1YWNA

Vegfr2 in complex with a novel 4-amino-furo[2,3-d]pyrimidine
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
302
structure length
279
Chain Sequence
LPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLTHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDIKDPDVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Vascular endothelial growth factor receptor 2
publication title Novel 4-amino-furo[2,3-d]pyrimidines as Tie-2 and VEGFR2 dual inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 279
sequence length 302
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1ywnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1ywnA01
3F3TA 3HDNA 5L6WL 3GC7A 4IAKA 3UQCA 4ENXA 2VTMA 2XJ1A 1A06A 2YIYA 4UEUA 3P4KA 3W33A 3B8QA 3GENA 2ZV2A 4IFGA 3UG2A 3QX2A 4JRVA 4JG8A 3ALNA 1APME 2OXYA 4B99A 4P7EA 4EOMA 4EH4A 3LQ3A 2CKPA 1YHWA 3NSZA 5HTIA 4G3DA 3C0IA 2UZBA 3TTJA 4EQMA 3R2BA 5HG8A 4E8AA 3CCNA 4IAYA 1JOWB 1FBNA 4YO6A 2J0JA 1FMKA 3L9MA 4BKZA 4R5YA 2GS7A 3E8CA 4GFMA 5JFSA 4K1BA 3PSBA 1U54B 4IHPA 4X2GA 4AW0A 3ZM9A 1GAGA 2X7OA 2C5NA 2I40A 4FSUA 4FTKA 4AT4A 4EUUA 3S4QA 1LEWA 4CQEA 4XV9A 5DEYA 3NX8A 5FBOA 2YM8A 4CYIA 2GQSA 3R73A 3NCZA 5IA5A 5CF4A 1KWPA 3TDWA 3QYWA 1J91A 2UW9A 4LUDA 3QA0A 5J7BA 2JBPA 3W16A 2E9NA 2YA9A 3HZTA 4H1MA 5CTPA 4C3FA 3QL8A 3FJQE 4YHFA 4UALA 5CXHA 4X21A 3TZ7A 3D7TA 4ZZNA 4MXAA 3I4BA 5KBQA 2V5QA 2OXXA 4GH2A 3O96A 1BI7A 1GZOA 5JEBA 3HV7A 3PY3A 4MYGA 5EHOA 4S34A 3OUNB 5HO8A 2JDOA 1G5SA 3R8PA 5D41A 4PMTA 3FEGA 4O7YA 2WQEA 1GZ8A 3VBYA 2R7IA 5AIKA 4F1MA 2QNJA 3UO6A 5JQ5A 4ASEA 1XH5A 3HMNA 4I1ZA 3PXRA 2OBJA 3PVBA 3AD5A 3OOMA 5EYMA 1AQ1A 3CD8A 4AGDA 3FMNA 5BNJA 3EHAA 1PMUA 3UVPA 5AP1A 2VTRA 4QMZA 2C3IB 5KZ0A 4Y5HA 4YTFA 2QHNA 5CF5A 5K9IA 4EK5A 3ZEWA 2QR8A 3VIDA 3IO7A 1OIQA 3PIZA 4XP2A 3KF7A 4DN5A 1XH9A 2C47A 4FT0A 2W17A 4YJSA 1OI9A 2JKQA 4D4YA 3UBDA 3MPTA 2GQGA 2XNOA 4F65A 3AXWA 3DTCA 1IASA 2CCIA 3E63A 4G6NA 5AR4A 3DXNA 3VULA 3ZXZA 2G1TA 5IA0A 5J79A 2OH4A 4DE4A 2J5EA 3QLGA 5AX9A 2WOUA 3A7JA 4DA5A 1CTPE 3MH1A 4R3CA 4L3LA 3R1NA 3RZFA 4FG9A 5AP5A 3CLYA 2WQMA 3ANQA 5DHJA 2PZ5A 2WMBA 3EIDA 2B53A 3BU3A 3F61A 3HL7A 4JDHA 4L8MA 4M69B 4RJ8A 4RT7A 4ANQA 1H07A 3C0GA 4H3PA 5HG9A 4OUCA 5JZNA 4YC8A 4CT1A 4E26A 3MN3A 5CVGA 4O96A 4YJQA 3COHA 4I93A 4FL3A 3QFVA 5EDRA 3VHEA 3NNWA 3S00A 3MTFA 1PMNA 2X39A 2X2KA 5AEPA 2XF0A 5LCJA 1KV2A 1YXUA 3BI6A 2A4LA 2WO6A 1RW8A 5EM6A 4ZSLA 4QMVA 4WSQA 4D1XA 4LUEA 3KRWA 4YZNA 3RPVA 2QCSA 3EJ1A 3MS9A 2ZJWA 5IKWA 4K0YA 4FEXA 2WZJA 3Q6UA 3PVWA 4NH1A 4CNHA 2I7QA 5EDPA 3G15A 1UVRA 3Q5IA 3V8WA 4EKKA 5FGKA 4FV7A 2F7ZE 4IJPA 4MNEA 3NYOA 3TUCA 5GIPE 2JFLA 1FVVA 4O83A 3CBLA 5CQWA 3WE4A 3Q9XA 2X2MA 2R3RA 5B7VA 3GBZA 3OY3A 3MVJA 3ZYAA 4AUAA 5LMAA 3EYGA 4F6UA 2WTVA 2XKCA 3PVUA 1Q24A 3CKWA 3BGZA 1FINA 2EB2A 3L9LA 3MH0A 1XR1A 5FEEA 5KBRA 2C5VA 2G2FA 2F49A 4IIRA 5AUXA 3KULB 4C4HA 3HNGA 1PY5A 1LPUA 2OJGA 4OTDA 5AV2A 5HNGA 2B9HA 4JI9A 4U5JA 4BWXA 5FDXA 3W2SA 2ITZA 3ZO1A 1WVXA 5EI6A 2OXDA 2GCDA 1F3MC 3NIZA 3NUYA 3QX4A 2GFSA 3EOCA 5J8IA 4AA5A 3S0OA 2OFVA 5CI6A 4YGAA 1WAKA 4FKOA 2Y8OA 4A9SA 3UO5A 3UOLA 3F7ZA 2GPHA 2XJ2A 3A4OX 2ACXA 2I0YA 2Q0BA 4H58A 3F82A 3NUNA 4HGSA 3ZZEA 4AZWA 3KMUA 2IVSA 3BKBA 3IGOA 5BVEA 5FG8A 4EL9A 3ZOSA 4PPCA 1JBPE 4YO4A 5H8GA 1JPAA 4FKRA 2ZMDA 5CSVA 3DAEA 5BVOA 1MRUA 5HVKA 3C51A 3P0MA 4CLIA 3UVQA 4PMMA 3MESA 4O7ZA 5IQDA 3VS2A 4IX5A 4EWHA 3UPZA 3DJ6A 4IXPA 3E93A 4ASXA 2BUJA 5HQ0A 4I0RA 4FA2A 4IEBA 2FB8A 3PLAE 5HCXA 4BCPA 5KNJA 5K4IA 1M52A 4GW8A 3BBWA 3TV4A 5BQ0A 4YP8A 2UZWE 2P2HA 4FNZA 3QTRA 4RQVA 4DTBA 1K2PA 3LVPA 2HW7A 4D2SA 4F1TA 2C68A 3TACA 4I94A 2WMXA 4YC6A 1TQPA 4DTKA 1ZMVA 4FTUA 4C61A 4ZTNA 5AA9A 4XG2A 2HYYA 2UZOA 3A99A 4I6HA 3UQGA 3ZLSA 3K5UA 3O50A 1IA8A 1UU7A 1ZOEA 4UMUA 2VO6A 5DOSA 5HIEA 3OW4A 4UX9A 4FSYA 3KEXA 4F0IA 3W2PA 5ACKA 5KCVA 4I5MA 5EW3A 5JRSA 3DU8A 3LZBA 4IADA 4CFNA 4EH3A 2C69A 2F2CB 3QXOA 5DYJA 5AFVA 2RGPA 3CGOA 5JGBA 3OCBA 5CQUA 2BFXA 4ARKA 1JVPP 5J1VA 3K3JA 4YPDA 5FWKK 3KXXA 3E5AA 3QUEA 2PZIA 5M51A 3ZONA 2XUUA 4GKIA 3DCVA 3HYHA 5BVDA 2JKKA 3W1FA 4M15A 4IW0A 5AM6A 3ZCLA 3W10A 4WRGA 4ZLZA 2HWPA 1VR2A 5K5XA 4E6AA 4FUYA 1M2QA 3RP9A 3N4VA 3ULIA 3VWAA 1NVSA 4CMUA 3PSCA 3Q4TA 4ZOGA 2OJFE 4IAAA 4F63A 1YXSA 3LXNA 3EQHA 2UW5A 3KK9A 3P86A 1WFCA 2YM5A 3POOA 3F3VA 2QG5A 3PRFA 4IAIA 1E1VA 2NP8A 4MF1A 4U41A 3T3UA 3UNJA 4FSZA 4JG6A 1WVYA 4EORA 1HCLA 4YJVA 2WTDA 2XCKA 1GNGA 3SXSA 3ITZA 1PXLA 2JIUA 3I81A 5IA4A 2REIA 4FOBA 1URCA 3LMIA 3QQKA 5HLPA 3BWFA 5E8TA 4W8EA 2XVDA 2VN9A 4M8TA 4BIEA 5HLWA 2BZKB 4CEGA 4HGLA 4J53A 3FY0A 5GZ9A 3IG7A 4RPVA 3MY0A 3P23A 2YFXA 4I0SA 1PMVA 2UZNA 3IDCA 4NM0A 4EONA 5H9BA 4MD8E 3THBA 3HP2A 4AU8A 3K5VA 2QOQA 5E4HA 3R9DA 3RK7A 2HELA 2PHKA 2FSLX 4O0YA 2XBAA 2XZSA 1OKVA 3L8XA 4QQ5A 5BVNA 4TYIA 5HD4A 5C01A 4RVLA 4YTHA 5AIRA 3QUPA 2C0OA 3V8TA 1H01A 1OIYA 1JSVA 5CU6A 5HZNA 4UY9A 3OF0A 1W0XC 3EQGA 5EHYA 2FVDA 2W1EA 1SNXA 4GK3A 2BROA 4HYUA 4DTAA 4OAVB 5HIDA 3RPYA 2CJMA 3HECA 3GCSA 4IBMA 3PA4A 4F64A 2FUMA 2R64A 4F0FA 1UV5A 4GCJA 2YITA 3AT2A 5IEXA 3EH9A 4X6RA 3RALA 2G2HA 4L42A 4ACDA 2R3GA 2WOTA 