3IDBA

Crystal structure of (108-268)riib:c holoenzyme of camp-dependent protein kinase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
343
structure length
341
Chain Sequence
KGSEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Novel isoform-specific interfaces revealed by PKA RIIbeta holoenzyme structures.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 108
structure length 341
sequence length 343
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3idbA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3idbA02
3NYOA 3DTCA 2R3NA 3V5JA 4M0ZA 5J5SA 1OKWA 2WHBA 2FSLX 4JNWA 5AP6A 5C01A 4TYEA 3PPZA 1XH8A 4E7WA 5L2TA 5CSHA 4QMXA 3BHTA 3ZEPA 2JBPA 5IQAA 3S0OA 4BFMA 3QQFA 2OJFE 4RLKA 4B6LA 3FPQA 1ZOGA 1ZYLA 1YDSE 3V51A 5K9IA 1PHKA 3BHUA 3DDPA 3IW7A 3OCBA 5IH5A 4TKSA 4NW6A 2XIXA 3HRBA 3UPZA 1F5QA 2JDOA 3QUPA 2CJMA 2FO0A 5E8TA 3CE3A 3CIKA 5IEVA 1LPUA 5ANEA 3RINA 3G9NA 4FF8A 4BTJA 4EK4A 1R0EA 3MB6A 3QL8A 4O6LA 3DOGA 4Y85A 5AWMA 4FE2A 4IAAA 5ANKA 4EOQA 5GIOE 2WIPA 3R0TA 5EI8A 3E8DA 3EQIA 4C4FA 5IQIA 2VZ6A 1M2RA 2XBAA 4YJOA 5HBEA 4D2RA 2QD9A 5BVOA 2BMCA 4CFXA 4MBJA 5DRBA 3BHYA 4DEEA 2Y7JA 3LQ3A 1BKXA 1SNXA 3KRLA 3KXNA 3OG7A 5TR6A 4HYHA 3JVSA 3V8WA 3HAVA 5TKDA 4F08A 4DGOA 4DBNA 3CPBA 2J5FA 4NTSA 5A4LA 4FTJA 2YACA 4J98A 4TXCA 4XLVA 5FTGA 2Z60A 3RTPA 3P79A 4XG7A 3M42A 2R4BA 1W84A 3WYYA 3VBQA 4ZP5A 4CT2A 3D5WA 4QMTA 4DH5A 3R63A 5EFQA 3KRJA 3UYTA 3RNIA 4ZLOA 3QQUA 3I5ZA 4LMNA 1BL7A 4V01A 5ETFA 1GIHA 5DG5A 5M4IA 4LRKA 2G01A 2QOBA 3IKAA 2G2FA 3WE4A 3IK3A 3KXMA 4MNEB 2C6LA 4EQMA 4FZDB 3MYGA 1H0WA 3AMBA 1V1KA 5D7AA 4M66A 4AZEA 4F7SA 1JPAA 3OXTA 2WMWA 3QZHA 2R0IA 4BDDA 3ANRA 3UOHA 4LOQA 4MXOA 3UNJA 4ZSGA 5EYDA 3V5PA 3FV8A 2REIA 3ZFMA 2V62A 3DBQA 2Z7LA 3SW4A 3PIZA 2V0DA 2FSOX 3VUMA 4EKKA 1PYXA 3DJ7A 3ZONA 2A4LA 4TW9A 2IVSA 3EYHA 3FPMA 3JPVA 3NMUF 4M12A 4A4XA 2BZKB 3TN8A 4EYJA 4XMOA 3MY0A 5HO7A 4YZMA 3BZ3A 4AW2A 2V22A 2ZM3A 4MHAA 4B8LA 3FL5A 3W2CA 4Z3VA 5IQBA 2GNIA 4A4OA 1UWJA 4D1XA 5IG1A 3HRCA 5TO8A 5EHYA 1WCCA 3K3IA 2VWBA 4ASXA 4K2RA 2PVJA 4KS7A 3K3JA 4FEVA 3DB6A 4FV9A 4IVDA 2WD1A 1G3NA 2Y9QA 4PL5A 4RIOA 5KBQA 3KCFA 3KVWA 1KE7A 3G6HA 4I6FA 2XEYA 4Z16A 4LYNA 5CF6A 1K3AA 4R78A 5EDQA 3DB8A 1XHAA 2C69A 4L43A 3LCKA 4OAUC 3L1SA 2IVVA 5ANJA 3BPRA 4MX9A 4KIKB 4BGQA 4PTCA 5BVEA 3EN7A 4QYEA 4CYJA 3OMVA 3VBXA 5FXQA 4ZZMA 4BDBA 1WBNA 5T6KA 2PK9A 1IASA 3GCUA 3I60A 3TIZA 3DXQA 5CXHA 1GOLA 3UVPA 2VX0A 1PRYA 1Q8TA 3RPVA 3RCDA 4X6RA 3P9JA 4C59A 3EYGA 3HLLA 3DBCA 4HZSA 4RQVA 4DCEA 1UNGA 1OBGA 1U4DA 3OBJA 4FZ7A 1NA7A 4UMPA 2XIZA 3EFKA 3FWQA 1GY3A 5KHXA 5EI6A 2QVSE 1OPKA 1RE8A 3FI8A 3LMHA 5C4KA 1M7QA 3MJ1A 4GL9A 4FT5A 4BHZA 2GSFA 2XK8A 4X2JA 5FP6A 2I1MA 4MXYA 5HG7A 2RFDA 3I7CA 2W1FA 1STCE 4C4GA 5BVNA 2JFMA 3Q9ZA 4AAAA 4JR7A 4MNEA 1PMVA 2ITXA 4NTTA 4CZYB 1ZZ2A 4M84A 2W0JA 4C37A 5I4NA 5K5XA 3D7TB 4O0XA 5J9ZA 2VTHA 4QMNA 3VS2A 3HV3A 2B0QA 5CENA 4NM5A 2VTRA 2FUMA 4D4YA 3QWKA 5J87A 3TJCA 4O7YA 4EONA 1X8BA 2QCSA 2RFNA 1Z9XA 2R0UA 3ZFXA 1KOAA 4DE4A 3EKNA 1FVVA 3NCZA 4E5WA 4EOPA 3P23A 1B39A 4RZVA 4W8DA 4P5QA 2VUWA 3GP0A 2F7XE 2JFLA 4PUZA 3SGCA 3FE3A 3AQVA 4PTEA 5HTCA 2GS6A 4GVJA 4EH7A 2GNGA 2EVAA 4QD6A 1P5EA 3GBZA 1PXLA 4L42A 4OBPA 2OF2A 1JAMA 4JAIA 2OZAA 4L01A 4AX8A 3Q5ZA 4MXCA 2YZAA 3TZMA 5KHWA 5AUWA 3C4XA 3MVMA 4K1BA 4I0TA 4XV3A 3H9OA 4DN5A 4F9AA 1WBTA 5DR9A 4EBWA 3ET7A 3ORPA 5AP7A 2OIDA 3RAWA 2WMSA 3DAEA 3NUSA 3LKMA 4KIPA 3D5VA 5BYLA 4L8MA 5BYYA 4NH1A 5KX8A 2QR8A 3ZO2A 4RWKA 2XK9A 3NVKI 3TL8A 1OIQA 4C4IA 2ACXA 3BKBA 4GK4A 4DGNA 2R7IA 4ACMA 3HDMA 5JGBA 5AV1A 4GG7A 2CMWA 4FKUA 4M14A 4X0MA 4PDYA 2GQGA 5E91A 2WQMA 4FI1A 1W7HA 4O0TA 4J95A 3KXXA 5A14A 1PMEA 2BPMA 3AC2A 5AR5A 4DH7A 5HU9A 3H9FA 3JVRA 2JBOA 3FYKX 3UE4A 1SVEA 3GU4A 4O0WA 4PNIA 5JH6A 2VWZA 5EI2A 1O6YA 2W7XA 3JY0A 4KBAA 4MK0A 2WO6A 3VHKA 4NEUA 4Y95A 3NYVA 4FTAA 4WA9A 2W1HA 4HOKA 4WD5A 2XCKA 2IZTA 2F2CB 2YCQA 3CLYA 4GT3A 4XBUA 4HVDA 3NUNA 5J9YA 4R7HA 4BCNA 4CZUA 4JG7A 3ZLYA 3I0OA 4L00A 4QO9A 5JMSA 2XJ2A 2J4ZA 1PMNA 3U4WA 4JJRA 3P7CA 3QALE 3EN6A 3VUDA 3D7TA 4XJ0A 5J5TA 5KE0A 3SVVA 2BRGA 3C5UA 3TZ8A 3R73A 2XMYA 4W9WA 3QTIA 1SVGA 4D1SA 4BCFA 4E6AA 3EKKA 4GS6A 2OIBA 1A06A 1U46A 3QTUA 2F9GA 5FWKK 4CKJA 4EH8A 4BIEA 4D5KA 3D83A 3VS6A 3WF6A 4EL9A 3NUAA 4YC8A 4G3EA 2BAJA 3Q6UA 5HD4A 5KUPA 1DS5A 2ONLC 5C9CA 4AOIA 2BIYA 5FEDA 2PVYA 5BUEA 4QP9A 4K77A 4U7ZA 3QTZA 5HBHA 1JSVA 3HMOA 3RVGA 3OS3A 4GYGA 3COIA 4UALA 4B0GA 5DNRA 3UIXA 3FQEA 2XH5A 3BQRA 5HOAA 5CSPA 2R3MA 4CG8A 2YM6A 2QOHA 3MFUA 5IA5A 5HU3A 3P08A 4DYMA 4AFJA 3TWJA 1S9IA 5K3YA 1GNGA 5IDPA 2PSQA 4I6BA 4BCGA 4FV7A 1J91A 2RFSA 4B7TA 3HMIA 4JRVA 2BAKA 5EYMA 5EOBA 3W10A 3QFVA 3ORXA 4BDCA 1GJOA 3I5NA 4YP8A 5HVJA 1OVEA 1WAKA 4FKSA 4M69B 2VX1A 3A8XA 3I1AA 1OB3A 3QKMA 4F64A 4BL1A 4BWXA 4BRXA 4RSSA 3QCYA 2YCRA 4UWBA 4EQUA 3QQGA 2W17A 3PSCA 1YXXA 5A3XA 3NAYA 1XH6A 5GNKA 1UVRA 4ZSAA 3UQFA 1YWVA 1H27A 2XS0A 5FLFA 5AR7A 2YCSA 4FK3A 1TQIA 3TUBA 3FL4A 5LVOA 2QR7A 3PXYA 4ZXTA 3KRXA 4GFMA 4CQGA 3TTJA 3ZYAA 3LMGA 3WE8A 1J7LA 1W0XC 3ZRMA 5HE0A 3RAIA 4FUXA 3LCOA 3CJGA 4FIEA 