1YWNA

Vegfr2 in complex with a novel 4-amino-furo[2,3-d]pyrimidine
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
302
structure length
279
Chain Sequence
LPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLTHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDIKDPDVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel 4-amino-furo[2,3-d]pyrimidines as Tie-2 and VEGFR2 dual inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Vascular endothelial growth factor receptor 2
total genus 92
structure length 279
sequence length 302
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1ywnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1ywnA01
2OF2A 5CNNA 3QQJA 4I23A 4AOTA 3UOKA 3IQ7A 3Q4TA 5EW8A 3ZUTA 3OS3A 4K77A 5BUIA 3V04A 4ZSLA 5FD2A 4ACHA 1U54A 3DTCA 4FUYA 4EH8A 4NSTA 3KRLA 2X6EA 4RWIA 2BRMA 3NSZA 5C01A 1OM1A 4L45A 3GQLA 5CF6A 4FTTA 4FNYA 1MP8A 2BDJA 1IAHA 4LQMA 4M67A 3SXRA 4DA5A 1OIQA 2ONLC 4JQEA 1AGWA 4FSUA 1ZYLA 5DHJA 3DKCA 4DLIA 4XP2A 3NWWA 5EOLA 3ZXTA 2XYNA 3BLRA 2WIHA 5E8YA 3NW7A 3II5A 4XBUA 2J51A 2ONLA 2PU8A 4F1TA 5HZNA 3RPSA 5JGDA 4FV7A 4KAOA 5GINE 3G9NA 2HWOA 3VUGA 5J7BA 2WTVA 1CTPE 2QOIA 5HLPA 3NPCA 4JNWA 2FVDA 2J6MA 4L6QA 2UZBA 3MH3A 4D9UA 3Q9YA 4R3CA 2PMLX 3W32A 1ND4A 3P08A 3COMA 3ROYA 4CV9A 3Q4CA 3RNYA 5LJJA 2WTCA 4L3PA 4U5JA 4FICA 4ASXA 3VW6A 3AC3A 4FT0A 3E8CA 2ZM1A 4UB7A 3CD3A 5EG3A 1W98A 2WOUA 4IANA 4MNEA 3GNIB 5CSWA 4U8ZA 3UGCA 3VS6A 3SW7A 3JR1A 2Q0NA 5E4HA 4KNBA 3VRZA 5BYYA 3QRIA 5FEDA 3KXXA 2YM4A 3CKWA 4X21A 4ALVA 2C30A 2CGWA 3ZZWA 5DT3A 2H96A 4EONA 5M57A 2HZIA 4TZRA 2C6EA 3QTRA 4U7ZA 4AZEA 4ZY5A 1H8FA 3DS6A 4EBWA 4KBCA 2CMWA 4M12A 3RAWA 1MQ4A 4C36A 4Z3VA 3BHUA 4EOIA 3ERKA 3KVXA 3F2AA 3RALA 4L53A 3TKIA 4IAAA 5EDRA 4HYSA 4L44A 5FGKA 3R8LA 5CAQA 3VBWA 4YJUA 3PUPA 4N6ZA 2Y6MA 2BDWA 3PXYA 2Y9QA 3AC2A 4IVDA 3PDTA 3QRTA 2BIKB 4FE2A 4C38A 3OT8A 4FOCA 2G2IA 5CXHA 3I6WA 4KKHA 3L8PA 1ZZLA 3SA0A 2CDZA 4HCUA 4AW0A 5M51A 4QMMA 4X2GA 5IQCA 3I0QA 3KMUA 2UVZA 3OCBA 5LWMA 4YZMA 3FLYA 5FEQA 1OGUA 3UO4A 1H27A 3R73A 3ORPA 3TKHA 2O65A 2HAKA 3VHKA 3RP9A 4AWIA 4FL1A 2WMBA 5J7HA 4FYNA 2ITVA 1TQMA 4DFUA 1RW8A 2VX1A 5CAUA 2GTNA 3A60A 4GL9A 4O2PA 5H8BA 1W0XC 2ITPA 1SMHA 4O7LA 1YDRE 3AD4A 5FTQA 2XK3A 2HK5A 1P2AA 5HNBA 5I9UA 2R3MA 3MDYA 4G2FA 4XX9A 4QP3A 4FKOA 2Q83A 3QTIA 2B55A 3LHJA 1Q97A 2VAGA 2JKQA 3UOHA 2B9JA 3TJDA 3DLZA 3NUUA 5CEOA 2XKDA 2RKUA 1W83A 3CJGA 3TN8A 3TV7A 2B9IA 1UNGA 1WBVA 5LVNA 2V5QA 4P90A 3ZYAA 2Y0AA 3OWKA 4FNWA 2C5OA 4YJQA 3FMHA 4EOMA 3BX5A 3FI8A 5M09A 4BCGA 4UMTA 4C3RA 3EQHA 1OKVA 2ZOQA 2AYPA 4Y5HA 4XV2A 5A4QA 3QAME 3QC4A 3O51A 5KCVA 3LCDA 5M4FA 3DK7A 3DK3A 4UALA 4CQGA 4DG2E 2OWBA 3M11A 3GEQA 1CKPA 1GJOA 3GC0A 4AOIA 4BI0A 4O7WA 4PTCA 3EN4A 3GP0A 1ZOEA 2IN6A 4MXOA 5CNOA 4ZTQA 5FUTA 2GMXA 3R21A 1Y91A 4B8MA 5JKGA 1ZY4A 2X9EA 3R1SA 5DRBA 1OZ1A 3RPYA 4GK4A 3MB7A 5CLPA 1PRYA 4XG6A 3DJ5A 2XS0A 4ZIMA 5LMKA 1OBDA 3DZQA 3P7BA 5E8VA 4AX8A 3NS9A 5IA5A 3UP2A 1WBWA 5HX8A 2O5KA 5EOBA 3UMWA 3OP5A 4D5KA 2PE2A 5DR6A 4E93A 1HCLA 2H34A 5HG9A 3VBYA 4C4GA 4JLCA 4KIPA 4EK3A 5CT0A 5GHVA 3EWHA 3LFBA 3TZMA 4L43A 4DEHA 4DH7A 5IA3A 2PSQA 4WBBB 4BCPA 4HOKA 3TIYA 3OEFX 3RTPA 2PPQA 4XCUA 3D7TA 4F9BA 3ZCLA 4Q5HA 2C6OA 3C4FA 3LLAA 1U5QA 4AXAA 4FT3A 3EFWA 4ERKA 1TQPA 4MHAA 4MCVA 2BFXA 4FTCA 4FNXA 5LCKA 2H8HA 3MWUA 3KXZA 3DDQA 4BDJA 2R3RA 2C6MA 2UZWE 3I4BA 2JIVA 3ET7A 4DGNA 3PE1A 4E4XA 4RWJA 5M4IA 2BZKB 4H58A 4TYGA 4LOPA 4YUQA 4F08A 4F7LA 4CG9A 3Q9XA 2ZV2A 3L8XA 1YXTA 4Q9SA 4ERWA 1UU7A 3ZUVA 3R1NA 4OTHA 2C6DA 2BROA 3OXIA 5EFQA 1CKJA 4AS0A 4CD0A 5B2MA 4QP7A 2BRHA 1OIYA 3DKFA 3HX4A 2YM6A 4RJ3A 2OF4A 4IC7A 3I7BA 4OAUC 3E88A 2H9VA 1FVVA 3HRBA 4F63A 4U42A 2XNOA 4R8QA 1KE7A 3NEWA 4XV1A 4D2SA 4FTIA 4O0VA 4I3ZA 3C5UA 4F0GA 1V1KA 3PA5A 4PL3A 4TYIA 4WA9A 4BC6A 1JKLA 4ANBA 3CLYA 2W96B 4XJ0A 4JXFA 4RWLA 5GIOE 2WMXA 3A7JA 3Q3BA 3EKKA 2JDRA 3LXNA 1A9UA 3RAKA 2GQGA 5LQFA 2WMRA 2Y7JA 1KUTA 4O7NA 2C6KA 4HPUE 3KXGA 4TNDA 1Q24A 4CFUA 3TNHA 4EJNA 3DNEA 4Q9ZA 4BDHA 2XK8A 3RJCA 2VX0A 4UX9A 2XH5A 1A06A 3FLWA 2V62A 5E91A 4EH7A 5IEYA 3PJ3A 4LOQA 2C5XA 5D7AA 3R2YA 4ANMA 3CC6A 4PMTA 1UU9A 2WTJA 4BY9E 4RIOA 4YSMA 4M14A 2IVVA 2A0CX 3OW3A 1XR1A 2RFSA 5J5TA 4YP8A 3KCFA 1KSWA 3NIEA 4TYHA 1V0PA 2XUUA 3QRJA 5HD7A 3VUTA 3K3JA 3W2OA 4AF3A 1PMNA 5T68A 2ZV7A 4OTGA 4BVUA 2WFYA 4C3PA 4C58A 4L68A 2WKMA 4S32A 1PXJA 4I0RA 2XCKA 3FHIA 4JBQA 4W4WA 4H1MA 5IMEA 4H05A 4BDDA 4QMOA 3CJFA 4W8EA 5FG8A 3PRIA 4FIGA 1WVWA 5JSMA 4FV2A 3OZ6A 4JDKA 4CMUA 1NW1A 5HE3A 1BYGA 1XH8A 2P33A 3F88A 4ZLOA 1ZYJA 1PXIA 4XV3A 4PDYA 3TNIA 2XYUA 4I21A 5FP5A 5JMSA 1YOJA 4KIOA 1WCCA 4XG2A 3DY7A 3FKOA 5LARA 3RPVA 5H3QA 2ZV9A 5CYIA 5IMXA 1NXKA 4FTOA 1O6KA 5AV1A 5TF9A 3COHA 3EOCA 5BQ0A 1UWJA 5C1QB 3EQIA 3O50A 4YTHA 4D1ZA 2FH9A 3CQEA 2EU9A 1XBBA 3MY0A 4PDSA 5K5NA 5I0BA 1R0PA 4FIEA 4DEIA 1F0QA 3PZHA 4JDHA 3ZEWA 4DEBA 5LOHA 2VWBA 1NVSA 3CQWA 3ZFYA 4GT5A 5F4NA 5A14A 4YZ9A 5HEZA 2ZJWA 2Y6OA 4D4VA 1GZ8A 1VEBA 5ICPA 2XNEA 5BVKA 5IQHA 3Q32A 3F2NA 3ZC5A 4G16A 1JOWB 4ZMFA 2VTHA 3BU3A 4KIKA 4RT7A 3E87A 2OJFE 4RIWA 1BL7A 3BLHA 3R1QA 4QMQA 4USEA 