5KX8A

Irak4-inhibitor co-structure
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
297
structure length
285
Chain Sequence
b'TRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLATTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEVMRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 receptor-associated kinase 4
publication title Efforts towards the optimization of a bi-aryl class of potent IRAK4 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 98
structure length 285
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5kx8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5kx8A01
5CT7A 5FP5A 5HIBA 2GPHA 4FICA 4QNAA 2WU7A 4ORKA 3PE1A 3A7HA 1ZARA 4K8AA 3SXSA 3LFCA 4CGAA 4M67A 1XQZA 2EXEA 4BCJA 3HV7A 3SG8A 2XKFA 4Y5QA 2J0MB 2C5VA 4OR5A 4KIQA 1H0VA 4U8ZA 5EOLA 4L8MA 4C4FA 2R3IA 3UIMA 2ITNA 4G5JA 5GHVA 3GFWA 3PXQA 4FT7A 4GRBA 3ZLYA 4BYJA 4FEUA 2XYNA 3BKBA 3LVPA 2WB8A 3TNHA 3CSVA 2GNLA 5IA1A 4S33A 4ZZMA 1OL1A 2BAKA 3HZTA 3RCJA 3FLZA 3H10A 5LCKA 3Q9ZA 4M14A 3WF8A 4XG6A 4H36A 1IEPA 4CFNA 5DR6A 5F94A 5CXHA 4F7LA 1NVQA 3FAAA 3ALOA 4XMOA 5D7VA 3F2NA 5L2SA 4IM0A 4FT5A 3HDMA 4ASXA 4B99A 3DAJA 4HW7A 4E4XA 3IG7A 2WTVA 2GNIA 1YXSA 2UZNA 4H3QA 1YWRA 1ZY4A 2HW6A 2PVMA 2VGOA 2W1EA 3GI3A 5HBEA 3IKAA 4AOIA 4FEWA 3R83A 2H34A 4LGDA 3ZBXA 4CZTA 3EN7A 3BLHA 3MSSA 2HY0A 4C35A 4R7IA 3QU0A 2ZJWA 5IMXA 1ZLTA 2OF4A 2WHBA 3KC3A 3QQLA 4MHAA 4RIYB 3IW7A 2JDOA 2WEIA 2W1DA 2QODA 4ALUA 5E8SA 4BTKA 4F70A 3VIDA 2EWAA 2QG7A 2XK6A 3SLSA 1IR3A 2JGZA 3B2TA 3QHRA 2B52A 2BZIB 4CYIA 2QQ7A 2IVVA 4G5PA 4WUNA 5DPVA 4BDGA 3BQRA 3QD0A 1STCE 3LQ8A 3WE8A 3GCSA 5TE0A 3D5VA 4HCVA 2OLCA 1CDKA 3B8RA 4IJPA 3GCPA 4YHJA 4QPSA 5DVRA 3TZMA 5E1EA 5HO8A 5JFWA 2RFEA 4YSMA 3R9OA 3UO6A 4CZYB 3KEXA 1L8TA 1OIUA 2YJSA 5BVKA 3SOAA 4Z7GA 3D5XA 1OL5A 4TWOA 1REKA 4EH5A 3BYSA 2C69A 2VTNA 4UXLA 3ORMA 1R39A 4HVIA 2YCRA 3U6HA 2CGXA 4LL0A 5D12A 5KCVA 2HENA 4DINA 4FVRA 5IEYA 4YSJA 4EOOA 1SM2A 2CGUA 1B39A 3ERKA 3QRTA 3ZC6A 1VZOA 5EYCA 3OCTA 4JAJA 5CEPA 3UQCA 3OBJA 4M13A 4XP3A 2UW5A 3V5JA 3C5UA 1VEBA 5IKWA 3SGCA 1JKTA 1YWVA 2ZV9A 3UOHA 4HVDA 1M7QA 2HIWA 4ITJA 4FEQA 4X6QC 4UY9A 2XIYA 5K5XA 5BMSA 4ZSEA 1KV1A 2ZVAA 4TTHB 4EJ7A 4CKRA 1OL2A 1PW2A 3DK6A 2QU6A 5T6KA 3E8NA 5IQEA 4O7ZA 4ZLZA 4O7SA 3P78A 5JFSA 1PXNA 4UYNA 2CKOA 3G0FA 1PXIA 3GCQA 4IANA 1OKWA 2X7FA 1WBTA 3C51A 2WQBA 4ACMA 3GU5A 4J96A 4G3EA 4UZHA 5CI6A 4IW0A 5E1SA 3RAIA 3PPJA 5LXMA 5D9HA 3PIXA 5JFXA 3GC8A 2F2CB 4FKWA 1MRVA 4DH8A 3UGCA 2UVZA 4FIHA 5LCJA 2VTHA 4M3QA 4R1YA 5HE1A 4CQEA 4DA5A 3NUSA 3D5WA 4FZ7A 4FIGA 4GJ3A 1M17A 3FYJX 4H05A 2CPKE 2W4KA 4LG4A 2WAJA 5L6PA 3O8TA 2R3OA 2XP2A 3FI3A 5C01A 3QD3A 5KMKA 2EXMA 1OB3A 3FMMA 2QOLA 2F4JA 3NCGA 3NW5A 1FVTA 4DN5A 4J1RA 5CWZA 4BTJA 3LQ3A 4R78A 5EHLA 3DBCA 2O0UA 5CEIA 3FMJA 2QO7A 2PPQA 4M7IA 3HECA 4J52A 3GU6A 5B2KA 1H25A 5HG9A 5AIKA 5IQFA 5M4IA 3R8VA 3TKUA 5FTGA 5HTBA 4M12A 3EN9A 1YXTA 3R8UA 3LJ2A 3QTUA 1BYGA 2YIWA 3DOGA 4IZAA 4E5BA 3NCZA 4PL5A 1OUYA 4FL3A 5DGZA 1YHWA 3W55A 2G1TA 2QURA 4YJNA 3WZUA 3TUBA 2FA2A 2VWIA 4RA4A 5HCXA 3LHJA 1OGUA 4XG4A 1R0PA 4JQEA 4U5JA 3NUAA 3ZUUA 5IA3A 4PP9A 2CKEA 1ZY5A 5A4LA 5IQDA 4S2ZA 4KIOA 3MESA 4EWHA 4CFVA 5FLFA 4YHFA 2ZB0A 3SD0A 1Q8UA 4NKAA 3E3BX 4APCA 4QTEA 4KSQA 1HCKA 3QTXA 2OW3A 3R7YA 2I40A 4C2WA 3UPZA 3DBDA 3GEQA 2DYLA 4MXAA 2Z8CA 2VWBA 2WMWA 3NNUA 4YNOA 2J5EA 3V5PA 2GNJA 4O84A 3L8SA 1GIHA 2ITOA 5EYKA 1WVXA 4DFXE 2YWPA 3FXXA 3PVBA 3R1NA 4J71A 4V04A 5EW3A 3IK3A 3REPA 4BBEA 1UNLA 3EIDA 5JT2A 2Y4IC 4HPTE 4R1VA 4YURA 4AZSA 4BVUA 1GY3A 3PXRA 4I5CA 1DAWA 3MH1A 4RFMA 4WNMA 4NM7A 5B0XA 5IUGA 3KU2A 3C0GA 4IFCA 4MNEA 2WIHA 3MB7A 4IEBA 2WU6A 1UV5A 4EHGA 1WBVA 2F2UA 2R0UA 4F09A 2OO8X 4RJ3A 1YOLA 4PY1A 5EDPA 4YZDA 1YI4A 2XNGA 3OEZA 4TY1A 3TWJA 2PU8A 3S4QA 1OITA 4ANBA 1UU9A 5AAEA 2YIQA 4ZTSA 3GC9A 1R0EA 4AW2A 2V7OA 4AZWA 3BGQA 3OS3A 4KIPA 1WMKA 1IAJA 3LFFA 3MVMA 2VWUA 3Q2MA 3ZSIA 4F7NA 3Q9XA 4NT4A 4XBRA 1KE8A 2VD5A 3H0ZA 4AZFA 1WBOA 1YW2A 3AGMA 4CSVA 1FMKA 3MBLA 3E92A 4AOTA 3CPCA 4FTNA 2VNYA 4PL4A 3KXGA 2CHLA 4UV0A 3ITZA 1URWA 1G8AA 5IMEA 4J8MA 4EH8A 3GCVA 3UOKA 3W2QA 5KBRA 4K1BA 2F7EE 2HXLA 4JI9A 5CT0A 3FXZA 3ZFMA 2W0JA 1Q5KA 3R1SA 3AG9A 4BYIA 2YEXA 4BWXA 1Q61A 2W05A 4ZTRA 5GJFA 4E4MA 1PMVA 2ITQA 4AS0A 4MF0A 3MW1A 4C4IA 2W5HA 4PNKA 2OFUA 4FL1A 4L68A 2CCIA 1BL7A 3KA0A 4O0UA 2HWPA 2R3PA 5HO7A 2PZPA 4QTAA 4BDFA 5IH4A 2PVRA 4UB7A 3UYSA 4CV9A 4IZ7A 2VTAA 3MH2A 5DIAA 4H1JA 4FIIA 2BZHB 3EKNA 2XK3A 4OTIA 4X2JA 3IW6A 2Q83A 4I20A 4A4OA 1O6KA 1PKDA 3DZQA 3NMUF 3MIYA 5HHWA 3O0GA 3VUMA 4M8TA 1ZOGA 5L6OA 4AOJA 4AUAA 2BRMA 1H8FA 2Y9QA 2C1BA 4YPDA 5FEQA 4J7BA 3MV5A 1JKSA 3PXKA 2YIRA 4ZMFA 3R30A 3KF7A 3TZ8A 4EC8A 4ZP5A 4DEEA 3CLYA 4BBFA 1BMKA 4KAOA 3TTIA 4YJUA 3T3UA 5ETIA 2HY81 3WYXA 3ANQA 4AE6A 2Z7RA 3HRBA 3KGAA 4TL0A 4ZY4A 3ZSHA 2C6KA 3FZOA 3FPQA 4CYJA 3U8WA 2YHVA 3UJGA 3MGYA 3DTCA 3DJ6A 4KIKB 2J0IA 3F6XA 4AWIA 2J4ZA 3GVUA 2VRXA 4Y85A 5FUTA 4DEAA 4O7TA 5HLNA 4FKTA 2BTSA 5AX9A 4L3JA 2WTKB 3QTRA 2QOHA 3A2CA 5A3XA 3RAHA 2VTMA 4EQMA 1Q8WA 2I1MA 2ITPA 1GIIA 3FLSA 3FZRA 5DI1A 3TKHA 