4L7FA 3U6HA 3BBTB 1QPDA 4IX4A 2Y4IC 2YACA 4BFMA 4QMSA 3QALE 2C1AA 3HMMA 5H8BA 1STCE 2BTSA 4RIWB 5CS6A 2F9GA 2C0IA 2OIQA 5E8YA 2XNPA 2F7XE 2R3JA 3TIYA 4EQUA 4Z55A 5BUJA 4KUJA 3SQQA 3UIUA 4LL5A 3DLSA 4G6OA 5ANDA 5EH0A 2ZAZA 1OIRA 2FA2A 3RCDA 2W1IA 4FKSA 4BHZA 3LKMA 2Z60A 3ZU7A 1BL7A 2H34A 3GU4A 3EFKA 2PUPA 3ET7A 3PG3A 3FKNA 4CFWA 4F6WA 4BIBA 5GIOE 4KD1A 3U51A 2PZRA 2I0EA 5HI2A 2B0QA 2JFMA 4ZMEA 4UZHA 3R8MA 3A7HA 4XNEA 4ACMA 2JBOA 2ITTA 3OCSA 4XV3A 3RPSA 4CT2A 5AAEA 2O2UA 2QKRA 3C4WA 2PUIA 3VUHA 3MH2A 4QTAA 5DI1A 3LCDA 4ZSAA 4JDIA 4NYEA 3HVCA 3SG9A 4ZZMA 3GNIB 5DWRA 4IX6A 5FUTA 3KN5A 1ZYJA 2CGVA 5LWNA 3A7GA 5HOAA 3BX5A 4O86A 3QQGA 1KOAA 1UA2A 2WD1A 3OXTA 2YM3A 3QD4A 5HLNA 4YLLA 3FI2A 5JZJA 1KE7A 4EOPA 4JIKA 2W05A 3FLNC 3GOKA 1Q4LA 1WBSA 4L3PA 4IZYA 4BGQA 4GIHA 3HP5A 1UWJA 4FKVA 4FIFA 5AUWA 3L8SA 1XWSA 2GU8A 5KMIA 4NIFB 4YBJA 3DOGA 1DS5A 4D0WA 1YI6A 2IW6A 3OVVA 1OL6A 5LMBA 5DMZA 1OB3A 4O1OA 4XG7A 4XLIA 3Q2JA 5DPVA 4ITJA 3FZOA 4PNKA 4U44A 2XK9A 1BI8A 4M12A 4TTHB 4ZXTA 2UZEA 4EWQA 5K4JA 5IDPA 3ATTA 5IMXA 2BAQA 4EC9A 4J95A 3L9PA 4J98A 4KIOA 4O82A 4JL9A 1ERKA 1NT2A 4W9XA 5E92A 3U9NA 1UNGA 2W4JA 2PMIA 4PTCA 4DAWA 3RTPA 4CRLA 2RG6A 4A07A 1CKIA 4F9YA 4M7IA 3HAVA 3UZPA 3H9FA 4HVGA 4O7LA 4QQTA 3EFJA 3LCSA 4I6QA 2ZV8A 4OTQA 4C58A 4S2ZA 1PW2A 2JDSA 5K0KA 1YOMA 3TL8A 4QP6A 3KULA 2BIKB 4MXXA 4DFUA 4ZS4A 3TNWA 2HZNA 4O0XA 4BR3A 4WIHA 3DBQA 4WOVA 4JDJA 4O21A 4PX6A 3QTQA 1HCKA 5IDNA 1O6KA 5KUPA 3JY0A 3MPAA 3C9WA 4M97A 4UZDA 1M2RA 3OS3A 1G8SA 4ZY5A 3LXLA 4MQ2A 2BMCA 1VZOA 3RCJA 4AZFA 2GFCA 3KU2A 5BMMA 2EUFB 2NNWB 5CALA 4JBVA 4MF0A 4RZWA 5A4CA 3MWUA 3ODYX 5IUHA 4FEQA 4UYNA 5GJFA 4HW7A 4YHJA 1OITA 2BKKA 5ACBC 4N70A 4PRJA 3P7CA 2OJIA 3GCUA 1QPCA 1XKKA 2BZHB 4L3JA 1R78A 2I0VA 4PL3A 4RA4A 5I9UA 2PZPA 4U3YA 3ZHPC 3GC0A 2XRWA 3ELJA 3OUKA 4H3BA 1OM1A 2VTTA 3VC4A 3VUKA 4BB4A 5IA2A 3C50A 3FWQA 4E7WA 4C2VA 1R39A 2QQ7A 1J7LA 2AC3A 2W1CA 4QYEA 3DS6A 2OJ9A 2XK8A 1B6CB 2FYSA 3NAYA 3PTGA 2R2PA 4FV2A 3R83A 3R6XA 3M11A 3C4ZA 1XBAA 4NW6A 4OTIA 1H1WA 2HZ0A 2X8DA 4BZOA 4CLJA 4Y5QA 3SVVA 5IQEA 4DLIA 1XH6A 2VNYA 3Q4UA 2JLDA 5EQYA 1PXOA 2J6MA 3ZC5A 1ZYDA 2BAJA 2XNNA 2QOOA 3BLRA 5HCZA 2WTWA 4AT5A 3ZO2A 4WG4A 4B8LA 4KSQA 5AV0A 4YMJA 4GVJA 2VTPA 4OLIA 5LVPA 1PJKA 3KCKA 3OP5A 2PVMA 3NCGA 4TWNA 3HV5A 2PVFA 3MFSA 3OWLA 1OL7A 4HYIA 4FIGA 4YJRA 5B0XA 5I9YA 1WZYA 2YCFA 2W1FA 1H24A 5BYLA 3W18A 4II5A 3JVRA 3KKVA 3OWJA 3R0TA 3A60A 3F5XA 5FDPA 3Q3BA 4G9CA 5A6NA 3H10A 3QCXA 2P0CA 2R3HA 3DKGA 3PY0A 3R71A 2ZB1A 4G5PA 4JVGA 3TM0A 5BYZA 3NPCA 2Q0NA 4EOSA 4RC3A 3U87A 3G9NA 3COMA 2QG7A 3Q60A 5BVWA 3GC8A 3HA8A 4EQCA 3C4CA 3K2LA 2VU3A 1Q8YA 3D5UA 4GMYA 3VAPA 2X4FA 2YJSA 5CEPA 1E1XA 4CFFA 2WMRA 5AUZA 4TYGA 4AT3A 3HDMA 4U3ZA 4BYIA 2W96B 4L9IA 2HCKA 4GFOA 1FOTA 5KMNA 2Y9QA 3MJ1A 3HRFA 3ZDIA 3RZBA 4ACCA 5TT7A 3BQRA 4RLKA 3VF9A 3PJ3A 4E4LA 3RWQA 4WNPA 3KCFA 4BDBA 3U55A 1YI4A 3D5VA 3QQJA 3RAWA 3VS5A 2WAJA 4B6LA 5L2SA 4HCUA 4XX9A 4XEYA 3OD6X 5FM3A 1SNUA 4JDKA 5IQCA 3OW3A 3KK8A 4EHGA 4W4VA 3D94A 2BR1A 4TNDA 4EZ3A 1H8FA 2IVUA 4X3FB 3LPBA 3VS7A 4PMPA 3FLSA 3BWJA 4N6ZA 4WG3A 3SHEA 4FYNA 4F7JA 5A54A 5LXMA 3VVHA 2UVZA 3ZRMA 4RSSA 2YWPA 1JWHA 2B9JA 2WTCA 2VWWA 3DAJA 4JR7A 4GYIA 4R3PA 4R8QA 5AP0A 2QONA 3PJ2A 4N57A 3GCVA 4L46A 3QUDA 3B8RA 2QR7A 5M53A 1FMOE 4KRDA 5E8UA 4DT9A 5JN2A 5LWMA 3UMWA 1BLXA 1U4DA 2VTSA 1Y6AA 5M06A 2ZV9A 4AOIA 1BMKA 1V1KA 2HAKA 2JKMA 2C6IA 2XK4A 4O6LA 5HE0A 3V5LA 4DEHA 2VTLA 3NRMA 4YUQA 1YOLA 4CVAA 3WZJA 3PE1A 3F69A 3FMMA 4RRVA 2YEXA 4DT8A 4FZFB 3R63A 5L2IA 3ORMA 3UZRA 5T6KA 2C6EA 4IB5A 4KKHA 4DH3A 5LCKA 3WIKA 2R0IA 3QWJA 4RIWA 5FTQA 3KRRA 4I5PA 5E8XA 4EH9A 1DAWA 3UIXA 3OWPA 2GQRA 2PVKA 3QLFA 2YN8A 4RJ3A 4FKIA 3LHJA 4QP7A 3FMHA 4O7TA 5BVFA 2RIOA 5B2LA 3QRKA 5GJGA 1M7NA 4EH8A 3HV6A 3P78A 5HG5A 5HU9A 3H4JA 2NPQA 4RX8A 4FNYA 1TKIA 5L4QA 4LGGA 4AQCA 1SMHA 4BCGA 1J1CA 4XCUA 4H36A 4BTMA 3SXFA 2J0MB 2Y6OA 4P90A 2QHMA 3NW5A 4XP3A 5LVOA 3SA0A 3ZH8A 3E87A 2PY3A 2QOKA 2ZM4A 2AUHA 4DG0E 2R3FA 3EN4A 3Q5ZA 3CTJA 5FXRA 5EM7A 5M56A 4GS6A 4PDSA 4I0TA 5EQEA 1LEZA 5KE0A 5C03A 5IH4A 3FZSA 4FL1A 2NRUA 4MX9A 3QU0A 3OWKA 3JUHA 1Z9XA 5EK7A 3ZSGA 3O7LB 2BCJA 2BRNA 2IWIA 3FQSA 4K18A 4TKSA 4FTLA 4Y72A 5LVNA 4DFBA 4BY9E 3NGAA 4RX5A 4HCVA 5D7VA 4D2TA 4X2KA 4JLCA 3T3VA 2WIPA 2EWAA 3DJ7A 3R8UA 1O6LA 3VRZA 3BPRA 2VAGA 3OG7A 4M66A 4MXYA 2BHEA 3BRBA 2NO3A 2NRYA 2VTAA 3DT1A 4OR5A 2P2IA 4CKJA 1X8BA 3H9RA 2ITQA 2X7GA 3W2QA 3FLZA 4NIFA 2ZMCA 3NLBA 4D9TA 5CASA 5JGAA 5AA8A 2BDWA 2G9XA 2PVRA 4U81A 4EZ7A 2XEZA 2YJRA 4KS7A 3FDNA 2XBJA 4GG7A 3P79A 4Q2AA 4GIIA 5I5ZA 4UBAA 3QKKA 3F66A 4NU1A 5J87A 4JBOA 4OTRA 4S33A 2XK7A 4HVHA 1GJOA 3QHRA 1J7UA 1CM8A 2SRCA 1YOJA 2QOFA 4IM3A 4YR8A 2QLUA 5C26A 3DZQA 1PXNA 4OBOA 3E7OA 3NYXA 2YM4A 3VUMA 1KE8A 3QGYA 2ITUA 1YW2A 2VWUA 2VO3A 3MIAA 4N4SA 4RWKA 4DITA 3ZO4A 4ID7A 5TKDA 2VV9A 2DYLA 2WU7A 5DLSA 3UC3A 2W1HA 1S9IA 4C0TA 4NZWB 4DFLA 3OOGA 5JRQA 5CVFA 5EM8A 3ROCA 1ATPE 4ZJVA 3COKA 3I6WA 4U97A 2B55A 5DT4A 4G16A 2X9FA 4HVSA 2EXEA 4QTDA 5KMKA 3G0FA 3FZPA 4B8MA 5EKNA 4EOLA 4CZUA 1DI9A 2W9ZB 3DB6A 3FBVA 3CPCA 3R02A 4I41A 5ANIA 