3IDBA

Crystal structure of (108-268)riib:c holoenzyme of camp-dependent protein kinase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
343
structure length
341
Chain Sequence
KGSEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Novel isoform-specific interfaces revealed by PKA RIIbeta holoenzyme structures.
pubmed doi rcsb
source organism Mus musculus
total genus 108
structure length 341
sequence length 343
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3idbA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3idbA02
4U8ZA 3TTIA 4ZY6A 4S33A 3R1QA 2QO2A 2WMSA 3BHTA 3KXHA 4FZ7A 4KIKB 5IA5A 4UX9A 4M67A 4GFOA 3KVXA 4C35A 2V62A 5EOLA 2VTIA 3G2FA 2AUHA 1U4DA 3ZTXA 2ZV9A 4X3FA 4EOMA 5JGAA 1QCFA 4FV2A 4J71A 4W4XA 2EU9A 2W0JA 4YJRA 5CSHA 5TE0A 5T68A 3UVPA 4FYOA 4CT2A 5AAGA 4U9AA 4QTBA 4QPMA 2UV2A 3ZHPC 5EYCA 4UXQA 4GUEA 3AT4A 5GHVA 4F0FA 5K0XA 4G3CA 2VTTA 4FV5A 1WBNA 5I3RA 3BWJA 3KXXA 5AR7A 2GQGA 5HEZA 3ITZA 3DAKA 2B9FA 2OJJA 3MDYA 3HYHA 3PXZA 3CXWA 4FG9A 2XM9A 4C0TA 1OUYA 1FOTA 4WG3A 4L45A 4XRJA 3R2BA 1Y6BA 2XIKA 4G17A 3NVMB 3KK8A 5HNBA 4MBJA 4NW6A 2W1GA 2CDZA 2C6TA 2OU7A 3QQKA 4RFZA 2OLCA 4MEDA 4AOJA 2ETMA 1XH8A 2ETRA 1OB3A 4ZTLA 2GMXA 3DLZA 2X1NA 4UZDA 2VWWA 5AA8A 2CPKE 2VWBA 5DBXA 4Z7GA 2H8HA 5DA3A 3R00A 4HGSA 2ITVA 5LMKA 1QL6A 4DINA 4G5PA 1REKA 3A99A 4FT9A 3KK9A 2WMAA 3LCDA 3DDPA 1W0XC 3I60A 3DK7A 4I5HA 4IDVA 3AC8A 3OXIA 4B6LA 5A4LA 3CSVA 3H3CA 5FP6A 2VTHA 4BC6A 3HP5A 2W5HA 3QCXA 3MIAA 4G6OA 4EYMA 3VULA 4UEUA 4CMOA 3KXGA 4TNBA 5C8KA 5EM5A 5JFSA 3E93A 2FH9A 1Q8UA 3NWWA 5I0BA 3LW0A 3NYXA 5HTCA 3R8PA 4PL4A 5AA9A 4FK3A 1YWVA 2HWOA 3TDVA 2R5TA 1JSTA 4JG7A 5IQIA 3PY0A 5L4QA 2ZAZA 3SOCA 2JDRA 2GQSA 2ACXA 4A7CA 1YRPA 3ATSA 3LFDA 3ORTA 4QMVA 5E8TA 2J51A 2Z7QA 4GVJA 4MCVA 1YXXA 5HI2A 3RPSA 4EYJA 1Q41A 3C9WA 3HVCA 3TUDA 3TM0A 2B54A 4EK4A 3QD0A 5ANKA 1Q3DA 4R5SA 4IX6A 5EW3A 5BVEA 3L9LA 4NM3A 3ORNA 2LAVA 2Y4IB 2WGJA 3QTRA 5AR4A 4PTEA 4DEAA 3MIYA 5J1VA 2XIYA 5M44A 4MXCA 2E9VA 2Q0NA 2UZUE 2YLFA 2YM4A 4B8LA 5AAEA 3NAXA 1AGWA 5ANGA 4ALWA 3LLAA 3RPRA 3V8SA 2GNLA 1FVRA 4FVPA 3R01A 2YM8A 5CASA 3L8VA 4DH3A 4PL3A 1NY3A 3G6HA 2W1DA 4IAYA 2X2LA 1NA7A 4AXAA 5KX8A 3AOXA 3PY1A 3W8QA 2WTKB 5HVYA 1MRVA 3G0EA 4RMZA 5HLNA 3MH3A 3NLBA 2HOGA 2UZOA 3NNXA 5E8XA 3D5UA 2XKCA 3EYGA 1J3HA 2QOQA 5GJGA 4EK6A 3OXTA 1CSNA 2UZWE 3NIEA 1K2PA 2OICA 3HGKA 2EUFB 4E5BA 4JQ7A 4YC6A 4O86A 1PXJA 2VWYA 5EW9A 4JRVA 3WIKA 4O7WA 2YHVA 1PXIA 4DAWA 4ACCA 3EQGA 3U87A 4EC8A 4WNPA 1P4FA 5AP5A 4AFJA 1R78A 3IDBA 2X2MA 3HMPA 2VZ6A 1M7NA 3ZH8A 3P86A 3BIZA 1Q24A 3UJGA 5L2IA 4H3QA 4R3PA 3BYUA 4BIBA 2XJ2A 4OTHA 3ZUVA 3A62A 5HIEA 3F7ZA 4JBPA 4XLIA 5J9YA 2X0GA 2ZDUA 3L9PA 5EH0A 4AW2A 2GQRA 2WFYA 3BCEA 3BYVA 4FK6A 4ZP5A 5KNJA 3V8TA 3DS6A 5DNRA 5FEQA 1PMNA 2E9OA 2XK4A 4RC3A 3DJ6A 4ZJJA 3DBQA 3SRVA 2BIYA 5K4IA 4ZZNA 3THBA 3VC4A 3KA0A 2QOKA 3DB8A 4FTTA 4HCVA 3FZPA 2JGZA 4LRKA 3QTIA 3ZFXA 4NM5A 1BX6A 3PJ3A 3UBDA 3ZDIA 2YCFA 4AAAA 3IW4A 2X8IA 4DITA 4DTAA 3QD2B 2ERKA 4HOKA 4E73A 5H2UA 4ZOGA 5DT3A 4K8AA 4AX8A 5EI6A 3GQIA 2CN8A 1DI8A 2G2FA 5CEOA 1BI7A 2C68A 4GUBA 4UWCA 5CF6A 1UNHA 2Z2WA 5E8YA 1DM2A 3ROCA 4X3FC 4FTMA 2X7FA 3L8XA 2ZV8A 4CFUA 1KWPA 3E62A 3DKOA 2PHKA 5AX9A 3EN4A 4DBNA 2YCRA 4NIFA 2IZTA 2WZJA 4IZYA 1WFCA 4U5JA 3REPA 3QX2A 2Z60A 3C4EA 3ET7A 3OZ6A 4OTQA 3RZFA 4A9TA 1JKKA 4K77A 3ZZWA 3COIA 4IWQA 3G15A 5CAPA 2RF9A 4RX7A 2OK1A 5EFQA 4QYGA 4J52A 4JVGA 5BYZA 5BMSA 1OKZA 4FIJA 4CFNA 3LMHA 2CSNA 3OCTA 3OUNB 4CFFA 3UQGA 4USFA 3OOGA 4FV6A 1YDTE 4F09A 3TZ7A 4RVTA 4TZRA 3QZIA 4A06A 2QOLA 4R7BA 5JT2A 3QWKA 4BBEA 4RBLA 5C4KA 3FXXA 5LVNA 1DS5A 2R2PA 2BIKB 1FMOE 1W84A 3QTQA 3OD6X 4MKCA 4AQCA 4DYMA 3PIYA 3QCYA 4LOOA 4EORA 1Q8WA 4E6CA 1KV1A 3R6XA 3GXLA 2Q0BA 3W18A 5FDXA 4QOXA 4FIHA 3SXFA 4TWCA 5AJQA 4MBLA 5CALA 4FGBA 5LMKC 1TKIA 4ZTHA 4BZNA 2CHLA 2XIXA 3QQUA 1GIHA 3GCUA 1GZ8A 5EHOA 3U9CA 3R1YA 3ZM4A 3IKAA 4PP7A 1W98A 4CXAA 5HVJA 3Q52A 2XKFA 2W1FA 4C59A 4U3YA 5E8ZA 5FBNC 2REIA 3OEFX 3GFWA 5HESA 3K5VA 3R9OA 1AD5A 3LJ0A 5G6VA 3AG9A 3GCSA 3PVGA 4AGCA 3SLSA 4EH4A 3R7VA 4ANOA 3FHRA 4LM5A 3EWHA 4X6QC 1ZWSA 4YTIA 4Z16A 4C2WA 5EDRA 5ANDA 1OL5A 3FAAA 3QTUA 2IG7A 3Q9XA 4HCUA 4R3RA 5BVKA 4PWNA 4A4LA 3RAKA 4XG7A 2PVYA 3IDPA 2WB8A 4IE9A 4RWLA 5FXQA 2XYNA 1BL6A 2OJGA 4XLVA 5H8BA 4BDCA 1PRYA 1WCCA 5JSMA 3PJ2A 2B53A 2J0KA 2V5QA 2QODA 2VO7A 3A7GA 4V0GA 5CU6A 4PNIA 3HUBA 1J1BA 1XH9A 5AP7A 5M4UA 1TVOA 3DGKA 3T8OA 4EJNA 2E2BA 3FMNA 4CRSA 3DJ5A 3DQWA 2XEYA 3QZFA 2UVYA 2Y6MA 5AIKA 1STCE 4QTAA 3CC6A 3IOPA 4G3GA 3R9NA 2PULA 2VWIA 3RM7A 1YI4A 2C5NA 4BZOA 5E1SA 4E4LA 4ARKA 4BCIA 1OL7A 2V22A 3BHVA 5IA2A 4TL0A 5C01A 2WU6A 2QOIA 3R04A 4BTMA 5FDPA 3RJCA 4KIOA 4R77A 5A14A 1LR4A 2W4KA 4OGRA 3RBWA 3W8LA 5JH6A 1FQ1B 4B9DA 2G9XA 2F57A 4HGLA 2CMWA 3P08A 4LRJA 2YFXA 2IW9A 5FEDA 5AAFA 4BZDA 3B2WA 3JR1A 2W9FB 4M69A 3CR0A 1LEWA 4DN5A 4YPDA 3ZUTA 3E64A 3CS9A 2VX3A 1YDRE 4J98A 5LCJA 1U5RA 2OW3A 3QHWA 4YHFA 4H05A 3SXSA 4ZLYA 2PL0A 5CAVA 2RG5A 4ZSJA 4IAZA 3E8CA 4FTAA 3NUAA 1LPUA 4C2VA 2JDOA 3RK7A 5HZNA 3VBVA 3L8SA 5E91A 2FSMX 2VX0A 1RDQE 