4AOJA 2WU6A 2QOKA 4M66A 2H6DA 2R3LA 4RJ4A 3ROCA 2OIBA 2WB8A 3OT3A 4C34A 1ZOGA 2BUJA 3TDVA 2WTKC 2QONA 3K5UA 2VWUA 3BQRA 3QQKA 5LMAA 3H9FA 5H8GA 4PP7A 4WG3A 5A4EA 2XRWA 2XJ2A 2YDKA 3IOKA 4IAIA 5DFPA 3GOPA 2B0QA 5HCXA 5ANJA 4BI1A 2WQNA 1PXOA 5EM8A 4XMOA 2ITWA 1JPAA 2RGPA 3AC1A 1ZMWA 3PIZA 4ZOGA 2ZVAA 4D4RA 3OG7A 5I9WA 4F0FA 1T46A 3D5VA 3SXFA 3DLSA 4GSBA 2P4IA 3WF9A 4NYEA 5HD4A 4JRVA 4DEAA 3CTHA 4OW8A 3ORKA 2XJ0A 4OBOA 4ZJIA 1Q8TA 4B7TA 1EH4A 4CVAA 1U54B 3PTGA 4PPCA 3S00A 2V22A 1OITA 4AGWA 4RX8A 3PP1A 3BE9A 4RVTA 3ANQA 3PPJA 3DTWA 4HJOA 2BZHB 2KULA 4V0GA 1W82A 2X4FA 4Y72A 4C4EA 5C27A 4ZTNA 3LCSA 2P2IA 4S33A 3WE4A 3AQVA 4U3YA 3H30A 1OECA 4Y85A 3V5LA 2Z60A 3OHTA 1ERKA 1PXPA 4FKQA 1I44A 2O3PA 2PVKA 2ETMA 4IAKA 4L01A 5HORA 4IB5A 2VTLA 3BIZA 3VS4A 4B8LA 4EI4A 2PVMA 4NIFB 5D9HA 5AMNA 2JDOA 3ELJA 3DQWA 2IW9A 1J7IA 4XLVA 2C0TA 1FVRA 4O96A 4WNPA 1IA9A 3G6GA 2VWIA 3F5GA 4IB3A 3HYHA 5IDPA 3P86A 3EN6A 4HCVA 4I41A 3TZ8A 3FSKA 3LAUA 3SGCA 1J1CA 2PTKA 3HGKA 5HE0A 3TXOA 4YJOA 1URCA 2F49A 2YM3A 3FJQE 4XLIA 3IKAA 5AP6A 4DG0E 3M42A 4IAZA 4C3FA 1M2RA 3MVLA 4J8MA 4O0UA 4QRCA 4RJ5A 4YNOA 5KMIA 3OBJA 2GDOA 4JRNA 3DOGA 4KA3A 3DAKA 4WNOA 4NM3A 5CI7A 2OU7A 3UQFA 4FKJA 3A7IA 5HOAA 1YOMA 1SVGA 2XK4A 4XEYA 3ZZEA 4ZTMA 1H00A 2VTNA 4CMTA 2IZUA 3RWQA 4QQ5A 2ZDTA 3BI6A 3PXFA 4FTJA 4QOXA 5AM7A 3LVPA 4FIFA 2VWVA 3O23A 2ZDUA 5K9IA 4OBPA 5JRSA 3LCTA 3AC4A 2R0IA 5GJFA 4FYOA 5HG7A 4YZNA 1DS5A 4E4MA 2BRBA 4B6LA 3P23A 5IA2A 1SM2A 3HAMA 2W7XA 4JDJA 3PPZA 4LV8A 3ODYX 2PZIA 2SRCA 2XIXA 3PRFA 4QMLA 3EQDA 3LKMA 1VYWA 4A4XA 4AGDA 2J0IA 3NYVA 3HRFA 3I81A 1M14A 3GCSA 4FR4A 3DXPA 4K6ZA 4YZCA 4ORKA 4DGGA 1U4DA 3UNJA 2PMOX 3CD8A 4OTPA 4BBMA 2HY81 2W1HA 5IH5A 3FXZA 4KBKA 4DT8A 2XM9A 3O8PA 4X3FB 4FEQA 5AUWA 1Z5MA 3RAHA 5IDNA 4DFZE 4FEVA 4ZSGA 5KBQA 2WMAA 5AP4A 3NZ0A 4GFOA 2WZJA 3ZMMA 4CV8A 3LQ3A 4OGRA 5DG5A 3QUPA 3VO3A 3WIGA 4MXXA 4Y46A 3FPQA 5F94A 4OR5A 3BYOA 4MWHA 4AA0A 3E8NA 4GFMA 3R02A 2O8YA 1PHKA 3BPRA 4PMPA 4AN9A 4DITA 1KV1A 4NUSA 2Y8OA 5H9BA 4LGDA 5EKOA 3UQGA 4U0IA 2QLUA 1P4OA 4UYAA 3T3VA 4D2WA 2FO0A 2VUWA 3HVCA 4C7TA 4P2KA 3S3IA 1YW2A 4FODA 4QMTA 4QMVA 3LMIA 2BALA 4JR7A 1GOLA 3PP0A 3ZRMA 2VO0A 4FIIA 4YC3A 1PYXA 3E8DA 5IISA 4U40A 3Q5ZA 2CKQA 3O8UA 3TT0A 2G2FA 4ITJA 2HCKA 3NNWA 1LPUA 4RSSA 4LRJA 5GZAA 5CEMA 1GZNA 2JIIA 2OKRA 3LE6A 4EOOA 4EUUA 5JN2A 2XNGA 3V6RA 3UZRA 4ANNA 3KVWA 4I4FA 4F70A 1XH5A 4U79A 2WELA 3WBLA 2WMQA 4H39A 3VC4A 4EH6A 4CKRA 2W1CA 1H01A 4M13A 1REKA 4DH1A 3EQFA 1TVOA 4QNYA 4QYGA 1KE8A 3KXMA 3RI1A 3V5TA 5IUHA 1REJA 4FG9A 3TUBA 4IM0A 2ZV8A 4IX4A 3EN9A 3NLBA 3NUYA 2WHBA 5LCJA 4DC2A 3NUXA 3R8UA 2JDVA 4GCJA 1MRUA 3W8LA 4X0MA 4ZP5A 3R7VA 2OI4X 3PXZA 2UW7A 4D2VA 2XK6A 3C1XA 3MB6A 5AR4A 3M2WA 3SG9A 2QU5A 5D11A 3R9HA 3C4WA 3CPCA 2VWXA 3UG2A 5DA3A 3A4PA 3LFNA 3LFFA 2ETRA 1WBSA 3UPXA 2X81A 2GPHA 4IACA 1YI3A 3C9WA 4NM7A 3HRCA 4V05A 5F20A 5AUTA 1QPCA 3E63A 3DBFA 4G9RA 3MFSA 1JKSA 4KIKB 4O38A 4CYIA 3MESA 4K8AA 2X8IA 3HMMA 4OTQA 3R83A 2WTIA 2YM7A 2J0KA 5AADA 2JAMA 5AAGA 3VUMA 3NRMA 2UZVA 1Q3WA 1KV2A 2EB2A 4TXCA 4ACDA 3U55A 3Q6WA 4BRXA 4ZS4A 3T8OA 1JKTA 3L9PA 3CEKA 4G9CA 5FDPA 3IPHA 3VUDA 2EXEA 1HCKA 2OSCA 2PYWA 4Z7GA 3LFEA 3IK3A 4IIRA 2YZAA 3DU8A 2VWWA 2PZRA 3FLQA 5E8SA 3ZLSA 5HLWA 3GU4A 4F0IA 4AGUA 3C0HA 4FT7A 5T3QA 4E6DA 2CLXA 4HZSA 3KN5A 4EHVA 4O6EA 3DPKA 3GVUA 3E7OA 2OJIA 4BDAA 3DBDA 1XQZA 4NJ3A 2OIDA 5J95A 4AZSA 1H1WA 4W4VA 3FL4A 3W33A 3GU6A 3MH2A 4HYIA 3K3IA 1B39A 1LR4A 4BGQA 4S31A 4F7JA 4GT3A 3W8QA 3GU5A 3IW6A 4RRVA 3ZO2A 4DTBA 2QKWB 4DT9A 5AUUA 2UZUE 4IJ9A 3I7CA 4RJ7A 4UZHA 4WIHA 4YHJA 2QLQA 4PPBA 4WSYA 5CZHA 2WD1A 5JFWA 3CP9A 3P7AA 1XJDA 3KU2A 2YHVA 4C4FA 3ID6C 2XIRA 3NYXA 3MTLA 4J95A 5HNGA 2GS2A 4DH8A 4R5SA 2VWZA 1BKXA 2E2BA 5DVRA 3R22A 4FX3A 1Q8ZA 4AN2A 3VIDA 1WBPA 1YI4A 2DWBA 4NZWB 2HY0A 4BCNA 2WOTA 1PJKA 4RPVA 3EKNA 5CX9A 3AT4A 5ANEA 4JBOA 2A19B 4UXQA 5EK7A 5HO7A 5EDPA 4CTBA 1V0BA 5FTGA 3A7HA 3DGKA 1Q8YA 3H10A 3SRVB 5J79A 5TE0A 4CFVA 4A4LA 3W18A 4QPAA 3QTQA 3TUCA 5C4KA 4EK4A 4R1VA 2IVTA 5M44A 2C47A 4TWCA 3C0GA 4BWPA 5CAOA 5HTCA 4GUBA 4FZ7A 3HEGA 3WF7A 4YJRA 4B99A 4EEVA 4EK8A 5EKNA 4LYNA 2GS6A 3E5AA 2ITQA 3JVRA 3MFUA 4HGSA 2R4BA 4YNEA 4IAFA 4GYGA 4BHZA 4GU9A 2XIKA 3UVQA 3FZ1A 5BVNA 3PJ8A 2BZJA 3WZDA 4BI2A 4O7VA 5BYLA 1BLXA 3ZONA 2R3KA 5FDXA 2R5TA 3GT8A 5EHYA 4TT7A 2GQSA 4CFWA 1KE5A 3F9NA 4RWKA 4J1RA 3I79A 3ORLA 5GZ8A 2GHGA 1NY3A 3R1YA 4BZOA 4G34A 3NVMB 5AR3A 4M15A 4FEWA 4NW6A 1WFCA 3LJ2A 4RMZA 4QP9A 5JK3A 3HAVA 2W4KA 4LRMA 3R9OA 3QBNA 3WF6A 4DEDA 1KE6A 3R2BA 4U44A 4APCA 4CKIA 5TO8A 4JIKA 2VTSA 2R3FA 2QI8A 3ZXZA 3RHXA 5HICA 3DXNA 4J52A 2Z8CA 2PUIA 3QRKA 4FZFB 2W9FB 1KOBA 3EB0A 2BHHA 1J3HA 4UYNA 4BCKA 3OCSA 3QQHA 4FV9A 2W06A 4MD9E 2GFCA 5M08A 3CPBA 2ITTA 4Y95A 4DFBA 3QD2B 5CF8A 4X2KA 4F7NA 4IM2A 2ZMDA 4Z55A 2I0YA 3W2SA 3KXNA 2BAQA 2EB3A 5I9YA 4XG9A 2RL5A 3HV6A 5G1XA 2HOGA 5CQUA 4ZLZA 3OMVA 5AP2A 4AU8A 1LUFA 1VZOA 3CS9A 4E6QA 5KHWA 5DT4A 3FLZA 4YLLA 4O84A 4ZSEA 3PSDA 1SYKA 1M7QA 2IZTA 4AAAA 4EKKA 3VAPA 3MVJA 4E1ZA 3NYNA 2CGXA 3SX9A 5HO6A 4H3PA 3KULB 4NT4A 4IWOA 4QTBA 4CRLA 5B0XA 4EOSA 