3RK9A 4DGNA 1JSTA 3A7IA 4KSPA 4D58A 3S3IA 3VUIA 3D7ZA 2BDJA 4QMOA 3VBVA 3RNIA 5IQHA 4AZVA 4F4PA 3LCTA 4OT6A 2C5XA 2XM9A 2ETMA 2OGVA 3HMIA 1KE6A 2JITA 2OZOA 4LMUA 4E73A 4MHAA 3OEZA 2JKOA 1UU3A 2H6DA 1RJBA 3OBJA 2LGCA 4H3QA 4TYJA 5G6VA 1Q99A 4BCOA 5DH3A 4XG4A 3MFUA 1CDKA 5DA3A 4GL9A 4IX3A 2PYWA 4OTGA 5ANGA 5GNKA 4EBWA 2HOGA 4E6DA 4I6BA 2GS2A 3BHUA 1ZY4A 3DTWA 4WBBB 2ITVA 5D11A 4C35A 3E8EA 3A62A 4EK3A 5CT7A 1BUHA 2VTQA 1WBTA 5CSPA 2V7OA 4IFCA 5EI2A 4KB8A 4FSRA 3ATSA 3AMAA 4WA9A 1OL1A 2EB3A 3JPVA 1XQZA 1REKA 3G9LX 3QD2B 4J52A 1M7QA 2C6OA 3AQVA 1FVRA 4FR4A 3KXNA 5HEZA 2KTYA 5LQFA 2P55A 3O8PA 5E90A 3MV5A 4XOZA 4DGMA 4EHZA 4KIKB 3LFQA 3LJ2A 4AN9A 4QMNA 4DCAA 4O2ZA 5EM5A 2GNFA 4ANMA 3LFDA 4FZ7A 4U40A 5HE2A 3UO4A 4ERWA 3PDTA 4EK8A 3MVHA 4LGDA 1RDQE 4FKTA 2J4ZA 1ZAOA 3PLSA 4S32A 1VEBA 2JC6A 5J5TA 5KHWA 4AZSA 4AS0A 4IWPA 5D10A 3W55A 5JK3A 3PPJA 3ORPA 2Y4PA 1H28A 3DK7A 3E64A 4G31A 2ZOQA 3MFTA 3VS3A 2PVLA 3D0EA 4RG0A 5HBJA 4BZDA 4HOKA 1XH4A 4ZS0A 2CNQA 3LFBA 3PZHA 3TG1A 3IW6A 1SYKA 5CT0A 3H30A 4JQ8A 2J50A 4R5SA 3MYGA 3F2RA 4UWCA 3GQIA 3ENMA 3KFAA 4R1VA 3EMGA 3NAXA 4TXCA 4P4CA 4BTJA 5HX8A 4FNWA 4PTGA 3TKHA 4C37A 3CSVA 3O8UA 4PY1A 4XV2A 4M13A 5EDQA 3W2RA 5LVLA 3WIGA 2WMVA 4RC2A 4LQMA 4B7TA 4IM0A 4XMOA 4O0RA 1OKWA 5EYCA 4D4RA 5IQAA 3Q32A 4OW8A 3EB0A 4CG8A 5AP7A 3KB7A 4QP3A 4OBPA 4RX7A 3QBNA 1YXTA 4I5HA 1G8AA 3PIXA 1H00A 4DH8A 4B9DA 4AE9A 4X3FA 1UU9A 2UW8A 5I3RA 3C4EA 4X6QC 3MTLA 4O0TA 2PPQA 2X8EA 5AUVA 3C0HA 4YJTA 4APPA 2Y6MA 3ZFMA 4APCA 4I4EA 2YZLA 1XHAA 4QMTA 3QRIA 4BGGA 4E4XA 5AUUA 3UPXA 5J9ZA 3FV8A 1KV1A 2HK5A 3PPZA 3Q2MA 4A4XA 2OK1A 1PXJA 3W2CA 2QODA 3AGLA 4DCEA 1Q3DA 2ZDTA 4JNWA 4RA5A 4FIHA 5HVYA 4ANOA 2XK6A 4USFA 1H1SA 2UV2A 3EQIA 3BELA 2IJMA 3MBLA 2YIQA 4FKLA 5AR2A 3DY7A 4KNBA 4WNMA 5KMJA 5IEYA 1UNHA 2QURA 3T8OA 4R7IA 4FGRA 3FI4A 4C34A 2BKZA 3AGMA 3I60A 3UC4A 2QKWB 5KO1A 3KXHA 3ZZWA 3PVGA 5DGZA 2VO0A 3PIYA 4O22A 4ZTHA 5C9CA 4JX7A 4EOOA 2JD5A 5CYIA 1YQJA 3ZBFA 3L1SA 4FL2A 3JS2A 3LE6A 5C4KA 4GUEA 2BHHA 3CY3A 3D14A 3DBFA 3IW5A 4D9UA 1V0BA 4ZP5A 4FKUA 4QNYA 5K5NA 4QP1A 2GNHA 3JXWA 3UP7A 3KQ7A 4U6RA 2VNWA 4QTCA 4IDTA 3IKAA 4H05A 4LRKA 1IR3A 4AACA 1J3HA 4M0YA 2GDOA 3BCEA 3GC9A 5ANKA 2GMXA 5HE3A 3HRCA 3Q9WA 2B52A 5BUEA 4IWOA 5IQIA 2VGOA 2FSTX 5FXSA 1KE9A 4FV0A 2HZ4A 4J8MA 4HYSA 2CKQA 2A1AB 5IH6A 4YC3A 5CLPA 1CMKE 1B38A 3HA6A 3LOKA 5I3OA 2O5KA 3GU7A 2F2UA 3LQ8A 4R1YA 4C4FA 3SOCA 1OL2A 3AC8A 4J99A 4G3EA 2QOLA 3PJCA 1XBCA 1ZYCA 3EL7A 2XIKA 3Q6WA 2GNIA 4IVDA 4WRSA 4HVDA 4LV5A 3ZLWA 4FIEA 2WU6A 3F88A 3RM7A 4IANA 4CFXA 3TV6A 3P1AA 2CGUA 2HWOA 3D83A 3FI3A 4WT6A 1UWHA 4GJ2A 4DLJA 3ZC6A 2XCHA 1M14A 3QTWA 1XH7A 2F57A 3PWYA 1UKIA 4M0ZA 1GIJA 5AWMA 4R77A 4IC8A 2X81A 1SVHA 3BGQA 5FLFA 5HORA 3UNKA 4O7VA 3V5TA 3HMPA 2W1ZA 3ZSHA 2X2LA 4NL0A 3F9NA 4MH7A 2HY0A 3QQUA 2PE1A 4F7NA 3MW1A 3FZ1A 3D5XA 1ZMWA 3D15A 3VN9A 4HGEA 2WMWA 3DFCB 2WMUA 4I4FA 4WNOA 4F08A 4QMQA 2Z8CA 2BPMA 1TQMA 3ULZA 4IQ6A 2PZYA 5CXZA 2W1DA 2X9EA 5HG7A 4DFYA 3R22A 1U54A 4EH7A 3TIZA 2WHBA 4FKQA 5FXQA 4C57A 2Y7JA 2ETRA 3VHKA 3H0YA 2Z02A 2ITNA 3TUDA 3B2WA 4FTTA 3NUUA 3VJOA 2A2AA 3BLHA 3BYSA 3M42A 3PA3A 4UWYA 3RWPA 4CCBA 3GU8A 3H3CA 4FSMA 2UW6A 4JOAA 4QTBA 3UODA 5EQPA 3FUPA 5E1SA 4UXLA 3AC1A 2YAAA 2B1PA 2IN6A 2J9MA 3C13A 5HO7A 4O7NA 2EXCX 4BCQA 1PYXA 2V62A 4QP8A 3BEGA 3F2AA 3F2NA 4I20A 5DRDA 2OO8X 3QC9A 1J7IA 5A6OA 5BX0A 4O81A 4XJ0A 4CMOA 5IG1A 4G17A 2WMQA 5HHWA 4ANNA 3U6IA 4XRJA 4GT3A 4CKRA 4JAJA 4FT5A 5FQDC 5LVMA 2OLCA 1P2AA 2YAKA 3QTIA 3SGCA 5J95A 3E92A 2C1BA 3POZA 2V55A 3P5KA 4RJ4A 4FODA 1K9AA 3DQWA 2Z7SA 5JH6A 3DFAA 4C33A 5JMSA 4F9AA 3UIMA 4FTJA 3LMGA 3ENHA 1VYZA 1B39A 4Z7GA 4XS2A 4AG8A 1QCFA 2X1NA 4K11A 3EZRA 3GU6A 2GTMA 5AJQA 4O84A 4PL4A 3CP9A 1HOWA 2OW3A 3QZHA 2PE2A 1OKYA 4MAOA 4DEBA 4AE6A 1MUOA 5DEWA 3UP2A 3KMWA 5I0BA 5I9VA 4QOXA 5L2WA 3UGCA 2QOHA 5CAVA 1L3RE 4EH2A 4MK0A 2EU9A 3FPMA 2PULA 3F5GA 2YZAA 4BI2A 4EOJA 3NYNA 4UV0A 5CNNA 2Z2WA 2KULA 4UXQA 3VRYA 3R7GA 4DFXE 4IVCA 4ONAA 3VF8A 4UN0C 5CEIA 3QCSA 5ANJA 3HUCA 4EH6A 2BRBA 5BMSA 2RL5A 4F9WA 2OG8A 4CCUA 2VO7A 2UZUE 4NWMA 4U79A 4HZRA 5TR6A 1H27A 2VTOA 4M69A 2XNBA 4RFMA 2W4OA 3OEFX 2ONLA 3C5UA 3PE2A 4ASDA 4GV1A 4E1ZA 5HBHA 4M68A 5HVJA 3R21A 2IVVA 5EHLA 2VX3A 2BAKA 4YJPA 5H2UA 1MQ4A 4GYGA 3F5UA 5KKRB 3Q04A 3M2WA 4DH5A 3LJ0A 3AC3A 4QMWA 3ORTA 3RVGA 4ALWA 4F70A 4GVAA 3LLAA 4FT3A 1U5QA 2WQNA 3VBQA 3BU5A 3LFNA 1Z5MA 5TO8A 2WQOA 1YDTE 3LJ1A 1NY3A 3VS0A 4Y85A 2ZM1A 3NW7A 5EOLA 2XIYA 3DB8A 1KE5A 4W4YA 4FEVA 3R8VA 3CQWA 4BDHA 4I3ZA 3A2CA 3EKKA 1JKKA 2J90A 3UIBA 2HENA 3HMOA 3I0QA 4PMSA 3ZS5A 3NVKI 2UVYA 4TNBA 5DE2A 3FY2A 4L45A 4X3FC 4ZY4A 4TWOA 5DN3A 5ETAA 3RHKA 1BX6A 2R9SA 4XLVA 4TYHB 4YJNA 3RK5A 2VZ6A 5A9UA 2WMTA 4CRSA 3WI6A 5ANEA 4ITIA 3SOAA 4F6SA 3CQEA 3KXGA 4BTFA 2XNGA 5DR2A 4FTMA 1Q41A 1PMEA 5D12A 5F95A 4R7HA 3MGYA 4GEOA 3UOKA 4LGHA 3V3VA 3KXZA 3NW6A 5T68A 5A4QA 3RPOA 4FNXA 4AFJA 2W06A 4EOKA 2OZAB 2UW7A 2R5TA 3DPKA 4LOOA 4GUBA 4RMZA 3QCQA 5CSHA 4CFUA 3BHTA 3R7UA 3TT0A 1JNKA 3VUGA 2J2IB 1PXKA 3PP0A 4TZRA 3DQXA 3I5NA 2YCSA 4E6QA 1OIUA 3SG8A 4FC0A 1TVOA 3TNPC 4AW2A 