2YABA 3W1FA 3R8MA 4JDHA 3D7TA 4IW0A 2NRYA 4WHZA 2WEIA 5AUUA 1Q3WA 1GNGA 1PXPA 4BDJA 4PMMA 3FL4A 3JYAA 4GSBA 3ZS5A 3NVKI 2PMOX 3ZUUA 1OZ1A 3F3VA 4V04A 1VYWA 3LFBA 3MFRA 5EHLA 5BPYA 4EZ7A 2XBJA 5CEKA 1IR3A 2W96B 4L46A 5LVMA 3ZEWA 2C6MA 5DR9A 4DTBA 1OIQA 3FV8A 3LJ1A 4U7ZA 2PVMA 3W2RA 3PJ8A 3A7HA 4JDIA 4WIHA 4GCJA 3AMYA 3ODZX 3NUNA 3V51A 4DT8A 2JKKA 4ZSGA 3ID6C 2FVDA 4TYHB 3GU8A 3TUCA 4O6LA 3O51A 5GIOE 1F0QA 2BDJA 2RG6A 3UMWA 3LXLA 3ZLYA 1GZNA 4YJVA 3EHAA 3MWUA 3O96A 4IH8A 4BYIA 4ZTSA 4KSPA 4O7RA 2ESMA 2IVVA 4AS0A 4X3JA 3UO4A 3DLSA 4EHZA 4MWHA 4FZDB 3SVVA 2OZOA 4YC8A 3KRLA 3R7OA 3RNIA 1W83A 4ZAUA 4FKWA 4EK8A 5EW8A 2P33A 3PRIA 3RHXA 1WAKA 4ZMFA 2E9PA 2B9JA 3FZSA 3FLSA 4O7LA 2XJ1A 2CKEA 3GT8A 4GYIA 5AM6A 4OTIA 2IPXA 4KB8A 4ZEGA 5L3AA 3MH1A 2BZIB 5CTPA 1Y57A 1KE7A 4AOTA 4GW8A 4UALA 1LUFA 2OJIA 3DNDA 4FTCA 3MVJA 2XBAA 3MJ1A 2WTCA 1UU8A 2PVHA 4EUUA 1WBVA 3R28A 4AE9A 2WMWA 2HY0A 4XG8A 4Y83A 4N70A 4CQEA 5IG1A 4JJRA 4QQCA 2QHNA 2B7AA 4JXFA 5E90A 3QLGA 3HP2A 3PG3A 4LYNA 4DEDA 2ZM4A 3FEGA 1BMKA 4F1TA 2OXYA 4FV3A 4F6WA 4IDTA 5DHJA 4CNHA 4YUQA 3UDBA 3NYOA 3UZTA 1REJA 1Z57A 4LQMA 4NUSA 4AW0A 2PPQA 5KMIA 3MYGA 5AP4A 3VWAA 3WE8A 1O9UA 3H0YA 2YIWA 3M2WA 4RPVA 4TY1A 5DLSA 4D2WA 3FI2A 1H08A 4D58A 5DFPA 1QPJA 3VHEA 2Z02A 3OMVA 1FVTA 1XH6A 3NYVA 3N4TA 2FYSA 3QXOA 4AT3A 4PMPA 5FG8A 4N57A 3UODA 2PUPA 3RNYA 3KGAA 3MVHA 5AP2A 5IUGA 2C0IA 1FMKA 1GZOA 4IAKA 4PPAA 4YURA 3NDMA 4L42A 3W33A 3FDNA 5CAUA 2OO8X 1T46A 2YWVA 3FUPA 4QMYA 3UIUA 3DKGA 3ATTA 4NKAA 4OT5A 4ZZMA 2J0IA 3EOCA 4O38A 4GFGA 4IC7A 3R30A 1ND4A 4J99A 4HPUE 4R7IA 3T3VA 4QQJA 4G2FA 4J53A 4O0TA 3BV3A 2YCSA 3QQJA 4E4XA 3BELA 3CGFA 4YJTA 1TQIA 4D2VA 2PE0A 4H3PA 3F2AA 2C5VA 4J8NA 1MQBA 3BLHA 4RZVA 4DEHA 2X8DA 4MTAA 1FVVA 4H39A 3P9JA 2RIOA 2O5KA 2X39A 5C27A 2OXXA 4ZSLA 4HW7A 2BHEA 3U54A 3EKKA 2ERZE 4V05A 4FKSA 4BCKA 4EK3A 1MRUA 3OROA 5HD7A 5C4LA 4UYAA 3G0FA 3TKHA 1YWNA 3UC4A 5D1JA 2J90A 3HMOA 3ZFMA 4I20A 1IAHA 3F2RA 5LMBA 4BB4A 1B38A 4ZTQA 4FKGA 2WKMA 3KQ7A 3F82A 3MTFA 3BU6A 3VS7A 4EBVA 2R0IA 2PZIA 4YMJA 5HG7A 3TZ8A 2C30A 3F5XA 5F94A 2V55A 5HX6A 2YDIA 3GCQA 3IW5A 3S0OA 3KREA 4HNFA 3GBZA 3KKVA 3TCPA 4DH7A 4DG2E 2A0CX 1ZRZA 3LFFA 3RZBA 2VWXA 4Q9ZA 4AF3A 1JSUA 4YJSA 2R3HA 4R8QA 1J1CA 2ZVAA 5LMAA 5M4FA 3CTQA 5FTQA 2XMYA 4MNEA 3CIKA 2X2KA 2ZMCA 2FSLX 3MY0A 2YAAA 3E8DA 2YWPA 3NUYA 4IWOA 4LMNA 3K5UA 5AR2A 4ACMA 5L6OA 3Q60A 1E1VA 2JLDA 4AFEA 4DE4A 4C4IA 5JKGA 4ZS4A 5KMMA 1YVJA 2O0UA 2OKRA 4RSSA 3VF8A 2Z7RA 3TV4A 4F6SA 1ZOHA 4IJPA 3ZBXA 5F9EA 4UB7A 5HBEA 4C4GA 3VS1A 4F0IA 2LGCA 1DI9A 1O6KA 1OI9A 4FI1A 4ID7A 4JL9A 1RQQA 4ZXTA 3ZO2A 2PVKA 4DG3E 1O6LA 4EH3A 4YU2A 4ONAA 2G1TA 2OBJA 5A46A 1ZARA 2F7EE 3QQLA 3GC9A 4BI2A 2VTJA 2WMUA 4XOYA 2WMXA 3LQ5A 4YZNA 5CT0A 4AUAA 2BDWA 5AUZA 3D7ZA 4F7JA 3QTWA 4D0XA 1CTPE 4A9RA 5A4QA 5JQ8A 1PJKA 4JR3A 3IW8A 2QR7A 2CCHA 1BYGA 3CPBA 1GIJA 1EH4A 3UNZA 2WTJA 2O63A 5AUYA 4FZAB 4BHZA 3PP1A 3QAME 4ERKA 3UVRA 5AUVA 3KULA 1SYKA 3FLNC 2XEZA 2WELA 2PZPA 4FSQA 3UE4A 3Q4UA 1PY5A 3IDCA 3Q3BA 3OBJA 3ZBFA 3WF5A 4II5A 5I9WA 5JFXA 1F5QA 4KKEA 5CEIA 1G8AA 2YAKA 1ERKA 5K0KA 5T3QA 2EB2A 4YLLA 5ANEA 4FT7A 1E9HA 1LP4A 4A9UA 3DAJA 3EL7A 4G31A 5HG9A 1OBGA 5CYIA 4IVDA 4A9SA 1BI8A 4C36A 2C6KA 2BRNA 3BLQA 3FJQE 3LQ8A 5CVGA 4X2JA 4WNKA 3RCJA 2PUNA 3VQHA 3ZDUA 5HG5A 4D1XA 4FG7A 4OT6A 5HORA 2HCKA 4BGGA 4KBAA 3TTJA 4BWXA 3O8TA 3PFQA 5IA0A 3D5WA 5I9VA 3ORZA 1ZYCA 4LRMA 4GK2A 4OR5A 4U40A 5AIRA 4IWDA 4QMPA 3ACJA 4HYUA 2PMLX 2VO3A 4W4YA 5HIBA 4AW1A 4XP2A 3F6XA 4K9YA 4FKUA 4BICA 4QP3A 3PVUA 2B0QA 2HIWA 2VRXA 1IRKA 3PWYA 4M66A 5HVKA 2HZNA 4NSTA 4CFWA 2H96A 2HZIA 4N6YA 1H0WA 4WBOA 5CF4A 2XCHA 3FC2A 4LGGA 4DF3A 3U6HA 3A61A 3KN6A 2YACA 4HGEA 2R0UA 1JVPP 1OIUA 2CJMA 4E6QA 3JY9A 2WEVA 1Q8YA 2XYUA 3BHUA 4AZEA 4IX5A 5DI1A 3NUSA 3QTSA 3OF0A 2C5OA 3SHEA 4CZYB 2CN5A 2OF4A 3C4WA 4YZCA 4HGTA 3SQQA 4IEBA 3CY2A 4DFZE 3M1SA 5K5XA 3UO5A 1GIIA 4C4JA 3HV7A 5B2LA 2G15A 3G33A 4L67A 2EWAA 3FLYA 4F9AA 3KRJA 3GOKA 2HXQA 3NYNA 3MPMA 4FYNA 3F9NA 3F88A 5CANA 2HY81 5KHXA 3ZSIA 2DUVA 3TG1A 2F49A 2BVAA 4QPSA 4EHGA 1PXMA 3HMIA 3UOHA 3ZOSA 4P2KA 4UMRA 4GL9A 4DBXA 4OAUC 5HE3A 2VGOA 2PK9A 3HV6A 1PYEA 5D7VA 5EYDA 4XMOA 4ZSEA 1UKHA 3G9LX 4GU9A 4YZMA 3BEGA 4CVAA 3O23A 2W5BA 3CEKA 2IWIA 3A8XA 3D2IA 3NUUA 2J2IB 4FKLA 3C7QA 4EZ5A 3LFCA 3OEZA 5DH3A 2ZB1A 5ETAA 2RSVA 2GU8A 3FZOA 4C3PA 4E6AA 3FKLA 4N4SA 4XG3A 4MD9E 4O27B 3UNKA 4I5CA 3NW5A 5FD2A 3PA4A 4ZTNA 5M4CA 2I7QA 2WTWA 3VUKA 4P7EA 2IW6A 4IVCA 3RCDA 4WD5A 5EDQA 3P5KA 3TT0A 4Q2AA 4GKHA 2BFXA 4OW8A 3Q4ZA 5ANOA 4S32A 4CT1A 4O7TA 3FLWA 3P78A 4JG6A 5FXSA 4KBCA 1PYXA 4E4NA 3GU7A 4QYYA 4HCTA 4AGUA 3BE2A 2Y8OA 3OS3A 2W1HA 3T9TA 2GCDA 3DK3A 4C4FA 4RX5A 3VBYA 3QLFA 4ZTMA 4BDFA 2AC5A 3ZONA 1FINA 4JI9A 5HE0A 1J7LA 1WBTA 4QO9A 3Q5ZA 3UQCA 2FA2A 2E9UA 2X7OA 4UZHA 1SNUA 2BAJA 5C9CA 4EH5A 4LOQA 4NWMA 5DRBA 3BYOA 3DK6A 4M7IA 3AD4A 4G6NA 4HYSA 4TKSA 4CG9A 4PDPA 1ZLTA 3SXRA 5GJDA 5HO8A 3OXZA 5C03A 3G9NA 3TXOA 2GFCA 3EFWA 1OIRA 4C58A 4F70A 3HRFA 2XNBA 3CJGA 3D4QA 1R3CA 3OCBA 4RJ7A 5M56A 3O2MA 1FPUA 3I81A 4ACGA 5TKDA 2BKKA 3NW6A 