1YWNA

Vegfr2 in complex with a novel 4-amino-furo[2,3-d]pyrimidine
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
302
structure length
279
Chain Sequence
LPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLTHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDIKDPDVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vascular endothelial growth factor receptor 2
publication title Novel 4-amino-furo[2,3-d]pyrimidines as Tie-2 and VEGFR2 dual inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 279
sequence length 302
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1ywnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1ywnA01
4L3JA 3MY0A 4DG3E 3DJ7A 3JVSA 1VEBA 5D12A 5CNOA 2OFVA 2WTVA 4O0WA 3U6JA 4FF8A 4I1ZA 2Y0AA 3PIYA 1SMHA 1U5QA 4HCUA 5E1SA 4X3FA 3FSKA 4KBCA 1XH4A 3EKNA 3ZM9A 2X2MA 4FL1A 3NMUF 3BYVA 3DGKA 4FSMA 4XEYA 1KOAA 5ANIA 1DS5A 1NVQA 4BY9E 4DBNA 3RPYA 5CF6A 1Q8TA 2OK1A 3BLHA 4EH2A 3N4UA 3NAYA 3UIBA 4CCBA 3CPBA 4WD5A 5DLSA 2XYNA 4CNHA 3R00A 3VW6A 1FINA 3QXPA 1ZY4A 3PG1A 3WZEA 5DYJA 5H8GA 2QC6A 1S9JA 4ALVA 4KINA 5HIBA 1PMVA 3DNDA 1XQZA 2X6EA 5GINE 2UZNA 4NZWB 2YDJA 2QOIA 3A7HA 4HCTA 2GSFA 4O0UA 2GS2A 5DE2A 5AAFA 3F7ZA 5HI2A 4Z7HA 4DEEA 3ODYX 4BCQA 4FTKA 4LMUA 2JGZA 4K9YA 5IUIA 3QAME 5JQ5A 2EXCX 5FD2A 3OD6X 3OUKA 3QGWA 1OPKA 3BCEA 5EKOA 4YZCA 4DGOA 2YZAA 2OJGA 5HVJA 2C6TA 3OT8A 4FKRA 4RIXA 3VN9A 4FTRA 3PIZA 5JT2A 4M67A 5IUGA 2ITUA 4MXOA 2WGJA 2YCRA 2ETRA 4XHKB 3QYWA 4O7RA 4BFMA 2ONLC 3UZPA 5L2IA 2J90A 4G9CA 5CI6A 5CEOA 4EL9A 2J50A 4IZ5A 3FMMA 1UV5A 4PX6A 3POOA 1SVGA 4FT7A 3DCVA 4X2GA 3E93A 1XBCA 3P9JA 3SW4A 3VUHA 3ID6C 2YLFA 4ANQA 3QUPA 4S31A 3OF0A 4TT7A 2I6LA 4NIFA 1E9HA 2QODA 1UU9A 2RF9A 2VWVA 2GU8A 3F66A 4R7HA 5HO6A 4R7BA 4FEXA 5BYYA 3ZMMA 3DAJA 3TIZA 1PKDA 2H34A 2XF0A 4BYIA 3DOGA 3F5PA 5I3RA 2NP8A 5CEQA 4TY1A 3RJCA 4FODA 2UZVA 3QD3A 5D41A 2UZOA 5HTBA 2PYWA 2O2UA 3ZM4A 3GCVA 5EQPA 3BGZA 5IH4A 4DBXA 3O50A 2BR1A 2R4BA 3QHWA 4JRVA 4IVAA 1SNXA 1MQBA 1J91A 2PUPA 4Q5EA 4FC0A 4JL9A 3ROYA 1ZMWA 3BBWA 3C5UA 3PLSA 5KNJA 3WE4A 1URCA 3OZ6A 4ASXA 3NEWA 3HV6A 5L8LA 4O84A 3CQEA 1Q61A 4GYIA 2VGPA 4DH8A 4QMLA 3AC2A 3TZ9A 3V5TA 2J5FA 2VNWA 4IADA 4FYNA 3UYSA 4DAWA 4F1TA 3TL8A 5CSHA 2ONLA 4ZSLA 4EOKA 3ANRA 3SQQA 3HV5A 2VX3A 3BE2A 3O17A 4CFUA 5GIPE 1TQIA 5K0XA 5FGKA 2B55A 4Z16A 3CJGA 3HVCA 2PZIA 3T9TA 4CD0A 5HIDA 4I94A 4BTKA 4ZTMA 4JG8A 5HG5A 3FYKX 4LGDA 1IA9A 3PJ3A 2VTNA 1PMNA 2DWBA 2R3QA 3F5UA 1GZ8A 5GNKA 4F6SA 5FP6A 3ULIA 2UW0A 3ROCA 5FTGA 4AT4A 4E6QA 4LV5A 4RLLA 3UODA 5M56A 3IW5A 5AR2A 5CAPA 3CTQA 3WF9A 4QP9A 4YTHA 4AQCA 2W1HA 4QMSA 4J95A 3MGYA 3UQGA 5FG8A 2PUNA 3B8RA 3EN7A 5BVOA 2BZHB 4F08A 3QTXA 3COKA 2JITA 3MWUA 4ZY6A 3EQFA 4O1OA 3FQHA 2VO0A 3EYGA 4KIKB 2OLCA 3LFBA 2XBAA 5ANEA 1VYWA 5KKRB 2CKQA 1Y8YA 4AW1A 4CG8A 4EOJA 2YM3A 2C3JA 4FKJA 4FV8A 4U40A 5C8NA 3QF9A 2BDFA 4QMOA 3KEXA 4CMUA 4LUDA 2BMCA 4FKLA 3BLRA 3UMWA 3F3WA 4OTFA 5AADA 4MWIA 5KHXA 3ETAA 4U42A 4G6NA 3PSDA 3UGCA 2ITXA 4NCTC 4BDIA 2A0CX 4XP3A 4RQKA 5JFXA 4NM7A 5M4IA 4I41A 1WBWA 2YFXA 2C69A 4G5JA 3S95A 4FZ7A 3TKHA 3W1FA 4YGAA 4D28A 2VO6A 2W99B 3MV5A 4JBOA 4XH6A 2UZEA 2XM9A 4B6LA 1OKWA 2R5TA 2UW9A 5KMNA 4ACCA 3GOKA 4CFWA 1YOMA 4IC8A 3EOCA 1J7LA 5L3AA 5L4QA 3EQIA 4GT5A 4LRKA 3WBLA 1OUKA 1WBSA 4JLCA 3EHAA 2C47A 4M8TA 4I5HA 5J5SA 2GQSA 1VZOA 2GNJA 3AMYA 3DPKA 3LCTA 3PPZA 2BRMA 4CTCA 2WU7A 4Y46A 4ANNA 1QPCA 2CKPA 3FMEA 5HEZA 1CKPA 2X2KA 4DEDA 1ZAOA 3FY0A 3UZTA 4ZLZA 3TUBA 3HP5A 3W2SA 5AR8A 3GOPA 4FV4A 4LGHA 4JG7A 5JZNA 1REJA 2JC6A 1ZY5A 4QMMA 4QP2A 1YXXA 4RLKA 5ETCA 2UW5A 3WIGA 4ACHA 3RTPA 4TKSA 5GIOE 1YHWA 3PE2A 4U7ZA 5AWMA 4YU2A 4QP4A 5EOBA 3OW4A 3KMMA 2WEVA 4IJ9A 5FWKK 4D55A 4IWPA 4FKVA 2XK7A 4GS6A 2E9OA 2RGPA 3D94A 3EMGA 3KXGA 3DZOA 5H3QA 3NUSA 1UU8A 3BV2A 3G51A 4KIOA 3BU6A 3ELJA 4OUCA 1FMOE 3KF7A 3PA3A 2QOQA 1CTPE 3NW5A 2PE0A 2UZUE 5E92A 3O8UA 4FT9A 4O38A 3WZDA 2V62A 5KKRC 2YEXA 3CGOA 4PPCA 3ZZEA 4EC9A 3WF7A 1OBGA 5CEPA 3SRVB 4M15A 2PVJA 3CJFA 4RRVA 5GJDA 2IG7A 4DH3A 5HNGA 4F70A 3VS4A 1UU3A 4GVJA 5IQGA 2DQ7X 3G90X 4IZYA 4CRLA 3UZRA 3BKBA 4M0ZA 4ZTNA 2V5QA 3GEQA 1WVWA 3ZLYA 2JEDA 2FO0A 4FGRA 3IONA 3PJ8A 4FKQA 2XB7A 4U8ZA 1FMKA 4E20A 2W4OA 3R9NA 4TL0A 1HCLA 4B0GA 1YXVA 1LEWA 4ZY5A 4AAAA 4NSTA 2OJ9A 2YA9A 4G16A 1ZYLA 3LMGA 4FEQA 2QOLA 4KNBA 4LUEA 3VAPA 1B38A 4EKKA 1V0OA 4TRLA 5DRDA 3KRLA 3AXWA 4FBXA 1CM8A 2WO6A 4QMYA 3C9WA 4AFJA 4ERWA 4FSTA 2QO9A 3OEFX 4IE9A 4NFMA 4UMTA 4CKIA 3MFRA 3N51A 2X7GA 4BZDA 2W1EA 3EWHA 3BQCA 4C0TA 3PJ1A 4PMSA 4V04A 4RC3A 4KIKA 2GNIA 5LQFA 3HZTA 1AD5A 4IWDA 3KB7A 4I6BA 2W96B 3KRRA 4RX8A 5F20A 4F7JA 4D0XA 2XNOA 2RKUA 4RZVA 3QTWA 3SGCA 2W7XA 1J1CA 2QCSA 3LFDA 3RAIA 1Y6AA 3QTQA 5EM8A 3UVRA 4FTCA 1Z9XA 2AC3A 3TIYA 3WZJA 4XX9A 3WARA 2XK3A 4IJPA 2UW6A 2Y9QA 3ORNA 4D2VA 5K9IA 3V6RA 4CFXA 3CEKA 3A62A 3QKKA 5KBRA 1JKKA 5EG3A 3LM5A 1U46A 1OKYA 2Z7LA 3A7GA 3FJQE 3BYSA 3DQXA 3VUIA 2X6DA 4FL3A 3C4EA 5HO8A 3UP2A 5BPYA 4ORKA 4EH5A 2A27A 2WEIA 4JDKA 5KX8A 4Y73A 2UZWE 4D2RA 4GJ3A 5HD7A 3SLSA 4GU6A 4YC6A 4LI5A 5C26A 3VS7A 4Z7GA 1J1BA 4JX7A 3PSBA 2JDOA 2YHVA 3UOHA 1M14A 