5SA 3CPBA 3R7VA 4U5JA 4FEUA 3QD0A 3EZRA 5IQCA 2ZB1A 3OTVA 3TT0A 4I20A 1YHWA 3VNTA 2CKEA 2RL5A 2IZUA 3HV3A 4GKHA 4ANOA 4NYEA 2BRNA 3Q9XA 3TM0A 5AP2A 1FGKA 2RSVA 5CEIA 2IZRA 3C4ZA 5KUPA 1IA9A 4CD0A 4G3GA 5BVKA 3IDCA 5IDNA 3CPCA 4CMUA 4F1MA 3LFNA 5E1SA 5A4TA 4ONAA 3COHA 3E63A 3FPQA 4RC4A 4BHZA 4C4EA 4E73A 4F4PA 1NW1A 4Y5HA 3NAYA 1O6YA 4QMQA 4O0WA 2GPHA 4X2GA 3BX5A 4IHPA 2RFDA 4I4FA 4TWCA 4C3RA 4CKIA 2GU8A 4CCBA 2YLEA 3O71A 4EHZA 4XV3A 3CS9A 3DS6A 3R7YA 3F5XA 5HTBA 4GFMA 3FAAA 5E8YA 3AG9A 5DVRA 4BTFA 1ZOHA 4FUYA 4LOPA 4RX7A 4E7WA 2V55A 3FY2A 4I24A 3QTUA 1FPUA 3E64A 4XCUA 4KSPA 2DUVA 2VGPA 1KE6A 4IFGA 3W10A 4FV0A 3BU5A 5CF5A 5CLPA 1BKXA 4O27B 4O22A 4QD6A 3ALOA 5AR5A 4GK4A 4USFA 2WTDA 1TKIA 3QQKA 4LQMA 2BZIB 3DAKA 2XNGA 3IOKA 2XS0A 3OFMA 4W4XA 5IF1A 4BI0A 2I7QA 4AW5A 5J5TA 5BUEA 1PY5A 3NW7A 4YMJA 5L6PA 4ALVA 4DEBA 5AJQA 5DRBA 3ZC5A 5AR2A 4CFFA 3UVRA 4C4IA 1XH4A 3C0HA 2W1HA 3CJGA 3ROCA 3PRFA 4RA5A 4F1TA 3IO7A 1REKA 2GQRA 3BLQA 3VIDA 2I1MA 1Y8YA 2E9NA 1DI8A 3RMFA 1WVYA 1M14A 3PPJA 4WSYA 3D14A 3R9OA 4FTUA 3ZONA 1R39A 2EXCX 2J0LA 2W1IA 4M66A 4MNFA 3MBLA 2I0YA 3HZTA 4RX8A 2VTIA 5I5ZA 5K4IA 3BYSA 4FKIA 4YTCA 3PJ1A 2GS7A 2QO7A 4U44A 4XG6A 2W99B 1Y57A 2ZMDA 1BYGA 3QD3A 2XM8A 1NXKA 1PF8A 3NRMA 4FTNA 3QRIA 2VTHA 2WOTA 4J96A 5EI2A 2IVVA 4A9YA 3DXPA 3PVUA 4UZDA 2YM5A 2YDJA 1OM1A 5AWMA 5IA4A 3DV3A 3PP1A 1XH5A 3UBDA 4PTGA 3SXRA 3ZDIA 3C4WA 4C3FA 5F95A 3HMNA 5I9ZA 3KB7A 2W1EA 3UTOA 4PPBA 5CNNA 2OW3A 2QOCA 3FMJA 3FWQA 3ZRMA 1JKKA 2WELA 3OUKA 5AUWA 5A14A 3I7BA 4OT5A 2QOHA 4FV7A 3LAUA 1LEZA 4KKGA 5A3XA 4FSMA 3DJ7A 3QZFA 5GZ8A 1Q97A 4ZMFA 4DITA 4D1ZA 4IACA 3W2OA 4G6OA 4RFYA 5IPJA 4BCJA 2UVZA 4FL2A 2R3HA 4BCHA 2VN9A 4Z3VA 4BDGA 2WMTA 4LFIA 4M97A 1PHKA 3CJFA 4O1OA 5IU2A 3QCYA 4Y83A 1M17A 3U4WA 4A4LA 4W8DA 4ZTMA 4RIOA 4O81A 1FGIA 3NDMA 4Z9LA 3GOPA 4DF3A 4DFNA 2CNVA 1Z5MA 4RJ6A 4WOVA 4RIWB 1PMVA 1KOAA 2Z8CA 2QOKA 3DB8A 3T3VA 4FODA 4FTAA 4U40A 3ZXTA 1WBSA 2BRMA 3RGFA 4PPAA 5J7HA 2PUIA 2RGPA 3D5VA 3VS0A 1FVVA 4FT0A 3E5AA 1YXUA 4CLJA 5AP7A 4MVFA 3UZTA 4ID7A 3JYAA 4OTFA 4XBUA 5C8MA 3JY0A 2HZ4A 2O2UA 3AT4A 5CU4A 3RWPA 1OMWA 1OL1A 3JY9A 2X4FA 3C4XA 2XKEA 4GS6A 4ACDA 3R73A 4QMPA 3VS7A 4D4SA 3DBEA 5DN3A 1NY3A 3I79A 4BIDA 5HCZA 4LV5A 3OY1A 4RIYB 3FKOA 3NZ0A 4U45A 3PE2A 3QYZA 4ZK5A 1G8AA 3G15A 4JR3A 4ZTHA 3QL8A 2PMNX 3LLTA 3HL7A 1STCE 2I0EA 3KN6A 4EH2A 4X3FA 5CF6A 2XVDA 3QALE 4G16A 4O7YA 4O7VA 5ITAA 5KMNA 2HWPA 4U3YA 3BGPA 3UO6A 5BPYA 4N0SA 3TG1A 3LQ3A 1I09A 2FGIA 3PJCA 4UMPA 4BCMA 1R0PA 5ETAA 3PG3A 2XK4A 2BAJA 2FUMA 4C59A 2C5YA 4AZSA 5HLWA 1H1RA 2WTIA 4I5MA 3KKVA 4OTGA 1H25A 4UX9A 4FEXA 4YJSA 3KK9A 4DN5A 3C50A 4GT3A 4F7NA 4E4LA 4P7EA 5M55A 3ETAA 4BKJA 4OT6A 5J79A 4ZSAA 3HVCA 4FOBA 2EVAA 5F1ZA 4ZLYA 4D2VA 3QC4A 5AX3A 4DGMA 1UV5A 3G33A 4K0YA 3OVVA 3OEFX 3BYUA 1E1VA 2UZDA 2XIXA 3E8NA 3CGFA 2IJMA 2R64A 2DWBA 4O86A 3S1HA 3ZCLA 5D7VA 1QPJA 2QOFA 5JEBA 4O2ZA 4ACMA 1M52A 3Q96A 4QQJA 4OUCA 5FXQA 1J1BA 5KMOA 5KCVA 2X2LA 3H9RA 4MHAA 4CFVA 4ZSGA 3I81A 2OK1A 5L6WL 3UDBA 2C5NA 5ETIA 2W5HA 5J9YA 4JDHA 4MK0A 4FTJA 4EOPA 2X7OA 3DDQA 4IX6A 3QZIA 2WMRA 4UXQA 5HO7A 4Y8DA 3EFWA 4BDJA 4KBAA 4U80A 4WBOA 2BRHA 3MB7A 5DHJA 5J9ZA 1H24A 2XNPA 3MB6A 3PVGA 3HYHA 2X7FA 2PZIA 3QTSA 5EW9A 3HDNA 1JVPP 4BDEA 4FKUA 4I4EA 4YTIA 3HRFA 4AA0A 3I6UA 4FIJA 5JK3A 4I3ZA 4ACCA 3BELA 3LXNA 1LUFA 4RIWA 3A7JA 3KMMA 3DJ6A 5JGDA 3VW6A 4CV8A 4PL5A 1XBAA 5JFSA 3VC4A 5BMSA 4NL0A 4ZLOA 3ZBFA 4H1MA 3MV5A 2VX3A 1VR2A 1OIRA 4KNBA 1KSWA 4PTEA 3ZH8A 3PP0A 5HKMA 4F09A 1K2PA 4LOQA 3IW4A 3MPAA 4S32A 2C30A 4FKTA 4E8AA 4FKLA 4EOIA 3MWUA 4QTDA 3EYHA 