5AV4A 3I0QA 4F64A 3BV2A 1NVQA 4D4VA 4GRBA 4BKYA 2NP8A 2QLUA 3LXPA 4I5MA 5CXZA 5IUHA 3QHRA 2WIPA 2W1IA 3S95A 3QYWA 4FMQA 2BCJA 2WHBA 4IFCA 2QR8A 4PUZA 4RVKA 5JEBA 1UWHA 1ZY5A 5M06A 2HXLA 3OUKA 3IQ7A 4RVLA 3LCTA 4RIWB 2B55A 3AD5A 5IDNA 2XNPA 3MA6A 2HWPA 3SV0A 2QVSE 3O0GA 5IQAA 2XH5A 2WMRA 4M12A 4EOOA 1IA8A 1XH4A 3VAPA 5CNOA 1W7HA 2C6LA 3ZO3A 4BIEA 5IEXA 2YDJA 3VRYA 4YTFA 5LVLA 4DCEA 3COMA 4CKRA 4BDDA 5L2WA 3TEIA 5K5NA 3MTLA 4QMZA 4BCMA 5KBQA 4QPAA 3R7UA 4XHKB 3LFQA 4U80A 5CZHA 3VRZA 1QPCA 3NW7A 4KRCA 3QRKA 3BEAA 4D2SA 3CTHA 5CX9A 5E8SA 4G34A 4IM2A 5FTOA 2CKOA 3A7IA 5E1EA 2V0DA 2WQNA 3LM5A 4IC8A 3FPMA 3UO6A 1Y8YA 1GY3A 4XBUA 2YZLA 2WTIA 4ZIMA 4OTPA 4FOBA 3A8WA 4EH6A 4D28A 4ENYA 3GEQA 1Q8TA 1GJOA 3NGAA 4BKZA 4MH7A 4S31A 5IISA 3ACKA 3AMBA 4X2GA 5DT4A 4G16A 4AZSA 4GH2A 1ZOEA 4GJ3A 4AN9A 3FC1X 3V5WA 4AN2A 4W4VA 2PY3A 2C6OA 4UXLA 3MFSA 4FKPA 4Y5HA 5JN2A 2ZYBA 2W9ZB 1WBOA 1XJDA 4RFMA 4NM0A 4RFYA 4RG0A 2J0MB 5BMMA 4A07A 4AT4A 4XOZA 4EOLA 2YM5A 3I1AA 3MFUA 3QCSA 1Q4LA 4PV0A 5FM2A 3WZUA 4OBPA 5D7AA 3O50A 4HVHA 3OP5A 2PVRA 1PXLA 3FKNA 3R83A 3D2KA 5KUPA 3IO7A 4WG4A 5BX0A 1ZYLA 5EI8A 3RM6A 4B99A 4YJUA 1VR2A 4LV8A 2VX1A 3GU4A 4MHAA 4MD7E 3I5NA 3P0MA 2XP2A 5A3XA 2R3FA 4QQTA 2PZYA 3LQ3A 3ZRKA 5ACKA 2XNOA 1IA9A 2YJRA 4MF1A 4EOQA 5AUTA 2G2IA 4KIKA 3V5LA 3PIZA 3UG2A 3R21A 3UOKA 4FIIA 4O0VA 4QP4A 2UVZA 4A4OA 4YO6A 4NTTA 4EKLA 2C5XA 5LJJA 2XNMA 3PTGA 4LG4A 5CSXA 3H0ZA 2X9FA 4FC0A 4AZFA 5AUWA 2W17A 4DGMA 4QP9A 1IEPA 3GFEA 2XNGA 4KRDA 4EWHA 3ULZA 3MGYA 3AC3A 4G3FA 3F3ZA 4DEIA 2QG7A 4GYGA 4EBWA 3UYSA 2ITZA 3AGMA 5HLWA 2GHMA 2C69A 3EQIA 5CVFA 4C02A 4MYGA 3IONA 3OWKA 5K4JA 2JIIA 3GQLA 2IZSA 3Q53A 4QP8A 4ASEA 4UYNA 3VW8A 1JWHA 3NNUA 5IQGA 3I0OA 2R7BA 1CMKE 5FM3A 1YKRA 3F7WA 3VS5A 4E93A 3Q9ZA 1HCKA 3FY2A 3MY1A 3KC3A 4R5YA 4K11A 2WQBA 4BDGA 4OBQA 5CEMA 3POOA 5CY3A 2O2UA 4UMUA 4Z55A 2JBPA 2YIYA 5J1WA 3Q9WA 5E4HA 5E7RA 3FY0A 3LLTA 1K9AA 5AFVA 4M97A 3CY3A 4W9WA 1JSVA 2YDKA 1OGUA 5CSVA 4YJNA 5CENA 4I4FA 2WQOA 5EKOA 4RIYB 2UW5A 4XRLA 4WBBB 4ZTRA 5I5ZA 4KINA 5DR6A 4Y46A 1J91A 2UW8A 4BI1A 4JR7A 4G6LA 1BUHA 4I0TA 4ZK5A 2R7IA 3E7VA 4EEVA 4YR8A 3NS9A 5JK3A 3VS4A 5CU2A 2PMNX 3V5JA 3OVVA 3JXWA 4S34A 3VUIA 5C8NA 3TV7A 5JMSA 3QYZA 2UZBA 3FSFA 1URWA 2DQ7X 3R9DA 3IGOA 3FXWA 3PSBA 5TT7A 3ORXA 1OKVA 1XH7A 4O82A 1OMWA 1FBNA 4TTHB 2ZOQA 2CCIA 3ORIA 5ITAA 4I0RA 4L3LA 3S2PA 4FV9A 4IANA 4BGHA 4EJ7A 2VUWA 3PP0A 4F0GA 2WOUA 5LARA 3CQEA 3BZ3A 5DE2A 1JOWB 5D12A 3D0EA 2BALA 3UTOA 3S4QA 3BGZA 3ODYX 3C4FA 5TF9A 4QTEA 3O7LB 2UW0A 4CYJA 5EKNA 5CU3A 5DPVA 4GK4A 4XNEA 3RKBA 4YBJA 4XG2A 3DJ7A 3NRMA 5EM8A 2I40A 4OTFA 1CKIA 1URCA 4ITJA 2PZ5A 3QUDA 4FKQA 4RIXB 4RX9A 3EH9A 4RT7A 5CT7A 4F7SA 2ITWA 4CSVA 2XIRA 4IFGA 4BDIA 4U45A 3A2CA 4GS6A 4B7TA 3QTZA 1U54B 4F1OA 1UU9A 3RPOA 3SD0A 2R3NA 5BYYA 2GS7A 3BX5A 4V01A 5DMZA 5EQPA 4APPA 5C26A 4AGWA 3D5XA 3FLZA 4TWOA 2NRUA 3R8UA 3FLQA 4O0SA 5M4IA 4O7SA 3DZQA 3FMLA 3FPQA 5E8VA 3KEXA 4IM3A 3L1SA 2H34A 3WIGA 4L68A 3L9NA 1BLXA 4I24A 1YHWA 3H9RA 1UU3A 1NW1A 3NEWA 3V5PA 5M08A 1PMVA 5HICA 2YISA 2YM7A 3HKOA 2VWZA 5CU4A 5L2TA 5KMOA 2UZNA 2WAJA 4C3RA 4TPTA 3N51A 4I92A 4BCHA 3OW4A 2Y4PA 4X21A 3W55A 2OIQA 4FTJA 1JLUE 5KBRA 4BTFA 4PDYA 5HE2A 4E4MA 4ITHA 2J9MA 1WZYA 4H36A 2RGPA 3UQFA 3P7BA 4BIDA 3EMGA 3P7AA 4IVAA 1PMUA 1R0PA 4EHVA 4P5QA 4J95A 4XBRA 3R71A 3HA6A 2HELA 3AD6A 3CKWA 4IHPA 2ZDTA 2OXDA 3NCGA 5FLFA 3W16A 4BBMA 2JDVA 4D4RA 4BY9E 2JD5A 2J0LA 4U43A 4O6EA 3K2LA 4WNMA 4IVBA 5DOSA 5L8KA 4HNIA 2CNVA 1KOBA 2X81A 2R4BA 4TYEA 3LKMA 5CF8A 5DIAA 4PNKA 3KCFA 2BRMA 2QQ7A 4KA3A 5J79A 4JBVA 2XIZA 4OTDA 5A4TA 3P7CA 4FX3A 5F1ZA 4DGNA 3QKKA 5HLPA 5GNKA 3BI6A 3FMHA 5AP0A 5FEEA 4EH2A 4LI5A 4DFUA 1G5SA 1PKGA 3EQCA 5KMKA 3DXQA 2GDOA 4AT5A 1Q61A 2XNNA 4FKIA 2R3PA 3DKFA 1ZYSA 1MRYA 2QOOA 4L3PA 4ANSA 2PVLA 2EXMA 2XJ0A 3LIJA 3RTPA 3UOLA 4R3CA 2F9GA 2QC6A 3IGGA 4YJPA 4DFXE 1R0EA 4XS2A 3PIXA 3QQHA 3CJFA 5HNGA 3PXKA 2NO3A 2YIQA 4IB1A 4YLJA 3C0IA 5EYKA 3PLSA 4QMTA 4U41A 4FZFB 4EK5A 2YEXA 4CFMA 1JPAA 1PXNA 2ZV2A 1CDKA 2ITUA 3L8PA 3SKCA 3QZHA 1H1QA 2W1EA 1H07A 4B4LA 4ZY5A 3F61A 1JKTA 4WRGA 1YW2A 1J7IA 4BDAA 1PMEA 4MQ1A 4Z7HA 3TNQB 5K9IA 4DFYA 4TT7A 3ZC6A 3V6SA 3IPHA 4TW9A 2I0EA 4GIHA 4QP7A 2VNWA 2R3JA 3CD8A 2B9HA 3QGWA 4FEQA 3MY5A 5AV1A 3QUPA 4ERWA 2QOBA 3MN3A 2XB7A 2W7XA 3HV3A 4F4PA 4BR3A 4IZ7A 3FYJX 3AC2A 3I5ZA 3MSSA 4CV9A 3FXZA 4F08A 3I6WA 5L6PA 3TI1A 4DGOA 4F7NA 4IADA 3UZPA 1R1WA 4R7HA 4E20A 4IBMA 3SW4A 4USDA 1SNXA 4U79A 4IAAA 4JT3A 4U97A 1H01A 4O22A 2UZDA 3UPXA 3KMWA 3ULIA 5B2KA 2R3MA 3V3VA 5KMLA 2F2CB 3OTUA 3TJCA 1V1KA 4PP9A 1CKPA 4KS7A 4R6VA 1XHAA 2ITNA 3KXZA 1P4OA 3PG1A 3QRTA 3NIZA 4M84A 5HCXA 1JKLA 4RIOA 3U4UA 3PPKA 2OIDA 4MXZA 2UZVA 4O7ZA 2IW8A 2QONA 4IX3A 4PTCA 4D2RA 5DYJA 1YXTA 3LAUA 2IVTA 2PE1A 2X4FA 3NZ0A 4KNBA 2JKOA 1GZKA 3OG7A 2JC6A 2Y4IC 3H9OA 3JS2A 3C13A 5CI6A 3WARA 2W4OA 4QMQA 5IEYA 5J9LA 5LCKA 2BPMA 1ZMUA 2C3LA 3E8EA 2ITTA 4FTRA 5AV0A 4L52A 5IQEA 3F5PA 2FB8A 3ZZEA 2ITYA 5IF1A 2JDSA 5M51A 4JX3A 3K54A 1MQ4A 1NVRA 3BYMA 3HECA 3PJ1A 4FUYA 3EYHA 4IZAA 4L7SA 2WMBA 5E92A 4IACA 