3DLZA 4J98A 2QURA 4FV7A 5D7AA 4FIHA 3NS9A 2YIQA 3A99A 5AA8A 3LMHA 1F5QA 5IMXA 5JGBA 3D5UA 4PMMA 2JAVA 2VTRA 4O0VA 4QNYA 2J9MA 1Q99A 2BIYA 1H27A 3DDQA 3GNIB 2VWIA 4R3PA 4NM0A 4BDHA 4BGQA 2R9SA 3NNWA 4AWIA 4D4SA 2BFYA 2OIBA 4L3PA 1ZYDA 2I0HA 2G2IA 2SRCA 2Y6MA 3FY2A 1YWVA 4E5AX 4AGWA 4EUUA 2HZ0A 3IECA 3LQ3A 2P0CA 5JMSA 3SXRA 3TXOA 5CZHA 4R6VA 3HL7A 4I0SA 1JBPE 2DYLA 3BYOA 4WNPA 1Y8GA 5DI1A 5DR6A 3VC4A 3TUCA 4YBJA 1WBTA 1ZYSA 3U9NA 5TT7A 4FKIA 4ANOA 3VBYA 3SRVA 3W55A 3ZCLA 1DAWA 2W1GA 5LVMA 2EB2A 4UZHA 4BVUA 2PMOX 5IEYA 1M2QA 1FPUA 4TW9A 3FI2A 5BMSA 5M51A 3SG9A 3GU6A 3O7LD 1B39A 3V5QA 4H3PA 4BC6A 3ZDIA 5IQAA 5CLPA 5EDQA 1XH8A 2G2HA 3G9NA 4J8MA 2VTQA 1Q8ZA 3ZDUA 4AXAA 5AUWA 4BGHA 4MXZA 4I21A 1PXKA 4CKJA 4MD9E 4BKYA 3LLTA 4H3BA 1P4OA 2BRBA 4MEDA 3V6SA 2B1PA 4QRCA 3TTJA 2W1FA 3RM6A 2IZSA 2YACA 4W4XA 3GCUA 3MTFA 5J95A 4A9TA 3QLFA 4PPAA 2C5NA 3E3PA 4J1RA 1ZYJA 4JNWA 5CENA 2C0TA 1IRKA 4AN2A 4F1OA 4BR3A 4DGMA 5EQYA 4AA4A 3UQCA 3KQ7A 5D10A 4BCOA 4C58A 5IA2A 4KIQA 3U9CA 4JXFA 4JR3A 1BUHA 4KUJA 4M14A 3TJDA 3EKKA 4AF3A 4OAVB 4BZOA 5BYLA 3O8PA 4FK3A 2H9VA 3UC3A 2WOUA 4TYHB 3C0GA 3CCNA 3FZRA 4ZTRA 4EK3A 1BL7A 2B9IA 2WAJA 3WZKA 3ORIA 2BZJA 3TTIA 2WB8A 4QTBA 3JS2A 4V05A 4NFNA 3QQJA 4F9YA 3G0EA 3V51A 3RZBA 2VWBA 2QLUA 3PWYA 4D0WA 2PMNX 2WNTA 3VS5A 4KD1A 2XEYA 4ZAUA 1ZLTA 5EDRA 2YIWA 2JDTA 3NW6A 2I0VA 3H4JA 3UQFA 2J6MA 5E7RA 4UB7A 2QOOA 5J5TA 2J4ZA 3COMA 4X7QA 3TV7A 2WTWA 2VTTA 4OTDA 3F3ZA 3PIXA 3C4FA 5HLWA 3QTZA 4RX9A 4G2FA 4ASZA 1UNLA 1PW2A 2R3FA 2B7AA 4XBRA 4YNOA 3UTOA 4RJ7A 2XK9A 4AT5A 4FKSA 4KKGA 3F5GA 3V8TA 3ZFXA 5EQEA 5HCZA 5C8MA 3QUDA 2BTRA 3PXFA 3ZXTA 1L8TA 1PYEA 4QP6A 5CU6A 1WBVA 5EM6A 5EYKA 4ZZNA 3W33A 1DM2A 1OL1A 2E9PA 3V3VA 4WRGA 4CFVA 4EYJA 4M84A 3MTLA 4CZTA 5AX9A 5EM7A 4QTCA 3EQGA 4FKTA 3E5AA 2PY3A 3OWLA 4IB0A 5HVKA 4ZXTA 3MBLA 4RMZA 5FTQA 4QMWA 5GZAA 5JKGA 5HE2A 4YHJA 3I79A 3C7QA 5HNBA 3ZU7A 4CQGA 4BDDA 5KUPA 3SAYA 3I60A 3R2BA 2WMBA 3AD4A 5CZIA 2I7QA 3DBEA 2GTNA 4HVIA 1XJDA 4PDYA 2X1NA 2Y8OA 1GOLA 3OY1A 4NK9A 3AMAA 5IUHA 2IW9A 4UXQA 1UNGA 1WMKA 4C2VA 1OGUA 3PVBA 3QCYA 3I0OA 4Q9SA 3ALNA 3AGLA 4GK4A 3RALA 1PXPA 3P78A 5J8IA 2ZB0A 4RWJA 4YSMA 3E8NA 4E93A 4FYOA 4ID7A 2OJFE 3EYHA 3U87A 2PVRA 4I5PA 5FEQA 4K8AA 4TNBA 3ZXZA 3ATSA 5EW8A 3KA0A 4J8NA 3DBQA 2JDRA 2Y6OA 1U54B 1JLUE 5AV1A 3BQRA 4FNXA 2X4FA 3SX9A 2J51A 1R0EA 5HVYA 4FG9A 5CAOA 3LFCA 1TVOA 5CXZA 5CAVA 2H6DA 2XUUA 4XP2A 4O7TA 2QOBA 4FIJA 3R8PA 2ITYA 3PDTA 1APME 4DFUA 1NVSA 2JDSA 3AOXA 3LFAA 2ESMA 4O0RA 4D2TA 3T8OA 4LOQA 4OR5A 3IS5A 3R9RA 5CX9A 3I5NA 4C4IA 4U9AA 4OAUC 3GT8A 3SXFA 4DLJA 4DFBA 2RFDA 5IQBA 2F7EE 4FV1A 4I6HA 4U97A 2IW6A 5DPVA 3QQKA 3MFUA 4L7SA 1UWJA 3TKIA 4IWOA 2ZM1A 4Z9LA 3M1SA 2CGVA 2IVUA 4TYHA 1R78A 5EOLA 2PZPA 2BHEA 5AP1A 5ICPA 4EC8A 2R3JA 3KMWA 3ZTXA 4I3ZA 3VRYA 4YJSA 3M42A 3UO4A 3MH2A 3B8QA 5CF8A 3TNPC 2XK6A 4FX3A 4U5JA 3QC9A 3EL7A 3FLNC 4MXXA 4UXLA 2Y4IB 3UG1A 3TJCA 5L6OA 4IH8A 4RX5A 4YO6A 2ZAZA 3D15A 3VBTA 2C0OA 4O96A 1QPDA 1YKRA 4MCVA 3BEGA 4FZ6A 2REIA 2QHMA 3MH1A 1OITA 3B2WA 4IDTA 2WU6A 2E9NA 5KBQA 3HECA 2W9FB 3LCKA 3GC7A 3F69A 5AR5A 5CALA 4IM2A 5IA3A 2B9JA 2GNGA 2XYUA 3KN6A 3EL8A 3PY1A 3KY2A 4RWLA 1ZYCA 4ZJIA 2GFCA 2WMQA 3F3TA 5E8XA 1SM2A 1J7UA 1QPEA 3R83A 4EBWA 3FI8A 4FKGA 4EHGA 3NUYA 4LYNA 4CQEA 4FIIA 5J9YA 4EZ7A 3Q96A 2OXXA 4MTAA 3KN5A 3W18A 3QRTA 4PL5A 2QO2A 3O8TA 3UIMA 2X8IA 4AW2A 2NPQA 3DXNA 4RA5A 3QZFA 4FTLA 3MW1A 4N6ZA 3SA0A 3I6UA 3AG9A 4D2PA 4MBLA 3MFSA 3Q9YA 4ZLYA 4IB1A 4I22A 3MJ2A 2CLXA 3EFLA 4GH2A 4O86A 3LFEA 4E3CA 4GFGA 2JFLA 2GNFA 2BTSA 2CNVA 3KK8A 4GW8A 3T3UA 4O2ZA 1M7NA 4EWHA 3QHRA 2HZNA 5DN3A 2PVFA 4EONA 4USFA 5E8ZA 1R3CA 2OFUA 2XVDA 1NW1A 3L9LA 3HAMA 3GC0A 2C6MA 3Q6WA 4PL4A 3RHKA 2ZM4A 3RCJA 4B8LA 2VO7A 3TCPA 3KU2A 3IPHA 4I93A 4BI1A 2YLEA 5AM6A 4DITA 2A2AA 2C6KA 2W17A 2ITQA 3PG3A 4JG6A 2B53A 2P2IA 5AA9A 1H07A 2XNNA 3KVWA 3P1AA 3BHYA 4RIOA 3R7YA 4FTOA 2YCFA 2R3HA 2OO8X 3BWJA 3I81A 4D1ZA 3SVVA 1O6LA 3DZQA 3ODZX 4JDHA 5DT4A 5E8TA 4AFEA 4MX9A 4CRSA 4ZJJA 4WG5A 2Y4IC 3GU4A 3DK3A 4KBAA 2HYYA 2YITA 5C4LA 5K4JA 4WRSA 1UVRA 4FZDB 3HDMA 3EN5A 1KV1A 3NRMA 5D1JA 3W2PA 2Z02A 4BL1A 1U54A 2C5VA 3WI6A 5T3QA 4OW8A 2VWYA 2VTPA 4OTWA 4AOJA 1WBNA 2EUFB 4YLJA 4C4GA 4RJ6A 2XCHA 3KVXA 3FL5A 3QUEA 4PPBA 4PQNA 1G5SA 4C57A 4GSBA 5AM7A 4C2WA 3RPSA 4AZTA 3QTSA 5JGDA 1H01A 1GJOA 1UWHA 1XWSA 4I20A 4F09A 2P4IA 3VF9A 1KUTA 4DF3A 2OW3A 3VNTA 2HXQA 4I4FA 4N57A 4LL5A 4WT6A 4ITJA 5DR2A 4R78A 4RA4A 2UW7A 4YPDA 1OPLA 3PUPA 4YUQA 1Y91A 4DC2A 3U6HA 5JGAA 4BIBA 3NGAA 4WBBB 1GIJA 1YXSA 1J7IA 3OTVA 4GK3A 4I4EA 4FTMA 3I0QA 3MH0A 2XNMA 5DR9A 1U59A 5EI2A 1REKA 3G5DA 4XV9A 4A4XA 4MAOA 4YR8A 1A48A 3E3BX 4A9UA 2FA2A 1SNUA 2F57A 4MXYA 2WQBA 3E7VA 2UW3A 4FNWA 4E6CA 4JQ7A 2F2UA 3VULA 2X81A 4AZEA 2RFEA 2XRUA 5ITAA 2QU5A 3RNIA 2XCKA 3FZPA 4XV1A 3UNJA 3N4TA 5B2KA 4HVHA 1JSTA 1YW2A 2IJMA 5I3OA 5LCJA 3R30A 3FDNA 2PVKA 4AGCA 3CBLA 3VQUA 4CG9A 5G6VA 1V0PA 4YZ9A 4CT2A 5BVEA 1BI7A 4AX8A 2GNHA 4ASDA 1V1KA 4XG7A 2ZMCA 4IC7A 4EI4A 2B9HA 4W8EA 5GJFA 3R28A 1RDQE 2VTJA 2V7OA 3A61A 5CVHA 3R9DA 4IWQA 2XKCA 5E8YA 2X7OA 4HPTE 4QMPA 2HELA 