2PVKA 2UZUE 3OHTA 1REKA 4FKWA 4FC0A 5E8XA 2OI4X 5G6VA 3TUDA 2CNVA 2IPXA 1WVYA 2YAKA 3EWHA 4NSTA 3ITZA 3ZUUA 1XWSA 4OTDA 3LXNA 3PE2A 4A9SA 3F2AA 4CTBA 2VTQA 5C8KA 5IUGA 5JFWA 5HG8A 3ZRKA 4AFEA 5LMBA 2UW6A 2W99B 2ZM1A 3F82A 4C0TA 3QTRA 5F9EA 3ORIA 2QQ7A 4X2KA 4DT9A 2OH4A 1OGUA 3KU2A 1IA8A 3PJ1A 4QTEA 3MW1A 4ZSEA 4CRLA 3Q3BA 3NYNA 4C62A 5AUUA 4FIFA 3F3WA 2F7EE 3R2YA 3TT0A 2QU6A 3KGAA 4LMUA 4O0VA 1XR1A 3GOPA 1YKRA 4IVAA 5DI1A 3ZUTA 4J1RA 5A9UA 4U5JA 1BYGA 3S1HA 4EH2A 3KRWA 2JKMA 2OIQA 4R3RA 4U3YA 3WF5A 4DEGA 3R02A 4YPDA 5D10A 5IQFA 2OSCA 4HZRA 3QTQA 5CU6A 4DFBA 1V0PA 3OY1A 4IH8A 5ANGA 2XUUA 4PP7A 4D55A 3MIAA 2X2KA 3BEGA 3IW8A 3COHA 4X21A 5DT4A 4YNOA 3KKVA 1PF8A 4FOBA 4DC2A 4PWNA 4J71A 3V6RA 4RPVA 4M15A 2BRHA 4D2SA 3DK6A 2PULA 3OXZA 4C8BA 2HIWA 5D9HA 2CN5A 1K2PA 3FMMA 3LZBA 1H8FA 3ULIA 4R3CA 2GQSA 4M69A 3TNHA 4BKYA 2QI8A 3ZO4A 4FSWA 1ZY4A 3R8MA 4CMOA 4ENYA 3VS4A 4RVKA 4ACCA 4BDAA 3R9NA 2Y0AA 4I6HA 3IGGA 1M7NA 2X81A 5DYJA 5B2KA 2VGPA 3C1XA 2EB3A 3HVCA 3K5VA 2Z7QA 4RC3A 1I09A 5AP2A 2BDJA 3DTWA 3R00A 4IM0A 5CU4A 3RGFA 4A9YA 4QQCA 2ZV2A 4DEIA 2C3IB 2ZJWA 5KMKA 1B6CB 3DXNA 3QX2A 2IZUA 1FMKA 5EQPA 5A54A 4I5PA 2OBJA 4C02A 4U40A 3BYMA 4IANA 5DGZA 5DRDA 4FT3A 5JRSA 2WU7A 2I40A 5ETCA 3OWPA 4RIYB 4FEXA 4C4EA 4CYIA 2R3KA 3NSZA 2B53A 4KD1A 4R6VA 3VS3A 2C0TA 2OO8X 4NW5A 1H28A 1Y8GA 4QMYA 4IW0A 5IA3A 2BZJA 3R7VA 4W9XA 4D2TA 3JUHA 5TOZA 4HVSA 3IGOA 2UW5A 3TEIA 4FSTA 4DTKA 2H96A 1QPDA 4D2VA 3MVHA 1ZYCA 4NUSA 4ZS0A 2X4ZA 3E64A 4M3QA 2UW8A 3TM0A 2PVMA 3QCXA 5C26A 1FQ1B 2OF4A 2P3GX 3BLHA 1H1QA 2C3KA 3IOPA 2CDZA 5AV3A 3ZU7A 3N51A 3UYSA 5LVLA 4A9RA 2A1AB 1J7IA 2WEVA 4HPUE 4Y72A 1FVRA 1REJA 2PZYA 2X2LA 1SMHA 4TWOA 3LW0A 3UZPA 5EQYA 3CTJA 3SOAA 1NY3A 2X1NA 3OOGA 3W2SA 3FAAA 2OG8A 3SRVB 3ZLXA 5K5NA 2J0KA 2CKEA 3HL7A 5CF8A 3D7ZA 3FMNA 2HZNA 3FMLA 2GTNA 5GIPE 5ANDA 4Y46A 2VWWA 5FEQA 3ORZA 1L8TA 4F0FA 3KVXA 3L8XA 2BAQA 4AA4A 2UW7A 4ASZA 4KUJA 4JQ7A 4JT3A 5D1JA 4G6LA 2ITOA 3UGCA 1ZZLA 3UNZA 2WIHA 1Y6AA 1YW2A 4AGWA 4BI2A 2OWBA 2VWYA 4IEBA 4WNKA 4BDKA 4V05A 4I6QA 2BHHA 4QNYA 3KA0A 2C3JA 3QHWA 4MXAA 5CNNA 3LJ2A 4DCAA 5M4UA 4E6QA 1T46A 4HCVA 3OTVA 3HV6A 3WARA 2X9EA 4FZAB 5I3RA 5H8GA 4FV8A 4PP9A 3QQLA 4Y8DA 5IF1A 4WG3A 3PWYA 4D9UA 3P5KA 2BTSA 4FICA 4FKQA 4XG2A 3FY0A 4GIHA 5AX9A 3KN5A 2VTNA 4J52A 5AV2A 4XOYA 4O81A 1YHWA 1TVOA 4DF3A 2ITUA 4TWCA 2B9HA 5HG5A 4M8TA 4AE9A 5BUIA 5CEMA 2X4FA 3QKKA 3ZC5A 3IDCA 3DZOA 4FV4A 4RIYA 3EN9A 4JDHA 1H01A 4IZYA 4RQKA 2PUIA 2C5XA 4JBPA 4RZWA 4S33A 3I79A 4ID7A 1Q5KA 4LV8A 3GQIA 4UMRA 4NFMA 3RMFA 1ND4A 5AIKA 4FTMA 5E1EA 4MQ2A 2EXEA 4GV1A 4D58A 3R6XA 4JBQA 5CI6A 4LGHA 5DMZA 1QPJA 2O65A 3HGKA 5DT0A 3VJOA 3UODA 2W1ZA 4UN0C 1Q3WA 4OTIA 4DFZE 4EJ7A 1WVXA 3M2WA 4AGDA 3NWWA 3ULZA 4RJ7A 3OD6X 3LE6A 3QX4A 4P90A 2I7QA 3FI4A 4M0YA 2WMXA 5F20A 5DR2A 3R9OA 3MWUA 4C7TA 1KUTA 5IQHA 4YC6A 3WZKA 4E5AX 3O51A 4YHTA 3EQFA 3OUKA 2R3RA 4D0WA 4ERKA 4IE9A 2BZHB 1AGWA 2X7OA 1IA9A 3FC1X 3BX5A 4I93A 4JX7A 2WPAA 4CVAA 3HECA 3S00A 3HRFA 3SKCA 3GFEA 3AC8A 4JQEA 4NKSA 1O9UA 2A2AA 3ORTA 5F4NA 3ACJA 4DEHA 5JGAA 4D0XA 4Z55A 3MY1A 1PXPA 3BWJA 2C0OA 1K9AA 5I5ZA 3A4PA 5L6WL 4YJVA 3VQUA 3PZHA 2UZBA 3C4FA 3WIGA 4WUNA 3QF9A 2WGJA 3DT1A 3AMAA 4BC6A 1KWPA 2XCHA 1BI8A 4IJ9A 3WBLA 4IMYA 4BYJA 1Q24A 3PE1A 2BILB 5BVKA 4CQEA 4AS0A 3O8PA 5AM6A 2UVYA 3TIYA 3ZTXA 2I0EA 3LLTA 3MSSA 4YTHA 3NIEA 1KV2A 2WEIA 3P86A 3TACA 5CU2A 4AU8A 3UOJA 3G90X 4IX3A 3VBYA 3NUUA 4JLCA 1OL7A 2XYNA 2NRUA 4MD7E 4RWLA 3LFBA 2WOTA 1ATPE 3EQPA 4IZ7A 4ONAA 5AR8A 2PUPA 3WZUA 3K2LA 2WMVA 5M4FA 2I0HA 1W83A 1GZOA 3TKHA 2WOUA 1VYZA 3PLSA 2EB2A 5EDRA 3UG1A 5AP0A 3VN9A 4DLIA 5IA1A 3PY0A 4O0SA 1IR3A 1OL5A 2WMBA 4RFMA 3F61A 2UW3A 2UVZA 4IFCA 4BIDA 5L2QA 2ONLA 4YO4A 5I9WA 4GUBA 4RIXA 3VUHA 3KK8A 3ELJA 3L9MA 5EYCA 2UUEA 1OPJA 3R8PA 3HP2A 4PL3A 3GCVA 2ITPA 3IO7A 4I23A 4KAOA 3R7UA 3VNTA 4BDGA 5A46A 5CXZA 3LLAA 5D12A 4H3QA 5GZAA 4QP7A 3PPJA 3VO3A 2GQRA 2XK6A 5M07A 3Q2MA 4MAOA 5F95A 1PMUA 1NT2A 4F7JA 2QO9A 3OXIA 3BBTB 2XBJA 4LGGA 3OF0A 1UKHA 2PMLX 4FTKA 5AAFA 4DEBA 2PTKA 2FSMX 3AT3A 4CLJA 4CFUA 2ZDUA 4HCTA 2WTWA 3KRRA 3N9XA 4HVHA 3GC7A 4MYGA 2VTLA 4CZTA 2YLEA 3ACKA 3ATTA 5CAQA 3Q4ZA 3OT3A 1ZLTA 2V5QA 3FKNA 2O0UA 4GJ3A 4OUCA 2GS2A 4FA2A 3UZRA 4LUEA 4S31A 4Y83A 2W1CA 3MH1A 4I4FA 2XNNA 3O2MA 5AUVA 4AWIA 4PTGA 5AM7A 2BFXA 3W2QA 4BCQA 1FGKA 4JXFA 3CSVA 4CV9A 3FY2A 2NNWB 1GAGA 2BRNA 4IAFA 2B9JA 1FPUA 3PTGA 4QP3A 4NYEA 4ZTQA 4C34A 3BLQA 3O17A 1NVQA 3QQKA 3PVUA 3QLFA 4A7CA 3KK9A 4DGMA 3FHRA 3UVRA 2C6KA 2CNQA 3VS7A 4R5SA 1OMWA 4JR3A 2XM8A 2WQBA 2ZB0A 2CGVA 3F3UA 1XKKA 4IAKA 4YJPA 4E73A 5TF9A 5KMLA 2BTRA 2W1EA 3ZZWA 1YI3A 4GEOA 3VBTA 1Q8YA 4AQCA 3VS5A 4NFNA 4G9RA 4OTFA 3W32A 1UU9A 2IW8A 1FVTA 1U5RA 4FX3A 4TYJA 4LI5A 1YXVA 4CCBA 1RJBA 3P4KA 4TY1A 1BL6A 1ZOHA 2XP2A 1CTPE 4OW8A 4YJUA 2OW3A 2QOFA 1OUYA 3CC6A 1T45A 4G5JA 4WRSA 5K4JA 4N57A 3ZDIA 3CP9A 3Q9YA 3FXXA 4UYNA 3AC4A 4HGSA 3CGOA 5EW8A 4ZTNA 1UWHA 3PXQA 2YM3A 3DU8A 2XZSA 4ZTRA 2BALA 5HX6A 2ERKA 3MTFA 2R9SA 5EG3A 3TZ7A 4F7NA 2OK1A 3RI1A 1J3HA 4A9TA 4QYGA 4O7NA 4WT6A 5CVHA 3ZC6A 5FP5A 