3SX9A 2VO0A 3GCVA 3QCQA 4JG8A 3HZTA 3NUPA 2JBOA 4EWQA 4ORKA 2WTKC 3F3TA 2BZJA 3KF7A 2CLXA 4M15A 2QKRA 4Y73A 3RK9A 4K2RA 4AACA 5HO7A 3W2QA 1A48A 4KKGA 5GINE 5KHWA 3MI9A 4C57A 1I09A 2AYPA 4ZJIA 5KMNA 3NSZA 3QRUA 1M17A 4E7WA 4FEUA 4DA5A 2VTQA 4FSTA 3PYYA 3UG1A 3R1SA 3QQFA 2BILB 4EUTA 4AZVA 1J7UA 4GIIA 2DYLA 2R3IA 2OZAB 3D14A 4L7FA 3Q2JA 3D94A 4F9YA 4JOAA 2R3RA 4QP6A 5J5TA 1ZAOA 4CFVA 2JAVA 3EB0A 2PMIA 5EDPA 3SOAA 2OFUA 4BKJA 3II5A 4ANBA 5KKRB 5LXMA 4O84A 4RJ4A 3RAIA 4BYJA 3SC1A 5HU9A 5GIPE 3VBQA 4BHNA 4K18A 3EN5A 4DHFA 3VNTA 3ZSGA 3V04A 4RRVA 4X2FA 4LUEA 3LCKA 4I6QA 5I3OA 4D5HA 4YC3A 4TYHA 4D2PA 4DLIA 4IM0A 4FNXA 4KD1A 2O64A 5DEYA 3MESA 5IA3A 3N4UA 4YSMA 2C1AA 5LWMA 4U42A 4J1RA 4U3ZA 2OH0E 3BHHA 4QD6A 4M0YA 4XG6A 5CZIA 2F2UA 4H58A 3BLRA 4IZ5A 4JQEA 4YHJA 5HHWA 5TO8A 4F9CA 2JIVA 3PA5A 4AU8A 1SVHA 2XCKA 3GOPA 4WSQA 1XO2B 3RINA 5HQ0A 2FSTX 3RGFA 4ASXA 3C0HA 5AP6A 4AGDA 3R7GA 4BTJA 2OJFE 2XRUA 3E5AA 3PVWA 2Z7SA 1ZY4A 4MK0A 5AR8A 3I7CA 2VTRA 2WNTA 4AZWA 2W1CA 3QGYA 4BGQA 4TRLA 3DNEA 1YHVA 3DB6A 1H00A 3WZJA 2JDTA 3FMDA 3MVLA 2R3LA 4X3FB 4AW5A 2A4LA 4CGAA 3HRBA 4IIRA 5HCYA 2XNEA 4WUAA 2X6DA 4CKIA 4ANLA 5JQ5A 3HEGA 5JZJA 4BRXA 4LUDA 3JVSA 3ZC5A 3VBTA 2FUMA 2B4SB 1YOMA 4QMLA 2DS1A 4RVMA 4FVRA 2WQEA 4TXCA 4BCPA 1XH5A 4F6UA 4RWKA 1RE8A 3FQHA 4LL5A 4RQVA 3KMUA 5ICPA 2UW3A 2W05A 4WKQA 3ZLSA 5M55A 2ZMDA 1HCLA 4IJ9A 1M7QA 5KO1A 3MFTA 2BUJA 3WI6A 4ALUA 4NJDA 5BYLA 5DRDA 4FTLA 4BWKA 2F7XE 4BCFA 4QMNA 3AGLA 4FKVA 5LQFA 4QQ5A 3DY7A 4YJOA 4I6HA 2CGVA 5M53A 1NT2A 5FGKA 1TQMA 3ZEPA 4LV5A 5IQBA 2VTOA 3O8UA 3SAYA 3OBGA 2C6IA 3M42A 3PZHA 4AZTA 5L2SA 3ZLWA 2Z8CA 3S1HA 4G9RA 4G5JA 5BVNA 1YQJA 3MV5A 5IQCA 3ZCLA 2W06A 4D4SA 5FXRA 1CKJA 1XKKA 4GVAA 1H1RA 5D10A 2JIUA 1Q5KA 3JY0A 5JRQA 2WMTA 1H28A 4BF2A 5IPJA 1PKDA 4JLCA 1APME 4FG8A 5AUXA 3BU3A 4TYJA 3B2TA 4D2TA 2OF2A 2XK3A 2Y6OA 2YITA 4Q5EA 2YA9A 4ANQA 3UMXA 3H4JA 4KBKA 4E5AX 5A4CA 4FNZA 5LWNA 3KCKA 3FMKA 3VBXA 5AR3A 1OPLA 4PDOA 2ITXA 3DZOA 1YI6A 4TYGA 4D1ZA 2NPQA 3FZTA 1WBSA 2EB3A 5JGDA 4FEWA 3Q6UA 2RFSA 1XBAA 3C4CA 2WO6A 3WE4A 3MPTA 3EN6A 3PWDA 3GGFA 2YERA 4TNDA 1WMKA 2SRCA 3KRXA 3BBTB 2UW6A 3FL5A 1WVXA 3R7EA 3W2CA 1U59A 3ZXZA 5CEPA 1ATPE 3OY3A 3QRJA 2V7AA 1WBPA 4GJ2A 1SM2A 3DKCA 3FE3A 4M68A 3CKXA 3H30A 1XQZA 4S30A 4JDKA 4YTHA 1K3AA 3EKNA 3FZ1A 4RJ5A 4GT4A 4JQ8A 5HBHA 5J8IA 3RK5A 3M11A 3PXFA 3EJ1A 3VUMA 4UBAA 4DTKA 4EOIA 4FSRA 1KUTA 3BGPA 3CQUA 3EQDA 2IN6A 2QO9A 3F3UA 4CD0A 4RWJA 4C61A 3N4VA 4ZS0A 4DGLC 3PXYA 4UN0C 1V0PA 3P1AA 2PVNA 1OECA 1IAJA 4FEVA 2OGVA 5H8GA 1H27A 3QRIA 3IS5A 3VS6A 3MW1A 4DH1A 2ONLA 4AP7A 3CPCA 2UVXA 3ENMA 3JUHA 4XEYA 4ASDA 2YZAA 4S2ZA 3DBFA 4O7NA 1UV5A 4C8BA 1L3RE 1CM8A 1UNGA 2CGXA 2Y7JA 3UGCA 4C34A 4FKJA 2HENA 4IB0A 1AQ1A 1M2RA 3WF8A 1L8TA 2OIBA 1VZOA 2QOHA 1YXVA 1FGIA 3EQBA 3R8VA 5AADA 5E9EA 4I1ZA 5HU3A 3QXPA 3BQCA 4I6BA 5H3QA 2B9IA 1YHSA 5T6KA 1OL1A 5EHYA 4NW5A 5BVFA 5F95A 5IMXA 3V6RA 4FR4A 1OPKA 3QL8A 4LGDA 4BWPA 2XRWA 3RHKA 3FI4A 4PF4A 4X6RA 3EL8A 3O8PA 3UIBA 3E8NA 4WUNA 3ERKA 5CEQA 2BR1A 2WTDA 3FWQA 4YHTA 5IKWA 1H1PA 3LHJA 3PXRA 3VVHA 3R9RA 4LL0A 2P55A 4GG7A 1KOAA 4NT4A 4DEBA 4D4YA 3E3PA 3TNWA 5BVDA 3PA3A 4EQUA 4FGRA 2BTRA 2HW7A 4HZRA 4K1BA 1U46A 4QYEA 1XBBA 2XK7A 1YDSE 3VS0A 2A1AB 5CU0A 2WOTA 3LFAA 2QHMA 1RJBA 1UKIA 4F9BA 4FV7A 3UIXA 2FO0A 1PXKA 5G1XA 5BVOA 2VTNA 3UYTA 5L2QA 1OL2A 4EHEA 1H24A 4FNYA 2YIXA 4FICA 1H0VA 3SRVB 3JPVA 4QTDA 3VIDA 3WZEA 3Q96A 2QU5A 2XK6A 4C37A 4RX8A 4IMYA 5K3YA 3UIMA 3ZO1A 3TUBA 2C3IB 4XX9A 1DAYA 1XR1A 3LFEA 3FMMA 2QD9A 1BL7A 4FKOA 4APCA 5EQEA 3D83A 5EYMA 3HMNA 4HVSA 2PWLA 4AG8A 4ANNA 2YN8A 4FL1A 5EOBA 5L8JA 3G90X 3TNHA 3U51A 4QTCA 4RLLA 4YGAA 3UP2A 4OAVB 2ZV7A 3GC0A 2VD5A 2I0VA 5A6NA 4Y85A 3EZVA 5H9BA 4O0RA 4PY1A 3Q9YA 4R1YA 3VQUA 2GNJA 4R1VA 1E1XA 4NIFB 4M0ZA 1ZMVA 2WMVA 4XG4A 4ANMA 4ASZA 5B0XA 4UV0A 4QYFA 3C50A 4MXYA 1ZYDA 3HUCA 3HV4A 4XV3A 5I9XA 3AQVA 1WVWA 3F3WA 4NFNA 4QP2A 3VS2A 3D5VA 4GFMA 4TWPA 5C1QB 3UZRA 3NR9A 5JZNA 2P3GX 3DAEA 4IXPA 3RVGA 1MUOA 3CP9A 3ORKA 4UMTA 3CTJA 2VN9A 5JFVA 2ZB0A 3K3IA 4L9IA 3KRWA 3T3UA 3ORPA 5HNIX 1ZZ2A 4JBQA 4NH1A 3MB7A 3UP7A 3W10A 3ELJA 3NNWA 3WF6A 1F3MC 4CRLA 3DCVA 3K3JA 4GV1A 1W82A 3LE6A 3LXNA 3QA0A 3MPAA 4WT6A 3PLAE 5AWMA 1S9IA 2EXCX 3GI3A 4JAIA 4QMUA 4PPBA 3W32A 4FF8A 4FNWA 3P23A 1NXKA 3PJCA 2R3QA 1WVYA 1OL6A 5GJFA 3DQXA 4BCQA 4I22A 4N6ZA 1Q8ZA 3Q4CA 3QD4A 4RJ8A 3LFNA 2AC3A 4BVUA 5H8EA 5HTIA 4KWPA 4F9WA 4PX6A 4UWBA 2GSFA 4USEA 3KFAA 3WBLA 4CZTA 2CKPA 5AP1A 3OWPA 4CLJA 3QD3A 4DFLA 4MQ2A 4HVDA 3R02A 1KSWA 4I41A 2W5AA 2QURA 3DXNA 3GC8A 3LXKA 4WO5A 5ACBC 4CCBA 5BNJA 3PUPA 3Q04A 4ZMEA 4D9UA 4P4CA 2X6EA 5FWKK 4ZJVA 3KL8A 4P90A 3EQHA 3G51A 3GP0A 1WBWA 2PTKA 1BKXA 3EIDA 4GT3A 1O6YA 2W99B 4Z9LA 3HAMA 4F63A 2R9SA 3WILA 3POZA 2VNYA 1OPJA 4TYIA 2XVDA 4MWIA 2ZJWA 4V0GB 5KE0A 3C4XA 3DFCB 3HV5A 4G3DA 5I9UA 1NVSA 4CLIA 3I79A 1KE6A 2J6MA 4FBXA 5DN3A 2R3OA 3A7FA 5A4EA 4FSUA 3AT3A 1VJYA 3ZRMA 5HGIA 4XV1A 3OC1A 5HX8A 3TJDA 5CXHA 4O0YA 1JKSA 3VUGA 2GS6A 3Q32A 3EQPA 4GMYA 3F2NA 5M57A 4K33A 4RC4A 3U8WA 2GTMA 5LVOA 2P0CA 3ALNA 4MXOA 5KKRC 