5EM5A

Egfr kinase domain mutant "tmlr" with pyridone compound 2: 4-[2-(4-chlorophenyl)ethylamino]-~{n}-[4-(4-methylpiperazin-1-yl)phenyl]-2-oxidanylidene-1~{h}-pyridine-3-carboxamide
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
323
structure length
298
Chain Sequence
EAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKETSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYEEDMDDVVDADEYLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
publication title Pyridones as Highly Selective, Noncovalent Inhibitors of T790M Double Mutants of EGFR.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 298
sequence length 323
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5em5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5em5A01
4M67A 4D4VA 4Z7HA 2YCQA 4RA5A 3SDJA 4WO5A 2XNMA 4BDFA 1H1RA 2CNQA 1XR1A 4APPA 4IIRA 3O8UA 4YC8A 4F65A 2DWBA 3CIKA 3K5UA 4HCVA 4L3LA 3BWJA 1Z5MA 5JRQA 4PMTA 3CQWA 2WIHA 3DOGA 4FT3A 3C5IA 5M09A 3NW7A 4ASXA 5CTPA 1SVGA 4AOIA 4IEBA 3AC1A 4ZJVA 1Q8UA 3SXFA 3HAVA 2X4ZA 3C9WA 5IA3A 5AUZA 4QOXA 3Q5IA 3FMEA 4BN1A 3QC4A 3W8LA 3RAKA 1SNUA 3BELA 4DHFA 2Y4IC 3LFBA 2WMWA 4IM3A 2XMYA 2C5XA 2HENA 2JITA 5DYJA 5HG9A 5I3RA 1MP8A 1NW1A 2VNYA 4D0XA 5AV1A 3KRXA 3BCEA 1H26A 1TQMA 4AOTA 5E90A 3QXPA 1OIYA 2V22A 3TNWA 2H8HA 3TXOA 4Y72A 2ZB1A 4QMTA 1JPAA 3UVQA 1PXKA 5HE1A 2VTNA 4U8ZA 5JZNA 3HV4A 4F99A 3KEXA 5AV3A 3NYOA 4FSWA 3AT2A 4TYGA 3LM0A 2E9PA 4ENYA 2Y4IB 2XUUA 4ZSGA 3W2PA 4UMRA 4Q5HA 4KRDA 5CSVA 5TR6A 1XBCA 1Y6BA 3QZHA 4R1YA 2YM6A 4AU8A 1Q24A 3HV5A 2ZM1A 4KSQA 1VJYA 2PE0A 4BIDA 2AUHA 4DG0E 3FLSA 2QHNA 4IC7A 1PKGA 1SYKA 4GT4A 3Q9WA 4ZY5A 3KC3A 2WQEA 3O7LD 4F7LA 2REIA 4XOZA 3HA6A 3DS6A 4NZWB 3DQXA 5BUIA 4PF4A 2F57A 3GQIA 4CNHA 4ZSLA 3VBTA 5ANGA 4I6BA 1L3RE 3VIDA 3LCOA 4ZSJA 1YW2A 4Z55A 2ESMA 5DNRA 4XP3A 1Z57A 5BX0A 5AM7A 4QNYA 4XBRA 3D0EA 4G3EA 4MTAA 4ZMFA 4X3FC 2PMLX 2OFUA 5IA0A 2HZIA 4QMMA 3P08A 1H0VA 5A54A 5IQEA 4E8AA 1BI7A 4V01A 5BYZA 2V62A 4JBQA 4E26A 4TYHB 4EH6A 5J9YA 4KBKA 4CCBA 3MIAA 3C0IA 4I0TA 4C7TA 1JBPE 5E1SA 4PTEA 2YLEA 5BYYA 3MPMA 3W10A 2VWZA 3FZSA 1GZOA 2OJJA 2UW0A 3E64A 4FTOA 4I21A 2C6KA 3U9NA 4XJ0A 4BTKA 3LM5A 1JSVA 1GIJA 2GQGA 3BU3A 1ZYDA 4EBWA 4D58A 5B7VA 4FTMA 4FVRA 3L9MA 4X3FB 3F5GA 4Y8DA 2VTQA 3WARA 1YOJA 4CQEA 4C4EA 3ZZWA 3Q4TA 2E2BA 4YGAA 3PFQA 3HMOA 3ODYX 3Q6UA 5AP5A 3ZLXA 1YOLA 4QTEA 2EXMA 1PKDA 3DDPA 4YJUA 3W33A 1WZYA 2YIXA 4UWYA 5CQUA 4BGQA 5BMMA 4CFXA 4L43A 5HE2A 3PA3A 4O82A 5D1JA 1IR3A 2HWPA 1PMEA 4PWNA 1M17A 5AIKA 4W8DA 3LXNA 5L8KA 4I22A 1JVPP 2ERZE 4WG4A 3UOKA 4BDHA 4F6WA 2WQNA 4FKWA 1Y6AA 1NY3A 2CHLA 3ZSHA 2PTKA 2QOBA 2O0UA 2YWPA 2BMCA 2UZBA 4C4GA 4F09A 4NJDA 4RMZA 2F2CB 3O8PA 3OFMA 5DT4A 2Y0AA 4W8EA 2JDOA 2R2PA 3DY7A 4AZSA 4FR4A 4FV4A 2JDSA 3VBVA 4F08A 4D2VA 4OAUC 3VS5A 4IMYA 2XEZA 3P5KA 3SLSA 3ZC6A 5LVOA 2C69A 1P2AA 4IZAA 1FQ1B 4WOVA 5AMNA 4AGUA 2VTRA 1MQBA 3UE4A 4O86A 2CGVA 3Q4UA 4FV0A 2XP2A 4FYNA 2YFXA 5KMNA 4S33A 5D10A 2QOOA 2XS0A 3FMHA 4X2JA 3ZDUA 3KU2A 4GH2A 1B39A 4ASEA 4YLJA 2YA9A 3RK7A 4WBOA 3LCTA 1XH5A 3UDBA 4USEA 4WG5A 2E9NA 2B52A 3MIYA 3F3VA 2C6EA 3DCVA 4DYMA 4J96A 3OG7A 3O0GA 3KXZA 4E7WA 4ANBA 4FV6A 3F9NA 3TN8A 2RKUA 4QTCA 4WBBB 1AQ1A 4GCJA 5HNGA 3REPA 3UVPA 4JX7A 2UW5A 5KBRA 3O71A 2ONLA 5HO6A 3B2WA 2OIQA 3QZFA 3V6SA 1PXIA 3C4ZA 4NL0A 3VUTA 4FTNA 2IVVA 3UPXA 5JH6A 5EYDA 5CAOA 4DG3E 3AD6A 3OVVA 4DEGA 5D7VA 4ZLOA 4S2ZA 4E4NA 1IA8A 4ARKA 3MBLA 2B54A 4NTSA 3DDQA 5AM6A 4XV1A 2IW6A 4PNIA 2BZJA 2A2AA 1P5EA 2C6IA 2I40A 4KWPA 4AW2A 2GNGA 5EYMA 4UN0C 5KUPA 2XEYA 5KBQA 1ZXEA 3R63A 2ITWA 4QTBA 4CV9A 2VNWA 4USFA 3THBA 2YISA 1XQZA 4IVDA 3QTSA 3BU5A 3QTZA 3FJQE 3V5QA 3VWAA 5ANDA 4IADA 3VS3A 4MYGA 2QLUA 3JUHA 4D28A 4QRCA 3DKOA 3GENA 1W98A 2OWBA 3EFWA 4EK5A 3PSCA 3OOMA 5EOLA 2GS7A 5IUIA 1FBNA 4IJ9A 4KD1A 4YLKA 5GZ9A 4ASZA 4UZHA 4OBQA 3OY3A 4JX3A 3JS2A 2X8DA 4NWMA 2UZOA 4FKUA 4CMUA 5AWMA 2WMSA 3CD8A 4RJ4A 4WUAA 3R28A 4EK6A 2Q0NA 2GTMA 1PRYA 3I6WA 4Z9LA 2Z60A 4UXQA 4WG3A 5IPJA 4AZVA 4FGBA 4A9TA 3R01A 1XH6A 4H3QA 2WMVA 2IG7A 1YI3A 3RZBA 3F66A 2O64A 4P4CA 4E20A 3R7VA 3SG9A 3KMMA 1QL6A 3DQWA 2BR1A 3FC1X 4M12A 3RAHA 4DG2E 1TQPA 4A9SA 3ITZA 3RPYA 4MWHA 4NUSA 5A6NA 4MH7A 4P5ZA 4BCNA 4WKQA 3M2WA 4LM5A 3FZRA 3E8EA 5C8MA 3FLZA 2YAKA 3WF5A 3NMUF 3FMKA 3QD3A 5DHJA 2GDOA 5IQBA 4LL5A 2R3GA 3ACJA 4FKSA 4IAYA 2ZV8A 5HIBA 4BDGA 4AQCA 4CD0A 3C1XA 3C7QA 4FTLA 4O96A 4BKYA 2UW9A 2OXDA 2F7XE 5CAVA 3ZUTA 3DLSA 1KSWA 2P4IA 2VTHA 3FQSA 4MQ2A 4KS8A 2HY81 3IQ7A 5CSXA 2YWVA 1Q5KA 3BI6A 3R1SA 4AAAA 2RG6A 3OUKA 3VHEA 4GSBA 3BGPA 2JLDA 4U81A 2ITZA 4NFNA 1QPCA 3L9NA 5DGZA 5DEYA 4PL4A 4LUDA 5ETAA 1ZYSA 3H10A 1W8CA 3UP2A 3WYYA 3SW7A 4OTRA 4B7TA 2OZOA 3DNDA 3IW8A 3PVGA 4V0GB 4L45A 4TWNA 4C2WA 4FSMA 4GVAA 4AUAA 3OP5A 5AADA 3HL7A 4XRLA 1J7LA 2PZ5A 2VTMA 3P4KA 5BUJA 5DT3A 2WZJA 2WOTA 5GINE 3A7JA 2CGXA 3OF0A 4DAWA 2BALA 4FKGA 4MX9A 3VNTA 4DEAA 3NDMA 5F4NA 3QTIA 4JQEA 2C5VA 2R3IA 2OXYA 3V01A 4FV7A 2CN8A 2R64A 4NFMA 5TT7A 4C38A 2YLFA 2R3LA 3FY2A 1V0BA 4BZDA 4GKIA 4YHJA 3QYZA 4XG2A 3I4BA 1W7HA 2EB2A 3T3VA 5CEPA 2OLCA 3HRCA 2OSCA 3BHUA 4C4FA 4FIHA 4HCTA 