4C4GA 2QO9A 4IVBA 3AC4A 2WKMA 3KY2A 3OXIA 4IMYA 3FXZA 5M4CA 4RLLA 3DBEA 3F6XA 4J97A 5AR7A 3QKLA 3GOPA 4MXZA 4E3CA 5IPJA 3AOXA 5HGIA 4IM2A 2UUEA 4J8NA 3V6RA 5JGDA 3WF6A 3LMHA 4F7LA 2HXQA 4DEIA 2C6MA 2V0DA 3KVWA 4ZTMA 3T9TA 4AZTA 5J7HA 4EK4A 5ETFA 3ZMMA 1T46A 5TF9A 3G33A 4BI0A 4J7BA 1JAMA 4TY1A 3IOKA 3GUBA 2G15A 1XO2B 1KSWA 2XKFA 3MSSA 3EQFA 4FVQA 4X2NA 4XG6A 2GS6A 4BBEA 5JSMA 1IG1A 4PQNA 4L44A 3G5DA 3D5WA 3R9HA 4QTEA 1YWNA 4FZAB 4O38A 2GNLA 4JXFA 4KKGA 4FI1A 4AXAA 2J0LA 4JQEA 4BDAA 4D2VA 2YIRA 4DGOA 3KREA 3ORIA 1DAYA 1H25A 4HZSA 1JQHA 1BKXA 2PMLX 1XH8A 4OTPA 3QHWA 3RINA 4I6FA 3BEAA 3TZ9A 3V5JA 2JAVA 5FP6A 4AA4A 4XRLA 3VS4A 2I6LA 3A8WA 3FXWA 3IPHA 5J9LA 2RFEA 5DG5A 2OWBA 4PPAA 3DXPA 3N51A 4RJ5A 5CSWA 4KBKA 5IUIA 3WZKA 3BZ3A 3R7YA 3Q53A 3NVMB 1H26A 4XBUA 4HVIA 5L8LA 1SZMA 4GT4A 3FC2A 4QPMA 3FAAA 5IF1A 4RIXB 4GK2A 1IA9A 4ALUA 3FMKA 5C1QB 4RC4A 3U4UA 4K9YA 3A7FA 4MBLA 4M84A 3D2IA 3II5A 3UNZA 2OSCA 3Q9ZA 5C8NA 2XMYA 5CVHA 4NTTA 4RIYB 4J96A 4RZVA 2O64A 5M44A 2WTKB 3SRVB 2UZDA 3FMDA 4RIOA 3O0GA 3R1SA 1QPJA 4ACGA 2PUNA 2B4SB 5GZAA 3V5WA 3FZRA 4LOPA 5CX9A 4EJ7A 4BKJA 3UYSA 3TCPA 4IAFA 4ZJIA 2O8YA 4DEEA 4CTCA 3ZFYA 3KN6A 2R3NA 2YIXA 4Q5EA 4TRLA 4BZNA 3R28A 2C30A 4Q5HA 1YHVA 1JLUE 1LUFA 2QD9A 3RPRA 4M67A 3N4TA 2A27A 5T3QA 4W9WA 4D5HA 2VWVA 3P08A 4ZSGA 1Y8YA 2UZVA 5EOBA 5F1ZA 3U4WA 4C7TA 1WCCA 4V05A 2ITWA 4A9YA 4O7RA 1GZNA 3L8VA 4RWIA 5E9EA 4JX3A 1WBVA 3UVRA 4EK6A 2CN8A 3B2TA 1UKHA 3GFWA 3R7VA 5IEVA 3DAKA 1V0PA 4QMUA 2R3OA 4U80A 2CLXA 2X6DA 3S95A 3UJGA 1FPUA 3TNQB 4U43A 2PU8A 4JQ7A 2XH5A 1WBOA 3ORNA 2YCQA 4BDGA 1Q8ZA 2VD5A 4D5KA 5CF6A 2BFYA 5TOZA 3TUBA 4BBFA 1FVTA 4G5JA 2RFSA 4Y46A 4FSQA 4E6CA 4FK6A 3QKMA 4FK3A 4D2WA 3O71A 5IQFA 4CKIA 4DC2A 1OMWA 1Q3WA 4M14A 1PXIA 1ZXEA 4FICA 4ENYA 5CWZA 5JQ8A 2CGWA 3JYAA 4FGBA 1PF8A 4C62A 3Q9YA 3FYJX 3A4PA 4NFMA 4BF2A 4D0XA 2W5AA 3RMFA 3UG1A 4G3FA 3NUXA 1OVEA 4GRBA 5E7RA 3HKOA 3DGKA 4YLJA 2GHGA 2QLQA 3PRIA 4WHZA 4IVAA 2PVYA 3V01A 5FBNC 2R3KA 3EN9A 3WF9A 4YJOA 5D1JA 3DDQA 2VGPA 3QGWA 4O0VA 1LP4A 1ZWSA 2WEVA 1PXMA 4I23A 4BDIA 3KVXA 3L8PA 2ITPA 2BDFA 4FOCA 4AOTA 4BDKA 5C4LA 1K3AA 2QU6A 1W7HA 3F7WA 4QP2A 4KINA 1O9UA 2XB7A 5JFVA 3AD4A 3FLQA 4XV1A 1YI3A 3DBDA 4FTRA 3FQEA 3HUBA 2IW9A 3WYXA 4BCIA 1JKSA 3EN5A 1FQ1B 4RX9A 3V51A 3E7VA 2Z7RA 5KHXA 4FEWA 1XJDA 4R78A 3NNVA 3DBCA 4ANLA 5FTOA 1URWA 4FT9A 4IJ9A 2ONLC 5HD7A 3TDVA 4ZY6A 4RFZA 3IW7A 2VWBA 2EVAA 3AC2A 5A4EA 2BZJA 5EYKA 2XKEA 5M4IA 1Q5KA 1Y91A 2I1MA 2IPXA 4FTIA 4P5QA 1I44A 2EXMA 5AV1A 2Q83A 1MRVA 4EYJA 2PUUA 3EFWA 4ZEGA 5HCYA 3I7CA 2B9IA 2FSMX 3HEGA 5IMEA 2VWXA 3DKFA 4JIAA 1Y6BA 3PP1A 3TNHA 1PXPA 2RF9A 5ICPA 2OIDA 3LCKA 3I1AA 5BYYA 4OAUC 4IB0A 3DXQA 4PWNA 2OIBA 4U42A 3QCYA 5B2KA 3ZBXA 2BILB 5HNBA 1OPLA 3GU5A 4ANSA 3N4UA 1PYEA 5DNRA 4X7QA 1ZZLA 4L43A 4NKAA 2C5OA 4FKPA 5DT0A 5L2QA 4C38A 3PSDA 4FEUA 5CU4A 4B0GA 1KOBA 3FLYA 3NS9A 3K3IA 4FVRA 4J71A 1QMZA 4KABA 4DGLC 5AUYA 3SDJA 3ZUTA 4EJNA 1R0PA 3GXLA 1A48A 3O7LD 2CKOA 3BQCA 3FC1X 1I09A 1OZ1A 4JJRA 3SW4A 2FH9A 4LMNA 3ZO3A 5AP2A 1H1QA 3FSFA 4HPTE 4FTNA 4BIDA 1V0OA 3CC6A 4XP0A 2VTHA 4YZDA 3ZEPA 3CJGA 1ZMUA 5JKGA 2B7AA 4N0SA 4Z9LA 5FP5A 4BGHA 3EZVA 4YTIA 4D2RA 3ZM4A 2Z7QA 3MY5A 4NJDA 5E8WA 3R7EA 3VBWA 2WTIA 3K54A 2XA4A 2PL0A 3DNDA 5HICA 3VBXA 2VX0A 4OTFA 4FZ6A 5IQGA 4ZTLA 2YLEA 3KRLA 1W8CA 4XG3A 5IUGA 2C4GA 4IWQA 4TYHA 2OFUA 3CPBA 1U59A 4JT3A 4YHTA 3HLLA 4ZTRA 5DR6A 3BGPA 4QMYA 1T45A 4U8ZA 5F94A 4F9BA 1Q62A 4QP9A 3OCTA 3R9OA 2O65A 2A0CX 1PKGA 2C3JA 3CTQA 5DBXA 5CAPA 2OZAA 4FTCA 2UW0A 3OT8A 5GHVA 4UMQA 3GCQA 4K33A 3IQ7A 2PVNA 2W9FB 2XS0A 4F09A 3GVUA 2X8IA 3HV4A 1OUKA 2GSFA 3ALOA 2BVAA 4IZ5A 4YZMA 3ROYA 3A61A 3DV3A 4O7WA 4CZYB 3CEKA 1W82A 4MKCA 2PMOX 3FMEA 5AAFA 4FG8A 3LW0A 4JAIA 3TN8A 3SKCA 3ZSIA 1Z57A 3UYTA 4BDDA 2WB8A 4F0GA 1NVQA 3CQUA 4EEVA 3QQHA 4LG4A 3OMVA 3MJ2A 5DVRA 3TV7A 4QO9A 1R0EA 4CQGA 5M57A 1PHKA 3N9XA 4PP9A 5B2MA 2JIIA 3FI8A 4DG3E 3LM0A 3ZLYA 2CPKE 4Y73A 4TPTA 4Z3VA 5L6PA 1GOLA 4ZIMA 5ETCA 3IECA 4BDJA 4BTKA 5M4UA 3BE9A 4FSTA 1S9JA 3F3UA 1M17A 3QZIA 4JG7A 4R6VA 4AGWA 3SW7A 5CU2A 3VBTA 4XHKB 5J5SA 4OBQA 4NCTA 4RGJA 4DEGA 4F7SA 5F9EA 4FX3A 4ZLYA 2ESMA 1ZLTA 2PK9A 2QO7A 3OC1A 3MI9A 4KWPA 5FM2A 2R3MA 2R7BA 4E93A 5KX8A 3CD3A 2YM6A 3QQLA 3F3WA 4RVTA 3KA0A 4O7SA 3ZRLA 4FUXA 3LLTA 1OBGA 5D9HA 4DEDA 4DHFA 5FTGA 3QZGA 3EN6A 3TXOA 4GSBA 3WF5A 4O2PA 1H1PA 4NM7A 4YNEA 3EL8A 2RKUA 3BV2A 3LQ5A 1Y8GA 4G2FA 4RIXA 1Q61A 3IGGA 3G6HA 3EKNA 4IC7A 2YIWA 4PUZA 4XG8A 5HX6A 2WELA 4FV9A 3CJFA 4NKSA 5H8EA 4YBKA 3E62A 4QYHA 3SV0A 4BBMA 4BN1A 4MD9E 4C3PA 5AADA 3ID6C 4RIYA 4RQKA 3MA3A 4ACHA 2BIYA 5M09A 1ZOHA 3ORLA 4FIJA 3SRVA 2CSNA 4L68A 4LV8A 4USDA 4Z7HA 4E20A 5HTCA 2AC5A 4JS8A 4BVUA 4LL0A 4NM5A 2RFNA 3I0OA 3RJCA 4EKLA 4ORKA 3W32A 4EOQA 2GNGA 3RKBA 1GIIA 4KKEA 3V04A 4A4OA 4F99A 1H0VA 1ZOGA 4QD6A 5M4FA 5C27A 2J7TA 2JDVA 3R8LA 5E1EA 3TKUA 2R3PA 4D4SA 3BHHA 4S30A 3OFMA 2W99B 1ZYSA 2YABA 1ZYLA 3KMMA 4N6YA 4IB1A 4MTAA 4NK9A 3BYUA 3GI3A 4WG5A 1SVGA 5D7AA 3TJDA 4BHNA 3GQLA 1Y57A 3RNYA 4KA3A 4NM3A 5EFQA 4HNFA 4AGUA 3SAYA 4HCTA 2CDZA 3QD0A 4GK4A 4QMXA 1NW1A 3UOJA 4TW9A 