2ONLC 4EOSA 5IZFA 3FYKX 3OCGA 5AV3A 4NM7A 4CCUA 4UWYA 5CWZA 2JFMA 4EQCA 3LCOA 3LM0A 3LPBA 4I93A 4A9YA 4E5WA 4M69B 4Z3VA 2VGPA 2BTSA 4E26A 3TDWA 5J7HA 1H1SA 4EOPA 2CKQA 5J87A 4D5KA 4EC9A 2PUUA 3R0TA 4EZ3A 5AM7A 3HDNA 2QO7A 4MXXA 1JQHA 4BTKA 3HNGA 2Q83A 2PZRA 2C6EA 1KE8A 1T45A 4L6QA 5DT0A 3WF7A 4U44A 4WRSA 3NCZA 2XA4A 4PRJA 4O21A 2QCSA 4JAJA 5CI7A 1Y6AA 3KF4A 4FV0A 4C3FA 3RWQA 1X8BA 3VJNA 3BHYA 4MX9A 4IB3A 3QALE 4Y8DA 4J97A 3C1XA 3DTWA 4GEOA 4WNOA 3BBWA 3D7TB 3HAVA 1ZYJA 4JS8A 1ZOGA 1P14A 1M2QA 4FSNA 4H1JA 4NEUA 4TN6A 3OWLA 4L3JA 2BKZA 4PMTA 1QPEA 4NTSA 4OLIA 4BDBA 2VWUA 4ZZOA 2Y9QA 3CCNA 1W8CA 3TV6A 1SVEA 4AE6A 4ZY4A 1VYZA 4HYHA 4YP8A 3DBCA 1LEZA 4YPSA 3RPYA 3H9FA 4RIWA 5HO6A 4W8DA 5D9HA 1GOLA 3PZEA 3WYYA 4BCJA 3E87A 4L00A 2P2IA 5I9ZA 3U55A 3BWFA 2VU3A 4QYHA 5D41A 3UC3A 4E8AA 3DBDA 3BQRA 3TKUA 3PE2A 3IK3A 3NNVA 4LMUA 4H3BA 3FQSA 5KCVA 2O8YA 1QPDA 2QKWB 3DT1A 4C4EA 3EQRA 3KY2A 4QMMA 2A27A 4FT5A 3HMMA 4MNFA 3MS9A 3H10A 4NCTA 3SA0A 3EFLA 3OCSA 4YSJA 5HBJA 4U81A 4XV9A 2OI4X 3R73A 5KMJA 3QF9A 3CD3A 4I6FA 5F4NA 4PQNA 4BDEA 3QFVA 4AN3A 2XF0A 3COKA 3ZO4A 4O81A 5LVPA 2HZ0A 1OM1A 4HVGA 4QT1A 2VTAA 3BGQA 3KMMA 1RW8A 5EQYA 1B6CB 2XUUA 5IQDA 2B52A 4CV8A 3OOMA 3BE9A 3IW7A 3FI8A 2IVUA 4C38A 4QNAA 2I1MA 3GCPA 4L01A 2VTMA 3V5QA 4I5PA 4Y95A 3WF9A 4FTIA 2VO6A 2CLQA 4M8TA 3I7BA 5HOAA 3S00A 4FL3A 3DBEA 4QMOA 3P79A 3UVQA 1UNLA 4KUJA 3MVMA 3RI1A 4DFNA 3FSKA 2H6DA 2BHHA 4O1PA 3DOGA 1JBPE 1TQPA 5CVHA 1B39A 4HZSA 3RPVA 5IA4A 4E6DA 1H26A 4WG5A 4DT9A 3PY3A 1DAWA 3ORLA 4N0SA 4W9XA 3V8WA 3TWJA 4GT5A 3I4BA 1Q99A 3TNIA 3EFKA 3VUTA 5TR6A 3QQGA 4FIGA 3KB7A 2QG5A 3F69A 5FBOA 5HIDA 1P2AA 3VUDA 3SGCA 3QBNA 4L8MA 3W2PA 1YWRA 2C3KA 2WQMA 1ZXEA 3V5TA 3QX4A 1OITA 2HAKA 4GU6A 3WOWA 4BFMA 5IA1A 1QMZA 2UZLA 3N9XA 5F20A 4NK9A 1G8SA 3MA3A 2XKDA 4FVQA 4FTOA 3ZRLA 5BVWA 3TZMA 4XJ0A 4WOVA 3C5UA 1VEBA 3QTXA 4D9TA 3QKMA 4A4XA 2WIHA 4MF0A 3TKIA 3A7JA 5DWRA 1UA2A 4OUCA 4OTWA 4XP3A 5M09A 5CAOA 5ANJA 2BAQA 2XZSA 2YJSA 5BUEA 4GK3A 1IASA 4X2KA 3TN8A 4BI0A 3ZM9A 3NX8A 1UWJA 5ETFA 2F4JA 4GG5A 2ITQA 4DC2A 5IUIA 4O2PA 1H25A 4TWNA 3V01A 1Y8GA 4EI4A 4ZLZA 5GZ9A 4YLKA 4YJQA 3ZXTA 3UOJA 4FUXA 4ALVA 2DWBA 4LFIA 4ZLOA 1P5EA 2PSQA 4L53A 2ZM1A 4YNOA 2OG8A 3EFJA 3OFMA 4O7YA 1U5QA 4QRCA 4XV2A 2W4JA 4GKIA 1SZMA 3FZRA 4C7TA 4O96A 4XCUA 4IAFA 5LOHA 3CBLA 2O3PA 2I0YA 3IW6A 2UW4A 2R3GA 4RWIA 3B8RA 2FSOX 3LCSA 3MBLA 4MNEB 3W2SA 2GS2A 3VF9A 4DFBA 1R39A 4IQ6A 4FV8A 2GNFA 4L44A 3A4OX 1M14A 2WXVA 2ITPA 1KV2A 3R22A 4RIYA 2XK8A 3E88A 3IG7A 4RGJA 1MP8A 4FTQA 4KSQA 3KXNA 3O7LD 5FQDC 3VN9A 3SG8A 4DCAA 2VWVA 4RJ3A 4QP1A 3FI3A 3E3BX 1V0BA 2J5EA 4FL2A 3DPKA 3NAYA 4KIPA 2IZUA 3E63A 4YZ9A 3B8QA 5AX3A 3U6JA 2YIRA 1SVGA 4KS8A 3GNIB 5IU2A 3NUXA 3ALOA 4P5ZA 3VS3A 4CEGA 2OWBA 2X8EA 4FSWA 3HL7A 4MXAA 5HG8A 3P4KA 2JEDA 3AC5A 3LVPA 4NJ3A 3R1NA 3FQEA 3AMAA 3GUBA 4M14A 5CQUA 3TIYA 4ACDA 5A6OA 1Y91A 4FTNA 3EN9A 3DTCA 4QMXA 3NMUF 4JX7A 5IEVA 2HZ4A 2BFYA 1H8FA 2CNQA 5IQFA 5AP3A 4F99A 4KAOA 4O0XA 5IH6A 4FSYA 5E8WA 4KIQA 3KVWA 2R64A 1YOLA 4O2ZA 3PXQA 3ANRA 2B1PA 3KULB 2C0TA 4OBOA 2QI8A 4C33A 4BN1A 4EONA 3DDQA 4Y72A 1YXSA 4E1ZA 4CTCA 5IMEA 2A2AA 2C47A 2QOCA 2GNGA 4EQMA 3PPZA 2YM3A 3ANQA 2RFDA 3FBVA 4EH7A 3CLYA 3OTVA 4FSZA 4BDHA 4RIXA 2PYWA 3QWJA 4ZSAA 4IX4A 1UVRA 2C6DA 4Q5HA 1YI3A 2RFEA 5HKMA 2J7TA 1M52A 3COHA 4NCTC 4XG9A 2G01A 4NFMA 3ETAA 1U54A 2PUIA 5ETCA 4EH8A 3C0GA 4QMWA 5EM7A 1JNKA 1M2PA 2PVJA 3ENHA 2VV9A 3FMJA 3KU2A 4YBKA 2GHGA 1Z9XA 5L8LA 2BDFA 4K6ZA 4I3ZA 2JKMA 4U0IA 2QU6A 3CGOA 3LMGA 3O17A 5JGBA 5DG5A 5CS6A 3GB2A 2OSCA 3Q4TA 1V0OA 2P4IA 3R8LA 3Q6WA 3DXPA 5GZAA 4PMSA 4ITIA 3HLLA 1PXOA 5JRSA 4YZDA 4E3CA 2UZTA 4HYIA 5GZ8A 4XYFA 5AEPA 2BRBA 2KULA 4FSMA 3VUHA 3ZYAA 3VHKA 5L6WL 3O71A 4DG0E 4FEXA 2WU7A 2BRGA 2UW7A 2HW6A 2V7OA 3DU8A 3AC1A 4G1WA 4O7VA 3VBWA 5BUJA 3BU5A 5M07A 2RKUA 2X4ZA 4G3EA 4RA4A 1G3NA 5FP5A 3R63A 4HPTE 3UPZA 4AOIA 4I94A 4D1SA 5IQHA 3ZU7A 5ANIA 4BCGA 3SG9A 5AR5A 3EN7A 1ZMWA 4JIKA 4HVIA 5J5SA 4DEGA 4CFXA 3JVRA 1OIYA 2IZRA 3HDMA 3I6UA 4M13A 3VO3A 1H1WA 2GNIA 3AC4A 3AXWA 5EI2A 3IECA 5DGZA 2C3JA 3MH0A 5IH5A 3E92A 2IO6A 4ENXA 3LFSA 2BMCA 4EOKA 5BQ0A 3VW6A 5CAQA 2HK5A 5ETIA 2R3KA 5A54A 4M3QA 2KTYA 3CE3A 2J4ZA 5CLPA 2NNWB 1ZZLA 3HRCA 4CZUA 2O65A 4AWIA 3TL8A 3R7IA 5EM6A 5CSWA 4C62A 4O83A 1OUKA 4MD8E 4NL0A 4OTRA 3G6GA 3OT8A 3BYSA 5I9YA 4F7LA 5CQWA 1YOJA 4EOJA 5DVRA 3A4PA 2UW9A 4QNYA 4DH8A 4KABA 2YLEA 4CKJA 3L9MA 3QA8A 4I21A 5I4NA 2BZKB 2OH4A 4MAOA 4DEEA 1IG1A 4AA5A 2BRHA 3F5UA 3WZKA 3DFAA 3UNJA 2BZHB 4HJOA 4LGHA 1XWSA 4O0WA 3HA8A 4FTUA 4H1MA 3TIZA 5CSPA 1XBCA 4RC2A 3SW7A 4FKTA 3C51A 3TZ9A 5HD4A 2JITA 1OBDA 1JAMA 2C4GA 4KKHA 4FIEA 4BCNA 4I0SA 1UU7A 4G9CA 2J50A 3SDJA 2I6LA 3AT2A 3ZLXA 5B7VA 3MJ2A 1YXUA 2RL5A 1OVEA 2CNUA 1H4LA 2C0OA 3EQFA 4F1MA 3QU0A 4FV4A 1S9JA 4X2NA 4PPCA 2XKEA 4YO4A 4B8MA 3EZRA 4L43A 2P2HA 3U6IA 2OFVA 2YM6A 3BRBA 2UZEA 4ACHA 3LMIA 2EXEA 2QLQA 2XK9A 1I44A 1Z5MA 4AA0A 2VTLA 3QUEA 2ETKA 4MVFA 2WD1A 5FUTA 3GU5A 1Q62A 2PE2A 3FMEA 4YNEA 3R7YA 2H9VA 3GU6A 4XUFA 4FA2A 5IDPA 3RWPA 2RFNA 3G5DA 3RP9A 4I4EA 3D15A 