5LMBA 3S1HA 3ALOA 4EH2A 4D1XA 1FMOE 4DG3E 3ANRA 4E4NA 1YHVA 4L3JA 3EIDA 4L7SA 3NUPA 2VWYA 4ZSJA 1Z57A 4BYJA 4C4HA 5AX3A 5EYCA 4F9WA 2KTYA 3GBZA 3NNVA 2UW8A 3QA8A 5AP0A 4FV5A 2QOQA 5AUYA 1DI8A 1O6LA 3R63A 3S4QA 4FV0A 4X3FC 4A7CA 4ZTHA 3Q60A 3FC1X 4RQVA 4AZTA 4C8BA 3Q04A 4K9YA 4F6UA 4FVPA 3O2MA 1MQBA 3SW4A 4BYIA 3JXWA 4O6LA 3VUHA 2WNTA 1YXSA 2O64A 5AR7A 1WBOA 2CCIA 3HMIA 3ZO4A 1ATPE 3PIYA 1OKYA 3LM0A 3N51A 4DINA 2BCJA 4MXZA 4FBXA 5KO1A 4WNKA 2O63A 4TN6A 5I9XA 3FWQA 4QYEA 5T6KA 3Q2JA 3LQ8A 4IVAA 3A7FA 2Q0BA 5CU3A 5BYZA 4YURA 4V01A 2CNVA 3OWLA 1J91A 4QMYA 5L6PA 5AAFA 3KREA 4GFGA 3FQSA 3F66A 4G17A 3G0EA 4B9DA 4IFGA 2WEIA 3O0GA 3PPKA 4C0TA 3SVVA 2YCFA 2DYLA 3NUNA 4DEEA 3V5JA 1PXKA 4ANOA 4CXAA 3V8SA 3O17A 4FF8A 2J2IB 4I20A 4RFYA 4YPSA 3A2CA 4BWKA 4A07A 4FSNA 4X2NA 5AAEA 4NCTA 3BHTA 3BE2A 4YHTA 3FZPA 1K3AA 4FKIA 4OT6A 4YLJA 3TNWA 2BZIB 3MBLA 3PVWA 3LZBA 2JITA 5IA4A 2J0LA 4F9AA 1TQIA 5M4CA 2YABA 4CT1A 4GJ2A 4IVBA 4P5QA 2WQEA 3FKLA 4ZZNA 3FBVA 3CGFA 1BX6A 4R5YA 3RCJA 3L9NA 1SVEA 4ANQA 5EW3A 4I1ZA 4P7EA 3C4XA 3W2CA 3GUBA 3KF7A 3GCPA 3OTVA 3JY9A 4O0XA 4P4CA 5CEPA 5DWRA 3WF8A 3PY3A 2RFNA 4AG8A 2XKFA 3A8WA 3TJCA 2JDSA 3PY1A 2OLCA 3OUKA 2HW7A 5HQ0A 2YISA 4J53A 3KFAA 3RNIA 2ZM4A 3HNGA 3LFCA 3FMKA 1JVPP 3D5WA 2OK1A 3RZBA 4FTQA 1RQQA 4S30A 2B53A 4E5AX 4JG8A 3PSCA 4ZY4A 4G5JA 4I5PA 4LGGA 5I3OA 3ZU7A 4HGTA 5E1SA 3QZFA 2WMVA 4KWPA 2UW9A 5CQWA 4BGGA 4LUEA 4RZVA 3POOA 1XO2B 5F95A 1SNUA 3DBCA 4FV4A 4AA5A 1OL7A 2XVDA 5JEBA 3A99A 3KN6A 2X2MA 3R7OA 2YA9A 4W9WA 3QWJA 4TYJA 4ZLYA 4FTNA 3W2RA 3D4QA 2CSNA 3BYVA 4GG7A 3V5WA 2PZPA 1YVJA 3BKBA 3V51A 4MXCA 5K4IA 4EH5A 2VO6A 4XOYA 1STCE 5EHOA 4QMWA 4ASZA 3LJ0A 4FTAA 3QZGA 1Q4LA 4S34A 4LOOA 1OKZA 5CF5A 3VS7A 3ULIA 3UZPA 2ITUA 2R2PA 3VQHA 5KX8A 3OY1A 3T3UA 2JGZA 3VN9A 3LQ5A 4N6YA 3I6UA 4BGHA 4XOZA 5BVFA 2J4ZA 5A54A 2B54A 2W99B 2HZ0A 4MBJA 4IZ5A 4W4XA 3RWPA 4FZAB 3KC3A 5BVDA 4O7SA 4MKCA 2XF0A 2F9GA 2NRYA 4O0RA 1ZMVA 5CI6A 4R6VA 5JQ5A 2JBOA 3PA4A 3ORXA 5TT7A 5KMNA 2WO6A 2X8DA 3MH1A 1IG1A 5BNJA 4BKYA 4FSMA 3W10A 4DTAA 4PF4A 4FTLA 4LL5A 2Y4PA 1GZOA 4W9XA 4XHKB 3VS5A 4MTAA 4C2WA 5FM2A 2FA2A 4MH7A 2PVYA 3TNPC 5AV4A 4ZK5A 4HNFA 4I0TA 5D1JA 4PMSA 3UDBA 4JX7A 2QODA 4WRGA 4TYEA 3BBTB 2LAVA 2W5HA 3R8PA 3ZBXA 4BR3A 3A61A 4G31A 3HV4A 3IW5A 3DFAA 3C0IA 4BCQA 3JUHA 4YTCA 4I92A 3D0EA 3D5XA 3H4JA 2BR1A 2VO3A 2VTTA 3BU6A 4YBJA 5DR2A 4ANSA 3UODA 1R3CA 2OW3A 3DAJA 4YC6A 4RZWA 5JZNA 4C62A 1PXNA 3N4VA 5DR9A 3BYMA 5I9VA 4KBAA 2WIPA 2R7IA 4YC8A 4M0ZA 4BDCA 1UVRA 4JG6A 4F6SA 4NIFA 3ATTA 1FMKA 3LPBA 5AIKA 2IVSA 2P3GX 4K0YA 2YACA 4E20A 1ZLTA 3QZIA 2ITNA 1NVRA 2R3GA 1A48A 3F69A 2WPAA 2Z2WA 5AUXA 5B7VA 3LCOA 1NT2A 4EJ7A 2QOHA 3QXPA 3E92A 4TY1A 4E3CA 3AGLA 4JQ8A 4AP7A 1OI9A 2W5BA 3MY1A 3DNDA 2XCHA 2P55A 3R71A 4HVSA 1H4LA 3PWDA 2HELA 1IASA 3QZHA 5AFVA 1PMEA 4AZVA 4F99A 2UZLA 5FTOA 5AP7A 4RA5A 3SOCA 3CTQA 3I1AA 1FQ1B 5DMZA 3LIJA 2RFEA 3ZUUA 4CT2A 4EQCA 4LV5A 5JFVA 4C35A 3K54A 1B6CB 2C5NA 3FY0A 1DAYA 2R3HA 3SDJA 4F7SA 5L6OA 3BV3A 1VYZA 4TWPA 3TTJA 5K5XA 5ETCA 3VS2A 5KUPA 2YM5A 2YLEA 3ZH8A 3QCQA 5CU6A 4H36A 4DBXA 1F3MC 2QOBA 1M17A 3OXZA 5IUIA 2XNPA 2YAKA 4O91A 4IW0A 2O0UA 1P14A 2FSLX 1OIRA 3CBLA 4ACMA 4D5HA 5B2LA 4IEBA 4NJDA 5L2QA 3G51A 4G6OA 5M53A 3FL5A 3HDNA 3LW0A 4BHNA 4KS7A 5A46A 1IRKA 3OVVA 3NIZA 4MQ1A 4IH8A 3MIYA 2JEDA 4ITHA 4EOQA 3PG3A 5HTBA 2C6LA 2Z7SA 4I0SA 4HGEA 5J8IA 4O83A 4KS8A 3WARA 3RZFA 4L42A 1OVEA 3FMLA 1VJYA 3BRBA 3NUAA 3E3BX 1L3RE 2VV9A 3O7LD 3Q9WA 4BB4A 4F65A 1QPJA 2HXLA 3EFKA 3UNZA 3QC9A 3FDNA 4AFEA 4LRKA 4FSZA 4AT4A 3R7IA 1ZYDA 4CTCA 4GJ3A 4E6AA 5L3AA 4E26A 2ESMA 3G33A 4JAIA 1FBNA 4FTMA 2GHLA 2WAJA 5BUJA 2PULA 5EQPA 5AV3A 4IDTA 2GNJA 1G8AA 2Y4IC 5AEPA 1J7UA 1Q62A 4R1YA 2X0GA 1FPUA 5K3YA 4GKHA 3HV7A 4IX3A 4UMQA 4XS2A 4E8AA 2YWVA 4FEXA 3COKA 1E9HA 2XEYA 4E7WA 2ZAZA 5LXMA 2OZOA 3V8WA 4ID7A 4J97A 2C3LA 2VTOA 3HUCA 2A2AA 4PP9A 4GT4A 5C26A 1U59A 2VNYA 3A62A 5DEWA 4LG4A 5DYJA 4A9SA 3MA6A 3HMPA 3BYUA 2ERKA 3OBGA 3LFDA 3JPVA 3FMNA 2QC6A 4C2VA 5LVOA 3TUDA 1CSNA 4E73A 2V55A 4ZXTA 2BRGA 4UMUA 2J50A 5AR8A 1JBPE 2J7TA 2FUMA 4W4YA 3UP7A 2Z02A 1UNHA 3EQBA 5CU0A 3FLNC 4PRJA 3LM5A 2BVAA 2X2KA 4AT3A 2YWPA 3LOKA 3GQIA 2J5EA 2V7OA 3NYOA 3R7GA 4GK3A 3TKUA 2C1AA 1H1RA 4OTRA 4AUAA 1IA8A 4CZTA 4Y8DA 4I4EA 3N4UA 5CEQA 4U6RA 4EQMA 3QYZA 1IR3A 2CJMA 1GNGA 3RK7A 4GRBA 4GEOA 1R78A 3D9VA 5ANIA 2VD5A 2IW6A 4CSVA 2FSMX 5BUEA 1QPEA 3TTIA 2ITZA 5AJQA 4ARKA 1OL6A 3OD6X 4WRSA 5C4LA 3FI3A 1O6YA 5HKMA 4IB0A 5DOSA 2QOLA 1W84A 3BV2A 4KB8A 4XYFA 5HIBA 4G3DA 4QMUA 4IVCA 3R6XA 1JLUE 3FQEA 1JWHA 2I0EA 4C57A 2FSTX 2X1NA 4U81A 3HZTA 3DA6A 5J9LA 3AXWA 4J7BA 4RIXA 1S9IA 2GNIA 1XHAA 3PVGA 5FRIA 5HCZA 4TL0A 4PL5A 4RIYA 4BBFA 3KEXA 2UW0A 4EH3A 1F5QA 3S2PA 3W55A 4AZWA 2F2UA 3MFTA 1YWVA 4U41A 4V04A 4EOJA 3MJ1A 2AUHA 2AC5A 3L9MA 1B38A 5HHWA 1WMKA 5CSXA 1XWSA 4FMQA 3VS1A 2I6LA 5DPVA 3E7VA 5HU9A 4CQEA 4DTKA 3EZRA 3FLSA 4PQNA 2XRUA 3FE3A 2C5YA 4BDKA 3DB8A 2UZTA 4DGLC 4UMPA 1Q8WA 4X2FA 3VWAA 2ZMCA 5C8KA 2GQRA 4MYGA 5DNRA 5A3XA 2QKRA 3U87A 4KRDA 4USDA 3KMMA 4MBLA 5AA8A 3U4WA 4O7ZA 5AM6A 2C1BA 2E9UA 2XKCA 3R7UA 