4H1JA 3LXKA 4HNFA 4NM3A 3JVSA 4OTIA 1YXXA 3TTJA 2GQSA 3GI3A 3TV6A 2WAJA 2IVTA 3D2IA 4PL3A 5J1VA 2ITYA 2JDRA 2VU3A 2WZJA 5AMNA 4EH7A 5M51A 1JSTA 4DT8A 2ACXA 2H96A 3NS9A 4EC8A 3F2RA 2R3LA 5FEQA 1GZOA 2WB8A 4FTOA 4QMUA 4TXCA 3UZPA 3F3VA 2R3KA 4FZ7A 1YHSA 2PZRA 4XUFA 4LL5A 3MJ2A 4BC6A 3QKLA 4BCNA 2W05A 2WTWA 4O6EA 5HORA 4ITIA 1PXOA 3CQEA 4RC2A 2XK7A 4EOOA 4FV2A 2GSFA 3D83A 4QP9A 5FQDC 4L00A 1CKPA 3G6GA 3VUGA 3ZMMA 5CAUA 5M08A 3QA8A 3EZVA 4BWKA 5K3YA 2XYUA 2RG6A 5EDQA 3FZTA 4UYNA 5HEZA 4E3CA 5J5SA 3ZM4A 4O0SA 3DBFA 2C0TA 4XYFA 4X6RA 4C58A 3SA0A 3F2NA 3IG7A 4MTAA 4BTMA 3ZSHA 4EHEA 4HYHA 4X3JA 2OO8X 3IOPA 3M11A 3DNDA 1YI6A 3KQ7A 3RHKA 3ERKA 1E1XA 4QTCA 3OWKA 4QYYA 1T45A 4D2RA 3EQCA 2DYLA 1WBOA 2W4JA 3UO5A 3D15A 4E5AX 4IB3A 5JFXA 4BDAA 5HGIA 3EIDA 3MVJA 5EW3A 2PL0A 2UW8A 2VTMA 4I23A 3VUIA 4CMOA 1H8FA 4RJ4A 2RFSA 3ODZX 4O91A 2UW3A 4PDSA 1IASA 3KK8A 1QCFA 4XV9A 5L2QA 5TF9A 4QTBA 4L7SA 3LMGA 5CZIA 1Y6AA 5CF4A 2XK6A 4EJNA 4CV9A 4ZS0A 3DQXA 1YI4A 3PA4A 4RSSA 3AMAA 2XCKA 4WNOA 5E1EA 5CYIA 2AYPA 5TKDA 3UP2A 3IW5A 5K9IA 2YITA 3DK6A 3EQBA 4XV1A 3A4OX 3PXZA 4APCA 1H28A 2KULA 3Q60A 2OJJA 1P5EA 4BZOA 3ZM9A 4JG6A 2A19B 4RIXB 4RBLA 3QX4A 4WIHA 4AGCA 1KE8A 4DH7A 4DGLC 3RHXA 5HQ0A 5CQWA 4U41A 4P90A 4EKKA 3Q2JA 3HRBA 5C1QB 2ZDUA 3KA0A 4PPCA 4AOIA 4D2WA 1ZY5A 4KRCA 2PVYA 2R3QA 4GU6A 2UZWE 1XHAA 2QNJA 2X7GA 1GNGA 4FV8A 4NM5A 1PXPA 4HGTA 4NU1A 1NA7A 4X3FC 5CU2A 3C51A 5ANGA 2GHLA 3F7ZA 1LR4A 3HRCA 3D2KA 5DR2A 5HOAA 3UNZA 3CQWA 3VN9A 4MX9A 2OSCA 4L3LA 5JT2A 1UU8A 4GIHA 4HGEA 5HCXA 4FKPA 4PMSA 5DEYA 3ET7A 1DI9A 1EH4A 2UVYA 1ZXEA 2XMYA 5KHXA 3NUNA 4B99A 4YPDA 3D7TA 2Y7JA 2X8IA 4EKLA 2V5QA 5I9XA 3EHAA 4FIEA 3OD6X 4FNYA 5GJGA 4TPTA 4JJRA 2JC6A 4X7QA 2GTMA 5ACKA 3OC1A 5HU3A 3FI3A 5HG9A 2C3KA 4EORA 4YLJA 4M7IA 2Y0AA 1ZYCA 3GBZA 4O0RA 5FTOA 4AA5A 2AC3A 4OGRA 4NIFA 4U79A 5IUHA 2J90A 5CU3A 1R0EA 1ZZ2A 3QRKA 3CGOA 4WRGA 1YI3A 3PJ8A 1XKKA 3ZO4A 4JG7A 4Q9SA 2JEDA 3DKFA 4WG4A 3JVRA 3OZ6A 2YCQA 5E8SA 1MUOA 3KRWA 3IGOA 4QMLA 4RA4A 1GIIA 1BL7A 2PWLA 3AT2A 3LIJA 3COKA 4JLCA 4ZZMA 5C8KA 4CZTA 3NLBA 2JIIA 5M09A 3PXQA 3PJ2A 2C47A 4W9WA 4M15A 3QQHA 3IDBA 4F0GA 5AA9A 1U46A 2CCHA 2Q0NA 3MA3A 5HO8A 1NVSA 2ERZE 5E8WA 3VAPA 3MDYA 4BDCA 2XP2A 2FSMX 1MRVA 2F57A 3CP9A 4QPSA 3FBVA 4F7LA 1O6LA 1DAWA 1UU3A 2YIXA 3F9NA 3FSKA 3KVXA 3NCGA 5JN2A 4M68A 4JX7A 5FLFA 2VO6A 1I44A 3S95A 5HG5A 2ESMA 5E4HA 2EB3A 3R6XA 3FSFA 5G6VA 3UNJA 4E6AA 3F7WA 4YJPA 3UVPA 4IDVA 2G9XA 2H34A 2Y8OA 4IX5A 1Q61A 2XA4A 3FHRA 4ZTNA 4LYNA 4DEIA 4GJ2A 3Q6UA 5ETFA 2X81A 4L6QA 5DR6A 2C6EA 3EQPA 2WFYA 5D10A 5KMMA 1WFCA 4CKRA 1IRKA 3EOCA 3FKLA 5M56A 4C37A 4G1WA 3AGLA 1O6KA 3POZA 2F4JA 3MVLA 4FC0A 3PY1A 4HVIA 2PUNA 3WIGA 3M42A 2XF0A 1PMEA 4OAUC 4KKEA 3WILA 5DT0A 1OPJA 4G9CA 3UOHA 2X8DA 5AUYA 4D4VA 2ZM1A 4ASDA 3R7OA 3LHJA 2IZSA 4XBRA 4O7LA 2WEVA 2WTVA 5KMJA 4EOLA 2YZLA 4RMZA 1U54A 4CG9A 3GUBA 3HV5A 4K77A 3MH2A 4JBOA 4Y72A 1H0VA 3TIZA 3Q6WA 1CKIA 4X2FA 3O96A 3MFTA 3ULZA 3QTZA 3DFCB 2BALA 4LRMA 4NH1A 2J0JA 5DIAA 4HPUE 5HZNA 4BCGA 5IA0A 2H9VA 4RPVA 1ZYLA 4ZMEA 5L2TA 4MD8E 4FV1A 4IZAA 4YSJA 2QC6A 2JLDA 2V7AA 3FYJX 3NW5A 3BHTA 5HHWA 5AM7A 4GCJA 4AZFA 3QAME 4MD9E 3C0IA 2E9OA 2UZNA 3DZOA 3BRBA 4Y46A 5AP0A 5CANA 2OI4X 2O0UA 4QP1A 2ZM4A 4XJ0A 4RJ8A 4GKIA 4C2VA 3P7CA 1PXMA 3RPSA 2XNMA 3VVHA 3BYMA 5K0XA 4GJ3A 3U6JA 1UKHA 2IO6A 2ZB0A 3REPA 4O0YA 3RM7A 4F0FA 1F5QA 1DAYA 3OW3A 4FKSA 3WZEA 4CMTA 3E8EA 3MFSA 4LGDA 4X3FB 4BRXA 4HW7A 4F7SA 3NSZA 3ZOSA 5KE0A 1GIJA 2FSTX 3KXHA 3QCSA 3SD0A 3ZHPC 5AV0A 3MS9A 4JDKA 4EK5A 4KIOA 3UOJA 2YWPA 4GT4A 4JXFA 4UV0A 3SOCA 5LWMA 