3IDBA

Crystal structure of (108-268)riib:c holoenzyme of camp-dependent protein kinase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
343
structure length
341
Chain Sequence
KGSEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel isoform-specific interfaces revealed by PKA RIIbeta holoenzyme structures.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
total genus 108
structure length 341
sequence length 343
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3idbA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3idbA02
4DAWA 3GT8A 5HVKA 3NVMB 2VTPA 2WIPA 4EK5A 2PMIA 4XRLA 4L9IA 4YPDA 4ARKA 3LQ3A 3ELJA 2JFMA 4K77A 4L44A 2JKKA 4OGRA 3GOKA 1PKGA 2ERKA 3GBZA 5FXSA 5H3QA 4U6RA 2XIYA 4QNYA 5KX8A 3VBTA 4NM7A 5HNBA 2WPAA 4J8MA 4BZNA 4C57A 3PSCA 3QUEA 2BRMA 4YZCA 2FSLX 4DTKA 5J9LA 3VS3A 3B2WA 4O7SA 3PPJA 4GCJA 2HY0A 2PVRA 3R73A 5AR2A 1W84A 4GT3A 4USEA 1XQZA 5LWNA 2PHKA 4DA5A 5AUXA 3JVSA 2VTNA 3QTZA 2OW3A 4AUAA 5JFVA 3QWKA 4FT3A 4O1OA 3Q2JA 2J0IA 2WOUA 3ORXA 5IA5A 2BFXA 5CU3A 2YEXA 3TNQB 4WD5A 2VO6A 5AADA 4H1JA 3HYHA 4NH1A 4U81A 4MXAA 5GJGA 4EJNA 2OICA 2YCQA 4W8DA 2VTLA 2WEVA 4WSQA 2W1HA 4AAAA 5C26A 1ZOEA 1P14A 4C4HA 4OTFA 1W82A 1L3RE 4E4XA 4ACGA 1PXIA 3FLSA 5CT7A 3OBJA 4C61A 5C8KA 3VRYA 3NW6A 3ORIA 4YJNA 1SMHA 4I92A 1KWPA 4F9YA 3PVUA 3ZUTA 4GRBA 1BKXA 2BZKB 2CJMA 2VTQA 4WG4A 1PHKA 3VS1A 2VTMA 4WNMA 4OLIA 3WZEA 4A07A 4BGQA 4ZIMA 5IA4A 4HCVA 1ZY5A 5KZIA 4GW8A 4K6ZA 3ETAA 4GSBA 2JC6A 3DA6A 4FKQA 3SLSA 3U6IA 3PVWA 4DG3E 3NW5A 2GTNA 5AR8A 1GAGA 3KCKA 4YZ9A 3CE3A 4BTMA 1YXXA 2PVYA 2OU7A 3R02A 4PPCA 1M17A 3QGYA 3UIBA 2J5FA 2A1AB 4PQNA 3LM5A 4RFMA 4YR8A 4YHJA 2CKOA 3GC9A 4FIGA 2FB8A 2UW8A 4C3FA 2IVTA 1JKLA 3SKCA 3VS6A 3MH0A 2A27A 5D9HA 5DG5A 3R1QA 3O0GA 4YP8A 4RFZA 4BI2A 2FUMA 2Y4PA 3WZDA 1KE5A 2WIHA 4Z55A 1W98A 3PPZA 4O38A 4ZXTA 2BFYA 3AC1A 4QOXA 1BLXA 4XUFA 1VJYA 4FTKA 3OD6X 4AN3A 4L3JA 2VX3A 4NJDA 2OH0E 3NIEA 4HW7A 3VF9A 1UA2A 3BLHA 5B0XA 5AP5A 4RX7A 4S33A 3EN5A 4WSYA 4U43A 3V6SA 3REPA 3G0EA 3ZXTA 5LMBA 4RC2A 5JQ8A 3V3VA 5B7VA 2XCHA 2X1NA 5AP1A 3W2RA 2RG5A 4AW0A 1PJKA 3UVQA 5KMNA 1BL7A 1JPAA 3O7LD 2XS0A 3F7WA 3OCSA 5KMOA 4TYEA 4F9AA 4ZY5A 4CGAA 2CSNA 5IZFA 2X8IA 3KU2A 1PY5A 3GGFA 2Y4IC 3PXKA 4EZ3A 4FZAB 4MBJA 4JDJA 3GCPA 3WF5A 5K0KA 3WIKA 4PF4A 4YZNA 3EQRA 1ZAOA 4DHFA 5JGAA 1RE8A 3I6WA 3EN6A 4BIDA 3DTWA 3G51A 4GFOA 3ATTA 2ITUA 3FQEA 4GIHA 4PDPA 2B4SB 1U4DA 3AT3A 4ERKA 4WNKA 1QMZA 3F6XA 4EWQA 2HIWA 5HESA 4CMTA 3HP5A 3PE2A 3R9DA 4X2GA 4EQCA 5AV2A 4FV0A 3CS9A 3DKCA 3NW7A 3DBEA 2W1GA 4FX3A 4O84A 4ONAA 3R01A 5DH3A 1AGWA 2WAJA 2FA2A 5GIOE 3UTOA 4I0RA 3ALNA 5FM2A 3MW1A 4J98A 4TYGA 3SXSA 2I1MA 2ETKA 2VV9A 1Y8GA 5FXRA 3BYVA 5DGZA 4EWHA 3LVPA 1XO2B 3BELA 2OGVA 3OW3A 2PZPA 1PMNA 4NW5A 4FSTA 2P0CA 4TKSA 4FVPA 4IX6A 3ZHPC 4PPBA 1H1PA 3BBTB 4QMWA 2Z2WA 3CJFA 4CFVA 4GKIA 3NS9A 2PUUA 4W4XA 1F5QA 1OL7A 2GNGA 3UJGA 3FXZA 5HX6A 3MV5A 4W9WA 3BLRA 3SW7A 2CKEA 2VWUA 2YN8A 1XH8A 5J9ZA 3I1AA 4GL9A 4MAOA 2FVDA 2WO6A 3ORNA 2YM7A 4XG2A 5AV1A 3VJNA 3VUMA 3BEAA 5BUIA 1JWHA 3BYSA 4O27B 3AQVA 3R8VA 3LCKA 5L2IA 5IQHA 3MPAA 4BDAA 3ZFMA 4QPMA 2C6KA 3UPXA 2UZOA 3FZRA 4WNOA 5M44A 4AN2A 4BDKA 5D41A 2W4KA 1GNGA 2XIRA 3POOA 3PIZA 5T68A 2P4IA 1PXJA 4X21A 4O81A 4YO4A 1LR4A 1MUOA 3TV6A 1FGKA 4BDJA 3QQGA 4R3CA 2W1IA 2RL5A 5HG9A 2J51A 3NR9A 5LXMA 1XBAA 4O83A 5IQDA 3LOKA 2YA9A 4YHFA 4IC8A 3NRMA 3EKNA 2J90A 1GZKA 3QQLA 5DEYA 2JBPA 3UO5A 2YM6A 3R1YA 1WVWA 2PZYA 3LQ8A 2C3JA 3DAKA 3DGKA 4BKJA 4L8MA 2PE1A 5CY3A 3AGLA 1L8TA 4DH8A 1YHVA 4YURA 5A4LA 2OWBA 2F4JA 3A7HA 3H0YA 4I94A 3TTJA 3VBWA 2HY81 2OFVA 3CLYA 4G5PA 3W55A 4LYNA 4TPTA 3TJDA 5EFQA 4BICA 4UMRA 5M4FA 4QQ5A 4GUEA 3EQHA 3TDWA 3BGZA 3OEZA 3D7ZA 2CNQA 1R1WA 5KKRB 3JXWA 3L9MA 3EFWA 3LFSA 3VRZA 4NFMA 4FEWA 4F6WA 3LFFA 4AZWA 5L6OA 5GINE 3GQIA 3E3BX 3Q9XA 4N70A 4RWKA 4QPAA 2QOOA 3QKKA 4XG3A 1SVEA 4IB3A 4TWOA 4I0SA 4PL3A 4YJOA 3T3VA 1GIJA 4QPSA 1H1WA 4FC0A 5CF8A 4D1ZA 2CKQA 5D10A 3NAXA 1OIUA 3MA3A 3AD6A 4DEBA 3H9RA 2A2AA 3COKA 4LRKA 1GZNA 4IWPA 4FTJA 3UMXA 4AZVA 4FNXA 5FTQA 3S4QA 2C6EA 1XH7A 2BDWA 3GQLA 3IS5A 4FTQA 3DQXA 3Q9ZA 3SXFA 5LWMA 2NP8A 4XG4A 1PMUA 3MFSA 2VTHA 3PXFA 4XLIA 4JJRA 4MWHA 4XNEA 2GFCA 2YLEA 3GC8A 5CS6A 3FY0A 3A2CA 3UG1A 3PJ1A 5DR9A 4J7BA 3W8LA 3F5XA 2CGUA 3VW6A 4F0IA 2OIBA 3ENHA 3TZ8A 5HVYA 3OTVA 4LMUA 2OBJA 5IDPA 2CLXA 2WTIA 4ALVA 4APCA 5C03A 2VGPA 4WBOA 1ERKA 1JVPP 5AFVA 1YOLA 2C3KA 1PW2A 1U46A 2HCKA 4R7IA 3L8PA 5L3AA 3LHJA 4QQJA 1YXUA 4O0RA 2PVKA 4D1SA 4C59A 3PLSA 3HECA 3HUBA 3NDMA 3FV8A 1ZMVA 4EK8A 4YJUA 4CTBA 2HAKA 4QP6A 5CSHA 4FG9A 1ZARA 3C5UA 1OI9A 1NVSA 2YAKA 3FBVA 3RI1A 4E93A 2PUNA 3U4WA 2OXYA 4PRJA 5FG8A 4MCVA 4IZ5A 4MD7E 3HEGA 5KBQA 5KNJA 3FMDA 4OTWA 2XYUA 2X2MA 4RJ6A 2IVVA 2X2LA 4HOKA 3PZHA 1YDSE 4UZDA 2Q0NA 4USDA 2LAVA 4C34A 4IVBA 3TIZA 5ETCA 4AZEA 5LVOA 4KKEA 2QU6A 3KXMA 5HBHA 5HD7A 4IC7A 3QTIA 2LGCA 3NYVA 1M52A 4ZS4A 3PY1A 3PIXA 2V62A 5K0XA 3E8DA 4WOVA 4F99A 3UPZA 4QP2A 2UUEA 4ALWA 4JR7A 3D15A 4BIBA 4YLKA 2JDOA 4ZZOA 4MF1A 2YIYA 3OY3A 2BVAA 5GZ9A 1PRYA 1UVRA 1YKRA 3TNWA 3TXOA 3Q9WA 4IZYA 