2WEIA 3NUSA 4PNIA 5K0XA 2YM7A 4G34A 4EI4A 3FE3A 4GG5A 4FTOA 2QVSE 1M2PA 3IDBA 4Y95A 5DT3A 3NDMA 3W8QA 4AX8A 2F7EE 3C4FA 2XK3A 1MP8A 4O1PA 3W2OA 5HE1A 1Q97A 3QRJA 5CEOA 2W4KA 2ERZE 4O6EA 3I5ZA 1A9UA 4BWKA 3KF4A 4QRCA 5KMOA 3WZUA 2C6TA 2PE0A 4DYMA 4BDEA 3CE3A 4O0SA 4IE9A 2JEDA 5K3YA 3PYYA 1H4LA 4QMLA 3CKXA 4X2JA 4X0MA 1AGWA 5ITAA 3GT8A 4UB7A 3W8LA 4OTHA 3TNIA 5LJJA 3NUPA 3OROA 3FSKA 5EYDA 4CFVA 4MBIA 1QPEA 3RGFA 4KS8A 5A14A 4TT7A 5L3AA 2C3LA 2QC6A 3BLQA 5CAOA 4AAAA 4DFZE 3MY1A 5E8SA 5LOHA 3FL5A 3R04A 3GB2A 2FGIA 4FV5A 3COIA 4U9AA 5H3QA 4BDCA 2P3GX 1IRKA 5BUIA 4ZTSA 3QYZA 4QYYA 4UWBA 4BCNA 2ZVAA 3Q4ZA 4I92A 5LMKA 1YWVA 4PL5A 1IAJA 4FZDB 1JKLA 3FPQA 3ZXTA 4MD7E 3BV3A 2WXVA 3GP0A 1WBPA 3OT3A 3V5PA 3FKLA 1RE8A 3MDYA 5GJDA 3AMBA 2QI8A 4MCVA 5HU3A 1P4FA 3HAMA 4YU2A 4FF8A 3ODZX 2XIXA 3FHIA 2QOBA 4FYOA 4EH5A 4NSTA 1YDSE 2OICA 3Q52A 3C5IA 1LR4A 3RHXA 4AFEA 2BRHA 4QPSA 2UW4A 3HRBA 2J0KA 2XNEA 4HPUE 3DKCA 1CKPA 2IG7A 2E9OA 2OU7A 2XRUA 4EYMA 4RBLA 3UOHA 4F9CA 3KL8A 4C59A 5AM7A 2CKEA 3L9NA 2XKDA 1U46A 3MB7A 3NYVA 1ZRZA 2YCRA 5CEMA 3H9OA 4H1JA 1CSNA 3DLZA 4PP7A 5KKRC 2YLFA 2BRMA 3MB6A 2XP2A 3LCOA 3CGFA 3EWHA 3LAUA 5FEDA 2Y0AA 3FXXA 3LXPA 3BHVA 2OI4X 4XBRA 2OH0E 2IO6A 3KRXA 1SVEA 4XYFA 3WARA 3E8DA 3ACKA 3ZUUA 5HKMA 3ORKA 4AN2A 3PXYA 4C3RA 1DI8A 2VX1A 4ITHA 4MXOA 2BTRA 2IW8A 4BCMA 4WNKA 3R8ZA 1VJYA 4EC8A 3MA6A 3G51A 1KUTA 3MPMA 4KIQA 3LM5A 2VTJA 1OL5A 4J1RA 4K77A 5EI8A 2H96A 3EFLA 3TZ8A 3BIZA 3RAKA 2ERKA 4ZJJA 1TQIA 2UVXA 3HX4A 4MWHA 3P7BA 4YZCA 1YDRE 4NTSA 4ZMFA 2ITYA 1YRPA 2CHLA 3PXZA 4IWDA 4WBOA 2ETKA 5JT2A 2HW6A 4FSWA 1WMKA 2CNUA 2J51A 3BYOA 3I6UA 2BRGA 4L52A 2JAMA 4U45A 4OGRA 4EHEA 2CCHA 3QTXA 4FV8A 3V8SA 4YLKA 3OTUA 4YZBA 5FEQA 4OT5A 3E3PA 4CGAA 4NJ3A 3LFSA 3Q4CA 3LIJA 2GHLA 2LAVA 3QWKA 4HNIA 4C4IA 1ZY5A 2QO2A 4ASZA 4XH6A 4F1OA 3BYVA 3EN7A 2DQ7X 4IZ7A 4O27B 4M3QA 5EKOA 4C8BA 4AA0A 2JDTA 1OECA 3PJ8A 3NZ0A 3LFFA 3UDBA 5GINE 2C0TA 1GZKA 3KXMA 4XOYA 2E2BA 4TN6A 4BI1A 4BCFA 2R4BA 4FV1A 4ZSJA 4BKYA 4E5WA 1YKRA 4FKGA 3OCGA 3ZFXA 3S2PA 3VW6A 4L00A 3LXKA 5E8ZA 4CV8A 4L01A 2ZB0A 4ZLOA 2B54A 2QOIA 5CU3A 4WO5A 2GNJA 3QXPA 3DZOA 4MEDA 4MNFA 4RVMA 5EW9A 5AR3A 4BYJA 4FTQA 5A46A 2HXLA 4IACA 4ZK5A 4XG9A 4DGGA 3R1YA 4YNOA 5AP6A 4NCTC 4ZAUA 2X0GA 3R01A 4FKJA 4A9TA 4FT7A 3G0EA 3UQFA 3GFEA 2C3KA 4DBNA 5J9YA 3ORZA 3U54A 4TYEA 3EYHA 4D28A 3IS5A 3MVMA 4A9UA 4QMPA 4Y83A 4A9RA 3P9JA 3O51A 4L6QA 1ND4A 4BDFA 2JDRA 3QZFA 4IDVA 4U7ZA 4USEA 5L8KA 5M55A 4A4LA 2WPAA 3IW4A 2HIWA 4FV4A 4GT5A 5ETIA 1ZZ2A 3ANRA 2O63A 3KC3A 4G6LA 4KIPA 3REPA 3FYKX 4DF3A 3CY2A 3O2MA 2CNVA 3JR1A 2X7FA 4ZSEA 4W4XA 5AR8A 2JGZA 3SLSA 3FMJA 4E4NA 2OJJA 2QU5A 2YDKA 1P14A 3CXWA 1AD5A 3ORXA 4QPAA 4WKQA 3PA5A 3PFQA 3ZTXA 4EOIA 4O0UA 3HV3A 5A4TA 5CEKA 1J1BA 3TKIA 3DK3A 4X3JA 1PRYA 5AP3A 4ANBA 4KIKA 2WTKC 2R3QA 3QF9A 3BU6A 3NMUF 4FMQA 4WUNA 4AW5A 1YXVA 1W98A 4MBJA 3UMXA 3SXRA 4G1WA 4IAZA 1U5RA 3ZDUA 4AF3A 4FV6A 4AWIA 4V0GB 4RJ7A 4AN3A 2FSOX 1REJA 2R3IA 4YZ9A 3E3BX 4LRMA 2E9PA 4PDPA 3FZTA 2G01A 4V04A 1P4OA 2WNTA 2W5BA 4NFNA 4U0IA 5TE0A 3I7BA 3EQDA 3R30A 4MXCA 5L2TA 3WYYA 2VRXA 4AGCA 5GZ8A 4E5AX 2QOCA 3AG9A 2IZTA 5HNIX 3DKOA 3PUPA 2OKRA 1CKJA 3EQRA 4LFIA 5IH5A 2XM8A 5HIBA 3DNEA 3G6GA 3LFEA 5CZHA 5HESA 3R9NA 4D55A 3F5PA 4ERKA 2PWLA 1Q8WA 2BZIB 3AD6A 4PF4A 4EUTA 3SD0A 5AUTA 3F3ZA 4GU6A 4KBAA 3TWJA 5M08A 4QQJA 2X6EA 2YERA 1BYGA 2RG5A 1G3NA 3PPKA 4RFYA 3E88A 3TJCA 4FSNA 3U6JA 4E4MA 4KBCA 1L8TA 2PVHA 4CZTA 4JR3A 3MFRA 4FV3A 4GJ3A 3O8TA 3R7OA 5CANA 2I0HA 4HJOA 1GIHA 4FE2A 2XIZA 5DFPA 3VNTA 4C02A 4EZ5A 3WZEA 4MVFA 3OXZA 3VQUA 3NNXA 3UE4A 3ZUVA 4DINA 4YPSA 2IZSA 3WILA 4A06A 4ZZOA 1OGUA 3ZRKA 2ITXA 1Q8UA 2V22A 3TI1A 2AYPA 2O3PA 3PG1A 3QTUA 3U8WA 4BRXA 3QRTA 4FIIA 3ERKA 3PWDA 4QMMA 2WGJA 4WD5A 2CGXA 3ZLXA 4TWPA 3R7IA 3SC1A 1FGKA 3PXFA 3ACJA 4QNAA 3MH3A 4BCHA 5LMKC 4UYAA 4RVKA 3D7TB 2YWVA 4BC6A 4EHVA 5IU2A 4R7BA 4NT4A 3MVLA 4L53A 1F0QA 3V5QA 4WUAA 3LFAA 3NWWA 5E8VA 5I4NA 4BL1A 4YTCA 2XNMA 5AV4A 1IEPA 3EQCA 5EW8A 3AC5A 4MWIA 3OBGA 3P7AA 3BHYA 4RJ6A 4WSYA 1NXKA 4V01A 2WMSA 5EG3A 4UMRA 5IQBA 2W7XA 4I21A 4LI5A 5A3XA 1H0WA 4PDOA 3EQPA 4BCJA 4CXAA 3GEQA 3WOWA 3TTIA 3HGKA 3C4XA 4PV0A 1GY3A 4HGTA 5DRBA 5FRIA 2Y4IB 3WF8A 3GCPA 3LFCA 3CS9A 3D2KA 3C7QA 1OKZA 3KGAA 2X4ZA 4JBQA 2P4IA 5CF8A 5L8JA 4C36A 3PXKA 1VYWA 1MRYA 1ZARA 2JIVA 2H9VA 4IZAA 2XJ0A 4MQ1A 5F20A 5A4LA 5JFWA 2W0JA 1OBDA 3NUAA 2B9FA 4KAOA 2WTJA 2WQBA 3RAIA 3VJNA 2UZLA 4TL0A 3PJ1A 2XYNA 2VWIA 1UU8A 3ETAA 2XIRA 2VWZA 3OZ6A 4DH1A 2IZRA 2V7AA 3FLWA 2IVTA 4Q9ZA 3WF7A 5I9XA 2ZYBA 2UW3A 2YDIA 3R1QA 3A8XA 3CR0A 5BPYA 2PVJA 2Z7LA 2RSVA 3TZMA 5FD2A 5CAUA 3NIEA 4BICA 1FGIA 1DM2A 4IB3A 1YWRA 4QYGA 4C4EA 4CYJA 2ZM3A 4D2PA 1E9HA 3EQBA 3QTSA 2G2IA 2J5FA 3U9CA 2HZIA 1R3CA 4IH8A 3WE8A 4G3CA 4LRJA 3RI1A 4CSVA 4CMTA 5HTBA 2WFYA 2C6DA 4LM5A 3DK6A 5KMLA 3R2YA 2C6LA 4G9RA 4JBPA 1W83A 3DDPA 2DS1A 4MNEB 3VS6A 5CY3A 2P33A 5AV3A 4W4WA 5M07A 2W1GA 5IA1A 4E5BA 2CLQA 1MQBA 5F4NA 4CFMA 2OF4A 2UZTA 2XEYA 3NNUA 3Q96A 4G3GA 1F5QA 4JRNA 4BCKA 2CN5A 5ANOA 3D4QA 1PKDA 4I5CA 4YSJA 1OPJA 2ZDUA 4K8AA 4C2WA 3FMLA 4Z16A 3PZEA 