2ZAZA 3NYNA 3I5ZA 3ORTA 2W1CA 4AW2A 4IWQA 4DFBA 3R28A 4DGGA 5EQYA 4CFWA 2C1BA 2VTPA 1H1SA 5EYMA 3F66A 2ETRA 5A4EA 4HZSA 5DYJA 3D7ZA 3R30A 4TYEA 4U42A 4ZTRA 2J9MA 3MH1A 5K5NA 1Q24A 4FTLA 1SNUA 5M44A 5HIBA 4BTJA 2BPMA 2BUJA 2UZVA 1Q62A 4NTSA 2BHHA 3L9LA 2BILB 4RWIA 4GVAA 3NEWA 3KFAA 4AGUA 4O1PA 3RAIA 3EN5A 3CKWA 2BTRA 4NSTA 3TJDA 2C5OA 2GHGA 2XKDA 3L8PA 2O63A 4BIBA 2JFMA 3QFVA 3ZSGA 1LPUA 5DMZA 3UO4A 4OTWA 5GZAA 5J1WA 5T6KA 4BN1A 4ASZA 5BVFA 2HWOA 1JKLA 2BFYA 4L01A 3JR1A 4PNKA 4FNZA 5AUTA 3MESA 2FVDA 3BBTB 3E92A 4YJRA 4DCEA 2W9ZB 4CYJA 3FY0A 5A4CA 4ANNA 5IH4A 3MH3A 2YA9A 4GG7A 1UU9A 2CGWA 4TY1A 3V51A 2CCIA 4FKVA 5E9EA 2OIDA 3W2PA 3EQIA 3COIA 1YW2A 5I0BA 1UKIA 4K11A 3SVVA 2B54A 3G2FA 3KRLA 2VTJA 4GK3A 1FBNA 4QP6A 4FG9A 3WZDA 2XIKA 3L8VA 3QQLA 3QXPA 3FE3A 4DA5A 1JPAA 2BRGA 4ITHA 2HW6A 3QGWA 1HCLA 3BGZA 4GSBA 4IAKA 4YZNA 4HVGA 2B9HA 3S00A 2Z7SA 3JS2A 5G1XA 4C7TA 2WU7A 4E26A 3OOMA 4ZTSA 4FTKA 5IA2A 4O7WA 4DEEA 2QG7A 3BYVA 4UZHA 3PWYA 3BBWA 4IIRA 4TTHB 3PDTA 3B2TA 4I41A 4YHTA 4HVHA 1J7LA 3TZ9A 1ZMWA 3DTCA 3Q4CA 3ZLXA 1ZLTA 5M4UA 3LFSA 2XJ0A 3ORMA 4GIIA 2C6MA 3U4UA 3QTXA 3TWJA 5LMKC 4U3ZA 4LUDA 4ZY4A 3O0GA 4FSWA 4DH8A 3Q3BA 5C26A 4RZWA 2C68A 4CT1A 4AFJA 1U5QA 3RALA 1Q8ZA 3C5UA 4O7RA 3PVBA 5HLNA 4BIEA 1PXLA 3MN3A 5CI7A 4X0MA 1ZMUA 1VYWA 4I0RA 5A54A 2ITTA 3WZUA 4F9WA 4YSMA 1W84A 4IWOA 5L2WA 4F9AA 3V5TA 3R8LA 1W98A 1PYEA 4FIIA 2G2IA 2PK9A 1IR3A 3O51A 2X4ZA 4KAOA 3V5WA 2ITUA 2G01A 4A9UA 3UE4A 5LVNA 3OWLA 3BU6A 2Z7QA 2EU9A 4P2KA 3KMWA 3UMWA 4D9TA 2QO2A 3O7LD 2CNQA 5JQ8A 4TYIA 2F7ZE 4J98A 2JDSA 2WQEA 3FQHA 3L9NA 4NWMA 3SW4A 4KIKB 1R78A 5GHVA 4O7NA 4S30A 2UW5A 4G3CA 4HVSA 2ETKA 2B53A 3NWWA 4EUUA 3C4EA 3GU8A 3SG8A 3NUYA 3QTWA 4FGBA 3V5QA 4AZVA 4PMPA 2VNYA 4IZ5A 5HX8A 3ZEWA 5L4QA 3QHRA 1OL2A 1HOWA 1RQQA 4LV8A 2X6DA 4ZSLA 3N4UA 4YZCA 3SLSA 1CDKA 2JGZA 4X6QC 4FTRA 3T9TA 4RX5A 4MNEB 4II5A 4BDBA 4KRDA 1ZYSA 3NAXA 4CZUA 3UODA 2ITZA 4AG8A 2QHMA 1NVQA 3A61A 1OKYA 2P0CA 3CKXA 5GNKA 4B0GA 4YURA 3ENHA 1F3MC 4GYIA 4QP2A 5CAVA 3RAWA 5FWKK 3HUCA 4C4FA 5AX9A 3NYXA 1YDSE 3EL7A 2R3PA 3DFAA 4E1ZA 4FEVA 1H4LA 4R3CA 5AP4A 1Q41A 1S9IA 4XG9A 2PMLX 3ZUVA 3HA8A 5K5XA 3PZEA 4C4HA 5BVEA 2J0IA 4OTRA 3PPKA 3CSVA 2VAGA 4QQTA 3CE3A 3G90X 1OI9A 1P2AA 2V7OA 5IQFA 1JQHA 3NUSA 2WQBA 3M2WA 4PNIA 3RZFA 2J51A 1PKGA 4BKZA 5AIKA 3Q53A 4M13A 5D1JA 5LJJA 2XBAA 2PZPA 3OCBA 4DTKA 3T9IA 3FMKA 5HBHA 5BVOA 5IMXA 5JFWA 4O82A 3NYVA 3ZUUA 5EM7A 4EK8A 5L2IA 5C03A 3N9XA 3ZSIA 1W83A 1YHVA 4RRVA 3BPRA 3ZLWA 2UW0A 5TE0A 4AX8A 3OMVA 3IQ7A 4GG5A 2B9FA 4MXCA 4RWLA 4FG7A 3VBYA 3FDNA 1UNLA 1MP8A 3LPBA 4AN2A 4EQCA 4GH2A 4IAZA 4ITJA 3NGAA 3KRXA 3MI9A 3MTFA 3MY1A 3FLQA 2B0QA 3IPHA 3RWQA 3PY0A 4M67A 2ZVAA 2QCSA 3IW8A 3FLNC 3NNXA 5TR6A 4DFYA 1H00A 5I9VA 5H9BA 5IQBA 3QLFA 2O64A 4KB8A 4ZLZA 5IQIA 3E8DA 5E7RA 3P1AA 2YABA 1L8TA 4IJ9A 3KXGA 5AR4A 3LFDA 4EOQA 2W1ZA 2GS2A 2F7EE 3SAYA 3KC3A 3PTGA 3ZUTA 2YCFA 3BHUA 5AUVA 1KE5A 1ZOEA 4I1ZA 3FLSA 2QI8A 1JNKA 3H0YA 4HYUA 3GC0A 4LGHA 1R3CA 3CD3A 1ZY4A 1KV2A 4QOXA 5EI8A 2C69A 3NUXA 2G15A 4GL9A 2UZUE 4A07A 3TTIA 5C9CA 4TN6A 3WARA 2W7XA 3VUMA 4DTBA 2HW7A 5I9WA 4C57A 3AD4A 4B6LA 3TNHA 2WQMA 3C7QA 4BF2A 3VQHA 1ZZLA 3MYGA 1H01A 2BVAA 2OF2A 3AXWA 3HKOA 4H36A 4JRNA 5AR8A 3SRVA 4QMNA 4PUZA 1E9HA 3LJ2A 2NPQA 2BZHB 2UZLA 3FMEA 4NEUA 2Y9QA 3TXOA 2QLUA 1Q8TA 4BDHA 4WA9A 4XP3A 4RJ3A 3R7EA 2NRUA 3PIYA 2XM9A 4F9CA 4RWKA 3HMOA 3D0EA 4F6WA 5JQ5A 2FYSA 1YXVA 3VS2A 3RZBA 2AC5A 3O8UA 5EOLA 4AE9A 4UWBA 3HGKA 3KXMA 3OW4A 4ORKA 3O50A 3R2BA 5CSXA 3JPVA 3EMGA 4M12A 3EKKA 4GW8A 3RJCA 4DEAA 4FIGA 4NK9A 4MH7A 4AF3A 