4BKZA 4RIWB 4HPUE 5IDNA 2W06A 4LOOA 4EZ3A 2CNUA 2Q83A 4ZSEA 4GJ2A 3KMUA 4I5MA 3TM0A 1BYGA 1KSWA 2VTHA 4Y85A 1OL7A 3WF6A 4ACDA 2WMTA 3QFVA 5CSXA 3D2IA 5AP6A 5BUJA 4RIYB 3OW3A 4D9TA 2YJSA 3K3IA 2XJ0A 5DOSA 3L8VA 3MYGA 1H8FA 2WMWA 2VN9A 3AGMA 4AZWA 4CFMA 4YURA 1H08A 3QD2B 2XEZA 1OM1A 4R5YA 3R7VA 4PRJA 4RSSA 4NW5A 5KMOA 2C3LA 4ZTHA 4HYHA 4WIHA 5AUXA 2OJIA 4F7NA 5J7HA 3PPJA 5BX0A 2G9XA 3MPAA 4ZTQA 1OVEA 3PTGA 2GPHA 5EW9A 4IAFA 4P4CA 3D5XA 4WNKA 4JBQA 4EUTA 3DNEA 4GK2A 5M06A 2Q0NA 4AUAA 4NJ3A 4YPSA 5K0KA 4BRXA 4DGGA 3Q2JA 1ZMUA 2JIVA 3TDWA 2XZSA 1H24A 2B9FA 5IEXA 2UW4A 2VNYA 5BVDA 4DEHA 3GU5A 5AV0A 3C0IA 1EH4A 3H3CA 3SKCA 4IZAA 5IU2A 2ZB1A 3QWKA 4A9SA 1UA2A 4AGDA 3DK6A 2VX0A 3EFWA 3SG8A 3RWQA 1WVXA 3MA6A 5T68A 2JIUA 1Q3WA 2QKWB 3LXLA 4GT4A 4DFLA 3LFSA 3P7BA 4A07A 2R64A 3OMVA 1UKHA 4DHFA 1ZZ2A 2PVNA 4RT7A 3TZMA 5FEDA 4FSZA 5IISA 4I0TA 4NW6A 3V01A 4BDCA 4P5ZA 3HLLA 3AD5A 3FPMA 3VS0A 3FEGA 3PXRA 2QOFA 4MWHA 2OH4A 3Q4ZA 5AR3A 3SD0A 3UVQA 1LPUA 3IK3A 4OT6A 3R8LA 1MP8A 5I9WA 5J1VA 2JBPA 4GRBA 3UPZA 4EQMA 3G2FA 4GCJA 2B52A 2WOTA 3U4UA 3VJNA 2W1DA 5M09A 3V8SA 2XK4A 3MN3A 5LMBA 4MVFA 5HQ0A 4ZTSA 1A06A 1STCE 3C1XA 3UP7A 2C1AA 4YLKA 2GDOA 4KKEA 3R8VA 2VV9A 4IX4A 2X4ZA 3PA4A 3RAWA 3OC1A 2R3GA 4J99A 3ZBFA 5CU0A 5HTCA 4R5SA 5IH6A 1PRYA 3TI1A 4IXPA 2ITWA 4U6RA 4MKCA 3F9NA 2PTKA 1TQMA 4PDSA 2JKQA 1OKZA 3A2CA 2ITNA 2PSQA 4EWQA 4JAIA 4AE9A 4D4RA 4FTTA 5B2MA 5IA0A 5M4FA 3FLZA 4F7LA 1XHAA 4IEBA 5EHOA 5KMLA 4ZSGA 4Y72A 4IAAA 1XR1A 4GMYA 3OROA 3R7IA 4C33A 2YISA 4FSRA 3LJ0A 4BCMA 5FBOA 4IFCA 4FG8A 5JQ8A 3NUPA 5FEEA 3EN9A 2WKMA 4UALA 3ULZA 5I9XA 4GVAA 3PJCA 2P3GX 1FVVA 3BU3A 3KF4A 2VGOA 3NZ0A 4IFGA 3WYYA 4ZY4A 4BDBA 3IGGA 5CQWA 4P2KA 4RIWA 2FSTX 4I5CA 3S4QA 3BZ3A 4UYNA 2A19B 5DMZA 4FEUA 4G3FA 2HZIA 2BAKA 1FGKA 4WNMA 5IA1A 4GKIA 3QTUA 3JY9A 4AOTA 4DEIA 4ANMA 3E8EA 3QKLA 4FV9A 4RIYA 3W8LA 4DGNA 1SVHA 4A9RA 3DK7A 4NH1A 2OZOA 4CYJA 2V0DA 3W16A 4H3QA 3ZO4A 4WUNA 2WMUA 4JQ8A 3TV4A 4OTQA 3A4PA 3CE3A 4UX9A 4BCJA 3H9FA 2RL5A 3KULB 3FYJX 2W5BA 1FVRA 3DKCA 3L8PA 4KSQA 5DT3A 4YTCA 4D5HA 5DNRA 5ACKA 1XH9A 2W0JA 1OKVA 3R1SA 4F6UA 3NVKI 4FZAB 5H8EA 3MB6A 2JBOA 1P5EA 5C01A 5M53A 1FOTA 2WFYA 5FDXA 3W10A 1IAJA 3R02A 4N0SA 4FT5A 4HVDA 2GHLA 2WMRA 4H1MA 4JIAA 2R3IA 1DAYA 1JVPP 1H1RA 4FV3A 4F0IA 3LZBA 5EYDA 4OTIA 2PULA 4KSPA 5HE1A 4UYAA 5AP2A 2ITOA 2QVSE 3FMLA 4DTAA 1CKIA 2E9UA 4NTSA 3RI1A 4BTJA 4DCAA 4JDIA 5HG7A 5BUIA 3LLAA 3FQEA 1ZARA 4R7IA 2WTIA 4O0TA 3D7ZA 1W84A 4AU8A 4QP1A 3EN6A 3GVUA 3RAHA 3BLQA 4X2FA 2OJJA 2IPXA 2XKDA 5J9LA 1WBPA 5CASA 5JH6A 2RIOA 4ENYA 3E7OA 2JFMA 4BI2A 4EK8A 4O0SA 5HE0A 1Q24A 2P33A 2PMLX 3NYXA 4LV8A 5HD4A 1R1WA 3PXQA 3R04A 3RKBA 4RC2A 3IKAA 1LP4A 2C3IB 3CTJA 1OMWA 4M66A 4O21A 2W1ZA 5H8BA 2VTMA 4EH3A 4QYHA 1YOJA 4L52A 4BHZA 5HX6A 5C4KA 3ACKA 2QOHA 3POZA 4FTQA 4G3GA 4MF0A 4MNFA 3W2OA 3OCTA 3ZOSA 4DCEA 1K3AA 4NT4A 4ZZOA 3OXIA 2OXDA 4XP0A 4FTIA 4ASEA 1Z5MA 2C68A 3IW6A 4YZNA 3A7JA 5ETIA 3RZFA 5HTIA 5BVNA 2ZDTA 2Z7RA 4JS8A 4PP9A 1BKXA 5JRQA 3JYAA 4IAZA 4YO4A 3LFNA 3R7OA 4MD8E 2CKEA 3OY3A 4D2SA 2Z8CA 1PJKA 2YCQA 3DKOA 3O96A 3Q6UA 4FEVA 4EH9A 4BCIA 4IVDA 5DGZA 4C4HA 4YJRA 4M69B 1IA8A 4H58A 4WBOA 2VUWA 2ZJWA 5F94A 2CHLA 3SDJA 2C30A 5H9BA 4U3YA 3UOJA 2OIDA 4FUXA 4XV3A 5G1XA 3RPRA 4ACGA 4PTEA 4E7WA 3U6IA 3GUBA 3C4XA 2WMSA 2BCJA 3KXHA 5KMJA 1GAGA 3QRJA 2W5AA 4CYIA 2V55A 5HO7A 3KXNA 2CCHA 2GHGA 1F0QA 3PVUA 3ZUVA 4EK5A 3DAEA 3NYOA 3M11A 4RVMA 3AQVA 3ITZA 2WMXA 2Z2WA 4EHZA 3ZO3A 4O81A 2IO6A 5M57A 3JVRA 1G8AA 3NNVA 3H0YA 4GUBA 3RMFA 4LG4A 5EHYA 4UZDA 4CEGA 3E63A 3Q32A 2QQ7A 3GP0A 3KGAA 4KS7A 4NM3A 4WSYA 2F9GA 2A4LA 2Z7QA 3FKNA 2XNPA 2PVHA 4ENXA 5JFVA 2B54A 3NR9A 5IQIA 5TKDA 4LOPA 3PXYA 3PJ2A 2WHBA 4PDPA 5FRIA 4QMQA 4X6RA 4XNEA 5AP4A 3KULA 4Y83A 4O0XA 5CQUA 5ANOA 5M08A 1CDKA 2HW7A 3HMNA 4XG4A 3RPVA 3L8SA 3DB8A 1IR3A 2XA4A 4J71A 1PXOA 3DKFA 1A9UA 3OWJA 4N4SA 4FT0A 3R1YA 3PA5A 3H9OA 3R9HA 3WOWA 4BBMA 3LCDA 5E8VA 4KRCA 3QCXA 3VS6A 1GZOA 5CEIA 1MRVA 3CXWA 1H25A 3DT1A 4FL2A 4QMZA 5LVOA 5K5XA 1WBOA 2UVYA 1T45A 3VBWA 3R7UA 4IQ6A 4AE6A 1YXTA 1OIQA 3R1NA 3HA6A 4P5QA 2BHHA 4EOSA 5LMKC 4M0YA 1H00A 2HK5A 3FL4A 2UZDA 3OXTA 4TYJA 5FDPA 4AACA 4G6LA 5A4CA 5HHWA 4OTGA 4QPMA 3M2WA 3VBQA 1ZWSA 2WTCA 3Q2MA 2F7ZE 4UMUA 3AC3A 3U51A 1W82A 1YI4A 2C4GA 2HOGA 4HGLA 3WILA 3ZLXA 2QU6A 4FV6A 4RWKA 2VTSA 3UO5A 4ZOGA 1YXUA 3VHEA 5HIEA 2FSMX 4PL3A 3TKUA 3G6HA 4ONAA 3U8WA 3H9RA 3D9VA 4BCFA 3EN4A 2IVTA 3QA8A 3R8ZA 2YJRA 4QYFA 5CVFA 4C34A 1CKJA 3FZ1A 1OIUA 1VYZA 2BIKB 4RWIA 4RZWA 2EVAA 4U44A 5DHJA 3GC8A 1XO2B 5EI6A 5F95A 5LVLA 4J7BA 5AFVA 3DXPA 1OECA 1JKTA 3BWFA 4RJ8A 5DT0A 3D4QA 5LVNA 4C3RA 4QO9A 1JPAA 3LPBA 2RG5A 5CU2A 5IQHA 2H8HA 1IAHA 1PHKA 3OCBA 3UVPA 1H26A 4I24A 3I7CA 3A8XA 3OS3A 1UKIA 3EIDA 1AQ1A 4YJPA 4RG0A 3GXLA 3TNWA 4PF4A 1KWPA 4LM5A 2C3KA 3EFKA 1U5RA 5AEPA 3R7GA 2CMWA 4XRJA 2WZJA 5CWZA 5A6OA 4FV2A 3G33A 5AUUA 3ZZWA 2FB8A 4Y5QA 1OL2A 3L9NA 5LMKA 4V01A 4X3JA 3EQRA 2BZKB 3F6XA 1Q3DA 3ERKA 1W83A 3I4BA 1ZRZA 1SVEA 2VO3A 3P23A 3SOAA 1JKLA 2WIPA 2GS6A 3VWAA 2ZYBA 4E4NA 5C27A 4C02A 4M69A 4MF1A 3W8QA 4BDFA 1NA7A 4YJOA 