4EH9A 2R3LA 5FQDC 4CV9A 3F3ZA 3LCSA 5EM7A 2BUJA 3MN3A 4HYIA 2PVFA 1FOTA 1APME 4FKSA 4ACMA 3R9OA 3R8PA 5CU0A 2X7FA 2C30A 5J5SA 4EJ7A 3E62A 5LVLA 2HELA 2XUUA 4O0VA 2R2PA 4JDHA 3KN6A 4M69A 3ZC5A 4EONA 4F7JA 2E9NA 5JH6A 4G16A 3DK3A 4NU1A 4EOLA 3G90X 4IAKA 2H96A 1WBSA 4DE4A 4MWIA 3OZ6A 3FEGA 3QD4A 4EH7A 3OCGA 3QUPA 3R63A 5JGBA 2X9EA 4DG2E 4FK6A 1UNHA 4PV0A 3A7GA 3QBNA 4QMZA 4D55A 1IG1A 1V0PA 5H9BA 2VTTA 4C37A 4E3CA 2V7OA 4M68A 3HV6A 4YSMA 5E8WA 5BVWA 2YZLA 2RIOA 4FT7A 4GFGA 3R9HA 3VHKA 3FLQA 5LARA 4RIWA 3W32A 1UNGA 3R7GA 3FMHA 4J8NA 4XOZA 4PDYA 3R7YA 3PWDA 4NFNA 4AG8A 4EI4A 5KKRC 2PSQA 4R78A 2W96B 3I5ZA 3NAYA 2DQ7X 2JGZA 4ID7A 4RWIA 5E91A 4ITIA 3UIUA 4AGWA 1Q41A 4H05A 3UOLA 3V51A 2CNVA 3O71A 4XLVA 2J4ZA 2QR7A 3TNHA 1Q8WA 3BE2A 4X3FB 4ANNA 4DEDA 3SG8A 3PA4A 3QQUA 3ALOA 2X8DA 4M8TA 4AT4A 3DLSA 4IJPA 3TTIA 1FBNA 4UWCA 4FNWA 3G33A 5AIKA 3AC8A 4APPA 1OUKA 2XK9A 3G0FA 1ZYCA 5I9YA 3PJ3A 5EQYA 3EL8A 2XNNA 1Q8TA 4FGBA 2HWPA 1CTPE 4FA2A 2XKDA 2BRHA 1YW2A 3V5PA 2QD9A 3FXXA 4X2FA 4FV7A 4EKLA 4MNFA 3KRWA 4HPUE 2JAVA 4O7WA 1YOJA 2JKQA 2R3RA 3RAIA 1PMEA 3IDCA 4FSMA 4H58A 3UE4A 4EOPA 2XM9A 2CCIA 2QO7A 1UKIA 4ZSEA 4PY1A 2J5EA 5AWMA 4OBPA 5KMLA 4O96A 5IU2A 3VWAA 3KXGA 4QYFA 4IW0A 1T45A 2OJFE 3AC5A 2WTKC 3BKBA 2IZUA 3EL7A 2PPQA 1CSNA 4CT1A 3TUCA 2PK9A 4KKGA 4C4IA 3BV2A 5HO8A 5L6PA 1DS5A 2E2BA 4AZFA 2C5YA 4JOAA 3KRRA 5EW8A 4QP8A 4WG5A 2YJSA 5EG3A 4DGMA 4KWPA 1U59A 3ATSA 2XEYA 2YM4A 1ZLTA 3NUAA 3ZRLA 5DA3A 4AGCA 3OWKA 5HCYA 5DBXA 3PVBA 4X6RA 2WFYA 3ZYAA 5JQ5A 4O7ZA 1GIIA 4O0YA 1H26A 2ITYA 5EDRA 2UVZA 1E1XA 2ZV8A 1YDTE 2VWZA 4P5QA 3TG1A 1BX6A 1E9HA 3EHAA 4OW8A 4RJ7A 4ZTLA 1JAMA 3W2OA 4E6CA 5AV4A 4KUJA 4O7YA 5LJJA 4ZSAA 3HGKA 5BPYA 1Q3WA 2XK6A 4BDFA 3SQQA 4LUDA 4RLLA 1U54A 3FHIA 3VBQA 4FTMA 4CFFA 3LPBA 3S1HA 3OBGA 1OL1A 1OL6A 4QMSA 4O0XA 5ANKA 4JXFA 2C5OA 4BKYA 3RPVA 2VTSA 2IJMA 2BKKA 3R7IA 4F7LA 1PKDA 3CKXA 3PG1A 3D7TB 4BTFA 1PXPA 4CTCA 3Q9YA 4Z16A 2DWBA 5I0BA 2B7AA 4YUQA 2R3GA 5J7HA 4WA9A 3COHA 1P4OA 5M53A 4R1YA 4CRLA 2WMBA 2ZOQA 4FF8A 4M97A 3UG2A 4BCIA 4XBRA 3FLZA 4CLIA 4EOQA 2CN8A 3CBLA 3PP0A 3W8QA 2HK5A 3QRUA 2VWYA 4KD1A 4NWMA 2RG6A 3W1FA 5BVFA 5CALA 3CD8A 4PTEA 4RJ4A 4O7RA 3BHYA 2VAGA 1IEPA 4N4SA 4CFXA 2Y6OA 5JZNA 3D4QA 1KSWA 4FYNA 5KE0A 3EOCA 1ZYSA 4KRDA 4KSQA 5TKDA 4C0TA 5I3RA 1Z9XA 4IADA 4IAAA 2OJJA 4FZFB 2IZRA 5HIBA 1TQPA 3G9NA 5EOLA 2P55A 4RIOA 2R0UA 3E64A 1WBVA 4GYGA 3FZTA 4IXPA 2H6DA 3BI6A 5KMIA 1S9IA 3FZSA 3Q04A 4Y5QA 4S34A 3P79A 1JNKA 1SVGA 3POZA 1Z5MA 2HW6A 2QHNA 3DB8A 3DKFA 3T9TA 2UW7A 4R7BA 1U54B 4JQ8A 2O8YA 5DI1A 2NO3A 2UZVA 4X2JA 3BQRA 3B8RA 2R3NA 4BCPA 1WMKA 3FYKX 4CCUA 5CAPA 4H3BA 3H9OA 2Q83A 4BDEA 1LEZA 5CAOA 1ZYJA 5K9IA 4BGHA 5IMXA 1IR3A 4FIIA 4FKOA 4G3GA 1CDKA 5DR2A 3FPQA 2YITA 3MTFA 3FLYA 4K0YA 5BUJA 5FBNC 3N4TA 1YQJA 2W17A 3GEQA 3OY1A 4XJ0A 2ONLA 4D58A 3MA6A 4YMJA 2HYYA 3EFLA 2C47A 3A4OX 4LQMA 4AZSA 2PUIA 3LFEA 3NNWA 5L2SA 1UU7A 2VWWA 3HLLA 3QQJA 4FNZA 4OAUC 2UVYA 3BPRA 3VN9A 4PL4A 2WNTA 3DT1A 5GJFA 1YI6A 5IQGA 2R3HA 3O51A 5H8BA 2C5NA 2QONA 5F1ZA 3UP2A 3EB0A 1RQQA 4J1RA 5HE1A 3V01A 4R77A 4F0FA 3FAAA 1PXLA 4D9TA 2PTKA 2F2CB 3JS2A 4CMUA 4EOIA 4F0GA 4U42A 4ENYA 2YWVA 4FEXA 4BBEA 4J71A 2GPHA 4OTDA 5AP7A 3C0IA 3FI3A 4CD0A 2QG5A 1GOLA 5EHYA 3VS5A 4TXCA 2UW0A 2C6LA 4CMOA 4OTHA 3VUDA 3IG7A 5M08A 1PMVA 3I79A 2XIKA 4RRVA 3ZUUA 3DB6A 3BHVA 4ZTNA 4GJ3A 4IZ7A 4F08A 4I22A 3QFVA 2X2KA 4RJ8A 1OUYA 3EFJA 1PXMA 4RQVA 5AR3A 3UBDA 3R1SA 3A8XA 1GY3A 4AE9A 3RWPA 3OXIA 4FV1A 4DGOA 3ZTXA 3HZTA 2ERZE 1KV2A 3CGFA 2XP2A 4G34A 3Q6UA 3LMIA 3PG3A 3TACA 3F2AA 4I6HA 3ZLSA 4BCKA 4UN0C 4RIWB 4X3FC 3MIAA 3LM0A 3UOHA 4UBAA 2BIYA 3C0GA 3C1XA 4II5A 5L2QA 3UC3A 2H9VA 4G9RA 3FSKA 3W2QA 4G5JA 1MQBA 3SOCA 4WO5A 2WTWA 4IX4A 4UZHA 4RIXB 4HVSA 3KXXA 3ZC6A 3LFCA 1WAKA 1PYXA 4NZWB 4UX9A 3LLAA 3DS6A 5A46A 2X7GA 4O21A 2IWIA 2WOTA 4U80A 4A7CA 1FVRA 4QYEA 4FTIA 2VUWA 3QD3A 1OKWA 4YU2A 4QMVA 3EQPA 4Y5HA 2WXVA 3TJCA 2YDJA 2YIXA 5L6WL 4JRNA 3R6XA 4M7IA 4NT4A 4EHGA 4Z7HA 3QX2A 5DT0A 4QMMA 5K5XA 3KMMA 3QAME 3W33A 5BNJA 4BL1A 5HLNA 2OZAB 3OP5A 3Q6WA 4BVUA 1H28A 2YM5A 2B55A 3ZDIA 3QXPA 3TWJA 3ZUVA 2CDZA 1MP8A 4Q9ZA 5K5NA 3SDJA 1HCLA 2J9MA 3R7UA 5LMKA 4ZTQA 2C6TA 4CRSA 3MI9A 5CASA 2OF4A 3DU8A 3FMNA 5HKMA 1OL5A 2QURA 4I6BA 4P4CA 4M13A 5EM6A 4C02A 2RFSA 4Q9SA 3ENMA 4Z7GA 3HAMA 3D5VA 4FIEA 4BWKA 4FOBA 4HGTA 3C4XA 4ZSGA 2P33A 4TWCA 2QVSE 5L2TA 4RA5A 4D5KA 1OZ1A 3LAUA 4EBVA 2HXLA 5HU3A 4U97A 5IQIA 1WFCA 3CY2A 5J87A 1NT2A 1OL2A 1OBDA 4E7WA 4I5CA 3ZO3A 2BILB 4DGGA 2NRUA 4AT3A 4CZUA 2Z7QA 3O23A 3P9JA 4B9DA 2CHLA 3R9NA 3WARA 3UNJA 3W2CA 4ACCA 3HX4A 1W83A 4G6LA 2QG7A 4L01A 3HAVA 4GIIA 5GZAA 5AV3A 4JG7A 4S30A 4V01A 3AXWA 5HTIA 3Q53A 5DLSA 5JFSA 3W18A 4EOJA 2Q0BA 3KMUA 3C13A 1DAYA 3BLQA 4IE9A 2B9FA 3DKOA 5CU6A 3OW4A 1XJDA 3DFAA 4BY9E 4XV3A 3KREA 4YLLA 1Q8UA 5T6KA 1SM2A 2CMWA 1OIYA 4B8LA 3U87A 1WBPA 4JBVA 4CFWA 2VWVA 4F64A 4ZJIA 3P4KA 4GUBA 3FXWA 4PDSA 3KEXA 3E7VA 4X3FA 5E90A 5AR7A 2EWAA 3PRFA 3FC1X 2W5AA 2C4GA 3ZH8A 4LI5A 4J52A 4NSTA 1M7QA 1S9JA 4JAIA 4C2VA 5CVFA 5HO7A 3I0OA 3UYSA 3RJCA 4M0ZA 