2CPKE 3ORXA 3P78A 4RIXA 5DPVA 3QC9A 1OUKA 4D9UA 1SZMA 3PIZA 2XIRA 2VWWA 2GNJA 2FB8A 2QVSE 3DKOA 4HYSA 5CALA 2YIYA 1UA2A 4QMXA 3PY3A 3E3BX 2SRCA 4HNIA 4IQ6A 2WIHA 4U0IA 4IVAA 4M3QA 4Q5HA 3TI1A 4ANBA 1PYXA 4GMYA 3M1SA 3UOLA 4YNOA 4O38A 3DDPA 3F88A 1SVEA 4IX4A 4MXAA 3NX8A 3GCSA 3VUKA 4DH1A 5IZFA 3S3IA 2WXVA 4WKQA 4FKOA 2BROA 1YKRA 3Q4UA 4JAJA 3RNYA 5BUJA 5BVNA 5IDPA 3O7LB 2WEIA 4GEOA 4V0GB 2W5BA 3S2PA 2JFLA 4QMTA 4YLLA 5IQHA 1VYZA 4WT6A 2OH4A 5ANKA 5EDPA 1XWSA 3R9NA 4H58A 5CAOA 2HOGA 3QWKA 2C6IA 4B7TA 2FSLX 3DK3A 2JD5A 5BYLA 2OZAA 4GVJA 3DPKA 2XYNA 4WG5A 3MY5A 3EWHA 4FNWA 4G5JA 4QMWA 4U6RA 4G6LA 5EW8A 3PYYA 4N6ZA 5I4NA 1DS5A 4JAIA 4CFUA 4L44A 5FDXA 2BIKB 1ZYDA 2JKKA 2QHNA 5CEPA 2XIZA 5HI2A 2WMXA 3CY3A 3QD2B 5CEKA 3LQ5A 2WPAA 3WZJA 2ITQA 4K2RA 3D5UA 3FKNA 3K2LA 4MXOA 2HCKA 2HK5A 1URWA 2X6EA 3B8QA 2JKOA 4FV5A 3LFAA 2E2BA 2HZNA 4AT3A 2Z60A 4KINA 3RNIA 1U59A 3U9NA 3VRYA 3ORZA 4BI1A 1FOTA 2ZJWA 5F94A 3P0MA 3ZZWA 1G3NA 3Q32A 2H6DA 3V6RA 4TNBA 4H3BA 3C0GA 2HY81 1TVOA 3NW6A 3K5VA 4M69A 3MW1A 4MWHA 1O9UA 3IW7A 5CX9A 1YXSA 4EK6A 1M7QA 4J97A 4CRSA 2WTKC 3OXIA 4QPMA 4DFXE 3R71A 5IA1A 5CVFA 3AOXA 4IADA 3PXFA 4X2JA 3E7OA 4C38A 4Q5EA 4I0SA 3ZRLA 1UWHA 2W0JA 2Y4IC 2VTOA 3FYKX 4IZ7A 4YJUA 1BL6A 4D0XA 4YR8A 4USDA 4QMMA 3QHWA 3MFRA 3OS3A 4PX6A 1BUHA 3S4QA 4F9BA 3FZPA 4AZWA 2PTKA 4TYHB 1OIYA 2OGVA 3MH0A 5CVHA 2OJ9A 2AUHA 3PFQA 3SKCA 4K18A 3UQCA 5DLSA 2PVRA 5I9UA 3H10A 3G5DA 4N4SA 4M14A 2C6OA 2XEZA 4HCTA 3G0FA 3TNPC 4YLKA 4UEUA 2OFVA 2KTYA 3W2QA 5I3RA 4DFUA 4DEGA 3QTIA 4O0VA 2VWXA 2YFXA 3KXNA 2C5VA 4HPTE 5HU9A 3FUPA 3VF8A 4R3PA 2F9GA 2WQNA 2XH5A 4K9YA 1RE8A 1ERKA 1ZRZA 2WMAA 4OR5A 1WZYA 3BGQA 3PG1A 2A0CX 4L45A 5KBQA 5IQDA 2PHKA 2HY0A 2P2HA 1YQJA 1SYKA 3W1FA 4R7HA 3MJ1A 4MXYA 1WBTA 4FGRA 2XBJA 3GC7A 3F2AA 4AZTA 3EN9A 4E4MA 5AV4A 4XG8A 4D55A 3DKGA 4IZYA 4M69B 2BDWA 3ULIA 3V6SA 3KCKA 4JOAA 4JX3A 4MBJA 4QPAA 4HZRA 4R3RA 1X8BA 2ITNA 3NUPA 4L43A 3RK9A 2R3NA 1TQIA 2RKUA 4FA2A 2WNTA 4K1BA 4EBWA 4FL3A 4G3FA 3SGCA 3PJ3A 4PWNA 4FK3A 3QF9A 3PRIA 4TWPA 5HICA 5AUXA 2QOIA 4BDDA 5FTGA 5M06A 2C0OA 3RBWA 5BNJA 3ENMA 3UYTA 3R1QA 3R63A 4YBJA 4PL4A 3F3ZA 4ZTLA 3RKBA 2BR1A 4AA4A 3I1AA 2CGXA 4MBLA 1BI7A 2IW9A 5L8JA 4FEWA 3F6XA 1XH8A 3QQUA 3RP9A 2F2UA 2WU6A 4I94A 3FJQE 5LVOA 4YZDA 3KF7A 4WUAA 3COMA 3LLAA 3R7GA 3BEGA 1XH9A 2ZV7A 4NJ3A 2IG7A 2BHEA 3FZ1A 3OT3A 4RFZA 4FUXA 1OL6A 4DEHA 4YNEA 4I5CA 1KUTA 4J99A 1AQ1A 2PVHA 2V0DA 2W17A 1Y91A 3PSCA 1ZYJA 3VBTA 4AN3A 4ANLA 3PXRA 4AAAA 4MD7E 3E88A 4WNMA 3K5UA 2JBPA 5HVYA 2JBOA 3OWJA 2FA2A 1CKJA 4FTTA 4X2KA 5D7AA 2XK8A 2QLQA 3JUHA 3WIKA 4EH5A 3TNQB 4V01A 3CR0A 4NW5A 3F3TA 3ORLA 3I4BA 4E6CA 4BR3A 4M0YA 1KOBA 4NTTA 5LCJA 2V62A 3UPZA 5EKNA 1G8SA 3MVHA 3R1YA 4OTQA 1YWVA 2UW4A 3GP0A 3LFFA 4FBXA 2QKWB 2YDKA 4ANMA 3MSSA 2WO6A 4FTIA 4GK2A 5F9EA 2A4LA 1YWNA 5EQPA 2QOBA 2QD9A 4IEBA 4DEDA 4I6BA 2PVJA 2X0GA 4ANSA 5JZJA 3WE4A 2P2IA 2CMWA 5CTPA 4RX9A 1QPEA 3DK7A 3DZQA 2ETMA 3WF9A 3BU3A 4FYNA 4PDYA 3VBXA 1J91A 2YWVA 3EYGA 3Q4TA 4EH6A 1OPLA 3L9MA 4W4WA 3UP7A 4U9AA 4XRJA 3VBVA 5KO1A 2RFNA 5HD7A 5GIOE 5EYCA 2WTJA 4TT7A 4RC3A 4BDIA 3O17A 4FL1A 5KZ0A 2WMWA 4EHVA 1XJDA 3SRVB 2GMXA 4JL9A 4RQKA 2BCJA 5D9HA 5L8LA 4O7SA 2CJMA 2J0KA 2PZYA 4U8ZA 4BVUA 5H8BA 4CVAA 4YU2A 4DGNA 4YJVA 1UWJA 4JRVA 1W82A 1WBNA 2A1AB 3GT8A 3GU6A 3ORIA 4P5QA 4LL0A 3ZZEA 4B8LA 1XQZA 5AAGA 4ANQA 5KZIA 3FI2A 5AA8A 3A2CA 5ANIA 5BX0A 1Y8GA 4AFEA 3ZBXA 5T68A 1Z9XA 2JDOA 2DS1A 3TKHA 2O3PA 4OW8A 1WBWA 2VX1A 2C0IA 1SM2A 1MQBA 2VNWA 4AP7A 4XS2A 3IECA 3NUUA 3VULA 4DLJA 1XH6A 5H3QA 1FINA 4O2PA 4IBMA 3E8CA 2NO3A 4ZXTA 