4XLIA 3Q04A 3RJCA 2VWVA 4EOOA 3QD2B 2J90A 2VTSA 4IX6A 3QRJA 3O96A 4WSYA 5GZ9A 2O63A 3VWAA 4E4MA 2JIIA 4DFYA 4U44A 1R39A 3IG7A 4QTAA 3DBDA 4YLJA 3ZM4A 3MA6A 4MQ1A 3CXWA 3QQJA 3ID6C 3NR9A 3OWJA 3QAME 2HYYA 3ZXZA 4FMQA 4W4YA 4QMZA 2PMIA 3PUPA 3ZM9A 3NW7A 5LCJA 4EUTA 4J7BA 1WFCA 4IVBA 5C4LA 2IO6A 4I0RA 1URCA 1Z5MA 3NVMB 2YITA 4AG8A 5DT3A 1ZARA 1JVPP 3VS0A 4AN3A 2QODA 4EOMA 2C68A 2HWOA 2QG5A 3ZO1A 1OL6A 5JEBA 3FKOA 4ASEA 4J8MA 2C6MA 3V3VA 1CMKE 3UO5A 4QTBA 5HVKA 2PMNX 2X7FA 3L9LA 3RHKA 4UBAA 3HV5A 5FM2A 4ANLA 4C57A 4FYOA 1OZ1A 1FGIA 5CT0A 4E1ZA 4F7LA 5CEOA 3PRIA 1JKLA 1I44A 2DUVA 3PWDA 4Q5HA 4TYHB 4Y5HA 5AV4A 5E9EA 4OTGA 4J8NA 4DBXA 5M53A 3I6WA 3QXOA 3FZPA 4ORKA 3C50A 4BIBA 3BIZA 3GQLA 2CGUA 3CS9A 4EH9A 2HK5A 4QMSA 4OAVB 3PIXA 5GJGA 4FKLA 4L7FA 5AAEA 4FIJA 3KXGA 4FSRA 4UYAA 4L3PA 3UOKA 2W9ZB 2PYWA 1VJYA 3ORKA 2KULA 5IA4A 3E7OA 1PXKA 3NUXA 4GYIA 4MBLA 5DR6A 3PXFA 3MH2A 4RMZA 4S2ZA 4E4XA 1H07A 4NCTC 4UWYA 4F65A 3E8EA 4F9CA 3ZO3A 4FVQA 5CLPA 4QT1A 3MTLA 4FGBA 3FSFA 3DKOA 3FDNA 1OL1A 3NRMA 3HMNA 2CHLA 2YM8A 4YGAA 3ZDUA 4EH6A 2NP8A 4ZOGA 3P78A 3DV3A 4RWJA 5BPYA 3R8LA 3T9IA 3TKUA 2BVAA 5CYIA 3A7HA 5FXSA 3U87A 4C38A 4F4PA 5BX0A 1Q97A 1NVSA 2ZMDA 2YABA 4FSYA 3BHVA 2VO7A 1MUOA 4AZSA 1OL2A 3TTIA 2UV2A 1BX6A 2WTVA 3LQ8A 3BYOA 4F1TA 4KB8A 2RKUA 2UZVA 2ZB1A 2X7GA 4A9UA 4FKPA 5DN3A 4BGHA 5C8MA 1UNHA 3TDWA 1YXUA 4JX3A 2P4IA 4EOLA 3V6SA 4EYMA 5JQ5A 3F2RA 2C5NA 2ZDTA 5J79A 4DEDA 1G8AA 3QLGA 3RWPA 2IVUA 1ZWSA 3RZFA 4O83A 3FMJA 4KSPA 3KN6A 3QD4A 4MEDA 1LR4A 2HXQA 3A7JA 4O27B 4O96A 5BVWA 3REPA 4AZWA 5IZFA 3FEGA 3AD5A 4PDSA 3IW4A 1WBSA 4PL4A 4FIGA 4FNWA 2OJJA 5CEQA 3A8WA 3A62A 2UZOA 3F69A 4I0SA 3V04A 4FV5A 4O86A 3MPAA 2B1PA 2UVXA 4LGDA 3HX4A 4YBJA 1WMKA 2R5TA 1P2AA 4IB1A 4U0IA 3A99A 4O6EA 4O1OA 3EL7A 4YU2A 5IEXA 3KQ7A 3R8VA 1G8SA 4KIKA 4USEA 3A60A 3FKLA 3MY5A 4LOPA 4B4LA 3CEKA 2CLQA 3OFMA 3ORNA 3PVBA 2WMTA 3QXPA 4MKCA 2JD5A 4PX6A 4O7RA 3U55A 4ZLZA 1H00A 2VX3A 3R28A 4FBXA 4FVPA 4NJDA 4FEWA 4ZS4A 2J7TA 5DFPA 2XNOA 4XP3A 4NT4A 4EORA 4HYUA 5JSMA 3R7IA 2P55A 4XP0A 4FSUA 5M4CA 3TJDA 3S95A 3WI6A 3N4TA 4O7ZA 2PY3A 3PDTA 2F4JA 3BQCA 2H6DA 3IONA 4AGCA 5AR2A 4X6QC 3SDJA 3F3VA 4L67A 4X2FA 5EM5A 5IH6A 1QPEA 4RIWB 4XS2A 1FOTA 3QZFA 3GCQA 4J96A 4WRGA 1B38A 3QGWA 2XK7A 4IVCA 4K6ZA 4XCUA 5CS6A 4ZTHA 4FKIA 5FTOA 2WTJA 1CSNA 4LOOA 5FGKA 4BWKA 4CGAA 3CTQA 1Q99A 4YO6A 4EC9A 3D9VA 3ALOA 3L8SA 2GNHA 2W4KA 1M2QA 3F3TA 5K4IA 4CMUA 4OLIA 4RLLA 3NZ0A 3WILA 2OKRA 4H3PA 4HGLA 4E4LA 3BE2A 4Z9LA 4KIQA 1OITA 2UW4A 5LOHA 3LOKA 4AA5A 4JBOA 4U42A 5H2UA 1DAWA 4YJTA 2YAAA 4EK6A 4I94A 5HI2A 4BCPA 4FG9A 3F5UA 4CRSA 5IQDA 3KL8A 1SVHA 4QP1A 3WZDA 5EM7A 4EH5A 5E4HA 5B0XA 4BTKA 2BDFA 1M2PA 5FXRA 3QZGA 1J1BA 4TL0A 1IRKA 3OBGA 1ZMVA 2XM9A 3EMGA 4FT7A 1H25A 3IS5A 3MA3A 4H36A 3BYSA 2XB7A 3NW5A 4V0GB 4D28A 3NW6A 4IC7A 4U79A 4I20A 3EJ1A 3ZHPC 2X39A 2ETKA 3OCGA 2OXYA 4E5BA 3E7VA 3R01A 3RPOA 1XJDA 4ZK5A 1OKVA 5HIEA 3GT8A 1NXKA 1V0BA 4FK6A 2Z02A 4QMWA 4XG6A 3LCTA 4EBVA 1KSWA 1DAYA 3T9TA 4O0UA 2XK3A 3MESA 4IIRA 2JEDA 2F49A 2P33A 2XJ0A 3IPHA 3ODZX 3IQ7A 3DK7A 4GH2A 4PDOA 3LJ1A 4U8ZA 5IMEA 2QG7A 3ODYX 4BKZA 5I9YA 2W05A 4CD0A 2QKRA 4FZ6A 5EKOA 4BDJA 4XRJA 2HELA 5DBXA 4NM0A 3GENA 4CSVA 4F1OA 3AC1A 4YLLA 1YVJA 1J7UA 4C3PA 3GC9A 4AW5A 5CSXA 5L6OA 3QGYA 5HBJA 4CEGA 3C0GA 3PG3A 5H8BA 3D2KA 5KBRA 2BZIB 2C5OA 5FRIA 3RM7A 1Q4LA 3ETAA 3FZSA 3MGYA 4FTIA 4IWPA 3BBWA 3WYXA 1OKZA 1KE6A 4IX4A 4MD8E 2PPQA 1WVWA 5A6NA 3V5LA 3ATSA 2IN6A 3K54A 5I9UA 4KABA 4BDHA 4BR3A 3U9NA 3AT2A 1Q3DA 2ITTA 2Y6MA 3EZRA 4G3GA 4A4LA 4BN1A 2BROA 1XH7A 3CD8A 4RIWA 4FEUA 4YR8A 2W1GA 2OFUA 3SRVA 4BTMA 4F0IA 4RJ6A 3SXRA 4N70A 3O7LB 4ERWA 3G0EA 3R2BA 4FIHA 1M14A 4KBCA 5LJJA 2WQNA 3BYUA 2HAKA 3PA3A 4FTQA 4G16A 4GRBA 5DVRA 3LVPA 3QQHA 1W8CA 4N4SA 1YXTA 3CQUA 3E63A 3MFRA 4MTAA 3BELA 4UX9A 3G5DA 5CQUA 3TNWA 3ANQA 4HVIA 5AA9A 2W06A 3OUNB 4O2ZA 2C6TA 2VTMA 3M1SA 3SC1A 2Y8OA 5FD2A 3RM6A 3DDQA 3O0GA 1DI8A 2J0MB 3E8NA 3FMDA 4IHPA 3R30A 4QP4A 4CCUA 3UPXA 2QLQA 2QOQA 2W5AA 2YZLA 3QRIA 5C27A 4EEVA 3R7OA 5JGDA 1SM2A 2C1AA 4QOXA 1ZY5A 2B54A 3KXZA 3PG1A 4FV6A 2ZM4A 4NM3A 5D11A 2P2IA 1PXMA 2ERZE 3GNIB 2UZDA 2QO2A 4O91A 3D2IA 4MCVA 3SAYA 1SZMA 3QTWA 5K0KA 1PXNA 2VRXA 3HMMA 3UC3A 4R3PA 2PVLA 3RZBA 2PZIA 2QHNA 4H58A 4D4SA 2VTOA 3RPSA 5CZHA 3QA8A 4O2PA 3WZEA 3BV3A 3QUDA 1Q62A 2J2IB 2XEZA 4AUAA 4YBKA 4BWPA 5BVFA 5AMNA 5AUZA 3MH0A 4GMYA 4EOIA 1UU3A 3PP1A 1XBCA 4NL0A 3QYWA 2YIYA 1Q8ZA 1Y6BA 3VBWA 4YNEA 1GZ8A 3CY2A 2VO6A 2JDRA 1WBOA 3CQWA 3DZQA 2JKOA 3UP2A 3VUTA 2WMRA 1YI6A 2OXXA 4BDEA 3BU6A 4YZCA 3COKA 3W8QA 1YHSA 3W18A 2PL0A 5L3AA 3DK3A 5JFSA 4BBMA 2UZLA 4C4JA 5E1SA 5LVMA 4CNHA 2XNPA 3LFCA 5L4QA 2VNWA 3MJ2A 5AR4A 1YHVA 3GI3A 2PMOX 4S32A 5HNBA 2QONA 3FLQA 3LJ0A 3TCPA 4FKRA 4AE6A 4FEQA 3F5PA 4ZAUA 3RK7A 3CPCA 3LXKA 3ZBXA 4YTIA 4AT3A 1YWRA 4RFZA 5HE1A 1HOWA 4E6DA 5JT2A 2PZPA 3OWLA 3VF8A 4OTWA 5LCKA 4KWPA 4FKTA 2A27A 4G3CA 4UMQA 4UMUA 4DH3A 2DQ7X 3UG2A 3N4UA 2FB8A 5F94A 2BDWA 4BY9E 4B9DA 4PV0A 4FGRA 5E8ZA 1YI4A 4S34A 1LEWA 3NNWA 4ZSJA 3SLSA 2HY81 4ZMFA 4I24A 4YMJA 5IEYA 5LVNA 