5L3AA 5ETFA 3ZMMA 3R0TA 3VUGA 4DF3A 3MN3A 2CNVA 3FMHA 3LOKA 4MX9A 1OPJA 4DYMA 2W1FA 2EB2A 3A7GA 2W1HA 2V0DA 3ID6C 3Q3BA 1Y91A 4RIXB 2HOGA 2VO6A 4LM5A 3I60A 5AA8A 1TQIA 4BGGA 2JDTA 4GKIA 2BZKB 4KBCA 3F3WA 2A0CX 2BDWA 3EL7A 3E93A 4QMWA 3SW7A 5DA3A 1RQQA 4N6ZA 3II5A 4I5HA 3K2LA 5AP0A 4E4LA 4XG9A 2HYYA 4ITIA 3T9TA 3UZPA 3UNKA 1SMHA 4QMYA 2J5FA 3OEFX 5D7AA 5LVLA 4KS7A 4WIHA 3WIKA 2X0GA 4I94A 2IZRA 4FUXA 4PDPA 2BHEA 4L53A 3VUKA 4NIFA 3G9NA 3FI4A 2OK1A 3FZ1A 3HMPA 3OXTA 4MF1A 5ANDA 3VNTA 4AGWA 3ZTXA 4D58A 3L9LA 3IW5A 4NWMA 1TQMA 4O38A 3RPYA 4ZY5A 4GCJA 4J8NA 4TXCA 2WMVA 5FGKA 3V5LA 2NRYA 5CSPA 5DBXA 4AGCA 2C6LA 1ND4A 3IDPA 3KB7A 2VV9A 4JOAA 3AC3A 2OIQA 2Z7QA 1W7HA 2HK5A 4RC3A 5FM2A 4D0XA 2YITA 3G5DA 4CCBA 4FZAB 4XP0A 4NYEA 1OVEA 3FKOA 5CASA 4IHPA 4BTFA 5K0KA 4OTHA 4EKKA 4O83A 3I0OA 3PSDA 3AQVA 5AP6A 4F9YA 4FKGA 1Q62A 4FV7A 4KNBA 4BCGA 3KXXA 5JQ5A 2VTJA 3FY0A 5B2MA 2HWOA 4PP7A 5A6OA 3QTSA 4FYOA 3KKVA 2ETMA 4XOYA 4QTBA 4XLVA 4C38A 3UVQA 3EQGA 4A4LA 2XK8A 5DEYA 2NRUA 2G9XA 4AT3A 4O7YA 2H8HA 1Q24A 2GTNA 3QCXA 1H4LA 4ONAA 4UEUA 4C61A 3CPBA 2CMWA 1ZZLA 2YACA 4ACGA 4KA3A 2BAJA 3BE9A 1JOWB 3QQHA 4X2NA 3SX9A 5HI2A 4Q9ZA 1M7NA 4YO6A 5EM5A 3N9XA 5IA4A 5C03A 2C5NA 4E93A 3ZS5A 5KE0A 3Q9YA 3UNZA 3H9RA 1H26A 3VBVA 4HVHA 3UVPA 1J1CA 4QT1A 4FKSA 5FWKK 3AT4A 4RJ5A 4O6LA 3CD3A 5BNJA 4FTOA 1T45A 1JNKA 4X2GA 2AC5A 4F1MA 4LGGA 3DB8A 4Y5HA 4M15A 5K0XA 1H1PA 3NZ0A 3ENMA 4IM2A 3ZO2A 2XCHA 3BLRA 3EQCA 3FBVA 3V5TA 3VWAA 2W9ZB 2PULA 5HVYA 1SYKA 4DAWA 3SXRA 4CFFA 2XJ2A 2GQSA 3KXHA 3OFMA 4HYSA 5CZHA 2JLDA 3HX4A 3UO4A 1Q97A 5E90A 2ZAZA 4GU9A 1Z5MA 4IDTA 2C6DA 2WGJA 3OCGA 3ORNA 4N57A 3PG1A 3V01A 4YJQA 2WMUA 5I9XA 3Q04A 2WEVA 3IOPA 1KOAA 4HCTA 2QR8A 1PYEA 3A8XA 3PZEA 4J95A 5K4IA 3O96A 5AV1A 2X6DA 2C30A 2XNPA 4LGHA 3ZFXA 3CBLA 2IZUA 4U3YA 3K3JA 5GJDA 3GQIA 3A99A 2OJ9A 3HLLA 3E7VA 3HV3A 4I22A 4MK0A 2C68A 4XJ0A 1XO2B 2XIXA 1LR4A 3DY7A 4TYEA 4O0VA 2IG7A 2UUEA 4C57A 5CQUA 4CMOA 3PA5A 4BKJA 2IJMA 3M11A 3MYGA 3KXNA 3PFQA 4BFMA 4I23A 4JBVA 3FMLA 3EFJA 5EW8A 4C0TA 5LVOA 3HAVA 4D1SA 1UWHA 5IQCA 5JZJA 1Y6BA 2EXCX 5EH0A 5G6VA 4YLLA 3HUCA 5HE2A 2XNBA 3R8MA 3L9PA 4BDCA 4BI2A 4X2FA 4O7LA 5LMKC 3KY2A 1NXKA 4FGBA 4A9UA 3S00A 4MEDA 2A4LA 4TNBA 5AUXA 4O81A 3TEIA 1WZYA 5E91A 2J51A 5L2IA 2XJ0A 5I9UA 1P2AA 3R9NA 4IAAA 4AZTA 4BB4A 1FVRA 3VUTA 3I81A 2GS7A 4ANQA 4N6YA 3FC1X 4FMQA 3NRMA 3D0EA 2O64A 5FTQA 4G6OA 4GK2A 3T8OA 3BV3A 4FOCA 4AAAA 2RF9A 4MH7A 5HOAA 5BQ0A 5C8KA 3WILA 3VBXA 3NUXA 1JSVA 4FZ6A 5CF8A 2P55A 4O0XA 3NGAA 3PWYA 3CGFA 3V51A 3VULA 3WYYA 3OCSA 3RJCA 2NPQA 4X0MA 3FLWA 3VS1A 3R2YA 3TNQB 3O7LB 4YMJA 5HX8A 5M51A 1U54B 2W06A 2B1PA 3ZDIA 4A4XA 3O8UA 4X3FB 1Z57A 5EHYA 4C4EA 2BMCA 5JGBA 5K9IA 5EW9A 5T3QA 1JQHA 4A7CA 3DAEA 4C34A 3LCSA 5EK7A 2IW8A 5I9YA 3W8QA 4OBQA 1XH8A 2WTDA 4IAKA 4IB0A 3MJ1A 3TT0A 3UDBA 3PTGA 4RBLA 3TIYA 3FPMA 2QO2A 1APME 3OW4A 4FT0A 2PVJA 4M68A 3I4BA 3PRIA 4DGOA 4R7HA 4ZS0A 2YAAA 3Q4UA 3IW8A 3LKMA 3VS6A 3OT3A 3MVLA 3SVVA 1IG1A 4V0GA 3PVUA 2WMQA 2PE2A 1ZMWA 4IC8A 4MKCA 3RHKA 3KCKA 3KK9A 3R21A 5HE0A 3VS4A 1ERKA 4FKUA 4AGDA 3KQ7A 3F3UA 4FSMA 4AT5A 3GT8A 4N0SA 5AUVA 1KUTA 2XIKA 2W1GA 4IAIA 3D9VA 5AP1A 4ASEA 4BCFA 5M57A 4JDJA 4F63A 5L4QA 3HMOA 3EYHA 4HPUE 1YXXA 4X6RA 4Z16A 2IVSA 4EK3A 5M07A 4KINA 4BIBA 4CMTA 2W1IA 4RIWB 3GU7A 3OUKA 4K9YA 4EZ3A 1NT2A 4I4EA 4O21A 3DLZA 1YQJA 4B7TA 3Q5IA 5EKOA 4F65A 3P9JA 3QALE 4DC2A 5GZ8A 5J79A 3QXOA 4FA2A 5KMMA 5A4EA 3R7GA 4ZLYA 2YDJA 3DKOA 4ANMA 4UMRA 5DT3A 1WVWA 2OU7A 1H24A 2P3GX 5H2UA 4GVJA 3P08A 4FYNA 4NU1A 2G2IA 3MA6A 4RVLA 3JR1A 4O2PA 4EOMA 4WO5A 2F7ZE 2CN5A 2XNEA 1QPJA 3LPBA 5TO8A 3WF6A 3WOWA 5CAPA 3FWQA 4EZ7A 3MTFA 4F64A 1XBAA 2OXYA 3C1XA 4NCTC 4QQJA 2H6DA 2VWZA 4QD6A 4FSNA 4ZTHA 1L3RE 2VZ6A 4M69B 5IQBA 1AD5A 2OJGA 2BVAA 4P7EA 3D14A 5HG8A 3VQUA 1ZMUA 1OL7A 4GW8A 5CTPA 3TZ9A 2YA9A 2ZDTA 3PXZA 4Y73A 4BCQA 1PY5A 4Q5EA 1SVGA 2EB3A 1XJDA 4K18A 2YN8A 3ORTA 2UW4A 3NEWA 4OTRA 5ANIA 5JKGA 4J99A 4OUCA 4DG2E 4DH3A 5CYIA 5KHXA 4FTJA 3DBEA 3QZHA 5HESA 3KRXA 3ZXTA 3VC4A 4RIYA 4BDEA 3ZYAA 4CMUA 4CXAA 2QCSA 4AW1A 1XH6A 4QMOA 2XMYA 3QRUA 4MD9E 4HZRA 2WIPA 2VTIA 4TKSA 4BZDA 4OTGA 4D28A 4BI0A 2WMXA 3E5AA 5D41A 4YJOA 1BI8A 4N4SA 2XYUA 5CVFA 5BYLA 4K2RA 3QUDA 4NTSA 1U46A 3M42A 5HTIA 2XKEA 4G9RA 3FYKX 3WARA 3R9DA 1UNHA 4GKHA 4L01A 4NM3A 4QP8A 4BDIA 4O0RA 3E62A 3ZRMA 3SV0A 3E3PA 3DCVA 3EN5A 2Z2WA 2X7OA 3P79A 3WBLA 5CY3A 4C3RA 3UO5A 2PMLX 2R3FA 4BF2A 4PWNA 4JR3A 4FEXA 4GVAA 4UBAA 2BRBA 4FEVA 5AIRA 1IAHA 4F08A 5CF5A 2YM7A 4R3PA 3DQWA 5FBOA 3AC1A 2WNTA 3NNWA 4ZJVA 4KSPA 3FE3A 2UW7A 3WZJA 3KVWA 3BE2A 3BV2A 3R8ZA 1U5RA 2UW6A 3BU6A 3VHKA 3COIA 4EYMA 5CF4A 5JGDA 5CNOA 4JG6A 4F9CA 4QQCA 3VW6A 4WSYA 4AF3A 1MRYA 2WMTA 1H08A 3F3TA 3PPKA 4QMVA 4D5KA 3E87A 4ARKA 4Z9LA 2XKDA 4NEUA 4QMPA 3IOKA 4YJRA 5AR8A 4BCKA 5LVMA 4OTDA 3E8DA 4ZTNA 2P4IA 3BYMA 3TKIA 4YZBA 2XM8A 2QI8A 5KKRB 4IIRA 4IWOA 3FMNA 3WIGA 4CG9A 3W2PA 3Q6WA 3NIEA 3GC7A 5T68A 4RX5A 4CRLA 3W2SA 1W82A 5HTCA 3QWJA 3QQKA 2VWVA 4FV5A 2C0OA 1CTPE 2JEDA 5DR9A 3GB2A 3ZM4A 4AFJA 4D2TA 3FKNA 4TWPA 1IA8A 5DWRA 4FTQA 2XIRA 3PYYA 