2OU7A 3TV4A 4DYMA 3QCXA 4ACHA 3GCPA 3RPVA 3VS1A 3VS4A 1WBPA 1FQ1B 4FV3A 5HIEA 3UNKA 4I93A 3V01A 3D7TB 3ANRA 3FMLA 4FTQA 5IQAA 1YOLA 3FPMA 2XEYA 3NVKI 1YDRE 3Q9WA 1IA8A 4G34A 4RVLA 3R8ZA 5JGAA 3RK5A 5CENA 3LFEA 3VHKA 4RZVA 3ZFXA 5CQUA 2R3FA 4BDFA 4Y73A 5JMSA 1CTPE 3MY0A 4QRCA 5B7VA 2YIQA 2XZSA 3RM6A 1OGUA 1VEBA 1M7NA 2HXLA 3OHTA 4BFMA 2ONLC 3QX2A 2JITA 2QU6A 4IB5A 3EFLA 3HECA 4C4GA 3DBCA 4KA3A 3R2YA 3VF9A 3F5PA 2RIOA 3HEGA 4R8QA 3H4JA 2XKCA 2EB2A 4W4YA 4WSQA 2DQ7X 4QT1A 3DA6A 4W8EA 5CS6A 4BZNA 3OTUA 4TWNA 3PLAE 2R9SA 2UZOA 4FICA 2PVNA 3AC2A
chains in the Genus database with same CATH superfamily
2PY3A 3SV0A 1YDTE 1L3RE 2CKOA 4DCAA 4BHNA 4DBNA 2I0VA 2X39A 3HV7A 4JVGA 2UV2A 3BI6A 5AAFA 4BBEA 3LOKA 3NIEA 4FTCA 3ZO1A 4F6SA 1XMMA 3UIBA 4OTPA 2W1FA 2PSQA 2QOQA 2YIWA 3NNWA 3R04A 2HAKA 4IVDA 4UB7A 4PDPA 4W9XA 2NYAA 3LMHA 4CNHA 3TACA 2ERKA 4FKWA 4IX3A 2XKFA 2I40A 4E4NA 4EWQA 1DM2A 4IC7A 3RAKA 1WBVA 4CXAA 3TV7A 3W16A 3LM5A 3KCFA 5DH3A 3I6WA 4QNYA 4B9DA 4E6DA 4FNXA 2EXMA 3HMMA 4XEYA 3HV4A 1OBDA 3UQGA 4KIQA 3QKMA 5EYKA 3AC3A 2X0QA 4RT7A 2C3IB 4GRBA 1V1KA 2WOUA 3FI8A 2R3GA 3K3JA 4O6LA 2X2MA 4D2SA 3FLYA 4P5ZA 4CKJA 4APPA 1PXNA 2CHLA 3SOAA 3QUEA 1H26A 5DGZA 5JKGA 5L8KA 3GQIA 1TFFA 4FT5A 3VUTA 3QD4A 3SX9A 5E90A 2W1DA 3AQVA 1FMOE 1WVXA 4L7FA 5CSWA 3BEAA 5HE3A 5TT7A 4G3DA 5IMEA 5CI6A 2BZJA 4ZJIA 1P4FA 4FK6A 4I22A 4UMRA 4KWPA 4BWXA 4EOKA 2QONA 2Y4PA 2X9EA 4FT9A 1YVJA 3LFCA 4CFNA 3BKBA 2UUEA 4FX3A 3FZSA 3R9HA 2FO0A 1FMKA 3A8WA 4ENYA 4EYJA 2BRBA 3IKAA 4RJ7A 4XG3A 4F99A 4I6QA 3E87A 1TQMA 3POOA 2J2IB 4AQKA 3U9CA 2NNWB 2IVUA 1H1QA 4HCVA 2XJ2A 4MF1A 5CXHA 3HX4A 4UMUA 2WIPA 1SVGA 1H27A 5HE0A 4BCFA 3KRJA 3PSBA 4F70A 4FT3A 4C4JA 1MQ4A 3RTPA 4D58A 4XP2A 4IVCA 5IEVA 2XRUA 2XNOA 3BL9A 4PP9A 5H8GA 5EG3A 4E5WA 3HLLA 4I6HA 4S2ZA 5A46A 4CGAA 3HAMA 5M4FA 4L8MA 3WE8A 2PE1A 4CTBA 3OP5A 4OLIA 1Y6BA 4JNWA 2A2AA 5CY3A 1Q8WA 5DT4A 2OJGA 2BDJA 3OCTA 4PRJA 4WO5A 5B2LA 2OICA 3P08A 3FZRA 1R1WA 4PDOA 3CXWA 4Z7GA 4X21A 4GU9A 3R9RA 3NNUA 1Q8UA 3FLZA 3QWJA 3P4KA 4FIHA 4RJ5A 3PXYA 1M2QA 4FKGA 2B52A 4LOOA 2HYYA 4IC8A 4JBPA 5T3QA 4XLIA 5HBJA 2PUUA 2VWVA 4L53A 4EBVA 4Y95A 3R83A 2ZFYA 3EJ1A 4FZAB 3F3UA 4NKAA 2W96B 3I0OA 4G6NA 4GV1A 5EH0A 3K3IA 1S9JA 3CC6A 3GNIB 4PP7A 2AEGA 4IE9A 4PQNA 3AMYA 5A4QA 4XV2A 4BCOA 4DFLA 4L52A 4FZFB 4C02A 5BYYA 3WI6A 3BLRA 4XX9A 4A4OA 4FVRA 5GJDA 3WF5A 2Z02A 3VUDA 4D4RA 5CVGA 4DFZE 3OBJA 4JIKA 4MBIA 4PF4A 4QMYA 2PMOX 3W2SA 5CU0A 3AD6A 1UNHA 3C4FA 4ALWA 4CZYB 3QXOA 3FQEA 4IM2A 1GY3A 2VWUA 5DEWA 4EWHA 4L3JA 2CSNA 5C8NA 2VX0A 2P4IA 4AOTA 5F4NA 2GFCA 2OJIA 3F61A 3G0EA 4CTCA 3MIAA 2F7XE 5CXZA 1JSUA 4D5KA 4BBMA 5LVMA 3AKKA 2YM4A 1PW2A 1ZOGA 4R77A 3U55A 3HMPA 3LCDA 3H9FA 4IDTA 4WHZA 4YZBA 5B0XA 5LQFA 3U6IA 5ACBC 1JSVA 3R8MA 4FE2A 1BLXA 2RFEA 4O84A 4EJ7A 3KL8A 3BZ3A 4GYGA 4KSQA 3CQUA 3ORNA 1YRPA 4FV4A 5CF8A 4OBPA 4BCKA 1XO2B 4Z55A 4FKQA 4NFMA 2BKZA 2OJFE 3UIUA 1Q4LA 3DKCA 1H07A 2QQ7A 2RG5A 2V22A 4WUNA 3RVGA 5HVKA 2BDFA 2BTSA 4A7CA 4N57A 3A8XA 1HCKA 4H3PA 4LRJA 1VJYA 3DLZA 1OUYA 2YM8A 4NFNA 4FR4A 3RCDA 5JH6A 1V0PA 3P9JA 3A7GA 1WCCA 3QRJA 3DLSA 5KX8A 3W32A 3ZYAA 2LAVA 2WHBA 5AV1A 2OXDA 3OOGA 4HYIA 3GC8A 1JLUE 4JG8A 1Q5KA 2ONLA 3OCSA 4LMUA 3S0OA 5ANEA 3F5UA 4FI1A 2IW8A 5FP5A 2QG5A 5EHLA 4OBOA 3NNVA 5HIDA 3EQHA 3WZKA 3EN6A 3LKMA 4DC2A 4QTAA 3AMBA 1JOWB 3H0ZA 5C27A 5AFVA 3ALNA 4FKJA 4F0IA 3TUDA 2QOLA 5C4KA 4G17A 4PMMA 5EQEA 1XBCA 4A4XA 3ZDUA 2VWZA 1RJBA 5EM5A 3RPRA 3QQGA 5BYZA 2I0HA 5M4CA 5J87A 4QYFA 3QRUA 5TOZA 4IAIA 5CSHA 1J1CA 2PYWA 3VHEA 5HE2A 5CEQA 4U81A 2J4ZA 3LFQA 3MIYA 2YACA 3HAVA 