3OTVA 3QA8A 4FG7A 2VTIA 3WZDA 1IAHA 4R3RA 2VTNA 4AP7A 5AR5A 2E9VA 3VUDA 3TEIA 3E8NA 2R0UA 4L67A 3S1HA 3FQHA 4AOJA 4PTEA 3QAME 4I22A 2CMWA 5L6OA 4C4JA 4QYFA 5BVKA 3FKOA 4ALVA 4OTWA 4D1SA 3QQFA 3VO3A 4D1ZA 5IZFA 3R9RA 4B4LA 3OHTA 3MIYA 5AX3A 4AW1A 2A19B 3VW8A 3AT4A 1UNLA 3FHRA 4EBVA 3BE2A 5DR9A 4YURA 5C8KA 2W5HA 3WBLA 2OF2A 5DIAA 5AMNA 3RAHA 5I9WA 3VS1A 3M1SA 3QD3A 3VUTA 2GTNA 5JFXA 4FVPA 1QL6A 5G1XA 4LYNA 4NUSA 5CENA 1BL6A 2GHMA 4O91A 4CTBA 3DA6A 2PSQA 3R00A 3UZTA 5LARA 5I9ZA 3H0ZA 4RWJA 1R1WA 2O0UA 4GKHA 1OUYA 1XBBA 4DG2E 3BYMA 3O23A 4AZEA 4UMTA 4CD0A 3IDPA 4ZTQA 4CG9A 1W84A 4HYHA 4S31A 1OPKA 3DJ5A 3IONA 3QC4A 4D4VA 1O6YA 1YXXA 5C8MA 3D9VA 5CEQA 5HBEA 1JSUA 1H1RA 4XUFA 1RQQA 3JY9A 5CAQA 2BALA 1YVJA 3QTZA 4DBXA 2R3LA 2YDJA 3G90X 1H08A 2HY81 3QRUA 3OY1A 2XYUA 4K2RA 2DUVA 3GGFA 2PTKA 4H39A 2J0IA 5CSXA 4FTAA 3C1XA 3I79A 3JVSA 2PMNX 4QT1A 2YISA 4DFNA 4DEAA 4DH7A 4I24A 4GFGA 5KMMA 4YJUA 4YSMA 1WBNA 2ZV7A 1EH4A 2E9UA 3IOPA 3PXQA 1NVRA 3CIKA 3KRJA 3G2FA 5CNOA 5CU0A 4LOQA 4W8DA 4A7CA 5IA3A 1SM2A 3IW8A 4NEUA 2RFDA 4O0WA 4UMPA 1Q8TA 4FKWA 2F4JA 3PY1A 1WVWA 2VWYA 1JKTA 4TWCA 1NA7A 4BWPA 5AAGA 4PDYA 3NR9A 4KRCA 4FBXA 2IZUA 3IK3A 2C6KA 4X2FA 5CI7A 4Y8DA 5AP4A 2WMAA 2DWBA 2C5YA 4V0GA 2ITOA 3T9IA 3AMYA 1WBWA 4L7SA 2WIHA 4QQCA 3RM6A 2FO0A 2H8HA 5HO6A 5J1WA 3RBWA 4RWLA 4P2KA 5E91A 3AT3A 1P5EA 2VUWA 4K6ZA 3V6SA 4QP4A 5KZIA 4CV9A 3CTHA 4NW5A 2YHVA 5IISA 1YHSA 4PPBA 3FL4A 4GU9A 5CZIA 4Q9SA 3SX9A 3NEWA 3UTOA 3O17A 4P5ZA 3VQHA
chains in the Genus database with same CATH superfamily
3F3TA 3HDNA 5L6WL 3GC7A 4IAKA 3UQCA 4ENXA 2VTMA 2XJ1A 1A06A 2YIYA 4UEUA 3P4KA 3W33A 3B8QA 3GENA 2ZV2A 4IFGA 3UG2A 3QX2A 4JRVA 4JG8A 3ALNA 1APME 2OXYA 4B99A 4P7EA 4EOMA 4EH4A 3LQ3A 2CKPA 1YHWA 3NSZA 5HTIA 4G3DA 3C0IA 2UZBA 3TTJA 4EQMA 3R2BA 5HG8A 4E8AA 3CCNA 4IAYA 1JOWB 1FBNA 4O4FA 4YO6A 2J0JA 1FMKA 3L9MA 4BKZA 4R5YA 2GS7A 3E8CA 4GFMA 5JFSA 4K1BA 3PSBA 1U54B 4IHPA 4X2GA 4AW0A 3ZM9A 1GAGA 2X7OA 2C5NA 2I40A 4FSUA 4FTKA 4AT4A 4EUUA 3S4QA 1LEWA 4CQEA 4XV9A 5DEYA 3NX8A 5FBOA 2YM8A 4CYIA 2GQSA 3R73A 3NCZA 5IA5A 5CF4A 1KWPA 3TDWA 3QYWA 1J91A 2UW9A 4LUDA 3QA0A 5J7BA 2JBPA 3W16A 2E9NA 2YA9A 3HZTA 4H1MA 5CTPA 1W2CA 4C3FA 3QL8A 3FJQE 4YHFA 4UALA 5CXHA 4X21A 3TZ7A 3D7TA 4ZZNA 4MXAA 3I4BA 5KBQA 2V5QA 2OXXA 4GH2A 3O96A 1BI7A 1GZOA 5JEBA 3HV7A 3PY3A 4MYGA 5EHOA 4S34A 3OUNB 5HO8A 2JDOA 1G5SA 3R8PA 5D41A 4PMTA 3FEGA 4O7YA 2WQEA 1GZ8A 3VBYA 2R7IA 5AIKA 4F1MA 2QNJA 3UO6A 5JQ5A 1TFFA 4ASEA 1XH5A 3HMNA 4I1ZA 3PXRA 2OBJA 3PVBA 3AD5A 3OOMA 5EYMA 1AQ1A 3CD8A 4AGDA 3FMNA 5BNJA 3EHAA 1PMUA 3UVPA 5AP1A 2VTRA 4QMZA 2C3IB 5KZ0A 4Y5HA 4YTFA 2QHNA 5CF5A 5K9IA 4EK5A 3ZEWA 2QR8A 3VIDA 3IO7A 1OIQA 3PIZA 4XP2A 3KF7A 4DN5A 1XH9A 2C47A 4FT0A 2W17A 4YJSA 1OI9A 2JKQA 4D4YA 3UBDA 3MPTA 2GQGA 2XNOA 4F65A 3AXWA 3DTCA 1IASA 2CCIA 3E63A 4G6NA 5AR4A 3DXNA 3VULA 3ZXZA 2G1TA 5IA0A 5J79A 2OH4A 4DE4A 2J5EA 3QLGA 5AX9A 2WOUA 3A7JA 4DA5A 1CTPE 3MH1A 4R3CA 4L3LA 3R1NA 3RZFA 4FG9A 5AP5A 3CLYA 2WQMA 4DHZA 3ANQA 5DHJA 2PZ5A 2WMBA 3EIDA 2B53A 3BU3A 3F61A 3HL7A 4JDHA 4L8MA 4M69B 4RJ8A 4RT7A 4ANQA 1H07A 4LV7A 3C0GA 4H3PA 5HG9A 4OUCA 5JZNA 4YC8A 4CT1A 4E26A 3MN3A 5CVGA 4O96A 4YJQA 3COHA 4I93A 4FL3A 3QFVA 5EDRA 3VHEA 3NNWA 3S00A 3W0QA 3MTFA 1PMNA 2X39A 2X2KA 5AEPA 2XF0A 5LCJA 1KV2A 1YXUA 3BI6A 2A4LA 2WO6A 1RW8A 5EM6A 4ZSLA 4QMVA 4WSQA 4D1XA 4LUEA 3KRWA 4YZNA 3RPVA 2QCSA 3EJ1A 3MS9A 2ZJWA 5IKWA 4K0YA 4FEXA 2WZJA 3Q6UA 3PVWA 4NH1A 4CNHA 2I7QA 5EDPA 3G15A 1UVRA 3Q5IA 3V8WA 4EKKA 5FGKA 4FV7A 2F7ZE 4IJPA 4MNEA 3NYOA 3TUCA 5GIPE 2JFLA 1FVVA 4O83A 3CBLA 5CQWA 3WE4A 3Q9XA 2X2MA 2R3RA 5B7VA 3GBZA 4DHIB 3OY3A 3MVJA 3ZYAA 4AUAA 5LMAA 3EYGA 4F6UA 2WTVA 2XKCA 3PVUA 1Q24A 3CKWA 3BGZA 1FINA 2EB2A 3L9LA 3MH0A 1XR1A 5FEEA 5KBRA 2C5VA 2G2FA 2F49A 4IIRA 5AUXA 3KULB 4C4HA 3HNGA 1PY5A 1LPUA 2OJGA 4OTDA 5AV2A 5HNGA 2B9HA 4JI9A 4U5JA 4BWXA 5FDXA 3W2SA 2ITZA 3ZO1A 1WVXA 5EI6A 2OXDA 2GCDA 1F3MC 3NIZA 3NUYA 3QX4A 2GFSA 3EOCA 5J8IA 4AA5A 3S0OA 1G8JA 2OFVA 5CI6A 4YGAA 1WAKA 4FKOA 2Y8OA 4A9SA 3UO5A 3UOLA 3F7ZA 2GPHA 2XJ2A 3A4OX 2ACXA 2I0YA 2Q0BA 4H58A 3F82A 3NUNA 4HGSA 3ZZEA 4AZWA 3KMUA 2IVSA 3BKBA 3IGOA 5BVEA 5FG8A 4EL9A 3ZOSA 4PPCA 1JBPE 4YO4A 5H8GA 1JPAA 4FKRA 2ZMDA 5CSVA 3DAEA 5BVOA 1MRUA 5HVKA 3C51A 3P0MA 4CLIA 3UVQA 4PMMA 3MESA 4O7ZA 5IQDA 3VS2A 4IX5A 4EWHA 3UPZA 4JMQA 3DJ6A 4IXPA 3E93A 4ASXA 2BUJA 5HQ0A 4I0RA 3TMOA 4FA2A 4IEBA 2FB8A 3PLAE 5HCXA 4BCPA 5KNJA 5K4IA 1M52A 4GW8A 3BBWA 3TV4A 5BQ0A 4YP8A 2UZWE 2P2HA 4FNZA 3QTRA 4RQVA 4DTBA 1K2PA 3LVPA 2HW7A 4D2SA 4F1TA 2C68A 3TACA 4I94A 2WMXA 4YC6A 1TQPA 4DTKA 1ZMVA 4FTUA 4C61A 4ZTNA 5AA9A 4XG2A 2HYYA 2UZOA 3A99A 4I6HA 3UQGA 3ZLSA 3K5UA 3O50A 1IA8A 1UU7A 1ZOEA 4UMUA 2VO6A 5DOSA 5HIEA 3OW4A 4UX9A 4FSYA 3KEXA 4F0IA 3W2PA 5ACKA 5KCVA 4I5MA 5EW3A 5JRSA 3DU8A 3LZBA 4IADA 4CFNA 4EH3A 2C69A 2F2CB 3QXOA 5DYJA 5AFVA 2RGPA 3CGOA 3PUFC 5JGBA 3OCBA 5CQUA 2BFXA 4ARKA 1JVPP 5J1VA 3K3JA 4YPDA 5FWKK 3KXXA 3E5AA 3QUEA 2PZIA 5M51A 3ZONA 2XUUA 4GKIA 3DCVA 3HYHA 5BVDA 2JKKA 3W1FA 4M15A 4IW0A 5AM6A 3ZCLA 3W10A 4WRGA 4ZLZA 2HWPA 1VR2A 5K5XA 4E6AA 4FUYA 1M2QA 