2LGCA 4W4XA 4N6YA 4QQTA 2E9OA 5DEWA 2O2UA 4XG9A 2JKQA 3I0QA 4G6NA 3R1YA 3ZS5A 1XBAA 3C0IA 4WG4A 3NDMA 3R1QA 3FMHA 3T3VA 4Z7GA 2H9VA 3I81A 4CFVA 1Y57A 3PZEA 4JOAA 4YHJA 2IVTA 2NPQA 3AOXA 4OTQA 3S2PA 4ENXA 2FSTX 2WNTA 3D15A 2A19B 3DKFA 4OTHA 4C33A 5F1ZA 4BBFA 2OH0E 5FBNC 1PYEA 3T8OA 3I6UA 3SG8A 2ZVAA 4D9TA 3QRTA 5ETAA 2G1TA 4GU9A 3GCPA 3CJFA 1IAHA 1XBBA 4FSZA 3ROCA 2YIQA 2XA4A 3DLSA 5JZJA 2BR1A 3FZRA 4IC8A 5C8NA 3QWJA 4DFLA 1CDKA 3R9HA 4UMTA 3NYXA 3ZEWA 3WIKA 4ANOA 4TWNA 3A7IA 5HHWA 4Q9ZA 1DM2A 4NCTA 2CGWA 4NK9A 5DPVA 3W2RA 4F09A 5KKRC 4R7BA 1TKIA 3FI2A 4BZNA 3NLBA 2XIYA 4BI0A 5LWNA 3LCSA 5IKWA 1YRPA 4BYIA 1UU7A 2B52A 3DLZA 5G1XA 3HV4A 4ALVA 3EOCA 2CCIA 2X6DA 4QP8A 4AP7A 4P7EA 3C0HA 3F6XA 5EM8A 3EQGA 4YZDA 4GU6A 4KKGA 3BE9A 2NO3A 3FMEA 3FLZA 5KMNA 2W9FB 2C47A 4WBOA 5KNJA 5DHJA 4FNXA 2WKMA 4BTFA 2AC5A 3H10A 4EOJA 4FTRA 4QMVA 5CEIA 5HTBA 4JIKA 5EYKA 4RJ8A 3PLAE 4RC4A 4ZIMA 4IDVA 3BGPA 3U4UA 4K33A 3DKCA 1ZOEA 3DPKA 4DTAA 3L9PA 2HXLA 2VWXA 4FKJA 4EK5A 4WUAA 3R83A 3O71A 3WZJA 2Z2WA 3PRFA 4U41A 3B8QA 5T68A 4B99A 4GKHA 3LQ5A 2Q0NA 2AC3A 4KS8A 2XKFA 4IFGA 5A6OA 2EXCX 4ZY6A 5JRQA 5A4QA 3BU3A 5EKNA 4QQJA 3ALNA 1A9UA 3GGFA 4JBVA 5IA2A 2PVHA 2R3JA 4G9CA 4L45A 1A48A 1ERKA 1WZYA 4BGGA 5FG8A 3EQBA 4JIAA 4RJ4A 1P4FA 4DINA 1IG1A 2R3OA 4G2FA 2E9PA 3E92A 3DS6A 5CZIA 4YZ9A 3PA5A 2VGOA 3BU5A 3EQHA 3D4QA 2J51A 4HNIA 5BMMA 2LAVA 3ROYA 4DH1A 5KO1A 4NKAA 3H0ZA 5HIBA 4A06A 3RAKA 4FSNA 1UA2A 1E1VA 3VUIA 3QHRA 1GIJA 5ACBC 4AOTA 4BCIA 3WF8A 4XBRA 3C51A 4QMLA 4KKEA 1M17A 4IZ5A 3GVUA 4M67A 3GCSA 4OBQA 4YPSA 2YDJA 4GSBA 4HPTE 4IDTA 4UZHA 5HCZA 3G15A 2A0CX 1YOLA 2Z7SA 3NNVA 4DG0E 4F9WA 2C3LA 1JSTA 4RA5A 2FH9A 2QO7A 3HUCA 3SV0A 2JIVA 3G33A 4U97A 2XJ1A 2BKKA 4O21A 4KKHA 3EL8A 1MQ4A 4YSMA 5FEEA 1G5SA 4DFUA 1RW8A 4XH6A 4GVAA 5BVDA 1KE5A 4CTCA 2Z8CA 4IZAA 4L52A 4FNZA 4PPBA 1OI9A 1CM8A 2XNBA 4O0RA 5HG9A 3TG1A 3V8SA 1RQQA 3G0FA 4FG7A 4USFA 1MRVA 4NZWB 5CT7A 1GZNA 4XRLA 4YUQA 2C6OA 3SOCA 5HVYA 4ZTMA 4HGEA 2WTCA 4IX5A 2RG5A 1V0OA 3DQXA 2J50A 3EFWA 2YEXA 3O7LD 3ZSHA 5A4TA 3NAXA 4FIIA 4RJ5A 4BCJA 5LMKC 4GT5A 5CSWA 2I0VA 4L44A 5IUIA 2QHMA 1DI9A 3D5XA 4JDJA 3DGKA 4HYIA 1ZYSA 3GB2A 2JAVA 4PQNA 3CGFA 4R8QA 3ZSIA 3UC4A 3QTXA 5BQ0A 4CFFA 5HE3A 2J0JA 1JNKA 2ETRA 4EOKA 4AA0A 1FINA 2J6MA 1OIRA 4JI9A 4QTDA 3LFAA 4XG8A 4D4VA 2CNUA 2IZRA 4I3ZA 3ZOSA 2R7BA 5AP3A 2EUFB 3O50A 2V7OA 3GU8A 4MXXA 2IW6A 1FBNA 2PHKA 3C4ZA 3OW3A 3Q2JA 1M52A 5AUTA 3DNDA 4ARKA 3O23A 5LVPA 4LM5A 5CY3A 4JG6A 4O38A 1PW2A 4S30A 5B2LA 3IDBA 3DAJA 4KRCA 5CSVA 5IUHA 4PRJA 5FDXA 2QURA 4WNOA 5M08A 5IU2A 5EH0A 4DG3E 2OFVA 1VZOA 3U54A 2HZ4A 4JVGA 4X3FC 4EHZA 3LFDA 2WTDA 3FI3A 4JL9A 2FA2A 3CBLA 1PXIA 3DQWA 3R1SA 1YWNA 3V5QA 4KSQA 4ANMA 2B9IA 2VTPA 5TE0A 3BGZA 3F3ZA 4RC2A 2EXMA 3EN4A 2IW9A 3C5IA 4U81A 3NCGA 4EZ7A 5IH4A 4AN9A 2WMAA 4JDIA 4YJQA 5L6PA 5CQWA 3P7AA 3V5WA 1KOBA 3R1NA 4H05A 3FUPA 3QRKA 4H1MA 2UZEA 2YERA 1UKIA 4ANQA 5AUXA 1L3RE 4WSQA 5CU0A 3AG9A 2C6EA 4O0YA 4FV1A 4GIIA 3PJ3A 5AFVA 5JZNA 1R78A 4J97A 3JXWA 2YHVA 4IADA 5GHVA 5I9ZA 4WHZA 5HQ0A 3HA6A 2H34A 2PVNA 2VO3A 3P1AA 4GUEA 4UXQA 5I3OA 4QMUA 3KB7A 3BHHA 4C61A 1U54B 1H1WA 1OM1A 5HCXA 2CKOA 2AYPA 5AR3A 4RX9A 2WQEA 2I0YA 3F7ZA 2V55A 5ITAA 4RJ3A 3OEZA 1Q8WA 4PDPA 3N4VA 3PY3A 5KZ0A 5HLPA 3BWFA 5B2MA 3IW6A 1R3CA 3QBNA 4ANSA 4G6OA 3VHEA 4X3JA 4QNAA 5AX3A 3UO6A 5E8WA 5M44A 3FZOA 3A2CA 4GCJA 4GK3A 1Y8YA 2UW9A 4LRJA 5M55A 2J9MA 3NUYA 3PVWA 2B4SB 3I4BA 2GU8A 2QLUA 2VNYA 3BCEA 1NVRA 3FZ1A 1PKDA 1PXJA 3GFWA 4HJOA 5CVFA 3TV7A 4USDA 4CXAA 4MF0A 4DLJA 4IWQA 1H08A 4L68A 4BVUA 1PY5A 2PE2A 3F7WA 1P4OA 3DJ5A 3C7QA 2GCDA 3HKOA 3KCKA 5L8LA 4ANBA 5FDPA 3OTUA 3QD0A 4GW8A 4X2GA 4XOZA 3EIDA 3RNYA 5ICPA 2GTMA 4BZOA 5AA8A 4F70A 2VTIA 2X9FA 3LFSA 4I41A 4ZY5A 1F3MC 1VEBA 2G9XA 3R71A 4MF1A 5DE2A 2VD5A 3RAHA 2HZIA 3UIMA 2ZMCA 2G2HA 3ZZEA 5CF5A 4E93A 3V8TA 3POOA 2X8EA 1H26A 5EDPA 4Y73A 2W1DA 3F66A 2J0IA 4RT7A 3PJCA 3RP9A 3DFCB 4K11A 4F9YA 4GK2A 5C03A 3VIDA 2HENA 4PY1A 3GU5A 1KE9A 2GHGA 5FUTA 4KA3A 4EZ5A 2YN8A 3ZUVA 4QPAA 1YQJA 4F0GA 4XV2A 5KKRB 2CN8A 2PVRA 3B2WA 2CCHA 4GKIA 2W1IA 2R3LA 1WBWA 3PP0A 2GNJA 3U6HA 4FT9A 2VAGA 4CT1A 3U8WA 4PF4A 5HD7A 1H4LA 4IAIA 4EZ3A 3M11A 3QTSA 4FSMA 2XKDA 2X2MA 3HUBA 4X2NA 2Y4IC 3KULB 3DNEA 1P14A 1EH4A 2VN9A 5IQEA 1BI7A 4RX5A 2O3PA 4J99A 1OIYA 5DEYA 2BFYA 2RL5A 1ZAOA 2OGVA 5IQCA 3UQGA 1APME 4I21A 5EHLA 3MV5A 1U54A 4UEUA 1OUKA 3KY2A 2X8DA 3UOLA 3W2OA 4AZFA 3C9WA 2YLFA 5AADA 4XUFA 2OZAB 4HYSA 4AW0A 5GZ8A 1QL6A 3Q96A 4I4EA 3OP5A 4DAWA 4EI4A 3UMXA 1PKGA 1VR2A 2F7ZE 3G6GA 3AGLA 3NX8A 2XRUA 2ITWA 2EWAA 3NGAA 4YTCA 2WZJA 4FT0A 4XYFA 2WTKC 3EZVA 4DTBA 4TN6A 1W82A 3PXRA 2ZV9A 3RPYA 5AIRA 2IWIA 4CG9A 4BF2A 3LCDA 2OJIA 4EJNA 3S4QA 2FVDA 4A07A 1YDRE 1H24A 5CWZA 4E6CA 3QD3A 3D0EA 3HMPA 4NIFB 2J0LA 3RK5A 3A7GA 3ORMA 4JQ8A 4JRNA 3D94A 3VUKA 4GG5A 4D2PA 1GZKA 3FJQE 4G34A 1F0QA 1SYKA 3HV7A 3SQQA 4O7SA 3Q53A 3SXFA 2R64A 5H9BA 5EM6A 4U43A 2WELA 4NWMA 3GU7A 5KMIA 2WAJA 4L9IA 3MVJA 3RALA 1CKIA 4FTOA 4QPSA 2DWBA 3AC5A 5AUYA 3RCJA 3EQDA 2BKZA 4NJ3A 2P0CA 3W1FA 1HCKA 2GNFA 4TNDA 2YIRA 