1GIHA 3U54A 1Y8YA 3RAHA 3PLAE 2B54A 5HCXA 2F7EE 2JKMA 4G17A 4IAZA 4MKCA 4BDGA 4PDOA 4PMSA 2J50A 3BU6A 4BI0A 4CG8A 4DFBA 2QO9A 3OCBA 3HL7A 2OIQA 3R1NA 3H4JA 2W1ZA 3NMUF 4BHZA 1NVQA 3R2BA 3KK8A 4USFA 4RX9A 4AOJA 2RSVA 3W2SA 2Z7RA 4XEYA 5HOAA 3NNVA 1J1BA 2QR8A 2JFLA 3UQGA 4K11A 5AMNA 3WI6A 5HIDA 4RX8A 4NL0A 4AGUA 4UWBA 1O6YA 3ROYA 5HEZA 4E5BA 4QRCA 3QCSA 2GS7A 5EQEA 4FTNA 3A8WA 4QTAA 5T3QA 4B99A 4N57A 2C3LA 3D2KA 3IW4A 2OI4X 2QKRA 4RIYB 3BGQA 3Q60A 4PTCA 3UZPA 2O2UA 1G3NA 3UOKA 3BRBA 3GU7A 2VWIA 3G2FA 3DTCA 4JL9A 3LFBA 3O96A 3COIA 4I24A 2GS2A 4V04A 3U8WA 4ZLOA 4FEUA 4IVDA 4NUSA 4FE2A 2YZAA 4D1XA 4JLCA 3JUHA 4R6VA 4BN1A 4QMLA 2JDTA 4HCTA 4E4MA 2VX0A 3HA8A 4J95A 4X3JA 4BZOA 3ODYX 5HHWA 4ZJVA 1R0EA 3OMVA 4KAOA 5ANIA 4C4FA 4RQKA 5E7RA 4N6YA 1REKA 2OZAA 4QMXA 1YWRA 3DXPA 4UB7A 3GU4A 3HV5A 5ACKA 3E63A 5HE3A 5IISA 2A4LA 2OZOA 2QKWB 4FT5A 2OH4A 3GP0A 4Y83A 3WE4A 4EZ5A 5A6OA 4R7HA 3AMAA 4EH6A 3IW8A 3RCJA 3V5QA 1QL6A 4RT7A 2UZLA 4UMUA 5HORA 3DBDA 3E93A 3QYZA 5IA3A 3QCXA 5IKWA 2HW7A 3GU6A 3O8UA 3OXZA 3UO4A 4C3RA 2W5HA 2E9UA 4U45A 3ANQA 4FODA 4FEVA 5ETFA 1IA8A 5JMSA 4NEUA 4EKKA 5HE0A 3V5WA 4C2WA 3MDYA 2XNBA 3GNIB 2VWBA 3MIYA 3MVJA 4FKRA 3QALE 3BU5A 1JKKA 3DKGA 2IG7A 4FTCA 2YM8A 1J91A 3KVWA 4RVKA 1J7UA 4BTJA 2XRWA 2Y0AA 3NNUA 2R3FA 3KXZA 3SC1A 4GT4A 2VTJA 4GU9A 1BMKA 2BIKB 1FMKA 4QYYA 4A9YA 4BYIA 5AUUA 3MFUA 5GZ8A 4LOQA 2JIVA 2WU6A 4DBNA 1Y91A 4PNIA 3ORMA 4GT5A 4NIFB 3R00A 2OF2A 3NEWA 1ZZ2A 3QZHA 3RINA 3V5JA 4CV8A 5AP6A 5DEWA 4K1BA 5F95A 3T8OA 4MX9A 3MYGA 4FT0A 3SRVA 1T46A 3TM0A 4KS7A 2UZDA 4FEQA 2UZBA 4AWIA 3RKBA 4LMNA 3LKMA 3HMPA 4I3ZA 2XK7A 4R1VA 2R7IA 3OWLA 5M51A 3LXLA 5BVNA 4RC3A 3OT3A 5E8VA 4ZTMA 5AM6A 4EH3A 3R28A 3MY0A 5CSXA 3C4FA 4FI1A 5CYIA 3OFMA 5DMZA 3UO6A 3ZBFA 5M09A 3GCSA 4HJOA 5DFPA 4LGDA 4AGDA 2IN6A 1WBNA 2FH9A 4ITJA 5IQEA 5A4CA 2UW6A 4QMUA 4V0GA 3F3WA 3HV4A 3MH2A 2WMRA 4GG7A 3O8TA 4MXCA 3ZLYA 5FP6A 3W2PA 5CEMA 3A60A 3EZVA 3GCQA 3NUPA 3P7CA 2B53A 1ND4A 4M66A 3VBVA 1H4LA 1XH4A 3BYMA 3D7TA 4L42A 2ZAZA 4TRLA 4B8MA 3E8EA 2ESMA 3F5PA 2W99B 4GG5A 4WRGA 5JRQA 4EOMA 2CN5A 5DVRA 4FR4A 5BMMA 3ZSGA 3N4UA 3QQFA 2QOFA 3WYYA 3CJGA 3Q4ZA 4MBIA 4QYHA 4XH6A 4EORA 3PWYA 4B7TA 3ZLXA 3MS9A 4M14A 4ANQA 2BTSA 4BIEA 3ZRMA 2OKRA 3MESA 4IFCA 3NX8A 4CYJA 3EYGA 3RK9A 2BHEA 3SG9A 5M55A 4I5PA 3NUSA 4DTAA 4CFMA 3RZBA 3R71A 5A4TA 5EYMA 4ASZA 3FQHA 4YTHA 3PJCA 1OKYA 5CAVA 3E92A 2PMNX 5H8EA 3GI3A 3HRBA 3EIDA 4DH1A 2OK1A 5HTCA 3AG9A 4YC8A 4BDIA 4WIHA 2G2IA 4CG9A 3MVLA 4FMQA 3FYJX 4ANLA 4KBKA 5AV0A 5J8IA 2W1DA 5KMMA 2ONLC 2RFNA 3HMOA 4JDIA 4OTQA 2YDIA 3D5XA 5AP0A 5C9CA 1BYGA 2BKZA 4L00A 3WF6A 1ZRZA 1H8FA 1GZOA 4QP3A 4H3PA 4BB4A 1UV5A 2XRUA 4G6NA 4Z9LA 3MJ2A 3Q4UA 3VS2A 3ZBXA 3AD4A 4IHPA 3R21A 4X7QA 5CF5A 3U9CA 1M14A 5E8TA 4UALA 2NRYA 1KE7A 2I0HA 4DH7A 4DFLA 3H9FA 2ITNA 4PX6A 4BBFA 2E9PA 2XVDA 3T3UA 3H3CA 5EI6A 2BDJA 5FDPA 1M2PA 2R4BA 3L9PA 5L8JA 3RALA 2OLCA 5EQPA 2ITWA 3M1SA 4UYNA 4J97A 3RAKA 3RK5A 3R7VA 4DTBA 2CGVA 2JITA 3TL8A 3VUTA 3EN7A 5CANA 5C8NA 3ID6C 2WZJA 3DY7A 3SGCA 2V55A 3ACJA 2AC5A 4X2KA 4O0UA 4OUCA 2C68A 3QZFA 4A9UA 4LFIA 3QUDA 5BQ0A 4UV0A 4PPAA 4RJ5A 3QWJA 1JSUA 1W7HA 3HV7A 4R8QA 4RX5A 4FKPA 3HNGA 5GJDA 5I5ZA 3MPTA 4IM3A 4QT1A 4QMYA 3D94A 4M0YA 4JQEA 4UMTA 3LFDA 1MRUA 3HA6A 1Q61A 2EXMA 5E1SA 4AS0A 2SRCA 4R5SA 4F65A 3OTUA 4P7EA 5CVGA 4YTCA 1O6LA 3FMKA 3W10A 4YC3A 4B0GA 5JFWA 3GC0A 5M56A 4UWYA 5EI8A 4EC8A 2NNWB 2WD1A 4HZSA 3PXQA 4BCHA 3NUXA 5CQWA 2ITQA 3FLNC 5BVDA 1NVRA 4IFGA 3B8QA 2YCRA 4EBWA 3QTUA 4IJ9A 3RAWA 3TKUA 1KUTA 2HZ4A 2IPXA 4ASEA 4NM3A 2X8EA 2BDFA 3UIMA 3VW8A 4P2KA 5GHVA 4AA4A 2OJGA 1V0BA 2UW3A 1OPLA 1YWNA 2XK4A 3WBLA 5CAQA 5IH4A 5ANDA 2ETRA 3DNEA 3EKKA 4TTHB 3VVHA 5BVOA 4YTFA 4DCEA 2WTJA 5DR6A 4XBUA 4ZTHA 1JSVA 3OVVA 4BCQA 1UU3A 3F9NA 5EH0A 4IH8A 3EJ1A 5DNRA 3PXYA 3R83A 4C4GA 4CLJA 5HLWA 5JGDA 2V7AA 3IO7A 4RWJA 2G2HA 2P2IA 3NLBA 5FLFA 5J1VA 4IWOA 1MRYA 2G1TA 1ZY4A 2GDOA 2GHLA 3ORKA 4QMTA 3DNDA 2WQMA 3AOXA 3A62A 5HG7A 2VNYA 3ZU7A 2KTYA 4FV2A 4A9RA 3Q4CA 4KINA 2WHBA 2WMSA 5AP2A 3VHEA 3ZFXA 5BX0A 1LEWA 4G31A 4FV6A 4DEHA 5TF9A 4HYSA 3FI4A 1VEBA 3O2MA 1YXSA 1FMOE 1G5SA 4FL2A 4TYHA 1H1SA 4M67A 4MXOA 2JD5A 1V1KA 1PXNA 4LG4A 1TVOA 4CQGA 2PMLX 3CXWA 3KRLA 4J99A 2OXXA 5CXZA 1G8SA 5HI2A 4WUNA 4DFUA 2FSOX 4LOOA 3DJ5A 4K33A 3V8WA 4MD8E 3PDTA 2R3PA 2XB7A 3I4BA 2X4FA 3TZMA 3FLWA 4GV1A 2WTDA 5DN3A 2X4ZA 2WMUA 4FV3A 5JN2A 1JOWB 4WT6A 5L4QA 5L8LA 1YXVA 4TNBA 3BBWA 4CCBA 4M12A 4MXXA 4FSUA 2OG8A 4AW1A 3VIDA 5JKGA 4UEUA 2OO8X 4WKQA 4YPSA 3BWJA 2X39A 5CLPA 3UP7A 5D1JA 1WBOA 4C4JA 1B6CB 2I0YA 3DAEA 1WZYA 4YLJA 4FSNA 2W9ZB 3FUPA 3DBQA 5HLPA 5TT7A 4AQCA 4FUXA 3MVHA 4LOPA 3ORPA 1ZZLA 4ZY4A 2PY3A 3A61A 4BDBA 2UZEA 5E92A 3QD0A 5KO1A 1IAHA 1QPJA 2O64A 4A4LA 2OIDA 2V0DA 3AMYA 4KBCA 5EI2A 4YBKA 1JKTA 3F88A 4FV9A 3VBYA 2XYNA 3AC3A 4JBOA 4D9UA 4JRVA 2EB3A 5DT3A 2HENA 3E3PA 3I5NA 4U3ZA 5L8KA 4ZZNA 2CPKE 2C0OA 2R3OA 2BTRA 5FGKA 1UNLA 4R3RA 5CSPA 4FGRA 3UC4A 3KB7A 4XP0A 4C62A 4GK4A 2XA4A 1OPKA 4CXAA 4HYHA 1YHSA 2YIRA 4G3DA 5CZIA 2XH5A 2UZNA 5HE2A 3U9NA 2F2UA 1QPEA 3HV3A 3BQCA 