5KX8A

Irak4-inhibitor co-structure
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
297
structure length
285
Chain Sequence
TRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLATTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEVMRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Interleukin-1 receptor-associated kinase 4
publication title Efforts towards the optimization of a bi-aryl class of potent IRAK4 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 285
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5kx8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5kx8A01
1ZMVA 4FKQA 1V0BA 3ULIA 5BX0A 5AJQA 2ZMCA 3EFLA 4D4SA 5J95A 4LQMA 3ZFMA 4KIKB 4DF3A 3C13A 2XKFA 5LCKA 2C30A 3R83A 5I9UA 1A06A 2BDJA 3CKXA 3EYGA 4FV7A 4EL9A 5E8UA 2NO3A 4ZZNA 4V04A 3CY3A 3HUBA 3VQHA 4DH1A 5FEDA 3FL4A 4O1PA 2GTNA 2W4JA 2XBAA 4L43A 1OKVA 4GK2A 3OTVA 4X2KA 4IFCA 4HVSA 5L3AA 4IX6A 2G1TA 3ZLWA 4D4YA 4ANQA 3WI6A 4CG9A 4I92A 4IDVA 1ZOEA 2J4ZA 3HV6A 1JKKA 5HE1A 5L2QA 4CZUA 3ETAA 4A9UA 2E9PA 3UIMA 4WG3A 4FIGA 4HYUA 5AP2A 2OXDA 3I0OA 3ZXTA 4BFMA 1Q4LA 3DU8A 4BBEA 1YRPA 3PZHA 3CEKA 4ZTMA 4M15A 2WIHA 4AG8A 1H0VA 5J79A 3HRCA 3T3UA 4FG9A 3UC4A 5A4LA 2IO6A 3NR9A 3QCXA 1UA2A 1PXLA 3IS5A 4MNFA 2CLQA 4TNBA 3DY7A 5TT7A 4EEVA 1H00A 4KUJA 4KBKA 3D5XA 4C33A 3I7CA 5KZIA 5J1WA 3MIYA 1O6YA 2WXVA 1BI8A 3SDJA 2CKOA 3UJGA 4AOIA 3JY0A 4Q9SA 2VO3A 3WF8A 1REJA 3C0GA 1KWPA 1ZLTA 3R28A 5G1XA 3VBXA 1Q8WA 2BAKA 3IGOA 1YXTA 3TZMA 1AD5A 2PZYA 4FA2A 3GC9A 4I6HA 1O6LA 3FZSA 3MB7A 3HDMA 4BCGA 3FLNC 4CTBA 3U6JA 4DHFA 2CN8A 2PTKA 2XIXA 4KS7A 2OZAB 4W8EA 1CSNA 5CAPA 3KRRA 3LJ0A 4BDHA 4ZSAA 1BMKA 1H25A 2NP8A 4DINA 4N6ZA 4IZYA 2B52A 3F69A 4YPDA 3TN8A 3LHJA 4DGNA 1TQMA 2C6LA 5AX9A 4GUEA 3TUCA 3DFAA 5LWNA 2J7TA 2JD5A 3ZEWA 2GPHA 4R6VA 1JOWB 3OY1A 4EZ3A 4BICA 2NNWB 3QYZA 3ZRKA 2X8IA 4LGDA 3FZRA 4NUSA 3IW7A 4YC6A 3WYXA 4EOPA 5D7VA 5AR4A 3PDTA 3JR1A 4S31A 4XV3A 4FSZA 4GIHA 4YHJA 1JBPE 4J7BA 2GNGA 3PVBA 3OCBA 4P2KA 2KTYA 3MVHA 5JMSA 2PVRA 5EI2A 2O63A 2BAQA 5HCZA 2BCJA 3VF9A 4J95A 5HVKA 1PJKA 