5I0BA 3IOKA 2JLDA 4D9UA 3TUDA 2R2PA 1NVRA 4XOZA 2X39A 4FTUA 1ZOEA 3S3IA 5IKWA 3D5WA 2IZRA 2BAJA 2VX1A 3NUNA 3P5KA 5EH0A 3VVHA 4FUYA 4IZ7A 4C37A 4NU1A 4PNKA 2QO7A 4KKHA 4DH5A 5K5NA 3C5IA 2VWXA 3QWJA 2EU9A 5K3YA 1FQ1B 4O7SA 4Y8DA 3QZIA 2XK8A 3QTIA 3ZO1A 5CI7A 4UN0C 3U55A 4LGGA 3QQLA 1U4DA 4IVBA 4CSVA 5A4LA 1M52A 4QP7A 4APPA 2OF2A 3IO7A 1H1WA 3FLYA 4CCUA 2PE1A 1PY5A 5TF9A 4DFYA 5AAEA 5E90A 4IACA 1LUFA 5AP7A 3FBVA 3LQ5A 4HW7A 4FR4A 4NL0A 3CKXA 5M44A 3ZFYA 1JKSA 5FM3A 3V04A 2JIIA 2QKRA 4A7CA 5BQ0A 5JFSA 3LW0A 4LRJA 5EHLA 3TZ8A 3DFAA 4GFOA 5F4NA 4JRNA 4C38A 3QCQA 4L44A 4CZYB 3LXKA 4D4YA 5LOHA 1PXIA 3TV6A 3QTRA 1JSVA 3IQ7A 4BWKA 4NM5A 4J96A 4ALWA 4GT3A 4NYEA 2EWAA 4QP8A 4MNEA 5LVPA 4IDVA 3EQHA 3Q4TA 2F49A 1JQHA 3Q9XA 5TR6A 5L6PA 4C4FA 4FNYA 4IAYA 4EYMA 1Q4LA 3ORPA 2OWBA 4G34A 3P7CA 4U41A 4WHZA 4LMNA 3NW7A 4YJNA 5IEVA 2R3RA 3HDNA 3UIXA 3RBWA 3K5UA 3II5A 3QX2A 4L3LA 1X8BA 2I40A 4KBKA 2CNQA 4C7TA 2PPQA 4N6YA 3BHHA 5HE3A 4FKUA 1H0WA 4YHTA 3FI3A 4JT3A 4ERKA 3WYXA 1H1PA 2C0IA 3PP0A 4S30A 5AR7A 3UG2A 3WF8A 4D4VA 2HCKA 1HCKA 4XG9A 5DEWA 4FSQA 5A4QA 2UVZA 2XNBA 3BV3A 3ZUTA 1P2AA 4MQ1A 4H1JA 2R3NA 3JXWA 2XIKA 1FGIA 3VUTA 5DFPA 2ZV9A 5JSMA 2WD1A 5CU4A 3S00A 4L01A 2OKRA 3R63A 4F9CA 3ZC6A 4NWMA 5DWRA 3ORLA 4A06A 5DG5A 2WELA 4Q9ZA 4EOPA 2ETKA 3VBXA 3HUCA 2BVAA 3OBGA 2PUIA 1WAKA 3QQFA 3L9MA 3OEZA 3QQHA 5M55A 4QP3A 4CXAA 1UU7A 3IDCA 3Q5ZA 4Y5HA 2V22A 5IG1A 3MESA 3WZUA 4QYEA 2R0IA 5IF1A 5KO1A 3BYUA 4AA5A 4C62A 4E4MA 1XBAA 5LARA 1NT2A 2YZLA 2WMVA 4K11A 1OBDA 3AT2A 4IMYA 4L8MA 4FIGA 3W2QA 3DJ6A 2VZ6A 2R7BA 3OCSA 3D2KA 5HNIX 1L3RE 4EJ7A 2WMAA 2YERA 2HW6A 5L8KA 3MJ1A 2KULA 3C0HA 3LJ2A 2BFXA 5HGIA 3ZS5A 3UJGA 4TWCA 4FICA 4CKRA 3BHVA 3IW4A 4U80A 5A46A 3D5VA 1YDRE 2ERZE 4EEVA 4RBLA 4B7TA 3P79A 3A4OX 5LCKA 4F6WA 5BNJA 5AIRA 3Q04A 1VJYA 3CY3A 4K77A 2J0KA 3LHJA 3MA3A 5EYMA 5C1QB 3BRBA 4CLJA 4U81A 4IM0A 4QQTA 5KMKA 1F3MC 2AC5A 2Z7SA 4JQEA 4NTTA 2CGXA 3VQHA 1KV2A 3I1AA 2E2BA 3GFWA 3IOPA 4YC8A 2PZ5A 5JRSA 4C4EA 2H96A 4CMOA 4RC4A 3RP9A 3SXSA 3CC6A 2FSLX 3RNYA 1GNGA 1OL5A 3RAKA 1P4FA 2GHMA 4TPTA 4ZSAA 1G3NA 4IW0A 1XH7A 5GZ9A 2VTOA 3ET7A 3UNZA 5CAUA 4E4XA 5L2SA 4R77A 1PKGA 2V7AA 3NIZA 5CY3A 1MUOA 4A9YA 5BUEA 4G17A 2C6LA 2R7IA 3FI4A 3OWPA 2ERKA 1OUYA 4DG2E 4WNOA 4BB4A 3DJ5A 4UV0A 3EQPA 2C6OA 4IIRA 3UYTA 4EORA 4KA3A 2JKOA 5DA3A 5DBXA 3OT3A 5IQEA 3I7BA 3ZEWA 2YABA 3DBDA 3KCKA 3KL8A 3EZRA 3ZH8A 3FE3A 3COHA 4F9WA 1PXJA 4FV5A 3NSZA 4PTGA 1O6KA 3TZ7A 4DGLC 4FTAA 3FMDA 4AT3A 4XBUA 4YHFA 4ZS4A 3NPCA 5J87A 3S0OA 4OBPA 2HWPA 1SYKA 3Q9ZA 4IX3A 3LAUA 4U3ZA 4P90A 2W9ZB 4OTRA 2VWWA 4EOIA 3PSCA 5A4EA 1QPJA 4GG7A 5KHWA 3FPQA 4O27B 5L8JA 1YQJA 2ZMDA 3ACJA 3P08A 4EOLA 2X8EA 3QQGA 3CTHA 4MQ2A 4O2PA 3RPOA 4EH7A 4G1WA 4FOCA 4UY9A 5FBNC 2P55A 3HRCA 2QONA 1AGWA 4YC3A 5LWMA 2DUVA 1ZOHA 5A9UA 2F4JA 2OSCA 5HU9A 2YWVA 5A54A 5B2LA 3PYYA 2HY0A 4DFXE 3ZRMA 5CNNA 3NYVA 5A14A 4X2NA 5AIKA 4L7FA 2FUMA 2O64A 3V5LA 3WE8A 1Y57A 2VWUA 5AR4A 3COIA 4PTCA 4BDKA 2PVLA 1R39A 2QR8A 2FVDA 2JAMA 2I0YA 1M2RA 4PMPA 4Z3VA 4YJUA 5B7VA 4I6QA 4BYJA 2Y4PA 3TN8A 1W8CA 4L6QA 4O0YA 4L68A 3NVMB 1YWNA 4DLIA 5HORA 2O63A 5AAGA 4R1YA 4XG2A 2FGIA 2CPKE 2PHKA 3IGOA 2PU8A 4G5PA 5E4HA 3F3VA 3KRJA 1BX6A 3BI6A 3FKOA 3EQCA 4GIHA 3ZBXA 3FXWA 2I0EA 2BAQA 2HXLA 2VTLA 2ETMA 4IAKA 4MXCA 5I9YA 3DU8A 3N9XA 4FI1A 4F63A 3BHUA 1IASA 4BZNA 3H30A 1Q8WA 3ENMA 3P0MA 3GCQA 4USDA 2R3MA 5AV3A 2XJ2A 4GV1A 4BCHA 3CKWA 4E73A 3G15A 4PUZA 4H39A 4UMRA 4AN9A 3L9PA 3VW8A 3NUUA 1E1VA 4X21A 2ZM3A 3OHTA 3FWQA 3JPVA 4C35A 3FLQA 3BU5A 4GKHA 3FMKA 4EJNA 4F99A 3D7TB 4YBKA 3TWJA 5GZ8A 2PE2A 2ITZA 4ZIMA 3F7WA 3KXZA 3O23A 2NNWB 3LJ1A 4A4LA 2WTDA 3CIKA 2OZAB 3Q4CA 4E1ZA 1GZNA 2OU7A 3UOLA 1LR4A 5AV4A 4S34A 3QC4A 3MDYA 5TO8A 3KXMA 4MYGA 3NNUA 3R8MA 5EKNA 4U0IA 3OCGA 4Q2AA 4JVGA 4QTAA 4BBEA 4MD7E 2OG8A 3PZHA 4BIEA 3C4WA 3NAXA 3AC1A 2J2IB 2A1AB 1BMKA 3KFAA 2JKKA 2C6DA 2QNJA 4MK0A 5D11A 5DVRA 3VJOA 3GCPA 3U54A 4YZDA 4C3FA 4EOOA 1PF8A 5AV2A 5KZ0A 5L2QA 2G2FA 2BRNA 3KKVA 2W1IA 5A3XA 2EXEA 3BGPA 3CS9A 3H10A 4JIKA 5CSVA 3LXNA 2ITPA 4OTPA 5KZIA 3K5VA 3DTWA 1URWA 4FTJA 4I92A 3PRFA 4PDOA 1OZ1A 3NIEA 4DEAA 4G3EA 5JFWA 4O7WA 5M4CA 1YWRA 3DBFA 3P7AA 4AP7A 3C13A 4D58A 4AZSA 3S2PA 4FV0A 5M4UA 3PRIA 3IG7A 4ZZMA 5HICA 3C4ZA 4AA0A 3FZSA 4ALUA 4CZUA 3QD4A 4F4PA 4QD6A 4FSNA 4JR7A 5FP5A 4BN1A 3FMHA 5CEKA 3NUAA 2LGCA 5EFQA 3QRUA 4D1SA 3HUBA 3A60A 3ORMA 2QLQA 3QD0A 4X0MA 4IB5A 5EI8A 5ACBC 4BHNA 4QNAA 4EK4A 1YHSA 2CLQA 3DQWA 4F65A 4BDEA 3UIUA 4QMNA 1B6CB 3W32A 4IX5A 5FTOA 4HOKA 5J1WA 1E1XA 3NCZA 4XUFA 3UPXA 3HV4A 1NY3A 4FE2A 4TZRA 4PV0A 3EQDA 4FVQA 2PK9A 2QOKA 3H0ZA 1XKKA 4DT8A 3EFJA 4WSQA 3KCFA 2ZDUA 4PMTA 4R8QA 3O7LB 4EOQA 2PL0A 4TYIA 2IZUA 3QXOA 4HGTA 1WFCA 4RVKA 4FKOA 4OTHA 3FZOA 4UBAA 2YIXA 4O7NA 3UE4A 3HEGA 5HOAA 4MBIA 4BTFA 4DTKA 4O6EA 4QMXA 4FSUA 2OXYA 2YM4A 4HYUA 4R3RA 2J0LA 2UZTA 3DV3A 1M7QA 4C61A 2R0UA 3NLBA 5I4NA 3O0GA 4IX6A 2X9EA 5IQFA 1JAMA 2CSNA 3GQIA 3PY3A 2XIRA 2BUJA 1QCFA 3HX4A 4YZMA 3V5WA 3W2CA 3DDPA 3UOKA 3OP5A 3SW7A 4O6LA 2YDIA 3ZYAA 5F9EA 2X7FA 4FIEA 4AOIA 2DS1A 5KE0A 5DH3A 4QYGA 3MY5A 4EHVA 3HMPA 