3VVHA 4AA4A 4MF1A 4S2ZA 3P0MA 3PY0A 3NMUF 4Y83A 3V3VA 4KD1A 2HWPA 2WQBA 4OTWA 4F09A 4M3QA 1J7LA 1Q8UA 4HW7A 2WQMA 3OFMA 5DLSA 3HP2A 5CSVA 2WQOA 2QR8A 3FI4A 5IQIA 1DAWA 3JY0A 2IVUA 2GHMA 3FI2A 3F5XA 4PMMA 5HVJA 5CU4A 3CCNA 3GC8A 3OUNB 5AUVA 3ACJA 4JOAA 4EHGA 2YIYA 3C4ZA 5HU3A 3BLQA 3V8TA 5DT0A 3VJOA 3BGQA 5A9UA 1K2PA 2JKKA 2RIOA 4AE6A 4G3CA 4NWMA 5D7VA 3HV3A 3KK8A 4IZYA 5EI6A 3QQFA 5IQBA 2JKOA 4TPTA 4BFMA 2XJ1A 3MFRA 3U6JA 1WAKA 3N4TA 3G6HA 2W17A 3PYYA 4BTMA 4PTEA 4EK5A 1OKWA 5E8XA 5HVYA 4DEGA 4FT9A 5DIAA 5LVPA 2YCSA 3P79A 4EORA 4OTDA 3RINA 3QHRA 5L2WA 4XH6A 4MAOA 2PUUA 2YIWA 2J90A 3TDWA 4CFNA 2W1GA 4YBKA 4L52A 4QMSA 3QGYA 2YCRA 1H1SA 3PG1A 4RIWB 3QCXA 3C5IA 4XP0A 4WBOA 4R7IA 4EC9A 4FOBA 2UW4A 4KINA 5E8ZA 4I6FA 1URWA 4JQ7A 3NUSA 3QTUA 4NTTA 1Z9XA 2WTKB 4JX3A 3QD4A 3GOKA 1XBCA 4PUZA 5DH3A 2BTSA 2YEXA 4E5WA 4OTIA 5EM5A 3HUBA 4HYHA 3UE4A 3FQHA 1G5SA 1IAJA 3DDPA 3CKXA 4AW5A 1OBGA 4FT5A 2YITA 3T9TA 3LMHA 3UO5A 4EYMA 2OJGA 3FZOA 3NCZA 1G3NA 2I1MA 3I60A 2OO8X 5ITAA 4QTAA 4DCAA 3ZO3A 4D0XA 4NH1A 3TV4A 4DLJA 2BKKA 5CVHA 5JGBA 3SKCA 1NVQA 5ANKA 3GCQA 3FKNA 3EYHA 3MH0A 3BHHA 1XKKA 5AWMA 2WMUA 5A6OA 4GU6A 2C0OA 4CFFA 3C4CA 3R01A 5FBOA 4BCJA 2XMYA 3UYTA 5I5ZA 5DEYA 3KK9A 4AQCA 3ORZA 2E9OA 3VF8A 4GW8A 3IG7A 1X8BA 5CS6A 4FKVA 4EZ3A 5AUZA 1ZYSA 4V0GB 2QO9A 1JSTA 3HLLA 2G2HA 3IDBA 4A9RA 1M2QA 1Y57A 2OICA 2VRXA 4QP1A 4XG4A 5GJGA 5CVGA 2UV2A 5FXSA 4CLIA 4RC4A 3WZKA 5CAVA 4NL0A 3AD5A 2OZAA 3IO7A 2F2CB 1YXXA 2IJMA 4IM3A 3QF9A 4CKJA 4YGAA 1E1VA 4O0SA 5GNKA 3ZDUA 3FMDA 2EVAA 3C4EA 4NFNA 3ZC6A 2JC6A 1QCFA 2WMTA 1JSUA 1YHWA 3UIXA 3RBWA 3AT3A 4MVFA 4IWPA 3R28A 3AMAA 4FTKA 4IX6A 4JDIA 3R00A 3SRVA 3D94A 3F7ZA 4FZDB 5B2KA 2QNJA 3DK6A 2G01A 2C3JA 4FI1A 5AX9A 3VJNA 3D2IA 4EC8A 4R7HA 2WMSA 5AR5A 3D7ZA 3W2PA 2XB7A 3TNQB 3MN3A 1LEZA 3IS5A 2IWIA 3MYGA 4FGBA 2C3IB 3Q9ZA 1H1PA 4ZS0A 2QOCA 5IH6A 3OY3A 4ZTLA 5HVKA 2VX3A 4IX5A 4YR8A 4D0WA 4MQ2A 5IQGA 1ZOHA 4U3ZA 3EJ1A 4D2RA 3CSVA 2OG8A 3OXTA 4WG4A 5BVWA 4FVQA 5L4QA 4N57A 3GCVA 3H9RA 4D28A 4FNZA 4RX7A 3PWYA 2A27A 2F57A 3UOJA 2X7OA 5EQYA 2B9FA 1FOTA 2C69A 2PVJA 3FMEA 3M1SA 3K2LA 5EDQA 4R78A 3NAYA 3PIXA 3SLSA 3FMJA 4EK6A 5JFSA 3JYAA 2E9NA 3GB2A 1M2PA 5J1VA 2UW5A 1UKIA 2WTWA 3P5KA 3ZDIA 3O71A 4IAYA 4HVGA 4NK9A 4I5MA 2G15A 3KL8A 4D9TA 4YTFA 2R64A 2CGVA 3DAEA 2JD5A 4FV1A 4O1PA 5E7RA 3VW8A 4HVIA 4YMJA 3PLAE 1WBNA 2BDFA 4Z16A 5IPJA 3IDPA 3F3WA 3KQ7A 3UMXA 2YN8A 3Q52A 5CVFA 3AOXA 2I7QA 4DYMA 4I5HA 3B2TA 3IOPA 4ZJJA 4ALWA 3U6IA 3RPRA 4YJTA 2WU7A 2RG6A 1ZWSA 3A7GA 3QYWA 3HMOA 3TIZA 5CASA 5KZ0A 1PYEA 5IA1A 4ASDA 3T9IA 4I6HA 3LXPA 5JRQA 4QMPA 4XNEA 4K11A 5JT2A 2QO7A 4PL4A 2RG5A 2X7GA 4R3PA 3AMBA 4GG5A 3RCDA 2PK9A 3R0TA 4MEDA 2QOOA 4QTDA 4YO4A 5D41A 4I6QA 1V0OA 3FYJX 3UG1A 1OL5A 2FB8A 5CEKA 1H28A 1YKRA 5L2IA 1UA2A 4FSQA 2IZSA 3FAAA 2C68A 3ETAA 3QUDA 5KKRB 3ZHPC 2RSVA 3CY3A 4FSRA 4X2JA 5ACBC 3W2QA 5IQAA 4DFYA 3TZ7A 3HMNA 2C4GA 2NPQA 4C02A 1BL6A 3VUKA 1UV5A 1Q3DA 3SAYA 5BMSA 3MVMA 3TZ9A 3VULA 3C7QA 2UW3A 4LI5A 4LL0A 2BMCA 3MV5A 3Q5IA 1YXVA 2DQ7X 2JLDA 4H1JA 5BVEA 3U54A 3CGOA 3ACKA 3P4KA 4C4JA 4RFZA 4M8TA 5IF1A 4JJRA 4GV1A 4N4SA 5C9CA 3KRRA 4WOVA 3VQUA 4A06A 2XIZA 4Z7HA 5E8TA 4N0SA 2ZM3A 5KMOA 2BPMA 2DUVA 4EOPA 3F3UA 4CGAA 3NNXA 2CKPA 5EYMA 5LWNA 3IGGA 4JVGA 4FEUA 3RM6A 3N9XA 3G9LX 5L8LA 4RLLA 4FTUA 3R9RA 3IONA 4YJVA 2W5AA 3U6HA 2UVYA 2QHMA 5J87A 4WG5A 3NDMA 3GGFA 4L00A 4MXAA 5HI2A 3ORNA 3ZTXA 3D15A 1XH9A 3RMFA 3VHEA 3IECA 2CGUA 3HA6A 3TI1A 2ITXA 4FVRA 3QU0A 4JL9A 3UQCA 2GNHA 3AMYA 3RVGA 1AQ1A 3F82A 2EXCX 1OUKA 1W8CA 5G6VA 3E62A 2PL0A 4I93A 3CTJA 4MWIA 4C37A 3CE3A 4DGOA 3C51A 3RK9A 4QP6A 4BTJA 4IZAA 1S9JA 1U5RA 3IW7A 3UO6A 1JQHA 3ZM9A 3DBQA 4ZZOA 3PE2A 3SD0A 1H08A 4D2PA 4W8DA 1P5EA 3ORMA 4OLIA 5HCYA 3PVUA 2PZYA 3QTWA 4CFMA 4ONAA 5IZFA 3TWJA 2NP8A 4HPTE 2W05A 4JBVA 4QT1A 4C4IA 4I24A 2X6DA 4NW5A 4YJSA 3H9OA 4E5BA 1FINA 3HECA 4EWQA 1M7NA 4Q2AA 4UBAA 4ACCA 4DN5A 4DCEA 3DCVA 5CANA 3UPZA 1ZXEA 2J5FA 2Z7RA 3BYSA 4O2ZA 4FKLA 5EI2A 2R7BA 2YDIA 3RAIA 3E64A 2XP2A 4EHZA 4PNKA 3S0OA 3F7WA 4PWNA 2HZ4A 4WUAA 2EUFB 5EW9A 4CCUA 3F61A 2W1ZA 2W9ZB 4M69B 4QMXA 4XG7A 2R0UA 5IEXA 2PE0A 2WGJA 1YDSE 5FLFA 3ZRKA 4CFXA 4MK0A 5FBNC 4E4LA 2BRNA 4HNIA 4DFXE 2O2UA 4GVJA 1ZY5A 3OCGA 4AW2A 3OCTA 4CCBA 1YHSA 2PUNA 4BIEA 3DZOA 5HE2A 3QXOA 4D58A 4OAVB 3R8MA 2PHKA 2XEZA 4X7QA 3ZO1A 4ALUA 2R3OA 4TRLA 2UZDA 5HIDA 4O81A 1Y8YA 4IE9A 5IQFA 4I94A 4U9AA 3BZ3A 3FZSA 3TM0A 3UNKA 5HO8A 2XA4A 1CKIA 4ENXA 4HYUA 2ACXA 4ZJVA 4A9TA 3THBA 4II5A 4RJ8A 4NKSA 4RGJA 5KMMA 5JH6A 2ZYBA 4O0TA 4GH2A 5DE2A 5KBRA 4WHZA 3G2FA 1OB3A 4FKUA 4FKTA 4U45A 3W1FA 3H0ZA 2CPKE 4BDGA 4BCFA 5EI8A 4C59A 5ANDA 4ZZMA 3FC2A 3DFCB 4M97A 5KMJA 5J9ZA 4HZRA 1XBAA 3FUPA 4TTHB 4U80A 4GVAA 4BIBA 3FEGA 2VTRA 5AIRA 5CT7A 3NX8A 3WZEA 4FSYA 3F3ZA 3F5PA 3MY5A 3PFQA 3VBTA 4KSQA 3FXWA 1O9UA 3KCKA 3PSBA 3PXRA 3QCYA 2F7ZE 5AV0A 5IUGA 5E90A 3VBXA 3R9DA 3Q6UA 2VTMA 1E1XA 3DB6A 3BQCA 3ODZX 5E8UA 4BL1A 1CMKE 1BI7A 3DJ7A 3AGMA 4MNFA 4X6RA 2JDTA 5JZJA 4R77A 1MUOA 1OPLA 1SZMA 3HDMA 3R04A 4QP2A 2CNQA 3FYKX 3QLGA 1SNXA 3DT1A 1P4FA 4TKSA 4JBPA 4JT3A 4AE9A 2ZB1A 