2HW7A 4YJTA 3DKOA 3QL8A 5CASA 2UZTA 3CTJA 2B54A 3TCPA 2GS2A 3MVJA 3NW7A 2VX1A 4FNZA 4HJOA 1W0XC 1NVQA 1GY3A 2GQGA 4FV2A 4L9IA 3QCSA 4CYIA 4XJ0A 3LOKA 3WOWA 3EJ1A 3ZO3A 3R00A 4DEDA 3UMXA 4E20A 1O9UA 3SV0A 4O7RA 1JAMA 4MWIA 4U45A 4W4YA 3UOJA 4JT3A 1BL6A 4O86A 4YJNA 4JRNA 3HUCA 3NGAA 4NKAA 4XLVA 5JZJA 4HZSA 4W8DA 5CQWA 5BYLA 1G5SA 1R0PA 4HNIA 1T45A 3TNQB 2B53A 3IKAA 4EHGA 3OT3A 4WUNA 4R8QA 4DH8A 2Z7SA 4KAOA 1F0QA 2BVAA 4WSQA 3PVUA 4IVAA 5BVOA 4TXCA 5IPJA 4G3DA 2XK8A 4QMPA 2PL0A 4M69B 3E64A 4QYEA 4UXQA 3Q60A 5IQBA 3AD4A 3BBWA 5C26A 4FZDB 2CNQA 2AYPA 4BCHA 4EOMA 5E4HA 4ZS4A 3FZ1A 4DG2E 3DKGA 4KS8A 4F64A 5IDNA 1JSUA 1FVRA 5AR8A 3NPCA 5ETIA 5FEEA 3TUDA 4JI9A 3DNEA 4K8AA 4CLJA 2XF0A 2WTJA 3TACA 4BCOA 4FYNA 4FL3A 4XP2A 4C4IA 4XG9A 4GKIA 3A7JA 4ASEA 2QOHA 3K54A 4GFGA 2GDOA 4D2VA 2VO7A 2XYNA 5IU2A 2I7QA 4F1OA 4EJNA 5AA9A 2W99B 5HTIA 2G9XA 2W1DA 4O7NA 2CGVA 4IWOA 4LYNA 1CKJA 4FSNA 3P4KA 4JS8A 2YIRA 3IDCA 5ANJA 2GNHA 4AW1A 1XH8A 4G34A 4RC2A 5EFQA 5EOBA 3ZM9A 3NIEA 5E8TA 2YAKA 3RZBA 3RGFA 3FYJX 4EC8A 2OIDA 3ZM4A 4X6RA 1DM2A 4RX8A 3TTIA 5CF4A 1PYXA 1YXUA 2WTVA 3A7IA 3F88A 3HNGA 3HP5A 3B8RA 2B9HA 4O96A 4TYGA 4WSYA 3LXKA 5DFPA 3VVHA 4FK6A 4P90A 2DS1A 5CT7A 3F6XA 3EQIA 2A2AA 3EMGA 3ZZWA 2YWVA 3HMPA 3UQGA 1ZYLA 4UX9A 3IW6A 1VZOA 3A8XA 3ATSA 4FX3A 3KK9A 3RK7A 3A61A 5A14A 3ENMA 2QI8A 3V5WA 3AG9A 3UNJA 4XS2A 1OL6A 4NTSA 1E1XA 4PQNA 1QMZA 1ATPE 4U40A 4OLIA 5F94A 3PFQA 3CP9A 2JFLA 1WAKA 4FYOA 4GJ2A 4R7BA 3ODYX 3ORPA 3TG1A 3O17A 1E9HA 2PE2A 4LRKA 2O2UA 4AQCA 3FZOA 5EW9A 2VWYA 2YLEA 4FKUA 3AC3A 3GCVA 5HGIA 3F3WA 4BTMA 4QQCA 3V6SA 5CX9A 4CXAA 3ZFYA 3ACKA 3D2IA 3OP5A 5DG5A 3VAPA 4O0VA 1L8TA 3CGOA 4TTHB 4JG8A 5JFSA 4KSQA 4I1ZA 4WBBB 2W5HA 1H1RA 2IVTA 3LQ5A 3QQFA 3TL8A 4BDEA 4BI1A 3OFMA 4DA5A 4GMYA 3E63A 4J96A 4X2NA 3RK5A 4I4FA 1Q24A 2AUHA 4IX3A 5GINE 4KWPA 4XG8A 3HV5A 4CSVA 5HG5A 1REKA 4P5ZA 3BU5A 2YIWA 4RLKA 3OUKA 4O0RA 4W4VA 3D2KA 3VS7A 3TUBA 1RDQE 4HCUA 2C0IA 2Y4IB 5EQEA 3NYXA 4H1MA 3CR0A 2VWZA 1BKXA 4MVFA 3UG2A 1NA7A 2F2CB 4DT9A 5AEPA 3VIDA 4BKJA 3I81A 2P3GX 1FMKA 2OF2A 3KXXA 