3W8QA 2CKQA 4NKAA 2PZIA 1YHWA 3PE2A 4W9WA 2I6LA 4WUNA 4I5MA 1O6KA 4IAFA 5AP6A 1H01A 1J1BA 3A60A 4RJ3A 4FIIA 3RAIA 3ZO2A 5CU3A 3G6GA 4BI0A 3G9NA 4F1MA 2R3JA 3CP9A 3QQLA 2BAKA 2FGIA 1U59A 2A19B 1RE8A 1GY3A 3IONA 5JQ8A 2YIQA 2QOLA 2O65A 4BDDA 3DBFA 3HLLA 4PPBA 3ULIA 4EHGA 3WIKA 5TE0A 4BDBA 4D2SA 4J1RA 1GAGA 2JDRA 3FSFA 3RWQA 2PVFA 3G51A 3ENHA 1M52A 4G34A 4LGHA 3R8VA 2WTKC 1NT2A 3LAUA 4L8MA 4FEVA 2VTOA 1WBWA 4PMPA 1ZMWA 1CM8A 3L8VA 4W4WA 3TKHA 1JKLA 4IH8A 3G2FA 1R0EA 4G6OA 2IW8A 4OGRA 5GJDA 5IQFA 3MY0A 3PXZA 3F5UA 5KNJA 2KULA 4XMOA 3U55A 3AC5A 3F5PA 2QKRA 4OLIA 4CRSA 1VR2A 2VTPA 5JGBA 2WEVA 3PY3A 4S30A 1YHSA 3V8WA 4Q9SA 1GIHA 3LW0A 3OCSA 5AJQA 4FTIA 2X2LA 3W2QA 3DZQA 4XS2A 1DI9A 3UO5A 2B9FA 2F2UA 2WTKB 3C51A 3FLYA 5BUEA 2AC3A 1PW2A 3A7IA 3VS7A 5I0BA 5DFPA 4RZWA 4RSSA 1UU3A 4GK4A 3TKIA 4AZFA 2VX3A 3E3PA 1WCCA 2DQ7X 5GJGA 3MPTA 4MNFA 3OD6X 3QX4A 1PHKA 2EWAA 3E63A 3NYXA 4BI1A 5KO1A 5J1WA 1NVQA 2JKOA 2Z02A 4XHKB 2XF0A 5FM3A 3LFSA 2X0GA 5LCKA 4FL2A 2XIXA 4FF8A 4QMUA 5FTOA 2RFSA 3ZUUA 4C3PA 5HIEA 4FGRA 3NNVA 4RLKA 4ZAUA 4UEUA 4AW5A 4ENXA 1FMKA 2PSQA 4ZJIA 3VHKA 3ZONA 4BGHA 1IRKA 2WTJA 2ZMCA 3MFRA 4H1MA 3UQFA 1WBVA 5EDQA 2X7FA 3UBDA 1OPKA 2XJ2A 4XRJA 2J4ZA 2OJFE 2ITYA 2W9ZB 4FBXA 4HYIA 4JAJA 4CKIA 4F6UA 3P78A 3PXFA 2UW7A 2VWXA 3FZ1A 5KE0A 5AP2A 3GU5A 2WMBA 4L00A 4FG9A 5C8NA 3NAXA 3T3UA 3VULA 4AA5A 4DBNA 5CASA 3KVXA 2W0JA 2VO6A 4E5WA 1W0XC 2X8EA 3F7ZA 5F94A 1YDSE 3NIZA 5HCZA 5HKMA 4F9BA 3ZM9A 4J98A 4QD6A 3PPKA 1OL5A 3A2CA 4YHFA 2LAVA 3TI1A 1Q61A 3JPVA 3Q52A 5LMKA 2RFNA 1JKKA 3D2KA 3KCFA 3N51A 3FZPA 3ZLSA 4A4LA 4H1JA 4IB3A 3FBVA 5I9UA 3SHEA 4OTFA 3D9VA 5BVKA 4HNIA 4U9AA 4EQMA 1BL6A 4ONAA 2X9FA 4D1ZA 5JSMA 3VS4A 3NVKI 3AT3A 5CZHA 4ZZNA 5IDNA 3FI4A 1FINA 4FTTA 1SVEA 3UPZA 5GNKA 5KMJA 3PA4A 5I3OA 4MF1A 4LV8A 3AQVA 3BBTB 3KB7A 2WMRA 3VS0A 2PY3A 1WAKA 2HELA 4PTCA 4TN6A 5AP1A 2ETKA 3ORXA 5DBXA 3F6XA 2BUJA 5A3XA 2BIYA 2XRUA 2YZLA 3DB8A 1GZKA 4BF2A 4O83A 3GU4A 2XK3A 2QOQA 5LJJA 3DXPA 3EQRA 4JRVA 2BKZA 3ZO1A 1IA9A 1Y8YA 4ZTHA 1IAHA 2YM5A 2XM9A 4QMVA 3V5WA 4WIHA 5IMEA 5J7BA 5JFWA 3HAMA 2R0IA 4M14A 2WMUA 4X7QA 4S31A 4JNWA 2VWBA 4D1SA 4R7HA 4F1TA 4N70A 2R3OA 4QMNA 3NPCA 3SX9A 4O7YA 3Q32A 3PVUA 3TNHA 2FUMA 4X2NA 1WFCA 3Q6WA 2CCHA 3NUYA 2YDIA 1REKA 2H9VA 2W1DA 5ANJA 4XG6A 2DYLA 3PVBA 4M66A 3ZBXA 4D4YA 3RPVA 5AUVA 3ZYAA 2GNIA 2PVRA 4C0TA 4GYIA 1ERKA 3ORIA 4I1ZA 3UOJA 4O7VA 3IO7A 3WYXA 2XH5A 3EJ1A 3TV4A 4U42A 4ANNA 1FVRA 1UU7A 4GIHA 4PV0A 2QVSE 4TNDA 4FA2A 5AR5A 3QTQA 2Y4PA 3KQ7A 2GMXA 4O7TA 4LQMA 4RG0A 3OMVA 3OY1A 2R0UA 4ZP5A 4BCOA 4BI2A 4UALA 4QYYA 2BZKB 2VGPA 3MS9A 3VO3A 3S2PA 5GZ8A 4I41A 5C03A 3O8TA 4QP3A 4ZZMA 3BV3A 4J52A 2QO7A 2QOCA 3BX5A 5AP7A 4EKKA 3KXMA 5A14A 5EQPA 5F1ZA 5IA1A 4Q2AA 2OBJA 3EZRA 3UG1A 5LMBA 3NSZA 4IX4A 1OKZA 4FC0A 5AFVA 2C1BA 3L9LA 2ITTA 3CCNA 2UZUE 3HGKA 3OWLA 1IAJA 2XBJA 3FPMA 3PSDA 4UWBA 3WILA 3ZFXA 4I4EA 1H27A 4YSMA 3EFJA 3D7TA 4CV8A 4ZSAA 5CVFA 3DAEA 2PUNA 3IW7A 4A7CA 4UXLA 4EOJA 3PIZA 4YZNA 3TL8A 4AW1A 5HU9A 2UZTA 3F3UA 2CLXA 3VBYA 1UKIA 4CFVA 1H1PA 2W1ZA 2PZYA 1OL7A 4DEEA 1A06A 2ITUA 2R3FA 4C58A 3ALNA 3GC9A 3I81A 3R0TA 5M51A 3MSSA 2J9MA 3A8XA 2QODA 5FXSA 2X8IA 2YIRA 4EORA 2CGWA 4ZMEA 3KXXA 4NM3A 2WKMA 5K0KA 5CALA 5JZJA 1B38A 1OL1A 3OW3A 2A0CX 4EOOA 1WVYA 4NCTA 1W82A 3QRUA 4FV9A 2X2MA 4F6SA 2IJMA 5EDRA 1GIIA 4UYNA 3GCPA 3ZXZA 3ZFMA 2C6DA 2ITQA 4TZRA 1YXVA 3PG1A 3HEGA 3BQRA 4IC8A 1UU8A 1CSNA 4JDJA 4XNEA 4ZK5A 5T6KA 5KZ0A 4YTFA 2CNUA 3S0OA 4LL0A 1IEPA 4QMYA 4FKPA 2VU3A 2IZSA 2UW8A 4PPCA 4E4LA 4B6LA 4CKRA 4DFNA 2ETMA 2UZNA 5AV2A 4CVAA 5IISA 3H9RA 2PUIA 2YERA 3TZ9A 2EXCX 5CEOA 5IF1A 5H2UA 5D41A 4AFEA 4OBPA 3UZPA 3Q9YA 4CYIA 2YCSA 2WB8A 4QTAA 4BHNA 2XNEA 4CFNA 4FIJA 3TEIA 4XH6A 5DEWA 3IDBA 4TRLA 4FNXA 3I7CA 1OECA 1KUTA 3QGWA 3L9PA 5K9IA 4QMZA 2QO9A 2C5OA 5HBJA 3QFVA 1R3CA 4IAZA 4G31A 1XKKA 2WNTA 5IEVA 4KRCA 4DTBA 4FSNA 2CPKE 2VWUA 3CTJA 5ACBC 4F7JA 1PMVA 2VAGA 3KF7A 3MH1A 4FNWA 4ANMA 3QQHA 4Q5EA 5EOBA 2EUFB 4J71A 5L8LA 4II5A 1ZAOA 3O96A 3NNWA 2VO0A 3LJ0A 1A9UA 3MTFA 4BYIA 1Z9XA 4ACMA 4IANA 5K0XA 5FXQA 4CQGA 3AD4A 3MJ1A 2W1IA 3EQBA 4FZAB 4AGDA 1JOWB 2RGPA 3QKLA 2UZWE 3EZVA 2VRXA 4DH7A 4ZZOA 1JSUA 5DH3A 3ORTA 4I5CA 3EQIA 4GFMA 4DLIA 5CT7A 3IKAA 4K1BA 3QLFA 5JFVA 3DV3A 4M8TA 4DINA 4YNOA 3AMYA 3ET7A 4TPTA 2YJSA 4HVSA 4EQCA 2IVTA 3BGQA 4GU6A 2QNJA 4U44A 1UU9A 2J90A 4FUYA 3I0OA 4AN2A 4EH9A 3LQ5A 3W2OA 3QD0A 4BZNA 4BFMA 2OF2A 2PVMA 4D4SA 3MFSA 3QCQA 1H28A 3G33A 3QKKA 3PRFA 1Q8WA 4C34A 3QC9A 3GEQA 4EOPA 1WMKA 2CSNA 2XNPA 3Q53A 4RJ6A 5JGDA 2PL0A 4HYHA 4PL5A 4RGJA 4AT5A 4JT3A 4JIAA 3H9FA 3IGOA 4KKHA 4GFGA 1H07A 2RG5A 3LQ3A 3B2TA 4G3FA 3H4JA 4MK0A 4RC2A 1PF8A 4NIFA 5CENA 5LCJA 4CG9A 1KE9A 2HK5A 4GV1A 3RMFA 4IWPA 4AA4A 4JI9A 3QTXA 4Y5QA 4CMOA 3GB2A 2C0TA 2CN5A 5A4CA 2OZAA 3D94A 5HEZA 5LVLA 5L2SA 3CGOA 4JR7A 3R7IA 3QL8A 4CLJA 3QZIA 2VO3A 3OXIA 3KULA 3D7ZA 2ZV9A 4Z16A 2IZRA 4B0GA 5L2TA 4NT4A 3PZEA 2JBPA 3R7GA 4ITIA 3I6UA 2X9EA 3DU8A 4TT7A 3T9TA 4TYEA 4EH7A 3HUBA 2B9JA 5IQHA 4FMQA 4O38A 4QP1A 5FRIA 4RIYA 3MWUA 4FKOA 4HNFA 5HI2A 4DF3A 5B2MA 1Y91A 1J1CA 3HP5A 4YUQA 1ZYJA 2ZV2A 3D5VA 