4KA3A 1H27A 2BRBA 5FDXA 2QOKA 3UIXA 5I9ZA 4BR3A 3COMA 1KOBA 4F1TA 4AZTA 3AD5A 4DEGA 1P4FA 1VYZA 2P2HA 2CGXA 4I5MA 3IOPA 4E1ZA 2ACXA 4IX5A 4KKHA 5J9YA 5CTPA 3QA0A 4Y8DA 1CKPA 4ZEGA 3OC1A 1R0PA 4QQCA 1YHWA 4JIAA 4RLKA 3R8MA 1OGUA 4HZRA 2W05A 3I7BA 4XG9A 2CCHA 2WQBA 3VNTA 3TN8A 1SVHA 1RDQE 4IAFA 4TWPA 4C8BA 4AW2A 3F69A 1NA7A 4QMOA 3P7BA 4PNKA 2C0TA 4QP9A 4YBJA 2QHMA 4YJQA 3QRJA 2G01A 3QX4A 2XJ2A 4E5AX 4KIOA 3DZQA 2ZB0A 3O50A 5DRBA 2I0VA 5E1EA 4DN5A 2HXQA 4ZMFA 3CPCA 1YVJA 3MTLA 2PVMA 3KKVA 1J1CA 3LFAA 4JX7A 2VNWA 3UVRA 4F70A 4J96A 5E9EA 4EH2A 3G9LX 3LW0A 2UV2A 4FKIA 2XK8A 2BZHB 5M4UA 2IVSA 2JEDA 4IZAA 5IDNA 2GS6A 3ZZEA 3ZCLA 2YDKA 2GMXA 5C27A 5CAUA 4U5JA 4YTIA 3DOGA 3QTWA 3RK7A 2ETMA 3NZ0A 4DH5A 4HNFA 3JVRA 3ZONA 3LIJA 4FIFA 5LMAA 2BCJA 4EYJA 3NCGA 1JSTA 2C5XA 3MPMA 2F49A 1M7NA 3QRTA 4F6UA 4UMPA 4CKRA 3QKMA 4RSSA 2HZNA 4CFUA 4I41A 1MRVA 3MB6A 3MH3A 4KABA 2YCFA 4ZP5A 1NW1A 2C1BA 3CTQA 4KRCA 4E6DA 3L9NA 4XOYA 3RNIA 3JPVA 5FEEA 4M69B 5IEYA 1I09A 2Z7LA 3NUNA 3II5A 5B2LA 4NM5A 3K54A 4DFYA 4JVGA 3IPHA 3L9LA 3TI1A 3UZRA 4XP3A 2QQ7A 3ROCA 4IAYA 5ACBC 2QC6A 3A7FA 3N51A 5L2WA 2C69A 3C4CA 3OXTA 4NYEA 3R2YA 3OHTA 5IQCA 3PXZA 4EK6A 1IASA 2J6MA 3CGOA 4IDVA 4Y73A 5I9UA 4TL0A 2B52A 4MVFA 5AA9A 2XJ0A 3WZJA 3JY9A 5CSWA 4Z3VA 3VJOA 2R64A 3JYAA 4CYIA 3A99A 4YJVA 5LOHA 2UZUE 1FPUA 2ITOA 4DEAA 1H24A 3H0ZA 3M11A 4F4PA 1O9UA 3F66A 4AA5A 1K9AA 3C50A 4QP7A 5EYKA 4DINA 1JKSA 5LVPA 2X7OA 2EU9A 3ULIA 1FINA 3AC2A 4IANA 4EK3A 1OIRA 2J2IB 4BCGA 2YWPA 4DF3A 2BMCA 4ZOGA 3DBCA 2BZIB 3M42A 2G15A 3QTRA 2ZYBA 3ZDUA 3GXLA 4BCNA 5CF6A 4DBXA 2ZMDA 2QI8A 4YNEA 2JLDA 4G3EA 2VWXA 3IECA 4FSQA 3UDBA 1XH5A 2WGJA 2GNJA 2W0JA 3F61A 2B1PA 5BVEA 3RNYA 3ZO2A 4L45A 4CQEA 4EYMA 5JSMA 3CD3A 4CT2A 3NNXA 3MY5A 3EQBA 4IX3A 3HMIA 5IQAA 2YFXA 3CY3A 3OT8A 5EHLA 1KE9A 3QD2B 3LJ0A 2VTAA 3A7JA 2GHGA 5CI7A 1Q5KA 4YZMA 1ATPE 2XCKA 3UMWA 3VUIA 2Y7JA 4QTEA 4JQ7A 4YSJA 1Q99A 3FZPA 3QQKA 3R8UA 4O7LA 4O0SA 5FWKK 3LMGA 2JDVA 4U41A 2NPQA 2XKEA 4M15A 2J7TA 4UXLA 5FRIA 4BFMA 2YISA 4FTLA 4CEGA 5IH5A 5CNNA 3RM7A 3NCZA 5F94A 5HGIA 5H8GA 1BL6A 3TIYA 4AFEA 4A06A 3A7IA 3OEFX 2X81A 3HMMA 2PVJA 2XIXA 2IW9A 4BDHA 5AIRA 3PRIA 3PIYA 3BE9A 3FC2A 3BU3A 3TKHA 1M2RA 1A9UA 3ZSHA 4E26A 3GUBA 3P5KA 4G1WA 4E6QA 1J3HA 3EYHA 3O8PA 1VR2A 2WMVA 2UZTA 3AT2A 4HNIA 4GYIA 4BGGA 4DG0E 5IPJA 3F3VA 2C6DA 4GKHA 5AJQA 4BCOA 2WKMA 4S31A 1DI9A 2Y8OA 2PULA 1URWA 4KIKB 5AX3A 3QRKA 3WZUA 1YI3A 3I7CA 4PMTA 4Y85A 3DJ7A 3ODZX 4Y95A 3V6RA 2GQRA 3RPYA 4LV8A 3R0TA 3S0OA 2ZV2A 1CM8A 3BWFA 1Y6AA 3E8NA 4JIKA 3IOKA 4FKJA 3DJ6A 4EH8A 4EH4A 3BEGA 3KQ7A 5DIAA 2PE2A 4XYFA 5A14A 4AN9A 4O2ZA 4TYIA 4BZDA 1Q3DA 2W9FB 3OWJA 2XNPA 4LL0A 3R8LA 4XG8A 4C35A 3ZEWA 2H34A 4MQ2A 5CSVA 5E8ZA 2VD5A 1X8BA 3ZM4A 3BHHA 1TKIA 3Q5ZA 3Q52A 4TWNA 5D11A 3F82A 3L8VA 3QC4A 5TE0A 4YZBA 3TKIA 5IG1A 1UWHA 4FIJA 2GNFA 1ZOGA 5M07A 1R3CA 3RGFA 4GMYA 4MXYA 2JIIA 4BYJA 4FG8A 2J0JA 1OITA 2H8HA 2PVLA 3QZGA 4CZTA 3S00A 5CVHA 2E9VA 4AXAA 5AUYA 3RHKA 1GJOA 2RGPA 3T9IA 4GFMA 5CX9A 2JDSA 5FM3A 1BI7A 2XBAA 4RJ3A 4HGEA 1STCE 3KGAA 3EQFA 4QO9A 4F7SA 5CEOA 3ZM9A 4L53A 3C51A 4S32A 3I81A 5H2UA 4CNHA 4L7FA 3ZXZA 3BZ3A 5D7VA 2XNMA 3CQEA 3MJ1A 4RZVA 1H0WA 2R3MA 4MTAA 3D5UA 5AAEA 4GK2A 4DLIA 2IZTA 2VZ6A 4BBMA 2YACA 2VU3A 4D2VA 3DAJA 1WVXA 2VO3A 4QTBA 1AD5A 3AMBA 4IACA 1HCKA 5LMKC 4MQ1A 2BR1A 2XM8A 4V0GB 4FIHA 1Q8YA 4WBBB 5DT4A 3PZEA 3PSDA 3D0EA 4WRSA 4MF0A 3FZ1A 2IW8A 4MXZA 4U0IA 3ULZA 2WELA 1H1QA 3BYUA 4FTOA 5D7AA 5CENA 5AA8A 3RPSA 2RFEA 3QF9A 3WILA 3AC4A 2REIA 5AAGA 3PFQA 3SXRA 3MGYA 4I21A 2YERA 4HCUA 1B38A 3KF7A 1M2QA 2JDRA 3R8ZA 4FZ6A 4E5WA 3LCOA 4ZZMA 3BHUA 5B2MA 2XBJA 3PA3A 4Y72A 1P2AA 3FKNA 1ZYDA 4RVTA 2XKFA 3OOGA 1YXTA 3TCPA 2XMYA 4ENXA 1ZWSA 4D4VA 3WOWA 3RMFA 2C6MA 4KIKA 3SHEA 4HPTE 3S2PA 5LQFA 3MBLA 4JBQA 2FGIA 3DV3A 3KC3A 2WU7A 4JDKA 2I7QA 2B9HA 2WQNA 3KRXA 4FTAA 4N6ZA 4PUZA 1OIQA 4XX9A 3D9VA 4YNOA 5M4IA 3UQCA 5EM8A 2WTCA 5EM5A 4FYOA 4G9CA 3PP1A 2VTOA 2AC3A 4F63A 4FSZA 2WEIA 2FYSA 5IUIA 2Y9QA 3TZ9A 4EK4A 3VUGA 3G5DA 1I44A 3UOJA 4DFNA 5EW9A 2GSFA 2UW9A 5LCKA 2EB2A 3F5GA 4I1ZA 4I4FA 4F7NA 4EL9A 3B2TA 4ORKA 5JRSA 3FL4A 4F9WA 4F9BA 5E8XA 2QNJA 4D28A 4D2PA 2EXEA 3H30A 3ZO1A 2X0GA 5IA0A 3SA0A 2ITPA 4EC9A 4O7VA 5EOBA 3PJ2A 2C3IB 4UYAA 5FXQA 4FZDB 4AA0A 1SNUA 4B6LA 4D2RA 4W8EA 3MVMA 4F9CA 2JAMA 3RWQA 2Y6MA 1VYWA 4EH5A 3RTPA 2UW4A 3ITZA 3QLGA 3QCYA 3Q2MA 5KCVA 5BUEA 2PMOX 3ORZA 4FOCA 3QHRA 4MK0A 3SV0A 3ET7A 3IONA 4QD6A 2YLFA 4O2PA 3CQUA 4PL5A 2PZ5A 5ANGA 5HQ0A 3TT0A 4C4EA 3E8CA 5HD4A 4U40A 4BRXA 1FVVA 2FSMX 3DCVA 2FSTX 4ERWA 2AUHA 2YIQA 2I40A 4TYHB 2G2FA 3ZZWA 4OAVB 1ZXEA 3KXNA 4FTTA 1J7IA 3BYOA 2J0KA 3C0HA 3DQWA 4X0MA 4U3YA 5TR6A 3QZIA 1A06A 4WNPA 4DCAA 1Y6BA 3SOAA 4A9TA 4EOOA 1Q4LA 2QOCA 5ETIA 3EQCA 4BI1A 3U55A 5EYDA 3LZBA 4G6OA 3R9RA 1B39A 1W0XC 1ZMWA 5C01A 3CP9A 3KL8A 5HO6A 4ZK5A 3G15A 3DK6A 2VTIA 2YM3A 3I6UA 4FV4A 4Q5HA 3FSFA 3QQHA 4TW9A 1RJBA 1H07A 1F3MC 2VO7A 4HGSA 4R3PA 4IBMA 3UYTA 4D2SA 2QOBA 3C9WA 1H1RA 1LPUA 2GTMA 5LCJA 3QXOA 4W4WA 4FKLA 4ZS0A 5TO8A 3FI8A 4ZTSA 3CCNA 4XP2A 5FTOA 3H10A 