3U4WA 5C8MA 4X7QA 4DH5A 4JRNA 5DR2A 5HTBA 1GAGA 5J95A 2PVFA 3U9NA 2J0JA 3TACA 2EVAA 2ZM3A 3QKLA 4I23A 3R8ZA 4J8MA 2QOFA 4BCOA 3PRFA 4YZBA 5A9UA 2E9NA 4DGGA 4CQGA 3IOKA 3OW3A 3C4ZA 5D11A 3F5GA 3LOKA 3R2YA 2ITOA 4FTKA 4FZ6A 2CGWA 3ORMA 3RAHA 5J7BA 4BDKA 2VTPA 4O0UA 2A19B 3HX4A 4FOCA 3OHTA 3WYXA 4YTCA 4RLKA 3T9IA 4IWPA 2GHLA 4RQKA 2JFLA 4CMTA 2CGUA 2OJ9A 2YCQA 1A06A 1PW2A 4FT0A 2C1BA 2UUEA 3MH2A 2FGIA 3F66A 3QZGA 4UMQA 4F65A 2GPHA 4AA4A 2BROA 4FODA 3KN5A 3R9HA 4UY9A 4FT3A 4PTGA 4RZWA 5CF5A 4JIAA 4NZWB 5BUIA 3PE1A 3OT3A 5E8UA 3RAWA 4J96A 2IVSA 2BAKA 4PL5A 3S3IA 3A60A 4RA5A 4Y5QA 2PU8A 4CG8A 3C5IA 1PHKA 5HCZA 3ZFYA 5B2MA 4EH9A 4R78A 3PVBA 4EKKA 5HE1A 4IB5A 4UMPA 5CNNA 4FKRA 3WZDA 3Q5IA 4LOPA 3ZMMA 4Q9SA 4RJ6A 5EK7A 2XS0A 5DEWA 3OWJA 4JBOA 2VTSA 5KZ0A 3BPRA 3TNPC 4O1OA 4XP0A 2WTVA 4CYIA 2GNHA 4JDJA 4IAIA 4WA9A 5KZIA 4B0GA 4U6RA 3MB6A 4D55A 4FE2A 2JKQA 5JFWA 4NKSA 3PSCA 3BKBA 4K0YA 3GENA 4QMSA 2OZAA 2JAMA 4FIFA 5AMNA 2F7ZE 1OKWA 1OKYA 2J5FA 5EG3A 2QNJA 3FHIA 3GVUA 1FGKA 3KRRA 2C5YA 3OY1A 3QC4A 4NU1A 4O91A 4OTGA 3LJ2A 4XH6A 4JNWA 4W4WA 3RALA 4J7BA 4MBIA 3ZSHA 2X7GA 3LZBA 2VAGA 5FRIA 3NPCA 4X0MA 5J9ZA 5TOZA 5IH4A 4D0WA 4PDSA 3Q2MA 4W8EA 3W2OA 2G2HA 3ROYA 2XM8A 3DA6A 4CMUA 3VJOA 1SMHA 4DLJA 1KE5A 3FKOA 2Z7LA 4BBFA 3PDTA 1PF8A 2HYYA 2I0HA 3CQWA 3DV3A 4C4HA 3PPJA 4BL1A 2GTNA 3RMFA 4EL9A 2Y0AA 3GC7A 2IJMA 4WSYA 2WMQA 3E7OA 3D9VA 2GFSA 2W1ZA 1Q97A 1A9UA 2X9EA 3KXMA 3PSDA 3QC9A 5AV2A 5FTGA 4FV1A 1HOWA 1KE9A 2WPAA 4NYEA 4CTBA
chains in the Genus database with same CATH superfamily
4U8ZA 3TTIA 4ZY6A 4S33A 3R1QA 2QO2A 2WMSA 3BHTA 3KXHA 4FZ7A 4KIKB 5IA5A 4UX9A 4M67A 4GFOA 3KVXA 4C35A 2V62A 5EOLA 2VTIA 3G2FA 2AUHA 1U4DA 3ZTXA 2ZV9A 4X3FA 4EOMA 5JGAA 1QCFA 4FV2A 4J71A 4W4XA 2EU9A 2W0JA 4YJRA 5CSHA 5TE0A 5T68A 3UVPA 4FYOA 4CT2A 5AAGA 4U9AA 4QTBA 4QPMA 2UV2A 3ZHPC 5EYCA 4UXQA 4GUEA 3AT4A 5GHVA 4F0FA 5K0XA 4G3CA 2VTTA 4FV5A 1WBNA 5I3RA 3BWJA 3KXXA 5AR7A 2GQGA 5HEZA 2A98A 1G8JA 3ITZA 3DAKA 2B9FA 2OJJA 3MDYA 3HYHA 3PXZA 3CXWA 4FG9A 2XM9A 4C0TA 1OUYA 1FOTA 4WG3A 4L45A 4XRJA 3R2BA 1Y6BA 2XIKA 4G17A 3NVMB 3KK8A 5HNBA 4MBJA 4NW6A 2W1GA 2CDZA 2C6TA 2OU7A 3QQKA 4RFZA 2OLCA 4MEDA 4AOJA 2ETMA 1XH8A 2ETRA 1OB3A 4ZTLA 2GMXA 3DLZA 2X1NA 4UZDA 2VWWA 5AA8A 2CPKE 2VWBA 5DBXA 4Z7GA 2H8HA 5DA3A 3R00A 4HGSA 2ITVA 5LMKA 1QL6A 4DINA 4G5PA 1REKA 3A99A 4FT9A 3KK9A 2WMAA 3LCDA 3DDPA 1W0XC 3I60A 3DK7A 4I5HA 4IDVA 3AC8A 3OXIA 4B6LA 5A4LA 3CSVA 3H3CA 5FP6A 2VTHA 4BC6A 3HP5A 2W5HA 3QCXA 3MIAA 4G6OA 4EYMA 3VULA 4UEUA 4CMOA 3KXGA 4TNBA 5C8KA 5EM5A 5JFSA 3E93A 2FH9A 1Q8UA 3NWWA 5I0BA 3LW0A 3NYXA 5HTCA 3R8PA 4PL4A 5AA9A 4FK3A 1YWVA 2HWOA 3TDVA 2R5TA 1JSTA 4JG7A 5IQIA 3PY0A 5L4QA 2ZAZA 3SOCA 2JDRA 2GQSA 2ACXA 4A7CA 1YRPA 3ATSA 3LFDA 3ORTA 4QMVA 5E8TA 2J51A 2Z7QA 4GVJA 4MCVA 1YXXA 5HI2A 3RPSA 4EYJA 1Q41A 3C9WA 3HVCA 3TUDA 3TM0A 2B54A 4EK4A 3QD0A 5ANKA 1Q3DA 4R5SA 4IX6A 5EW3A 5BVEA 3L9LA 4NM3A 3ORNA 2LAVA 2Y4IB 2WGJA 3QTRA 5AR4A 4PTEA 4DEAA 3MIYA 5J1VA 2XIYA 5M44A 4MXCA 2E9VA 2Q0NA 2UZUE 2YLFA 2YM4A 4B8LA 5AAEA 4QDVA 3NAXA 1AGWA 5ANGA 4ALWA 3LLAA 3RPRA 3V8SA 2GNLA 1FVRA 4FVPA 3R01A 2YM8A 5CASA 3L8VA 4DH3A 4PL3A 1NY3A 3G6HA 2W1DA 4IAYA 2X2LA 1NA7A 4AXAA 5KX8A 3AOXA 3PY1A 3W8QA 2WTKB 5HVYA 1MRVA 3G0EA 4RMZA 5HLNA 3MH3A 3NLBA 2HOGA 2UZOA 3NNXA 5E8XA 3D5UA 2XKCA 3EYGA 1J3HA 2QOQA 5GJGA 4EK6A 3OXTA 1CSNA 2UZWE 3NIEA 1K2PA 2OICA 3HGKA 2EUFB 4E5BA 4JQ7A 4YC6A 4O86A 1PXJA 2VWYA 5EW9A 4JRVA 3WIKA 4O7WA 2YHVA 1PXIA 4DAWA 4ACCA 3EQGA 3U87A 4EC8A 4WNPA 1P4FA 5AP5A 4AFJA 1R78A 3IDBA 2X2MA 3HMPA 2VZ6A 1M7NA 3ZH8A 3P86A 3BIZA 1Q24A 3UJGA 5L2IA 4H3QA 4R3PA 3BYUA 4BIBA 2XJ2A 4OTHA 3ZUVA 3A62A 4AQKA 5HIEA 3F7ZA 4JBPA 3TMOA 4XLIA 5J9YA 2X0GA 2ZDUA 3L9PA 5EH0A 4AW2A 2GQRA 2WFYA 3BCEA 3BYVA 4FK6A 4ZP5A 5KNJA 3V8TA 3DS6A 5DNRA 5FEQA 1PMNA 2E9OA 2XK4A 4RC3A 3DJ6A 4ZJJA 3DBQA 3SRVA 2BIYA 5K4IA 4ZZNA 3THBA 3VC4A 3KA0A 2QOKA 3DB8A 4FTTA 4HCVA 3FZPA 2JGZA 4LRKA 3QTIA 3ZFXA 4NM5A 1BX6A 3PJ3A 3UBDA 3ZDIA 2YCFA 4AAAA 3IW4A 2X8IA 4DITA 4DTAA 3QD2B 2ERKA 4HOKA 4E73A 5H2UA 4ZOGA 5DT3A 4K8AA 4AX8A 5EI6A 3GQIA 2CN8A 1DI8A 2G2FA 5CEOA 1BI7A 2C68A 4GUBA 4UWCA 5CF6A 1UNHA 2Z2WA 5E8YA 1DM2A 3ROCA 4X3FC 4FTMA 2X7FA 3L8XA 2ZV8A 4CFUA 1KWPA 3E62A 3DKOA 2PHKA 5AX9A 3EN4A 4DBNA 2YCRA 4NIFA 2IZTA 2WZJA 4IZYA 1WFCA 4U5JA 3REPA 3QX2A 2Z60A 3C4EA 3ET7A 3OZ6A 4OTQA 3RZFA 4A9TA 1JKKA 4K77A 3ZZWA 3COIA 4IWQA 3G15A 5CAPA 2RF9A 4RX7A 2OK1A 5EFQA 4QYGA 4J52A 4JVGA 3NFFB 5BYZA 4QEBA 5BMSA 1OKZA 4FIJA 4CFNA 3LMHA 2CSNA 2NYAA 3OCTA 3OUNB 4CFFA 3UQGA 4USFA 3OOGA 4FV6A 3PFYA 1YDTE 4F09A 3TZ7A 4RVTA 4TZRA 3QZIA 4A06A 2QOLA 4R7BA 5JT2A 3QWKA 4BBEA 4RBLA 5C4KA 3FXXA 5LVNA 1DS5A 2R2PA 2BIKB 1FMOE 1W84A 3QTQA 3OD6X 4MKCA 4AQCA 4DYMA 3PIYA 3QCYA 4LOOA 4EORA 1Q8WA 4E6CA 1KV1A 3R6XA 3GXLA 2Q0BA 3W18A 5FDXA 4QOXA 4FIHA 3SXFA 4TWCA 5AJQA 4MBLA 5CALA 4FGBA 5LMKC 1TKIA 4ZTHA 4BZNA 2CHLA 2XIXA 3QQUA 1GIHA 3AKLA 3GCUA 1GZ8A 5EHOA 3U9CA 3R1YA 3ZM4A 3IKAA 4PP7A 1W98A 4CXAA 2AQXA 5HVJA 3Q52A 2XKFA 2W1FA 4DHIB 4JMQA 4C59A 4U3YA 5E8ZA 5FBNC 2REIA 3OEFX 3GFWA 