3EL7A 4RVMA 2C3KA 3HP5A 3LMGA 3VRYA 4L46A 4QP8A 5IKWA 2VNWA 4XRJA 5TR6A 1M52A 5IQEA 2VN9A 4XG8A 3UIBA 3VBVA 4ZAUA 4NTSA 3KMWA 2WEVA 4FIJA 4YJPA 4BTKA 2EWAA 3QWKA 4RC3A 4FSWA 3EN5A 2GTMA 3O7LB 3OC1A 3Q4UA 2QG5A 3ZBFA 4LFIA 4BZNA 4WKQA 5M06A 2W1FA 4D4SA 4OT5A 3EQCA 3U9CA 2QHNA 3NVKI 3CIKA 4EYJA 3GC9A 4JR3A 4RA4A 1MRYA 1BI8A 3QKKA 2CN5A 5K4JA 5K0XA 5JFXA 1DM2A 4NCTC 4U43A 3I5NA 5FQDC 3BELA 3IDCA 3JVSA 3WZJA 1PY5A 2YCQA 4QMNA 4ZMEA 3ALNA 4BKJA 2IZRA 2NNWB 1AD5A 3NAXA 4TWNA 2PUPA 4FV8A 3DQXA 1UU8A 5CSHA 2C6IA 5CENA 3HA8A 2PY3A 3OWJA 2I0VA 3PJ2A 3B8RA 4DGMA 4FKGA 3QX2A 5HG5A 5ACKA 2GNGA 4DBNA 3EQPA 1KOAA 3D83A 4XP3A 3ITZA 1BUHA 2HW6A 3P78A 2JBPA 2JFMA 3KB7A 3ZFMA 4O7RA 4FGRA 4FKRA 3ZLYA 2YJSA 5CEIA 5FXRA 3DV3A 3MA3A 4MXYA 3QLFA 3BBWA 2XM8A 3LXLA 2VGPA 3VUIA 2X2LA 4I22A 4EQUA 4YO6A 5KE0A 5C8NA 3NGAA 3PJCA 3IW8A 1NA7A 3QL8A 4MD7E 4JAJA 2REIA 2X8EA 3EYGA 1UWHA 3QTZA 3PLSA 1H24A 4RG0A 1GIHA 4PDOA 3O8TA 3HL7A 2XNNA 4KKEA 4B0GA 1XH4A 3U51A 5AA9A 1APME 2GFSA 4FUXA 4O27B 2E9VA 4DF3A 3KKVA 5E9EA 3L8VA 1H07A 2W4JA 1PW2A 3HV5A 1L8TA 4OUCA 4YHFA 2OBJA 2RFDA 4J8NA 4HVDA 2B7AA 3BCEA 3E93A 4IC8A 5HIEA 5HLNA 1GAGA 4IB1A 2CN8A 4I5CA 3AT2A 3OROA 2CHLA 3EQGA 4E6CA 3LFQA 3QFVA 2VGOA 5BMMA 3U9NA 3VS3A 3ZM4A 5IU2A 4UN0C 4NM0A 1PMVA 4IDVA 4QYFA 3ZSHA 3IGOA 3D5UA 4MF0A 3SG8A 4ZY6A 2QOFA 3UVRA 1PF8A 5IH4A 4A9YA 4M84A 3L8SA 3TV6A 2BIYA 3PJ1A 4XV9A 5J9YA 1DI9A 1OUYA 5L8JA 4OTFA 2OJJA 2ZB0A 2YLFA 4PTGA 2V7AA 4IWDA 5DGZA 4CNHA 2IG7A 3R7EA 1Q41A 4RIYB 1WZYA 1FGIA 1OL2A 1YDTE 1Q61A 2JKMA 2J0MB 3F6XA 3OOGA 4WNMA 3DKOA 2BFYA 2R3IA 3RGFA 4O21A 4YSJA 4QYHA 4NFMA 4F9CA 2JFLA 4FL3A 2J9MA 3BEAA 1FVTA 4QPMA 3BU5A 4QYYA 3RKBA 4C61A 5E92A 3VNTA 5IEVA 4UZDA 3MSSA 4C33A 4J71A 2IO6A 4G3EA 1WVYA 2HYYA 2QG7A 3I0OA 5DRDA 4KRCA 2F7EE 1GIIA 1PKGA 1OL1A 3ENHA 3LLTA 4ITIA 3D2KA 4XBRA 5J1WA 1RDQE 4IZ7A 4CZYB 4Y5QA 3FY2A 2XNBA 4QP4A 4Y73A 4EH9A 5D12A 4F6WA 4TWOA 4UWCA 4GIHA 4I6BA 3KULA 3UIUA 4FKWA 2HXQA 2ITOA 4QMZA 4O82A 4A9UA 3ZFXA 1YOLA 2OXDA 3FV8A 5LMKC 1QL6A 5BPYA 4AT5A 2OFVA 3WE8A 3NNUA 3VBQA 4BICA 1U46A 3FXXA 2XBAA 4L3LA 5IG1A 4YTIA 3GC7A 3FSFA 5FXQA 2GS7A 5M4UA 4YJNA 5DI1A 3VS0A 3KRJA 2XKEA 2FSOX 3BGPA 4QTCA 4QNAA 4X3FA 5K0KA 2CCHA 3CXWA 2A1AB 1QMZA 2YFXA 3DXQA 3MI9A 3OOMA 2A4LA 4J99A 4LMNA 3WI6A 4L67A 3D7TB 2B9HA 4G3GA 3F5UA 5F1ZA 2B4SB 5EM6A 4DE4A 5EH0A 3POZA 2X7FA 2X39A 3WYYA 4EUTA 3ORTA 2W0JA 5LVMA 4AACA 4RVLA 2UZOA 1ZYCA 1VR2A 3QD0A 5A4CA 4LGHA 3AC8A 3W16A 3QQGA 3ZOSA 4G6NA 2QQ7A 3LFSA 4FKSA 1UKHA 2HZNA 4EBVA 3QKMA 5AV2A 3DBEA 4AZFA 5EM7A 3H0YA 1ZAOA 2HIWA 4NEUA 1XH6A 2W1IA 2YERA 2YM8A 5EYDA 2WMWA 1KE9A 2B52A 3U8WA 3ORIA 4G5PA 3R7YA 3PA3A 4RLKA 2YAAA 3WILA 4O86A 1YRPA 3AC5A 5BVOA 3FZRA 2XBJA 3L9LA 3HKOA 4RC2A 4DFNA 5CSPA 4EH4A 2R3PA 2G1TA 3UVPA 1YXUA 5HX6A 4O0WA 3ZSIA 4FV6A 4KKGA 5KZIA 4DAWA 4IBMA 4XG3A 2BILB 3L1SA 4FG7A 3KGAA 4NM5A 4L7FA 5E8WA 2LGCA 4YZBA 3SQQA 3ULZA 3BGZA 4R3RA 3PXQA 1JNKA 4IXPA 3V01A 5JQ8A 4CG8A 4FKPA 1BMKA 4KIQA 3GENA 5CY3A 4Z9LA 4FK3A 4UWBA 5ETFA 5C8MA 4N70A 2VTPA 3EMGA 2PWLA 4O7YA 3DKGA 3QKLA 3Q4ZA 4P5ZA 4MBIA 3SHEA 3UTOA 1Q5KA 3A4OX 2QR7A 3RK5A 1HOWA 2YIRA 4EL9A 4YZDA 2R3QA 3TCPA 4OBQA 4U97A 5C03A 3LFAA 2GNFA 2BAKA 4O0YA 3SV0A 3GU7A 5CF4A 3TL8A 5ANGA 2P0CA 2W1EA 1GIJA 5HGIA 4PX6A 3NW6A 2YZLA 5IQDA 3CR0A 2W4OA 4BCOA 4PDPA 3ZLWA 3S95A 3PVBA 4DFLA 3E3PA 4PV0A 2BAJA 3TACA 3PXKA 4ANLA 2WXVA 2XIYA 5CTPA 2Z7LA 4CLJA 3KRWA 3UZTA 4EZ5A 3A8XA 2V0DA 2OH4A 3P1AA 4USFA 3P7CA 1OMWA 5A6NA 1ZMUA 5AP3A 3IW4A 3Q53A 4D2TA 4LMUA 4F64A 4PNIA 4EOKA 4RVKA 4ZTSA 3G15A 2YIXA 4H3BA 3MVHA 2EXMA 2VZ6A 5HNIX 5KKRC 3Q96A 2YIQA 4G6LA 3KY2A 3ZS5A 4PPAA 4BDBA 2OGVA 1OIUA 4ENYA 2UW6A 2CNUA 2R3JA 5A4TA 3MGYA 2BKZA 4JS8A 1IEPA 3SC1A 3EL8A 4G3FA 4JIAA 4QQCA 4D1SA 3RHKA 5DBXA 2PMIA 4HCTA 3K5VA 5ETIA 3FMMA 3GFWA 5M55A 4EKLA 2I40A 4RX9A 5AR2A 4F1OA 4IFCA 3UBDA 4TYHB 3GCUA 1H25A 1UU3A 4GUEA 4BF2A 4BN1A 4H3QA 5CWZA 4KSPA 4RQKA 3KXHA 4GIIA 4K2RA 2CKOA 4D4YA 2FGIA 5FEEA 3UOLA 4CYJA 4DHFA 4O7TA 4IJPA 4ASEA 4HVHA 4L8MA 1G8SA 5I9ZA 2Z7QA 1YI6A 2QVSE 5CU2A 2QURA 5HBHA 1H1QA 3V5QA 3QA0A 4FL2A 2GNLA 5HE1A 4RX5A 4FG8A 1GZKA 2VTAA 2FYSA 1PXLA 3I5ZA 3PZEA 4JI9A 4RBLA 4BZDA 1J1BA 2VTIA 4A4OA 2JAVA 5FWKK 4F4PA 1ZRZA 2BTRA 3GI3A 2YJRA 5LVLA 3QHWA 4NKAA 3R30A 4CZUA 3ZLXA 1JAMA 1W7HA 3QRUA 2X4ZA 2R3NA 3BWJA 5KMKA 5ETAA 4YLKA 4MD8E 3UIMA 4FV3A 2OZAB 3E8EA 5KNJA 5HG8A 3AD6A 5L6WL 3U4UA 5CAPA 3WZUA 4QO9A 4UEUA 1XH7A 3NW5A 1LP4A 2CKEA 1KWPA 5GZ9A 3QX4A 3KRXA 5EYKA 4GK2A 3BWFA 3UYSA 2E9PA 2UVXA 3EN7A 4K33A 5FP6A 5IA0A 1GY3A 4O22A 4M68A 3OEZA 4IMYA 3V5PA 2VU3A 5ANOA 3SOAA 5HBJA 3QCSA 4J96A 2PVLA 3G0FA 4NU1A 1PXMA 4WO5A 3V6SA 2VO7A 2C0IA 3UJGA 3ZRLA 2PVNA 4TW9A 4UMRA 3BEGA 5AP1A 3ZEPA 1R0EA 3LCKA 4KABA 5M07A 3G90X 2C6TA 3H3CA 3QGWA 5CXZA 4EOLA 3MPTA 4APPA 3MS9A 4GYIA 3RM7A 3GU8A 3WIKA 2YDJA 4FZ6A 4CEGA 3P9JA 4IADA 1PMUA 4F1MA 1LEWA 3C50A 3MIAA 4EZ7A 1WVXA 2F4JA 2QD9A 2GSFA 1H26A 4AGCA 3Q2MA 4FA2A 2J0JA 3C13A 2VTJA 3JS2A 5H8EA 4JG7A 3DJ6A 1JSVA 4KUJA 4RFMA 1RE8A 4D55A 3F3TA 1OPJA 2PVFA 3R9NA 4FTRA 4BTFA 4M0YA 1MRVA 5M56A 2GCDA 4BDFA 1JKKA 