1FVTA 4RGJA 5CF4A 4FG7A 3NYXA 1TQIA 1SZMA 5HZNA 3IKAA 3FKOA 3IW7A 5HBEA 4D2WA 4PWNA 1R78A 4NTTA 1QCFA 5CXHA 4NK9A 2G9XA 3KXHA 3EQIA 3NUYA 3QU0A 1YI4A 2W7XA 5M06A 3LXPA 5I9WA 3UQFA 5HCZA 5IMEA 2PWLA 2C0IA 4DLJA 1OB3A 3IQ7A 2Z60A 5ANOA 3IW6A 3OF0A 3CTHA 3QLFA 2XK3A 4XCUA 5LVNA 1XKKA 3F3TA 4PTGA 2PL0A 4ZSJA 4O7TA 4BWPA 4QNAA 3MWUA 3EZRA 4C38A 1FGIA 4ZJJA 4XMOA 5AEPA 5KUPA 3LXNA 5IA2A 2WTKB 2O3PA 3EQDA 4IMYA 4ANBA 2ZM4A 1SNXA 2QOQA 5FUTA 4H39A 4V05A 4QMNA 4BCFA 2QOLA 3HUCA 2W1EA 3NYNA 3P0MA 3PXRA 4I0TA 4N0SA 2OFUA 3BHTA 2V22A 3FL5A 4A4OA 2BHHA 3V8TA 4ZAUA 2JIUA 2WTVA 3EN4A 4FSRA 4RA4A 4RVMA 1UWJA 2XNOA 4IB1A 2PVNA 2YJRA 4E4NA 3QGWA 4EQMA 1A48A 5IUHA 3GVUA 4H36A 3HMNA 4FTUA 3RP9A 3VAPA 5EDQA 4EOKA 1JQHA 4H1MA 4TN6A 4ACDA 1MQ4A 2VTRA 4NKAA 5JK3A 2KULA 3VF8A 4BWXA 4O86A 3RVGA 1DI8A 2QODA 3P78A 5J5TA 1XWSA 3CC6A 5F4NA 2W06A 4HVDA 2AYPA 4HVGA 3TZ7A 4CKJA 3D14A 2QLUA 3PA5A 4X2NA 2B9JA 3OUNB 1U5QA 3CIKA 1H25A 3RM6A 4ZY6A 1ZMUA 1LP4A 3SX9A 3CPBA 1LUFA 3DFCB 2BALA 4YO6A 3U6JA 2OXDA 5AP3A 2GNLA 4GVAA 2ZJWA 3DLZA 3R04A 5EK7A 3F3UA 3VC4A 3C4WA 3MFRA 5IH6A 4QTCA 4CSVA 3CEKA 5CEQA 5CWZA 2R3JA 4IAIA 4IWQA 3I0QA 3QL8A 3UNKA 2Z02A 4ZMEA 4NCTA 5LVMA 2I6LA 3OWPA 2IW6A 3GU5A 1OECA 4W4YA 5HICA 2PU8A 3L8SA 1DAWA 4ANOA 4LGHA 3MFTA 4AW5A 3IGGA 1E1VA 2QU5A 3NSZA 4LM5A 4WG3A 5C1QB 4D5HA 4FK3A 3KA0A 2V5QA 2GQGA 3BCEA 3R7OA 4DITA 3TDVA 4GK3A 3IK3A 1UU9A 4U79A 4A9SA 4MBLA 4QQTA 1IAJA 4JG8A 2C6IA 4CFNA 1U5RA 4ZTRA 4E20A 1JBPE 5ANJA 3FE3A 3ZO4A 4BDCA 4PMPA 4YJPA 3DDQA 4NM0A 1AQ1A 1Y57A 4XS2A 3VS7A 3VULA 4FBXA 3KVXA 2PUPA 3ZEPA 4JT3A 2GU8A 3ZFYA 5ETAA 4DGLC 5DRDA 1KE8A 3FMLA 4FV8A 5DHJA 2YHVA 4BKZA 2Z7SA 4AF3A 4D4SA 4LUEA 4BHNA 4C7TA 3CQWA 3K5UA 4C3PA 4FL1A 2BZJA 3ZMMA 3HDMA 2OJIA 4FSWA 2ZV7A 5K3YA 4K9YA 2WB8A 5CU4A 2O63A 1PXOA 3AGMA 2XJ1A 3DZOA 5A6NA 1XH6A 5FBOA 2RKUA 4OT6A 4YZDA 5A3XA 1BUHA 1YOMA 2UZWE 3NPCA 2R3QA 3P08A 1URCA 2QCSA 2PZRA 2HZIA 3RPOA 5A54A 5E4HA 5KHXA 2YAAA 3D83A 2ZM1A 3FDNA 4C33A 4QYGA 3K5VA 4JG6A 1V0OA 4F09A 2BAQA 3O7LB 4QMPA 3OCTA 1XHAA 3KFAA 3QCQA 4P5ZA 5E8SA 1ZYLA 5C8MA 4BDDA 3U6HA 2JBOA 2QO2A 3Q32A 4KSPA 2E9OA 4ZLZA 5IUGA 4FKVA 3QTQA 4AFJA 5BYLA 4XV2A 4EOSA 4BCJA 4GU6A 2BPMA 3VUHA 4QMQA 3P23A 3KN5A 4MNEA 4AT5A 3UVPA 4CZYB 4BTKA 5A4QA 5HIEA 4IM2A 2HWOA 2O65A 3EN9A 3U4UA 3NIZA 3N4VA 4RBLA 5KZ0A 3LQ5A 4W9XA 4ZLYA 4DYMA 4DEEA 3PE1A 3RPRA 3EWHA 3D5WA 5AUZA 4BCMA 4JR3A 5J79A 4KB8A 3VUKA 4PP7A 5KMKA 2UVXA 1EH4A 3C7QA 3CR0A 3OOMA 4ASXA 3QC9A 4ACHA 5I9VA 2R0IA 4NTSA 1K3AA 1OVEA 2DUVA 2ITXA 3MY1A 4TT7A 4YC6A 2B0QA 4L43A 4TNDA 3TUDA 2VX1A 3KULA 3E5AA 5CEIA 3N9XA 3VQUA 4DGNA 1UU8A 2W4OA 4AOIA 2CLQA 2ITTA 4FKGA 2VO0A 2WMXA 4I6QA 4MD9E 5CU2A 5EHOA 5IQFA 2DYLA 2B9IA 2PZIA 4IQ6A 4QP4A 1OMWA 4HGLA 4MEDA 2RF9A 3SRVB 1PYEA 2R3IA 4FKTA 5DYJA 3SVVA 1VZOA 3IGOA 4A4XA 3V5TA 2FO0A 3V8SA 3LFQA 5J1WA 2ZM3A 2XZSA 3FMJA 4EZ7A 1KE6A 1WBTA 4WUAA 3BX5A 1OBGA 2WQOA 5K4IA 1YWVA 3E7OA 3GC7A 1J7LA 3TNIA 5M57A 2OSCA 1HOWA 5CQUA 5CEKA 5J95A 3VQHA 4IB0A 5FEQA 1JLUE 3G6HA 5CI6A 4K18A 5HTBA 1QPCA 2GFSA 3HKOA 2EUFB 3LE6A 4FKUA 2IO6A 4XHKB 2IZSA 3HVCA 3FQSA 4AOTA 4OT5A 1IRKA 4RVLA 4OTPA 2C6OA 1QPDA 4RWLA 2GNIA 2OJ9A 3CSVA 3OUKA 3GOPA 2XKCA 3WE8A 4E6AA 4DT8A 4JBPA 5CZHA 3LJ1A 3QTSA 4UY9A 3FMEA 4DFZE 4OTGA 2Z8CA 3FI2A 4FNYA 3WYXA 3KK9A 3E88A 3GU8A 4GVJA 4JNWA 3IDBA 5K4JA 4NJ3A 4XG7A 5DOSA 5IF1A 1WCCA 4LRJA 4YJSA 4GEOA 3R22A 2A0CX 4FL3A 5G1XA 3UODA 3VO3A 2CKPA 2R7BA 4AX8A 4FKWA 2QOHA 4MNEB 1DM2A 2BAJA 4KIPA 3A4PA 1RW8A 5AR5A 3PJ8A 3K3JA 2O0UA 5CNOA 5EKOA 4L67A 2XEZA 4RG0A 3IDPA 4W4VA 1NXKA 2EXCX 4D0XA 4I6FA 4XV1A 2J0LA 4MHAA 4F6SA 4GH2A 4GJ2A 4EUTA 3VS4A 4DT9A 3ERKA 3K3IA 3SD0A 4JAJA 3QA8A 5JT2A 5HX8A 3MSSA 5AX9A 1W8CA 3ORTA 5KHWA 5I3OA 1NY3A 2ITZA 3VS0A 3WF7A 3KULB 3LCDA 3KCFA 4U7ZA 5ITAA 3DXQA 4G3CA 2ZB1A 5ANEA 2RFDA 2VGOA 3CTJA 4ANSA 5EDPA 2ZDUA 3MB7A 4IVCA 5AAFA 4M84A 3NGAA 5BYYA 1OM1A 3FY2A 1CKIA 3QTXA 2WMTA 4L6QA 4GS6A 5GNKA 3UGCA 1F0QA 1YDRE 4MH7A 4D2TA 2R3KA 4FV5A 2GQSA 3RCDA 2ZV9A 1TQMA 1H00A 4U8ZA 3OG7A 5HNIX 4OBQA 4UMQA 2P3GX 3LFNA 4LRMA 4FZ7A 1Q24A 1KOAA 3DK7A 2X6EA 4NW6A 3ZRKA 3U51A 4G2FA 1GZ8A 4L3LA 2BRNA 2A19B 3LCTA 1OKVA 4I5HA 2ZVAA 4HVIA 2VN9A 4L3PA 4OTIA 3R7EA 3BV3A 3PPKA 3R30A 1Q97A 3GFWA 4JI9A 4ITHA 4FVRA 2R9SA 4RFYA 2PYWA 4CVAA 4O7NA 1SYKA 4OR5A 4I20A 4B4LA 4I4EA 5GIPE 4TYJA 3BIZA 3QRIA 3WZKA 5KBRA 3MH1A 5A4EA 3KMWA 4ASDA 1XH9A 1KV1A 4D0WA 1ZOHA 5E8YA 4L68A 5F20A 1K2PA 5HNGA 5HU9A 4S2ZA 1BI8A 4Y46A 5HVJA 5CEPA 4RIYA 1YRPA 4K8AA 3V5LA 1P5EA 3NWWA 3FHRA 5I9XA 2WQEA 5CT0A 2BRGA 2GHMA 4RPVA 1Z57A 5BMSA 2BROA 4M3QA 2QLQA 3GB2A 5ICPA 4LL5A 4IWDA 3RZFA 2X9FA 4RZWA 4E8AA 3F2NA 4TY1A 3D2IA 4IEBA 4O6LA 4FUYA 3F5UA 3TNPC 3TV7A 1PXKA 2UW5A 3FZOA 4O82A 3L1SA 5G6VA 3AT4A 3SAYA 4WHZA 4KBAA 4YHTA 4HYUA 2F7ZE 5D12A 2HOGA 3C4EA 4P90A 3RHXA 4FVQA 3SW4A 4DC2A 3OS3A 3Q5IA 4YGAA 3HDNA 2IVUA 4IVAA 2YIWA 3M2WA 3Q3BA 2XF0A 4JS8A 4O0TA 2QOIA 4D4RA 3JR1A 3PTGA 4ALUA 2Y4IB 4AP7A 5HBJA 4U44A 3ORLA 2W4JA 2PE0A 4PP9A 4EHVA 2ZDTA 4RMZA 1XBBA 3VBXA 2GCDA 4E73A 3EFKA 3WF9A 4FTRA 5BYZA 2XNGA 3E87A 