5HESA 3K5VA 3R9OA 1AD5A 3LJ0A 5G6VA 3AG9A 3GCSA 3PVGA 4AGCA 3SLSA 4EH4A 3R7VA 4ANOA 3FHRA 4LM5A 3EWHA 4X6QC 1ZWSA 4YTIA 4Z16A 4C2WA 5EDRA 5ANDA 1OL5A 3FAAA 3QTUA 2IG7A 3Q9XA 4HCUA 4R3RA 5BVKA 4PWNA 4A4LA 3RAKA 4XG7A 2PVYA 3IDPA 2WB8A 4IE9A 4RWLA 5FXQA 2XYNA 1BL6A 2OJGA 4XLVA 5H8BA 4BDCA 1PRYA 1WCCA 5JSMA 3PJ2A 2B53A 2J0KA 2V5QA 2QODA 2VO7A 3A7GA 4V0GA 5CU6A 4PNIA 3HUBA 1J1BA 1XH9A 5AP7A 5M4UA 1TVOA 3DGKA 3T8OA 4EJNA 2E2BA 3FMNA 4CRSA 3DJ5A 3DQWA 2XEYA 3QZFA 2UVYA 2Y6MA 5AIKA 1STCE 4QTAA 3CC6A 3IOPA 4G3GA 3R9NA 2PULA 2VWIA 3RM7A 1YI4A 2C5NA 4BZOA 5E1SA 4E4LA 4ARKA 4BCIA 1OL7A 2V22A 3BHVA 5IA2A 4TL0A 5C01A 2WU6A 2QOIA 3R04A 4BTMA 5FDPA 3RJCA 4KIOA 4R77A 5A14A 1LR4A 2W4KA 4OGRA 3RBWA 3W8LA 5JH6A 1FQ1B 4B9DA 2G9XA 3W0SA 2F57A 4HGLA 2CMWA 3P08A 4LRJA 2YFXA 2IW9A 5FEDA 5AAFA 4BZDA 4I6LA 3B2WA 3JR1A 2W9FB 4M69A 3CR0A 1LEWA 4DN5A 4YPDA 2IF8A 3ZUTA 3E64A 3CS9A 2VX3A 1YDRE 4J98A 5LCJA 1U5RA 2OW3A 3QHWA 4YHFA 4H05A 3SXSA 4ZLYA 2PL0A 5CAVA 4FJVA 2RG5A 4ZSJA 4IAZA 3E8CA 4FTAA 3NUAA 1LPUA 4C2VA 2JDOA 3RK7A 5HZNA 3VBVA 3L8SA 5E91A 2FSMX 2VX0A 1RDQE 2YABA 3W1FA 3R8MA 4JDHA 3D7TA 4IW0A 2NRYA 4WHZA 2WEIA 5AUUA 1Q3WA 1GNGA 1PXPA 4BDJA 4PMMA 3FL4A 3JYAA 4GSBA 3ZS5A 3NVKI 2PMOX 3ZUUA 1OZ1A 3F3VA 4V04A 1VYWA 3LFBA 3MFRA 5EHLA 5BPYA 4EZ7A 2XBJA 3W0NA 5CEKA 1IR3A 2W96B 4L46A 5LVMA 3ZEWA 2C6MA 5DR9A 4DTBA 1OIQA 3FV8A 3LJ1A 4U7ZA 2PVMA 3W2RA 3PJ8A 3A7HA 4JDIA 4WIHA 4GCJA 3AMYA 3ODZX 3NUNA 3V51A 4DT8A 2JKKA 4ZSGA 3ID6C 2FVDA 4TYHB 3GU8A 3TUCA 4O6LA 3O51A 5GIOE 1F0QA 2BDJA 2RG6A 3UMWA 3LXLA 3ZLYA 1GZNA 4YJVA 3EHAA 3MWUA 3O96A 4IH8A 4BYIA 4ZTSA 4KSPA 4O7RA 2ESMA 2IVVA 4AS0A 4X3JA 3UO4A 3DLSA 4EHZA 4MWHA 4FZDB 3SVVA 2OZOA 4YC8A 3KRLA 3R7OA 3RNIA 1W83A 4ZAUA 4FKWA 4EK8A 5EW8A 2P33A 3PRIA 3RHXA 1WAKA 4ZMFA 2E9PA 2B9JA 3FZSA 3FLSA 4O7LA 2XJ1A 2CKEA 3GT8A 4GYIA 5AM6A 4OTIA 2IPXA 4KB8A 4ZEGA 5L3AA 3MH1A 2BZIB 5CTPA 1Y57A 1KE7A 4AOTA 4GW8A 4UALA 1LUFA 2OJIA 3DNDA 4FTCA 3MVJA 2XBAA 3MJ1A 2WTCA 1UU8A 2PVHA 4EUUA 1WBVA 3R28A 4AE9A 2WMWA 2HY0A 4XG8A 4Y83A 4N70A 4CQEA 5IG1A 4JJRA 4QQCA 2QHNA 2B7AA 4JXFA 5E90A 3QLGA 3HP2A 3PG3A 4LYNA 4DEDA 2ZM4A 3FEGA 3W0RA 1BMKA 4F1TA 2OXYA 4FV3A 4F6WA 4IDTA 5DHJA 4CNHA 4YUQA 3UDBA 3NYOA 3UZTA 1REJA 1Z57A 4LQMA 4NUSA 4AW0A 2PPQA 5KMIA 3MYGA 5AP4A 3VWAA 3WE8A 1O9UA 3H0YA 2YIWA 3M2WA 4RPVA 4TY1A 5DLSA 4D2WA 4AXEA 3FI2A 1H08A 4D58A 5DFPA 1QPJA 3VHEA 2Z02A 3OMVA 1FVTA 1XH6A 3NYVA 3N4TA 2FYSA 3QXOA 4AT3A 4PMPA 5FG8A 4N57A 3UODA 2PUPA 3RNYA 3KGAA 3W0MA 3MVHA 5AP2A 5IUGA 2C0IA 1FMKA 1GZOA 4IAKA 4PPAA 4YURA 3NDMA 4L42A 3W33A 3FDNA 5CAUA 2OO8X 1T46A 2YWVA 3FUPA 4QMYA 3UIUA 3DKGA 3ATTA 4NKAA 4OT5A 4ZZMA 2J0IA 3EOCA 4O38A 4GFGA 4IC7A 3R30A 1ND4A 4J99A 4AAYA 4HPUE 4R7IA 3T3VA 4QQJA 4G2FA 4J53A 4O0TA 3BV3A 2YCSA 3QQJA 4E4XA 3BELA 3CGFA 4YJTA 1TQIA 4D2VA 2PE0A 4H3PA 3F2AA 2C5VA 4J8NA 1MQBA 3BLHA 4RZVA 4DEHA 2X8DA 4MTAA 1FVVA 4H39A 3P9JA 2RIOA 2O5KA 2X39A 5C27A 2OXXA 4ZSLA 4HW7A 2BHEA 3U54A 3EKKA 2ERZE 4V05A 4FKSA 4BCKA 4EK3A 1MRUA 3OROA 5HD7A 5C4LA 4UYAA 3G0FA 3TKHA 1YWNA 3UC4A 5D1JA 2J90A 3HMOA 3ZFMA 4I20A 1IAHA 3F2RA 5LMBA 4BB4A 1B38A 4ZTQA 4FKGA 2WKMA 3KQ7A 3F82A 3MTFA 3BU6A 3VS7A 4EBVA 2R0IA 2PZIA 4YMJA 5HG7A 3TZ8A 2C30A 3F5XA 5F94A 2V55A 5HX6A 2YDIA 3GCQA 3IW5A 3S0OA 3KREA 4HNFA 3GBZA 3KKVA 3TCPA 4DH7A 4DG2E 2A0CX 1ZRZA 3LFFA 3RZBA 2VWXA 4Q9ZA 4AF3A 1JSUA 4YJSA 2R3HA 4R8QA 1J1CA 2ZVAA 5LMAA 5M4FA 3CTQA 5FTQA 2XMYA 4MNEA 3CIKA 2X2KA 2ZMCA 2FSLX 3MY0A 2YAAA 3E8DA 2YWPA 3NUYA 4DHJA 4IWOA 4LMNA 3K5UA 5AR2A 4ACMA 5L6OA 3Q60A 1E1VA 2JLDA 4AFEA 4DE4A 4C4IA 5JKGA 4ZS4A 5KMMA 1YVJA 2O0UA 2OKRA 4RSSA 3VF8A 2Z7RA 3TV4A 4F6SA 1ZOHA 4IJPA 3ZBXA 5F9EA 4UB7A 5HBEA 4C4GA 3VS1A 4F0IA 2LGCA 1DI9A 1O6KA 1OI9A 4FI1A 4ID7A 4JL9A 1RQQA 4ZXTA 3ZO2A 2PVKA 4DG3E 1O6LA 4EH3A 4YU2A 4ONAA 2G1TA 2OBJA 5A46A 1ZARA 2F7EE 3QQLA 3GC9A 4BI2A 2VTJA 2WMUA 4XOYA 2WMXA 3LQ5A 4YZNA 5CT0A 4AUAA 2BDWA 5AUZA 3D7ZA 4F7JA 3QTWA 4D0XA 1CTPE 4A9RA 5A4QA 5JQ8A 1PJKA 4JR3A 3IW8A 2QR7A 2CCHA 1BYGA 3UDTA 3CPBA 1GIJA 1EH4A 3UNZA 2WTJA 2O63A 5AUYA 4FZAB 4BHZA 3PP1A 3QAME 4ERKA 3UVRA 5AUVA 3KULA 1SYKA 3FLNC 2XEZA 2WELA 2PZPA 4FSQA 3UE4A 3ML1A 3Q4UA 1PY5A 3IDCA 3Q3BA 3OBJA 3ZBFA 3WF5A 4II5A 5I9WA 5JFXA 1F5QA 4KKEA 5CEIA 1G8AA 2YAKA 1ERKA 5K0KA 5T3QA 2EB2A 4YLLA 5ANEA 4FT7A 1E9HA 1LP4A 4A9UA 3DAJA 3EL7A 4G31A 5HG9A 1OBGA 5CYIA 4IVDA 4A9SA 1BI8A 4C36A 2C6KA 2BRNA 3BLQA 3FJQE 3LQ8A 5CVGA 4X2JA 4WNKA 3RCJA 2PUNA 3VQHA 3ZDUA 5HG5A 4D1XA 4FG7A 4OT6A 5HORA 2HCKA 4BGGA 4KBAA 3TTJA 1OGYA 4BWXA 3O8TA 3PFQA 5IA0A 3D5WA 5I9VA 3ORZA 1ZYCA 4LRMA 4GK2A 4OR5A 4U40A 5AIRA 4IWDA 4QMPA 3ACJA 4HYUA 2PMLX 2VO3A 4W4YA 5HIBA 4AW1A 4XP2A 3F6XA 4K9YA 4FKUA 4BICA 4QP3A 3PVUA 1ST0A 2B0QA 2HIWA 2VRXA 1IRKA 3PWYA 4M66A 5HVKA 2HZNA 4NSTA 4CFWA 2H96A 2HZIA 4N6YA 1H0WA 4WBOA 5CF4A 2XCHA 3FC2A 4LGGA 4DF3A 3U6HA 3A61A 3KN6A 2YACA 4HGEA 2R0UA 1JVPP 1OIUA 2CJMA 4E6QA 3JY9A 2WEVA 1Q8YA 2XYUA 3BHUA 4AZEA 4IX5A 5DI1A 3NUSA 3QTSA 3OF0A 2C5OA 3SHEA 4CZYB 2CN5A 2OF4A 3C4WA 4YZCA 4HGTA 3SQQA 4IEBA 3CY2A 4DFZE 3M1SA 5K5XA 3UO5A 1GIIA 