4ONAA 1ZYCA 2WTIA 3SXFA 3EB0A 4EHVA 4JX7A 4AUAA 4EH6A 3FHRA 4USFA 3QRKA 4J97A 4DTBA 2V7AA 2HZIA 1PHKA 4AE6A 4RIXB 3Q5IA 4W4XA 4Q2AA 2I0YA 4N70A 1Y91A 2VTIA 4HW7A 2WQEA 1OZ1A 3HV7A 2ITYA 2B4SB 2WKMA 4JBQA 3VC4A 2E9OA 4AZEA 2YCRA 5H3QA 4R78A 4XLIA 2Z8CA 3K2LA 3ZFXA 1QL6A 4YNEA 5AR7A 2FO0A 5J1VA 5C03A 5HVYA 4ACCA 2R9SA 3R63A 3I5ZA 3ORLA 4P5QA 1JKLA 2HY0A 2XKEA 1R1WA 5HNIX 3FDNA 4EOSA 3UO4A 5IA4A 3BPRA 3AOXA 3E7OA 1YDRE 4XP3A 3R7YA 5DR6A 1SM2A 3GQLA 3SOCA 5DYJA 4H36A 3GT8A 4ZTSA 5HU9A 1P2AA 2XP2A 1M17A 3Q04A 5M56A 3TI1A 2ZVAA 4YSMA 3BBTB 4BZOA 3FC1X 5CZIA 4OTWA 4XG3A 4YJUA 4YLJA 3MWUA 1KE9A 3C0IA 4I93A 4DG3E 5HBEA 1STCE 2PMIA 2W9FB 3FYKX 3PUPA 2Y6MA 4LRMA 1OGUA 3PJ8A 4QMZA 5FD2A 2IVUA 3RM6A 2RF9A 3R9NA 3HA6A 1T46A 3PXKA 1OI9A 3GEQA 3PPKA 3POZA 1WBNA 5TO8A 3P0MA 2PVKA 2OIBA 3R2YA 3RAIA 4F0GA 3OCGA 2C0OA 5EI8A 3ELJA 5K0XA 3G0EA 4TW9A 5DVRA 3BHYA 4C38A 2G15A 4MEDA 2QCSA 4KIPA 1WFCA 1R3CA 2P0CA 3TDVA 5C27A 3GBZA 4CV9A 4DEGA 3V8TA 3LCKA 4WA9A 5ACKA 4OT6A 4QMMA 4W9XA 5CVGA 4MD7E 3KEXA 4G5JA 4PRJA 4QQJA 3RCJA 2UW9A 2VWWA 1RQQA 5FRIA 4G3CA 2JKKA 2BTSA 3D94A 3MI9A 3ZOSA 2WGJA 4Y8DA 5HOAA 5CF8A 2XCKA 3JY9A 3M1SA 2EVAA 5E8SA 3TTJA 3E3PA 3AGLA 4ZTLA 2XK3A 5HLNA 2UVYA 2CPKE 2YITA 3BV3A 4QP7A 3ZBFA 2CGUA 4MXXA 4XG7A 3KGAA 3VHKA 1PMEA 4C0TA 5IQFA 5KMJA 4D1SA 2WMUA 2BIKB 2R3OA 5M4CA 3DV3A 3QHWA 5C1QB 1PXMA 1CKIA 3UQCA 1PXNA 4O7ZA 3DBDA 4RRVA 4RX5A 3AC1A 5M07A 2XJ0A 4HNFA 5ITAA 4IC7A 3S4QA 3HAMA 2F7EE 3HL7A 4LL0A 3BIZA 3MS9A 5ETCA 2F49A 2JDRA 2YACA 3R8ZA 4O83A 2PUIA 5H8EA 3PLSA 2FUMA 2PE1A 4MAOA 1OECA 4TYHA 4R1VA 2CJMA 4U80A 5F1ZA 4Q9ZA 4C4HA 4ASXA 3JYAA 3ZC5A 4YJOA 4WG5A 1L3RE 3G5DA 1XWSA 3PWDA 2QHNA 4FT7A 4A4LA 3S00A 3HX4A 4FSUA 1MQBA 4QPSA 2CMWA 4YZCA 2YDIA 4JDHA 4JQEA 5J87A 5IQAA 5KMMA 4E4MA 1NXKA 3VS6A 3PIZA 4X3FB 4IX4A 5JRQA 3D7ZA 5HD4A 5BVWA 4LG4A 4BGQA 2YN8A 4BZDA 3KXHA 3W2OA 5AP7A 5E8VA 3TKHA 3O0GA 2JGZA 5EOLA 4TWCA 5J9YA 2XIKA 2C3JA 2R7BA 3UYTA 4L67A 3MTLA 2YM6A 4FKLA 3NLBA 2WMBA 4ZSGA 5HD7A 2VTNA 4FIHA 5FXSA 4IAYA 1UV5A 2ITWA 4JDKA 1OM1A 5IA3A 5TF9A 3ORTA 