3DNEA 4OW8A 4QP4A 3TIZA 3SD0A 3D14A 4PP7A 1WBOA 3LFQA 4PNKA 3ROYA 2CDZA 5HO8A 3MH2A 1J7UA 2BCJA 4BKZA 5BNJA 3DFAA 1U4DA 1TQIA 3G0FA 3GU7A 4IBMA 1G8SA 2XVDA 3V8TA 2JIVA 2RL5A 4C62A 3EKNA 4LGDA 3SRVA 5C4LA 3Q2MA 5KHWA 4EOMA 2XKCA 4QO9A 4JR3A 4RWJA 4TY1A 5EM5A 4A06A 2HZ4A 2CJMA 3EHAA 3QTWA 4QMLA 3VUKA 2BDWA 4EH8A 3ZZEA 2ZB0A 3QRKA 4ZTLA 4YJVA 2ITVA 3QHRA 5AP0A 3CBLA 1UV5A 3EB0A 3LCSA 4QP8A 4NM0A 4A9RA 4EUUA 5AA9A 2JKKA 3MDYA 4RX5A 4CYJA 4EI4A 2AC5A 2Y7JA 3KN5A 3WIGA 5E1EA 4DITA 2W1CA 3LLTA 3LMHA 2XZSA 3PWDA 3QAME 3I79A 3ORMA 1NXKA 3TIYA 3RJCA 3HMMA 2OI4X 5M06A 2AYPA 2G2HA 3Q4CA 3UTOA 4IAKA 4ZJJA 4USDA 4ERWA 4F9WA 2PUPA 4O0TA 4RFZA 3F2RA 4V05A 4M0ZA 4QQJA 3W18A 2XKEA 1YI6A 3RWPA 1OI9A 1O6YA 2PZPA 4BWKA 5JFXA 1M14A 3A4OX 3QRTA 4H3PA 4JG8A 1Q62A 3E88A 4X21A 1ZYLA 1Q8YA 2BRGA 4U5JA 3UIBA 5IG1A 3Q5ZA 4G3GA 4ALVA 4L67A 1LR4A 2GHGA 3D2IA 3R71A 3VRYA 1MRUA 1MUOA 5AR2A 4FTKA 2YM7A 4QYEA 3TZMA 2VV9A 4S34A 2EU9A 4I0RA 4L3PA 4D2PA 5AAGA 1JAMA 4FOBA 4JAIA 4CTCA 5E8TA 3ZSIA 2QG7A 4D2WA 3DBQA 4U3YA 4QPMA 3NR9A 3ELJA 2WMTA 5FTGA 5JN2A 3QUPA 5CZIA 3BYVA 3BWFA 4FSUA 4PTGA 2HZNA 2OJ9A 3CC6A 2QR7A 3TTJA 5HU3A 3S4QA 5CAPA 3WZKA 3OS3A 3CY3A 1CKJA 2HXQA 4AACA 2J0IA 4CEGA 3D5UA 1P4OA 4MXYA 4QMPA 4Y95A 4PPAA 4GFOA 3GU6A 3DJ6A 4KINA 3HA8A 4IM0A 2XIRA 4FIFA 3LLAA 4K8AA 5IMXA 3KL8A 4EK3A 4RC3A 5LMKC 4EC8A 3ANRA 2YCFA 3RM6A 2PMOX 4YBJA 3QCSA 3KN6A 4FVQA 5CANA 3C13A 2BHEA 3TUDA 3CD3A 4YJQA 4PMMA 1JLUE 5I9YA 4GK2A 2G2FA 3DK3A 2FO0A 4UV0A 4AF3A 4BCIA 4A4OA 4DFUA 2XM8A 2DUVA 4B4LA 4JIKA 2WMQA 1QPEA 4RA4A 5A4TA 2YM8A 1ZYCA 2ZAZA 3ZUVA 3V8SA 5A6OA 2XNBA 5CU0A 3DLZA 4KS7A 4ITHA 3NUXA 4KIOA 4RWLA 4U80A 3OT3A 5C27A 4O7LA 3LMIA 3GCVA 2WOUA 3LCDA 5EDPA 4ID7A 4YJRA 4XBUA 1NVRA 2XK4A 3L8PA 5A4LA 1Q8ZA 1ZOGA 2XNGA 3AG9A 2CKOA 5M56A 1OB3A 4IX3A 4C2VA 2X2KA 3VW8A 1XH7A 3KKVA 4PDSA 5EKOA 3OROA 2IZTA 4L53A 2OH4A 1FOTA 2O8YA 3ATTA 3NUSA 3FHRA 3NIEA 3A7GA 1KOAA 3MVJA 5HZNA 4PRJA 2VTAA 4FKVA 3JXWA 5EI6A 1OPJA 4EOQA 3MGYA 4YO4A 1Y57A 5E8XA 3C0GA 3QQGA 3UQCA 2CCIA 4WRSA 1KE7A 3QUEA 2VTSA 5CSHA 2NP8A 2WQOA 4UYAA 2I0HA 3R1NA 1YWRA 2FB8A 5KCVA 2UVYA 3U6HA 4LUEA 5M4FA 3V04A 5DE2A 4C8BA 4I23A 5L6PA 3Q60A 5E91A 2R5TA 4O27B 3FYJX 2WHBA 2X81A 3BLRA 1M7NA 2XJ1A 2PZRA 3AC3A 3LZBA 5CLPA 5CX9A 4QQTA 1CKPA 4R8QA 3DAJA 3HX4A 5CNOA 2BRBA 1ZZLA 2BZHB 2XIZA 2YIWA 3MN3A 4YHTA 3FXZA 2PU8A 4RJ8A 2XK8A 3TDVA 2GQSA 1YXUA 2P2HA 5CI6A 2OG8A 2OU7A 3PTGA 4HVGA 4DFLA 3WZUA 4D55A 2J5EA 2W06A 5FUTA 3TUBA 4BR3A 2J0LA 4IJPA 3JYAA 5KMIA 1DM2A 5AIRA 4N6YA 4A07A 4LMUA 1H00A 3POZA 4IX6A 3SXSA 4M69A 3W1FA 4RWIA 4ASDA 3CJGA 5HVYA 3WZJA 4JRNA 4UY9A 3A62A 5D12A 3TNIA 4CSVA 4DEHA 3DKCA 4O84A 3GNIB 4K0YA 5F20A 3IDCA 5BVWA 4RLLA 4BCJA 3V5PA 4IDTA 4BCMA 3C5UA 4DTAA 2PVLA 2BRMA 4FG8A 5HORA 5GIPE 5E8ZA 3RZFA 4CZUA 1YXXA 4G6LA 5KMOA 3ORLA 4BDAA 5EW3A 4DGLC 2XRWA 4EZ3A 4XP0A 5BYLA 2ERKA 2G9XA 3PP1A 3COIA 3ZFYA 4E5BA 4QP9A 2R4BA 3R8PA 1PXJA 2GFSA 3ORKA 1Q4LA 3I0QA 1JWHA 2FH9A 4M3QA 4FKRA 3LPBA 4OT6A 4RIOA 4XV9A 1S9JA 3CR0A 2G1TA 3HZTA 3LQ8A 5AR8A 3NVMB 3GI3A 2UUEA 4G3DA 2O63A 4JBPA 5I9ZA 4M0YA 4IE9A 3HP2A 2WU6A 5C01A 4QYFA 2BAJA 3FLQA 3EN9A 5FGKA 2YZAA 4AOJA 3LJ1A 4X3JA 4E6AA 3F2NA 5EKNA 5KHXA 3UG2A 3EFLA 3HRFA 4C4HA 3KGAA 3DAKA 5HVJA 4P2KA 2GS2A 1M7QA 3V5JA 3FV8A 3E8NA 2XK6A 4YJPA 4EQUA 3ANQA 3RP9A 2XIKA 5CYIA 2YM4A 3ROCA 5AV4A 1WBTA 3RINA 1CDKA 4TW9A 4DFXE 2RIOA 5HTCA 5LWMA 4U41A 4R3RA 4BCKA 5FM2A 2YACA 2F7EE 4BL1A 3UNKA 4G16A 3KFAA 3SOAA 5L2QA 4XUFA 3NW5A 2HWOA 4K18A 1PMNA 2CMWA 3FPQA 1RDQE 4OR5A 3VF8A 2FSLX 3OWKA 4IX5A 4IQ6A 4K33A 4NK9A 3BU6A 4CFUA 4HVIA 1WVWA 3HUCA 2VWYA 4RX9A 1VYWA 3DZOA 5GZAA 2C3IB 3NUPA 2XJ0A 3PLSA 4MNEB 2QONA 5DRDA 3GP0A 5HE3A 3LXKA 4F7SA 4HOKA 2NRYA 2UV2A 4D9TA 4DGOA 2R7IA 1DAWA 2WTVA 3KREA 4GT3A 3MVLA 4FTJA 4ACGA 4DGNA 2SRCA 2WU7A 3P79A 2NRUA 1NVSA 1O9UA 2OXXA 3CTHA 3PUPA 4N4SA 5CVHA 4D1XA 1Q97A 1FPUA 4ZTSA 4GVJA 4IVCA 4BCHA 4J53A 5HTBA 1H24A 3PWYA 4U6RA 5BPYA 2ZDTA 3HDMA 3TUCA 3VC4A 2VWWA 4GL9A 3HMIA 3R6XA 4O2PA 2ITNA 4XYFA 2JEDA 4AWIA 4E3CA 5IA2A 3R9OA 4ACHA 4BIEA 5J79A 4U43A 1AD5A 3ETAA 4PP9A 3W2RA 2VD5A 4C4JA 5ETCA 1B6CB 4FTCA 5HLPA 3IPHA 3ZXTA 5E8VA 4I4FA 2BRNA 2BDFA 2WELA 2GFCA 3F3WA 4X6QC 1W84A 3RPSA 2O2UA 4B8MA 3BV2A 5BVNA 2A1AB 4MAOA 3KRLA 4FV8A 4Y46A 3JY0A 4PUZA 4KIKB 3HV7A 3PXKA 4UWCA 3TWJA 4C33A 2B4SB 4DC2A 3BHTA 3FI3A 5CXHA 4MVFA 4B99A 3W16A 4XG4A 4CZTA 4O7NA 4QP6A 3G15A 3QRIA 1FVTA 5CEQA 3BGZA 4L42A 4C37A 3NCZA 1XH4A 3EQPA 2HW7A 2J50A 2QKWB 3HRBA 4DFBA 4X3FA 5C1QB 3PJ8A 3LFNA 2W4JA 3PVWA 4JDKA 3WBLA 3L1SA 1OVEA 3GOPA 3WE8A 4BTFA 4D9UA 3KVWA 3BEAA 4X2GA 3BLQA 5M57A 4IWQA 4NW6A 5GJFA 1A48A 2FSMX 5FBNC 4KIPA 3VN9A 2JIUA 5JGAA 2ZVAA 4JQ8A 1FGKA 1LUFA 5C4KA 2XK9A 4QTDA 5M53A 4BDKA 2GNHA 3DB6A 2JAMA 1PXLA 3O7LB 4MXOA 1OKVA 3R1QA 3FSKA 1QMZA 2P0CA 3M42A 4BB4A 3BE2A 1UNHA 1KWPA 4D0WA 5FTQA 1PJKA 5KKRB 3UO4A 3HECA 5M4UA 4XV3A 2XKFA 5A4EA 5AX3A 3DBCA 4FL1A 1H4LA 3FHIA 3UC4A 4QYGA 1JNKA 4OTQA 5IU2A 2O3PA 4C4IA 4OTGA 4O7WA 4BCPA 2C5NA 3DK6A 2BHHA 4GJ3A 4MBJA 4NIFB 4C3RA 4DEDA 3SGCA 1G3NA 4ACDA 3HNGA 2NPQA 5FDXA 1VEBA 3RK5A 2OZAB 