4BICA 3OVVA 4YJNA 4ZJIA 4MXZA 4BBEA 4C3FA 5B7VA 5J7HA 2XYUA 4FTLA 4XEYA 4KRDA 4XNEA 3PJ2A 3E8CA 3DAKA 4W4VA 4I5MA 4AN2A 4TWPA 1R0PA 4YHFA 4RG0A 4EH4A 3ENHA 5HIDA 3CCNA 4YC3A 4EKLA 3TI1A 4EUUA 3THBA 3W8LA 4NM7A 4F6SA 4FNYA 5L2IA 5CF4A 2WMUA 3V01A 2YM5A 1YXSA 4L46A 4K0YA 2E9UA 1BLXA 3KULA 2PZ5A 4OGRA 5JFVA 4TYIA 3FLWA 4CKRA 2R3QA 4EC8A 5K0XA 3LFQA 1MP8A 3E93A 4YJRA 2VTJA 4R1YA 1ZMWA 2C0IA 3HP5A 4MBIA 5CAUA 2V7AA 2NRYA 4XG3A 4G17A 5CASA 5I9XA 3LAUA 2R2PA 2HY0A 4QP2A 4TYHA 4XHKB 4DT8A 4FTTA 1QMZA 3VF9A 3PSDA 4CFMA 3FLSA 3R04A 2H8HA 3DFAA 5HICA 3R7YA 2YISA 3PXKA 5T3QA 4MD9E 5GINE 1U5QA 4GFGA 3PJ8A 5KCVA 5IA0A 3MBLA 3FQHA 3R7EA 2JKKA 2J5EA 4FR4A 3ZFYA 3E87A 5CAOA 4O7VA 1YDTE 3MFTA 4HCUA 1MRYA 4BHNA 4I22A 4DA5A 3GC0A 2B55A 2W5HA 3IDPA 5JQ8A 2VO0A 2WMQA 4HW7A 4EHEA 3POZA 4OTRA 2QOLA 4L7SA 1MQBA 3MPMA 4R5YA 4FV3A 1WBPA 4U6RA 2XF0A 4U80A 3L9NA 2UW0A 3Q60A 3VRYA 1O6LA 3Q4UA 4DHFA 1ZMUA 5JK3A 2XRWA 3LFNA 2XKEA 4NIFA 1UV5A 3HAMA 4X3FB 3AGMA 2JAMA 3LM5A 3Q4TA 3H0YA 4FYNA 4IWOA 4TTHB 1TQPA 4TNBA 4WNMA 3TNPC 3RPRA 3QCSA 5AP1A 4LRMA 3QKLA 4ACDA 3WF9A 4C58A 2HOGA 5DA3A 2QOOA 3KMMA 2RG6A 2P2HA 4JG8A 3TUCA 4I5CA 4RGJA 3SX9A 3VRZA 3KMWA 3RHXA 1OKYA 2QU5A 3TZ9A 3B2TA 3R7GA 1Y91A 2OXDA 1VYWA 2CSNA 3H9RA 4G5PA 5AP5A 3W33A 3ZLWA 4FG8A 5FM3A 3LHJA 3OEFX 4UY9A 4XX9A 5J95A 3FSKA 3UDBA 5JKGA 3JYAA 5M57A 3ENMA 4BDIA 5M09A 4QRCA 2BRBA 4WO5A 2XNEA 3OOMA 1KV1A 4ZSLA 3QA0A 4ZZNA 3R22A 3FQSA 3BI6A 4Q5EA 2UZWE 5EQEA 3C13A 3VJNA 1ZYJA 3U6IA 2X8IA 4AZTA 2CKPA 3UIUA 4AOJA 3IECA 2YDIA 4P5ZA 2GPHA 5JN2A 5HORA 5LMAA 5ANOA 5CAPA 5IISA 2KTYA 3QC4A 3MS9A 3UBDA 3AD6A 4MNFA 2OJGA 3JY9A 4O22A 2R3IA 5LMKA 5LQFA 1CKJA 3DBEA 2ZV8A 3AMYA 4BCMA 1KE8A 3PY1A 2YWVA 3NNXA 4BDFA 3E5AA 3V5TA 2R3GA 4ANNA 3Q4CA 5CTPA 5CU3A 4YSJA 4BB4A 4WG5A 3ORLA 4KINA 4PMSA 4O7TA 4IAYA 3HNGA 3MH3A 5E8YA 3NUPA 4F9BA 3AT4A 1AQ1A 2OJ9A 2QOIA 2IJMA 2VWUA 3QC9A 3OZ6A 4XV1A 4G3DA 4QQ5A 3R8UA 4AT4A 1PXOA 3A4OX 3PSBA 1Q61A 3A7FA 4LG4A 4UZDA 5HE2A 4E26A 4YLKA 4C35A 4DEAA 2CPKE 3K5UA 3WOWA 4F63A 5I9VA 5M06A 5A4EA 2XIRA 4E3CA 4BKJA 3FXZA 5CEKA 2WQOA 2VTTA 2RF9A 3F88A 3KEXA 4WKQA 5DLSA 2YDKA 5CVGA 3CKWA 3E88A 3F5XA 3F5GA 4QP6A 2QNJA 4ITIA 4EHVA 2Y4PA 2B9FA 4X3FA 3C4EA 2O5KA 4F6WA 5E7RA 3DKGA 3F9NA 2BIKB 3CKXA 4LUDA 2RSVA 4OTPA 5DOSA 2XKCA 5HO8A 1QPCA 2WXVA 3UVQA 2Y6OA 1SNUA 4L53A 4IB3A 5HZNA 3KF4A 5J1VA 3S3IA 4KIOA 3NPCA 3GXLA 4AW1A 2YA9A 3UZTA 3CY3A 5J8IA 3ZSGA 1XO2B 5GJDA 5BYZA 4M7IA 3EFJA 4PMTA 4D1ZA 4IJPA 2Y4IB 2XVDA 2YM7A 2ESMA 3FXWA 4BZDA 5AV0A 3H3CA 3EB0A 2SRCA 2B7AA 2ZYBA 1JKTA 4P4CA 4XP2A 3TNQB 3WF7A 2I6LA 1H1PA 4V0GA 4OT5A 4U9AA 2PE0A 4LFIA 3E3BX 1ZXEA 3EH9A 2BCJA 2C30A 3LXLA 4QMOA 4R1VA 4EK3A 3DA6A 3MIYA 3HEGA 4MWIA 5HESA 3CTHA 4CFNA 1TQMA 1JLUE 3VAPA 2HWPA 4RVMA 1Q8UA 2PWLA 4R7IA 4C36A 3CQEA 4H1JA 3TV4A 2QC6A 3COMA 3SA0A 5EW9A 4JDKA 3Q6WA 4CLIA 5IQGA 4EOSA 4O84A 4XV9A 4CMTA 3FC2A 4I1ZA 4QMMA 4RA4A 4TZRA 3RWQA 5HKMA 1H1SA 4AF3A 1JBPE 4IB5A 4I5HA 5HGIA 2WU6A 4UV0A 2WTKB 4EWQA 2VU3A 4FV2A 4CV8A 4DITA 3DCVA 1W98A 2G15A 3NNUA 2R3FA 1XH5A 1XH4A 3G51A 1FMOE 3MN3A 3Q9XA 3GEQA 4NU1A 5HNIX 2C4GA 3MVLA 4KNBA 2QKWB 3W55A 4HNFA 4AGUA 4DH8A 2CKQA 4K18A 1OECA 2BHEA 3BLRA 5HLWA 2JC6A 4QMQA 3D5UA 4AZVA 4ACHA 4L3LA 3ZMMA 4IM2A 4RX7A 2IZSA 4FUYA 4BCOA 3UNKA 3AXWA 5J7BA 4ALUA 4ZY4A 2RGPA 1URWA 4FZFB 4R77A 4YURA 4P2KA 1JKKA 3VW8A 3C4WA 4AXAA 4BCKA 3BEAA 3PXZA 3HZTA 3IOKA 3P0MA 2O64A 2O8YA 1O6KA 4APCA 5I0BA 2JGZA 4U3ZA 4JAJA 3OY3A 4OT6A 4PPAA 3BYVA 5JFXA 4FL3A 2CGXA 2BUJA 3FBVA 2RIOA 3MFSA 1JSUA 5CNOA 3UJGA 2XNGA 3UTOA 3U6JA 4PNKA 1R1WA 3VVHA 5IMXA 4E20A 3BRBA 3EQRA 3G9LX 4H3BA 2ITNA 5EHOA 4ZTSA 5BMSA 1IAJA 4ACGA 4IWDA 4N6ZA 3PYYA 4H39A 4IBMA 3O8UA 4ASDA 5AP4A 2PUUA 3PFQA 2OICA 1JQHA 1MRUA 2GDOA 4RFYA 3CD3A 4HGTA 3UP7A 4O1PA 3PPKA 2C6DA 2E9NA 4M13A 4O7LA 3DXPA 3OWKA 3H30A 4GJ2A 4YJSA 4YZNA 4FTCA 4D2WA 4E8AA 5A4CA 4FSQA 3HDNA 1HCLA 2GNLA 3FHIA 4PMMA 2GHLA 1YOJA 3KXHA 3QCQA 3Q32A 5BNJA 4I92A 3KC3A 1LP4A 3EN5A 3NIZA 4K8AA 1J1CA 1QCFA 4IB0A 5FQDC 3MB7A 4ITHA 2W4JA 5H8EA 3D14A 3VS1A 3FYJX 4K9YA 1H1RA 1ZRZA 4RBLA 4C2VA 5HCYA 5CAVA 5CEPA 2ITZA 3DBFA 2C6IA 4FV0A 4II5A 2Z7RA 5HLNA 3UIBA 2QOCA 2R3PA 4Y5QA 5J1WA 3OT8A 5M56A 5KMJA 2FGIA 4GFOA 4FODA 5L8JA 3LM0A 1E9HA 2GHMA 3KMUA 4G31A 4LL5A 3II5A 1PJKA 2FYSA 4F99A 4G3FA 3QUEA 4UB7A 3U51A 4MH7A 4C3RA 5CI7A 3RBWA 4CKIA 2C5VA 5KZIA 4JS8A 5HO6A 4ALWA 4FOCA 5DWRA 3Q52A 3SXSA 3OC1A 4QYYA 1Z57A 2YWPA 2DS1A 4DFXE 2Q83A 2PZRA 4X7QA 4O82A 3FMKA 3OROA 3TNIA 3LPBA 4OBOA 2JDVA 3O8TA 2YM4A 4E4NA 3LFFA 3A61A 5J9LA 4DGLC 2GFCA 4WNPA 2XNMA 2VTAA 3PVGA 5M51A 1OBDA 3ZLSA 4EH3A 5E90A 2HZ0A 2C1BA 3QZIA 3TXOA 3JS2A 3GU6A 4MWHA 4WBBB 4GT4A 4IQ6A 4TT7A 4ZMEA 2JDTA 5EK7A 3ZH8A 3ZCLA 4AACA 2ZV7A 2JIUA 1S9JA 2YJRA 4FTNA 4QYHA 2VWIA 2HCKA 4LV5A 4QTCA 1XQZA 3B8RA 5L2WA 4F6UA 5E8UA 3OCSA 3ERKA 3CR0A 4TRLA 3UO4A 2ITQA 4U45A 4HVGA 3OCTA 3R21A 4RX8A 3UMWA 2EU9A 5E8VA 5EOLA 1YOMA 5E92A 3SHEA 3AD4A 5KMMA 2PUNA 2YFXA 2JLDA 4EHGA 2RFEA 4FL1A 3BV2A 5BUJA 3MPTA 4V04A 2E9VA 4YTFA 2GFSA 3E3PA 4TYGA 4PMPA 3L8PA 2AUHA 2W96B 