3HNGA 2RG6A 2VD5A 5LMAA 4WG4A 1RE8A 4IAIA 3ZONA 2Y7JA 4XS2A 5JZJA 2UW8A 2BKKA 3TDVA 5BVKA 4M12A 4WG3A 2WQOA 1BI8A 3DAKA 3JY0A 2C6IA 5ANGA 2CCIA 3DB6A 4O83A 1Q97A 2XP2A 4MH7A 3NNXA 4ZTLA 3R73A 4YSJA 3FXXA 4JBPA 4UWYA 5D9HA 5ANJA 3C4CA 4OBQA 3Q4UA 4JDJA 3GCSA 5CU3A 3F88A 2JD5A 3QL8A 1YDTE 2ZV2A 2OGVA 2AUHA 3ZHPC 5IPJA 3D7TA 4BDAA 3R2YA 4DEGA 4FEWA 4CGAA 2OZAA 5TOZA 3GFEA 1K2PA 4GFMA 4N70A 5CSPA 2PWLA 3MPMA 4J52A 4LRMA 4FVRA 4M3QA 1R0PA 1OIRA 1GIHA 1RQQA 2HWOA 3MVHA 4BI0A 3DBCA 3E8CA 3G0FA 3HA8A 4BWXA 4QMUA 2W1CA 2FH9A 5LWNA 2PVMA 2VTIA 4XG8A 2P2HA 3O2MA 5CT7A 2XS0A 2VTAA 3L1SA 4JOAA 4O22A 2NRYA 4HNFA 3ORXA 5B0XA 5E9EA 4TYGA 3IW8A 5AUZA 3VHKA 4EHEA 4CV8A 1YVJA 3GB2A 3ZLSA 3OTUA 3Q53A 3EJ1A 4QTDA 4G6OA 3ZSIA 2YCSA 4QTEA 3PLAE 3KREA 4HCVA 3IW7A 2F2CB 4YNEA 2YWPA 3HMMA 2WPAA 3REPA 1YOLA 4UWBA 4CVAA 3ZO2A 3LMIA 4DG0E 3HRFA 5I9VA 3RGFA 4DT9A 2XKEA 3GU8A 3EB0A 3R6XA 4OBOA 4IM3A 4BCKA 2GTMA 2WIHA 1OI9A 4RFYA 3R01A 3HRBA 4QQJA 5A4TA 5EDPA 4BKJA 4NCTA 4RPVA 1OPJA 4M7IA 3OOMA 3UC4A 4JAJA 5C03A 2PUUA 2YM5A 4WOVA 4WO5A 3V5JA 4CFNA 2IZTA 4K33A 3JR1A 2PVYA 1GY3A 3TNHA 4IVCA 5IQDA 4RVTA 4GU9A 4ZLOA 4ITHA 3UO6A 2HZ4A 3QRIA 5ANDA 5FUTA 1PYXA 2YM8A 2ZV7A 3DLSA 3RK5A 4F1MA 4ANLA 3F2NA 4R3CA 2BPMA 1QMZA 2W4JA 1Q5KA 2QG7A 3HV3A 3QQUA 4FTNA 3MVLA 1H1QA 4HJOA 3TNIA 1IEPA 3OG7A 3FUPA 2GQRA 2XBJA 1M17A 3CD8A 3PVGA 2CKOA 4WA9A 2EB3A 5CVGA 3LFQA 4CMTA 2OF4A 3BX5A 4YTFA 3HAVA 2WTKB 3KXXA 2VWZA 3MIAA 4EH6A 3ZFMA 4ACMA 3R71A 3FC2A 4D5KA 3QALE 4U43A 1RW8A 4ZK5A 1CSNA 4UEUA 3E88A 5E1EA 5EYCA 3VS3A 5IDPA 3E8DA 2X8DA 3RK7A 3MS9A 4ZP5A 3FC1X 3R0TA 2PZYA 4KABA 1IG1A 3O71A 4RJ3A 4EH4A 3LE6A 3DTCA 5HLPA 1PMUA 2GS7A 3AT3A 1H1SA 1ZOGA 4DA5A 1TKIA 2RSVA 4TN6A 5HLNA 4I0RA 2XJ1A 5IA5A 1ATPE 4C3PA 2CGWA 2XIZA 1NXKA 3CLYA 3JUHA 5AP0A 3AC4A 4P7EA 4DINA 1KE8A 4O82A 4EQCA 2HIWA 4NJDA 4KS8A 4TNDA 4CV9A 3CQWA 1PMEA 5GHVA 3ZSGA 3PZEA 2OICA 3TACA 3PXKA 2KTYA 3E87A 4FZFB 4OLIA 4GIIA 4EBVA 3PWDA 2W05A 3LVPA 1G8SA 4R1VA 3PXZA 4V0GB 3MVJA 2I1MA 3LQ8A 4F7SA 1SZMA 1WVYA 2XKFA 3FKLA 3Q9WA 4XLIA 5BMMA 1H4LA 2XM8A 1KE9A 3FLSA 2ACXA 2AYPA 3PY0A 3KK9A 2J0MB 4XOYA 4EH8A 1BL6A 5CS6A 5I5ZA 3NDMA 1JSUA 4EK6A 4EKLA 1YRPA 4Z55A 3V5PA 3U4WA 2J0IA 4AGUA 3MI9A 2R3KA 4BCPA 5CYIA 3DXQA 2BDWA 2ITVA 4F0FA 4ZSJA 4BDGA 4KB8A 3RCDA 1O9UA 1WZYA 3QU0A 4PWNA 5F1ZA 2QR7A 2IN6A 4O7VA 2GNLA 3ZUUA 2BILB 2E9VA 5DRBA 5H2UA 5FXSA 3ENHA 2HY81 1PXLA 4RJ5A 3BBTB 4XLVA 2JKMA 3FHIA 3BELA 3E64A 2XMYA 2OIQA 3ORKA 4NKSA 2IW8A 5GJGA 4DH7A 2WTKC 4E5BA 3LCSA 3I5ZA 5AUVA 4YJTA 4W8DA 1I44A 4IANA 2C5YA 3MY1A 1XH5A 4I6FA 1V0BA 5DIAA 1TQPA 2Q0BA 3AT4A 4E6DA 5JN2A 4BICA 2QI8A 2YAAA 2WXVA 3G9LX 4HVGA 3QLGA 4MNEB 4AG8A 4GYGA 1ZMVA 1GZKA 2G15A 3AC8A 2O5KA 4J53A 4CT1A 4BDJA 1BLXA 3ZEPA 2YIYA 2RFSA 3MFTA 5CXHA 2UZBA 3W2RA 1T46A 5HESA 3THBA 4BCGA 3GENA 3F5XA 4ZMEA 4QMTA 4XCUA 5HX8A 3MB7A 4K0YA 2FSOX 3GI3A 3BIZA 3MIYA 4BTMA 4JX3A 3HV7A 4NKAA 2XIYA 4BF2A 4XG6A 3HP2A 4K18A 2PMIA 5CANA 3QA0A 3VIDA 3A7FA 4HYSA 5D7VA 5CAQA 3P86A 5ANKA 2GQGA 5IMEA 3IDBA 2XRWA 5BVFA 4K2RA 2JDVA 4X6QC 4A4OA 2CDZA 1K9AA 2EXMA 3NWWA 4Y95A 3R1QA 4CFFA 1MQ4A 4FA2A 5IA4A 4APCA 3QRKA 2FYSA 3BHTA 4D1XA 5HCXA 3EQBA 3SHEA 3FV8A 2WQEA 2C6EA 4QQCA 3CP9A 3OWKA 3SOCA 5I9ZA 5KMMA 3WIKA 2IVVA 5KMIA 5FXRA 4H05A 4F9AA 1PXMA 5AX3A 3RVGA 1XBBA 4EOMA 4LL0A 2B4SB 2OH0E 4HZSA 4YJQA 2GMXA 3QBNA 3LFFA 4TYEA 2XNGA 4W4VA 2YDKA 5HG8A 3QZHA 4FGBA 1KE5A 3QZGA 1OB3A 4HGSA 4HNIA 5CEMA 4FIFA 4HYIA 5M07A 4G31A 4JI9A 3SV0A 2O0UA 5I9UA 4S33A 4G3CA 3OXZA 1I09A 4ARKA 3CQUA 4TXCA 3MH3A 5C9CA 2NRUA 3F3UA 4MXAA 2OBJA 1KOBA 1J3HA 3R21A 2F7XE 5FQDC 3UBDA 4G9RA 1CMKE 3K3JA 4I23A 4L46A 5AMNA 3VS1A 4USEA 5HBHA 3L8XA 2ZV8A 3Q52A 4QOXA 2BKZA 4FNZA 4L53A 3DFCB 4L45A 5E8SA 4ZJVA 3R8UA 3GQLA 4AN3A 5HG9A 4V0GA 1Q8UA 3HYHA 4GL9A 2O8YA 1MRUA 5J79A 4RX7A 3RM7A 1Q8YA 4W9WA 5FXQA 1YI6A 1ZXEA 2C5OA 3TG1A 4XMOA 4YZBA 3Q5IA 4D2WA 3VUMA 4GUEA 5T6KA 4C36A 4L67A 2UUEA 3LKMA 3BYMA 4KWPA 4FK6A 5BVWA 2J0JA 4LQMA 2VU3A 5HKMA 2XIXA 4FG7A 3IDPA 1YI3A 4DH1A 5K4IA 5LJJA 3DY7A 3BE9A 5IZFA 4TWOA 3TEIA 2BROA 3G6GA 3UMXA 2XH5A 4BWPA 4X2KA 4WUAA 3DKGA 3VUDA 4OGRA 1WCCA 3CR0A 3DS6A 2VAGA 3B2TA 4JBVA 5KCVA 3F2RA 4UMPA 5EM5A 2YM7A 3DA6A 2BALA 5AP5A 3CPCA 3O51A 4M13A 5HCYA 4XYFA 1Y6BA 4ANSA 3ORZA 3Q60A 4KIPA 1KE6A 5L6WL 4F0GA 5J7BA 3LM0A 2R3LA 4RVLA 3RINA 4B99A 1ZZLA 4ANBA 1GIIA 4QYYA 3EZVA 4GG5A 4O7YA 4BBFA 3OFMA 1S9IA 1P14A 1QL6A 3FMJA 3FQSA 2CJMA 3MSSA 4NUSA 3GBZA 1MRYA 1Q41A 3QYZA 4PP7A 4AZFA 3ATTA 4MHAA 4Q5HA 4HVSA 2ITTA 4IBMA 1YHVA 2YM6A 4FVPA 5HBJA 5HU3A 4YJVA 2IVSA 3TT0A 4AW0A 4JJRA 3R9OA 2C5XA 3ZRLA 3KRWA 1OL6A 2BRHA 1VR2A 5FLFA 5BYZA 2UVXA 3VUGA 4L9IA 2R3PA 1M2PA 3GGFA 1Z57A 4NEUA 3EH9A 4TWNA 3BPRA 4RQVA 3ZC5A 3KRXA 3K54A 2W4KA 2OI4X 4QT1A 4QMVA 3UDBA 4U45A 3CGFA 5LXMA 3LOKA 3FHRA 4DFZE 1W98A 2O65A 4RJ4A 5AP3A 4E5WA 3N4VA 4FSWA 3VF8A 2QD9A 2BDJA 4G3DA 3D83A 2Z60A 3FXZA 2G01A 3OUNB 4RIXB 3A8WA 3LXPA 5E8WA 3RHXA 4M68A 1XH6A 3OBJA 4U79A 5FM2A 1FVTA 3BGQA 4YLLA 1ERKA 4PY1A 3R7EA 3AC5A 4XV2A 2IWIA 4DEBA 3AD6A 1KE7A 2X2LA 3MPTA 4AW5A 4W4YA 4L00A 4RGJA 2PZRA 