3K5VA 3ZS5A 3MVHA 1K3AA 4F9CA 5IH5A 3COHA 4NW5A 1ZY5A 3COMA 3PP0A 5FEEA 5AUTA 1MRVA 3SV0A 3IDPA 3Q3BA 2C3KA 3VBXA 2PUUA 5E8YA 4RC4A 3EL8A 4V04A 4O6LA 3BYOA 5EFQA 2ZM4A 5EI2A 5HLNA 5I9XA 3EH9A 5ICPA 1OL2A 5IDPA 4FT7A 2BTSA 4JDHA 1DI8A 5EG3A 4ITJA 2PULA 3BYSA 4O1PA 4CFMA 3ZEWA 4C57A 2HIWA 1V1KA 3R1YA 4XX9A 2LGCA 2QU6A 3F5XA 3NLBA 5CY3A 4OTDA 4B9DA 1BKXA 4FTQA 2F9GA 3EMGA 3BPRA 5CAQA 3R02A 2YN8A 5DG5A 5C26A 1ZMUA 2BKKA 5DIAA 3Q04A 3OWJA 4I93A 4IM2A 5CSWA 4F0GA 1LEWA 1NA7A 4AZWA 4PX6A 3R04A 3PPZA 2W9FB 4DH3A 4JJRA 3NCGA 3P7CA 2ITXA 3NGAA 2C47A 3SRVB 3VJOA 1FVVA 2JFLA 4DEBA 5B0XA 3DPKA 4FKLA 2C4GA 1PXNA 3OT8A 3MA6A 4FSYA 2W1EA 3RI1A 4WNMA 4ALUA 4FYOA 4O7SA 3U8WA 4FZ6A 3PDTA 2VX1A 4ANSA 2BFYA 3VS2A 4MBIA 3VJNA 2H34A 3ORZA 5J5TA 2XB7A 2PVHA 2WTIA 4NU1A 1XBAA 2R3KA 2QURA 1PXPA 4ZY6A 3QWKA 2QLQA 3OXZA 4X2FA 3R8ZA 4CG8A 1BI8A 3G9LX 5FG8A 5L3AA 3HMNA 5IQAA 1T45A 4D2TA 3EWHA 3I5ZA 5DR2A 2HAKA 2W1FA 2Y9QA 3QD2B 4U45A 1GNGA 1WBPA 2OW3A 4E6DA 2KTYA 2J0JA 2XYUA 1YDTE 4RBLA 4FOCA 4XG9A 3GU8A 5L2IA 2HZ0A 3G5DA 1OM1A 5CNNA 3RHXA 4L6QA 5HOAA 5A4QA 5M4IA 3OEFX 3S3IA 3UVRA 4M7IA 5HBHA 1KV2A 1URCA 4FSTA 4FTRA 2VWIA 4J8NA 2C3LA 3E7OA 2V5QA 3FWQA 1U46A 3P9JA 4IVBA 4I20A 2BRHA 1EH4A 3DBEA 4NM5A 4LMNA 5LMAA 3TDWA 3UIUA 3QLGA 4AFJA 2XBAA 5G6VA 2CKEA 5JKGA 4L52A 4ALWA 2Z8CA 2NO3A 3RVGA 4RJ7A 1OIRA 1LPUA 4FL3A 4LRKA 4O91A 2XA4A 3KXGA 1Q99A 3QBNA 3VUGA 4YZCA 2XNNA 4ANLA 4IWOA 2JKMA 4P5QA 2CKPA 4FNZA 5HTIA 1XH9A 5E8SA 4AT3A 4DT8A 1Y8GA 5IA5A 3FZOA 2ONLC 4XV2A 5IEYA 1OBGA 5AR3A 4YZMA 1ZZ2A 3U9CA 2EXEA 3A7HA 2R3QA 2Y6OA 3AC4A 4L9IA 4QMOA 4EH2A 5L4QA 5LWNA 1M2PA 2OFVA 2V0DA 5G1XA 4RIXA 3FXXA 5CF5A 3VUDA 3LFDA 4PQNA 2B7AA 4L01A 2IZUA 4YURA 5L2WA 1H8FA 3A8WA 4KIQA 3QXOA 4GRBA 2B0QA 2GSFA 2ITOA 2UZLA 3D5WA 3KY2A 4YTIA 3WF8A 5BVOA 5FD2A 4G6NA 4WT6A 4FV5A 4KSPA 4ZLYA 3KA0A 3VF9A 4ZTQA 3P7BA 4L68A 3K3IA 4EC9A 2VWVA 4I94A 4TXCA 4YZBA 1YRPA 5EH0A 1YKRA 5CS6A 3JVRA 4AW0A 4YP8A 1FGIA 3H30A 4ZSEA 5I4NA 2JBOA 3IW4A 5HNIX 3QCXA 4KKEA 4E6QA 4MEDA 4I24A 2WMXA 3EKKA 4HVDA 1UKHA 1R1WA 2W5BA 2J51A 3ZSGA 4YJOA 3IW6A 4GW8A 5CEMA 1BMKA 1YWNA 4GU9A 5CU6A 4MBLA 5BMSA 5IH6A 4F1OA 4DA5A 4JXFA 3VAPA 2WMAA 3KK8A 4EUTA 4EZ5A 1E1XA 2VX0A 2X7OA 2V55A 3AXWA 3OBJA 3TG1A 4BY9E 2ZMDA 3VS6A 5EW9A 2Z7QA 4W4VA 3N4VA 1G8AA 4EOKA 2UVXA 3MFUA 1ND4A 3PY1A 3V51A 4QT1A 4QMSA 4E1ZA 3MPAA 4F4PA 3HYHA 4DT9A 2C1AA 3EN7A 3ZHPC 4G1WA 3TCPA 1OPLA 4BC6A 3CLYA 4YZ9A 2JFMA 1BL7A 5DI1A 5GHVA 3GOKA 4L44A 4BWPA 1VYZA 3U4UA 4D5HA 4EJ7A 3Q4ZA 3RPRA 3FLWA 5IUHA 3DBDA 2WPAA 3FYKX 1V0PA 3N4TA 4N57A 3FL5A 4AGWA 4BDIA 3HV6A 4DGGA 5DR6A 2RFDA 4FG7A 2OJGA 4PDYA 2VZ6A 3SG8A 1P4FA 3W55A 4CXAA 5FXRA 4WSYA 1ZARA 2YM3A 3R9NA 3W32A 1LEZA 3QA0A 3O2MA 4JDIA 4YLLA 2W5AA 1UA2A 2OO8X 2HOGA 3MFTA 1PXMA 2JC6A 4IAAA 3TZ8A 3VS1A 2I1MA 1OUKA 5J1VA 4M84A 2Q83A 4R5SA 3FEGA 1JSTA 2W7XA 2JIIA 2B53A 4CT2A 1LP4A 4C59A 5CAUA 4WSQA 2JDVA 2Z7LA 4UZDA 5JQ5A 5K4JA 4MKCA 3RBWA 1TKIA 3NS9A 4OUCA 3RKBA 4O0WA 5ANIA 5FWKK 4YJNA 4AS0A 5C9CA 4BCGA 4XG3A 3LHJA 5HLWA 1O6LA 3N9XA 3NUNA 4DTKA 4WNKA 2PMNX 2IWIA 2PWLA 4RFYA 3LFEA 3MB6A 4U3ZA 3AMBA 2Z2WA 2IVSA 2C3JA 1SNXA 4AXAA 5IUGA 3AD5A 3GT8A 4RQKA 2EB3A 3DFCB 3WZEA 4QMXA 5J9LA 1U5QA 2GTNA 2X4FA 3VVHA 3A7FA 4BIBA 4OTPA 2FVDA 1RQQA 3C4EA 4RVKA 5HHWA 4CKJA 4BDEA 3ORNA 4ANQA 4BRXA 4FT9A 3UIXA 4UMUA 4ZS0A 4HYUA 4KNBA 1E1VA 2WXVA 4E5AX 4H58A 4AE9A 5EI8A 2BZIB 3EQCA 5EM8A 4I5PA 2QU5A 3FMJA 1H08A 3E5AA 4QYHA 5D7AA 3H9OA 5HIDA 5A46A 4IAIA 1W83A 2PVNA 2XNOA 5KX8A 3R7UA 1HCLA 2VUWA 1SM2A 4TTHB 4LOQA 2BAQA 4G2FA 3KCKA 4MWIA 4YC3A 5HNBA 4L7SA 3ZCLA 4GT5A 4J95A 1UNGA 3CKXA 2CLQA 3ZTXA 2WIPA 3QD4A 5EHYA 2WEIA 4M97A 4ANOA 5H8GA 3QU0A 2ITPA 2BROA 3FZTA 5B2KA 2PVKA 4O1OA 3R9DA 4CLIA 3DXQA 3JVSA 5M07A 1URWA 5AV0A 4Y83A 3MH0A 5FBOA 1OGUA 3C4FA 3MYGA 4FTUA 4TKSA 1U54A 4GG7A 3R7OA 1UNLA 3BEGA 5CXZA 5HVKA 2HY0A 5IQGA 2HYYA 3PXYA 3QZGA 3ERKA 3OC1A 3C0HA 4IZ7A 4QQCA 3E92A 4FZDB 1OMWA 2BTRA 1WVXA 1BYGA 4GUEA 2YIYA 4U0IA 1H0WA 2IVUA 3PIXA 3POOA 1GJOA 3OTUA 3P7AA 3HVCA 2ZM3A 3K3JA 4O0XA 3R30A 4TWPA 3BZ3A 5TF9A 4CFWA 4FSQA 2JDTA 4O21A 3GC7A 2OH0E 1WBNA 1H25A 4DGMA 3PG3A 3NYNA 4A9UA 2UW6A 5ANKA 5HICA 2ACXA 2PMIA 1P14A 4F63A 3UC3A 3CQUA 4LOOA 3KMUA 3SW4A 3TNQB 5AUYA 3NAYA 3MI9A 3O23A 2PVJA 3HDNA 4KUJA 3WF6A 4JG6A 2ZV7A 2QCSA 2UZVA 5F9EA 3QF9A 3F7WA 5H8BA 1F5QA 3VUIA 4I6FA 2OK1A 4ZS4A 2WTDA 4G3CA 3MB7A 4TWCA 2XIYA 5DLSA 5H8EA 4O7RA 4BCFA 4EH4A 3IGGA 3M11A 5H9BA 3G90X 4EBVA 5IQIA 4IDVA 4K9YA 5HG5A 4IXPA 4XG7A 3C50A 4DEIA 5KMLA 4FI1A 1BLXA 3OHTA 4FT5A 3G0EA 5LVNA 3EL7A 3WI6A 5DA3A 4OT5A 4J97A 5J95A 2JD5A 4IZYA 5ACKA 3DKGA 4BBMA 1H1QA 1F0QA 5HO7A 3BRBA 5FEDA 4QNAA 2B1PA 2CGUA 5CEIA 3UJGA 3UODA 3ZH8A 4CT1A 1OBDA 2C0OA 3II5A 4IW0A 3FUPA 4XG8A 3OXTA 5TOZA 4DH1A 4IVAA 2Z7RA 4X2KA 5CT0A 3CPBA 3ZRKA 3BYUA 4CRLA 2P55A 4I6HA 2QD9A 3CEKA 4HCUA 3R9RA 3GGFA 3ZO4A 3UNJA 4AN3A 5CF8A 3DKFA 3RNIA 1RW8A 5CU4A 4E4MA 2A27A 5AEPA 5KMKA 5IH4A 2H96A 1SVHA 3F69A 4WNPA 4P7EA 1IASA 3TV6A 4GEOA 3ACKA 2UZEA 3PPJA 3WF9A 4DH8A 1OIUA 3O51A 4S32A 4PDPA 1OZ1A 4P90A 3JY9A 4I5HA 4E93A 3PXRA 3GBZA 5K4IA 1SZMA 2OKRA 