4IVDA 4RZVA 1GNGA 4AN2A 1OUKA 4EUTA 2ACXA 4PDSA 4YLJA 3A7IA 5ETCA 4L67A 5E8ZA 4DEGA 2XB7A 3HMIA 4GYIA 2VO7A 2X7GA 5A6NA 3UOLA 3KREA 3V8SA 1B38A 2P33A 5EYMA 2IPXA 4BR3A 5JMSA 2RFNA 5EHOA 4GG7A 4FKVA 3TV4A 3VS5A 4DE4A 4AQCA 2OH4A 4L3LA 5ANGA 5AUWA 3C4FA 3V5QA 4Q9SA 4YJPA 4UN0C 3VBYA 5A54A 4E5WA 5KMNA 4I6HA 1UU3A 3NYOA 2EU9A 1LP4A 4UALA 5ANJA 3R63A 3EZVA 4FTKA 5AP4A 2UW0A 4ASZA 4MQ1A 4PDOA 4RX8A 4IWDA 2YZAA 3CKXA 5HVKA 4EZ5A 4LRKA 4MXOA 5CANA 4OBPA 4WRGA 5AV3A 5HORA 5LVPA 2PYWA 3BGZA 4KABA 4FTIA 4TYHB 4WBOA 2C6EA 2PTKA 2WMRA 2QOFA 2YM3A 3NNXA 4HYHA 3UBDA 4BZNA 5HEZA 4EOPA 1Y8GA 5H8GA 4L52A 4I6QA 3ATTA 4JQ8A 3JPVA 5JSMA 1HOWA 1S9IA 4L43A 4YJTA 4G3CA 3PJ1A 2WTJA 4GFMA 3L8XA 2EVAA 4WG4A 3OTVA 4Q2AA 4FSUA 1MQBA 3KF4A 4QMLA 3LXNA 1YOMA 2XBAA 4I21A 3F5UA 1G3NA 3N4VA 4RLLA 4XX9A 4JS8A 3SHEA 2ITZA 2NNWB 5I9ZA 2OZAA 3HEGA 2P0CA 3FKLA 5KO1A 3RAKA 4MBLA 2OBJA 1P4OA 4ENYA 2O5KA 4I0RA 5CX9A 3BHTA 4ZK5A 4CTCA 2UZWE 3CP9A 2VO3A 3VQHA 5D1JA 4TYGA 3VVHA 4W8DA 2HXQA 4ZIMA 5IQGA 2QOBA 4BCHA 4U0IA 3VS2A 1Q99A 2C3KA 2SRCA 3AMAA 4FZDB 3LFBA 4KD1A 3OC1A 3OROA 4M0ZA 4LUDA 5EDRA 1FOTA 1V0BA 4QMMA 3Q4TA 3PDTA 3P7CA 3TV6A 4AZVA 3QA0A 2JBPA 4NKSA 4RWLA 3Q4CA 4GFGA 5H3QA 3UP7A 4O6EA 4Y46A 3V8WA 3EQBA 1SVEA 1K3AA 2O3PA 1M2PA 2YLEA 3QRJA 4WA9A 4QP3A 3JXWA 3QZIA 3V8TA 4QP7A 2YM5A 4RX7A 1PJKA 1NVSA 4IMYA 2BCJA 3MVHA 3P86A 3AT3A 4XRJA 3H3CA 5EI2A 4BDKA 1GJOA 3L8PA 4ZSGA 3P7BA 4JRNA 4CV8A 1LUFA 2CNQA 5E4HA 2HZIA 5M06A 3F5GA 3MB6A 2ETRA 4I92A 4AA4A 4TRLA 4O7NA 1RW8A 2WQMA 3RZFA 4QRCA 4I24A 3GQLA 5KUPA 5AV4A 1XH4A 3UPXA 3W1FA 3WE4A 4G3DA 4CQGA 2FYSA 5DR2A 4FVQA 4CKJA 3BHUA 2DUVA 3H0YA 3HA6A 4MQ2A 3RNIA 4EK8A 4LV8A 1QMZA 3F88A 3S2PA 4BCPA 5AA9A 4OAVB 2C0IA 2PE0A 5AADA 3LJ1A 1I09A 3QLGA 1HCLA 2R3GA 3QF9A 4BGQA 4DFZE 5EG3A 5EQYA 4YJSA 3NPCA 5FEEA 3EL8A 3TDWA 4FZFB 2PUPA 3M2WA 5I9VA 3PJCA 3CQWA 2OWBA 3BYVA 4C33A 5AP3A 5F9EA 3DGKA 3V3VA 5ACBC 5C26A 3CTHA 4YC8A 4FE2A 2YAKA 3O51A 4ACCA 3QGYA 5F1ZA 2UW9A 1O6YA 4U7ZA 4HVSA 1MP8A 3ANRA 3CEKA 3FMEA 3I1AA 3MA3A 3P0MA 3V04A 2VTSA 2JKOA 3A61A 1FMOE 4FV6A 3HV6A 2UV2A 4EH6A 4DH7A 2PZRA 4EOJA 5CAUA 5ACKA 4NW5A 5J95A 3PIYA 3HNGA 3LW0A 4GIIA 4NJ3A 1P14A 2XEYA 5DH3A 4S34A 5DYJA 4D1XA 2R3QA 3POZA 5F20A 2ITTA 2HZ4A 4O7WA 3CTJA 2FH9A 2QLQA 4GSBA 3NUNA 2VTRA 4KIKA 4QP1A 3O17A 1A48A 5HNBA 4BKZA 4C3PA 5AAFA 2B9IA 2F9GA 1H07A 3FC2A 3ACKA 1YVJA 4FC0A 4JBOA 4R5YA 4UXQA 2E9PA 4FKQA 1U5QA 2X2LA 4EBVA 5IZFA 4MCVA 4JL9A 3JVSA 1R1WA 2ZOQA 4TNDA 2QOIA 1JVPP 3THBA 2WMSA 5CU0A 3TNPC 4D55A 4GV1A 2BROA 4QYGA 4IAFA 3DKGA 2PVNA 4H1MA 3PXYA 4I4FA 3HV4A 3OY3A 2FGIA 1H1SA 3W8LA 4TYJA 5I0BA 2PUNA 2CGWA 4W4XA 5LWMA 2RSVA 2BPMA 3RK7A 3F3VA 3QTQA 3NW7A 4IH8A 4O96A 4TYIA 4F4PA 4GG5A 4NZWB 4BWKA 4CRSA 3HYHA 4WOVA 4XNEA 2X8IA 5BVOA 4YZCA 3TV7A 1YXVA 1GZNA 3KK8A 1XBCA 2Q0NA 2WMAA 5HU3A 2X6EA 2R9SA 3W32A 1SNUA 2G2HA 4RFYA 3EFLA 5FDXA 4DG3E 4IX6A 5BUJA 1YXUA 2XEZA 1PKGA 4XV1A 5CAOA 2ZMCA 3O7LD 4V01A 3JVRA 2PHKA 2BZJA 2X8DA 4X7QA 4EQCA 3NYVA 4R8QA 4MXCA 3EHAA 5C9CA 2V22A 4EK4A 1SZMA 1FGIA 1TKIA 3R8PA 4AW0A 3FDNA 4MNEB 1XKKA 2B4SB 3TI1A 4QMNA 1RE8A 3BYUA 2W96B 3LM5A 3LQ5A 3MPMA 4EOSA 1MUOA 1PXLA 2X9FA 4OTFA 5B7VA 4EOLA 4CFXA 4C36A 1CMKE 4ZS4A 2X2KA 2ERZE 1PF8A 4JDIA 4PPAA 5HE3A 3MWUA 1J91A 3Q60A 1F0QA 4HNFA 5HNGA 2ONLC 4C2VA 4ERKA 4O82A 5D11A 3TACA 3EJ1A 4IDVA 2YM4A 4AXAA 1RDQE 4UWCA 3TUCA 4QMSA 4ZZNA 3WF5A 4FSZA 3RBWA 4LOOA 1JKLA 1PMUA 3GU8A 3TIZA 3ZUVA 3LMGA 2W17A 4FX3A 4IX4A 4LUEA 3SRVB 4RVTA 5L8LA 4O1OA 4YPSA 2J0JA 3QRKA 4JDKA 4OTWA 2B7AA 2GDOA 1YOJA 3EZRA 4GS6A 4Y72A 2R3LA 5FM3A 2PUIA 4MVFA 1UVRA 3LFAA 3EQIA 2PMNX 2VAGA 3D5UA 3AMBA 1FPUA 3BBWA 3BELA 3PP0A 4QMUA 4G17A 3MFUA 5LOHA 5J7BA 1A06A 2WELA 1OKVA 5M44A 4G6LA 3GFEA 4G31A 3OT8A 4BIDA 3D7TA 5DRDA 5EKNA 3JS2A 3PLAE 2H9VA 5DN3A 2PVKA 3LCDA 4AA0A 4EBWA 5KNJA 2WTKC 1UKIA 4U41A 5CENA 4NUSA 4L44A 2CJMA 3EB0A 5CSXA 5BMMA 4F9WA 4BY9E 4KUJA 3LFNA 5CZIA 2JKKA 4RFZA 4RRVA 5CVGA 1K2PA 5LMKA 3QYWA 4NJDA 4BC6A 3UC4A 1BL6A 4ALWA 2WO6A 3MVJA 3OBGA 3KVXA 3RHXA 3CS9A 3BWFA 3OP5A 3V6RA 4F99A 3ZCLA 5IPJA 1ZYLA 5LVNA 3FZPA 1NVRA 3S3IA 2CKPA 4NTTA 2PMIA 2XK9A 3U9NA 4AT4A 5CSVA 3U54A 4BDAA 4C3FA 1KV2A 2OF2A 2XA4A 4BRXA 3JY9A 3NAXA 3C4EA 3C9WA 5GIPE 5LQFA 2CCHA 2GHLA 2PZ5A 3FQEA 2C4GA 3M1SA 3AOXA 2LAVA 4E5AX 4H3PA 5M53A 5KBQA 2X4ZA 3ZOSA 2YM6A 1YDSE 2YZLA 4RX9A 1YDRE 5H9BA 4D2PA 2C5YA 4U45A 4IAZA 4GJ2A 4RWKA 2BFXA 5CLPA 4AN9A 4DGMA 1PXPA 3V6SA 3MFRA 5HQ0A 3KMWA 1H28A 4RJ8A 1J7LA 4FT3A 1PXMA 1UU7A 2B54A 3FQHA 2W1CA 4FTCA 2WZJA 3A62A 3IGGA 3O23A 4K11A 4YNEA 1Y6AA 3IQ7A 4QPMA 3DK7A 3R71A 3ZZEA 3RM6A 4FSYA 4ASDA 4BHZA 1QPEA 2W4OA 4WD5A 5C8NA 2BIYA 4R5SA 4XV3A 3QXPA 3G6HA 4QO9A 4E1ZA 5EQPA 4FF8A 5HD4A 3SC1A 1WCCA 3OHTA 3UOJA 3I7BA 3ETAA 3L8VA 1YWNA 3GXLA 3N4UA 2GS6A 1JWHA 4JX3A 2WMBA 4D9UA 4DHFA 2BR1A 4FIJA 4BICA 4RJ7A 2FSLX 5JRSA 3EH9A 2I7QA 3I5ZA 3WF9A 4IX5A 2J0LA 3GU4A 2R3NA 4G16A 4QMZA 1U4DA 3P23A 3C4XA 4IVCA 4XUFA 3R00A 4CFUA 2BDFA 2FSMX 4EH7A 3QX2A 5CU6A 2VNWA 5LJJA 5I9WA 3BLQA 3ET7A 1DI9A 4DBXA 4R3CA 5IQIA 3EWHA 2PVHA 2ITWA 4ID7A 2ZYBA 4GIHA 