3ROYA 3GENA 3KULA 3UYSA 3UGCA 3B8RA 3H3CA 2JDVA 2YDIA 4FEQA 5DA3A 2UW6A 4I0TA 4DINA 5IEYA 3FLWA 4JT3A 3K54A 2Z7LA 3NR9A 3SW7A 4ASXA 1XR1A 3GFEA 4TZRA 2QU5A 5FEEA 4G3EA 4IVBA 3HA6A 4GFGA 5CSPA 2R2PA 4CSVA 3UDZA 4BDKA 1W2FA 4IJPA 2HZIA 3R01A 4S34A 4AT5A 2GCDA 3H30A 5EHYA 3PA3A 3W8QA 5DOSA 1SMHA 2XB7A 3BYOA 2W1GA 3OXTA 2VO3A 3GVUA 2YM7A 4EOSA 3KY2A 1V0OA 4MYGA 1A9UA 2R0IA 5AIRA 4AZEA 3BV2A 1FVRA 5ICPA 1UVRA 3ZFMA 3TNIA 2PUPA 1A06A 4BY9E 4EUTA 1IEPA 1UNGA 4FF8A 5IA3A 3V5JA 1B38A 1UU7A 3P7AA 1OBGA 3ID6C 4IAFA 3VBWA 5CNOA 5IUIA 4QP8A 5LMBA 5E92A 4AU8A 4AGDA 1P14A 4MWIA 4XH6A 4AS0A 3DAEA 1U54B 3CIKA 1GZKA 4QNAA 5FD2A 4YJTA 1OVEA 3CTHA 4FVQA 4LGGA 4LM5A 4V04A 4BGQA 3QU0A 2PULA 2IEWA 4EH3A 5M53A 5DFPA 5LARA 4KS8A 1VZOA 3IW6A 2PMIA 2W9FB 3R7IA 2ZMCA 3D5WA 4K8AA 3RK7A 4AOJA 5M4IA 3ANQA 5C01A 2VTRA 4IFCA 3DXNA 5J7BA 2XAMA 3EL8A 4L42A 3WF7A 2ITWA 4JS8A 4N6YA 4RVTA 4IAAA 5AV2A 5FDPA 4XMOA 2C6LA 3A99A 1M2PA 4J95A 4C3PA 3IONA 4KUJA 4H05A 2ITOA 2ZM3A 2VUWA 3PIXA 4R6VA 3TIYA 2GTNA 2ZV2A 4YO4A 2R3JA 4HGSA 3UIXA 4GUEA 2YM6A 5E91A 4AACA 3LJ0A 4M8TA 3QZGA 4CLIA 4JQEA 4ALUA 5L3AA 3DU8A 4UN0C 3QYWA 2QODA 5KMKA 2JIUA 1K9AA 3Q9ZA 3PSDA 4GFOA 4BTKA 1BX6A 5A9UA 4FSZA 4O0TA 3O2MA 2XNBA 1KV1A 3TKUA 2EWAA 5GINE 4F64A 4IWDA 4S31A 2VO0A 1WVWA 1W8CA 3O8PA 2W4OA 3R8VA 3DTWA 3G9NA 3FQSA 4FKRA 1ND4A 2J5EA 3L1SA 4J8NA 2Q83A 5D41A 4O21A 2HENA 3SXFA 1H1WA 3OCGA 3E62A 2W5AA 3PZHA 4JQ7A 3JXWA 3O8TA 4A9TA 3N4VA 4O0XA 5FRIA 4ERWA 3GB2A 2VO7A 1PJKA 3ELJA 3F5GA 4ASEA 2XALA 2R0UA 5KKRC 3NUAA 2Y6MA 1H1PA 3VS3A 4YUQA 4ENXA 3KXXA 5CZHA 5FTQA 4YGAA 3V8TA 4F6UA 1GZ8A 2CN5A 3GC9A 4ARKA 4EZ5A 1V0BA 4I5HA 4LUEA 4XRLA 3TZ8A 4C62A 5JSMA 5M07A 3CY2A 4UYAA 4BBFA 4EEVA 1Q3WA 4O4BB 5EYDA 3UG1A 2W06A 5CT7A 4S33A 4V05A 4YHJA 4R7IA 4IANA 4IW0A 4FSUA 3QTQA 3ITZA 3DXQA 2PZ5A 4TKSA 1OPKA 4D1SA 5LVPA 2IPXA 4O0UA 4QYGA 5A4LA 4D4YA 3N4TA 4E4XA 4BYIA 4DG3E 4WG3A 2C6DA 2GQGA 2VZ6A 5AP1A 5KKRB 3MFUA 3KU2A 3ZRKA 5HD4A 4YZMA 3LZBA 2RF9A 4TYHA 5GIPE 4IXPA 4KIKA 4RQVA 1NVRA 2VGOA 4QP7A 5CU6A 4CQGA 3FXXA 1U5RA 3U51A 4AXAA 3QGYA 4CRLA 1LP4A 4JQ8A 5HTCA 2PPQA 3IK3A 4V0GA 1QPDA 3BV3A 1YOMA 4C34A 4Z7HA 3HNGA 3G9LX 2J7TA 2HXQA 2YJSA 1OIUA 3LCKA 4H39A 4K33A 5CT0A 3VS5A 4D2PA 4NCTC 2C6KA 4J71A 3ZEPA 4AN9A 1JKSA 2VRXA 5CEMA 3GU7A 4RIYA 5KNJA 3E7VA 2OXXA 3TUCA 4FOCA 2WGJA 3LJ1A 3OY3A 5BMMA 4ERKA 5CAPA 1YWRA 3PA5A 2XNEA 3UG2A 4EZ3A 3GXLA 5ANJA 5HG8A 4ZTQA 2HIWA 4UMQA 1LEWA 3Q5IA 3KEXA 2UVXA 1GIHA 4TL0A 5JRQA 4JDIA 2PE0A 3TNWA 3AT3A 3EN4A 3QA0A 3ZU7A 3BL7A 1APME 5E8TA 4QTEA 2FSOX 4AUAA 4CT2A 3GGFA 4A9RA 2ZOQA 3R21A 4BI2A 4ZY5A 4O83A 4YO6A 5JRSA 1NT2A 4K6ZA 2WD1A 3BHYA 4MQ1A 3DB6A 4R7BA 3W0RA 3FC1X 2OG8A 4DGOA 3FMNA 2YCSA 2VD5A 4NUSA 4AE6A 4R5SA 4WBBB 5AEPA 2E9UA 1PRYA 1KWPA 2B9JA 4I6FA 4NT4A 4EOMA 4D2TA 3W18A 2HELA 4JR7A 4EOJA 1QMZA 4O4CA 3PE1A 3O23A 4UY9A 4Y85A 5DWRA 4BYJA 4DH3A 3MA6A 4IWPA 4OAVB 2CKQA 2UW9A 2WMSA 3ODYX 3OXZA 3QKKA 4MCVA 4CG8A 2WMVA 5DBXA 4NCTA 3C9WA 2W4KA 4MXZA 5HVJA 3NMUF 2QURA 3EH9A 3DCVA 4CCUA 1PXKA 3WF6A 5HX6A 5DT3A 4YC8A 3V8WA 2WTKB 3LXLA 3BHVA 2ITXA 4IMYA 4KBCA 5LXMA 5EKOA 3QUPA 5EM6A 3MGYA 4EH9A 4L9IA 3FXZA 4FZ6A 3A62A 4JIAA 5DG5A 4ZEGA 2ZYBA 1OL5A 3EKNA 4RG0A 1KE7A 3TZMA 4BGGA 1J7IA 4DDGA 4NM0A 5B2MA 5HESA 1XBBA 4FTMA 3VQUA 4DHIB 4ZIMA 2JIVA 3Q5ZA 2OZAB 5FBOA 2BAKA 2GDOA 4UBAA 2CKPA 3W0MA 5DE2A 4L67A 3GCVA 2QO9A 4KABA 4WNPA 3C5IA 4KKHA 3AD5A 2EXEA 2PVMA 4DLIA 5FG8A 5FUTA 2P55A 2JKMA 3A7IA 2UW7A 3ACKA 3QUDA 2X9FA 3DQWA 2OIQA 4PY1A 3FL4A 2YEXA 2B55A 2F2CB 5IH5A 4F1OA 4O7ZA 1OITA 5FM2A 1JKTA 1PKDA 2YAAA 3MTLA 