5D7VA 5HTIA 2XIKA 1GIIA 1BMKA 4RWIA 3E62A 2WB8A 4OR5A 3KFAA 2UZNA 2W5BA 3NEWA 3NS9A 3GOKA 3R9DA 3W2PA 2G2IA 4RRVA 3ZRLA 2CLXA 4FKGA 4RIXB 3GC8A 2OU7A 4BCHA 3Q5IA 5EW3A 5C1QB 3AC3A 5GJFA 5TT7A 5LXMA 5ACKA 3VULA 3QYZA 3I7BA 4D5HA 4BI1A 3FZTA 1U59A 3IW5A 4ITJA 3KREA 5FBOA 2HW6A 3U9CA 4ZLYA 2W4OA 2R3HA 4PPCA 3EHAA 1XH9A 2JDSA 4KBKA 3RKBA 4D4RA 2YIXA 5KMOA 3HYHA 4M97A 2OLCA 2C5YA 2F2UA 5DIAA 3SW7A 2GS7A 5AJQA 4ZJVA 3G2FA 2JITA 4O7WA 5CANA 3OW4A 3R8ZA 2ZOQA 5IPJA 4B8MA 1LUFA 4EWHA 4N0SA 3VUGA 5HX8A 4IXPA 3LXPA 4LL0A 5DH3A 4C4HA 5FTQA 5H3QA 3UQCA 2VV9A 4Q2AA 4EK8A 3VBVA 3TDVA 4QMPA 4M68A 2HW7A 3LFEA 2YJSA 3L8VA 4DGGA 2WFYA 3EQCA 1NW1A 3FLYA 1CKPA 5ETIA 3SG9A 3QRUA 5D41A 1ZYDA 1BUHA 2GMXA 2OZOA 3F2NA 3EFLA 4W4WA 5E8SA 3TV6A 1AD5A 1OPLA 4WIHA 4DG2E 5L8KA 2IG7A 3VC4A 4XG4A 3T3UA 4G1WA 4FTUA 4MVFA 5AEPA 1LEZA 4FKVA 1OIUA 2X6EA 3DY7A 4Q9SA 5ANIA 5LARA 2F57A 4IACA 5IDNA 3MDYA 4DFNA 4IM3A 3H4JA 3C4CA 3TKIA 4YZBA 2PE1A 3RK9A 3ZXTA 3LMIA 4ZTLA 3HA8A 2QOKA 4CFWA 2DYLA 1Q41A 2ETMA 5HEZA 3FLNC 1WBVA 1JWHA 2WTIA 4ZJJA 4IAZA 4LQMA 3P7BA 3JR1A 5CX9A 3R9RA 3VW6A 3ZBFA 4EQCA 1JKSA 4FKOA 3KF7A 3LIJA 2PU8A 4ZZOA 4QYFA 2UZTA 4J53A 4FVRA 3QU0A 3DJ6A 3W16A 3Q9WA 3VQHA 4C2WA 3SD0A 1H0VA 3PA4A 4RVTA 4ZEGA 1UNLA 2YIWA 5L2SA 4APPA 2X0GA 4UWCA 2ITVA 2PVFA 4FL2A 4F1MA 4TPTA 2YCFA 4L6QA 1IEPA 2ITYA 2ZAZA 3PIYA 5LWMA 1RDQE 1JOWB 2BRMA 3MI9A 4Z7HA 4RVLA 5AAGA 3GUBA 4L3JA 1E1XA 4W8EA 3BGQA 5CALA 4AT5A 4WOVA 2E2BA 4UXLA 5HNGA 1UU8A 4QPMA 2XK4A 2Q0BA
chains in the Genus database with same CATH superfamily
3NYOA 3DTCA 2R3NA 2IEWA 3V5JA 4M0ZA 5J5SA 1OKWA 2WHBA 2FSLX 4JNWA 5AP6A 5C01A 4O4CA 4TYEA 3PPZA 1XH8A 4E7WA 5L2TA 3W0PA 5CSHA 4QMXA 3BHTA 3ZEPA 2JBPA 5IQAA 3S0OA 4BFMA 3QQFA 2OJFE 4RLKA 4B6LA 3FPQA 1ZOGA 1ZYLA 1YDSE 3V51A 5K9IA 1PHKA 3BHUA 3DDPA 3IW7A 3OCBA 5IH5A 4TKSA 4NW6A 2XIXA 3HRBA 3UPZA 3BLAA 1F5QA 2JDOA 3QUPA 2CJMA 2FO0A 5E8TA 3CE3A 3CIKA 5IEVA 1LPUA 5ANEA 3RINA 3G9NA 4FF8A 4BTJA 4EK4A 1R0EA 3MB6A 3QL8A 4O6LA 3DOGA 4Y85A 5AWMA 4FE2A 4IAAA 5ANKA 4O4FA 4EOQA 5GIOE 2WIPA 3R0TA 5EI8A 3E8DA 3EQIA 4C4FA 5IQIA 2VZ6A 1M2RA 2XBAA 4YJOA 5HBEA 4D2RA 2QD9A 5BVOA 2BMCA 4CFXA 3P5JC 4MBJA 5DRBA 3BHYA 4DEEA 2Y7JA 3LQ3A 1BKXA 1SNXA 3KRLA 3KXNA 3OG7A 5TR6A 4HYHA 3JVSA 3V8WA 3BL9A 3HAVA 5TKDA 4F08A 4DGOA 4DBNA 3CPBA 2J5FA 4NTSA 5A4LA 4FTJA 2YACA 4J98A 4TXCA 4XLVA 5FTGA 2Z60A 3RTPA 3P79A 4XG7A 3M42A 2R4BA 1W84A 3WYYA 3VBQA 4ZP5A 4CT2A 3D5WA 4QMTA 4DH5A 3R63A 5EFQA 3KRJA 3UYTA 3RNIA 4ZLOA 3QQUA 3I5ZA 4LMNA 1BL7A 4V01A 5ETFA 1GIHA 5DG5A 5M4IA 4LRKA 2G01A 2QOBA 3IKAA 2G2FA 3WE4A 3IK3A 3KXMA 4MNEB 2C6LA 4EQMA 4FZDB 3MYGA 2XAOA 1H0WA 3AMBA 1V1KA 5D7AA 4M66A 4AZEA 4F7SA 1JPAA 3OXTA 2WMWA 3QZHA 2R0IA 4BDDA 3ANRA 3UOHA 4LOQA 4MXOA 3UNJA 4ZSGA 5EYDA 3V5PA 3FV8A 2REIA 3ZFMA 2V62A 3DBQA 2Z7LA 3SW4A 3PIZA 2V0DA 2FSOX 3VUMA 4EKKA 1PYXA 3DJ7A 3ZONA 2A4LA 4TW9A 2IVSA 3EYHA 3FPMA 3JPVA 3NMUF 4M12A 4A4XA 2BZKB 3TN8A 4EYJA 4XMOA 3MY0A 5HO7A 4YZMA 3BZ3A 4AW2A 2V22A 2ZM3A 4MHAA 4B8LA 3FL5A 3W2CA 4Z3VA 5IQBA 2GNIA 4A4OA 1UWJA 4D1XA 5IG1A 3HRCA 5TO8A 5EHYA 1WCCA 3K3IA 2VWBA 4ASXA 4K2RA 2PVJA 4KS7A 3K3JA 4FEVA 3DB6A 4FV9A 4IVDA 2WD1A 1G3NA 2Y9QA 4PL5A 4RIOA 5KBQA 3KCFA 3KVWA 1KE7A 3G6HA 4I6FA 2XEYA 4Z16A 4LYNA 5CF6A 1K3AA 4R78A 5EDQA 3DB8A 1XHAA 2C69A 4L43A 3LCKA 4OAUC 3L1SA 2IVVA 5ANJA 3BPRA 4MX9A 4KIKB 4BGQA 4PTCA 5BVEA 3EN7A 4QYEA 4CYJA 3OMVA 3VBXA 5FXQA 4ZZMA 4BDBA 1WBNA 5T6KA 2PK9A 1IASA 3GCUA 3I60A 3TIZA 3DXQA 5CXHA 1GOLA 3UVPA 2VX0A 1PRYA 3W0NA 1Q8TA 3RPVA 3RCDA 4X6RA 3P9JA 4C59A 3EYGA 3HLLA 3DBCA 4HZSA 4RQVA 4DCEA 1UNGA 1OBGA 1U4DA 3OBJA 4FZ7A 1NA7A 4UMPA 2XIZA 3EFKA 3FWQA 1GY3A 5KHXA 5EI6A 2QVSE 1OPKA 1RE8A 3FI8A 3LMHA 5C4KA 1M7QA 3MJ1A 4GL9A 4FT5A 4BHZA 2GSFA 2XK8A 4X2JA 5FP6A 2I1MA 4MXYA 5HG7A 2RFDA 3I7CA 2W1FA 1STCE 4C4GA 2X0OA 5BVNA 2JFMA 3Q9ZA 4AAAA 4JR7A 4MNEA 1PMVA 2ITXA 4NTTA 4CZYB 1ZZ2A 4M84A 2W0JA 4C37A 5I4NA 5K5XA 3D7TB 4O0XA 5J9ZA 2VTHA 4QMNA 3VS2A 3HV3A 2B0QA 5CENA 4NM5A 2VTRA 2FUMA 4D4YA 3QWKA 5J87A 3TJCA 4O7YA 4EONA 1X8BA 2QCSA 2RFNA 1Z9XA 2R0UA 3ZFXA 1KOAA 4DE4A 3EKNA 1FVVA 3NCZA 4E5WA 4EOPA 3P23A 1B39A 4RZVA 4W8DA 4P5QA 2VUWA 3GP0A 2F7XE 2JFLA 4PUZA 3SGCA 3FE3A 3AQVA 4PTEA 5HTCA 2GS6A 4GVJA 4EH7A 2GNGA 2EVAA 4QD6A 1P5EA 3GBZA 1PXLA 4L42A 4OBPA 2OF2A 1JAMA 4JAIA 2OZAA 4L01A 4AX8A 3Q5ZA 4MXCA 2YZAA 3TZMA 5KHWA 5AUWA 3C4XA 3MVMA 4K1BA 4I0TA 4XV3A 3H9OA 4DN5A 4F9AA 1WBTA 5DR9A 4EBWA 3ET7A 3ORPA 5AP7A 2OIDA 3RAWA 2WMSA 3DAEA 3NUSA 3LKMA 4KIPA 3D5VA 5BYLA 4L8MA 5BYYA 4NH1A 5KX8A 2QR8A 3ZO2A 4RWKA 3UDTA 2XK9A 3NVKI 3TL8A 1OIQA 4C4IA 2ACXA 3BKBA 4GK4A 4DGNA 2R7IA 4ACMA 3HDMA 5JGBA 5AV1A 3NFGB 4GG7A 2CMWA 4FKUA 4M14A 4X0MA 4PDYA 2GQGA 5E91A 2WQMA 4FI1A 1W7HA 4O0TA 4J95A 3KXXA 5A14A 1PMEA 2BPMA 3AC2A 5AR5A 4DH7A 5HU9A 3H9FA 3JVRA 2JBOA 3FYKX 3UE4A 1SVEA 3GU4A 4O0WA 4PNIA 5JH6A 2VWZA 5EI2A 1O6YA 2W7XA 3JY0A 4KBAA 4MK0A 2WO6A 3VHKA 4NEUA 4Y95A 3NYVA 4FTAA 4WA9A 2W1HA 4HOKA 4WD5A 2XCKA 2IZTA 2F2CB 2YCQA 3CLYA 4GT3A 4XBUA 4HVDA 3NUNA 5J9YA 4R7HA 4BCNA 4CZUA 4JG7A 4AXEA 3ZLYA 3I0OA 4L00A 