1ZOEA 4NFMA 5HCYA 4D4VA 4NIFB 5BPYA 3NVMB 3VW8A 3Q52A 1PHKA 4L42A 2GTMA 4YO4A 3ELJA 2BRGA 3QX4A 3DZOA 4XOZA 1TQPA 5EI8A 3RMFA 3ULZA 3UNJA 5GZAA 1KOBA 4OTPA 1MQ4A 1ATPE 2AUHA 4CD0A 3MFTA 4HZSA 3PRFA 4G34A 1KWPA 1OPKA 5E9EA 2JDVA 4PTCA 3VUHA 3TZ7A 3E64A 4IB3A 4UMUA 3A4PA 4PDYA 3KFAA 3RGFA 1ZAOA 4G9CA 5BVWA 3D7ZA 3G9LX 3W2RA 1CKJA 4RC4A 5L2QA 4IACA 4E6CA 1WFCA 2CLQA 3H4JA 4KWPA 3VN9A 3EQDA 3ULIA 2VN9A 2VWXA 5IUIA 1ZOHA 2C6OA 3JUHA 4FV0A 5AMNA 2ZV7A 4CLJA 3FSFA 3AT2A 4YZ9A 4DT9A 4M0YA 2BFYA 3UQFA 3FUPA 4YTHA 2IVUA 4RVMA 5EOBA 2RL5A 5F4NA 3E7OA 3LMIA 3SW4A 4ZMEA 3MY1A 4QPAA 3BEGA 3HDNA 3EFWA 1XBBA 2I0HA 4NCTA 4I6BA 3W10A 1WAKA 4XV9A 5I3OA 3EKKA 4UX9A 3CY3A 3FJQE 2VTPA 4OGRA 5TR6A 3WZEA 4DG0E 4DFBA 2GU8A 1AQ1A 2A19B 3KULA 4GT4A 2V55A 4J98A 1Z9XA 5GIOE 5CQWA 2IN6A 3ZC5A 4WRSA 2XCKA 3H9FA 4ITHA 2LGCA 5M55A 3T3VA 2H96A 3VJOA 2G01A 5I5ZA 4ZOGA 5CU4A 4JLCA 3CQUA 3T9IA 4F6UA 4QTDA 4O0SA 3C0IA 3UG1A 5J5TA 4RJ6A 4MXXA 3F5PA 3W18A 4ZAUA 2R2PA 3FHRA 4I41A 4MXZA 3IECA 4FKPA 3SAYA 4C02A 4CEGA 3UVRA 2PMOX 3QCQA 4BBMA 5HNIX 1H01A 3CQEA 3NNVA 2VX0A 4FNXA 4U9AA 1YHSA 2UZBA 5CSWA 5HKMA 1VR2A 3MH0A 3NUPA 3RINA 2DS1A 2O2UA 4KBKA 3C50A 3L9MA 4EYJA 1KE7A 4D4RA 2ZM3A 4GH2A 4BCOA 4CFMA 4ACDA 4DBNA 1R78A 2E2BA 2KTYA 4PL3A 2JBOA 3UMWA 4EUUA 3TTJA 1M2QA 4L46A 3W16A 4RZWA 1URCA 2PZIA 1KE9A 4FKLA 4M69A 3BYOA 3HP2A 5HU9A 5IG1A 5CI7A 1V0OA 2QO9A 2R64A 3Q6UA 1H1RA 5EYDA 2O65A 3SG9A 5M4FA 3UTOA 2E9VA 5CEMA 2YIYA 4XHKB 3GBZA 3PWDA 4KRDA 3OOMA 2W99B 3PSCA 5M09A 1NY3A 2OJFE 2F49A 3CY2A 1GZ8A 2XM9A 3EMGA 3CKWA 2PUUA 3FZSA 2XS0A 4PTGA 3OOGA 3U4WA 3OG7A 2XK7A 3EQRA 5D10A 3D94A 5FXRA 3R6XA 2FO0A 4HNIA 4X3FC 3PPZA 5AR2A 3AD5A 2VTQA 3LCTA 2QU5A 4FBXA 3G51A 5EDQA 3ZEPA 2XRWA 1OBGA 4GFOA 2ZB1A 1REJA 3LFQA 3ZRKA 4JNWA 2KULA 4BCMA 3A8WA 4QQTA 2ITUA 3U6JA 3BHYA 2J7TA 4DEHA 3BZ3A 1IASA 3LXPA 3QFVA 3RVGA 4BN1A 3QQUA 5M4CA 5CU3A 4NL0A 2PE1A 3D4QA 3A7JA 3DNDA 4DGNA 3ORPA 3RCDA 3R9RA 4MBIA 2JFLA 4R77A 3AC8A 5M08A 3QKMA 5ANKA 1JBPE 4YU2A 5HIDA 3WF7A 2NP8A 3CC6A 2WOTA 3HVCA 5IH5A 5JEBA 3H30A 4FK3A 4IAYA 4S32A 3CE3A 3ZM9A 4H58A 4IBMA 3I5NA 5DEWA 5AJQA 4ENXA 4NFNA 1SVHA 2XBJA 5E8YA 2B9JA 2R3JA 4U40A 3LAUA 3SXFA 4HJOA 4H39A 4RGJA 3RWPA 1WBPA 3LFDA 4WNOA 4DH1A 3TN8A 4F7JA 2OH0E 4BTMA 4L7SA 3UC3A 3I79A 4FTTA 3TM0A 2R5TA 3UE4A 3RP9A 2JIIA 3ZLWA 4KKGA 5CEQA 3TUDA 4EOKA 4I3ZA 2I0EA 1OKZA 2UVXA 2GNHA 5IH6A 3HL7A 3RZBA 4NH1A 1BUHA 3R9HA 4GT3A 3K3IA 5E8UA 4APPA 3UZRA 1OZ1A 4JIKA 4RQKA 2UZTA 4DLJA 5BVDA 3V5WA 2IWIA 2IW9A 5J9ZA 4U80A 4LV5A 5ETAA 5AX3A 3BX5A 4BKYA 4FV8A 3N51A 5IA0A 4WNKA 3OD6X 3ZDUA 3O8PA 4AFEA 4HGEA 2UW8A 4FKRA 4YC6A 4CKIA 1CKIA 3LJ0A 4QTCA 4ZXTA 1H1QA 1YI3A 3GP0A 4XYFA 2VWYA 4UWYA 5AV2A 4A07A 2RG5A 1T46A 3UZTA 2QOCA 4DTKA 2J90A 2YJRA 4E8AA 1Q3DA 2UVYA 3CD8A 4EEVA 4W9WA 2Y6MA 3QBNA 3DU8A 5HG7A 2G15A 5JFVA 2YCQA 3AC5A 4MXYA 1XHAA 4I0SA 1H1WA 3R04A 4C8BA 5AAGA 1J7IA 5IQAA 4PMMA 5E92A 3WZKA 3DS6A 4G1WA 4JG7A 3BI6A 4RMZA 5IEVA 3RWQA 2Y4PA 5HVJA 3TL8A 5AFVA 3BQCA 1OKYA 2PZYA 5DOSA 4AU8A 3VS0A 4L7FA 4XCUA 3AXWA 1A9UA 2QKWB 3QC9A 5HCZA 4O27B 2WKMA 3EOCA 3QWKA 4MNFA 2UZEA 4LRMA 3HAMA 3W2CA 1CSNA 4BL1A 4YTFA 3QGWA 2F7XE 4AZEA 4EHEA 5HIEA 1XR1A 3NAYA 4TYHA 3UQGA 1G5SA 2OZOA 3PUPA 3CJGA 4F0FA 4IE9A 4DLIA 4O22A 4WG3A 5HO6A 3OW3A 5E8TA 2QHNA 2JC6A 4M97A 2OJJA 3R7UA 3GNIB 1PXJA 1UNGA 4XLIA 3EQFA 2PVYA 5AR5A 3F2AA 4FODA 4GEOA 5JN2A 4B4LA 4DFNA 3A4OX 4UMPA 5ITAA 4R6VA 4LMNA 2C5XA 4R3RA 2V7AA 2C6TA 1XH9A 1X8BA 3PE2A 4QP4A 2FSOX 5TT7A 4XG8A 4TZRA 5A9UA 4P2KA 4AGUA 4A9TA 2PK9A 3NR9A 4QNYA 1J7UA 4FTUA 4RC2A 4E7WA 3FXWA 5LMBA 3VRZA 4CG8A 3QD4A 1K9AA 1LEZA 3OVVA 2DWBA 4ZZOA 4EI4A 3FLYA 4PPBA 2I6LA 5K5NA 5FRIA 1NW1A 5IDNA 3LFEA 5LARA 2YIXA 1PMNA 2B55A 5FG8A 1SNXA 5E8XA 5JH6A 2X1NA 4DFUA 1W8CA 1H27A 1YI6A 2OIDA 3HGKA 4GYGA 3AC4A 3A60A 2RFSA 4IWPA 5ANEA 4G6NA 3SKCA 3LLTA 4A9SA 4FT9A 5EQEA 3BBTB 2P2IA 2W4JA 3ORIA 5J7HA 3VF9A 2QKRA 3G0EA 2ITYA 4GUEA 3R7EA 2GFCA 4CT1A 5KKRC 3QL8A 4Z55A 1OIYA 2FB8A 2RIOA 4XBUA 4EHZA 3RK5A 2PY3A 4JX7A 3FSKA 1YDTE 4L00A 4K33A 3VO3A 3ZO1A 2X8EA 4ZSLA 2QD9A 4EWQA 2UZOA 4JR7A 3ACJA 2C3JA 3VAPA 3VUDA 4Z7HA 2E9NA 3IW4A 1BKXA 4OW8A 3B2WA 2GNGA 3TJDA 2OFVA 5CALA 3QRIA 4II5A 3AGLA 4OLIA 3OWJA 5EFQA 4ZEGA 3COMA 3EN6A 5AR4A 3IO7A 2OXXA 4RPVA 3BGPA 4B6LA 3HRFA 4DTBA 3DLSA 3NVKI 3MH3A 4E6AA 5IQHA 3ZU7A 4NM0A 4OBOA 3DNEA 4RLKA 2XNMA 1CKPA 5E7RA 3KMUA 4G2FA 4IQ6A 2B0QA 1IRKA 4JJRA 5CXZA 3ZO3A 1JSTA 3R01A 4ERWA 1KE5A 5H8BA 4TW9A 3SOCA 2ZM4A 4FV3A 4IADA 2IVTA 2CDZA 3Q53A 4USDA 4RIOA 3Q9WA 3D83A 3ORXA 1DI8A 3C7QA 3MDYA 3OXIA 4YTIA 1OBDA 3SDJA 4FV4A 1VJYA 1I44A 4JQ7A 5J87A 3WI6A 4FIEA 5FTOA 3I0QA 5M4UA 5HBJA 4UYAA 4YHTA 5ANOA 3TDVA 5FQDC 4ZJJA 2XRUA 2BRHA 1PRYA 3DBFA 4I93A 3B8QA 3IDCA 4IX3A 4GUBA 4RWIA 5GNKA 4I1ZA 4BCIA 3P4KA 2ESMA 2YISA 4GMYA 2JKMA 5A4QA 4XEYA 4NK9A 2QHMA 3QQJA 2X2MA 4I5PA 2BRNA 2XH5A 5HLPA 2OJIA 3S0OA 4DGLC 3KCFA 3CR0A 3VS7A 2J2IB 4FUYA 5FBNC 2C5OA 1MRUA 3ZONA 2PWLA 3PA4A 4NSTA 3MS9A 4YLKA 3DTWA 4FSWA 3TNIA 5IDPA 2A2AA 3RPOA 3ZXZA 3BIZA 1AGWA 3PXFA 3D2IA 3ORLA 4EH4A 1VYWA 3E88A 