3RP9A 3N4VA 3ULIA 3VWAA 1NVSA 4CMUA 3PSCA 3Q4TA 4ZOGA 2OJFE 4IAAA 2XAOA 4F63A 1YXSA 3LXNA 3EQHA 2UW5A 3KK9A 3P86A 1WFCA 2YM5A 3POOA 3F3VA 2QG5A 3PRFA 4IAIA 1E1VA 2NP8A 4MF1A 4U41A 3T3UA 3UNJA 4FSZA 4JG6A 1WVYA 4EORA 1HCLA 4YJVA 2WTDA 2XCKA 1GNGA 3SXSA 3ITZA 1PXLA 2JIUA 3I81A 5IA4A 2REIA 4FOBA 4DDIA 1URCA 3LMIA 3QQKA 5HLPA 3BWFA 5E8TA 4W8EA 2XVDA 2VN9A 4M8TA 4BIEA 5HLWA 2BZKB 4CEGA 4HGLA 4J53A 3FY0A 5GZ9A 3IG7A 4RPVA 3MY0A 3P23A 2YFXA 4I0SA 1PMVA 2UZNA 3IDCA 4NM0A 4EONA 5H9BA 4MD8E 3THBA 3HP2A 4AU8A 3K5VA 2QOQA 5E4HA 3R9DA 3RK7A 2HELA 2PHKA 2FSLX 4O0YA 2XBAA 2XZSA 1OKVA 3L8XA 4QQ5A 5BVNA 4TYIA 5HD4A 5C01A 4RVLA 4YTHA 5AIRA 3QUPA 2C0OA 3V8TA 1H01A 1OIYA 1JSVA 5CU6A 5HZNA 4UY9A 3OF0A 1W0XC 2X0OA 3EQGA 5EHYA 2FVDA 2W1EA 1SNXA 4GK3A 2BROA 4HYUA 4DTAA 4OAVB 5HIDA 3RPYA 2CJMA 3HECA 3GCSA 4IBMA 3PA4A 4F64A 2FUMA 2R64A 4F0FA 1UV5A 4GCJA 2YITA 3AT2A 5IEXA 3EH9A 4X6RA 3RALA 2G2HA 4L42A 4ACDA 2R3GA 2WOTA 4L7FA 3U6HA 3BBTB 1QPDA 4IX4A 2Y4IC 2YACA 4BFMA 4QMSA 3QALE 2C1AA 3HMMA 5H8BA 1STCE 2BTSA 4RIWB 5CS6A 2F9GA 2C0IA 2OIQA 5E8YA 2XNPA 2F7XE 2R3JA 3TIYA 4EQUA 4Z55A 5BUJA 4KUJA 3SQQA 3UIUA 4LL5A 3DLSA 4G6OA 5ANDA 5EH0A 2ZAZA 1OIRA 2FA2A 3RCDA 2W1IA 4FKSA 4BHZA 3LKMA 2Z60A 3ZU7A 1BL7A 2H34A 3GU4A 3EFKA 2PUPA 3ET7A 3PG3A 3FKNA 4CFWA 4F6WA 4BIBA 5GIOE 4KD1A 3U51A 2PZRA 2I0EA 5HI2A 2B0QA 4O4DA 2JFMA 4ZMEA 4UZHA 3R8MA 3A7HA 4XNEA 4ACMA 2JBOA 2ITTA 3OCSA 4XV3A 3RPSA 4CT2A 5AAEA 2O2UA 2QKRA 3C4WA 2PUIA 3VUHA 3MH2A 4QTAA 5DI1A 3LCDA 4ZSAA 4JDIA 4NYEA 3HVCA 3SG9A 4ZZMA 3GNIB 5DWRA 4IX6A 5FUTA 3KN5A 1ZYJA 2CGVA 5LWNA 3A7GA 5HOAA 3BX5A 4O86A 3QQGA 1KOAA 1UA2A 2WD1A 3OXTA 2YM3A 3QD4A 5HLNA 4YLLA 3FI2A 5JZJA 1KE7A 4EOPA 4JIKA 2W05A 3FLNC 3GOKA 1Q4LA 1WBSA 4L3PA 1VLRA 4IZYA 4BGQA 4GIHA 3HP5A 1UWJA 4FKVA 4FIFA 5AUWA 3L8SA 1XWSA 2GU8A 5KMIA 4NIFB 4YBJA 3DOGA 1DS5A 4D0WA 1YI6A 2IW6A 3OVVA 1OL6A 5LMBA 5DMZA 1OB3A 4O1OA 4XG7A 4XLIA 3Q2JA 5DPVA 4ITJA 3FZOA 4PNKA 4U44A 2XK9A 1BI8A 4M12A 4TTHB 4ZXTA 2UZEA 4EWQA 5K4JA 5IDPA 3ATTA 5IMXA 2BAQA 4EC9A 4J95A 3L9PA 4J98A 4KIOA 4O82A 4JL9A 1ERKA 1NT2A 4W9XA 5E92A 3U9NA 1UNGA 2W4JA 2PMIA 4PTCA 4DAWA 3RTPA 4CRLA 2RG6A 4A07A 1CKIA 4F9YA 4M7IA 3HAVA 3UZPA 3H9FA 4HVGA 4O7LA 4QQTA 3EFJA 3LCSA 4I6QA 2ZV8A 4OTQA 4C58A 4S2ZA 1PW2A 2JDSA 5K0KA 1YOMA 3TL8A 4QP6A 3KULA 2BIKB 4MXXA 4DFUA 4ZS4A 3TNWA 2HZNA 4O0XA 4BR3A 4WIHA 3DBQA 4WOVA 4JDJA 4O21A 4PX6A 4F78A 3QTQA 1HCKA 5IDNA 1O6KA 5KUPA 3JY0A 3MPAA 3C9WA 4M97A 4UZDA 1M2RA 3OS3A 1G8SA 4ZY5A 3LXLA 4MQ2A 2BMCA 1VZOA 3RCJA 4AZFA 2GFCA 3KU2A 5BMMA 2EUFB 2NNWB 5CALA 4JBVA 4MF0A 4RZWA 5A4CA 3MWUA 3ODYX 5IUHA 4FEQA 4UYNA 5GJFA 4HW7A 4YHJA 1OITA 2BKKA 5ACBC 4N70A 4PRJA 3P7CA 2OJIA 3GCUA 1QPCA 1XKKA 2BZHB 4L3JA 1R78A 2I0VA 4PL3A 4RA4A 5I9UA 2PZPA 4U3YA 3ZHPC 3GC0A 2XRWA 3ELJA 3OUKA 4H3BA 1OM1A 2VTTA 3VC4A 3VUKA 4BB4A 5IA2A 3C50A 3FWQA 4E7WA 4C2VA 1R39A 2QQ7A 1J7LA 2AC3A 2W1CA 4QYEA 3DS6A 2OJ9A 2XK8A 1B6CB 2FYSA 2XANA 3NAYA 3PTGA 2R2PA 4FV2A 3R83A 3R6XA 3M11A 3C4ZA 1XBAA 4NW6A 4OTIA 1H1WA 2HZ0A 2X8DA 4BZOA 4CLJA 4Y5QA 3SVVA 5IQEA 4DLIA 1XH6A 2VNYA 3Q4UA 2JLDA 5EQYA 1PXOA 2J6MA 3ZC5A 1ZYDA 2BAJA 2XNNA 2QOOA 3BLRA 5HCZA 2WTWA 4AT5A 3ZO2A 4WG4A 4B8LA 4KSQA 5AV0A 4YMJA 4GVJA 2VTPA 4OLIA 5LVPA 1PJKA 3KCKA 3OP5A 2PVMA 1G8KA 3NCGA 4TWNA 3HV5A 2PVFA 3MFSA 3OWLA 1OL7A 4HYIA 4FIGA 4YJRA 5B0XA 5I9YA 1WZYA 2YCFA 2W1FA 1H24A 5BYLA 3W18A 4II5A 3JVRA 3KKVA 3OWJA 3R0TA 3A60A 3F5XA 5FDPA 3Q3BA 4G9CA 5A6NA 3H10A 3QCXA 2P0CA 2R3HA 3DKGA 3PY0A 3R71A 2ZB1A 4G5PA 4JVGA 3TM0A 5BYZA 3NPCA 2Q0NA 4EOSA 4RC3A 3U87A 3G9NA 3COMA 2QG7A 3Q60A 5BVWA 3GC8A 3HA8A 4EQCA 3C4CA 3K2LA 2VU3A 1Q8YA 3D5UA 4GMYA 3VAPA 2X4FA 2YJSA 5CEPA 1E1XA 4CFFA 2WMRA 5AUZA 4TYGA 4AT3A 3HDMA 4U3ZA 4BYIA 2W96B 4L9IA 2HCKA 4GFOA 1FOTA 5KMNA 2Y9QA 3MJ1A 3HRFA 3ZDIA 3RZBA 4ACCA 5TT7A 3BQRA 4RLKA 3VF9A 3PJ3A 4E4LA 3RWQA 4WNPA 3KCFA 4BDBA 3U55A 1YI4A 3D5VA 3QQJA 3RAWA 3VS5A 2WAJA 4B6LA 5L2SA 4HCUA 4XX9A 4XEYA 3OD6X 5FM3A 1SNUA 4JDKA 5IQCA 3OW3A 3KK8A 4EHGA 4W4VA 3D94A 2BR1A 4TNDA 4EZ3A 1H8FA 2IVUA 4X3FB 3LPBA 3VS7A 4PMPA 3FLSA 3BWJA 4N6ZA 4WG3A 3SHEA 4FYNA 4F7JA 5A54A 5LXMA 3VVHA 2UVZA 3ZRMA 4RSSA 2YWPA 1JWHA 2B9JA 2WTCA 2VWWA 3DAJA 4JR7A 4GYIA 4R3PA 4R8QA 5AP0A 2QONA 3PJ2A 4N57A 3GCVA 4L46A 3W0OA 3QUDA 3B8RA 2QR7A 5M53A 1FMOE 4KRDA 5E8UA 4DT9A 5JN2A 5LWMA 3UMWA 1BLXA 1U4DA 2VTSA 1Y6AA 5M06A 2ZV9A 4AOIA 1BMKA 1V1KA 2HAKA 2JKMA 2C6IA 2XK4A 4O6LA 5HE0A 3V5LA 4DEHA 2VTLA 3NRMA 4YUQA 1YOLA 4CVAA 3WZJA 3PE1A 3F69A 3FMMA 4RRVA 2YEXA 4DT8A 4FZFB 3R63A 5L2IA 3ORMA 3UZRA 5T6KA 2C6EA 4IB5A 4KKHA 4DH3A 5LCKA 3WIKA 2R0IA 3QWJA 4RIWA 5FTQA 3KRRA 4I5PA 5E8XA 4EH9A 1DAWA 3UIXA 3OWPA 2GQRA 2PVKA 3QLFA 2YN8A 4RJ3A 4FKIA 3LHJA 4QP7A 3FMHA 4O7TA 5BVFA 2RIOA 5B2LA 3QRKA 5GJGA 1M7NA 4EH8A 3HV6A 3P78A 5HG5A 5HU9A 3H4JA 2NPQA 4RX8A 4FNYA 1TKIA 5L4QA 4LGGA 4AQCA 1SMHA 4BCGA 1J1CA 4XCUA 4H36A 4BTMA 3SXFA 2J0MB 2Y6OA 4P90A 2QHMA 3NW5A 4XP3A 5LVOA 3SA0A 3ZH8A 3E87A 2PY3A 2QOKA 2ZM4A 2AUHA 4DG0E 2R3FA 3EN4A 3Q5ZA 3CTJA 5FXRA 5EM7A 5M56A 4GS6A 4PDSA 4I0TA 5EQEA 1LEZA 5KE0A 5C03A 5IH4A 3FZSA 4FL1A 2NRUA 