1E9HA 2HW6A 4BVUA 3K2LA 4BZOA 3U54A 4FICA 2C68A 4HYSA 4R3PA 5EM7A 4E4XA 3WE4A 3FI8A 4JS8A 4HW7A 4GYGA 4MXAA 3FKLA 4YTHA 5AUWA 3BYMA 3V5TA 3QTUA 4WNOA 4FK6A 4FKIA 2P3GX 4RQVA 4W4XA 5K5XA 3SVVA 2X7GA 2GNFA 5I9VA 4J99A 1XBBA 3MH3A 3KK9A 3DXNA 3QALE 1PYEA 3FMNA 3OUNB 4DFZE 4RIWA 5E7RA 4MD9E 4Y73A 3FQHA 5HQ0A 3TJCA 1YXSA 4CZYB 4HZSA 3DTWA 4TYJA 3PYYA 4O81A 5EQEA 3WZDA 3RK9A 2GPHA 5FQDC 1BX6A 2C6TA 2I7QA 4H36A 5DMZA 4GG5A 4JQ7A 4YSJA 3KRWA 2QOKA 2GS6A 4R6VA 2ZYBA 4IFGA 4HPUE 4DN5A 4KA3A 3PY0A 1Q41A 2GNJA 2G2IA 2B9HA 3LXPA 1SMHA 3UIMA 1H1WA 5E8WA 1J3HA 3NYVA 3UYSA 2XYNA 1K2PA 1BUHA 3DTCA 2F7ZE 1PXOA 3NUUA 4I92A 3U6JA 4FEUA 5AUXA 3FL4A 2C5YA 3EYHA 3MJ2A 3R00A 5LVPA 5AR4A 2XCHA 4JOAA 3SQQA 5CEKA 4YBKA 4MF0A 3ZOSA 4YU2A 1Q3DA 4OTHA 3G6HA 4BICA 1UWHA 3FAAA 2ETRA 2VGOA 3F88A 4LYNA 4ZLZA 1I44A 5JEBA 2YHVA 4EOIA 1REJA 1OL6A 1QCFA 3E87A 3EYGA 2HXLA 4IZ5A 1F3MC 4D2RA 3KMWA 4D4RA 3LMGA 1U5RA 1STCE 5E92A 4ZIMA 5DRBA 4JBVA 1QPDA 3S00A 4R7IA 3P0MA 3QQKA 3COKA 3QX2A 4R1VA 2OGVA 3KXNA 2XCKA 3R8UA 4O2ZA 2QQ7A 1ZWSA 3EN6A 3EQGA 3RM7A 1HOWA 3I60A 4UMPA 3GCUA 1ZRZA 4RZVA 4F64A 4BTMA 3PRIA 3PXQA 1G5SA 2BVAA 3FQEA 4E73A 4C35A 1KE8A 4FZ7A 2WFYA 1YQJA 4LRMA 4ZTMA 2IN6A 3EQFA 3FY0A 3S1HA 4XLVA 3M1SA 3U4WA 3IECA 3ULZA 4GK3A 4ORKA 3U6IA 2WQBA 4H3BA 3RTPA 4CTBA 1KE6A 2J0KA 3CS9A 4L46A 4EWHA 5GIOE 1V0OA 2X1NA 3TTIA 4DBXA 3ZU7A 3GFEA 4FEXA 4RFMA 4AX8A 4HVHA 3TT0A 5IZFA 4K11A 5AX9A 2OJIA 4HGTA 4DH5A 5IQCA 5JMSA 4G5JA 2BFXA 4MHAA 1GOLA 5IKWA 4GIIA 4U7ZA 5HG8A 2UW4A 3I1AA 2F49A 2YEXA 3PSBA 3ZDIA 4K2RA 4JBOA 1YVJA 3EQHA 4YTCA 2QOFA 3QQUA 3IG7A 3T9IA 1VZOA 4QMWA 4MXZA 5CF4A 3LXLA 2BDJA 3CKWA 5LVMA 4XCUA 3O50A 3F61A 5LXMA 2W17A 2UVZA 4RWKA 2J2IB 3JR1A 3D7TB 5HD7A 4NCTC 3H0YA 4PY1A 5AA8A 4YR8A 3E8DA 4QP2A 5ANEA 3C4XA 4FKTA 4M13A 3RCDA 5HX6A 4RIXB 4MD8E 4O22A 2R3NA 3QQJA 3CJFA 4FKJA 5HCYA 2B9IA 1FMOE 4YMJA 2J7TA 3BE9A 4J8MA 2R3MA 3E8CA 3PZHA 3UMWA 4BBEA 4K77A 3ID6C 3Q2JA 2R9SA 3OOGA 3R73A 3GC8A 5EW8A 2P33A 3LIJA 3QWJA 1JKSA 3FXWA 3DJ7A 3EFKA 4IWDA 1XWSA 4IFCA 2E9OA 3R8LA 4NYEA 4O0YA 4FT0A 4NTTA 5KZIA 5EM6A 4W9XA 3PJCA 4YJSA 5J5SA 5KMMA 4FVPA 2JKQA 4FODA 1GZNA 4MQ1A 2QHMA 3RALA 4CCUA 2V7OA 3GVUA 4EK4A 1MRYA 3LVPA 2GQRA 2E9VA 4RVLA 5JT2A 1YDRE 2UW3A 2WTCA 4OTIA 3R7EA 5I9WA 3SXRA 5BVDA 2YAAA 4XOYA 4O0VA 3KXHA 1OKYA 5L8JA 2OICA 3UMXA 4LV5A 3F3TA 4FIGA 4BDCA 1XJDA 2VTTA 2FSTX 3B8QA 4EL9A 2WQMA 3TNPC 4H39A 3HV3A 3P86A 4U79A 4AG8A 2GHLA 3IK3A 5FP6A 3RHKA 2BILB 4BTJA 1YXTA 4CMTA 5LQFA 3E93A 3AGLA 1IG1A 2J0MB 1KE5A 1XHAA 4TYHA 3U51A 3RNYA 3EN5A 5HD4A 3QGYA 2R3PA 4MD7E 4ZEGA 3MV5A 2PYWA 4MXCA 1J91A 5DVRA 4FX3A 4AZEA 2PE2A 5DOSA 1KV1A 4Y5HA 4C36A 5BVEA 3NW6A 5BVFA 4KBAA 3CE3A 3MESA 3R2YA 3BHHA 2C6MA 3F82A 3TKUA 3ZRLA 5KKRC 5M08A 4RRVA 3ORPA 5CVGA 3R83A 4F0FA 5F95A 2ZJWA 1RJBA 4AA0A 2GU8A 1YWVA 3FKOA 1AGWA 4NJ3A 3ZBFA 5E4HA 1YOMA 3PJ1A 3V5LA 5H3QA 5HGIA 3Q96A 4D5KA 2YJRA 2QI8A 4EOLA 2W05A 2NNWB 2WO6A 4RT7A 5LARA 3QHWA 2R3HA 2V7AA 3OZ6A 4X0MA 3E3BX 2Y8OA 3K54A 1M2QA 4YPSA 4LI5A 4BGGA 4GKHA 4KKGA 5HBEA 4R77A 4A4XA 4ACCA 2JAVA 1ATPE 3MTLA 1WBSA 4YZDA 4AE6A 5B2LA 3NNUA 3OWPA 3TM0A 3PE1A 5J7HA 3QRJA 4J7BA 3UZTA 3QKMA 4XLIA 5C8KA 4ERKA 2WD1A 3UQGA 4JVGA 4QPAA 4WRGA 5K3YA 4IB5A 5DN3A 2DS1A 4GS6A 5ETIA 2Z7SA 3KRJA 4BYJA 4EJNA 3V3VA 2OIBA 5J8IA 2FSOX 3BHVA 3WF7A 3OBGA 3D5XA 4FE2A 3AC8A 3KF4A 3PJ3A 5T3QA 4I6QA 1ZMVA 4JG7A 3A99A 3MVMA 1OIQA 4L7FA 3BHYA 2FYSA 4G5PA 4O6EA 4QP7A 5AP3A 3GFWA 3PJ2A 3B8RA 2HCKA 3W2CA 3SA0A 5FEQA 2W99B 5DWRA 2W96B 3CPCA 3KULB 4HJOA 4DCEA 2Y6MA 2YDJA 5IEXA 4EYJA 4NM7A 3NZ0A 5IQDA 1I09A 2GCDA 3LJ2A 3UNZA 4R78A 3F3ZA 4FV1A 5AR7A 3LE6A 4LOPA 2A4LA 3ZRMA 3ZC5A 2VN9A 4KABA 4BBFA 4RIYB 4DCAA 2PK9A 4N6ZA 2J5FA 3EQDA 3BIZA 3CY2A 3GCQA 4XP2A 3TZ7A 2PE1A 1R39A 2C6OA 3IW5A 3PLAE 4DLJA 2G15A 3AT4A 3Q9XA 3OTVA 3TACA 4EWQA 2CNVA 4XEYA 4WHZA 2B55A 2R3RA 4JLCA 4QPSA 4FKQA 4U40A 4ZXTA 3TJDA 3UYTA 3H3CA 3CSVA 4KB8A 2W1GA 4NH1A 3UZRA 5FP5A 5EYCA 3LCKA 3SAYA 3CTQA 5ETFA 2IW9A 5DPVA 4TWOA 3R22A 4IB0A 3D4QA 5CQWA 5FLFA 5T68A 4EHVA 1PYXA 3QYWA 1CKIA 1U54B 2YCRA 4DE4A 3LFFA 5E9EA 2RF9A 4HZRA 3UOLA 1XH8A 3SKCA 1UWJA 2I0YA 3P23A 3NUAA 3OCTA 3A4PA 3R21A 4JL9A 1QPJA 4AZTA 2QOHA 3PIYA 3SOCA 1L8TA 1H1SA 4IB1A 4TYIA 3C4CA 3CQEA 3L8XA 2X6EA 2G01A 5L6OA 4MXXA 5LOHA 3D15A 3MY1A 4PMSA 4U97A 4GJ2A 3T8OA 2P2IA 3GUBA 3H0ZA 5L6WL 3MY5A 3CGFA 2WGJA 5EHLA 5TO8A 5ITAA 5JFSA 4N0SA 3N4UA 5EHOA 3E62A 3BBWA 3VQUA 1Q8TA 4YNEA 5EK7A 5HX8A 4AP7A 1R0PA 3LFAA 4FV2A 4H05A 4G17A 4UBAA 3ATSA 1DS5A 1PMUA 1R78A 3QUDA 4FZFB 4EH5A 4RX7A 1M2RA 2QOIA 5AP4A 3A61A 1GZ8A 2XK7A 4GMYA 3FLNC 4EHZA 5HG7A 2BIKB 2PPQA 5J9ZA 4HGSA 4I3ZA 3DA6A 3HMPA 1YI4A 3IS5A 4LFIA 2J6MA 4UMQA 5M55A 1X8BA 5TKDA 4AT4A 4BCQA 3VBWA 3AMAA 3FMMA 4FTAA 4ZTNA 3R7YA 2RFEA 4LRJA 4FNYA 1JQHA 2ZDUA 4O0SA 3EIDA 3FKNA 3U87A 3GQLA 1UVRA 3LKMA 4PDOA 4F70A 2OF4A 4RJ5A 4W4YA 3C4WA 5EYKA 3ZLYA 4C02A 4RX8A 5EQYA 3FMDA 2C30A 4CFFA 3HKOA 1ZLTA 4RVMA 5CWZA 3LOKA 4FSZA 4KBCA 4HGEA 3BLHA 3AOXA 4O0UA 4BWXA 3VRZA 4EOSA 5JRSA 5AUUA 4ZY4A 4YO6A 1OUYA 2C0IA 1YHVA 5HCXA 2F4JA 2W1HA 3ALOA 3RAWA 3WOWA 3ZM4A 3ZMMA 