4C4JA 3HV7A 5B2LA 2G15A 3G33A 4L67A 2EWAA 3FLYA 4F9AA 3KRJA 3GOKA 2HXQA 3NYNA 3MPMA 4FYNA 3F9NA 3F88A 4O4FA 2HY81 5CANA 5KHXA 3ZSIA 2DUVA 3TG1A 2F49A 2BVAA 4QPSA 4EHGA 1PXMA 3HMIA 3UOHA 3ZOSA 4P2KA 4UMRA 4GL9A 4DBXA 4OAUC 5HE3A 2VGOA 2PK9A 3HV6A 1PYEA 5D7VA 5EYDA 4XMOA 4ZSEA 1UKHA 3G9LX 4GU9A 4YZMA 3BEGA 4CVAA 3O23A 2W5BA 3CEKA 2IWIA 3A8XA 3D2IA 3NUUA 2J2IB 4FKLA 3C7QA 4EZ5A 3LFCA 3OEZA 5DH3A 2ZB1A 5ETAA 2RSVA 2GU8A 3FZOA 4C3PA 4E6AA 3FKLA 4N4SA 4XG3A 4MD9E 4O27B 3UNKA 4I5CA 3NW5A 5FD2A 3PA4A 4ZTNA 5M4CA 2I7QA 2WTWA 3VUKA 4P7EA 2IW6A 4IVCA 3RCDA 4WD5A 3NFGB 5EDQA 3P5KA 3TT0A 4Q2AA 4GKHA 2BFXA 4OW8A 3Q4ZA 5ANOA 4S32A 4CT1A 4AXCA 4O7TA 3FLWA 3P78A 4JG6A 5FXSA 4KBCA 1PYXA 4E4NA 3GU7A 2XAMA 4QYYA 4HCTA 4AGUA 3BE2A 2Y8OA 3OS3A 2W1HA 3T9TA 2GCDA 3DK3A 4C4FA 4RX5A 3VBYA 3QLFA 4ZTMA 4BDFA 2AC5A 3ZONA 1FINA 4JI9A 5HE0A 1J7LA 1WBTA 4QO9A 3Q5ZA 3UQCA 2FA2A 2E9UA 2X0QA 2X7OA 4UZHA 1SNUA 2BAJA 5C9CA 4EH5A 4LOQA 4NWMA 5DRBA 3BYOA 3DK6A 4M7IA 3AD4A 4G6NA 4HYSA 4TKSA 4CG9A 4PDPA 1ZLTA 3SXRA 5GJDA 5HO8A 3OXZA 5C03A 2XARA 3G9NA 3TXOA 2GFCA 3EFWA 1OIRA 4C58A 4F70A 3HRFA 2XNBA 3CJGA 3D4QA 1R3CA 3OCBA 4RJ7A 5M56A 3O2MA 1FPUA 3I81A 4ACGA 5TKDA 2BKKA 3NW6A 5AV4A 3I0QA 4F64A 3BV2A 1NVQA 4D4VA 4GRBA 4BKYA 2NP8A 2QLUA 3LXPA 4I5MA 5CXZA 5IUHA 3QHRA 2WIPA 2W1IA 3S95A 3QYWA 4FMQA 2BCJA 2WHBA 4IFCA 2QR8A 4PUZA 4RVKA 5JEBA 1UWHA 1ZY5A 5M06A 2HXLA 3OUKA 3IQ7A 4RVLA 3LCTA 4RIWB 2B55A 3AD5A 5IDNA 2XNPA 3MA6A 2HWPA 3SV0A 2QVSE 3O0GA 5IQAA 2XH5A 2WMRA 4M12A 4EOOA 1IA8A 3P5JC 1XH4A 3VAPA 5CNOA 1W7HA 2C6LA 3ZO3A 4BIEA 5IEXA 2YDJA 3VRYA 4YTFA 5LVLA 4DCEA 3COMA 4CKRA 4BDDA 5L2WA 3TEIA 5K5NA 3MTLA 4QMZA 4BCMA 3W0PA 5KBQA 4QPAA 3R7UA 4XHKB 3LFQA 4U80A 5CZHA 3VRZA 1QPCA 3NW7A 4KRCA 3QRKA 3BEAA 4D2SA 3CTHA 5CX9A 5E8SA 4G34A 4IM2A 5FTOA 2CKOA 3A7IA 5E1EA 2V0DA 2WQNA 3LM5A 4IC8A 3FPMA 3UO6A 1Y8YA 1GY3A 4XBUA 2YZLA 2WTIA 4ZIMA 4OTPA 4FOBA 3A8WA 4EH6A 4D28A 4ENYA 3GEQA 1Q8TA 1GJOA 3NGAA 4BKZA 4MH7A 4S31A 5IISA 3ACKA 3AMBA 4X2GA 5DT4A 4G16A 4AZSA 4GH2A 1ZOEA 4GJ3A 4AN9A 3FC1X 3V5WA 4AN2A 4W4VA 2PY3A 2C6OA 4UXLA 1TZDA 3MFSA 4FKPA 4Y5HA 5JN2A 2ZYBA 2W9ZB 1WBOA 1XJDA 4RFMA 4NM0A 4RFYA 4RG0A 2J0MB 5BMMA 4A07A 4AT4A 4XOZA 4EOLA 2YM5A 3I1AA 3MFUA 3QCSA 1Q4LA 4PV0A 5FM2A 3WZUA 4OBPA 5D7AA 3O50A 4HVHA 3OP5A 2PVRA 1PXLA 3FKNA 3R83A 3D2KA 5KUPA 3IO7A 4WG4A 5BX0A 1ZYLA 5EI8A 3RM6A 4B99A 4YJUA 1VR2A 4LV8A 2VX1A 3GU4A 4MHAA 4MD7E 3I5NA 3P0MA 2XP2A 5A3XA 2R3FA 4QQTA 2PZYA 3LQ3A 3ZRKA 5ACKA 2XNOA 1IA9A 2YJRA 4MF1A 4EOQA 5AUTA 2G2IA 4KIKA 3V5LA 3PIZA 3UG2A 3R21A 3UOKA 4FIIA 4O0VA 4QP4A 2UVZA 4A4OA 4YO6A 4NTTA 4EKLA 2C5XA 5LJJA 2XNMA 3PTGA 4LG4A 5CSXA 3H0ZA 2X9FA 4FC0A 4AZFA 5AUWA 2W17A 4DGMA 4QP9A 1IEPA 3GFEA 2XNGA 4KRDA 4EWHA 3ULZA 3MGYA 3AC3A 4G3FA 3F3ZA 4DEIA 2QG7A 4GYGA 4EBWA 3UYSA 2ITZA 3AGMA 5HLWA 2GHMA 2C69A 3EQIA 5CVFA 4C02A 4MYGA 3IONA 3OWKA 5K4JA 2JIIA 3GQLA 2IZSA 3Q53A 4QP8A 4ASEA 4UYNA 3VW8A 1JWHA 3NNUA 5IQGA 3I0OA 2R7BA 1CMKE 5FM3A 1YKRA 3F7WA 3VS5A 4E93A 3Q9ZA 1HCKA 3FY2A 3MY1A 3KC3A 4R5YA 4K11A 2WQBA 4BDGA 4OBQA 5CEMA 3POOA 5CY3A 2O2UA 4UMUA 4Z55A 2JBPA 2YIYA 5J1WA 3Q9WA 5E4HA 5E7RA 3FY0A 3LLTA 1K9AA 5AFVA 4M97A 3CY3A 4W9WA 4BJJB 1JSVA 2YDKA 1OGUA 5CSVA 4YJNA 5CENA 4I4FA 2WQOA 5EKOA 4RIYB 2UW5A 4XRLA 4WBBB 4ZTRA 5I5ZA 4KINA 5DR6A 4Y46A 1J91A 2UW8A 4BI1A 4JR7A 4G6LA 1BUHA 4I0TA 4ZK5A 2R7IA 3E7VA 4EEVA 4YR8A 3NS9A 5JK3A 3VS4A 5CU2A 2PMNX 3V5JA 3OVVA 3JXWA 4S34A 3VUIA 5C8NA 3TV7A 5JMSA 3QYZA 2UZBA 3FSFA 1URWA 2DQ7X 3R9DA 3IGOA 3BLAA 3FXWA 3PSBA 5TT7A 3ORXA 1OKVA 1XH7A 4O82A 1OMWA 1FBNA 4TTHB 2ZOQA 2CCIA 3ORIA 5ITAA 3PUFC 4I0RA 4L3LA 3S2PA 4FV9A 4IANA 4BGHA 4EJ7A 2VUWA 3PP0A 4F0GA 2WOUA 5LARA 3CQEA 3BZ3A 5DE2A 1JOWB 5D12A 3D0EA 2BALA 3UTOA 3S4QA 3BGZA 3ODYX 3C4FA 5TF9A 4QTEA 3O7LB 2UW0A 4CYJA 5EKNA 5CU3A 5DPVA 4GK4A 4XNEA 3RKBA 4YBJA 4XG2A 3DJ7A 3NRMA 5EM8A 2I40A 4OTFA 1CKIA 1URCA 4ITJA 2PZ5A 3QUDA 4FKQA 4RIXB 4RX9A 3EH9A 4RT7A 5CT7A 4F7SA 2ITWA 4CSVA 2XIRA 4IFGA 4BDIA 4U45A 3A2CA 4GS6A 4B7TA 3QTZA 4DDIA 1U54B 4F1OA 1UU9A 3RPOA 3SD0A 2R3NA 5BYYA 2GS7A 3BX5A 4V01A 5DMZA 5EQPA 4APPA 5C26A 4AGWA 3D5XA 3FLZA 4TWOA 2NRUA 3R8UA 3FLQA 4O0SA 5M4IA 4O7SA 3DZQA 3FMLA 3FPQA 5E8VA 3KEXA 4IM3A 3L1SA 2H34A 3WIGA 4L68A 3L9NA 1BLXA 4I24A 1YHWA 2XANA 3H9RA 1UU3A 1NW1A 3NEWA 3V5PA 5M08A 1PMVA 5HICA 2YISA 2YM7A 3HKOA 2VWZA 5CU4A 5L2TA 5KMOA 2UZNA 2WAJA 4C3RA 4TPTA 3N51A 4I92A 4BCHA 3OW4A 2Y4PA 4X21A 3W55A 2OIQA 4FTJA 1JLUE 5KBRA 4BTFA 4PDYA 5HE2A 4E4MA 4ITHA 2J9MA 1WZYA 4H36A 2RGPA 3UQFA 3P7BA 4BIDA 3EMGA 3P7AA 4IVAA 1PMUA 1R0PA 4EHVA 4P5QA 4J95A 4XBRA 3R71A 3HA6A 2HELA 3AD6A 3CKWA 4IHPA 2ZDTA 2OXDA 3NCGA 5FLFA 3W16A 4BBMA 2JDVA 4D4RA 4BY9E 2JD5A 2J0LA 4U43A 4O6EA 3K2LA 4WNMA 4IVBA 5DOSA 5L8KA 4HNIA 2CNVA 1KOBA 2X81A 2R4BA 4TYEA 3LKMA 5CF8A 5DIAA 4PNKA 3KCFA 2BRMA 2QQ7A 4KA3A 5J79A 4JBVA 2XIZA 4OTDA 5A4TA 3P7CA 4FX3A 5F1ZA 4DGNA 3QKKA 5HLPA 5GNKA 3BI6A 3FMHA 5AP0A 5FEEA 4EH2A 4LI5A 4DFUA 1G5SA 1PKGA 3EQCA 5KMKA 3DXQA 2GDOA 4AT5A 1Q61A 2XNNA 4FKIA 2R3PA 3DKFA 1ZYSA 1MRYA 2QOOA 4L3PA 4ANSA 2PVLA 2EXMA