4FIFA 4WNKA 3CD8A 5IQGA 2WQOA 3SHEA 2VWBA 4YJNA 5DNRA 3A60A 3U54A 2GFSA 3CTJA 1OL7A 3OEZA 4J8MA 4OTDA 3UQFA 3FEGA 3UVQA 3QZHA 4YPSA 3PWDA 3A4PA 2OXYA 4BICA 2B9IA 5E8VA 4C36A 4MKCA 1AGWA 1BMKA 1H08A 3GCQA 1J7UA 1MRYA 3W8LA 5J8IA 3CLYA 4IAYA 5LMKA 4IB0A 1T46A 4KBKA 4X2NA 2REIA 3P5KA 3KULB 4NZWB 3FMDA 5JZNA 4QMVA 1Z57A 3OUNB 4N70A 2G1TA 4GT5A 5E8ZA 4D5HA 4NW6A 5DI1A 2Y4IB 4BB4A 1AD5A 3DBDA 4QO9A 4G31A 5HE1A 3QQFA 4QYEA 3TEIA 5IQEA 4CFMA 4I21A 3DOGA 4O7TA 5AR7A 4ZSJA 3ZLSA 1IG1A 5A6OA 1K3AA 3L9PA 2JKQA 3Q2MA 3NIZA 3R8UA 2ITVA 4XOYA 4E93A 2QR7A 4FSRA 3WOWA 1PXIA 4LRKA 4AW0A 5IG1A 4ZP5A 2YN8A 4C0TA 3LMIA 4BZDA 4U97A 4F7JA 3V04A 3D94A 3LQ8A 2O8YA 3ZTXA 5IISA 3WBLA 4YBKA 2Q0BA 4LI5A 2G2HA 1ZAOA 2ZV9A 3H9OA 4TRLA 1PMNA 3F82A 4L46A 4F78A 5E8UA 3KF4A 5AR3A 5B2KA 4XG7A 3I7CA 2R7BA 3LW0A 3BQCA 4YC6A 4QYHA 4PTCA 4AW1A 4BCQA 3P5JC 1FVTA 4HCUA 3BQRA 4FG8A 4MAOA 4FV9A 3I0QA 5AM6A 5AADA 1JAMA 1XH7A 3PLSA 4FRFA 3RCJA 5M57A 2C1AA 5CASA 3BHHA 3D4QA 3VRZA 4TWOA 1CMKE 1F0QA 4B4LA 5LWNA 4IM3A 2IVSA 4YP8A 4ZJVA 4KD1A 5BQ0A 3UMXA 3PFYA 3Q52A 1W2CA 1WMKA 5BVWA 4P4CA 3AC4A 2QKRA 4HGLA 5LCKA 4E6QA 1QPCA 4EHGA 4UWYA 4BWPA 2GNFA 1JWHA 3RAHA 3UIMA 2WTCA 4FYOA 4UMTA 5EOBA 2CGVA 3I60A 4FSNA 2CNUA 3RPOA 3W33A 3HP2A 4DG0E 2CDZA 2XUUA 3KRRA 1P4OA 5GJFA 2BMCA 2YIRA 5HLPA 4RLLA 3BCEA 4ZJJA 3A7HA 2ZV8A 2YERA 5EI6A 4CYIA 4XG2A 4C61A 1YXTA 4EI4A 4F65A 1Q8YA 2GNGA 4I92A 1ZARA 3ORPA 5EK7A 1GOLA 2BIYA 5IKWA 4QQ5A 4XLVA 3VW8A 5FP6A 3OT8A 3D9VA 4NIFB 4R5YA 1J3HA 4RFMA 1OECA 4NM7A 1OIQA 4EQUA 2CGUA 3CCNA 4CFXA 2YLFA 1H0WA 3UZRA 5DR9A 3II5A 4HVDA 4OBQA 5K4JA 2JAVA 4G9RA 5E8XA 3IGGA 3SQQA 2XRWA 1IAHA 2F49A 3NCZA 3F69A 3W0QA 2JAMA 3EQRA 3U6HA 5FXSA 3RPYA 5CWZA 4DT9A 3KMUA 3C1XA 4OTHA 1ZMVA 1CSNA 3KGAA 3V5PA 1JBPE 5AAEA 3DT1A 4WRSA 3E93A 4MNEA 3QRTA 3TZ7A 2IZTA 3OROA 2Z7RA 3CEKA 3GOKA 3HUBA 4D1XA 3LXPA 2Z2WA 4J7BA 4QMZA 2YISA 2VWIA 3FC2A 4KIPA 3RI1A 4EQMA 2NRYA 2BAQA 3VO3A 4ZY6A 4FMQA 4XG4A 3SXSA 3UJGA 3Q4ZA 5KMLA 2UZBA 1W7HA 4FSTA 5IA5A 1KE9A 3O5AA 4J53A 3MPMA 3QLGA 4C2WA 3DAJA 2VTNA 4M84A 1RW8A 3UOKA 5H8EA 3R1SA 1Q3DA 2H8HA 3KN5A 3P79A 4DE4A 4PV0A 4NKSA 1SNXA 3ZO2A 3ZS5A 3KVWA 1WAKA 2GNLA 3LM0A 4AGWA 3W2CA 4CQEA 4R78A 3FHIA 3FZOA 3DNEA 2UZTA 3R02A 3R8PA 4BJJB 3HMIA 4GUBA 4L68A 3RINA 4MEDA 2OH0E 2GNIA 3AGMA 1B39A 2VV9A 3AC8A 3NPCA 3VUHA 2B1PA 4Q2AA 1XMLA 2OKRA 4U7ZA 2BZKB 4F08A 3ZO3A 2P33A 5HCYA 4C33A 2LGCA 1GZNA 5HBEA 1ZWSA 4USEA 1CM8A 2R3MA 2GS6A 5A6NA 3WYXA 5J9LA 2J6MA 5BVDA 3R00A 3TJCA 2CN8A 2VTQA 2E9PA 3B2WA 1GAGA 2VTSA 1Q99A 3WYYA 4EC9A 4DAWA 5KMIA 5EDRA 3DBQA 4E5BA 4LMNA 5LVLA 3TL8A 4Z16A 1OGYA 1BI8A 5AV3A 3ZXZA 4QQCA 4RGJA 5HTIA 2EUFB 2WKMA 2P3GX 3BWFA 5FXRA 3SG9A 5C4LA 5CSVA 3QTRA 4ZAUA 5ANDA 2NP8A 5EHOA 3HP5A 4I5PA 4AQCA 2C4GA 4BCIA 2OWBA 3W0SA 2ZDTA 3D5XA 4QMOA 4JDJA 4A06A 4JI9A 5EM8A 3R9DA 5D11A 2PU8A 2BFXA 4UXLA 5HG7A 3EQGA 2HZ0A 4JBQA 3EQFA 3UC3A 3OF0A 5EFQA 4ZOGA 5HNBA 4EYMA 2XIYA 4QMSA 4BKYA 4B8MA 5GZ9A 3TKIA 1OKWA 2XNNA 3LCSA 5AP3A 3W2RA 2C5XA 4ZZNA 5KHWA 3PPZA 4YC3A 1MRUA 2IW6A 3VJOA 4C35A 3ATTA 2X1NA 2OLCA 4TNDA 2R4BA 3UPXA 1REJA 3L8XA 3QBNA 3ACJA 3R1NA 4AWIA 3LVPA 3AC1A 3TCPA 1GJOA 2C3JA 3GFWA 4Y5QA 3DY7A 1OB3A 4EH4A 4NJDA 5I9YA 2OF4A 3T3UA 2GNHA 3HV6A 4FSQA 3DGKA 1OZ1A 3PVWA 1W0XC 1IAJA 3NYOA 3U87A 2JDTA 1YOJA 4CEGA 3BLHA 4YJOA 3EQDA 4W4VA 4ACGA 4XNEA 3CBLA 2E9VA 2XK9A 1OKVA 2PE2A 4IB1A 4YTHA 5AP6A 2YM3A 2CLXA 3I5NA 4RVMA 3VBQA 3TUBA 3C13A 3OG7A 2ITPA 2VTLA 4G2FA 3TN8A 3QCQA 2YAKA 1RDQE 4YHFA 3LE6A 4TYGA 4DHFA 3HDMA 2XJ1A 4XHKB 4ZSEA 4FV6A 3EFJA 3FV8A 3OWPA 1M2RA 3BE2A 5FGKA 4L3PA 