1ZY4A 3R2BA 2IO6A 2PVYA 4IACA 4IHPA 1JKTA 2VTIA 4EK8A 3AGMA 3MA3A 4FEQA 1HCKA 5E8UA 4FK3A 2ZOQA 3I5NA 5AAFA 4Z3VA 2VTLA 3V6RA 1PY5A 4NSTA 3S95A 3FMLA 2GNLA 5I5ZA 5DT0A 3DGKA 2OIDA 4F9YA 4YPDA 5HE0A 4APCA 2YDKA 4A9YA 1ZOHA 2X6DA 3QQFA 3VQHA 2H6DA 4V0GA 4O7ZA 2QG5A 3GCSA 5ANOA 1S9IA 5JK3A 4MCVA 1TVOA 3NEWA 4FV3A 3Q9ZA 3QA8A 4DFYA 1ZOEA 2XKDA 4PL3A 4TNBA 4OAVB 2FA2A 3L8SA 4FSRA 4RIWB 3D83A 2I0VA 3AC2A 2R7BA 3NNXA 3ZLWA 4AN9A 3UO6A 3ENMA 5D11A 4LGGA 4F7NA 4OTWA 4TL0A 4EKLA 3NX8A 2I0EA 4I0SA 5J87A 4EYMA 4CGAA 2BPMA 2X39A 4GUBA 3DK7A 3ODZX 1DAYA 3EN4A 4Z7GA 3UGCA 2VTJA 4B8LA 4BHZA 2UZDA 3TV7A 5K5NA 3OW4A 3VW6A 3UP7A 4L3JA 5D9HA 5FDPA 4M68A 4FUXA 3GXLA 5BQ0A 2W4KA 4MNEA 5CSPA 4BDJA 3O17A 5CI7A 4RVTA 4BKJA 5DR9A 3W2SA 2RSVA 4AGCA 4F0IA 4QQ5A 3KRRA 1OITA 1MQ4A 4K6ZA 4G9RA 3I7BA 3DT1A 3FC2A 4KAOA 4LG4A 4NEUA 2QO2A 3DJ5A 4RPVA 1CMKE 4O0RA 2O5KA 3ZO3A 5CF6A 4UMTA 3F2AA 4R3CA 4C61A 4YC6A 2VO7A 5M44A 4FEWA 2EVAA 2W4OA 2YABA 3IOKA 4WA9A 4Y85A 1APME 2YITA 3RGFA 3BKBA 4X6RA 4EHEA 4QMQA 3IOPA 4FIEA 3UOHA 4OBOA 4YJTA 3GC0A 3OCBA 4G9CA 1CTPE 3VBQA 3E7VA 4EONA 4HGLA 1J7IA 3RCJA 1T46A 3EOCA 2E9UA 1Q3WA 2Q0BA 1KOBA 4UB7A 3FE3A 4HPTE 4ZTRA 3RPOA 4EEVA 5M4CA 4KIKA 5CU2A 2QC6A 3BQCA 3QCYA 3LFCA 5AAEA 3R8MA 4R5YA 2PHKA 1K9AA 5IA4A 4R7BA 2QR8A 4WD5A 2C6LA 3NRMA 5HESA 4EZ7A 2GHMA 4Q9ZA 2IPXA 3SC1A 3FI2A 4C3FA 1XO2B 3P1AA 5A9UA 3MW1A 3OCGA 3VUMA 2WTWA 4E6CA 3NWWA 4ZOGA 2W5HA 3R9HA 4M69B 1OKWA 4EH3A 2WAJA 4F9AA 4UX9A 3PA5A 2JGZA 4M15A 4NKSA 3VUHA 3OEZA 3QTRA 3FDNA 3CXWA 3ZEPA
chains in the Genus database with same CATH superfamily
4M67A 4D4VA 4Z7HA 2YCQA 4RA5A 1XMMA 3SDJA 4WO5A 2XNMA 4BDFA 1H1RA 2CNQA 1XR1A 4APPA 4IIRA 3O8UA 4YC8A 4F65A 2DWBA 3CIKA 3K5UA 4HCVA 4L3LA 3W0OA 3BWJA 1Z5MA 5JRQA 4PMTA 3CQWA 2WIHA 3DOGA 4FT3A 3C5IA 5M09A 3NW7A 4ASXA 5CTPA 1SVGA 4AOIA 4IEBA 3AC1A 4ZJVA 1Q8UA 3SXFA 3HAVA 2X4ZA 3C9WA 5IA3A 5AUZA 4QOXA 3Q5IA 3FMEA 4BN1A 3QC4A 3W8LA 3RAKA 1SNUA 3BELA 4DHFA 2Y4IC 3LFBA 2WMWA 4IM3A 1W2CA 2XMYA 2C5XA 2HENA 2JITA 5DYJA 5HG9A 5I3RA 1MP8A 1NW1A 2VNYA 4D0XA 5AV1A 3KRXA 3BCEA 1H26A 1TQMA 4AOTA 5E90A 3QXPA 1OIYA 2V22A 3TNWA 2H8HA 3TXOA 4Y72A 2ZB1A 4QMTA 1JPAA 3UVQA 1PXKA 5HE1A 2VTNA 4U8ZA 5JZNA 3HV4A 4F99A 3KEXA 5AV3A 3NYOA 4FSWA 3AT2A 4TYGA 3LM0A 2E9PA 4ENYA 2Y4IB 2XUUA 4ZSGA 3W2PA 4UMRA 4Q5HA 4KRDA 5CSVA 5TR6A 1XBCA 1Y6BA 3QZHA 4R1YA 2YM6A 4AU8A 1Q24A 3HV5A 2ZM1A 4KSQA 1VJYA 2PE0A 4BIDA 2AUHA 4DG0E 3FLSA 2QHNA 4IC7A 1PKGA 1SYKA 4GT4A 3Q9WA 4ZY5A 3KC3A 2WQEA 3O7LD 4F7LA 2REIA 4XOZA 3HA6A 3DS6A 4NZWB 3DQXA 5BUIA 4PF4A 2F57A 3GQIA 4CNHA 4ZSLA 3VBTA 5ANGA 4I6BA 1L3RE 3VIDA 3LCOA 4ZSJA 1YW2A 4Z55A 2ESMA 5DNRA 4XP3A 1Z57A 5BX0A 5AM7A 4QNYA 4XBRA 3D0EA 4G3EA 4MTAA 4ZMFA 4X3FC 2PMLX 2OFUA 5IA0A 2HZIA 4QMMA 3P08A 1H0VA 5A54A 5IQEA 4E8AA 1BI7A 4V01A 5BYZA 2V62A 4JBQA 4E26A 4TYHB 4EH6A 5J9YA 4KBKA 4CCBA 3MIAA 3C0IA 4I0TA 4C7TA 1JBPE 5E1SA 4PTEA 2YLEA 5BYYA 3MPMA 3W10A 2VWZA 3FZSA 1GZOA 2OJJA 2UW0A 3E64A 4FTOA 4I21A 2C6KA 3U9NA 4XJ0A 4BTKA 3LM5A 1JSVA 1GIJA 2GQGA 3BU3A 1ZYDA 4EBWA 4D58A 5B7VA 4FTMA 4FVRA 3L9MA 4X3FB 3F5GA 4Y8DA 2VTQA 3WARA 1YOJA 4CQEA 4C4EA 3ZZWA 3Q4TA 2E2BA 4YGAA 3PFQA 3HMOA 3ODYX 3Q6UA 5AP5A 3ZLXA 1YOLA 4QTEA 2EXMA 1PKDA 3DDPA 4YJUA 3W33A 1WZYA 2YIXA 4UWYA 5CQUA 4BGQA 5BMMA 4CFXA 4L43A 5HE2A 1W2FA 3PA3A 5D1JA 1IR3A 2HWPA 1PMEA 4PWNA 1M17A 5AIKA 4W8DA 3LXNA 5L8KA 4I22A 1JVPP 2ERZE 4WG4A 3UOKA 4BDHA 4F6WA 2WQNA 4FKWA 1Y6AA 1NY3A 2CHLA 3ZSHA 2PTKA 2QOBA 2O0UA 2YWPA 2BMCA 2UZBA 4C4GA 4F09A 4NJDA 4RMZA 2F2CB 3O8PA 3OFMA 5DT4A 4DDIA 2Y0AA 4W8EA 2JDOA 2R2PA 3DY7A 4AZSA 4FR4A 4FV4A 2JDSA 3VBVA 4F08A 4D2VA 4OAUC 3VS5A 4IMYA 1VLRA 2XEZA 3P5KA 3SLSA 3ZC6A 5LVOA 2C69A 1P2AA 4IZAA 1FQ1B 4WOVA 5AMNA 4AGUA 2VTRA 1MQBA 3UE4A 4O86A 2CGVA 3Q4UA 4FV0A 2XP2A 4FYNA 2YFXA 5KMNA 4S33A 5D10A 2QOOA 2XS0A 3FMHA 4X2JA 3ZDUA 3KU2A 4GH2A 1B39A 4ASEA 4YLJA 2YA9A 3RK7A 4WBOA 3LCTA 1XH5A 3UDBA 4USEA 4WG5A 2E9NA 2B52A 3MIYA 3F3VA 2C6EA 3DCVA 4DYMA 4J96A 3OG7A 3O0GA 3KXZA 4E7WA 4ANBA 4FV6A 3AKJA 3F9NA 3TN8A 2RKUA 4QTCA 4WBBB 1AQ1A 4GCJA 5HNGA 3REPA 3UVPA 4JX7A 2UW5A 5KBRA 3O71A 2ONLA 5HO6A 3B2WA 2OIQA 3QZFA 3V6SA 1PXIA 3C4ZA 4NL0A 3VUTA 4FTNA 2IVVA 3UPXA 5JH6A 5EYDA 5CAOA 4DG3E 3AD6A 3OVVA 4DEGA 5D7VA 4ZLOA 4S2ZA 4E4NA 1IA8A 4ARKA 3MBLA 2B54A 4NTSA 3DDQA 5AM6A 4XV1A 2IW6A 4PNIA 2BZJA 2A2AA 1P5EA 2C6IA 2I40A 4KWPA 4AW2A 2GNGA 5EYMA 4UN0C 5KUPA 2XEYA 5KBQA 1ZXEA 3R63A 2ITWA 4QTBA 4CV9A 2VNWA 4USFA 3THBA 2YISA 1XQZA 4IVDA 3QTSA 3BU5A 3QTZA 3FJQE 3V5QA 3VWAA 5ANDA 4IADA 3VS3A 4MYGA 2QLUA 3JUHA 4D28A 4QRCA 3DKOA 3GENA 1W98A 2OWBA 3EFWA 4EK5A 3PSCA 3OOMA 5EOLA 2GS7A 5IUIA 1FBNA 4IJ9A 4KD1A 4YLKA 5GZ9A 4ASZA 4UZHA 4OBQA 3OY3A 4JX3A 3JS2A 2X8DA 4NWMA 2UZOA 4FKUA 4CMUA 5AWMA 2WMSA 3CD8A 4RJ4A 4WUAA 3R28A 4EK6A 2Q0NA 2GTMA 1PRYA 3I6WA 4Z9LA 2Z60A 4UXQA 4WG3A 5IPJA 4AZVA 4FGBA 4A9TA 3R01A 1XH6A 4H3QA 2WMVA 2IG7A 1YI3A 3RZBA 3F66A 2O64A 4P4CA 4E20A 3R7VA 3SG9A 3KMMA 1QL6A 3DQWA 2BR1A 3FC1X 4M12A 3RAHA 4DG2E 1TQPA 4A9SA 3ITZA 3RPYA 4MWHA 4NUSA 5A6NA 4MH7A 4P5ZA 4BCNA 4WKQA 3M2WA 4LM5A 3FZRA 3E8EA 5C8MA 3FLZA 2YAKA 3WF5A 