2G9XA 4LM5A 4LUDA 3GFEA 3MJ2A 3QALE 2VTQA 3O96A 2PVRA 2NO3A 4BDIA 4BWXA 2UZEA 5FM3A 1PKDA 1ZARA 2ITYA 3B2WA 2XNMA 4FIHA 4XRLA 3SXSA 1T45A 1H0VA 3TEIA 5F9EA 5GIPE 1Q99A 2F7XE 3QTXA 4YPDA 5TOZA 1OPKA 3QQLA 4MX9A 2JIUA 3WF5A 2BHEA 4QPSA 5CZIA 3QUEA 4AFJA 4J98A 1WBTA 3UC4A 4FC0A 1YWRA 4EHEA 4M7IA 4F9YA 4FK6A 4BIDA 1RJBA 2P2HA 1CDKA 3ATSA 2Y4IB 4QD6A 2IPXA 1R1WA 4WT6A 4CMOA 2ERZE 4R7BA 2OJ9A 3EH9A 4AN3A 1R39A 5KHXA 4UY9A 4X6QC 4QQJA 2PVHA 1K9AA 5BX0A 1YQJA 3EZVA 1ZZ2A 2PMNX 4BCHA 3EHAA 4DH5A 3R8ZA 3OF0A 5D10A 2XK7A 3COIA 3KA0A 1I09A 5AP5A 1Y6AA 3ZSGA 4XUFA 4ACGA 2NRUA 2QCSA 5L2TA 4O1OA 3ENMA 4UXLA 4DH3A 4GS6A 4WUNA 4GKIA 3D14A 3MTFA 5GJDA 3QTSA 3VF9A 3F3VA 4EWHA 3KF4A 2OFUA 4M69A 4BKZA 5I4NA 4Q5EA 5DN3A 1FGKA 3FPMA 3LXKA 5HESA 3WYXA 5H2UA 3RPOA 4UV0A 2UZNA 4GMYA 3R8VA 5JGAA 2C5VA 2XK9A 3QD3A 3MW1A 2CLQA 2I0HA 4QQTA 2R9SA 2WTDA 3FHRA 2IW8A 4K18A 3REPA 2DS1A 4HGLA 1Y6BA 2GU8A 3BHVA 3OWPA 5I3RA 1QPDA 3B8QA 2PE1A 2PZ5A 3MPMA 3UC3A 5HTIA 4K1BA 4RJ6A 4YU2A 2OXYA 1TKIA 3EQRA 4X3JA 5CALA 2QU6A 3GXLA 5L2SA 3AG9A 2UUEA 3NR9A 2QO2A 3OTUA 2OIQA 4PY1A 3QQUA 1H0WA 5L8KA 2OH0E 3OW4A 2B1PA 4BBEA 1SVHA 5EQEA 4L9IA 4MNEB 4IQ6A 4ZEGA 3CQUA 4IWQA 3EFJA 4TNBA 4ZTRA 4AW1A 4G1WA 4B4LA 5A4LA 2X9FA 5E1EA 2RF9A 5J5SA 5KMLA 1Y8GA 5EHLA 3CY2A 4BDEA 2W1DA 4FSTA 3LJ1A 3FZTA 3NCGA 3G5DA 4RIXB 2HENA 4UWYA 2AC3A 4WSQA 5HBEA 2OXXA 4BCIA 4BCMA 4QTEA 1UNLA 2ETKA 3TG1A 3MPAA 4CRSA 1CM8A 3WOWA 3EFLA 1YWNA 4IHPA 4ZSAA 5TKDA 4WD5A 2XZSA 3F2RA 3BHYA
chains in the Genus database with same CATH superfamily
2OF2A 5CNNA 3QQJA 4I23A 4AOTA 3UOKA 3IQ7A 3Q4TA 5EW8A 3ZUTA 3OS3A 4K77A 5BUIA 3V04A 4ZSLA 5FD2A 4ACHA 1U54A 3DTCA 4FUYA 4EH8A 4NSTA 3KRLA 2X6EA 4RWIA 2BRMA 3NSZA 5C01A 1OM1A 4L45A 3GQLA 5CF6A 4FTTA 4FNYA 1MP8A 2BDJA 1IAHA 2X0OA 4LQMA 4M67A 3SXRA 4DA5A 1OIQA 2ONLC 4JQEA 1AGWA 4FSUA 1ZYLA 5DHJA 3DKCA 4DLIA 4XP2A 3NWWA 5EOLA 3ZXTA 2XYNA 3BLRA 2WIHA 5E8YA 3NW7A 3II5A 4XBUA 2J51A 2ONLA 2PU8A 4F1TA 5HZNA 3RPSA 5JGDA 4FV7A 4KAOA 5GINE 3G9NA 2HWOA 3VUGA 5J7BA 2WTVA 1CTPE 2QOIA 5HLPA 3NPCA 4JNWA 2FVDA 2J6MA 4L6QA 2UZBA 3MH3A 4D9UA 1G8KA 3Q9YA 4R3CA 2PMLX 3W32A 1ND4A 3P08A 3COMA 3ROYA 4CV9A 3Q4CA 3RNYA 5LJJA 2WTCA 4L3PA 4U5JA 4FICA 4ASXA 3VW6A 3AC3A 4FT0A 3E8CA 2ZM1A 4UB7A 3CD3A 5EG3A 1W98A 2WOUA 4IANA 4MNEA 3GNIB 5CSWA 4U8ZA 3UGCA 3VS6A 3SW7A 3JR1A 2Q0NA 5E4HA 4KNBA 3VRZA 5BYYA 3QRIA 5FEDA 3KXXA 2YM4A 3CKWA 4BJJA 4X21A 4ALVA 2C30A 2CGWA 3ZZWA 5DT3A 2H96A 4EONA 5M57A 2HZIA 4TZRA 2C6EA 3QTRA 4U7ZA 4AZEA 4ZY5A 1H8FA 3DS6A 4EBWA 4KBCA 2CMWA 4M12A 3RAWA 1MQ4A 4C36A 4Z3VA 3BHUA 4EOIA 3ERKA 3KVXA 3F2AA 3RALA 4L53A 3TKIA 4IAAA 5EDRA 4HYSA 4L44A 5FGKA 3R8LA 5CAQA 3VBWA 4YJUA 3PUPA 4N6ZA 2Y6MA 2BDWA 3PXYA 2Y9QA 3AC2A 4IVDA 3PDTA 3QRTA 2BIKB 4FE2A 4C38A 3OT8A 4FOCA 2XANA 2G2IA 5CXHA 3I6WA 4KKHA 3L8PA 1ZZLA 3SA0A 2CDZA 4HCUA 4I6LA 4AXCA 4AW0A 5M51A 4QMMA 4X2GA 5IQCA 2A98A 3I0QA 3KMUA 2UVZA 4DHZA 3OCBA 5LWMA 4YZMA 3FLYA 5FEQA 1OGUA 3UO4A 1H27A 3R73A 3ORPA 3TKHA 2O65A 2HAKA 3VHKA 3RP9A 4AWIA 4FL1A 2WMBA 5J7HA 4FYNA 2ITVA 1TQMA 4DFUA 1RW8A 2VX1A 5CAUA 2GTNA 3A60A 4GL9A 4O2PA 5H8BA 1W0XC 2ITPA 1SMHA 4O7LA 1YDRE 3AD4A 5FTQA 2XK3A 2HK5A 1P2AA 5HNBA 5I9UA 2R3MA 3MDYA 4G2FA 4XX9A 4QP3A 4QEBA 4FKOA 2Q83A 3QTIA 2B55A 3LHJA 1Q97A 2VAGA 2JKQA 3UOHA 2B9JA 3TJDA 3DLZA 3NUUA 5CEOA 2XKDA 2RKUA 1W83A 3CJGA 3TN8A 3TV7A 2B9IA 1UNGA 1WBVA 5LVNA 2V5QA 4P90A 3ZYAA 2Y0AA 3OWKA 4FNWA 2C5OA 4YJQA 3FMHA 4EOMA 3BX5A 3FI8A 5M09A 4BCGA 4UMTA 4C3RA 3EQHA 1OKVA 2ZOQA 2AYPA 4Y5HA 4XV2A 5A4QA 3QAME 3QC4A 3O51A 5KCVA 3LCDA 5M4FA 3W0PA 3DK7A 3DK3A 4UALA 4CQGA 4DG2E 2OWBA 3M11A 3GEQA 1CKPA 2XAMA 1GJOA 3GC0A 4AOIA 4BI0A 4O7WA 4PTCA 3EN4A 3GP0A 1ZOEA 2IN6A 4MXOA 5CNOA 4ZTQA 5FUTA 2GMXA 3R21A 1Y91A 4B8MA 5JKGA 3PFYA 1ZY4A 2X9EA 3R1SA 5DRBA 1OZ1A 3RPYA 4GK4A 3MB7A 5CLPA 1PRYA 4XG6A 3DJ5A 2XS0A 4ZIMA 5LMKA 1OBDA 3DZQA 3P7BA 5E8VA 4AX8A 3NS9A 5IA5A 3UP2A 1WBWA 5HX8A 2O5KA 5EOBA 3UMWA 3OP5A 4D5KA 2PE2A 5DR6A 4E93A 1HCLA 2H34A 5HG9A 3VBYA 4C4GA 4JLCA 4KIPA 4EK3A 5CT0A 5GHVA 3EWHA 3LFBA 3TZMA 4L43A 4DEHA 4DH7A 5IA3A 2PSQA 4WBBB 4BCPA 4HOKA 3TIYA 3OEFX 3RTPA 2PPQA 4XCUA 3D7TA 4F9BA 3ZCLA 4Q5HA 2C6OA 3C4FA 3LLAA 1U5QA 4AXAA 4FT3A 3EFWA 1TZDA 4ERKA 1TQPA 4MHAA 4MCVA 2BFXA 4FTCA 4FNXA 5LCKA 2H8HA 3MWUA 3KXZA 4QDVA 3DDQA 4BDJA 2R3RA 2C6MA 2UZWE 3I4BA 2JIVA 3ET7A 4DGNA 3PE1A 4E4XA 4RWJA 5M4IA 2BZKB 4H58A 4TYGA 4LOPA 4YUQA 4F08A 4F7LA 4CG9A 3Q9XA 2ZV2A 3L8XA 1YXTA 4Q9SA 4ERWA 1UU7A 3ZUVA 3R1NA 4OTHA 2C6DA 2BROA 3OXIA 5EFQA 1CKJA 4AS0A 4CD0A 5B2MA 4QP7A 2BRHA 1OIYA 3DKFA 3HX4A 2YM6A 4RJ3A 2OF4A 4IC7A 3I7BA 4OAUC 3E88A 2H9VA 1FVVA 3HRBA 4F63A 4U42A 2XNOA 4R8QA 1KE7A 3NEWA 4XV1A 4D2SA 4FTIA 4O0VA 4I3ZA 3C5UA 4F0GA 1V1KA 3PA5A 4PL3A 4TYIA 4WA9A 4BC6A 1JKLA 4ANBA 3CLYA 2W96B 4XJ0A 4JXFA 4RWLA 5GIOE 2WMXA 3A7JA 3Q3BA 3EKKA 2JDRA 3LXNA 1A9UA 3RAKA 2GQGA 5LQFA 2WMRA 2Y7JA 1KUTA 4O7NA 2C6KA 4HPUE 3KXGA 4TNDA 1Q24A 4CFUA 3TNHA 4EJNA 3DNEA 4Q9ZA 4BDHA 2XK8A 3RJCA 2VX0A 4UX9A 2XH5A 1A06A 3FLWA 2V62A 5E91A 4EH7A 5IEYA 3PJ3A 4LOQA 2C5XA 5D7AA 3R2YA 4ANMA 3CC6A 4PMTA 1UU9A 2WTJA 