1OPJA 2F57A 2F9GA 3GCUA 3O17A 2DS1A 5AP4A 4FT9A 1WBWA 3HP2A 2ITVA 4E4LA 5I4NA 3NYOA 3PSBA 2PVHA 2WMQA 4NKSA 5FEDA 3LJ2A 3F7ZA 3WIGA 3I60A 2BAKA 4R5YA 5M4CA 3C5IA 3G6GA 3CKWA 5AM7A 3TV4A 3W16A 3WF8A 5FTGA 4ZSLA 3ACKA 3Q4TA 2CNUA 4F1MA 4O91A 2I0EA 3EH9A 4J53A 4U9AA 2EVAA 4LGGA 3FMMA 4QP1A 1O6KA 3L8XA 3THBA 3ZLWA 4LV5A 2W5BA 4D4YA 3BGPA 2JKOA 4L46A 4CKIA 5HG5A 5DPVA 5AUTA 4TZRA 4UXQA 3TEIA 4XV9A 3LMHA 2F7XE 3EMGA 4XG6A 3GCVA 2X6DA 4IM0A 3P7AA 4F1OA 3KRJA 4X6QC 3HRCA 3DXNA 4I93A 4KNBA 3FWQA 5EYCA 3FJQE 4ANMA 4C58A 1R39A 4KS8A 2XIZA 5B2KA 1H08A 4DH3A 4MYGA 4QTDA 3GENA 4EEVA 5BVKA 3QYWA 2J0MB 2YCSA 4O22A 1IA9A 3PY3A 2C1AA 4YJTA 2WMWA 4PMMA 5TOZA 3K2LA 3KY2A 3S95A 4XRJA 4AU8A 2HZ0A 1FQ1B 5DWRA 5AR4A 4IIRA 4L7SA 5JEBA 2ZMCA 3ANRA 5C4LA 5IEXA 3PUPA 5IEVA 3Q96A 4RIXA 4OBOA 5FP5A 3LLTA 5EKNA 1H0VA 3GFEA 3PYYA 4G3FA 4NIFA 3FPMA 3RBWA 4AE6A 3UNZA 1Q8ZA 4O1PA 2W1CA 5DE2A 3FKLA 3S3IA 4DEIA 3QHWA 1CMKE 5IA1A 1CKJA 3NUUA 4RC4A 4FSYA 4O0WA 3ZOSA 4EHZA 4AACA 2VRXA 3KF4A 3JY0A 5EW3A 3DBFA 3IW5A 2XNEA 2WMAA 1Q62A 3ZSIA 2C5VA 3DDPA 4FICA 4O6EA 5IQBA 2GNHA 4Q5EA 4HVHA 5JZJA 1PF8A 5F9EA 4NCTC 3P86A 2O5KA 3EQGA 3PVGA 3ZS5A 4BC6A 2W1FA 4K2RA 5JFXA 4H3QA 4KIQA 4IDTA 3TUBA 1WVYA 4DFXE 1REJA 3LXKA 3PY0A 4L52A 4I23A 5E8UA 4C36A 1UKHA 5FD2A 4EHEA 1XBCA 3HRFA 1G8AA 1OKZA 2CGWA 4OTRA 4EUUA 5AUVA 3UZTA 5A9UA 4YJRA 4Q2AA 1XR1A 4EQUA 3OROA 2YABA 3P1AA 3QKLA 4IB5A 1H01A 5KMJA 3NVKI 5AUWA 3V04A 3C4ZA 2R5TA 4BF2A 5J7BA 3F2RA 5HG8A 5C4KA 3DPKA 4JX3A
chains in the Genus database with same CATH superfamily
4DAWA 3GT8A 5HVKA 3NVMB 2VTPA 2WIPA 4EK5A 2PMIA 4XRLA 4L9IA 4YPDA 4ARKA 3LQ3A 3ELJA 2JFMA 4K77A 4L44A 2JKKA 4OGRA 3GOKA 1PKGA 2ERKA 3GBZA 5FXSA 5H3QA 4U6RA 2XIYA 4QNYA 5KX8A 3VBTA 4NM7A 5HNBA 2WPAA 4J8MA 4BZNA 4C57A 3PSCA 3QUEA 2BRMA 4YZCA 2FSLX 4DTKA 5J9LA 3VS3A 3B2WA 4O7SA 3PPJA 4GCJA 2HY0A 2PVRA 3R73A 5AR2A 1W84A 4GT3A 4USEA 1XQZA 5LWNA 2PHKA 4DA5A 5AUXA 3JVSA 2VTNA 3QTZA 2OW3A 4AUAA 5JFVA 3QWKA 4FT3A 4O1OA 3Q2JA 2J0IA 2WOUA 5BV3A 3ORXA 5IA5A 2BFXA 5CU3A 2YEXA 3TNQB 4WD5A 2VO6A 5AADA 4H1JA 3HYHA 4NH1A 4U81A 4MXAA 5GJGA 4EJNA 2OICA 1W2DA 2YCQA 2VTLA 2WEVA 4W8DA 2W1HA 4WSQA 4AAAA 5C26A 1ZOEA 1P14A 4C4HA 4OTFA 1W82A 1L3RE 4E4XA 4ACGA 1PXIA 3FLSA 5CT7A 3OBJA 4C61A 5C8KA 3VRYA 3NW6A 3ORIA 4YJNA 1SMHA 4I92A 1KWPA 4F9YA 3PVUA 3ZUTA 4GRBA 1BKXA 2BZKB 2CJMA 2VTQA 4WG4A 1PHKA 3VS1A 2VTMA 4WNMA 4OLIA 3WZEA 4A07A 4BGQA 4ZIMA 5IA4A 4HCVA 1ZY5A 5KZIA 4GW8A 4K6ZA 3ETAA 4GSBA 2JC6A 3DA6A 4FKQA 3SLSA 3U6IA 3PVWA 4DG3E 3NW5A 2GTNA 5AR8A 1GAGA 3KCKA 4YZ9A 3CE3A 4BTMA 1YXXA 2PVYA 2OU7A 3R02A 4PPCA 1M17A 3QGYA 3UIBA 2J5FA 2A1AB 4PQNA 3LM5A 4RFMA 4YR8A 4YHJA 2CKOA 3GC9A 4FIGA 2FB8A 2UW8A 4C3FA 2IVTA 1JKLA 3SKCA 3VS6A 3MH0A 2A27A 5D9HA 5DG5A 3R1QA 3O0GA 4YP8A 4DHIB 4RFZA 4BI2A 2FUMA 2Y4PA 3WZDA 1KE5A 2WIHA 4Z55A 1W98A 3PPZA 4O38A 4ZXTA 2BFYA 3AC1A 4QOXA 1BLXA 4XUFA 1VJYA 4FTKA 3OD6X 4AN3A 4L3JA 2VX3A 4NJDA 2OH0E 3NIEA 4HW7A 3VF9A 1UA2A 3BLHA 5B0XA 5AP5A 4RX7A 4S33A 3EN5A 4WSYA 4U43A 3V6SA 3REPA 3G0EA 3ZXTA 5LMBA 4RC2A 5JQ8A 3V3VA 5B7VA 2XCHA 2X1NA 5AP1A 3W2RA 2RG5A 4AW0A 1PJKA 3UVQA 5KMNA 1BL7A 1JPAA 3O7LD 2XS0A 3F7WA 3OCSA 5KMOA 4TYEA 4F9AA 4ZY5A 4CGAA 2CSNA 5IZFA 2X8IA 3KU2A 1PY5A 3GGFA 2Y4IC 3PXKA 4EZ3A 4FZAB 4MBJA 4JDJA 3GCPA 3WF5A 5K0KA 3WIKA 4PF4A 4YZNA 3EQRA 1ZAOA 4DHFA 5JGAA 1RE8A 3I6WA 3EN6A 4BIDA 3DTWA 3G51A 4GFOA 3ATTA 2ITUA 3FQEA 4GIHA 4PDPA 2B4SB 1U4DA 3AT3A 4ERKA 4WNKA 1QMZA 3F6XA 4EWQA 2HIWA 5HESA 4CMTA 3HP5A 3PE2A 3R9DA 4X2GA 4EQCA 5AV2A 4FV0A 3CS9A 3DKCA 3NW7A 3DBEA 2W1GA 4FX3A 4O84A 4ONAA 3R01A 5DH3A 1AGWA 2WAJA 2FA2A 5GIOE 3UTOA 4I0RA 3ALNA 5FM2A 3MW1A 4J98A 4TYGA 3SXSA 2I1MA 2ETKA 2VV9A 1Y8GA 5FXRA 3BYVA 5DGZA 4EWHA 3LVPA 1XO2B 3BELA 2OGVA 3OW3A 2PZPA 1PMNA 4NW5A 4FSTA 2P0CA 4TKSA 4FVPA 4IX6A 3ZHPC 4PPBA 1H1PA 3BBTB 4QMWA 2Z2WA 3CJFA 4CFVA 4GKIA 3NS9A 2PUUA 4W4XA 1F5QA 1OL7A 2GNGA 3UJGA 3FXZA 5HX6A 3MV5A 4W9WA 3BLRA 3SW7A 2CKEA 2VWUA 2YN8A 1XH8A 5J9ZA 3I1AA 4GL9A 4MAOA 2FVDA 2WO6A 3ORNA 2YM7A 4XG2A 5AV1A 3VJNA 3VUMA 1TZDA 3BEAA 1JWHA 3BYSA 4O27B 3AQVA 3R8VA 3LCKA 5L2IA 5IQHA 3MPAA 4BDAA 3ZFMA 4QPMA 2C6KA 3UPXA 2UZOA 3FZRA 4WNOA 5M44A 4AN2A 4BDKA 5D41A 2W4KA 1GNGA 2XIRA 3POOA 3PIZA 5T68A 2P4IA 1PXJA 4X21A 4O81A 4YO4A 1LR4A 1MUOA 3TV6A 1FGKA 4BDJA 3BLAA 3QQGA 4R3CA 2W1IA 2RL5A 5HG9A 2IF8A 2J51A 3NR9A 1XBAA 5LXMA 4O83A 3LOKA 5IQDA 2YA9A 4YHFA 4IC8A 3NRMA 3EKNA 2J90A 1GZKA 3QQLA 5DEYA 2JBPA 3UO5A 2YM6A 3R1YA 1WVWA 2PZYA 3LQ8A 2C3JA 3DAKA 3DGKA 4BKJA 4L8MA 2PE1A 5CY3A 3AGLA 1L8TA 4DH8A 1YHVA 4YURA 5A4LA 2OWBA 2F4JA 3A7HA 3H0YA 4I94A 3TTJA 3VBWA 2HY81 2OFVA 3CLYA 4G5PA 3W55A 4LYNA 4TPTA 3TJDA 5EFQA 4BICA 4UMRA 5M4FA 4QQ5A 4GUEA 3EQHA 3TDWA 3BGZA 3OEZA 3D7ZA 2CNQA 1R1WA 5KKRB 3JXWA 3L9MA 3EFWA 3LFSA 3VRZA 4NFMA 3W0QA 4FEWA 4F6WA 3LFFA 4AZWA 5L6OA 5GINE 3GQIA 3E3BX 3Q9XA 4N70A 4RWKA 4QPAA 2QOOA 3QKKA 4XG3A 1SVEA 4IB3A 4TWOA 4I0SA 4PL3A 4YJOA 3T3VA 1GIJA 4QPSA 1H1WA 4FC0A 5CF8A 4D1ZA 2CKQA 5D10A 3NAXA 1OIUA 3MA3A 3AD6A 4DEBA 3H9RA 2A2AA 3COKA 4LRKA 1GZNA 4IWPA 4FTJA 3UMXA 