4X3FB 4S32A 3AMBA 3P4KA 5L2TA 4C8BA 3R22A 4ZMFA 4AS0A 3T9IA 3UNKA 2LAVA 2QG5A 3A7IA 1H28A 2HENA 4EQUA 4E26A 3TNQB 4UWCA 5AUYA 4W4WA 5C8KA 5CF4A 2BZIB 4ZS0A 3PPKA 3V8WA 1H0VA 3WF5A 4TWPA 1PXNA 4H36A 5CSWA 2ZVAA 2ZOQA 2NO3A 3PVWA 3QX4A 5ETFA 2BRGA 3HMIA 4ZEGA 5AJQA 3QGYA 4B8MA 3MVMA 2B0QA 2CN5A 2WQMA 4O91A 2RFNA 3I6WA 3D14A 2GCDA 2VRXA 3F2AA 3PE1A 4M97A 5J9ZA 5JEBA 1W7HA 3F82A 2XNEA 3D0EA 3BEAA 4II5A 4F9BA 3OVVA 2X9FA 4FKPA 2X0GA 3CD3A 4C4JA 3QKMA 4BGGA 2WTJA 3E62A 4LFIA 2WQNA 2QOCA 4FT3A 4RFMA 3VBVA 3ZSHA 5JK3A 3Q3BA 2GFSA 3NCGA 4E8AA 4O1PA 4FKWA 4IB3A 4FSYA 3SC1A 1W0XC 4HGEA 4UMQA 3K2LA 2HAKA 4AZVA 3HGKA 4YP8A 3NUXA 3PP1A 5CT0A 5E91A 1JWHA 4KRDA 3OOGA 4EZ5A 3VRZA 2G1TA 3NYNA 2QHNA 4O7LA 3FLWA 2YIRA 3E92A 2CGUA 4XJ0A 5IH5A 5A6NA 4O7ZA 4FMQA 2O3PA 3FMNA 3GC9A 4QPSA 1DI8A 1LEZA 4IHPA 5ETAA 3T3VA 1YDSE 3VS2A 3VO3A 4NIFB 3FSFA 4FOBA 4HZRA 5EK7A 3PFQA 4DN5A 4E6AA 1FBNA 3FZTA 3RWPA 4B4LA 3RK9A 5CF5A 3KC3A 4J97A 1JOWB 4X2JA 4BCNA 4ITIA 4KAOA 3ALOA 4X3FC 3ZRKA 3C50A 1OIYA 4K6ZA 1Q62A 3ORTA 4TTHB 2C1BA 5HBEA 3CY2A 5CTPA 3ANQA 5EW3A 4E4LA 4YMJA 2J7TA 4RFZA 2UZLA 3LCOA 3FAAA 4S2ZA 4L42A 5E8UA 4CTBA 3QCSA 4OT5A 2CN8A 4K1BA 4W9XA 4F64A 5AUTA 3ZLWA 1HOWA 4L43A 3S1HA 1DI9A 4B9DA 1ND4A 5L2WA 4MBJA 3C51A 4DFNA 4BIDA 4CLIA 5IQCA 5HZNA 2W5HA 3F61A 1O6YA 2YN8A 5TE0A 4QPAA 3VUKA 1JNKA 1UNHA 4PNIA 3CSVA 4DTBA 4DYMA 3LIJA 2UV2A 4QQ5A 4C59A 3HMOA 2YAKA 4XG3A 4GEOA 3GU7A 4DE4A 3HKOA 2J5EA 4XRLA 5DEYA 4YTIA 2R3OA 4WKQA 3NX8A 1RJBA
chains in the Genus database with same CATH superfamily
4L3JA 3MY0A 4DG3E 3DJ7A 3JVSA 1VEBA 5D12A 5CNOA 2OFVA 2WTVA 4O0WA 3U6JA 4FF8A 4I1ZA 2Y0AA 3PIYA 1SMHA 1U5QA 4HCUA 5E1SA 4X3FA 3FSKA 4KBCA 1XH4A 3EKNA 3ZM9A 2X2MA 4FL1A 3NMUF 3BYVA 3DGKA 4FSMA 4XEYA 1KOAA 5ANIA 1DS5A 1NVQA 4BY9E 4DBNA 3RPYA 5CF6A 1Q8TA 2OK1A 3BLHA 4EH2A 3N4UA 3NAYA 3UIBA 4CCBA 3CPBA 4WD5A 5DLSA 2XYNA 4CNHA 3R00A 3VW6A 1FINA 3QXPA 1ZY4A 3PG1A 3WZEA 5DYJA 5H8GA 2QC6A 1S9JA 4ALVA 4KINA 2X0QA 5HIBA 1PMVA 3DNDA 1XQZA 2X6EA 5GINE 2UZNA 4NZWB 2YDJA 2QOIA 3A7HA 4HCTA 2GSFA 4O0UA 2GS2A 5DE2A 5AAFA 3F7ZA 5HI2A 4Z7HA 4DEEA 3ODYX 4BCQA 4FTKA 4LMUA 2JGZA 4K9YA 5IUIA 3QAME 5JQ5A 2EXCX 5FD2A 3OD6X 3OUKA 3QGWA 1OPKA 3BCEA 5EKOA 4YZCA 4DGOA 2YZAA 2OJGA 5HVJA 2C6TA 3OT8A 4FKRA 4RIXA 3VN9A 4FTRA 3PIZA 5JT2A 4M67A 5IUGA 2ITUA 4MXOA 2WGJA 2YCRA 2ETRA 4XHKB 3QYWA 4O7RA 4BFMA 2ONLC 3UZPA 5L2IA 2J90A 4G9CA 5CI6A 5CEOA 4EL9A 2IF8A 2J50A 4IZ5A 3FMMA 1UV5A 4PX6A 3POOA 1SVGA 4FT7A 3DCVA 4X2GA 3E93A 1XBCA 3P9JA 3SW4A 3VUHA 3ID6C 2YLFA 4ANQA 3QUPA 4S31A 3OF0A 4TT7A 2I6LA 4NIFA 1E9HA 2QODA 1UU9A 2RF9A 2VWVA 2GU8A 3F66A 4R7HA 5HO6A 4R7BA 4FEXA 5BYYA 3ZMMA 3DAJA 3TIZA 1PKDA 2H34A 2XF0A 4BYIA 3DOGA 3F5PA 3P5JC 5I3RA 2NP8A 5CEQA 4TY1A 3RJCA 4FODA 2UZVA 3QD3A 5D41A 2UZOA 5HTBA 2PYWA 2O2UA 3ZM4A 3GCVA 5EQPA 3BGZA 5IH4A 2XAOA 4DBXA 3O50A 2BR1A 2R4BA 3QHWA 4JRVA 4O4BB 4IVAA 1SNXA 1MQBA 1J91A 2PUPA 4Q5EA 4FC0A 4JL9A 3ROYA 1ZMWA 3BBWA 3C5UA 3PLSA 5KNJA 3WE4A 1URCA 3OZ6A 4ASXA 3NEWA 3HV6A 5L8LA 4O84A 3CQEA 1Q61A 4GYIA 4AXFA 2VGPA 4DH8A 4QMLA 3AC2A 3TZ9A 3V5TA 2J5FA 2VNWA 4IADA 4FYNA 3UYSA 4DAWA 4F1TA 3TL8A 5CSHA 2ONLA 4ZSLA 4EOKA 3ANRA 3SQQA 3HV5A 2VX3A 3BE2A 3O17A 4CFUA 5GIPE 1TQIA 5K0XA 5FGKA 2B55A 4Z16A 3CJGA 3HVCA 2PZIA 3T9TA 4LV7A 4CD0A 5HIDA 4I94A 4BTKA 4ZTMA 4JG8A 5HG5A 3FYKX 4LGDA 1IA9A 3PJ3A 2VTNA 1PMNA 2DWBA 2R3QA 3F5UA 1GZ8A 5GNKA 4F6SA 5FP6A 3ULIA 2UW0A 3ROCA 5FTGA 4AT4A 4E6QA 4LV5A 4RLLA 3UODA 5M56A 3IW5A 5AR2A 5CAPA 3CTQA 3WF9A 4QP9A 4YTHA 4AQCA 2W1HA 4QMSA 4J95A 3MGYA 3UQGA 5FG8A 2PUNA 3B8RA 3EN7A 5BVOA 2BZHB 4F08A 3QTXA 3COKA 2JITA 3MWUA 4ZY6A 3EQFA 4O1OA 3FQHA 2VO0A 3EYGA 4KIKB 2OLCA 3LFBA 2XBAA 5ANEA 1VYWA 5KKRB 2CKQA 1Y8YA 4AW1A 4CG8A 4EOJA 2YM3A 2C3JA 4FKJA 4FV8A 4U40A 5C8NA 3QF9A 2BDFA 4QMOA 3KEXA 4CMUA 4LUDA 2BMCA 4FKLA 3BLRA 3UMWA 3F3WA 4OTFA 5AADA 4MWIA 5KHXA 3ETAA 4U42A 4G6NA 3PSDA 3UGCA 2ITXA 4NCTC 4BDIA 2A0CX 4XP3A 4RQKA 5JFXA 4NM7A 5M4IA 4I41A 1WBWA 2YFXA 2C69A 4G5JA 3S95A 4FZ7A 3TKHA 3W1FA 4YGAA 4D28A 2VO6A 2W99B 3MV5A 4JBOA 4XH6A 2UZEA 2XM9A 4B6LA 1OKWA 2R5TA 2UW9A 5KMNA 4ACCA 3GOKA 4CFWA 1YOMA 4IC8A 3EOCA 1J7LA 5L3AA 5L4QA 3EQIA 4GT5A 4LRKA 3WBLA 1OUKA 1WBSA 4JLCA 3EHAA 2C47A 4M8TA 4I5HA 5J5SA 2GQSA 1VZOA 2GNJA 3AMYA 3DPKA 3LCTA 3PPZA 2BRMA 4CTCA 2WU7A 4Y46A 4ANNA 1QPCA 2CKPA 3FMEA 5HEZA 1CKPA 2X2KA 4DEDA 1ZAOA 3FY0A 3UZTA 4ZLZA 3TUBA 3HP5A 3W2SA 5AR8A 3GOPA 4FV4A 4LGHA 4JG7A 5JZNA 1REJA 2JC6A 2XANA 1ZY5A 4QMMA 4QP2A 1YXXA 4RLKA 5ETCA 2UW5A 3WIGA 4ACHA 3RTPA 4TKSA 5GIOE 1YHWA 3PE2A 4U7ZA 5AWMA 4YU2A 4QP4A 5EOBA 3OW4A 3KMMA 2WEVA 4IJ9A 5FWKK 4D55A 4IWPA 4FKVA 2XK7A 4GS6A 2E9OA 2RGPA 3D94A 3EMGA 3KXGA 3DZOA 5H3QA 3NUSA 1UU8A 3BV2A 3G51A 4KIOA 3BU6A 3ELJA 4OUCA 1FMOE 3KF7A 3PA3A 2QOQA 1CTPE 3NW5A 2PE0A 2UZUE 5E92A 3O8UA 4FT9A 4O38A 3WZDA 2V62A 5KKRC 2YEXA 3CGOA 4PPCA 3ZZEA 4EC9A 3WF7A 1OBGA 5CEPA 1TFFA 3SRVB 4M15A 2PVJA 3CJFA 4RRVA 5GJDA 2IG7A 4DH3A 5HNGA 4F70A 3VS4A 1UU3A 4GVJA 3W0QA 5IQGA 2DQ7X 3G90X 4IZYA 4CRLA 3UZRA 3BKBA 4M0ZA 4ZTNA 2V5QA 3GEQA 1WVWA 3ZLYA 2JEDA 2FO0A 4FGRA 3IONA 3PJ8A 4FKQA 