4I21A 4QTAA 4RC3A 2Y6OA 3JS2A 2J0JA 2UZBA 3EFWA 4FSWA 3K5VA 2LGCA 3ZU7A 2X6EA 2NRUA 4ERKA 4D58A 2XZSA 3VBYA 5D41A 3WF9A 3F3VA 3MA6A 4F70A 2HZ4A 4FTRA 5LVPA 4YR8A 2YAAA 4L7FA 3W18A 2QR7A 3VS3A 5HEZA 1UWHA 3CCNA 3KF7A 3Q5ZA 1MRUA 1XBBA 1YWNA 3LCDA 4QYHA 5EM6A 3NWWA 4J8NA 4XH6A 4BDIA 5M09A 3GB2A 1H4LA 4YJVA 4QMOA 3A8WA 5IA2A 3AC4A 3QX4A 2BKKA 2W17A 4DFXE 2Z7QA 4FI1A 2BDWA 3QLFA 2JEDA 5BYYA 4R77A 4U9AA 3MYGA 2X8DA 4LFIA 1MUOA 2RSVA 2PVNA 5AR3A 4IXPA 3PIYA 2PVHA 4II5A 4XV9A 1FBNA 4E5AX 4FC0A 4PPAA 3POOA 5CSXA 3F82A 2YM5A 4R5YA 2ZAZA 4I6FA 2WMQA 5DN3A 5EKOA 3TNWA 3D15A 2PVMA 5GZAA 3FXZA 4MK0A 5I9YA 1YI6A 4TT7A 1W7HA 5CS6A 4V05A 3EYHA 3DTCA 4F7LA 1YQJA 4FT9A 2A19B 2IVVA 3PSCA 5CU3A 4JL9A 4U5JA 1WBSA 4FKTA 4L42A 1IG1A 2B0QA 4HYIA 1PMVA 5F4NA 1K9AA 3QD3A 2R0UA 3NMUF 3DBQA 5GIPE 4UZDA 1G8AA 3GP0A 3UVRA 3L8VA 3C1XA 5HQ0A 3QQUA 1MRVA 5HVJA 3F5XA 3UPZA 5J9LA 3MJ1A 1PW2A 4EONA 4AA4A 4EOOA 4A9SA 4D4RA 1Y6BA 4CT1A 1ZOHA 2B55A 1KV1A 4DEBA 3UZTA 2XK7A 3KCKA 4JQ7A 4FMQA 4C3PA 1WVYA 2CCIA 3HMIA 3PA4A 4TYIA 3VN9A 5A6NA 4GW8A 5JQ8A 4FTCA 5I9WA 2QG7A 2ETRA 3IO7A 5IISA 3R73A 4WD5A 2OJ9A 3R01A 5DT4A 4RFYA 3LFBA 2BZJA 3E8CA 3OG7A 3UIXA 3R8UA 2I1MA 5JFXA 5BPYA 2GHLA 1H0WA 4YMJA 3GU7A 4FV4A 3QRUA 3DJ6A 4WO5A 3KRJA 4U43A 5H8BA 3VRYA 5AAGA 4EOJA 4F4PA 1SMHA 4EQMA 4OTGA 5AMNA 2J6MA 1U59A 4WT6A 3PRIA 3HLLA 1SNXA 2VWVA 3V5TA 2J9MA 5HLPA 4RX7A 1OUYA 3DDPA 5M06A 3RVGA 5CI6A 3DXNA 3PJCA 3ZSHA 1OB3A 4DCEA 3UOHA 3B8QA 4B8LA 3P78A 4ZSEA 2BPMA 4BDFA 4D2TA 4QTEA 4D2WA 1XH6A 3QRTA 4FIEA 5HO8A 3LKMA 5FBNC 1BI7A 4FGRA 2W9ZB 2XMYA 3KXZA 4PMPA 4O82A 3TZ8A 4MCVA 4C4EA 2UVXA 2QU5A 2VTMA 3GGFA 4J52A 3EH9A 4KABA 3RKBA 4PWNA 1V0PA 5DNRA 3LW0A 4QP8A 4O2ZA 5LMKA 3PWYA 1XJDA 3PY3A 3DB8A 1BLXA 2HWPA 4CQEA 3ORMA 4DT8A 4FIIA 5EQPA 3MW1A 1NT2A 3NAXA 3FLSA 3VBVA 4ZY5A 5KMLA 4XBRA 4APPA 2QO9A 3VBQA 3W33A 2PZRA 4YJSA 5DE2A 4OTFA 1H24A 5DWRA 2XB7A 2BDFA 3RNYA 4WHZA 2V0DA 3U4WA 4JNWA 1I44A 1APME 3JPVA 3R2BA 2CDZA 5EW8A 4LMNA 5E8ZA 2YERA 4X7QA 2WO6A 4XBUA 5J9ZA 3FV8A 2GQSA 5K4IA 4PNKA 5DGZA 1ZMWA 2IG7A 2G2FA 3VUGA 