4AZVA 4FNXA 5FTQA 3S4QA 3VONA 2C6EA 1XH7A 2BDWA 3GQLA 3IS5A 4FTQA 3DQXA 3Q9ZA 3SXFA 5LWMA 2NP8A 1G8KA 4XG4A 1PMUA 3MFSA 2VTHA 3PXFA 4XLIA 4JJRA 4MWHA 4XNEA 2GFCA 2YLEA 3GC8A 5CS6A 3FY0A 3A2CA 3UG1A 3PJ1A 5DR9A 4J7BA 3W8LA 3F5XA 2CGUA 3VW6A 4F0IA 2OIBA 3ENHA 3TZ8A 5HVYA 3OTVA 4LMUA 2OBJA 5IDPA 2CLXA 2WTIA 4ALVA 4APCA 5C03A 2VGPA 4WBOA 1ERKA 1JVPP 5AFVA 1YOLA 2C3KA 1PW2A 1U46A 2HCKA 4R7IA 3L8PA 5L3AA 3LHJA 4QQJA 1YXUA 4O0RA 2PVKA 4D1SA 4C59A 3PLSA 3HECA 3HUBA 3NDMA 3FV8A 1ZMVA 4EK8A 4YJUA 4CTBA 2HAKA 4QP6A 5CSHA 4FG9A 1ZARA 3C5UA 1OI9A 1NVSA 3W0MA 2YAKA 3FBVA 3RI1A 4E93A 2PUNA 3U4WA 2OXYA 4PRJA 5FG8A 4MCVA 4IZ5A 4MD7E 3HEGA 5KBQA 5KNJA 3FMDA 4OTWA 2XYUA 2X2MA 4RJ6A 2IVVA 2X2LA 4HOKA 3PZHA 1YDSE 2X0OA 4UZDA 2Q0NA 4USDA 2LAVA 4C34A 4IVBA 3TIZA 5ETCA 4AZEA 5LVOA 4KKEA 2QU6A 3KXMA 5HBHA 5HD7A 4IC7A 3QTIA 2LGCA 3NYVA 1M52A 4ZS4A 3PY1A 3PIXA 2V62A 5K0XA 2XALA 3E8DA 4WOVA 4F99A 3UPZA 4QP2A 2UUEA 4ALWA 4JR7A 3D15A 4BIBA 4YLKA 2JDOA 4ZZOA 4MF1A 2YIYA 3OY3A 2BVAA 5GZ9A 1PRYA 1UVRA 1YKRA 3TNWA 3TXOA 3Q9WA 4IZYA 4EH9A 2R3LA 5FQDC 4CV9A 3F3ZA 3LCSA 5EM7A 2BUJA 3MN3A 4HYIA 4BJJA 2PVFA 1FOTA 1APME 4FKSA 4ACMA 3R9OA 3R8PA 5CU0A 2X7FA 2C30A 5J5SA 4EJ7A 3E62A 5LVLA 2HELA 2XUUA 4O0VA 2R2PA 4JDHA 2NYAA 4DHZA 3KN6A 4M69A 4O4DA 3ZC5A 4EONA 4F7JA 2E9NA 5JH6A 4G16A 3DK3A 4NU1A 4EOLA 3G90X 4IAKA 2H96A 1WBSA 4DE4A 4MWIA 3OZ6A 3FEGA 3QD4A 4EH7A 3OCGA 3QUPA 3R63A 5JGBA 2X9EA 4DG2E 4FK6A 1UNHA 4PV0A 3A7GA 3QBNA 4QMZA 4D55A 1IG1A 1V0PA 5H9BA 2VTTA 4C37A 4E3CA 2V7OA 4M68A 3HV6A 4YSMA 5E8WA 5BVWA 2YZLA 2RIOA 4FT7A 4GFGA 3R9HA 3VHKA 3FLQA 5LARA 4RIWA 3W32A 1UNGA 3R7GA 3FMHA 4J8NA 4XOZA 1OGYA 3R7YA 3PWDA 4NFNA 4AG8A 4EI4A 5KKRC 2PSQA 4R78A 2W96B 3I5ZA 3NAYA 2DQ7X 2JGZA 4ID7A 4RWIA 5E91A 4ITIA 3UIUA 4AGWA 1Q41A 4H05A 3UOLA 3V51A 2CNVA 3O71A 4XLVA 2J4ZA 2QR7A 3TNHA 1Q8WA 3BE2A 4X3FB 4ANNA 4DEDA 3SG8A 3PA4A 3QQUA 3ALOA 2X8DA 4M8TA 4AT4A 3DLSA 4IJPA 3TTIA 1FBNA 4UWCA 4FNWA 3G33A 5AIKA 3AC8A 4APPA 1OUKA 2XK9A 3G0FA 1ZYCA 5I9YA 3PJ3A 5EQYA 3EL8A 2XNNA 1Q8TA 4FGBA 2HWPA 1CTPE 4FA2A 2XKDA 3PUFC 2BRHA 1YW2A 3V5PA 2QD9A 3FXXA 4X2FA 4FV7A 4EKLA 4MNFA 3KRWA 4HPUE 2JAVA 4O7WA 1YOJA 2JKQA 2R3RA 3RAIA 1PMEA 3IDCA 4FSMA 4H58A 3UE4A 4EOPA 2XM9A 2CCIA 2QO7A 1UKIA 4ZSEA 4PY1A 2J5EA 5AWMA 4OBPA 5KMLA 4O96A 5IU2A 3VWAA 3KXGA 4QYFA 4IW0A 1T45A 2OJFE 3AC5A 2WTKC 3BKBA 2IZUA 3EL7A 2PPQA 1CSNA 4CT1A 3TUCA 1G8JA 2PK9A 4KKGA 4C4IA 3BV2A 5HO8A 5L6PA 1DS5A 2E2BA 4AZFA 2C5YA 4JOAA 3KRRA 5EW8A 4QP8A 4WG5A 2YJSA 4QDVA 5EG3A 4DGMA 4KWPA 1U59A 3ATSA 2XEYA 2YM4A 1ZLTA 3NUAA 3ZRLA 5DA3A 4AGCA 3OWKA 5HCYA 5DBXA 3PVBA 4X6RA 2WFYA 3ZYAA 5JQ5A 4O7ZA 1GIIA 4O0YA 1H26A 2ITYA 5EDRA 2UVZA 1E1XA 2ZV8A 1YDTE 2VWZA 4P5QA 3TG1A 1BX6A 1E9HA 3EHAA 4OW8A 4RJ7A 4ZTLA 1JAMA 3W2OA 4E6CA 5AV4A 4KUJA 4O7YA 5LJJA 4ZSAA 3HGKA 5BPYA 1Q3WA 2XK6A 4BDFA 3SQQA 4LUDA 4RLLA 1U54A 3FHIA 3VBQA 4FTMA 4CFFA 3LPBA 3S1HA 3OBGA 1OL1A 1OL6A 4QMSA 4O0XA 5ANKA 4JXFA 2C5OA 4BKYA 4DDGA 3RPVA 2VTSA 2IJMA 2BKKA 3R7IA 4F7LA 1PKDA 3CKXA 3PG1A 3D7TB 4BTFA 1PXPA 4CTCA 3Q9YA 4Z16A 2DWBA 5I0BA 2B7AA 4YUQA 2R3GA 5J7HA 4WA9A 3COHA 1P4OA 5M53A 4R1YA 4CRLA 2WMBA 2ZOQA 4FF8A 4M97A 3UG2A 4BCIA 4XBRA 3FLZA 4CLIA 4EOQA 2CN8A 3CBLA 3PP0A 3W8QA 2HK5A 3QRUA 2VWYA 4KD1A 4NWMA 2RG6A 3W1FA 5BVFA 5CALA 3CD8A 4PTEA 4RJ4A 4O7RA 3BHYA 2VAGA 1IEPA 4N4SA 4CFXA 2Y6OA 5JZNA 3D4QA 1KSWA 4FYNA 5KE0A 3EOCA 1ZYSA 4KRDA 4KSQA 5TKDA 4C0TA 5I3RA 1Z9XA 4IADA 4IAAA 2OJJA 4FZFB 2IZRA 5HIBA 1TQPA 3G9NA 5EOLA 2P55A 4RIOA 2R0UA 3E64A 1WBVA 4GYGA 3FZTA 4IXPA 2H6DA 3BI6A 5KMIA 1S9IA 3FZSA 3Q04A 4Y5QA 4S34A 3P79A 1JNKA 1SVGA 3POZA 1Z5MA 2HW6A 3AKLA 2QHNA 3DB8A 3DKFA 3T9TA 2UW7A 4R7BA 1U54B 4JQ8A 2O8YA 5DI1A 2NO3A 2UZVA 4X2JA 3BQRA 3B8RA 2R3NA 4BCPA 1WMKA 3FYKX 4CCUA 5CAPA 4H3BA 3H9OA 2Q83A 4BDEA 1LEZA 5CAOA 1ZYJA 5K9IA 4BGHA 5IMXA 1IR3A 4FIIA 4FKOA 4G3GA 1CDKA 5DR2A 3FPQA 2YITA 3MTFA 3FLYA 4K0YA 5BUJA 5FBNC 3N4TA 1YQJA 2W17A 3GEQA 3OY1A 4XJ0A 2ONLA 4D58A 3MA6A 4YMJA 2HYYA 3EFLA 2C47A 3A4OX 4LQMA 4AZSA 2PUIA 3LFEA 3NNWA 5L2SA 1UU7A 2VWWA 3HLLA 3QQJA 4FNZA 4OAUC 2UVYA 3BPRA 3VN9A 4PL4A 2WNTA 3DT1A 5GJFA 1YI6A 5IQGA 2R3HA 3O51A 5H8BA 2C5NA 2QONA 5F1ZA 3UP2A 3EB0A 1RQQA 4J1RA 5HE1A 3V01A 4R77A 4F0FA 3FAAA 1PXLA 4D9TA 4QDEA 2PTKA 2F2CB 3JS2A 4CMUA 4EOIA 4F0GA 4U42A 4ENYA 2YWVA 4FEXA 4BBEA 4J71A 2GPHA 4OTDA 5AP7A 3C0IA 3FI3A 4CD0A 2QG5A 1GOLA 5EHYA 3VS5A 4TXCA 2UW0A 2C6LA 4CMOA 4OTHA 3VUDA 3IG7A 5M08A 1PMVA 3I79A 2XIKA 4RRVA 3ZUUA 3DB6A 3BHVA 4ZTNA 4GJ3A 4IZ7A 4F08A 4I22A 3QFVA 2X2KA 4RJ8A 1OUYA 3EFJA 1PXMA 4RQVA 4AXFA 5AR3A 3UBDA 3R1SA 3A8XA 1GY3A 4AE9A 3RWPA 3OXIA 4FV1A 4DGOA 3ZTXA 3HZTA 2ERZE 1KV2A 3CGFA 2XP2A 4G34A 3Q6UA 3LMIA 3PG3A 3TACA 3F2AA 4I6HA 3ZLSA 4BCKA 4UN0C 4RIWB 4X3FC 3MIAA 3LM0A 3UOHA 4UBAA 2BIYA 3C0GA 3C1XA 4II5A 5L2QA 3UC3A 2H9VA 4G9RA 3FSKA 3W2QA 4G5JA 1MQBA 3SOCA 4WO5A 2WTWA 4IX4A 4UZHA 4RIXB 4HVSA 4DHJA 3KXXA 3ZC6A 3LFCA 1WAKA 1PYXA 4NZWB 4I6LA 4UX9A 3LLAA 3DS6A 5A46A 2X7GA 4O21A 2IWIA 2WOTA 4U80A 4A7CA 4F78A 1FVRA 4QYEA 4FTIA 2VUWA 3QD3A 1OKWA 4YU2A 4QMVA 1TFFA 