2XNNA 4FSRA 4M84A 4U43A 3MIAA 4ZLOA 4YTCA 3K54A 3CCNA 2ITVA 2V5QA 1M52A 4RVKA 4BWPA 2Y4IB 3U4UA 3OWPA 3PP1A 5FEDA 4LOQA 5EM8A 2W5BA 4QQ5A 1Q8YA 3R1YA 3LLAA 3UYTA 4PX6A 1J3HA 3W33A 5J1WA 3N4TA 4OAUC 5KMOA 2GQRA 1ZYCA 1G8SA 2IZSA 5CS6A 5GINE 2HCKA 4Y95A 4B0GA 4EL9A 3NLBA 3R7OA 1PXOA 4YR8A 2R7BA 2VTTA 4XP2A 1GOLA 2QOOA 2WQOA 1ZXEA 2UZVA 1ZYDA 4IB5A 4MWHA 1CM8A 1NA7A 3FMDA 5BUEA 2GMXA 4EONA 2ONLA 1WBSA 1FVVA 3MY0A 2HZNA 5AR7A 2W1ZA 3BWJA 3JY0A 1QL6A 3FLNC 4IVAA 4F6SA 4WG5A 2XUUA 4FKOA 3SQQA 2F57A 1Q8TA 4RJ4A 4O7VA 3PJ3A 4FIFA 3DA6A 4YBJA 2YM8A 3OMVA 5AUZA 2OZAB 3Q96A 5DT0A 4QYFA 3LCKA 3DXQA 4FTRA 1Q41A 3UODA 4F7SA 3OY1A 3PG3A 5HD7A 4AX8A 5AUTA 3QAME 4PPCA 4JBPA 3O71A 2B9FA 3VUIA 1QCFA 4GT5A 4W8EA 4O91A 4P5ZA 1DS5A 4JXFA 2BKKA 3UIBA 3R1QA 4TN6A 1GAGA 2HELA 4JVGA 4EOQA 2FUMA 3RI1A 3ALNA 4CCUA 3FL5A 4YP8A 2JAVA 4A9RA 2Q0BA 2QONA 5G1XA 2C1AA 5I3RA 5BYYA 4DH5A 3FI8A 3DJ5A 5CEKA 3PJ8A 4L9IA 5LMAA 2B53A 5AUYA 4JRVA 3HA8A 4EC9A 1W83A 3KRRA 3NW6A 5BVFA 3MTLA 1W0XC 4BCNA 2AC3A 2WTWA 3F82A 4AACA 4GK3A 1Y57A 3MY5A 3WZDA 3HRCA 2OSCA 2BIKB 3QCYA 4GL9A 3TJCA 3MI9A 3DXPA 5GZ9A 4F6WA 2JAMA 1OECA 2HW7A 3NS9A 5L6WL 1JPAA 1JSUA 2GSFA 4RIXA 2VWWA 5CSHA 3F3ZA 3EYGA 4KS8A 3SRVA 4FV2A 4KRCA 2YWVA 1E1XA 2BDJA 3CTQA 4E26A 3BPRA 4HOKA 2UZLA 4MTAA 4U6RA 4EK6A 5IISA 4JAIA 2XIZA 3GUBA 4HGLA 2X81A 4D2VA 4IFGA 2W7XA 3G6GA 1OL6A 3K5UA 3P1AA 4NW6A 1H0WA 5CAVA 3QQFA 3CIKA 3PVGA 3QUEA 2WQNA 2JKQA 2ZM1A 5J8IA 3VRYA 4BGHA 3R73A 4D4YA 4K0YA 3R8LA 4E4NA 4USFA 3I6UA 3KN5A 4O0TA 3PZHA 3HMNA 4ZSAA 3LXLA 3KRWA 4E73A 5DMZA 4IC7A 5KMLA 3KN6A 3TNWA 2XF0A 2WD1A 3S1HA 4RSSA 2NO3A 4ZJIA 3P5KA 3PLSA 3F5XA 3LCOA 2Y7JA 4HYUA 4EKLA 1BLXA 4BDHA 3AMYA 3D15A 3L9NA 3FQSA 3ATSA 3FI2A 3COKA 3H9OA 4C4HA 2BKZA 5H8EA 5A14A 5KZ0A 4FSQA 1UA2A 1OIQA 1KSWA 1OIRA 3BHVA 2UW3A 2RFDA 3ORZA 4D5HA 4JT3A 1UKHA 2JDRA 1IA9A 3RKBA 3QC4A 3DBQA 3G33A 2C47A 5EM7A 2JFMA 5FP6A 3TXOA 5TOZA 3F66A 5BUIA 2YERA 2YCSA 3COHA 3C0HA 3FZTA 2E9OA 3E8CA 4IXPA 5C1QB 4QMTA 3IONA 1V1KA 3F69A 4UMQA 4MYGA 4EHVA 4QP2A 5FXSA 4PQNA 4LQMA 3ZFYA 2X9EA 5HZNA 3LMHA 1WBWA 3FY2A 4ZSJA 3R28A 1Q3WA 4WUAA 2J50A 1E1VA 3C5IA 5HLWA 2C0TA 2OI4X 4FNYA 4DEBA 1QPCA 3IPHA 3ROCA 3FL4A 4F0IA 1R3CA 3LZBA 3ODZX 4X21A 3F61A 5AV0A 4HVGA 3VHEA 4XG7A 2C3IB 4HCUA 5E8VA 4XH6A 4IVBA 3BU5A 4MBJA 4U3ZA 4ANSA 1OM1A 1V0PA 2JD5A 2JITA 3QLFA 4TWNA 1DM2A 2XZSA 1GZKA 3W2OA 2BALA 3EQPA 4C62A 1M2RA 2VTLA 2VX1A 3GGFA 3C13A 1GIJA 4L3PA 2GQGA 4A9YA 5L2TA 3RPSA 2R4BA 3E8EA 3ZZWA 4BDBA 4EOIA 4EORA 4GU6A 4U44A 2EUFB 3ZUTA 3QYZA 4F9AA 2R3KA 3OUNB 3QCSA 3DDQA 4KKHA 5AM6A 3PJ2A 2BAQA 4W4YA 4FKJA 3RPVA 4CFWA 4F1OA 3OWKA 1UWJA 3QTWA 1LEWA 1GZOA 3QHWA 3QTZA 3EFKA 4WHZA 1OPLA 4D2SA 1KE6A 2I0YA 4AP7A 3NYNA 2OKRA 2R7IA 1PXKA 3FV8A 5L8JA 5JGAA 4W4WA 3DDPA 4W4VA 3QD2B 3R7VA 4ANNA 3ZLSA 4E6DA 3BU3A 1YKRA 2V62A 3MPTA 1FGKA 1XWSA 2VO0A 4YC3A 4AG8A 4BDJA 4C37A 1UU8A 3Q32A 4CZUA 5L8KA 5DE2A 5AM7A 4AE9A 2CGVA 3OTUA 4I0TA 4XRLA 2BTRA 3I7CA 4RQVA 4MD7E 3TCPA 5F95A 5KMJA 2XNOA 3C4WA 4RA5A 4D9TA 4CVAA 4F9BA 1PYXA 2VTOA 4XS2A 2ITXA 4ZTMA 4X2KA 4D4SA 5CEOA 5BYZA 4KBAA 4C58A 3ROYA 2Z02A 2ZV2A 5EM6A 4L6QA 4U97A 5BVEA 2VGPA 4HYIA 2QR7A 2VX3A 3DFCB 5FXQA 4FGRA 3G90X 3MJ2A 2YLFA 2YDKA 4PRJA 5KX8A 1S9JA 4PV0A 4YBKA 3OZ6A 5KZIA 4CLIA 3QTIA 4CNHA 3GOPA 3DK3A 3LIJA 4FG8A 2BILB 4YUQA 4R7BA 3Q5ZA 4DTAA 4CT2A 5IU2A 5J1VA 4O1PA 4WSQA 1FQ1B 5HX6A 2OG8A 5HG5A 3VS3A 3GENA 3CGOA 3RPRA 2WQEA 2WFYA 5J5SA 1H00A 2PL0A 2YCFA 2IZTA 4YZMA 4FTAA 3RTPA 2G2FA 4DEIA 1OI9A 5EI6A 3FEGA 3BEAA 1BI7A 2C6MA 2J0KA 2GHGA 2AYPA 5DRBA 3HUBA 5BX0A 2XK4A 3KMMA 2YABA 3DQXA 1ZYJA 4O0YA 3TG1A 2FSTX 2ZV8A 3ENHA 4Z3VA 3U55A 3ZH8A 2QG5A 5JRQA 3S95A 4OT6A 2W9FB 3U9CA 4WT6A 3LE6A 4F1TA 4B8MA 3BRBA 4UZDA 1F5QA 1BX6A 4LI5A 3VJNA 4HGSA 2RGPA 4IM3A 4FG7A 2XJ1A 3NSZA 4LL5A 3D7TB 4Y8DA 2VU3A 2R3MA 4IZ5A 5TKDA 3UG2A 4C4GA 2R0IA 3O2MA 4O86A 4HGTA 5A4CA 4PNIA 4U42A 3QZGA 3FMKA 3VBTA 1U54A 3PY0A 5JZNA 3QKLA 4KKEA 4YZNA 4X3FA 3VBQA 5I4NA 2O63A 2Z7LA 3U51A 3POOA 4B9DA 3QQGA 4JIAA 4U81A 4C4JA 4G3GA 2IW6A 4ZTQA 1FBNA 4QYEA 2ERKA 1Q8ZA 2PVLA 3K5VA 3LXKA 3HMMA 4BDDA 3NWWA 2CLXA 2CSNA 4U79A 2WXVA 3A7FA 3O50A 4LOPA 2OXDA 2DQ7X 3LFSA 4IZYA 4P90A 1Y8YA 2WTCA 4P4CA 4PTEA 5DHJA 4D2WA 4G3FA 4UMTA 5C8MA 3EN4A 4FSTA 5CU2A 4EK5A 1W84A 2REIA 4X3JA 5BVNA 2A27A 2J9MA 3HP5A 1YHVA 4QYHA 3U6IA 4FK6A 4YGAA 4XG3A 4F0GA 4MD8E 4QOXA 4FV1A 4TPTA 3D2KA 3F7ZA 5AP7A 3MPAA 3C4ZA 3ZSGA 4RWJA 3EQHA 4EJNA 1O6LA 3G15A 5IEXA 3R22A 3R7IA 2W5AA 2JIUA 2O8YA 3DFAA 3R02A 2QOKA 1F3MC 5GJGA 3VBWA 4IJ9A 5CF6A 5ICPA 4FG9A 5FDPA 2YFXA 3BHHA 4BI1A 3PVWA 4ALVA 1YRPA 3FLQA 3UP2A 2P2HA 2PSQA 1EH4A 1ZWSA 3NIZA 1XH5A 2WOUA 2X39A 4FR4A 4H3BA 4M66A 4E3CA 4USEA 2QVSE 4OT5A 4RIWA 4IWQA 2OIBA 3ZLXA 4V05A 3U87A 4CTBA 3F7WA 3DXNA 1FINA 4FKIA 4L45A 4A06A 3F2RA 3QZFA 2WTIA 3NUUA 1JKKA 4E6QA 4FL2A 1ZYSA 1JAMA 4ANLA 4S31A 5TF9A 2I0VA 5FD2A 4XG2A 3UIUA 5JQ8A 4EH9A 3PA3A 4MWIA 2Y6OA 5AUUA 5J9LA 3R2BA 4AA5A 3RALA 4ACHA 4TT7A 3LM0A 5KHWA 1WBNA 4WKQA 4PF4A 1W98A 3OF0A 4PMTA 4WNPA 3UMXA 2Y0AA 2OICA 4J97A 4EQUA 4DEDA 5C4LA 4S30A 