4BY9E 4RIOA 4YSMA 4M14A 2IVVA 4JMQA 2A0CX 3OW3A 3ML1A 1XR1A 2RFSA 5J5TA 4YP8A 3KCFA 1KSWA 3NIEA 4TYHA 1V0PA 2XUUA 3QRJA 5HD7A 3VUTA 3K3JA 3W2OA 4AF3A 1PMNA 5T68A 2ZV7A 4OTGA 4BVUA 2WFYA 4C3PA 4C58A 4L68A 2WKMA 4S32A 1PXJA 4I0RA 2XCKA 3FHIA 4JBQA 4W4WA 4H1MA 5IMEA 4H05A 4BDDA 4QMOA 3CJFA 4W8EA 5FG8A 3PRIA 4FIGA 1WVWA 5JSMA 4FV2A 3OZ6A 4JDKA 4CMUA 1NW1A 5HE3A 1BYGA 1XH8A 2P33A 3F88A 4ZLOA 1ZYJA 1PXIA 4XV3A 4PDYA 3TNIA 2XYUA 4I21A 5FP5A 5JMSA 1YOJA 4KIOA 1WCCA 4XG2A 3DY7A 3FKOA 5LARA 3RPVA 5H3QA 2ZV9A 5CYIA 5IMXA 1NXKA 4FTOA 1O6KA 3BLAA 5AV1A 5TF9A 3COHA 3EOCA 5BQ0A 1UWJA 5C1QB 3EQIA 3O50A 4YTHA 4D1ZA 2FH9A 3CQEA 2EU9A 1XBBA 3MY0A 4DDGA 4PDSA 5K5NA 5I0BA 1R0PA 4FIEA 4DEIA 1F0QA 3PZHA 4JDHA 3ZEWA 4DEBA 5LOHA 2VWBA 1NVSA 3CQWA 3ZFYA 4GT5A 5F4NA 5A14A 4YZ9A 5HEZA 2ZJWA 2Y6OA 4D4VA 1GZ8A 1VEBA 5ICPA 2XNEA 5BVKA 5IQHA 3Q32A 3F2NA 3ZC5A 4G16A 1JOWB 4ZMFA 2VTHA 3BU3A 4KIKA 4RT7A 3E87A 2OJFE 4RIWA 1BL7A 3BLHA 3R1QA 4QMQA 4USEA 4AOJA 2WU6A 2QOKA 4M66A 2H6DA 2R3LA 4RJ4A 3ROCA 2OIBA 2WB8A 3OT3A 4C34A 1ZOGA 2BUJA 3TDVA 2WTKC 2QONA 3K5UA 2VWUA 3BQRA 3QQKA 5LMAA 3H9FA 5H8GA 4PP7A 4WG3A 5A4EA 2XRWA 3UDTA 2XJ2A 2YDKA 3IOKA 4IAIA 5DFPA 3GOPA 2B0QA 5HCXA 5ANJA 4BI1A 2WQNA 1PXOA 5EM8A 4XMOA 2ITWA 1JPAA 2RGPA 3AC1A 1ZMWA 3PIZA 4ZOGA 2ZVAA 4D4RA 3OG7A 5I9WA 4F0FA 1T46A 3D5VA 3SXFA 3DLSA 4GSBA 2P4IA 3WF9A 4NYEA 5HD4A 4JRVA 4DEAA 3CTHA 4OW8A 3ORKA 2XJ0A 4OBOA 4ZJIA 1Q8TA 4B7TA 1EH4A 4CVAA 1U54B 3PTGA 4PPCA 3S00A 2V22A 1OITA 4AGWA 4RX8A 3PP1A 3BE9A 4RVTA 3ANQA 3PPJA 3DTWA 4HJOA 2BZHB 2KULA 4V0GA 1W82A 2X4FA 4Y72A 4C4EA 5C27A 4ZTNA 3LCSA 2P2IA 4S33A 3WE4A 3AQVA 4U3YA 3H30A 1OECA 4Y85A 3V5LA 2Z60A 3OHTA 1ERKA 1PXPA 4FKQA 1I44A 2O3PA 2PVKA 2ETMA 4IAKA 4L01A 5HORA 4IB5A 2VTLA 3BIZA 3VS4A 4B8LA 4EI4A 2PVMA 4NIFB 5D9HA 5AMNA 2JDOA 3ELJA 3DQWA 2IW9A 1J7IA 4XLVA 2C0TA 1FVRA 4O96A 4WNPA 1IA9A 3G6GA 2VWIA 3F5GA 4IB3A 3HYHA 5IDPA 3P86A 3EN6A 4HCVA 4I41A 3TZ8A 3FSKA 3LAUA 3SGCA 1J1CA 2PTKA 3HGKA 5HE0A 3TXOA 4YJOA 1URCA 4AQKA 2F49A 2YM3A 3FJQE 4XLIA 3IKAA 5AP6A 4DG0E 3M42A 4IAZA 2IF8A 1M2RA 3MVLA 4J8MA 4C3FA 4O0UA 4QRCA 4RJ5A 4YNOA 5KMIA 3OBJA 2GDOA 4JRNA 3DOGA 4KA3A 3DAKA 4WNOA 4NM3A 5CI7A 2OU7A 3UQFA 4FKJA 3A7IA 5HOAA 1YOMA 1SVGA 2XK4A 4XEYA 3ZZEA 4ZTMA 1H00A 2VTNA 4CMTA 2IZUA 3RWQA 4QQ5A 2ZDTA 3BI6A 3PXFA 4FTJA 4QOXA 5AM7A 3LVPA 4FIFA 2VWVA 3O23A 2ZDUA 5K9IA 4OBPA 5JRSA 3LCTA 3AC4A 2R0IA 5GJFA 4FYOA 5HG7A 4YZNA 1DS5A 4E4MA 2BRBA 4B6LA 3P23A 5IA2A 1SM2A 3HAMA 2W7XA 4JDJA 3PPZA 4LV8A 3ODYX 2PZIA 2SRCA 2XIXA 3PRFA 4QMLA 3EQDA 3LKMA 1VYWA 4A4XA 4AGDA 2J0IA 3NYVA 3HRFA 3I81A 1M14A 3GCSA 4FR4A 3DXPA 4K6ZA 4YZCA 4ORKA 4DGGA 1U4DA 3UNJA 2PMOX 3CD8A 4OTPA 1ST4A 4BBMA 2HY81 2W1HA 5IH5A 3FXZA 4KBKA 4DT8A 2XM9A 3O8PA 4X3FB 4FEQA 5AUWA 1Z5MA 3RAHA 5IDNA 4DFZE 4FEVA 4ZSGA 5KBQA 2WMAA 5AP4A 3NZ0A 4GFOA 2WZJA 3ZMMA 4CV8A 3LQ3A 4OGRA 5DG5A 3QUPA 3VO3A 3WIGA 4MXXA 4Y46A 3FPQA 5F94A 4OR5A 3BYOA 4MWHA 4AA0A 3E8NA 4GFMA 2AQXA 2O8YA 1PHKA 3BPRA 3R02A 4PMPA 4AN9A 4DITA 1KV1A 4NUSA 2Y8OA 5H9BA 4LGDA 5EKOA 3UQGA 4U0IA 2QLUA 1P4OA 4UYAA 3T3VA 4D2WA 2FO0A 2VUWA 3HVCA 4C7TA 4P2KA 3S3IA 1YW2A 4FODA 4QMTA 4QMVA 3LMIA 2BALA 4JR7A 1GOLA 3PP0A 3ZRMA 2VO0A 4FIIA 4YC3A 1PYXA 3E8DA 5IISA 4U40A 3Q5ZA 2CKQA 3AKLA 3O8UA 3TT0A 2G2FA 4ITJA 2HCKA 3NNWA 1LPUA 4RSSA 4LRJA 5GZAA 5CEMA 1GZNA 2JIIA 2OKRA 3LE6A 4EOOA 4EUUA 5JN2A 2XNGA 3V6RA 3UZRA 4ANNA 3KVWA 4I4FA 4F70A 1XH5A 4U79A 2WELA 3WBLA 2WMQA 4H39A 3VC4A 4EH6A 4CKRA 2W1CA 1H01A 4M13A 1REKA 4DH1A 3EQFA 1TVOA 4QNYA 4QYGA 1KE8A 3KXMA 3RI1A 3V5TA 5IUHA 1REJA 4FG9A 3TUBA 4IM0A 2ZV8A 4IX4A 3EN9A 3NLBA 3NUYA 2WHBA 5LCJA 1W2DA 3NUXA 4DC2A 3R8UA 2JDVA 4GCJA 1MRUA 3W8LA 4X0MA 4ZP5A 3R7VA 2OI4X 3PXZA 2UW7A 4D2VA 2XK6A 3C1XA 3MB6A 5AR4A 3M2WA 3SG9A 2QU5A 5D11A 3R9HA 3C4WA 3CPCA 2VWXA 3UG2A 5DA3A 3A4PA 3LFNA 3LFFA 2ETRA 1WBSA 3UPXA 2X81A 2GPHA 4IACA 1YI3A 3C9WA 4NM7A 3HRCA 4V05A 5F20A 5AUTA 1QPCA 3E63A 3DBFA 4G9RA 3MFSA 1JKSA 4KIKB 4O38A 4CYIA 3MESA 4K8AA 2X8IA 3HMMA 4OTQA 3R83A 4DHJA 2WTIA 2YM7A 2J0KA 5AADA 2JAMA 4AXEA 1XMMA 3AKKA 5AAGA 3VUMA 3NRMA 2UZVA 1Q3WA 1KV2A 2EB2A 4TXCA 4ACDA 3U55A 3Q6WA 4BRXA 4ZS4A 3T8OA 1JKTA 3L9PA 3CEKA 4G9CA 5FDPA 3IPHA 3VUDA 2EXEA 1HCKA 2OSCA 2PYWA 4Z7GA 3LFEA 3IK3A 4IIRA 2YZAA 3DU8A 2VWWA 2PZRA 3FLQA 5E8SA 3ZLSA 5HLWA 3GU4A 4F0IA 4AGUA 3C0HA 4FT7A 5T3QA 4E6DA 2CLXA 4HZSA 3KN5A 4EHVA 4O6EA 3DPKA 3GVUA 3E7OA 2OJIA 4BDAA 3DBDA 1XQZA 4NJ3A 2OIDA 5J95A 4O4CA 4AZSA 1H1WA 4W4VA 3FL4A 3W33A 3GU6A 3MH2A 4HYIA 3K3IA 1B39A 1LR4A 4BGQA 4S31A 4F7JA 4GT3A 3W8QA 3GU5A 3IW6A 4RRVA 3ZO2A 4DTBA 2QKWB 4DT9A 5AUUA 2UZUE 4IJ9A 3I7CA 4RJ7A 4UZHA 4WIHA 4YHJA 2QLQA 4PPBA 4WSYA 5CZHA 2WD1A 5JFWA 3CP9A 3P7AA 1XJDA 3KU2A 2YHVA 4C4FA 3ID6C 2XIRA 3NYXA 3MTLA 4J95A 5HNGA 2GS2A 4DH8A 4R5SA 2VWZA 1BKXA 2E2BA 5DVRA 3R22A 4FX3A 1Q8ZA 4AN2A 3VIDA 1WBPA 1YI4A 2DWBA 4NZWB 2HY0A 4BCNA 2WOTA 1PJKA 4RPVA 3EKNA 5CX9A 3AT4A 5ANEA 4JBOA 2A19B 4UXQA 5EK7A 5HO7A 5EDPA 4CTBA 1V0BA 5FTGA 3A7HA 3DGKA 1Q8YA 3H10A 3SRVB 5J79A 5TE0A 4CFVA 4A4LA 3W18A 4QPAA 3QTQA 3TUCA 5C4KA 4EK4A 4R1VA 2IVTA 5M44A 2C47A 4TWCA 