4FV8A 3UBDA 4MF1A 4EUUA 2QO2A 4RJ8A 2OWBA 3PRFA 4TWNA 4E6QA 5AP1A 3BGPA 5CLPA 2DWBA 3O8PA 4BGHA 3QTIA 3QWKA 4JAJA 4D1XA 3M11A 4NM5A 5D7AA 2OO8X 3GU8A 3ZLYA 4RMZA 1QPCA 1CMKE 3GU6A 3V5LA 3W1FA 3D9VA 4XG6A 1GIIA 5JH6A 4C37A 3JVRA 3NZ0A 4RFZA 1YVJA 4RT7A 3D4QA 4AZWA 3SC1A 3C5IA 2C6KA 2EUFB 4QQ5A 5GZ8A 4ZLYA 3ANQA 5HX6A 2FH9A 4I5MA 4G3GA 4ZK5A 2GU8A 4MD8E 1H1PA 2GNFA 3FI4A 4YHFA 1XH4A 5AUWA 3R9RA 4R1YA 4TYJA 4EHEA 1NW1A 4WNKA 4L44A 2GCDA 2WMXA 3TNHA 4FR4A 5LJJA 3TM0A 3E88A 2IJMA 2ZYBA 5FXRA 3OOGA 2WHBA 2YDJA 2YJSA 4NH1A 3P7BA 3KN5A 2V7OA 3AC8A 4E5WA 4JXFA 1OL5A 5M55A 3ZLSA 1JLUE 4JBPA 3G0FA 4UEUA 4NIFB 3ZDUA 2ITPA 4I5HA 2BRNA 4IQ6A 3Q4ZA 2XK9A 4DH7A 4YBJA 1MQ4A 2HIWA 2YCFA 3Q4TA 4KIQA 2C3LA 5CU6A 1Y8YA 3H0YA 4BRXA 3CS9A 3QTQA 3DGKA 2BIYA 2ETMA 3DJ7A 3EZRA 4ANOA 4JIAA 3RPVA 4E6DA 4D5HA 1PMNA 2IZTA 5IA5A 4UWYA 2WEIA 4OTDA 3Q9ZA 4DFZE 3D7TA 1IA9A 1K3AA 4S2ZA 4GU9A 3FLZA 4PP9A 4C4FA 5IA0A 4CMOA 3FQEA 3QQJA 4GEOA 3COKA 4XV2A 4D0WA 3LQ3A 4TNDA 4ENXA 3P23A 3CD8A 4FKIA 4MKCA 4RIYB 4EJ7A 4R3RA 4M97A 2VUWA 4I24A 3DK6A 4NTTA 5EG3A 3V5PA 4D9TA 3G33A 3S95A 3PA5A 4AAAA 4JX3A 3OZ6A 4FE2A 4YJRA 4LUEA 4YP8A 4CV8A 4FSQA 5LVOA 1OPJA 3ZO2A 1SVEA 4RX9A 3PJ2A 2XIZA 5HORA 3MY0A 3ZEPA 3SRVA 2R7IA 4F9YA 5L2WA 3OEFX 4PF4A 4FTOA 4PL3A 1Q97A 4A7CA 4LI5A 4D5KA 4BWPA 4O7LA 3DBFA 3MPMA 3U6IA 4A9YA 3EHAA 2WD1A 1YOMA 1Q8YA 2X9EA 3NUNA 4G16A 2EB2A 3TDWA 3OC1A 4CMUA 3BE9A 4QYGA 1OL1A 4M14A 4D1ZA 5FM3A 4EK4A 1CTPE 2BMCA 5AUUA 3CQUA 3O71A 3P79A 3LE6A 5EW3A 3I5NA 3P08A 5IQIA 2BRMA 4TWOA 3D14A 5EDRA 4GVJA 1SYKA 2PE0A 3I4BA 4DG0E 2ZJWA 5E8YA 3TZ7A 4ZMFA 3MA3A 3BLHA 3IK3A 3LCOA 3MFRA 4JDIA 3DNDA 4LV8A 4NYEA 5JKGA 3QTRA 5CU2A 4ZS0A 3MPTA 5AV2A 5HE2A 2A1AB 4C2VA 2VO6A 4YBKA 3RM7A 2G01A 3QF9A 3RAHA 2YIYA 2XRWA 2YLFA 3NNUA 3KN6A 2ZMDA 4B7TA 4YPSA 2XNGA 1PXJA 2OSCA 4FSYA 5ANIA 4O84A 3U54A 1H01A 4O7VA 3JVSA 3OF0A 4WNPA 3R8LA 2I6LA 3LXNA 3EFJA 1WVWA 4CMTA 4GK3A 2GTMA 4RJ7A 2WU6A 3DPKA 5LMKC 3DFCB 4FEQA 3QQGA 2IW9A 1URCA 5CF6A 2C47A 4ZMEA 2CHLA 4MBIA 5BVDA 3NYVA 1ZRZA 5KBRA 4FOCA 1VYZA 4G9RA 4IANA 