4R1VA 1ATPE 4DBXA 3PUPA 2PVKA 3ATSA 3V3VA 3P86A 2YHVA 3P7BA 4H3QA 4R1YA 5L6OA 4WD5A 2R5TA 2BKKA 2FH9A 5F20A 5FM3A 5L2SA 4UWCA 2XK3A 3Q9YA 2WMBA 5HNGA 3ZFYA 4HJOA 3BIZA 3IS5A 5I3OA 1G8KA 4EL9A 3G6HA 2OIBA 3SC1A 4YTFA 5BUIA 2R7IA 2QR8A 4TYJA 4F9YA 2XCHA 4UALA 2B7AA 3EFKA 3VWAA 3E3PA 3GU4A 1QL6A 2CLQA 5IUGA 4EK3A 1PXJA 3A7FA 3LFBA 5LMAA 2G2FA 2J0MB 3R7UA 4M0ZA 4FVPA 4QP4A 3L8SA 2C6TA 4BL1A 1SVHA 3F3WA 2O5KA 3ZC6A 4J1RA 2OFUA 2J5FA 4KS7A 2PVLA 2OZOA 3AC5A 4RWJA 3FL5A 2VTAA 2PVFA 2UZEA 3BE9A 4MF0A 4DG2E 4Q9ZA 4BGHA 5IH6A 4O96A 5K0KA 3V8SA 2VTTA 4FT7A 3BWJA 4TW9A 4HOKA 3TDWA 2WMQA 3EB0A 2YJRA 3GEQA 2YZAA 4PMTA 2C3LA 4XP0A 3WF8A 2IWIA 5DRDA 2IN6A 5KBRA 4EZ7A 3MVMA 3U8WA 4D28A 2I6LA 2YCRA 3ZLYA 3GQLA 3R0TA 4MQ2A 5AUUA 3C4CA 4IH8A 4EH8A 4C8BA 2QOOA 4MXXA 5CEOA 5CAQA 4FZDB 3TDVA 5BV3A 3R22A 1U4DA 1URCA 3FMHA 3VJNA 4YZ9A 3VS6A 3G51A 4FSYA 2OBJA 3T8OA 4J52A 1OKZA 4EK4A 5IEXA 4DH5A 5LOHA 2R3OA 3W55A 5FBNC 3DJ5A 4BCPA 4DTAA 3QQJA 4U43A 4AT4A 1TZDA 3KREA 3MPTA 4EONA 5J95A 3V5LA 2X2KA 5AUZA 3PXKA 3IDPA 5TO8A 5H2UA 4A9SA 5D12A 3THBA 2VWYA 2J50A 3OBGA 3FI4A 5JGBA 4ZS4A 3LCTA 4IM0A 5ETCA 2X8EA 1A48A 5HO6A 2WMUA 3LCOA 5HNIX 5AP5A 3Q04A 3GU5A 1TQPA 4G5PA 4LG4A 4YJQA 3N51A 4QP3A 2O65A 2GHMA 3FMMA 4F63A 5FEDA 3KXZA 2Y6OA 4XOZA 2A27A 4JBVA 3EN7A 3ORKA 2R3IA 3SDJA 1B6CB 3CTQA 3FXWA 3GCUA 3P23A 5ANOA 4D0WA 4ZZOA 5JFVA 3NVMB 4RVKA 2R3RA 1PMUA 4RLKA 2B4SB 3UC4A 4E20A 1G5SA 3CPBA 3R7VA 4U5JA 4FEUA 3QD0A 3EZRA 5IQCA 2ZB1A 3OTVA 3TT0A 4I20A 1YHWA 3VNTA 2CKEA 2RL5A 2IZUA 3HV3A 4GKHA 4ANOA 4NYEA 2BRNA 3Q9XA 3TM0A 5AP2A 1FGKA 2RSVA 5CEIA 2IZRA 3C4ZA 5KUPA 1IA9A 4CD0A 4G3GA 5BVKA 3IDCA 5IDNA 4AXDA 3CPCA 4CMUA 4F1MA 3LFNA 5E1SA 5A4TA 4ONAA 3COHA 3E63A 3FPQA 4RC4A 4BHZA 4C4EA 4E73A 4F4PA 1NW1A 4Y5HA 3NAYA 1O6YA 4QMQA 4O0WA 2GPHA 4X2GA 3BX5A 4IHPA 2RFDA 4I4FA 4TWCA 4C3RA 4CKIA 2GU8A 4CCBA 2YLEA 3O71A 4EHZA 4XV3A 3CS9A 3DS6A 3R7YA 3F5XA 5HTBA 4GFMA 3FAAA 5E8YA 3AG9A 5DVRA 4BTFA 1ZOHA 4FUYA 4LOPA 4RX7A 4E7WA 2V55A 3FY2A 4I24A 3QTUA 1FPUA 3E64A 4XCUA 4KSPA 2DUVA 2VGPA 1KE6A 4IFGA 3W10A 4FV0A 3BU5A 5CF5A 5CLPA 1BKXA 4O27B 4O22A 4QD6A 3ALOA 5AR5A 4GK4A 4USFA 2WTDA 1TKIA 3QQKA 4LQMA 2BZIB 3DAKA 2XNGA 3IOKA 2XS0A 3OFMA 4W4XA 5IF1A 4BI0A 2I7QA 4AW5A 5J5TA 5BUEA 1PY5A 3NW7A 4YMJA 5L6PA 4ALVA 4DEBA 5AJQA 5DRBA 3ZC5A 5AR2A 3TYKA 4CFFA 3UVRA 4C4IA 1XH4A 3C0HA 2W1HA 3CJGA 3ROCA 3PRFA 4RA5A 4F1TA 3IO7A 1REKA 2GQRA 3BLQA 3VIDA 2I1MA 1Y8YA 2E9NA 1DI8A 3RMFA 1WVYA 1M14A 3PPJA 4QDEA 4WSYA 3D14A 3R9OA 4FTUA 4DDIA 3ZONA 1R39A 2EXCX 2J0LA 2W1IA 4M66A 4MNFA 3MBLA 2I0YA 3HZTA 4RX8A 2VTIA 5I5ZA 5K4IA 3BYSA 4FKIA 4YTCA 3PJ1A 2GS7A 2QO7A 4U44A 4XG6A 2W99B 1Y57A 2ZMDA 1BYGA 3QD3A 2XM8A 1NXKA 1PF8A 3NRMA 4FTNA 3QRIA 2VTHA 2WOTA 4J96A 5EI2A 2IVVA 4A9YA 3DXPA 3PVUA 4UZDA 2YM5A 2YDJA 1OM1A 5AWMA 5IA4A 3DV3A 3PP1A 1XH5A 3UBDA 4PTGA 3SXRA 1W2DA 3C4WA 3ZDIA 4C3FA 5F95A 3HMNA 5I9ZA 3KB7A 2W1EA 3UTOA 4PPBA 5CNNA 2OW3A 2QOCA 3FMJA 3FWQA 3ZRMA 1JKKA 2WELA 3OUKA 5AUWA 5A14A 3I7BA 4OT5A 2QOHA 4FV7A 3LAUA 1LEZA 4KKGA 5A3XA 4FSMA 3DJ7A 3QZFA 5GZ8A 1Q97A 4ZMFA 4DITA 4D1ZA 4IACA 3W2OA 4G6OA 4RFYA 5IPJA 4AAYA 4BCJA 2UVZA 4FL2A 2R3HA 4BCHA 2VN9A 4Z3VA 4BDGA 2WMTA 4LFIA 4M97A 1PHKA 3CJFA 4O1OA 5IU2A 3QCYA 4Y83A 1M17A 3U4WA 3PUFC 4A4LA 4W8DA 4ZTMA 4RIOA 4O81A 1FGIA 3NDMA 4Z9LA 3GOPA 4DF3A 4DFNA 2CNVA 1Z5MA 4RJ6A 4WOVA 4RIWB 1PMVA 1KOAA 2Z8CA 2QOKA 3DB8A 3T3VA 4FODA 4FTAA 4U40A 3ZXTA 1WBSA 2BRMA 3RGFA 4PPAA 5J7HA 2PUIA 2RGPA 3D5VA 3VS0A 1FVVA 4FT0A 3E5AA 1YXUA 4CLJA 5AP7A 4MVFA 3UZTA 4ID7A 3JYAA 4OTFA 4XBUA 5C8MA 3JY0A 2HZ4A 2O2UA