3C0GA 4BWPA 5CAOA 5HTCA 4GUBA 4FZ7A 3HEGA 3WF7A 4YJRA 4B99A 4EEVA 4EK8A 5EKNA 4LYNA 2GS6A 3E5AA 2ITQA 3JVRA 3MFUA 4HGSA 2R4BA 4YNEA 4IAFA 4GYGA 4BHZA 4GU9A 2XIKA 3UVQA 3FZ1A 5BVNA 3PJ8A 2BZJA 3WZDA 4BI2A 4O7VA 5BYLA 1BLXA 3ZONA 2R3KA 5FDXA 2R5TA 3PUFC 3GT8A 5EHYA 4TT7A 2GQSA 4CFWA 1KE5A 3F9NA 4RWKA 4J1RA 3I79A 3ORLA 5GZ8A 2GHGA 1NY3A 3R1YA 4BZOA 4G34A 4O4EA 5AR3A 3NVMB 3AKJA 4M15A 4FEWA 4NW6A 1WFCA 3LJ2A 4O4DA 4QP9A 4RMZA 5JK3A 3HAVA 2W4KA 4LRMA 3R9OA 3QBNA 3WF6A 4DEDA 1KE6A 3R2BA 4U44A 4APCA 4CKIA 5TO8A 4JIKA 2VTSA 2R3FA 2QI8A 3ZXZA 3RHXA 5HICA 3DXNA 4J52A 2Z8CA 2PUIA 3QRKA 4FZFB 2W9FB 1KOBA 3EB0A 2BHHA 1J3HA 4UYNA 4BCKA 3OCSA 3QQHA 4FV9A 4FRFA 2W06A 4MD9E 2GFCA 5M08A 3CPBA 2ITTA 4Y95A 4DFBA 3QD2B 5CF8A 4X2KA 4F7NA 4IM2A 2ZMDA 4Z55A 2I0YA 3W2SA 3KXNA 2BAQA 2EB3A 5I9YA 4XG9A 2RL5A 3HV6A 5G1XA 2HOGA 5CQUA 4ZLZA 3OMVA 5AP2A 4AU8A 1LUFA 1VZOA 3CS9A 4E6QA 5KHWA 5DT4A 3FLZA 4YLLA 4O84A 4ZSEA 3PSDA 1SYKA 1M7QA 2IZTA 4AAAA 4EKKA 3VAPA 3MVJA 4E1ZA 3NYNA 2CGXA 3SX9A 5HO6A 4H3PA 3KULB 4NT4A 4IWOA 4QTBA 4CRLA 5B0XA 4EOSA 5LMBA 3S1HA 3ALOA 4EH2A 4D1XA 1FMOE 4DG3E 3ANRA 4E4NA 1YHVA 4L3JA 3EIDA 4L7SA 3NUPA 2VWYA 4ZSJA 1Z57A 4BYJA 4C4HA 5AX3A 5EYCA 4F9WA 2KTYA 3GBZA 3NNVA 2UW8A 3QA8A 5AP0A 4FV5A 2QOQA 5AUYA 1DI8A 1O6LA 3R63A 3S4QA 4FV0A 4X3FC 4A7CA 4ZTHA 3Q60A 3FC1X 4RQVA 4AZTA 4C8BA 3Q04A 4K9YA 4F6UA 4FVPA 3O2MA 1MQBA 3SW4A 4BYIA 3JXWA 4O6LA 3VUHA 2WNTA 1YXSA 2O64A 5AR7A 1WBOA 2CCIA 3HMIA 3ZO4A 1ATPE 3PIYA 1OKYA 3LM0A 3N51A 4DINA 2BCJA 4MXZA 4QDEA 4FBXA 5KO1A 4WNKA 2O63A 4TN6A 5I9XA 3FWQA 4QYEA 5T6KA 3Q2JA 3LQ8A 4IVAA 3A7FA 2Q0BA 5CU3A 5BYZA 4YURA 4V01A 2CNVA 3OWLA 1J91A 4QMYA 5L6PA 5AAFA 3KREA 4GFGA 3FQSA 3F66A 4G17A 3G0EA 4B9DA 4IFGA 2WEIA 3O0GA 3PPKA 4C0TA 3SVVA 2YCFA 2DYLA 3NUNA 4DEEA 3V5JA 1PXKA 4ANOA 4CXAA 3V8SA 3O17A 4FF8A 2J2IB 4I20A 4RFYA 4YPSA 3A2CA 4BWKA 4A07A 3P5JC 4FSNA 4X2NA 5AAEA 4NCTA 3BHTA 3BE2A 4YHTA 3FZPA 1K3AA 4FKIA 4OT6A 4YLJA 3TNWA 2BZIB 3MBLA 3PVWA 3LZBA 2JITA 5IA4A 2J0LA 4F9AA 1TQIA 5M4CA 2YABA 4CT1A 4GJ2A 4IVBA 4P5QA 2WQEA 3FKLA 4ZZNA 3FBVA 3CGFA 1BX6A 4R5YA 3RCJA 3L9NA 1SVEA 4ANQA 5EW3A 4I1ZA 4P7EA 3C4XA 3W2CA 3GUBA 3KF7A 3GCPA 3OTVA 3JY9A 4O0XA 4P4CA 5CEPA 5DWRA 3WF8A 3PY3A 2RFNA 2AEGA 4AG8A 2XKFA 3A8WA 3TJCA 2JDSA 3PY1A 2OLCA 3OUKA 2HW7A 5HQ0A 2YISA 4J53A 3KFAA 3RNIA 2ZM4A 3HNGA 3LFCA 3FMKA 1JVPP 3D5WA 2OK1A 3RZBA 4FTQA 1RQQA 4S30A 3UDSA 2B53A 4E5AX 4JG8A 3PSCA 4ZY4A 4G5JA 4I5PA 4LGGA 5I3OA 3ZU7A 4HGTA 5E1SA 3QZFA 2WMVA 4KWPA 2UW9A 5CQWA 4BGGA 4LUEA 4RZVA 3POOA 1XO2B 5F95A 1SNUA 3DBCA 4FV4A 4AA5A 1OL7A 2XVDA 5JEBA 3KIOC 3A99A 3KN6A 2X2MA 3R7OA 2YA9A 4W9WA 3QWJA 4TYJA 4ZLYA 4FTNA 3W2RA 3D4QA 2CSNA 3BYVA 4GG7A 3V5WA 2PZPA 1YVJA 3BKBA 3V51A 4MXCA 5K4IA 4EH5A 2VO6A 4XOYA 1STCE 5EHOA 4QMWA 4ASZA 3LJ0A 4FTAA 1VLRA 3QZGA 1Q4LA 4S34A 1W2CA 1OKZA 4LOOA 5CF5A 3VS7A 3ULIA 3UZPA 2ITUA 2R2PA 3VQHA 5KX8A 3OY1A 3T3UA 2JGZA 3VN9A 3LQ5A 4N6YA 3I6UA 4BGHA 4XOZA 5BVFA 2J4ZA 5A54A 2B54A 2W99B 2HZ0A 4MBJA 4IZ5A 4W4XA 3RWPA 4FZAB 3KC3A 5BVDA 4O7SA 4MKCA 2XF0A 2F9GA 2NRYA 4O0RA 1ZMVA 5CI6A 4R6VA 5JQ5A 2JBOA 3PA4A 3ORXA 5TT7A 5KMNA 2WO6A 2X8DA 3MH1A 1IG1A 5BNJA 4BKYA 4FSMA 3W10A 3W0QA 4DTAA 4PF4A 4FTLA 4LL5A 2Y4PA 1GZOA 4W9XA 4XHKB 3VS5A 4MTAA 4C2WA 5FM2A 2FA2A 4MH7A 2PVYA 3TNPC 5AV4A 4ZK5A 4HNFA 4I0TA 5D1JA 4PMSA 3UDBA 4JX7A 2QODA 4WRGA 4TYEA 3BBTB 2LAVA 2W5HA 3R8PA 3ZBXA 4BR3A 3A61A 4G31A 3HV4A 3IW5A 3DFAA 3C0IA 4BCQA 3JUHA 4YTCA 4I92A 3D0EA 3D5XA 3H4JA 2BR1A 2VO3A 2VTTA 3BU6A 4YBJA 5DR2A 4ANSA 3UODA 1R3CA 2OW3A 3DAJA 4YC6A 4RZWA 5JZNA 4C62A 1PXNA 3N4VA 5DR9A 3BYMA 5I9VA 4KBAA 2WIPA 2R7IA 4YC8A 4M0ZA 4BDCA 1UVRA 4JG6A 4F6SA 4NIFA 3ATTA 1FMKA 3LPBA 5AIKA 2IVSA 2P3GX 4K0YA 2YACA 4E20A 1ZLTA 3QZIA 2ITNA 1NVRA 2R3GA 1A48A 3F69A 2WPAA 2Z2WA 5AUXA 5B7VA 3LCOA 1NT2A 4EJ7A 2QOHA 3QXPA 3E92A 4TY1A 4E3CA 3AGLA 4JQ8A 4AP7A 1OI9A 2W5BA 3MY1A 3DNDA 3NFGB 2XCHA 2P55A 3R71A 4HVSA 1H4LA 3PWDA 2HELA 1IASA 3QZHA 5AFVA 1PMEA 4AZVA 4F99A 2UZLA 5FTOA 5AP7A 4RA5A 3SOCA 3CTQA 3I1AA 1FQ1B 5DMZA 3LIJA 2RFEA 3ZUUA 4CT2A 4EQCA 4LV5A 5JFVA 4C35A 3K54A 1B6CB 2C5NA 3FY0A 1DAYA 2R3HA 3SDJA 4F7SA 5L6OA 3BV3A 1VYZA 4TWPA 3TTJA 5K5XA 5ETCA 3VS2A 5KUPA 2YM5A 2YLEA 3ZH8A 3QCQA 5CU6A 4H36A 4DBXA 1F3MC 2QOBA 1M17A 3OXZA 5IUIA 2XNPA 2YAKA 4O91A 4IW0A 2O0UA 1P14A 2FSLX 1OIRA 3CBLA 4ACMA 4D5HA 5B2LA 4IEBA 4NJDA 5L2QA 3G51A 4G6OA 5M53A 3FL5A 3HDNA 3LW0A 4BHNA 4KS7A 5A46A 1IRKA 3OVVA 3NIZA 4MQ1A 4IH8A 3MIYA 2JEDA 4ITHA 4EOQA 3PG3A 5HTBA 2C6LA 2Z7SA 4I0SA 4HGEA 5J8IA 4O83A 4KS8A 3WARA 3RZFA 4L42A 1OVEA 3FMLA 1VJYA 3BRBA 3NUAA 3E3BX 1L3RE 2VV9A 3O7LD 3Q9WA 4BB4A 4F65A 1QPJA 2HXLA 3EFKA 3UNZA 3QC9A 3FDNA 4AFEA 4LRKA 4FSZA 4AT4A 3R7IA 1ZYDA 4CTCA 4GJ3A 4E6AA 5L3AA 4E26A 2ESMA 3G33A 4JAIA 1FBNA 4FTMA 3UDZA 2GHLA 2WAJA 5BUJA 2PULA 3BL7A 5EQPA 5AV3A 4IDTA 2GNJA 1G8AA 2Y4IC 5AEPA 1J7UA 1Q62A 4R1YA 2X0GA 1FPUA 5K3YA 4GKHA 3HV7A 4IX3A 4UMQA 4XS2A 4E8AA 2YWVA 4FEXA 3COKA 1E9HA 2XEYA 4E7WA 2ZAZA 5LXMA 2OZOA 3V8WA 4ID7A 4J97A 2C3LA 2VTOA 3HUCA 2A2AA 4PP9A 4GT4A 5C26A 1U59A 2VNYA 3A62A 5DEWA 4LG4A 5DYJA 3W0SA 4A9SA