4FVRA 5AV3A 3U87A 3O7LB 5LARA 1H08A 4AT4A 4PDPA 4IAFA 3KXNA 3MH1A 4QNAA 3UYSA 1GIHA 3AD6A 1UU9A 5L2IA 1P4FA 5CU0A 1XBAA 1Y6AA 2OU7A 1ZYDA 4O2PA 2ONLC 3HV3A 4ZY6A 2B9JA 4BDCA 1JNKA 5CSVA 1GZOA 5CALA 4GYGA 1ZZLA 4BKYA 4IB3A 4ANBA 2WMWA 4YZNA 2WZJA 3ITZA 3F5PA 4IB1A 5AUVA 2OXXA 1Z5MA 3BEGA 4FEWA 3H9OA 2W06A 2C0TA 3LFSA 2J51A 4W9WA 5FDXA 3NUXA 2OGVA 3H9FA 3RZFA 4C8BA 2PHKA 4FV9A 3UGCA 3TNPC 1H26A 3TKUA 4G2FA 4O7SA 2LAVA 3MFSA 4O91A 3ZXZA 4GS6A 3E8EA 3IONA 4FUYA 5CWZA 4BDKA 2EU9A 3QD2B 4U7ZA 4U97A 2V55A 4CFXA 4I6BA 4JBVA 2FSOX 4WBOA 4ZZMA 3RP9A 3QTSA 4PTCA 3FMKA 3ORKA 2XUUA 4OT5A 3OXIA 1OIYA 4AGWA 2XK6A 3G51A 4BCIA 4RPVA 2X2KA 3ROCA 3SX9A 2EXCX 4FKSA 4HYSA 4YJPA 4I5CA 4RJ6A 5KMNA 2A27A 2P55A 1CKPA 4QP1A 4JR7A 4O1OA 4X2GA 1OVEA 2JIIA 3PP0A 4C59A 5CYIA 4I0TA 4K77A 5A4QA 2XM9A 4FV6A 3KRWA 4XRJA 4EH7A 3QCYA 4X6QC 5IUIA 3EN9A 3WZDA 3ZMMA 4C61A 4CYJA 4BYIA 4EKKA 2WQOA 4QOXA 3WZUA 3FE3A 2VD5A 1OIUA 1XR1A 2XJ1A 3LPBA 3QA0A 4XG4A 3QALE 2W1HA 2O8YA 3QWJA 3A2CA 4IBMA 5TKDA 2OF4A 2CCHA 4FG7A 2HXLA 4RBLA 1KE5A 4IDTA 2X7FA 4HPTE 3NSZA 4WKQA 3QGYA 3QTWA 3LM0A 3RAWA 2UZNA 5IH6A 5M53A 4M67A 3DK7A 3DOGA 3F9NA 2QD9A 1M14A 3JXWA 2GNLA 4DE4A 2BHEA 4KINA 4V0GA 4F09A 2JITA 3RBWA 4YZDA 1UU7A 5CAVA 4NIFA 4UY9A 2XNMA 4H05A 2H6DA 4EWHA 4FTAA 2ETKA 1K2PA 2OK1A 3C4XA 5JT2A 3NAYA 1ZXEA 4U3YA 3RJCA 4DEAA 3LVPA 4G5PA 3MH2A 5KO1A 4BGGA 2R3GA 1XH9A 4G6NA 3W10A 4ARKA 1ERKA 4EH5A 4MWHA 4DGMA 3DS6A 3DXQA 4QP9A 1SVHA 2ZB0A 4IM0A 3PXYA 4I23A 4F6UA 4BB4A 1TQPA 3FQSA 1ZAOA 2BRHA 3MDYA 3OOMA 4TYHB 4GJ3A 4P7EA 2JBPA 4GG5A 3KB7A 1YHSA 5BUIA 4IHPA 5DA3A 2XS0A 3UNKA 3FKOA 3CY2A 4ZJIA 2UZWE 3C4ZA 5C8NA 2VX3A 4BHNA 5KCVA 2R3KA 2FB8A 2BAJA 3K3JA 4PDOA 4AGUA 1OPKA 2VNYA 2QOCA 3VUHA 3A60A 2PSQA 1IRKA 2QOBA 3OT8A 3VUIA 1LUFA 4RIYA 2ITVA 2P2IA 3NNWA 3F3TA 3KA0A 3FUPA 5FTOA 2XYUA 4D2PA 1DAYA 3KMWA 2IWIA 2R64A 2WTKC 3DBCA 4QYFA 4MTAA 4BBFA 3CXWA 2Y7JA 3V5JA 4EZ5A 2W7XA 4GCJA 2HK5A 3NUPA 2C3IB 4PPCA 2HAKA 4RC4A 4TY1A 5IA1A 3VS5A 4DGGA 4QMNA 2PWLA 4C57A 4F9BA 4Z3VA 1UKHA 5A9UA 2J5FA 3G2FA 5AP5A 2A4LA 2QKRA 3P86A 