4QO9A 5JMSA 2XJ2A 2J4ZA 4AQKA 1PMNA 3U4WA 4JJRA 3P7CA 3QALE 3EN6A 3VUDA 3D7TA 4XJ0A 5J5TA 5KE0A 3SVVA 2BRGA 3C5UA 3TZ8A 3R73A 1W2CA 2XMYA 4W9WA 2AEGA 3QTIA 1SVGA 4D1SA 4BCFA 4E6AA 3EKKA 4GS6A 2OIBA 1A06A 1U46A 3QTUA 2F9GA 5FWKK 4CKJA 4EH8A 4BIEA 4D5KA 3D83A 3VS6A 3WF6A 4EL9A 3NUAA 4YC8A 4G3EA 2BAJA 3Q6UA 5HD4A 5KUPA 1DS5A 2ONLC 5C9CA 4AOIA 2BIYA 5FEDA 2PVYA 2X0QA 5BUEA 4QP9A 4K77A 4U7ZA 3QTZA 5HBHA 1JSVA 3HMOA 3RVGA 1VLRA 3OS3A 4GYGA 3COIA 4UALA 4B0GA 5DNRA 3UIXA 3FQEA 2XH5A 3BQRA 5HOAA 5CSPA 2R3MA 4QDEA 2YM6A 2QOHA 3MFUA 4CG8A 5IA5A 5HU3A 3P08A 1XMMA 4DYMA 4AFJA 4DHJA 3TWJA 1S9IA 4O4DA 1GNGA 5K3YA 5IDPA 2PSQA 4I6BA 4BCGA 4FV7A 1J91A 2RFSA 4B7TA 3HMIA 4JRVA 2BAKA 5EYMA 5EOBA 3W10A 3QFVA 3ORXA 4BDCA 1GJOA 3I5NA 4YP8A 5HVJA 1OVEA 1WAKA 4FKSA 4M69B 2VX1A 3A8XA 3I1AA 1OB3A 3QKMA 4F64A 4BL1A 4BWXA 4BRXA 3AKJA 4RSSA 3QCYA 2YCRA 4UWBA 4EQUA 3QQGA 2W17A 3PSCA 1YXXA 5A3XA 3NAYA 1XH6A 5GNKA 1UVRA 4ZSAA 3UQFA 1YWVA 1H27A 2XS0A 5FLFA 5AR7A 2YCSA 4FK3A 1TQIA 3TUBA 3FL4A 5LVOA 2QR7A 3PXYA 4ZXTA 3KRXA 4GFMA 4CQGA 3TTJA 3ZYAA 3LMGA 3WE8A 1J7LA 1W0XC 3ZRMA 5HE0A 3RAIA 4FUXA 3LCOA 3CJGA 4FIEA 2PVKA 2UZUE 3OHTA 1REKA 4FKWA 4FC0A 5E8XA 2OI4X 5G6VA 3TUDA 2CNVA 2IPXA 1WVYA 2YAKA 3EWHA 4NSTA 3ITZA 3ZUUA 1XWSA 4OTDA 3LXNA 3PE2A 4A9SA 3F2AA 4CTBA 2VTQA 5C8KA 5IUGA 5JFWA 5HG8A 3ZRKA 4AFEA 5LMBA 2UW6A 2W99B 2ZM1A 3F82A 4C0TA 3QTRA 5F9EA 3ORIA 2QQ7A 4X2KA 4DT9A 2OH4A 1OGUA 3KU2A 1IA8A 3PJ1A 4QTEA 3MW1A 4ZSEA 4CRLA 3Q3BA 3NYNA 4C62A 5AUUA 4FIFA 3F3WA 2F7EE 3R2YA 3TT0A 2QU6A 3KGAA 4LMUA 4O0VA 1XR1A 3GOPA 1YKRA 4IVAA 5DI1A 3ZUTA 4J1RA 5A9UA 4U5JA 1BYGA 3S1HA 4EH2A 3KRWA 2JKMA 2OIQA 4R3RA 4U3YA 3WF5A 4DEGA 3R02A 4YPDA 5D10A 5IQFA 2OSCA 4HZRA 3QTQA 5CU6A 4DFBA 1V0PA 3OY1A 4IH8A 5ANGA 2XUUA 4PP7A 4D55A 3MIAA 2X2KA 3BEGA 3IW8A 3COHA 4X21A 5DT4A 4YNOA 3KKVA 1PF8A 4FOBA 4DC2A 4PWNA 4J71A 3V6RA 4RPVA 4M15A 2BRHA 4D2SA 3DK6A 2PULA 3OXZA 4C8BA 2HIWA 5D9HA 2CN5A 1K2PA 3FMMA 3LZBA 1H8FA 3ULIA 4JMQA 4R3CA 2GQSA 4M69A 3TNHA 4BKYA 2QI8A 3ZO4A 4FSWA 1ZY4A 3R8MA 4CMOA 4ENYA 3VS4A 3BL7A 4RVKA 4ACCA 4BDAA 3R9NA 4AXDA 2Y0AA 4I6HA 3IGGA 1M7NA 2X81A 5DYJA 5B2KA 2VGPA 3C1XA 2EB3A 3HVCA 3K5VA 2Z7QA 4RC3A 1I09A 5AP2A 2BDJA 3DTWA 3R00A 4IM0A 5CU4A 3RGFA 4A9YA 4QQCA 2ZV2A 4DEIA 2C3IB 2ZJWA 5KMKA 1B6CB 3DXNA 3QX2A 2IZUA 1FMKA 5EQPA 5A54A 4I5PA 2OBJA 4C02A 4U40A 3BYMA 4IANA 5DGZA 5DRDA 4FT3A 5JRSA 2WU7A 2I40A 5ETCA 3OWPA 4RIYB 4FEXA 4C4EA 4CYIA 2R3KA 3NSZA 2B53A 4KD1A 4R6VA 3VS3A 2C0TA 2OO8X 4NW5A 1H28A 1Y8GA 4QMYA 4IW0A 5IA3A 2BZJA 3R7VA 4W9XA 4D2TA 3JUHA 5TOZA 4HVSA 3IGOA 2UW5A 3TEIA 4FSTA 4DTKA 2H96A 1QPDA 4D2VA 3MVHA 1ZYCA 4NUSA 4ZS0A 2X4ZA 3E64A 4M3QA 2UW8A 3TM0A 2PVMA 3QCXA 5C26A 1FQ1B 2OF4A 2P3GX 3BLHA 1H1QA 2C3KA 3IOPA 2CDZA 5AV3A 3ZU7A 3N51A 3UYSA 5LVLA 4A9RA 2A1AB 1J7IA 2WEVA 4HPUE 2XARA 4Y72A 1FVRA 1REJA 2PZYA 2X2LA 1SMHA 4TWOA 3LW0A 3UZPA 5EQYA 3CTJA 3SOAA 1NY3A 2X1NA 3OOGA 3W2SA 3FAAA 2OG8A 3SRVB 3ZLXA 5K5NA 2J0KA 2CKEA 3HL7A 5CF8A 3D7ZA 3FMNA 2HZNA 3FMLA 2GTNA 5GIPE 5ANDA 4Y46A 2VWWA 5FEQA 3ORZA 1L8TA 4F0FA 3KVXA 3L8XA 2BAQA 4AA4A 3W0MA 2UW7A 4ASZA 4KUJA 4JQ7A 4JT3A 5D1JA 4G6LA 2ITOA 3UGCA 4AXCA 1ZZLA 3UNZA 2WIHA 1Y6AA 1YW2A 4AGWA 4BI2A 2OWBA 2VWYA 4IEBA 4WNKA 4BDKA 4V05A 4I6QA 2BHHA 4QNYA 3KA0A 2C3JA 3QHWA 1TFFA 4MXAA 5CNNA 3LJ2A 4DCAA 5M4UA 4E6QA 1T46A 4HCVA 3OTVA 3HV6A 3WARA 2X9EA 4FZAB 5I3RA 5H8GA 4FV8A 4PP9A 3QQLA 4Y8DA 5IF1A 4WG3A 3PWYA 4D9UA 3P5KA 2BTSA 4FICA 4FKQA 4XG2A 3FY0A 4GIHA 5AX9A 3KN5A 2VTNA 4J52A 5AV2A 4XOYA 4O81A 1YHWA 1TVOA 4DF3A 2ITUA 4TWCA 2B9HA 5HG5A 2AQXA 4M8TA 4AE9A 5BUIA 5CEMA 2X4FA 3QKKA 3ZC5A 3IDCA 3DZOA 4FV4A 4RIYA 3EN9A 4JDHA 1H01A 4IZYA 4RQKA 2PUIA 2C5XA 4JBPA 4RZWA 4S33A 3I79A 4ID7A 1Q5KA 4LV8A 3GQIA 4UMRA 4NFMA 3RMFA 1ND4A 5AIKA 4FTMA 5E1EA 4MQ2A 2EXEA 4GV1A 4D58A 3R6XA 4JBQA 5CI6A 4LGHA 5DMZA 1QPJA 2O65A 3HGKA 5DT0A 3VJOA 3UODA 2W1ZA 4UN0C 1Q3WA 4OTIA 4DFZE 4EJ7A 1WVXA 3M2WA 4AGDA 3NWWA 3ULZA 4QDVA 4RJ7A 3OD6X 3LE6A 3QX4A 4P90A 2I7QA 3FI4A 4M0YA 2WMXA 5F20A 5DR2A 3R9OA 3MWUA 4C7TA 1KUTA 5IQHA 4YC6A 3WZKA 4E5AX 3O51A 4YHTA 3EQFA 3OUKA 2R3RA 4D0WA 4ERKA 4IE9A 2BZHB 1AGWA 2X7OA 1IA9A 3FC1X 3BX5A 4I93A 4JX7A 2WPAA 4CVAA 3HECA 3S00A 4F78A 3HRFA 3SKCA 3GFEA 3AC8A 4JQEA 4NKSA 1O9UA 2A2AA 3ORTA 5F4NA 3ACJA 4DEHA 5JGAA 4D0XA 4Z55A 3MY1A 1PXPA 3BWJA 2C0OA 1K9AA 5I5ZA 3A4PA 5L6WL 4YJVA 3VQUA 3PZHA 2UZBA 3C4FA 3WIGA 4WUNA 3QF9A 2WGJA 3DT1A 3AMAA 4BC6A 1KWPA 2XCHA 1BI8A 4IJ9A 3WBLA 4IMYA 4BYJA 1Q24A 3PE1A 2BILB 5BVKA 4CQEA 4AS0A 3O8PA 5AM6A 2UVYA 3TIYA 3ZTXA 2I0EA 3LLTA 3W0QA 3MSSA 4YTHA 3NIEA 1KV2A 2WEIA 3P86A 3TACA 5CU2A 4AU8A 3UOJA 3G90X 4IX3A 4AXFA 3VBYA 3NUUA 4JLCA 1OL7A 2XYNA 2NRUA 4MD7E 4RWLA 3LFBA 2WOTA 1ATPE 3EQPA 4IZ7A 4ONAA 5AR8A 2PUPA 3WZUA 3K2LA 2WMVA 5M4FA 2I0HA 1W83A 1GZOA 3TKHA 2WOUA 1VYZA 3PLSA 2EB2A 5EDRA 3UG1A 5AP0A 3VN9A 4DLIA 5IA1A 3PY0A 4O0SA 1IR3A 1OL5A 2WMBA 4RFMA 3F61A 2UW3A 2UVZA 4IFCA 4BIDA 5L2QA 2ONLA 4YO4A 3AKKA 5I9WA 4GUBA 4RIXA 3VUHA 3KK8A 3ELJA 3L9MA 5EYCA 2UUEA 1OPJA 3R8PA 3HP2A 4PL3A 3GCVA 2ITPA 3IO7A 4I23A 4KAOA 3R7UA 