4FOBA 4LMUA 4O7RA 5K4JA 5DLSA 4KB8A 4EH2A 2UZUE 3GC0A 5DNRA 3RM7A 3DAKA 4PMPA 4DCAA 5IA2A 4D0WA 4O0WA 5J9YA 4DFLA 4OTQA 3AD6A 3AD4A 4FVPA 1E9HA 3DT1A 3CJFA 3GOKA 3I6WA 4FNZA 4FV9A 4P5QA 3KL8A 3PSBA 3OCBA 4J53A 5CNNA 4WBBB 1P4FA 4FTMA 4PUZA 2BUJA 3ORKA 2GNFA 2HAKA 4QYYA 5DG5A 5E8WA 4D2RA 2ZMDA 3DPKA 4UWBA 2PVFA 2Z7SA 3KRLA 5AP5A 3ZEWA 5M56A 2UZDA 1JLUE 3MFSA 5HICA 3DB6A 1ZZ2A 1RJBA 3DJ7A 4C59A 4EH3A 1QPDA 3DKFA 3NYXA 2J6MA 4ZY6A 2Y8OA 3G2FA 2ZDUA 4YJVA 2B9HA 1OMWA 3DV3A 1WVYA 1ZRZA 2C3LA 3IS5A 4JBQA 3RAWA 4XV2A 4K6ZA 4B8LA 5HGIA 1TVOA 2GFSA 4Y83A 3BCEA 1ZMVA 3ZHPC 5C27A 3KRJA 4BIEA 1Q4LA 2VUWA 5IF1A 3IDBA 4FNWA 4C7TA 5KMIA 1XH7A 3QKKA 3KXMA 1LPUA 4LFIA 2BHHA 5B2LA 1O9UA 2GCDA 3IGOA 3KULB 2C6IA 2XVDA 3QA8A 4BZOA 5DT4A 2JDSA 4D1ZA 3ZRLA 5IUHA 5JK3A 4AW5A 3NX8A 2CKQA 1J1BA 2Z60A 4ANOA 3HKOA 4I6FA 2QOQA 4PMSA 2WPAA 4GK4A 4N70A 4Q5HA 3UIXA 5AP2A 1VYZA 3OXZA 3RNYA 2X4FA 2E9UA 3CXWA 4E20A 4QP6A 2JIVA 1DAYA 2RG6A 3JYAA 4MAOA 3SA0A 3F9NA 4FTLA 4BHNA 4QMXA 3Q2JA 4DGGA 2QC6A 2RKUA 3DKCA 5AR3A 2GHMA 5K3YA 2R3RA 2FVDA 3GCUA 2QLUA 2QNJA 3P7AA 3QUPA 4IB1A 4QP9A 4JG8A 5IA5A 5LWNA 2CNUA 2GS2A 5C4KA 4I5MA 4DCEA 3ZBFA 5A4TA 5A46A 1P5EA 2A1AB 4DFYA 4LRJA 5AEPA 2ETKA 3C4CA 3PIZA 3FHIA 5CVHA 5L2WA 3NUYA 4LYNA 4W9XA 2HZ0A 5DFPA 2CN8A 1U59A 3HV5A 4V0GB 3AC2A 4DITA 1PMEA 3ODYX 2R3HA 4RT7A 1B6CB 5CAQA 3VF8A 1M14A 4JDHA 3NDMA 4RG0A 4K77A 5HBHA 2XKCA 4TWCA 3OWLA 4O2ZA 3Q4ZA 2OGVA 4QMQA 3ZO4A 4DT8A 3L1SA 4ZTLA 3PY1A 5AWMA 2YDIA 3KXZA 4AN3A 3RK9A 2IO6A 4FI1A 3E63A 4NM5A 3PY3A
chains in the Genus database with same CATH superfamily
5CT7A 5FP5A 3BL7A 5HIBA 2GPHA 4FICA 4QNAA 2WU7A 4ORKA 3PE1A 3A7HA 1ZARA 4K8AA 3SXSA 3LFCA 4CGAA 4M67A 1XQZA 2EXEA 4BCJA 3AKLA 3HV7A 3SG8A 2XKFA 4Y5QA 2J0MB 2C5VA 4OR5A 4KIQA 1H0VA 4U8ZA 5EOLA 4L8MA 4C4FA 1G8JA 2R3IA 3UIMA 2ITNA 4G5JA 3TMOA 5GHVA 3GFWA 3PXQA 4FT7A 4GRBA 3ZLYA 4BYJA 4FEUA 2XYNA 3BKBA 3LVPA 4FRFA 2WB8A 3TNHA 3CSVA 2GNLA 5IA1A 4S33A 4ZZMA 1OL1A 2BAKA 3HZTA 4O4EA 3RCJA 3FLZA 3H10A 5LCKA 3Q9ZA 4M14A 3WF8A 4XG6A 4H36A 1IEPA 4CFNA 5DR6A 5F94A 5CXHA 4F7LA 1NVQA 3FAAA 3ALOA 4XMOA 5D7VA 4O4DA 3F2NA 5L2SA 4IM0A 4FT5A 3HDMA 4ASXA 4B99A 4AQKA 3DAJA 4HW7A 4E4XA 3IG7A 2WTVA 2GNIA 1YXSA 2UZNA 4H3QA 1YWRA 1ZY4A 2HW6A 2PVMA 2VGOA 2W1EA 3GI3A 5HBEA 3IKAA 4AOIA 4FEWA 3R83A 2H34A 4LGDA 3ZBXA 4CZTA 3EN7A 3BLHA 3MSSA 2HY0A 4C35A 4R7IA 4DHZA 3QU0A 2ZJWA 5IMXA 1ZLTA 2OF4A 2WHBA 3KC3A 3QQLA 4MHAA 4RIYB 3IW7A 2JDOA 2WEIA 2W1DA 2QODA 4ALUA 5E8SA 4BTKA 4F70A 3VIDA 2EWAA 2QG7A 2XK6A 3SLSA 1IR3A 2JGZA 3B2TA 3QHRA 2B52A 2BZIB 4CYIA 2QQ7A 2IVVA 4G5PA 4WUNA 5DPVA 4BDGA 3BQRA 3QD0A 1STCE 3LQ8A 3WE8A 3GCSA 5TE0A 3D5VA 4HCVA 2OLCA 1CDKA 3B8RA 4IJPA 3GCPA 4YHJA 4QPSA 5DVRA 3TZMA 5E1EA 5HO8A 5JFWA 2RFEA 4YSMA 3R9OA 3UO6A 4CZYB 3KEXA 1L8TA 1OIUA 2YJSA 5BVKA 3SOAA 4Z7GA 3D5XA 1OL5A 4TWOA 1REKA 4EH5A 3BYSA 2C69A 2VTNA 4UXLA 3ORMA 1R39A 4HVIA 2YCRA 3U6HA 2CGXA 4LL0A 5D12A 5KCVA 2HENA 4DINA 4FVRA 5IEYA 4YSJA 4EOOA 1SM2A 2CGUA 1B39A 3ERKA 3QRTA 3ZC6A 4AAYA 1VZOA 5EYCA 3OCTA 4JAJA 5CEPA 3UQCA 3OBJA 4M13A 4XP3A 2UW5A 3V5JA 3C5UA 1VEBA 5IKWA 3UDZA 3SGCA 1JKTA 1YWVA 2ZV9A 3UOHA 4HVDA 1M7QA 2HIWA 4ITJA 4FEQA 4X6QC 4UY9A 2XIYA 5K5XA 5BMSA 4ZSEA 1KV1A 2ZVAA 4TTHB 4EJ7A 4CKRA 1OL2A 1PW2A 3DK6A 2QU6A 5T6KA 3E8NA 5IQEA 4O7ZA 4ZLZA 4O7SA 3P78A 5JFSA 1PXNA 4UYNA 2CKOA 3G0FA 1PXIA 3GCQA 4IANA 1OKWA 2X7FA 1WBTA 3C51A 2WQBA 4ACMA 3GU5A 4J96A 4G3EA 4UZHA 5CI6A 4IW0A 5E1SA 3RAIA 3PPJA 5LXMA 5D9HA 3PIXA 5JFXA 3GC8A 2F2CB 4FKWA 1MRVA 4DH8A 3UGCA 2UVZA 4FIHA 5LCJA 2VTHA 4M3QA 4R1YA 5HE1A 4CQEA 4DA5A 3NUSA 3D5WA 4FZ7A 4FIGA 4GJ3A 1M17A 3FYJX 4H05A 2CPKE 2W4KA 4LG4A 2WAJA 5L6PA 3O8TA 2R3OA 2XP2A 3FI3A 5C01A 3QD3A 5KMKA 2EXMA 1OB3A 3FMMA 2QOLA 2F4JA 3NCGA 3NW5A 1FVTA 4DN5A 4J1RA 5CWZA 4BTJA 3KIOC 3LQ3A 5EHLA 3DBCA 2O0UA 4R78A 5CEIA 3FMJA 2QO7A 2PPQA 4M7IA 3HECA 4J52A 3GU6A 3AKJA 5B2KA 1H25A 5HG9A 5AIKA 5IQFA 5M4IA 3R8VA 3TKUA 5FTGA 5HTBA 4M12A 3EN9A 1YXTA 3R8UA 3LJ2A 3QTUA 4QDVA 1BYGA 2YIWA 3DOGA 4IZAA 4E5BA 3NCZA 4PL5A 1OUYA 4FL3A 5DGZA 1YHWA 3W55A 2G1TA 2QURA 4YJNA 3WZUA 3TUBA 2FA2A 3PUFC 2VWIA 4RA4A 5HCXA 3LHJA 1OGUA 4XG4A 1R0PA 4JQEA 4U5JA 3NUAA 3ZUUA 5IA3A 4PP9A 2CKEA 1ZY5A 5A4LA 5IQDA 4S2ZA 4KIOA 3MESA 4EWHA 4CFVA 5FLFA 4YHFA 2ZB0A 3SD0A 1OGYA 1Q8UA 4NKAA 3E3BX 4APCA 4QTEA 4KSQA 1HCKA 3QTXA 2OW3A 3R7YA 2I40A 4C2WA 3UPZA 3DBDA 3GEQA 2DYLA 4MXAA 2Z8CA 2VWBA 2WMWA 3NNUA 4YNOA 2J5EA 3V5PA 2GNJA 4O84A 3L8SA 1GIHA 2ITOA 5EYKA 1WVXA 4DFXE 2YWPA 3FXXA 3PVBA 2IEWA 3R1NA 4J71A 4V04A 5EW3A 3IK3A 3REPA 4BBEA 1UNLA 3EIDA 5JT2A 2Y4IC 4HPTE 4R1VA 4YURA 4AZSA 4BVUA 1GY3A 3PXRA 4I5CA 1DAWA 3MH1A 4RFMA 4WNMA 4NM7A 5B0XA 5IUGA 3KU2A 3C0GA 4IFCA 4MNEA 2WIHA 3MB7A 4IEBA 2WU6A 1UV5A 4EHGA 1WBVA 2F2UA 2R0UA 4F09A 2OO8X 4RJ3A 1YOLA 4PY1A 5EDPA 4YZDA 1YI4A 2XNGA 3OEZA 4TY1A 3TWJA 2PU8A 3S4QA 1OITA 4ANBA 1UU9A 5AAEA 2YIQA 4ZTSA 3GC9A 1R0EA 4AW2A 2V7OA 4AZWA 3BGQA 3OS3A 4KIPA 1WMKA 1IAJA 3LFFA 3MVMA 2VWUA 3Q2MA 3ZSIA 4F7NA 3Q9XA 4NT4A 4XBRA 1KE8A 2VD5A 3H0ZA 4AZFA 3BL9A 1WBOA 1YW2A 3AGMA 4CSVA 1FMKA 3MBLA 