2XB7A 4U8ZA 1FMKA 4E20A 2W4OA 3R9NA 4TL0A 1HCLA 4B0GA 1YXVA 1LEWA 4ZY5A 4AAAA 4NSTA 2OJ9A 2YA9A 4G16A 1ZYLA 3LMGA 4FEQA 2QOLA 4KNBA 4LUEA 3VAPA 1B38A 4EKKA 1V0OA 4TRLA 5DRDA 3KRLA 3AXWA 4FBXA 1CM8A 2WO6A 4QMYA 3C9WA 4AFJA 4ERWA 4FSTA 2QO9A 3OEFX 4IE9A 4NFMA 4UMTA 4CKIA 3MFRA 3N51A 2X7GA 4BZDA 2W1EA 3EWHA 3BQCA 4C0TA 3PJ1A 4PMSA 4V04A 4RC3A 4KIKA 2GNIA 3KIOC 5LQFA 3HZTA 1AD5A 4IWDA 3KB7A 4I6BA 2W96B 3KRRA 4RX8A 5F20A 4F7JA 4D0XA 2XNOA 2RKUA 4RZVA 3QTWA 3SGCA 2W7XA 1J1CA 2QCSA 3LFDA 3RAIA 1Y6AA 3QTQA 5EM8A 3UVRA 4FTCA 1Z9XA 2AC3A 3TIYA 3WZJA 4XX9A 3WARA 2XK3A 4IJPA 2UW6A 2Y9QA 3ORNA 4D2VA 5K9IA 3V6RA 4CFXA 3CEKA 3A62A 3UDTA 3QKKA 5KBRA 1JKKA 5EG3A 3LM5A 3TYKA 1U46A 1OKYA 2Z7LA 3A7GA 3FJQE 3BYSA 3DQXA 3VUIA 2X6DA 4FL3A 3C4EA 5HO8A 3UP2A 5BPYA 4ORKA 4EH5A 2A27A 2WEIA 4JDKA 5KX8A 4Y73A 2UZWE 4D2RA 4GJ3A 5HD7A 3SLSA 4GU6A 4YC6A 4LI5A 5C26A 3VS7A 4Z7GA 1J1BA 4JX7A 3PSBA 2JDOA 2YHVA 3UOHA 1M14A 3DLZA 4J98A 2QURA 4FV7A 5D7AA 4FIHA 3NS9A 2YIQA 3A99A 5AA8A 3LMHA 1F5QA 5IMXA 5JGBA 3D5UA 4PMMA 2ZFYA 2JAVA 2VTRA 4O0VA 4QNYA 2J9MA 1Q99A 2BIYA 1H27A 3DDQA 3GNIB 2VWIA 4R3PA 4NM0A 4BDHA 4BGQA 2R9SA 3NNWA 4AWIA 4D4SA 2BFYA 2OIBA 4L3PA 1ZYDA 2I0HA 2G2IA 2SRCA 2Y6MA 3FY2A 1YWVA 4E5AX 4AGWA 4EUUA 2HZ0A 3IECA 3LQ3A 2P0CA 5JMSA 3SXRA 3TXOA 5CZHA 4R6VA 3HL7A 4I0SA 1JBPE 2DYLA 3BYOA 4WNPA 1Y8GA 5DI1A 5DR6A 3VC4A 3TUCA 4YBJA 1WBTA 1ZYSA 3U9NA 5TT7A 4FKIA 4ANOA 3VBYA 3SRVA 3W55A 3ZCLA 1DAWA 2W1GA 5LVMA 2EB2A 4UZHA 4BVUA 2PMOX 5IEYA 1M2QA 1FPUA 4TW9A 3FI2A 5BMSA 5M51A 3SG9A 3GU6A 3O7LD 1B39A 3V5QA 4H3PA 4BC6A 3ZDIA 5IQAA 5CLPA 5EDQA 1XH8A 2G2HA 3G9NA 4J8MA 2VTQA 1Q8ZA 3ZDUA 4AXAA 5AUWA 4BGHA 4MXZA 4I21A 1PXKA 4UX9A 4CKJA 4MD9E 4BKYA 3LLTA 4H3BA 1P4OA 2BRBA 4MEDA 3V6SA 2B1PA 4QRCA 3TTJA 2W1FA 3RM6A 2IZSA 2YACA 4W4XA 3GCUA 3MTFA 5J95A 4A9TA 3QLFA 4PPAA 2C5NA 3E3PA 4J1RA 1ZYJA 4JNWA 5CENA 2C0TA 1IRKA 4AN2A 4F1OA 4BR3A 4DGMA 5EQYA 4AA4A 3UQCA 3KQ7A 5D10A 4BCOA 4C58A 5IA2A 4KIQA 3U9CA 4JXFA 4JR3A 1BUHA 4KUJA 4M14A 3TJDA 3EKKA 4AF3A 4OAVB 4BZOA 5BYLA 3O8PA 4FK3A 2H9VA 3UC3A 2WOUA 4TYHB 3C0GA 3CCNA 2X0OA 3FZRA 4ZTRA 1BL7A 2B9IA 2WAJA 3WZKA 3ORIA 2BZJA 3TTIA 2WB8A 4QTBA 3JS2A 4V05A 4NFNA 3QQJA 4F9YA 3G0EA 3V51A 3RZBA 2VWBA 2QLUA 3PWYA 4D0WA 3BLAA 2PMNX 2WNTA 3VS5A 1G8JA 4KD1A 2XEYA 4ZAUA 1ZLTA 5EDRA 2YIWA 2JDTA 3NW6A 3W0NA 2I0VA 3H4JA 3UQFA 2J6MA 5E7RA 4UB7A 2QOOA 5J5TA 2J4ZA 3COMA 4X7QA 1TZDA 3TV7A 2WTWA 2VTTA 4OTDA 3F3ZA 3PIXA 3C4FA 5HLWA 3QTZA 4RX9A 4G2FA 4ASZA 1UNLA 1PW2A 2R3FA 2B7AA 4XBRA 4YNOA 3UTOA 4RJ7A 2XK9A 4AT5A 4FKSA 4KKGA 3F5GA 3V8TA 3ZFXA 5EQEA 5HCZA 5C8MA 3QUDA 2BTRA 3PXFA 3ZXTA 1L8TA 1PYEA 4QP6A 5CU6A 1WBVA 5EM6A 5EYKA 4ZZNA 3W33A 1DM2A 1OL1A 2E9PA 3V3VA 4WRGA 4CFVA 4EYJA 4M84A 3MTLA 4CZTA 5AX9A 5EM7A 4QTCA 3EQGA 4FKTA 3E5AA 2PY3A 3OWLA 4IB0A 5HVKA 4ZXTA 3MBLA 4RMZA 5FTQA 4QMWA 5GZAA 5JKGA 5HE2A 4YHJA 3I79A 3C7QA 5HNBA 3ZU7A 4CQGA 4BDDA 5KUPA 3SAYA 3I60A 3R2BA 2WMBA 3AD4A 5CZIA 2I7QA 3DBEA 2GTNA 4HVIA 1XJDA 4PDYA 2X1NA 2Y8OA 1GOLA 3OY1A 4NK9A 3AMAA 5IUHA 2IW9A 4UXQA 1UNGA 1WMKA 4C2VA 1OGUA 3PVBA 3QCYA 3I0OA 4Q9SA 3ALNA 3AGLA 4GK4A 3RALA 1PXPA 3P78A 5J8IA 2ZB0A 4RWJA 4YSMA 3E8NA 4E93A 4FYOA 4ID7A 2OJFE 3EYHA 3U87A 2PVRA 4I5PA 5FEQA 4K8AA 4TNBA 3ZXZA 3ATSA 5EW8A 3KA0A 4J8NA 3DBQA 2JDRA 2Y6OA 1U54B 1JLUE 5AV1A 3BQRA 4FNXA 2X4FA 3SX9A 2J51A 1R0EA 5HVYA 4FG9A 5CAOA 3LFCA 1TVOA 5CXZA 5CAVA 2H6DA 2XUUA 4XP2A 4O7TA 2QOBA 4FIJA 3R8PA 2ITYA 3PDTA 1APME 4DFUA 1NVSA 2JDSA 3AOXA 3LFAA 2ESMA 4O0RA 4D2TA 3T8OA 4LOQA 4OR5A 3IS5A 3R9RA 5CX9A 3I5NA 4C4IA 4U9AA 4OAUC 3GT8A 3SXFA 4DLJA 4DFBA 2RFDA 5IQBA 2F7EE 4FV1A 3W0OA 4I6HA 4U97A 2IW6A 4O4CA 5DPVA 3QQKA 3MFUA 4L7SA 1UWJA 3TKIA 4IWOA 2ZM1A 4Z9LA 3M1SA 2CGVA 2IVUA 4TYHA 1R78A 5EOLA 2PZPA 2BHEA 5AP1A 5ICPA 4EC8A 2R3JA 3KMWA 3ZTXA 4I3ZA 3VRYA 4YJSA 3M42A 3UO4A 3MH2A 3B8QA 5CF8A 3TNPC 2XK6A 4FX3A 4U5JA 3QC9A 3EL7A 3FLNC 4MXXA 4UXLA 2Y4IB 3UG1A 3TJCA 5L6OA 4IH8A 4RX5A 4YO6A 2ZAZA 3D15A 3VBTA 2C0OA 4O96A 1QPDA 1YKRA 4MCVA 3BEGA 4FZ6A 2REIA 2QHMA 3MH1A 1OITA 3B2WA 4IDTA 2WU6A 2E9NA 5KBQA 3HECA 2W9FB 3LCKA 3GC7A 3F69A 5AR5A 5CALA 4IM2A 5IA3A 2B9JA 2GNGA 2XYUA 3KN6A 3EL8A 3PY1A 3AKKA 3KY2A 4RWLA 1ZYCA 4ZJIA 2GFCA 2WMQA 3F3TA 5E8XA 1SM2A 1J7UA 1QPEA 3R83A 4EBWA 3FI8A 4FKGA 4EHGA 3NUYA 4LYNA 4CQEA 4FIIA 5J9YA 4EZ7A 3Q96A 2OXXA 4MTAA 3KN5A 3W18A 3QRTA 4PL5A 2QO2A 3O8TA 3UIMA 2X8IA 4AW2A 2NPQA 3DXNA 4RA5A 3QZFA 4FTLA 3MW1A 4N6ZA 3SA0A 3I6UA 3AG9A 4D2PA 4MBLA 3MFSA 3Q9YA 4ZLYA 3W0SA 4IB1A 4I22A 3MJ2A 2CLXA 3EFLA 4GH2A 4O86A 3LFEA 4E3CA 4GFGA 2JFLA 2GNFA 2BTSA 2CNVA 3KK8A 4GW8A 3T3UA 4O2ZA 1M7NA 4EWHA 3QHRA 2HZNA 5DN3A 2PVFA 4EONA 4USFA 5E8ZA 1R3CA 2OFUA 2XVDA 1NW1A 3L9LA 3HAMA 3GC0A 2C6MA 3Q6WA 4PL4A 3RHKA 2ZM4A 3RCJA 4B8LA 2VO7A 3TCPA 3NFGB 3KU2A 3IPHA 4I93A 4BI1A 2YLEA 5AM6A 4DITA 2A2AA 2C6KA 2W17A 2ITQA 3PG3A 4JG6A 2B53A 2P2IA 5AA9A 2XALA 1H07A 2XNNA 3KVWA 3P1AA 3BHYA 4RIOA 3R7YA 4FTOA 2YCFA 2R3HA 2OO8X 3BWJA 3I81A 4D1ZA 3SVVA 1O6LA 3DZQA 3ODZX 4JDHA 5DT4A 5E8TA 4AFEA 4MX9A 4CRSA 4ZJJA 4WG5A 2Y4IC 3GU4A 3DK3A 4KBAA 2HYYA 2YITA 5C4LA 5K4JA 4WRSA 