1WBOA 5L2SA 4RWIA 4O22A 4EI4A 1AGWA 4AZVA 4NKSA 3S3IA 5KBQA 1XH5A 4YTIA 3OHTA 4FSTA 1B39A 2J0MB 4LMUA 4NW6A 3BWFA 1ZYSA 3TKIA 3WZKA 4C36A 1XQZA 5AR2A 4CT2A 4V01A 3OW3A 4A4OA 1YWVA 4QMQA 4M12A 1ZWSA 2OW3A 3NNXA 3RWPA 4X2FA 3W2RA 5HBHA 4C3RA 1ZYJA 2ITNA 1M7QA 3E5AA 1Q5KA 4GYIA 4EOKA 2HWOA 3ENHA 5ANDA 1U5QA 3R1YA 3ZSGA 3HAVA 5CQUA 2HZNA 2C68A 1GIJA 1Q8ZA 4CRLA 5CAOA 1WCCA 2R3IA 4Y72A 4EZ7A 2YM7A 3BE2A 3RAKA 4H3QA 4Y85A 4YGAA 1P4OA 4XRLA 3TIZA 3LFQA 3UIBA 4F0IA 3DQWA 3VBTA 2BTRA 2OG8A 2R5TA 4IWDA 5EM8A 4CRSA 5I3OA 3BYSA 3Q4UA 4JRVA 5CAQA 4WRGA 2PVJA 5JZNA 4CLIA 2YA9A 3GCQA 4EOIA 4ZY4A 1WMKA 4K11A 5HG7A 2C1AA 3HEGA 4AN2A 2VTQA 1JPAA 1YOLA 2VU3A 4KRCA 3ZO4A 4C4JA 5I5ZA 5IUHA 3LCSA 5DIAA 1JKTA 1B6CB 2V62A 4Y73A 3A4PA 3R9DA 3RHXA 4M13A 4EH4A 4S32A 4YHTA 3R8PA 5IZFA 3C9WA 2YJRA 2R0IA 3VHEA 5LWMA 5AM7A 2X4FA 5E8WA 2ITXA 4QMYA 1PRYA 3RCDA 4IW0A 2E9VA 5EHLA 4FEUA 3HA8A 4BN1A 2VO0A 5AAFA 4BZNA 2F4JA 4GFMA 3T9TA 4EOLA 3R7IA 4GRBA 5C8MA 3IW4A 3LJ2A 2QOIA 3R21A 4LM5A 3IOKA 1YDTE 3GQIA 3FMHA 2P33A 3ACJA 3AT2A 3SHEA 4FSRA 2OJJA 4FL2A 4G17A 3OUNB 4FTLA 5AP0A 3RPSA 3CTQA 3V8SA 4DEEA 2WMSA 1OITA 3CPCA 2CGWA 3M2WA 2ZV2A 4IVDA 3LXPA 4X0MA 2IW8A 4MXZA 2WAJA 4IIRA 4MNEA 3FI8A 3GNIB 3ANRA 2FSMX 3BX5A 2Y0AA 1KUTA 3VS2A 2ZOQA 3Q32A 4GSBA 2JC6A 4FBXA 2YZAA 3QC9A 3C5UA 3ZC6A 5FQDC 1Q3WA 2W4KA 3VO3A 4IVCA 4KIOA 4AP7A 3PPJA 4DH3A 4RFMA 2BFYA 4F1TA 2B7AA 3LMIA 4JG6A 1H1WA 5HICA 2UW8A 4HZRA 4FTMA 4C35A 3BHUA 5IUGA 2Q0BA 2NRYA 2C69A 1PYEA 3LFDA 5CNNA 2QODA 2UW6A 4ZSLA 4WNMA 3UO6A 4JQ8A 3LIJA 4MQ2A 4QMXA 4BC6A 3E8DA 3KULA 3GFEA 4EORA 3PSDA 5C01A 3BU3A 3HZTA 4MYGA 2XNPA 2VRXA 3QTZA 1VJYA 3MH0A 5EYMA 4D0XA 3HP2A 3CJGA 2O65A 3G6GA 4EQUA 2UZVA 4FTKA 1ND4A 4ZTNA 2OJGA 5IKWA 3NEWA 1OPLA 3PVWA 4LGHA 4DFUA 4LL5A 2XM8A 4NZWB 4OTRA 1KV2A 4NJ3A 3C4EA 2CKEA 1SNUA 3BQRA 3MPAA 3CQWA 3VW6A 1OL7A 2RFDA 3ZDIA 2XKCA 2RFEA 2BZIB 1UNHA 5J7BA 2QQ7A 5AP3A 5H9BA 5EYKA 4FKRA 4TWPA 4ERWA 3DAEA 1P5EA 2XNEA 3CD3A 4QTCA 5IEYA 2QR8A 4IZ7A 4MXOA 5HHWA 4ZIMA 1TQIA 3Q9YA 4BHZA 2PULA 5GHVA 2XKDA 4CCBA 3AT3A 3GUBA 3WF6A 