3E92A 4AOTA 3CPCA 4FTNA 2VNYA 4PL4A 3KXGA 2CHLA 4UV0A 3ITZA 1URWA 1G8AA 5IMEA 4J8MA 4EH8A 3GCVA 3UOKA 3W2QA 5KBRA 4K1BA 2F7EE 2HXLA 4JI9A 5CT0A 3FXZA 3ZFMA 2W0JA 1Q5KA 3R1SA 3AG9A 4BYIA 3W0PA 2YEXA 4BWXA 1Q61A 2W05A 4ZTRA 5GJFA 4E4MA 1PMVA 2ITQA 4AS0A 4MF0A 3MW1A 4C4IA 2W5HA 4PNKA 2OFUA 4FL1A 4L68A 2CCIA 1BL7A 3KA0A 4O0UA 2HWPA 2R3PA 5HO7A 2PZPA 4QTAA 4BDFA 5IH4A 2PVRA 4UB7A 3UYSA 4CV9A 4IZ7A 2VTAA 3MH2A 5DIAA 4H1JA 4FIIA 2BZHB 3EKNA 2XK3A 4OTIA 4X2JA 3IW6A 2Q83A 4I20A 4A4OA 1O6KA 1PKDA 3DZQA 3NMUF 3MIYA 5HHWA 3O0GA 3VUMA 4M8TA 1ZOGA 5L6OA 4AOJA 4AUAA 2BRMA 1H8FA 2Y9QA 2C1BA 4YPDA 5FEQA 4J7BA 3MV5A 1JKSA 3PXKA 2YIRA 4ZMFA 3R30A 3KF7A 3TZ8A 4EC8A 4ZP5A 4DEEA 3CLYA 4BBFA 1BMKA 4KAOA 3TTIA 4YJUA 3T3UA 5ETIA 2HY81 3WYXA 3ANQA 4AE6A 2Z7RA 3HRBA 3KGAA 4TL0A 4ZY4A 3ZSHA 2C6KA 3FZOA 3FPQA 4CYJA 3U8WA 2YHVA 3UJGA 3MGYA 4I6LA 3DTCA 3DJ6A 4KIKB 2J0IA 3F6XA 4AWIA 2J4ZA 3GVUA 2VRXA 4Y85A 5FUTA 4DEAA 4O7TA 5HLNA 4FKTA 2BTSA 5AX9A 4L3JA 2WTKB 3QTRA 2QOHA 3A2CA 5A3XA 3RAHA 2VTMA 4EQMA 1Q8WA 1ST4A 2I1MA 2ITPA 1GIIA 3FLSA 3FZRA 5DI1A 3TKHA 5L3AA 5ETFA 3ZMMA 3R0TA 3VUGA 4DF3A 3MN3A 2CNVA 3FMHA 3LOKA 4MX9A 1OPJA 4DYMA 2W1FA 2EB2A 3A7GA 2W1HA 4MUQA 2V0DA 5BV3A 3ID6C 3Q3BA 1Y91A 4RIXB 2HOGA 2VO6A 4LM5A 3I60A 5AA8A 1TQIA 4BGGA 2JDTA 4GKIA 2BZKB 4KBCA 3F3WA 2A0CX 2BDWA 3EL7A 3E93A 4QMWA 3SW7A 5DA3A 1RQQA 4N6ZA 3II5A 4I5HA 3K2LA 5AP0A 4E4LA 4XG9A 2HYYA 4ITIA 3T9TA 3UZPA 3UNKA 1XMMA 1SMHA 4QMYA 2J5FA 3OEFX 5D7AA 5LVLA 4KS7A 4WIHA 3WIKA 2X0GA 4I94A 2IZRA 4FUXA 4PDPA 2BHEA 4L53A 3VUKA 4NIFA 3G9NA 3FI4A 2OK1A 3FZ1A 3HMPA 3OXTA 4MF1A 5ANDA 3VNTA 4AGWA 3ZTXA 4D58A 3L9LA 3IW5A 1TZDA 4NWMA 1TQMA 4O38A 3RPYA 4ZY5A 4GCJA 4J8NA 4TXCA 2WMVA 5FGKA 3V5LA 2NRYA 5CSPA 5DBXA 4AGCA 2C6LA 1ND4A 3IDPA 3KB7A 2VV9A 4JOAA 3AC3A 2OIQA 2Z7QA 1W7HA 2HK5A 4RC3A 5FM2A 4D0XA 2YITA 3G5DA 4CCBA 4FZAB 4XP0A 4NYEA 1OVEA 3FKOA 5CASA 4IHPA 4BTFA 5K0KA 4OTHA 4EKKA 4O83A 3I0OA 3PSDA 3AQVA 5AP6A 4F9YA 4FKGA 1Q62A 4FV7A 4KNBA 4BCGA 3KXXA 5JQ5A 2VTJA 3FY0A 5B2MA 2HWOA 3UDTA 4PP7A 5A6OA 3QTSA 4FYOA 3KKVA 2ETMA 4XOYA 4QTBA 4XLVA 4C38A 3UVQA 3EQGA 4A4LA 2XK8A 5DEYA 2NRUA 2G9XA 4AT3A 4O7YA 2H8HA 1Q24A 2GTNA 3QCXA 1H4LA 4ONAA 4UEUA 4C61A 3CPBA 2CMWA 1ZZLA 2YACA 4ACGA 4KA3A 2BAJA 3BE9A 1JOWB 3QQHA 4X2NA 3SX9A 5HI2A 4Q9ZA 1M7NA 4YO6A 5EM5A 4F78A 3N9XA 5IA4A 5C03A 2C5NA 4E93A 3ZS5A 5KE0A 3Q9YA 3UNZA 3H9RA 1H26A 3VBVA 4HVHA 3UVPA 1J1CA 4QT1A 4FKSA 5FWKK 3AT4A 4RJ5A 4O6LA 3CD3A 5BNJA 4FTOA 1T45A 1JNKA 4X2GA 2AC5A 4F1MA 4LGGA 4DHJA 3DB8A 4Y5HA 4M15A 5K0XA 1H1PA 3NZ0A 3ENMA 4IM2A 3ZO2A 2XCHA 3BLRA 3EQCA 3FBVA 3V5TA 3VWAA 2W9ZB 2PULA 5HVYA 1SYKA 4DAWA 3SXRA 4CFFA 2XJ2A 2GQSA 3KXHA 3OFMA 4HYSA 5CZHA 2XAOA 2JLDA 3HX4A 3UO4A 1Q97A 5E90A 2ZAZA 4GU9A 1Z5MA 4IDTA 2C6DA 2WGJA 3OCGA 3ORNA 4N57A 3PG1A 3V01A 4YJQA 2WMUA 5I9XA 3Q04A 2WEVA 3IOPA 1KOAA 4HCTA 2QR8A 1PYEA 3A8XA 3PZEA 4J95A 5K4IA 3O96A 5AV1A 2X6DA 2C30A 2XNPA 4LGHA 3ZFXA 3CBLA 1ST0A 2IZUA 4U3YA 3K3JA 5GJDA 3GQIA 3A99A 2OJ9A 3HLLA 3E7VA 3HV3A 4I22A 4MK0A 2C68A 4XJ0A 1XO2B 2XIXA 1LR4A 3DY7A 4TYEA 4O0VA 2IG7A 2UUEA 4C57A 5CQUA 3TYKA 4CMOA 3PA5A 4BKJA 2IJMA 3M11A 3MYGA 3KXNA 3PFQA 4BFMA 4I23A 4JBVA 3FMLA 3EFJA 5EW8A 4C0TA 5LVOA 3HAVA 4D1SA 1UWHA 5IQCA 5JZJA 1Y6BA 2EXCX 5EH0A 5G6VA 4YLLA 3HUCA 5HE2A 2XNBA 3R8MA 3L9PA 4BDCA 4BI2A 4X2FA 4O7LA 5LMKC 3KY2A 1NXKA 4FGBA 4A9UA 3S00A 4MEDA 2A4LA 4TNBA 5AUXA 4O81A 3TEIA 1WZYA 5E91A 2J51A 5L2IA 2XJ0A 5I9UA 1P2AA 3R9NA 4IAAA 4AZTA 4BB4A 1FVRA 3VUTA 3I81A 2GS7A 4ANQA 4N6YA 3FC1X 4FMQA 3NRMA 3D0EA 2O64A 5FTQA 4G6OA 4GK2A 3T8OA 3BV3A 4FOCA 4AAAA 2RF9A 4MH7A 5HOAA 5BQ0A 5C8KA 3WILA 3VBXA 3NUXA 1JSVA 4FZ6A 5CF8A 2P55A 4O0XA 3NGAA 3PWYA 3CGFA 3V51A 3VULA 3WYYA 3OCSA 3RJCA 2NPQA 4X0MA 3FLWA 3VS1A 3R2YA 3TNQB 3O7LB 4YMJA 5HX8A 5M51A 1U54B 2W06A 2B1PA 3ZDIA 4A4XA 3O8UA 4X3FB 1Z57A 5EHYA 4C4EA 2BMCA 5JGBA 5K9IA 5EW9A 5T3QA 1JQHA 4A7CA 3DAEA 4QDEA 4C34A 3LCSA 5EK7A 2IW8A 5I9YA 3W8QA 4OBQA 2XALA 1XH8A 2WTDA 4IAKA 4IB0A 3MJ1A 3TT0A 3UDBA 3PTGA 4RBLA 3TIYA 3FPMA 2QO2A 1APME 3OW4A 4FT0A 2PVJA 4M68A 3I4BA 3PRIA 4DGOA 4R7HA 4ZS0A 2YAAA 3Q4UA 3IW8A 3LKMA 3VS6A 3OT3A 3MVLA 3SVVA 1IG1A 4V0GA 3PVUA 2WMQA 2PE2A 1ZMWA 4IC8A 4MKCA 3RHKA 3KCKA 3KK9A 3R21A 5HE0A 3VS4A 1ERKA 4FKUA 4AGDA 3KQ7A 3F3UA 4FSMA 4AT5A 3GT8A 4N0SA 5AUVA 1KUTA 2XIKA 2W1GA 4IAIA 3D9VA 5AP1A 4ASEA 4BCFA 5M57A 4JDJA 4F63A 5L4QA 3HMOA 3EYHA 4HPUE 1YXXA 4X6RA 4Z16A 2IVSA 4EK3A 5M07A 4KINA 4BIBA 4CMTA 2W1IA 4RIWB 3GU7A 3OUKA 4K9YA 4EZ3A 1NT2A 4I4EA 4O21A 3DLZA 1YQJA 4B7TA 3Q5IA 5EKOA 4F65A 3P9JA 3QALE 4DC2A 5GZ8A 5J79A 3QXOA 4FA2A 5KMMA 5A4EA 3R7GA 4ZLYA 2YDJA 3DKOA 2X0OA 4ANMA 4UMRA 5DT3A 1WVWA 2OU7A 1H24A 2P3GX 5H2UA 4GVJA 3P08A 4FYNA 4NU1A 2G2IA 3MA6A 4RVLA 3JR1A 4O2PA 4EOMA 4WO5A 2F7ZE 2CN5A 2XNEA 1QPJA 3LPBA 5TO8A 3WF6A 3WOWA 5CAPA 3FWQA 4EZ7A 3MTFA 4F64A 1XBAA 2OXYA 3C1XA 4NCTC 4QQJA 1TFFA 2H6DA 2VWZA 4QD6A 4FSNA 4ZTHA 1L3RE 2VZ6A 4M69B 5IQBA 1AD5A 2OJGA 2BVAA 4P7EA 3D14A 5HG8A 3VQUA 1ZMUA 1OL7A 4GW8A 5CTPA 3TZ9A 2YA9A 2ZDTA 3PXZA 4Y73A 4BCQA 1PY5A 4FJVA 4Q5EA 1SVGA 2EB3A 1XJDA 