4MX9A 3QU0A 3OWKA 3JUHA 1Z9XA 5EK7A 3ZSGA 3O7LB 2BCJA 2BRNA 2IWIA 3FQSA 4K18A 4TKSA 4FTLA 4Y72A 5LVNA 4DFBA 4BY9E 3NGAA 4RX5A 4HCVA 5D7VA 4D2TA 4X2KA 4JLCA 3T3VA 2WIPA 2EWAA 3DJ7A 3R8UA 1O6LA 3VRZA 3BPRA 2VAGA 3OG7A 4M66A 4MXYA 2BHEA 3BRBA 2NO3A 2NRYA 2VTAA 3DT1A 4OR5A 2P2IA 4CKJA 1X8BA 3H9RA 2ITQA 2X7GA 3W2QA 3FLZA 4NIFA 2ZMCA 3NLBA 4D9TA 5CASA 5JGAA 5AA8A 2BDWA 2G9XA 2PVRA 4U81A 4EZ7A 2XEZA 2YJRA 4KS7A 3FDNA 2XBJA 4GG7A 3P79A 4Q2AA 4GIIA 5I5ZA 4UBAA 3QKKA 3F66A 4NU1A 5J87A 4JBOA 4OTRA 4S33A 2XK7A 4HVHA 1GJOA 3QHRA 1J7UA 1CM8A 2SRCA 1YOJA 2QOFA 4IM3A 4YR8A 2QLUA 5C26A 3DZQA 1PXNA 4OBOA 4AXFA 3E7OA 3NYXA 2YM4A 3VUMA 1KE8A 3QGYA 2ITUA 1YW2A 2VWUA 2VO3A 3MIAA 4N4SA 4RWKA 4DITA 3ZO4A 4ID7A 5TKDA 2VV9A 2DYLA 2WU7A 5DLSA 3UC3A 2W1HA 1S9IA 4C0TA 4NZWB 4DFLA 3OOGA 5JRQA 5CVFA 5EM8A 3ROCA 1ATPE 4ZJVA 3COKA 3I6WA 4U97A 2B55A 5DT4A 4G16A 2X9FA 4HVSA 2EXEA 4QTDA 5KMKA 3G0FA 3FZPA 4B8MA 5EKNA 4EOLA 4CZUA 1DI9A 2W9ZB 2A98A 3DB6A 3FBVA 3CPCA 3R02A 4I41A 5ANIA 3RK9A 4DGNA 1JSTA 3A7IA 4KSPA 4D58A 3S3IA 3VUIA 3D7ZA 2BDJA 4QMOA 3VBVA 3RNIA 5IQHA 4AZVA 4F4PA 3LCTA 4OT6A 2C5XA 2XM9A 2ETMA 2OGVA 3HMIA 1KE6A 2JITA 2OZOA 4LMUA 4E73A 4MHAA 3OEZA 2JKOA 1UU3A 2H6DA 1RJBA 3OBJA 2LGCA 4H3QA 4TYJA 5G6VA 1Q99A 4BCOA 5DH3A 4XG4A 3MFUA 1CDKA 5DA3A 4GL9A 4IX3A 2PYWA 4OTGA 5ANGA 5GNKA 4EBWA 2HOGA 4E6DA 4I6BA 2GS2A 3BHUA 1ZY4A 3DTWA 4WBBB 2ITVA 5D11A 2AEGA 4C35A 3E8EA 3A62A 4EK3A 5CT7A 1BUHA 2VTQA 1WBTA 5CSPA 2V7OA 4IFCA 3BLAA 5EI2A 4KB8A 4FSRA 3ATSA 3AMAA 4WA9A 1OL1A 2EB3A 3JPVA 1XQZA 1REKA 3G9LX 3QD2B 4J52A 1M7QA 2C6OA 3AQVA 1FVRA 4FR4A 3KXNA 5HEZA 2KTYA 5LQFA 2P55A 3O8PA 5E90A 3MV5A 4XOZA 4DGMA 4EHZA 4KIKB 3LFQA 3LJ2A 4AN9A 4QMNA 4DCAA 4O2ZA 5EM5A 2GNFA 4ANMA 3LFDA 1XMLA 4FZ7A 4U40A 5HE2A 3UO4A 4ERWA 3PDTA 4EK8A 3MVHA 4LGDA 2ZFYA 1RDQE 4FKTA 2J4ZA 1ZAOA 3PLSA 4S32A 1VEBA 2JC6A 5J5TA 5KHWA 4AZSA 4AS0A 4IWPA 5D10A 3W55A 5JK3A 3PPJA 3ORPA 2Y4PA 1H28A 3DK7A 3E64A 4G31A 2ZOQA 3MFTA 3VS3A 2PVLA 3D0EA 4RG0A 5HBJA 4BZDA 4HOKA 1XH4A 4ZS0A 2CNQA 3LFBA 3PZHA 3TG1A 3IW6A 1SYKA 5CT0A 3H30A 4JQ8A 2J50A 4R5SA 3MYGA 3F2RA 4UWCA 3GQIA 3ENMA 3KFAA 4R1VA 3EMGA 3NAXA 4TXCA 4P4CA 4BTJA 3UDZA 5HX8A 4FNWA 4PTGA 3TKHA 4C37A 3CSVA 3O8UA 4PY1A 4XV2A 4M13A 5EDQA 3W2RA 5LVLA 2XARA 3WIGA 2WMVA 4RC2A 4LQMA 4B7TA 4IM0A 4XMOA 4O0RA 3AKKA 1OKWA 5EYCA 4D4RA 5IQAA 3VONA 3Q32A 4OW8A 3EB0A 4CG8A 5AP7A 3KB7A 4QP3A 4OBPA 4RX7A 3QBNA 1YXTA 4I5HA 1G8AA 3PIXA 1H00A 4DH8A 4B9DA 4AE9A 4X3FA 1UU9A 2UW8A 3NFGB 5I3RA 3C4EA 4X6QC 3MTLA 4O0TA 2PPQA 2X8EA 5AUVA 3C0HA 4YJTA 4APPA 2Y6MA 3ZFMA 4APCA 4I4EA 2YZLA 1XHAA 4QMTA 3QRIA 4BGGA 4E4XA 5AUUA 3UPXA 5J9ZA 3FV8A 1KV1A 2HK5A 3PPZA 3Q2MA 4A4XA 2OK1A 1PXJA 3W2CA 2QODA 3AGLA 4DCEA 1Q3DA 2ZDTA 4JNWA 4RA5A 4FIHA 5HVYA 4ANOA 2XK6A 4USFA 1H1SA 2UV2A 3EQIA 3BELA 2IJMA 3MBLA 2YIQA 4FKLA 5AR2A 3DY7A 4KNBA 4WNMA 5KMJA 5IEYA 1UNHA 2QURA 3T8OA 4R7IA 4FGRA 3FI4A 4C34A 2BKZA 3AGMA 3I60A 3UC4A 2QKWB 5KO1A 3KXHA 3ZZWA 3PVGA 5DGZA 2VO0A 3PIYA 4O22A 4ZTHA 5C9CA 4JX7A 4EOOA 2JD5A 5CYIA 1YQJA 3ZBFA 3L1SA 4FL2A 3JS2A 3LE6A 5C4KA 4GUEA 2BHHA 3CY3A 3D14A 3DBFA 3IW5A 4D9UA 1V0BA 4ZP5A 4FKUA 4QNYA 5K5NA 4QP1A 2GNHA 3JXWA 3UP7A 3KQ7A 4U6RA 2VNWA 4QTCA 4IDTA 4QDVA 3IKAA 4H05A 4LRKA 1IR3A 4AACA 1ST4A 1J3HA 4M0YA 2GDOA 3BCEA 3GC9A 5ANKA 2GMXA 5HE3A 3HRCA 3Q9WA 2B52A 5BUEA 4IWOA 5IQIA 2VGOA 2FSTX 5FXSA 1KE9A 4FV0A 2HZ4A 4J8MA 4HYSA 2CKQA 2A1AB 5IH6A 4YC3A 5CLPA 1CMKE 1B38A 3HA6A 3LOKA 5I3OA 2O5KA 3GU7A 2F2UA 3LQ8A 4R1YA 4C4FA 3SOCA 1OL2A 3AC8A 4J99A 4G3EA 2QOLA 3PJCA 1XBCA 1ZYCA 3EL7A 2XIKA 3Q6WA 2GNIA 4IVDA 4WRSA 4HVDA 4LV5A 3ZLWA 4FIEA 2WU6A 3F88A 3RM7A 4IANA 4CFXA 3TV6A 3P1AA 2CGUA 2HWOA 3D83A 3FI3A 4WT6A 1UWHA 4GJ2A 4DLJA 3ZC6A 2XCHA 1M14A 3QTWA 1XH7A 2F57A 3PWYA 1UKIA 4M0ZA 1GIJA 5AWMA 3NFFB 4R77A 4IC8A 2X81A 1SVHA 3BGQA 5FLFA 5HORA 3UNKA 4O7VA 3V5TA 3HMPA 2W1ZA 3ZSHA 2X2LA 4NL0A 3F9NA 4MH7A 2HY0A 3QQUA 2PE1A 4F7NA 3MW1A 3FZ1A 3D5XA 1ZMWA 3D15A 3VN9A 4HGEA 2WMWA 3DFCB 2WMUA 4I4FA 4WNOA 4F08A 4QMQA 2Z8CA 2BPMA 1TQMA 3ULZA 4IQ6A 2PZYA 5CXZA 2W1DA 2X9EA 5HG7A 4DFYA 3R22A 1U54A 4EH7A 3TIZA 2WHBA 4FKQA 5FXQA 4C57A 2Y7JA 2ETRA 3VHKA 3H0YA 2Z02A 2ITNA 3TUDA 3B2WA 4FTTA 3NUUA 3VJOA 2A2AA 3BLHA 3BYSA 3M42A 3PA3A 4UWYA 3RWPA 4CCBA 3GU8A 3H3CA 4FSMA 2UW6A 4JOAA 4QTBA 3UODA 5EQPA 3FUPA 5E1SA 4UXLA 3AC1A 2YAAA 2B1PA 2IN6A 2J9MA 3C13A 5HO7A 4O7NA 2EXCX 4BCQA 1PYXA 2V62A 4QP8A 3BEGA 3F2AA 3F2NA 4I20A 5DRDA 2OO8X 3QC9A 1J7IA 5A6OA 5BX0A 4O81A 4XJ0A 4CMOA 5IG1A 4G17A 2WMQA 5HHWA 4ANNA 3U6IA 4XRJA 4GT3A 4CKRA 4JAJA 4FT5A 5FQDC 5LVMA 2OLCA 1P2AA 2YAKA 3QTIA 3SGCA 5J95A 3E92A 2C1BA 3POZA 2V55A 3P5KA 4RJ4A 4FODA 1K9AA 3DQWA 2Z7SA 5JH6A 3W0MA 3DFAA 4C33A 5JMSA 4F9AA 3UIMA 4FTJA 3LMGA 3ENHA 1VYZA 1B39A 4Z7GA 4XS2A 4AG8A 1QCFA 2X1NA 4K11A 3EZRA 3GU6A 2GTMA 5AJQA 4O84A 4PL4A 3CP9A 1HOWA 2OW3A 3QZHA 2PE2A 1OKYA 4MAOA 4DEBA 4AE6A 1MUOA 5DEWA 3UP2A 3KMWA 5I0BA 5I9VA 4QOXA 5L2WA 3UGCA 2QOHA 5CAVA 1L3RE 2IEWA 4EH2A 4AXDA 4MK0A 2EU9A 3FPMA 2PULA 3F5GA 2YZAA 4BI2A 4EOJA 3NYNA 4UV0A 5CNNA 2Z2WA 2KULA 4UXQA 3VRYA 3R7GA 4DFXE 4IVCA 4ONAA 3VF8A