3VNTA 4BDGA 5A46A 5CXZA 3LLAA 5D12A 4H3QA 5GZAA 4QP7A 3PPJA 3VO3A 2GQRA 2XK6A 5M07A 3Q2MA 4MAOA 5F95A 1PMUA 1NT2A 4F7JA 2QO9A 3OXIA 3BBTB 2XBJA 4LGGA 3OF0A 1UKHA 2PMLX 4FTKA 5AAFA 4DEBA 2PTKA 2FSMX 3AT3A 4CLJA 4CFUA 2ZDUA 4HCTA 2WTWA 3KRRA 3N9XA 4HVHA 3GC7A 4MYGA 2VTLA 4CZTA 2YLEA 3ACKA 3ATTA 5CAQA 3Q4ZA 3OT3A 1ZLTA 2V5QA 3FKNA 2O0UA 4GJ3A 4OUCA 2GS2A 4FA2A 3UZRA 4LUEA 4S31A 4Y83A 2W1CA 3MH1A 4I4FA 2XNNA 3O2MA 5AUVA 4AWIA 4PTGA 5AM7A 2BFXA 3W2QA 4BCQA 1FGKA 4JXFA 3CSVA 4CV9A 3FY2A 2NNWB 1GAGA 2BRNA 4IAFA 2B9JA 1FPUA 3PTGA 4QP3A 4NYEA 4ZTQA 4C34A 3BLQA 3O17A 1NVQA 3QQKA 3PVUA 3QLFA 4A7CA 3KK9A 4DGMA 3FHRA 3UVRA 2C6KA 2CNQA 3VS7A 4R5SA 1OMWA 4JR3A 2XM8A 2WQBA 2ZB0A 2CGVA 3F3UA 1XKKA 4IAKA 4YJPA 4E73A 5TF9A 5KMLA 2BTRA 2W1EA 3ZZWA 1YI3A 4GEOA 3VBTA 1Q8YA 4AQCA 3VS5A 4NFNA 4G9RA 4OTFA 3W32A 1UU9A 2IW8A 1FVTA 1U5RA 4FX3A 4TYJA 4LI5A 1YXVA 4CCBA 1RJBA 3P4KA 4TY1A 1BL6A 1ZOHA 2XP2A 1CTPE 4OW8A 4YJUA 2OW3A 2QOFA 1OUYA 3CC6A 1T45A 4G5JA 4WRSA 5K4JA 4N57A 3ZDIA 3CP9A 3Q9YA 3FXXA 4UYNA 3AC4A 4HGSA 3CGOA 5EW8A 4ZTNA 1UWHA 3PXQA 2YM3A 3DU8A 2XZSA 4ZTRA 2BALA 5HX6A 2ERKA 3MTFA 2R9SA 5EG3A 3TZ7A 4F7NA 2OK1A 3RI1A 1J3HA 4A9TA 4QYGA 4O7NA 4WT6A 5CVHA 3ZC6A 5FP5A 4XLIA 3Q04A 3RJCA 2VWVA 4EOOA 3QD2B 2J90A 2VTSA 4IX6A 3QRJA 3O96A 4WSYA 5GZ9A 2O63A 3VWAA 4E4MA 2JIIA 4DFYA 4U44A 1R39A 3IG7A 4QTAA 3DBDA 4YLJA 3ZM4A 3MA6A 4MQ1A 3CXWA 3QQJA 3ID6C 3NR9A 3OWJA 3QAME 2HYYA 3ZXZA 4FMQA 4W4YA 4QMZA 2PMIA 3PUPA 3ZM9A 3NW7A 5LCJA 4EUTA 4J7BA 1WFCA 4IVBA 5C4LA 2IO6A 4I0RA 1URCA 1Z5MA 3NVMB 2YITA 4AG8A 5DT3A 1ZARA 1JVPP 3VS0A 4AN3A 2QODA 4EOMA 2C68A 2HWOA 2QG5A 3ZO1A 1OL6A 5JEBA 3FKOA 4ASEA 4J8MA 2C6MA 3V3VA 1CMKE 3UO5A 4QTBA 5HVKA 2PMNX 2X7FA 3L9LA 3RHKA 4UBAA 3HV5A 5FM2A 4ANLA 4C57A 4FYOA 1OZ1A 1FGIA 5CT0A 4E1ZA 4F7LA 5CEOA 3PRIA 1JKLA 1I44A 2DUVA 3PWDA 4Q5HA 4TYHB 4Y5HA 5AV4A 5E9EA 4OTGA 4J8NA 4DBXA 5M53A 3I6WA 3QXOA 3FZPA 4ORKA 3C50A 4BIBA 3BIZA 3GQLA 2CGUA 3CS9A 4EH9A 2HK5A 4QMSA 4OAVB 3PIXA 5GJGA 4FKLA 4L7FA 5AAEA 4FIJA 3KXGA 4FSRA 4UYAA 4L3PA 3UOKA 2W9ZB 2PYWA 1VJYA 3ORKA 2KULA 5IA4A 3E7OA 1PXKA 3NUXA 4GYIA 4MBLA 5DR6A 3PXFA 3MH2A 4RMZA 4S2ZA 4E4XA 1H07A 4NCTC 4UWYA 4F65A 3E8EA 4F9CA 3ZO3A 4FVQA 5CLPA 4QT1A 3MTLA 4FGBA 3FSFA 3DKOA 3FDNA 1OL1A 3NRMA 3HMNA 2CHLA 2YM8A 4YGAA 3ZDUA 4EH6A 2NP8A 4ZOGA 3P78A 3DV3A 4RWJA 5BPYA 3R8LA 3T9IA 3TKUA 2BVAA 5CYIA 3A7HA 5FXSA 3U87A 4C38A 4F4PA 5BX0A 1Q97A 1NVSA 2ZMDA 2YABA 4FSYA 3BHVA 2VO7A 1MUOA 4AZSA 1OL2A 3TTIA 2UV2A 1BX6A 2WTVA 3LQ8A 3BYOA 4F1TA 4KB8A 2RKUA 2UZVA 2ZB1A 2X7GA 4A9UA 4QEBA 4BJJB 4FKPA 5DN3A 4BGHA 5C8MA 1UNHA 3TDWA 1YXUA 4JX3A 2P4IA 4EOLA 3V6SA 4EYMA 5JQ5A 3F2RA 2C5NA 2ZDTA 5J79A 4DEDA 1G8AA 1W2DA 3QLGA 2IVUA 1ZWSA 3RWPA 3RZFA 4FJVA 4O83A 3FMJA 4KSPA 3KN6A 3QD4A 4MEDA 1LR4A 2HXQA 3A7JA 4O27B 4O96A 5BVWA 3REPA 4AZWA 5IZFA 3FEGA 3AD5A 4PDSA 3IW4A 1WBSA 4PL4A 4FIGA 4FNWA 2OJJA 5CEQA 3A8WA 3A62A 2UZOA 3F69A 4I0SA 3V04A 4FV5A 4O86A 3MPAA 2B1PA 2UVXA 4LGDA 3HX4A 4YBJA 1WMKA 2R5TA 1P2AA 4IB1A 4U0IA 3A99A 4O6EA 4O1OA 3EL7A 4YU2A 5IEXA 3KQ7A 3R8VA 1G8SA 4KIKA 4USEA 3A60A 3FKLA 3MY5A 4LOPA 4B4LA 3CEKA 2CLQA 3OFMA 3ORNA 3PVBA 2WMTA 3QXPA 4MKCA 2JD5A 4PX6A 4O7RA 3U55A 4ZLZA 1H00A 2VX3A 3R28A 4FBXA 4FVPA 4NJDA 4FEWA 4ZS4A 2J7TA 5DFPA 2XNOA 4XP3A 4NT4A 4EORA 4HYUA 5JSMA 3R7IA 2P55A 4XP0A 4FSUA 5M4CA 3TJDA 3S95A 3WI6A 3N4TA 4O7ZA 2PY3A 3PDTA 2F4JA 3BQCA 2H6DA 3IONA 4AGCA 5AR2A 4X6QC 3SDJA 3F3VA 4L67A 4X2FA 5EM5A 5IH6A 1QPEA 4RIWB 4XS2A 1FOTA 3QZFA 3GCQA 4J96A 4WRGA 1B38A 3QGWA 2XK7A 4IVCA 4K6ZA 4XCUA 5CS6A 4ZTHA 4FKIA 5FTOA 2WTJA 1CSNA 4LOOA 5FGKA 4BWKA 4CGAA 3CTQA 4O4EA 1Q99A 4YO6A 4EC9A 3D9VA 3ALOA 3L8SA 2GNHA 2W4KA 1M2QA 3F3TA 5K4IA 4CMUA 4OLIA 4RLLA 3NZ0A 3WILA 2OKRA 4H3PA 4HGLA 4E4LA 3BE2A 4Z9LA 4KIQA 1OITA 2UW4A 5LOHA 3LOKA 4AA5A 4JBOA 4U42A 5H2UA 1DAWA 4YJTA 2YAAA 4EK6A 4I94A 5HI2A 4BCPA 4FG9A 3F5UA 4CRSA 5IQDA 3KL8A 1SVHA 4QP1A 3WZDA 5EM7A 4EH5A 5E4HA 5B0XA 4BTKA 2BDFA 1M2PA 5FXRA 3QZGA 1J1BA 4TL0A 4BJJA 1IRKA 3OBGA 1ZMVA 2XM9A 3EMGA 4FT7A 1H25A 3IS5A 3MA3A 4H36A 3BYSA 2XB7A 3NW5A 4V0GB 4D28A 1ST4A 3NW6A 4IC7A 4U79A 4I20A 3EJ1A 3ZHPC 2X39A 2ETKA 3OCGA 2OXYA 4E5BA 3E7VA 3R01A 3RPOA 1XJDA 4ZK5A 3TMOA 1OKVA 5HIEA 3GT8A 1NXKA 1V0BA 4FK6A 2Z02A 4QMWA 4XG6A 3LCTA 4EBVA 1KSWA 1DAYA 3T9TA 4O0UA 2XK3A 3MESA 4IIRA 2JEDA 2F49A 2P33A 2XJ0A 3IPHA 3ODZX 3IQ7A 3DK7A 4GH2A 4PDOA 3LJ1A 4U8ZA 5IMEA 2QG7A 3ODYX 4BKZA 5I9YA 2W05A 4CD0A 2QKRA 4FZ6A 5EKOA 4BDJA 1W2FA 4XRJA 2HELA 5DBXA 4NM0A 3GENA 4CSVA 4F1OA 3AC1A 4YLLA 1YVJA 1J7UA 5BV3A 4C3PA 3GC9A 4AW5A 5CSXA 5L6OA 3QGYA 5HBJA 4CEGA 3C0GA 3PG3A 5H8BA 3D2KA 5KBRA 2BZIB 2C5OA 5FRIA 3RM7A 1Q4LA 3ETAA 3FZSA 3MGYA 4FTIA 4IWPA 3BBWA 3WYXA 1OKZA 1KE6A 4IX4A 4MD8E 2PPQA 1WVWA 5A6NA 3V5LA 3ATSA 2IN6A 3K54A 5I9UA 4KABA 4BDHA 4BR3A 3U9NA 3AT2A 1Q3DA 2ITTA 2Y6MA 3EZRA 4G3GA 4A4LA 4BN1A 2BROA 1XH7A 3CD8A 4RIWA 4FEUA 4YR8A 2W1GA 2OFUA 3SRVA 4BTMA 4F0IA 4RJ6A 3SXRA 4N70A 3O7LB 4ERWA 3G0EA 3R2BA 4FIHA 1M14A 4KBCA 5LJJA 2WQNA 3BYUA 2HAKA 3PA3A 4FTQA 4G16A 4GRBA 5DVRA 3LVPA 3QQHA 1W8CA 4N4SA