3NMUF 3FMKA 3QD3A 5DHJA 2GDOA 5IQBA 4LL5A 2R3GA 3ACJA 4FKSA 4IAYA 2ZV8A 5HIBA 4BDGA 4AQCA 4CD0A 3C1XA 3C7QA 4FTLA 4O96A 4BKYA 2UW9A 2OXDA 2F7XE 5CAVA 3ZUTA 3DLSA 1KSWA 2P4IA 5BV3A 2VTHA 3FQSA 4MQ2A 4KS8A 2HY81 3IQ7A 5CSXA 2YWVA 1Q5KA 3BI6A 3R1SA 4AAAA 2RG6A 3OUKA 3VHEA 4GSBA 3BGPA 2JLDA 4U81A 2ITZA 4NFNA 1QPCA 3L9NA 5DGZA 5DEYA 3VONA 4PL4A 4LUDA 5ETAA 1ZYSA 3H10A 1W8CA 3UP2A 3WYYA 3SW7A 4OTRA 4B7TA 2OZOA 3DNDA 3IW8A 3PVGA 4V0GB 4L45A 4TWNA 4C2WA 4FSMA 4GVAA 4AUAA 3OP5A 5AADA 3HL7A 4XRLA 1J7LA 2PZ5A 2VTMA 3P4KA 5BUJA 5DT3A 2WZJA 2WOTA 5GINE 3A7JA 2CGXA 3OF0A 4DAWA 2BALA 4FKGA 4MX9A 3VNTA 4DEAA 3NDMA 5F4NA 3QTIA 4JQEA 2C5VA 2R3IA 2IF8A 2OXYA 3V01A 4FV7A 4BJJA 2CN8A 2R64A 4NFMA 5TT7A 4C38A 2YLFA 2R3LA 3FY2A 1V0BA 4BZDA 4GKIA 4YHJA 3QYZA 4XG2A 3I4BA 1W7HA 2EB2A 3T3VA 5CEPA 2OLCA 3HRCA 2OSCA 3BHUA 4C4FA 4FIHA 4HCTA 3W8QA 2CKQA 4NKAA 2PZIA 1YHWA 3PE2A 4W9WA 2I6LA 4WUNA 4I5MA 1O6KA 4IAFA 5AP6A 1H01A 1J1BA 3A60A 4RJ3A 4FIIA 3RAIA 3ZO2A 5CU3A 3G6GA 4BI0A 3G9NA 4F1MA 2R3JA 3CP9A 3QQLA 2BAKA 2FGIA 4DHZA 1U59A 2A19B 1RE8A 1GY3A 1TZDA 3IONA 5JQ8A 2YIQA 2QOLA 2O65A 4BDDA 3DBFA 3HLLA 4PPBA 3ULIA 4EHGA 3WIKA 5TE0A 4BDBA 4D2SA 4J1RA 1GAGA 2JDRA 3FSFA 3RWQA 2PVFA 3G51A 1W2DA 3ENHA 1M52A 4G34A 4LGHA 3R8VA 2WTKC 1NT2A 3LAUA 4L8MA 4FEVA 3UDZA 2VTOA 1WBWA 4PMPA 1ZMWA 1CM8A 3L8VA 4W4WA 3TKHA 1JKLA 4IH8A 3G2FA 1R0EA 4G6OA 2IW8A 4OGRA 5GJDA 5IQFA 3MY0A 3PXZA 3F5UA 5KNJA 2KULA 4XMOA 3U55A 3AC5A 3F5PA 2QKRA 4OLIA 4CRSA 1VR2A 2VTPA 5JGBA 2WEVA 3PY3A 4S30A 1YHSA 3V8WA 4Q9SA 1GIHA 3LW0A 3OCSA 5AJQA 4FTIA 2X2LA 3W2QA 3DZQA 4XS2A 1DI9A 3UO5A 2B9FA 2F2UA 2WTKB 3C51A 3FLYA 5BUEA 2AC3A 1PW2A 3A7IA 3VS7A 5I0BA 5DFPA 4RZWA 4RSSA 1UU3A 4GK4A 3TKIA 4AZFA 2VX3A 3E3PA 1WCCA 2DQ7X 5GJGA 3MPTA 4MNFA 3OD6X 3QX4A 1PHKA 2EWAA 3E63A 3NYXA 4BI1A 5KO1A 5J1WA 1NVQA 2JKOA 2Z02A 4XHKB 2XF0A 5FM3A 3LFSA 2X0GA 5LCKA 4FL2A 2XIXA 4FF8A 4QMUA 5FTOA 2RFSA 3ZUUA 4C3PA 5HIEA 4FGRA 4AAYA 3NNVA 4RLKA 4ZAUA 4UEUA 4AW5A 4ENXA 1FMKA 2PSQA 4ZJIA 3VHKA 3ZONA 4BGHA 1IRKA 2WTJA 2ZMCA 3MFRA 4H1MA 3UQFA 1WBVA 5EDQA 2X7FA 3UBDA 1OPKA 2XJ2A 4XRJA 2J4ZA 2OJFE 2ITYA 2W9ZB 4FBXA 4HYIA 4JAJA 4CKIA 4F6UA 3P78A 3PXFA 2UW7A 2VWXA 3FZ1A 5KE0A 5AP2A 3GU5A 2WMBA 4L00A 4FG9A 5C8NA 3NFFB 3NAXA 3T3UA 3VULA 4AA5A 4DBNA 5CASA 3KVXA 2W0JA 2VO6A 4E5WA 4LDTA 1W0XC 2X8EA 3F7ZA 5F94A 1YDSE 3NIZA 5HCZA 5HKMA 4F9BA 3ZM9A 4J98A 4QD6A 3UDSA 3PPKA 1OL5A 3A2CA 4YHFA 2LAVA 3TI1A 1Q61A 3JPVA 3Q52A 5LMKA 2RFNA 1JKKA 3D2KA 3KCFA 3N51A 3FZPA 3ZLSA 3W0NA 4A4LA 4H1JA 4IB3A 3FBVA 5I9UA 3SHEA 4OTFA 3D9VA 5BVKA 4HNIA 4U9AA 4EQMA 1BL6A 4ONAA 2X9FA 4D1ZA 5JSMA 3VS4A 3NVKI 3AT3A 5CZHA 4ZZNA 5IDNA 3FI4A 1FINA 4FTTA 1SVEA 3UPZA 5GNKA 5KMJA 3PA4A 5I3OA 4MF1A 4LV8A 3AQVA 3BBTB 3KB7A 2WMRA 3VS0A 2PY3A 1WAKA 2HELA 4PTCA 4TN6A 5AP1A 2ETKA 3ORXA 5DBXA 3F6XA 2BUJA 5A3XA 2BIYA 2XRUA 2YZLA 3DB8A 1GZKA 4BF2A 4O83A 3GU4A 2XK3A 2QOQA 5LJJA 3DXPA 3EQRA 4JRVA 2BKZA 3ZO1A 1IA9A 1Y8YA 4ZTHA 1IAHA 2YM5A 2XM9A 4QMVA 3V5WA 4WIHA 5IMEA 5J7BA 5JFWA 3HAMA 2R0IA 4M14A 2WMUA 4X7QA 4S31A 4JNWA 2VWBA 4D1SA 2ZFYA 4R7HA 4F1TA 4N70A 2R3OA 4QMNA 3NPCA 3SX9A 4O7YA 3Q32A 3PVUA 3TNHA 2FUMA 4X2NA 1WFCA 3Q6WA 2CCHA 3NUYA 2YDIA 1REKA 2H9VA 2W1DA 5ANJA 4XG6A 2DYLA 3PVBA 4M66A 3ZBXA 4D4YA 3RPVA 5AUVA 3ZYAA 2GNIA 2PVRA 4C0TA 4GYIA 1ERKA 3ORIA 4I1ZA 3UOJA 4O7VA 3IO7A 3WYXA 2XH5A 3EJ1A 3TV4A 4U42A 4ANNA 1FVRA 1UU7A 4GIHA 4PV0A 2QVSE 4TNDA 4FA2A 5AR5A 3QTQA 2Y4PA 3KQ7A 2GMXA 4O7TA 4LQMA 4RG0A 3OMVA 3OY1A 2R0UA 4ZP5A 4BCOA 4BI2A 4UALA 4QYYA 2BZKB 2VGPA 3MS9A 3VO3A 3S2PA 5GZ8A 4I41A 5C03A 3O8TA 4QP3A 4ZZMA 3BV3A 4J52A 2QO7A 2QOCA 3BX5A 5AP7A 4EKKA 3KXMA 5A14A 5EQPA 5F1ZA 5IA1A 4Q2AA 2OBJA 3EZRA 3UG1A 5LMBA 3NSZA 4IX4A 1OKZA 4FC0A 5AFVA 2C1BA 3L9LA 2ITTA 3CCNA 2UZUE 3HGKA 3OWLA 1IAJA 2XBJA 3FPMA 3PSDA 4UWBA 3WILA 3ZFXA 4I4EA 1H27A 4YSMA 3EFJA 3D7TA 4CV8A 4ZSAA 5CVFA 3DAEA 2PUNA 3IW7A 4A7CA 4UXLA 4EOJA 3PIZA 4YZNA 3TL8A 4AW1A 5HU9A 2UZTA 3F3UA 2CLXA 3VBYA 1UKIA 4CFVA 1H1PA 2W1ZA 2PZYA 1OL7A 4DEEA 1A06A 2ITUA 2R3FA 4C58A 3ALNA 3GC9A 3I81A 3R0TA 5M51A 3MSSA 3BL9A 2J9MA 3A8XA 2QODA 5FXSA 2X8IA 2YIRA 4EORA 2CGWA 4ZMEA 3KXXA 4NM3A 2WKMA 5K0KA 5CALA 5JZJA 1B38A 1OL1A 3OW3A 2A0CX 4EOOA 1WVYA 4NCTA 1W82A 3QRUA 4FV9A 2X2MA 4F6SA 2IJMA 5EDRA 1GIIA 4UYNA 3GCPA 3ZXZA 3ZFMA 2C6DA 2ITQA 4TZRA 1YXVA 3PG1A 3HEGA 3BQRA 4IC8A 1UU8A 1CSNA 4JDJA 4XNEA 4ZK5A 5T6KA 5KZ0A 4YTFA 2CNUA 3S0OA 4LL0A 1IEPA 4QMYA 4FKPA 2VU3A 2IZSA 2UW8A 4PPCA 4E4LA 4B6LA 4CKRA 4DFNA 2ETMA 2UZNA 5AV2A 4CVAA 5IISA 2XANA 3H9RA 2PUIA 2YERA 3TZ9A 2EXCX 5CEOA 5IF1A 5H2UA 5D41A 4AFEA 4OBPA 3UZPA 4LV7A 3Q9YA 4CYIA 2YCSA 2WB8A 4QTAA 4BHNA 2XNEA 4CFNA 4FIJA 3TEIA 4XH6A 5DEWA 3IDBA 4TRLA 4FNXA 3I7CA 1OECA 1KUTA 3QGWA 3L9PA 5K9IA 4QMZA 2QO9A 2C5OA 5HBJA 3QFVA 1R3CA 4IAZA 4G31A 1XKKA 2WNTA 5IEVA 4KRCA 4DTBA 4FSNA 2CPKE 2VWUA 3CTJA 5ACBC 4F7JA 1PMVA 2VAGA 3KF7A 3MH1A 4FNWA 4ANMA 3QQHA 4Q5EA 1XMLA 5EOBA 2EUFB 4J71A 5L8LA 4II5A 1ZAOA 3O96A 3NNWA 2VO0A 3LJ0A 1A9UA 3MTFA 4BYIA 1Z9XA 4ACMA 4IANA 5K0XA 5FXQA 4CQGA 3AD4A 3BLAA 3MJ1A 2W1IA 3EQBA 4FZAB 4AGDA 1JOWB 2RGPA 3QKLA 2UZWE 