4K18A 4LV7A 2YN8A 3ORTA 2UW4A 3NEWA 4OTRA 5ANIA 5JKGA 4J99A 4OUCA 4DG2E 4DH3A 5CYIA 5KHXA 4FTJA 3DBEA 3QZHA 5HESA 3KRXA 3ZXTA 3VC4A 4RIYA 4BDEA 3ZYAA 4CMUA 4CXAA 2QCSA 4AW1A 1XH6A 4QMOA 2XMYA 3QRUA 4MD9E 4HZRA 2WIPA 2VTIA 4TKSA 4BZDA 4OTGA 4D28A 4BI0A 2WMXA 3E5AA 5D41A 4YJOA 1BI8A 4N4SA 2XYUA 5CVFA 5BYLA 4K2RA 3QUDA 4NTSA 1U46A 1W2DA 3M42A 2XKEA 4G9RA 3FYKX 3WARA 3R9DA 1UNHA 5HTIA 4L01A 4NM3A 4QP8A 3ML1A 4BDIA 4O0RA 3E62A 3ZRMA 3SV0A 3E3PA 3DCVA 3EN5A 2Z2WA 4BJJB 2X7OA 3P79A 3WBLA 5CY3A 4C3RA 3UO5A 2PMLX 2XARA 2R3FA 4BF2A 4PWNA 4JR3A 4FEXA 4GVAA 4UBAA 2BRBA 4FEVA 5AIRA 1IAHA 4F08A 5CF5A 2YM7A 4R3PA 3DQWA 5FBOA 3O5AA 3AC1A 2WNTA 3NNWA 4ZJVA 4KSPA 3FE3A 2UW7A 3WZJA 3KVWA 3BE2A 3BV2A 3R8ZA 1U5RA 2UW6A 3BU6A 3VHKA 3COIA 4EYMA 5CF4A 5JGDA 5CNOA 4JG6A 4F9CA 4QQCA 3VW6A 4WSYA 4AF3A 1MRYA 2WMTA 1H08A 3F3TA 3PPKA 4QMVA 4D5KA 3E87A 4ARKA 4Z9LA 2XKDA 4NEUA 4QMPA 3IOKA 4YJRA 5AR8A 4BCKA 5LVMA 4OTDA 3E8DA 4ZTNA 2P4IA 3BYMA 3TKIA 4YZBA 2XM8A 2QI8A 5KKRB 4IIRA 4IWOA 3FMNA 3WIGA 4CG9A 3W2PA 3Q6WA 3NIEA 3GC7A 5T68A 4RX5A 4CRLA 3W2SA 1W82A 5HTCA 3QWJA 3QQKA 2VWVA 4FV5A 2C0OA 1CTPE 2JEDA 5DR9A 3GB2A 3ZM4A 4AFJA 4D2TA 3FKNA 4TWPA 1IA8A 5DWRA 4FTQA 2XIRA 3PYYA 4IVDA 4RZVA 1GNGA 4AN2A 1OUKA 4EUTA 2ACXA 4PDSA 4YLJA 3A7IA 5ETCA 4L67A 5E8ZA 4DEGA 2XB7A 3HMIA 4GYIA 2VO7A 2X7GA 5A6NA 3UOLA 3KREA 3V8SA 1B38A 2P33A 5EYMA 2IPXA 4BR3A 5JMSA 2RFNA 5EHOA 4GG7A 4FKVA 3TV4A 3VS5A 4DE4A 4AQCA 2OH4A 4L3LA 5ANGA 5AUWA 3C4FA 3V5QA 4Q9SA 4YJPA 4UN0C 3VBYA 5A54A 4E5WA 5KMNA 4I6HA 1UU3A 3NYOA 2EU9A 1LP4A 4UALA 5ANJA 3R63A 3EZVA 4FTKA 5AP4A 2UW0A 4ASZA 4MQ1A 4PDOA 4RX8A 4IWDA 2YZAA 3CKXA 5HVKA 4O4BB 4EZ5A 4LRKA 4MXOA 5CANA 4OBPA 4WRGA 5AV3A 5HORA 5LVPA 2PYWA 3BGZA 4KABA 4FTIA 4TYHB 4WBOA 2C6EA 2PTKA 2WMRA 2XAMA 3W0NA 2QOFA 2YM3A 3NNXA 4HYHA 3UBDA 4BZNA 5HEZA 4EOPA 1Y8GA 5H8GA 4L52A 4I6QA 3ATTA 4JQ8A 3JPVA 5JSMA 1HOWA 1S9IA 4L43A 4YJTA 4G3CA 3PJ1A 2WTJA 4GFMA 3L8XA 2EVAA 4WG4A 3OTVA 4Q2AA 4FSUA 1MQBA 3KF4A 4QMLA 3LXNA 1YOMA 2XBAA 4I21A 3F5UA 1G3NA 3N4VA 4RLLA 4XX9A 4JS8A 3SHEA 2ITZA 2NNWB 5I9ZA 3W0SA 2OZAA 3HEGA 2P0CA 3FKLA 5KO1A 3RAKA 4MBLA 2OBJA 1P4OA 4ENYA 2O5KA 4I0RA 5CX9A 3BHTA 4ZK5A 4CTCA 2UZWE 3CP9A 2VO3A 3VQHA 5D1JA 4TYGA 3VVHA 4W8DA 2HXQA 4ZIMA 5IQGA 2QOBA 4BCHA 4U0IA 3VS2A 1Q99A 2C3KA 2SRCA 3AMAA 4FZDB 3LFBA 4KD1A 3OC1A 2XANA 3OROA 4M0ZA 4LUDA 5EDRA 4AXDA 1FOTA 1V0BA 4QMMA 3Q4TA 3PDTA 3P7CA 3TV6A 4AZVA 3QA0A 2JBPA 4NKSA 4RWLA 3Q4CA 4GFGA 5H3QA 3UP7A 4O6EA 4Y46A 3V8WA 3EQBA 1SVEA 1K3AA 2O3PA 1M2PA 2YLEA 3QRJA 4WA9A 4QP3A 3JXWA 3QZIA 3V8TA 4QP7A 2YM5A 4RX7A 1PJKA 1NVSA 4IMYA 2BCJA 3MVHA 3P86A 3AT3A 4XRJA 3H3CA 5EI2A 4BDKA 1GJOA 3L8PA 4ZSGA 3P7BA 4JRNA 4CV8A 1LUFA 2CNQA 5E4HA 2HZIA 5M06A 3F5GA 3MB6A 2ETRA 4I92A 4AA4A 4TRLA 4O7NA 1RW8A 2WQMA 3RZFA 4QRCA 4I24A 3GQLA 5KUPA 5AV4A 1XH4A 3UPXA 3W1FA 3WE4A 4G3DA 4CQGA 2FYSA 5DR2A 4FVQA 4CKJA 3BHUA 2DUVA 3H0YA 3HA6A 4MQ2A 3RNIA 4EK8A 4LV8A 1QMZA 3F88A 3S2PA 4BCPA 5AA9A 4OAVB 2C0IA 2PE0A 5AADA 3LJ1A 1I09A 3QLGA 1HCLA 2R3GA 3QF9A 4BGQA 4DFZE 5EG3A 5EQYA 4YJSA 3NPCA 5FEEA 3EL8A 3TDWA 4FZFB 2PUPA 3M2WA 5I9VA 3PJCA 3CQWA 2OWBA 3BYVA 4C33A 5AP3A 5F9EA 3DGKA 3V3VA 5ACBC 5C26A 3CTHA 4YC8A 4FE2A 2YAKA 3O51A 4ACCA 3QGYA 5F1ZA 2UW9A 1O6YA 4U7ZA 4HVSA 1MP8A 3ANRA 3CEKA 3FMEA 3I1AA 3MA3A 3P0MA 3UDSA 3V04A 2VTSA 2JKOA 3A61A 1FMOE 4FV6A 3HV6A 2UV2A 4EH6A 4DH7A 2PZRA 4EOJA 5CAUA 5ACKA 4NW5A 5J95A 3PIYA 3HNGA 3LW0A 4GIIA 4NJ3A 1P14A 2XEYA 5DH3A 4S34A 5DYJA 4D1XA 2R3QA 3POZA 5F20A 2ITTA 2HZ4A 4O7WA 3CTJA 2FH9A 2QLQA 4GSBA 3NUNA 2VTRA 4KIKA 4QP1A 3O17A 1A48A 5HNBA 4BKZA 4C3PA 5AAFA 2B9IA 2F9GA 1H07A 3FC2A 3ACKA 1YVJA 4FC0A 4JBOA 4R5YA 4UXQA 2E9PA 4FKQA 1U5QA 2X2LA 4EBVA 5IZFA 4MCVA 3W0RA 4JL9A 3JVSA 1R1WA 2ZOQA 4TNDA 2QOIA 1JVPP 3THBA 2WMSA 5CU0A 3TNPC 4D55A 4GV1A 2BROA 4QYGA 4IAFA 3DKGA 2PVNA 4H1MA 3PXYA 4I4FA 3HV4A 3OY3A 2FGIA 1H1SA 3W8LA 4TYJA 5I0BA 2PUNA 2CGWA 4W4XA 2X0PA 5LWMA 2RSVA 2BPMA 3RK7A 3F3VA 3QTQA 3NW7A 4IH8A 4O96A 4TYIA 4F4PA 4GG5A 4NZWB 4BWKA 4CRSA 3HYHA 4WOVA 4XNEA 2X8IA 5BVOA 4YZCA 3TV7A 1YXVA 1GZNA 3KK8A 1XBCA 2Q0NA 2WMAA 5HU3A 2X6EA 3BLAA 2R9SA 3W32A 1SNUA 2G2HA 4RFYA 3EFLA 5FDXA 4DG3E 4IX6A 5BUJA 1YXUA 2XEZA 1PKGA 4XV1A 5CAOA 2ZMCA 3O7LD 4V01A 3JVRA 2PHKA 2BZJA 2X8DA 4X7QA 4EQCA 3NYVA 4R8QA 4MXCA 3EHAA 5C9CA 2V22A 4EK4A 1SZMA 1FGIA 1TKIA 3R8PA 4AW0A 4JMQA 3FDNA 4MNEB 1XKKA 2B4SB 3TI1A 4QMNA 1RE8A 3BYUA 2W96B 3LM5A 3LQ5A 3MPMA 4EOSA 1MUOA 1PXLA 2X9FA 4OTFA 5B7VA 4EOLA 4CFXA 4C36A 1CMKE 4ZS4A 2X2KA 2ERZE 1PF8A 4JDIA 4PPAA 5HE3A 3MWUA 1J91A 3Q60A 1F0QA 4HNFA 5HNGA 2ONLC 4C2VA 4ERKA 4O82A 5D11A 3TACA 3EJ1A 4IDVA 2YM4A 4AXAA 1RDQE 4UWCA 3TUCA 4QMSA 4ZZNA 3WF5A 4FSZA 3RBWA 4LOOA 1JKLA 1PMUA 3GU8A 3TIZA 3ZUVA 3LMGA 2W17A 4FX3A 4IX4A 4LUEA 3SRVB 4RVTA 5L8LA 4O1OA 4YPSA 2J0JA 3QRKA 4JDKA 4OTWA 2B7AA 2GDOA 1YOJA 3EZRA 4GS6A 4Y72A 2R3LA 5FM3A 2PUIA 4MVFA 1UVRA 3LFAA 3EQIA 2PMNX 2VAGA 3D5UA 3AMBA 1FPUA 3BBWA 3BELA 3PP0A 4QMUA 4G17A 3MFUA 5LOHA 5J7BA 1A06A 2WELA 1OKVA 5M44A 4G6LA 3GFEA 4G31A 3OT8A 4BIDA 3D7TA 5DRDA 5EKNA 3JS2A 3PLAE 2H9VA