3EQPA 4Y5HA 2WXVA 3TJCA 2YDJA 2YIXA 5L6WL 4JRNA 3R6XA 4M7IA 4NT4A 4EHGA 4Z7HA 3QX2A 5DT0A 4QEBA 4QMMA 5K5XA 3KMMA 3QAME 3W33A 5BNJA 4BL1A 5HLNA 2OZAB 3OP5A 3Q6WA 4BVUA 1H28A 2YM5A 2B55A 3ZDIA 3QXPA 3TWJA 3ZUVA 2CDZA 1MP8A 4Q9ZA 5K5NA 3SDJA 1HCLA 2J9MA 3R7UA 5LMKA 4ZTQA 2C6TA 4CRSA 3MI9A 5CASA 2OF4A 3DU8A 3FMNA 5HKMA 1OL5A 2QURA 4I6BA 4P4CA 4M13A 5EM6A 4C02A 2RFSA 4Q9SA 3ENMA 4Z7GA 3HAMA 3D5VA 4FIEA 4BWKA 4FOBA 4HGTA 3C4XA 4ZSGA 2P33A 4TWCA 2QVSE 5L2TA 4LV7A 4RA5A 4D5KA 1OZ1A 3LAUA 4EBVA 2HXLA 5HU3A 4U97A 5IQIA 1WFCA 3CY2A 5J87A 1NT2A 1OL2A 1OBDA 4E7WA 4I5CA 3ZO3A 2BILB 4DGGA 2NRUA 4AT3A 4CZUA 2Z7QA 3O23A 3P9JA 4B9DA 2CHLA 3R9NA 3WARA 3UNJA 3W2CA 4ACCA 1ST0A 3HX4A 1W83A 4G6LA 2QG7A 4L01A 3HAVA 4GIIA 5GZAA 5AV3A 4JG7A 4S30A 4V01A 3AXWA 5HTIA 3Q53A 5DLSA 5JFSA 3W18A 4EOJA 2Q0BA 3KMUA 3C13A 1DAYA 3BLQA 4IE9A 2B9FA 3DKOA 5CU6A 3OW4A 1XJDA 3DFAA 4BY9E 4XV3A 3KREA 4YLLA 1Q8UA 5T6KA 1SM2A 2CMWA 1OIYA 4B8LA 3U87A 1WBPA 4JBVA 4CFWA 2VWVA 4F64A 4ZJIA 3P4KA 4GUBA 3FXWA 4PDSA 3KEXA 3E7VA 4X3FA 5E90A 5AR7A 2EWAA 3PRFA 3FC1X 2W5AA 2C4GA 3ZH8A 4LI5A 4J52A 4NSTA 1M7QA 1S9JA 4JAIA 4C2VA 5CVFA 5HO7A 3I0OA 3UYSA 3RJCA 4M0ZA 1GIHA 3U54A 1Y8YA 3RAHA 3PLAE 2B54A 5HCXA 2F7EE 2JKMA 4G17A 4IAZA 4MKCA 4BDGA 3UDTA 4PDOA 4PMSA 2J50A 3BU6A 4BI0A 4CG8A 4DFBA 2QO9A 3OCBA 3HL7A 2OIQA 3R1NA 3H4JA 2W1ZA 3NMUF 4BHZA 1NVQA 3R2BA 3KK8A 4USFA 4RX9A 4AOJA 4LDTA 2RSVA 3W2SA 2Z7RA 4XEYA 5HOAA 3NNVA 1J1BA 2QR8A 2JFLA 3UQGA 4K11A 4AXEA 5AMNA 3WI6A 5HIDA 4RX8A 4NL0A 4AGUA 4UWBA 1O6YA 3ROYA 5HEZA 4E5BA 4QRCA 3QCSA 2GS7A 5EQEA 4FTNA 3A8WA 4QTAA 5T3QA 4B99A 4N57A 2C3LA 3D2KA 3IW4A 2OI4X 2QKRA 4RIYB 3BGQA 3Q60A 4PTCA 3UZPA 2O2UA 1G3NA 3UOKA 3BRBA 3GU7A 2VWIA 3G2FA 3DTCA 4JL9A 3LFBA 3O96A 3COIA 4I24A 2GS2A 4V04A 3U8WA 4ZLOA 4FEUA 4IVDA 4NUSA 4FE2A 2YZAA 4D1XA 4JLCA 3JUHA 4R6VA 4BN1A 4QMLA 2JDTA 4HCTA 4E4MA 2VX0A 3HA8A 4J95A 4X3JA 4BZOA 3ODYX 5HHWA 4ZJVA 1R0EA 3OMVA 4KAOA 5ANIA 4C4FA 4RQKA 5E7RA 4N6YA 1REKA 2OZAA 4QMXA 1YWRA 3DXPA 4UB7A 3GU4A 3HV5A 5ACKA 3E63A 5HE3A 5IISA 2A4LA 2OZOA 2QKWB 4FT5A 2OH4A 3GP0A 4Y83A 3WE4A 4EZ5A 5A6OA 1XMMA 4R7HA 3AMAA 4EH6A 3IW8A 3RCJA 3V5QA 1QL6A 4RT7A 2UZLA 4UMUA 5HORA 3DBDA 3E93A 3QYZA 5IA3A 3QCXA 5IKWA 2HW7A 3GU6A 3O8UA 3OXZA 3UO4A 4C3RA 2W5HA 2E9UA 4U45A 3ANQA 4FODA 4FEVA 5ETFA 1IA8A 5JMSA 4NEUA 4EKKA 5HE0A 3V5WA 4C2WA 3MDYA 2XNBA 3GNIB 2VWBA 3MIYA 3MVJA 4FKRA 3QALE 3BU5A 1JKKA 3DKGA 2IG7A 4FRFA 4FTCA 2YM8A 1J91A 3KVWA 4RVKA 1J7UA 4BTJA 2XRWA 2Y0AA 3NNUA 2R3FA 3KXZA 3SC1A 4GT4A 2VTJA 4GU9A 1BMKA 2BIKB 1FMKA 4QYYA 4A9YA 4BYIA 5AUUA 3MFUA 5GZ8A 4LOQA 2JIVA 2WU6A 4DBNA 1Y91A 4PNIA 3ORMA 4GT5A 4NIFB 3R00A 2OF2A 3NEWA 1ZZ2A 3QZHA 3RINA 3V5JA 4CV8A 5AP6A 5DEWA 4K1BA 5F95A 3T8OA 4MX9A 3MYGA 4FT0A 3SRVA 1T46A 4JMQA 4KS7A 3TM0A 2UZDA 4FEQA 2UZBA 4AWIA 3RKBA 4LMNA 3LKMA 3HMPA 4I3ZA 2XK7A 4R1VA 3PFYA 2R7IA 3OWLA 5M51A 3LXLA 5BVNA 4RC3A 3OT3A 5E8VA 4ZTMA 5AM6A 4EH3A 3R28A 3MY0A 5CSXA 3C4FA 4FI1A 5CYIA 3OFMA 5DMZA 3UO6A 3ZBFA 5M09A 3GCSA 4HJOA 5DFPA 4LGDA 4AGDA 2IN6A 1WBNA 2FH9A 4ITJA 5IQEA 5A4CA 2UW6A 4O4BB 4QMUA 4V0GA 3F3WA 3HV4A 3MH2A 2WMRA 4GG7A 3TMOA 3O8TA 4MXCA 3ZLYA 5FP6A 3W2PA 5CEMA 3A60A 3EZVA 3GCQA 3NUPA 3P7CA 2B53A 1ND4A 4M66A 3VBVA 1H4LA 1XH4A 3BYMA 3D7TA 4L42A 2ZAZA 4TRLA 4B8MA 3E8EA 2ESMA 3F5PA 2W99B 4GG5A 4WRGA 5JRQA 4EOMA 2CN5A 5DVRA 4FR4A 5BMMA 3ZSGA 3N4UA 3QQFA 2QOFA 3WYYA 3CJGA 3Q4ZA 4MBIA 4QYHA 4XH6A 4EORA 3PWYA 4B7TA 3ZLXA 3MS9A 4M14A 4ANQA 2BTSA 4BIEA 3ZRMA 2OKRA 3MESA 4IFCA 3NX8A 4CYJA 3EYGA 3RK9A 2BHEA 3SG9A 5M55A 4I5PA 3NUSA 4DTAA 4CFMA 3RZBA 3R71A 5A4TA 5EYMA 4ASZA 3FQHA 4YTHA 3PJCA 1OKYA 5CAVA 3E92A 2ZFYA 2PMNX 5H8EA 3GI3A 3HRBA 3EIDA 4DH1A 2OK1A 5HTCA 3AG9A 4YC8A 4BDIA 3AKJA 4WIHA 2G2IA 4CG9A 3MVLA 4FMQA 3FYJX 2AQXA 4ANLA 4KBKA 5AV0A 5J8IA 2W1DA 5KMMA 2ONLC 2RFNA 3HMOA 4JDIA 4OTQA 2YDIA 3D5XA 5AP0A 5C9CA 1BYGA 2BKZA 4L00A 3WF6A 1ZRZA 1H8FA 1XMLA 1GZOA 4QP3A 4H3PA 4BB4A 1UV5A 2XRUA 4G6NA 4Z9LA 3MJ2A 3Q4UA 3VS2A 3ZBXA 3AD4A 4IHPA 3R21A 4X7QA 5CF5A 3U9CA 1M14A 5E8TA 4UALA 2NRYA 1KE7A 2I0HA 4DH7A 4DFLA 3H9FA 2ITNA 4PX6A 4BBFA 2E9PA 2XVDA 3T3UA 3H3CA 5EI6A 2BDJA 5FDPA 1M2PA 2R4BA 3L9PA 5L8JA 3RALA 2OLCA 5EQPA 2ITWA 3M1SA 4UYNA 4J97A 3RAKA 3RK5A 3R7VA 4DTBA 2CGVA 2JITA 3TL8A 3VUTA 3EN7A 5CANA 5C8NA 3ID6C 2WZJA 3DY7A 3SGCA 2V55A 3ACJA 2AC5A 4X2KA 4O0UA 4OUCA 2C68A 3QZFA 4A9UA 4LFIA 3QUDA 5BQ0A 4UV0A 4PPAA 4RJ5A 3QWJA 1JSUA 1W7HA 3HV7A 4R8QA 4RX5A 4FKPA 3HNGA 5GJDA 5I5ZA 3MPTA 4IM3A 4QT1A 4QMYA 3D94A 4M0YA 4JQEA 4UMTA 3LFDA 1MRUA 3HA6A 1Q61A 2EXMA 5E1SA 4AS0A 2SRCA 4R5SA 4F65A 3OTUA 4P7EA 5CVGA 4YTCA 1O6LA 3FMKA 3W10A 4YC3A 4B0GA 5JFWA 3GC0A 5M56A 4UWYA 5EI8A 4EC8A 2NNWB 2WD1A 4HZSA 3PXQA 4BCHA 3NUXA 5CQWA 2ITQA 3FLNC 5BVDA 1NVRA 4IFGA 3B8QA 2YCRA 4EBWA 3QTUA 4IJ9A 3RAWA 2AEGA 3TKUA 1KUTA 1W2FA 2HZ4A 4ASEA 2IPXA 4NM3A 2X8EA 2BDFA 3UIMA 3VW8A 4P2KA 5GHVA 4AA4A 2OJGA 1V0BA 2UW3A 1OPLA 1YWNA 2XK4A 3WBLA 5CAQA 5IH4A 5ANDA 2ETRA 3DNEA 3EKKA 4TTHB 3VVHA 5BVOA 4YTFA 4DCEA 2WTJA 5DR6A 4XBUA 4ZTHA 1JSVA 3OVVA 4BCQA 1UU3A 3F9NA 5EH0A 4IH8A 3EJ1A