3EZVA 2VRXA 4DH7A 4ZZOA 1JSUA 5DH3A 3ORTA 4I5CA 3EQIA 4GFMA 4DLIA 5CT7A 3IKAA 4K1BA 3QLFA 5JFVA 3DV3A 4M8TA 4DINA 4YNOA 3AMYA 3ET7A 4TPTA 2YJSA 4HVSA 2A98A 4EQCA 2IVTA 3BGQA 4GU6A 2QNJA 4U44A 1UU9A 2J90A 4FUYA 3I0OA 4AN2A 4EH9A 3LQ5A 3W2OA 3QD0A 4BZNA 4BFMA 2OF2A 2PVMA 4D4SA 3MFSA 3QCQA 1H28A 3G33A 3QKKA 3PRFA 1Q8WA 4C34A 3QC9A 3GEQA 4EOPA 1WMKA 2CSNA 2XNPA 3Q53A 4RJ6A 5JGDA 2PL0A 4HYHA 4PL5A 4RGJA 4AT5A 4JT3A 4JIAA 3H9FA 3IGOA 4KKHA 4GFGA 1H07A 2RG5A 3LQ3A 3B2TA 4G3FA 3H4JA 4MK0A 4RC2A 1PF8A 4NIFA 5CENA 5LCJA 4CG9A 1KE9A 2HK5A 4GV1A 3RMFA 4IWPA 4AA4A 4JI9A 3QTXA 4Y5QA 4CMOA 3GB2A 2C0TA 2CN5A 5A4CA 2OZAA 3D94A 5HEZA 5LVLA 5L2SA 3CGOA 4JR7A 3R7IA 3QL8A 4CLJA 3QZIA 2VO3A 3OXIA 4DHJA 3KULA 3D7ZA 2ZV9A 4Z16A 2IZRA 4B0GA 5L2TA 4NT4A 3PZEA 2JBPA 3R7GA 4ITIA 3I6UA 2X9EA 3DU8A 4TT7A 3T9TA 4TYEA 4EH7A 4AXDA 3HUBA 2B9JA 5IQHA 4FMQA 4O38A 4DHIB 4QP1A 5FRIA 4RIYA 3MWUA 4FKOA 4HNFA 5HI2A 4DF3A 5B2MA 1Y91A 1J1CA 3HP5A 4YUQA 1ZYJA 2ZV2A 3D5VA 3DNEA 4OW8A 4QP4A 3TIZA 3SD0A 3D14A 4PP7A 1WBOA 3LFQA 4PNKA 3ROYA 2CDZA 5HO8A 3MH2A 1J7UA 2BCJA 4BKZA 5BNJA 3DFAA 1U4DA 1TQIA 3G0FA 3GU7A 4IBMA 1G8SA 2XVDA 3V8TA 2JIVA 2RL5A 4C62A 3EKNA 4LGDA 3SRVA 5C4LA 3Q2MA 5KHWA 4EOMA 2XKCA 4QO9A 4JR3A 4RWJA 4TY1A 5EM5A 4A06A 2HZ4A 2CJMA 3EHAA 3QTWA 4QMLA 3VUKA 2BDWA 4EH8A 3ZZEA 2ZB0A 3QRKA 4ZTLA 4YJVA 2ITVA 3QHRA 5AP0A 3CBLA 1UV5A 3EB0A 3LCSA 4QP8A 4NM0A 4A9RA 4EUUA 5AA9A 2JKKA 3MDYA 4RX5A 4CYJA 4EI4A 2AC5A 2Y7JA 3KN5A 3WIGA 5E1EA 4DITA 2W1CA 3LLTA 3LMHA 2XZSA 3PWDA 3QAME 3I79A 3ORMA 1NXKA 3TIYA 3RJCA 3HMMA 2OI4X 5M06A 2AYPA 2G2HA 3Q4CA 3UTOA 4IAKA 4ZJJA 4USDA 4ERWA 4F9WA 2PUPA 4O0TA 4RFZA 3F2RA 4V05A 4M0ZA 4QQJA 4AXCA 3W18A 2XKEA 1YI6A 3RWPA 1OI9A 1O6YA 2PZPA 4BWKA 5JFXA 1M14A 3A4OX 3QRTA 4H3PA 4JG8A 1Q62A 3E88A 4X21A 1ZYLA 1Q8YA 2BRGA 4U5JA 3UIBA 5IG1A 3Q5ZA 4G3GA 4ALVA 4L67A 1LR4A 2GHGA 3D2IA 3R71A 3VRYA 1MRUA 1MUOA 5AR2A 4FTKA 2YM7A 4QYEA 3TZMA 2VV9A 4S34A 2EU9A 4I0RA 4L3PA 4D2PA 5AAGA 1JAMA 4FOBA 4JAIA 4CTCA 5E8TA 3ZSIA 2QG7A 4D2WA 3DBQA 4U3YA 4QPMA 3NR9A 3ELJA 2WMTA 5FTGA 5JN2A 3QUPA 5CZIA 3BYVA 3BWFA 4FSUA 4PTGA 2HZNA 2OJ9A 3CC6A 2QR7A 3TTJA 5HU3A 3S4QA 5CAPA 3WZKA 3OS3A 1CKJA 3CY3A 2HXQA 4AACA 2J0IA 4CEGA 3D5UA 1P4OA 4MXYA 4QMPA 4Y95A 4PPAA 4GFOA 3GU6A 3DJ6A 4KINA 3HA8A 4IM0A 2XIRA 4FIFA 3LLAA 4K8AA 5IMXA 3KL8A 4EK3A 4RC3A 5LMKC 4EC8A 3ANRA 2YCFA 3RM6A 2PMOX 4YBJA 3QCSA 3KN6A 4FVQA 5CANA 3C13A 2BHEA 3TUDA 3CD3A 4YJQA 4PMMA 1JLUE 5I9YA 4GK2A 2G2FA 3DK3A 2FO0A 4UV0A 4AF3A 4BCIA 4A4OA 4DFUA 2XM8A 2DUVA 4B4LA 4JIKA 2WMQA 1QPEA 4RA4A 5A4TA 2YM8A 1ZYCA 2ZAZA 3ZUVA 3V8SA 5A6OA 2XNBA 5CU0A 3DLZA 4KS7A 4ITHA 3NUXA 4KIOA 4RWLA 4U80A 3OT3A 5C27A 4O7LA 3LMIA 3GCVA 2WOUA 3LCDA 5EDPA 4ID7A 4YJRA 4XBUA 1NVRA 2XK4A 3L8PA 5A4LA 1Q8ZA 1ZOGA 2XNGA 3AG9A 1TFFA 2CKOA 5M56A 1OB3A 4IX3A 4C2VA 2X2KA 3VW8A 1XH7A 3KKVA 4PDSA 5EKOA 3OROA 2IZTA 4L53A 2OH4A 1FOTA 2O8YA 3KIOC 3ATTA 3NUSA 3FHRA 3NIEA 3A7GA 1KOAA 3MVJA 5HZNA 4PRJA 3W0QA 2VTAA 4FKVA 3JXWA 5EI6A 1OPJA 4EOQA 3MGYA 4YO4A 1Y57A 5E8XA 3C0GA 3QQGA 3UQCA 2CCIA 4WRSA 1KE7A 3QUEA 2VTSA 5CSHA 2NP8A 2WQOA 4UYAA 2I0HA 3R1NA 1YWRA 2FB8A 5KCVA 2UVYA 3U6HA 4LUEA 5M4FA 3V04A 5DE2A 4C8BA 4I23A 5L6PA 3Q60A 5E91A 4O4CA 3P5JC 2R5TA 4O27B 3FYJX 2WHBA 2X81A 3BLRA 1M7NA 2XJ1A 2PZRA 3AC3A 3LZBA 5CLPA 5CX9A 4QQTA 1CKPA 4R8QA 3DAJA 3HX4A 5CNOA 2BRBA 1ZZLA 4O4FA 2BZHB 3W0PA 2XIZA 2YIWA 3MN3A 4YHTA 3FXZA 2PU8A 4RJ8A 2XK8A 3TDVA 2GQSA 1YXUA 2P2HA 5CI6A 2OG8A 2OU7A 3PTGA 4HVGA 4DFLA 3WZUA 4D55A 2J5EA 2W06A 5FUTA 3TUBA 4BR3A 2J0LA 4IJPA 3JYAA 5KMIA 1DM2A 5AIRA 4N6YA 4A07A 4LMUA 1H00A 3POZA 4IX6A 3SXSA 4M69A 3W1FA 4RWIA 4ASDA 3CJGA 5HVYA 3WZJA 4JRNA 4UY9A 3A62A 5D12A 3TNIA 4CSVA 4DEHA 3DKCA 4O84A 3GNIB 4K0YA 5F20A 3IDCA 5BVWA 4RLLA 4BCJA 3V5PA 4IDTA 4BCMA 3C5UA 4DTAA 2PVLA 2BRMA 4FG8A 5HORA 5GIPE 5E8ZA 3RZFA 4CZUA 1YXXA 4G6LA 5KMOA 3ORLA 4BDAA 5EW3A 4DGLC 2XRWA 4EZ3A 4XP0A 5BYLA 2ERKA 2G9XA 3PP1A 3COIA 3ZFYA 4E5BA 4QP9A 2R4BA 3R8PA 1PXJA 2GFSA 3ORKA 1Q4LA 3I0QA 1JWHA 2FH9A 4M3QA 4FKRA 3LPBA 4OT6A 4RIOA 4XV9A 1S9JA 3CR0A 2G1TA 3HZTA 3LQ8A 5AR8A 3NVMB 3GI3A 2UUEA 4G3DA 2O63A 4JBPA 5I9ZA 4M0YA 4IE9A 3HP2A 2WU6A 5C01A 4QYFA 2BAJA 3FLQA 3EN9A 5FGKA 2YZAA 4AOJA 3LJ1A 4X3JA 4E6AA 3F2NA 5EKNA 5KHXA 3UG2A 3EFLA 3HRFA 4C4HA 3KGAA 3DAKA 5HVJA 4P2KA 2GS2A 1M7QA 3V5JA 3FV8A 3E8NA 2XK6A 4YJPA 4EQUA 3ANQA 3RP9A 2XIKA 5CYIA 2YM4A 3ROCA 5AV4A 1WBTA 3RINA 1CDKA 4TW9A 4DFXE 2RIOA 5HTCA 5LWMA 4U41A 4R3RA 4BCKA 5FM2A 2YACA 2F7EE 4BL1A 3UNKA 4G16A 3KFAA 3SOAA 5L2QA 4XUFA 3NW5A 2HWOA 4K18A 1PMNA 2CMWA 3FPQA 1RDQE 4OR5A 3VF8A 2FSLX 3OWKA 4IX5A 4IQ6A 4K33A 4NK9A 3BU6A 4CFUA 4HVIA 1WVWA 3HUCA 2VWYA 4RX9A 1VYWA 3DZOA 5GZAA 2C3IB 3NUPA 2XJ0A 3PLSA 4MNEB 2QONA 5DRDA 3GP0A 5HE3A 3LXKA 4F7SA 4HOKA 2NRYA 2UV2A 4D9TA 4DGOA 2R7IA 1DAWA 2WTVA 3KREA 4GT3A 3MVLA 4FTJA 4ACGA 4DGNA 2SRCA 2WU7A 3P79A 2NRUA 1NVSA 1O9UA 2OXXA 3CTHA 3PUPA 4N4SA 5CVHA 4D1XA 1Q97A 1FPUA 4ZTSA 4FJVA 4GVJA 4IVCA 4BCHA 4J53A 5HTBA 1H24A 3PWYA 4U6RA 5BPYA 2ZDTA 3HDMA 3TUCA 3VC4A 2VWWA 4GL9A 3HMIA 3R6XA 4O2PA 2ITNA 4XYFA 2JEDA 4AWIA 4E3CA 5IA2A 3R9OA 4ACHA