1UVRA 4FZDB 3HDMA 3EN5A 1KV1A 3NRMA 5D1JA 3W2PA 2Z02A 4BL1A 1U54A 2C5VA 3WI6A 5T3QA 4OW8A 2VWYA 2VTPA 4OTWA 4AOJA 1WBNA 2EUFB 4YLJA 4C4GA 4RJ6A 2XCHA 3KVXA 3FL5A 3QUEA 4PPBA 4PQNA 1G5SA 4C57A 4GSBA 5AM7A 4C2WA 3RPSA 4AZTA 3QTSA 5JGDA 1H01A 1GJOA 1UWHA 1XWSA 4I20A 4F09A 2P4IA 3VF9A 1KUTA 4DF3A 2OW3A 3VNTA 2HXQA 4I4FA 4N57A 4LL5A 4WT6A 4ITJA 5DR2A 4R78A 4RA4A 2UW7A 4YPDA 1OPLA 3PUPA 4YUQA 1Y91A 4DC2A 3U6HA 5JGAA 4BIBA 3NGAA 4WBBB 1GIJA 1YXSA 1J7IA 3OTVA 4GK3A 4I4EA 4FTMA 3I0QA 3MH0A 2XNMA 5DR9A 1U59A 5EI2A 1REKA 3G5DA 4XV9A 4A4XA 4MAOA 4YR8A 1A48A 3E3BX 4A9UA 2FA2A 1SNUA 2F57A 4MXYA 2WQBA 3E7VA 2UW3A 4FNWA 4E6CA 4JQ7A 2F2UA 3VULA 2X81A 4AZEA 2RFEA 2XRUA 5ITAA 2QU5A 3RNIA 2XCKA 3FZPA 4XV1A 3UNJA 3N4TA 5B2KA 4HVHA 1JSTA 1YW2A 2IJMA 5I3OA 5LCJA 3R30A 3FDNA 2PVKA 4AGCA 3CBLA 3VQUA 4CG9A 5G6VA 1V0PA 4YZ9A 4CT2A 5BVEA 1BI7A 4AX8A 2GNHA 4ASDA 1V1KA 4XG7A 2ZMCA 4IC7A 4EI4A 2B9HA 4W8EA 5GJFA 3R28A 1RDQE 2VTJA 2V7OA 3A61A 5CVHA 3R9DA 4IWQA 2XKCA 5E8YA 2X7OA 4HPTE 4QMPA 2HELA 4BKZA 4RIWB 4HPUE 5IDNA 2W06A 4LOOA 4EZ3A 1G8KA 2CNUA 4ZSEA 4GJ2A 3KMUA 4I5MA 3TM0A 1BYGA 1KSWA 2VTHA 4Y85A 1OL7A 3WF6A 4ACDA 2WMTA 3QFVA 5CSXA 3D2IA 5AP6A 5BUJA 4RIYB 3OW3A 4D9TA 2YJSA 3K3IA 2XJ0A 5DOSA 3L8VA 3MYGA 1H8FA 2WMWA 2VN9A 3AGMA 4AZWA 4CFMA 4YURA 1H08A 3QD2B 2XEZA 1OM1A 4R5YA 3R7VA 4PRJA 4RSSA 4NW5A 5KMOA 2C3LA 4ZTHA 4HYHA 4WIHA 5AUXA 2OJIA 4F7NA 5J7HA 3PPJA 5BX0A 2G9XA 3MPAA 4ZTQA 1OVEA 3PTGA 2GPHA 5EW9A 4IAFA 4P4CA 3D5XA 4WNKA 4JBQA 4EUTA 1OGYA 3DNEA 4GK2A 5M06A 4BJJB 2Q0NA 4AUAA 4NJ3A 4YPSA 5K0KA 4BRXA 4DGGA 3Q2JA 1ZMUA 2JIVA 3TDWA 2XZSA 1H24A 2B9FA 5IEXA 2UW4A 2VNYA 5BVDA 4DEHA 3GU5A 5AV0A 3C0IA 1EH4A 3H3CA 3SKCA 4IZAA 5IU2A 2ZB1A 3QWKA 4A9SA 1UA2A 4AGDA 3DK6A 2VX0A 3EFWA 3SG8A 3RWQA 4DHIB 1WVXA 3MA6A 5T68A 2JIUA 1Q3WA 2QKWB 3LXLA 4GT4A 4DFLA 3LFSA 3P7BA 4A07A 2R64A 3OMVA 1UKHA 4DHFA 1ZZ2A 2PVNA 4RT7A 3TZMA 5FEDA 4FSZA 5IISA 4I0TA 4NW6A 3V01A 4BDCA 4P5ZA 3HLLA 3AD5A 3FPMA 3VS0A 3FEGA 3PXRA 2QOFA 4MWHA 3BL9A 2OH4A 3Q4ZA 5AR3A 3SD0A 3UVQA 1LPUA 3IK3A 4OT6A 3R8LA 1MP8A 5I9WA 5J1VA 2JBPA 4GRBA 3UPZA 4EQMA 3G2FA 4GCJA 2B52A 2WOTA 3U4UA 3VJNA 2W1DA 5M09A 3V8SA 2XK4A 3MN3A 5LMBA 4MVFA 5HQ0A 4ZTSA 1A06A 1STCE 3C1XA 3UP7A 2C1AA 4YLKA 2GDOA 4KKEA 3R8VA 2VV9A 4IX4A 2X4ZA 3PA4A 3RAWA 3OC1A 2R3GA 4J99A 3ZBFA 5CU0A 5HTCA 4R5SA 5IH6A 1PRYA 3TI1A 1W2DA 4IXPA 2ITWA 4U6RA 4MKCA 3F9NA 2PTKA 1TQMA 4PDSA 2JKQA 1OKZA 3A2CA 2ITNA 2PSQA 4EWQA 4JAIA 4AE9A 4D4RA 4FTTA 5B2MA 5IA0A 5M4FA 3FLZA 4F7LA 1XHAA 4IEBA 5EHOA 5KMLA 4ZSGA 4Y72A 4IAAA 1XR1A 4GMYA 3OROA 3R7IA 4C33A 2YISA 4FSRA 3LJ0A 4BCMA 5FBOA 4IFCA 4FG8A 5JQ8A 3NUPA 5FEEA 3EN9A 2WKMA 4UALA 3ULZA 4I6LA 5I9XA 4GVAA 3PJCA 2P3GX 1FVVA 3BU3A 3KF4A 2VGOA 3NZ0A 4IFGA 3WYYA 4ZY4A 4BDBA 3IGGA 5CQWA 4P2KA 4RIWA 2FSTX 4I5CA 3S4QA 3BZ3A 4UYNA 2A19B 5DMZA 4FEUA 4G3FA 2HZIA 2BAKA 1FGKA 4WNMA 5IA1A 4GKIA 3QTUA 3JY9A 4AOTA 4DEIA 4ANMA 3E8EA 3QKLA 4FV9A 4RIYA 3W8LA 4DGNA 1SVHA 4JMQA 4A9RA 3DK7A 4NH1A 2OZOA 4CYJA 2V0DA 3W16A 4H3QA 3ZO4A 4WUNA 2WMUA 4JQ8A 3TV4A 4O4DA 3A4PA 3CE3A 4OTQA 4BCJA 3H9FA 2RL5A 3KULB 3FYJX 2W5BA 1FVRA 3DKCA 3L8PA 4KSQA 5DT3A 4YTCA 2AQXA 4D5HA 5DNRA 5ACKA 1XH9A 2W0JA 1OKVA 3R1SA 4F6UA 3NVKI 4FZAB 5H8EA 3MB6A 2JBOA 1P5EA 5C01A 5M53A 1FOTA 2WFYA 5FDXA 3W10A 1IAJA 4BJJA 3R02A 4N0SA 4FT5A 4HVDA 2GHLA 2WMRA 4H1MA 4JIAA 2R3IA 1DAYA 1JVPP 1H1RA 4FV3A 4F0IA 3LZBA 5EYDA 4OTIA 2PULA 4KSPA 5HE1A 4UYAA 5AP2A 2ITOA 2QVSE 3FMLA 4DTAA 1CKIA 2E9UA 4NTSA 3RI1A 4BTJA 4DCAA 4JDIA 5HG7A 5BUIA 3LLAA 3FQEA 1ZARA 4R7IA 2WTIA 4O0TA 3D7ZA 1W84A 4AU8A 4QP1A 3EN6A 3GVUA 3RAHA 3BLQA 4X2FA 2OJJA 2IPXA 2XKDA 5J9LA 1WBPA 4LDTA 5CASA 5JH6A 4O4FA 2RIOA 4ENYA 3E7OA 2JFMA 4BI2A 4EK8A 4O0SA 5HE0A 1Q24A 2P33A 2PMLX 3NYXA 4LV8A 5HD4A 1R1WA 3PXQA 3R04A 3RKBA 4RC2A 3IKAA 1LP4A 2C3IB 3CTJA 1OMWA 4M66A 4O21A 2W1ZA 5H8BA 2VTMA 4EH3A 4QYHA 1YOJA 4L52A 4BHZA 5HX6A 5C4KA 3ACKA 2QOHA 3POZA 4FTQA 4G3GA 4MF0A 4MNFA 3W2OA 3OCTA 3ZOSA 4DCEA 1K3AA 4NT4A 4ZZOA 3OXIA 2OXDA 4XP0A 4FTIA 4ASEA 1Z5MA 2C68A 3IW6A 4YZNA 3A7JA 5ETIA 3RZFA 5HTIA 5BVNA 2ZDTA 2Z7RA 4JS8A 4PP9A 1BKXA 5JRQA 1W2FA 3JYAA 4IAZA 4YO4A 3LFNA 3R7OA 4MD8E 2CKEA 3OY3A 4D2SA 2Z8CA 1PJKA 2YCQA 3DKOA 3O96A 3Q6UA 4FEVA 4EH9A 4BCIA 4IVDA 5DGZA 4C4HA 4YJRA 4M69B 1IA8A 4H58A 4WBOA 2VUWA 2ZJWA 5F94A 2CHLA 3SDJA 2C30A 5H9BA 4U3YA 3UOJA 2OIDA 4FUXA 4XV3A 5G1XA 3RPRA 4ACGA 4PTEA 4E7WA 3U6IA 3GUBA 3C4XA 2WMSA 2BCJA 3KXHA 5KMJA 1GAGA 3QRJA 2W5AA 4CYIA 2V55A 5HO7A 3KXNA 2CCHA 2GHGA 1F0QA 3PVUA 3ZUVA 4EK5A 3DAEA 3NYOA 3M11A 4RVMA 3AQVA 3ITZA 2WMXA 2Z2WA 4EHZA 3ZO3A 4O81A 2IO6A 5M57A 2Q83A 3JVRA 1G8AA 3NNVA 3H0YA 4GUBA 3RMFA 4LG4A 5EHYA 2IEWA 4UZDA 4CEGA 3E63A 3Q32A 2QQ7A 3GP0A 3KGAA 4KS7A 4NM3A 4WSYA 2F9GA 2A4LA 2Z7QA 3FKNA 2XNPA 2PVHA 4ENXA 5JFVA 2B54A 3NR9A 5IQIA 5TKDA 4LOPA 3PXYA 3PJ2A 2WHBA 4PDPA 5FRIA 4QMQA 4X6RA 4XNEA 5AP4A 3KULA 4Y83A 4O0XA 3PFYA 5CQUA 5ANOA 5M08A 1CDKA 2HW7A 3HMNA 4XG4A 3RPVA 3L8SA 3DB8A 1IR3A 2XA4A 4J71A 1PXOA 3DKFA 1A9UA 3OWJA 4N4SA 4FT0A 3R1YA 3PA5A 3H9OA 3R9HA 3WOWA 4BBMA 3LCDA 5E8VA 4KRCA 3QCXA 3VS6A 1GZOA 5CEIA 1MRVA