2XIYA 5HE0A 2JAVA 2E9NA 3D5WA 2OLCA 4O38A 2CN5A 1HCKA 4FIJA 2I40A 4AFJA 4D4VA 2IZSA 2R4BA 2BZKB 4X3JA 4DLJA 2GQRA 3RI1A 4EK5A 2GMXA 3MGYA 2CNUA 2GFCA 5FUTA 5FM2A 3GOKA 4BIEA 4LOQA 2ZDTA 2OZOA 3FSKA 3L1SA 5AP6A 3HECA 4WNOA 2ZM3A 3I6WA 3PY0A 3BKBA 2XCHA 1ZOGA 5G6VA 3KVXA 4UWCA 4E3CA 1ZY4A 2IVSA 4CFVA 2VN9A 5B7VA 4GT4A 4HYHA 3T3VA 5EKNA 5DR9A 4BR3A 2PUUA 2RL5A 2BHHA 2ZDUA 5ANOA 4XG2A 5TOZA 3FMEA 3ET7A 3GOPA 4IZ5A 3FXXA 4JIKA 3DZOA 4G9CA 4ALVA 3OMVA 4NM0A 4Q5HA 2QNJA 3KC3A 4IEBA 5D10A 5CXZA 4BDJA 1WVXA 5HU3A 5BUJA 5AP4A 3F5GA 3D0EA 2R3RA 4RG0A 1UU8A 4O27B 3L8SA 5DH3A 5LCJA 1W98A 2VTSA 3DT1A 1W83A 4M68A 5ETFA 4AE9A 4BIDA 5AUYA 1U5RA 5ACBC 4F9AA 4EK6A 4AW2A 3FZTA 5GZ9A 3K5UA 4QPMA 2RKUA 4FZ6A 3O50A 4CNHA 3D83A 4E4XA 2XEZA 2F57A 2W96B 4ITIA 4CFWA 4IADA 3W2QA 2PU8A 3AC2A 3AC5A 4U44A 5DOSA 2NPQA 2W5BA 3DQXA 3FI2A 3QQHA 4AGCA 2H9VA 3Q9WA 3VUKA 2BR1A 2R3FA 3QYWA 1PMUA 2OJIA 2ITQA 3NRMA 3D7TB 3MSSA 2EB3A 4PL4A 5EHYA 5KMIA 3VJNA 5BQ0A 3QTXA 5ANGA 3QQKA 4JOAA 3QGWA 3ZRMA 3SVVA 4L45A 4DFBA 3CBLA 4E7WA 4UV0A 4RVTA 3QD0A 3R9OA 3H4JA 3QX2A 4IMYA 4YJQA 3BHTA 2ESMA 2XNOA 2WMRA 3GU5A 4FZFB 3NDMA 1YOJA 4GK4A 4A9RA 4OAVB 2R3NA 1GNGA 4FV1A 4KBCA 2WQMA 1V1KA 3MFUA 1J7LA 4QP4A 4AOJA 3TIYA 3DA6A 3WE8A 3W2CA 5KKRC 1FMOE 1X8BA 3Q9XA 4FSMA 2QHMA 4F08A 5IDPA 4K6ZA 4R7HA 4KNBA 3DDQA 3O2MA 3SRVB 5BMMA 4BCPA 4RA5A 5LXMA 5E9EA 3L9MA 1KE6A 3NYOA 4FKVA 5D11A 2JDOA 4FKOA 3NCZA 4O6EA 4ZXTA 4D2RA 4DC2A 3A7GA 5K5XA 2QG5A 2KULA 4BCKA 2E2BA 4U41A 2CGXA 3EIDA 2ZV9A 5E1EA 4DCAA 5FEQA 4Y5HA 3TNIA 3C51A 5AUTA 2JDTA 4FICA 1YHVA 3EQFA 1VR2A 2Z60A 4JG7A 4PL5A 3TV6A 4ZLOA 3TT0A 3EN5A 2VTAA 4PV0A 3O51A 1J1BA 2WTKB 5K3YA 5EM5A 2OXYA 1F5QA 3DLZA 4FKJA 4FTJA 4GT5A 3GCSA 3MY5A 5JFWA 2CKPA 4UMRA 3VS4A 1OBGA 5JQ5A 2XK4A 4O0TA 1OL2A 2Z2WA 5TE0A 5IQEA 4EH9A 3UMWA 5HTCA 3EN7A 2W1FA 4UMPA 4GU6A 2W0JA 3ZBXA 1H27A 4G3FA 4AF3A 4QP6A 1YW2A 2OI4X 4IFGA 4E8AA 4AXAA 3VUMA 3KF4A 5F9EA 3NUSA 3HDNA 1H1QA 1CDKA 3RHKA 5IQCA 2FSTX 3AT4A 4QO9A 5B2MA 3E62A 4I5PA 3LM5A 3R9HA 5HIEA 4QTDA 5HLWA 4W4WA 2YWPA 1TVOA 3ORNA 4HGSA 3IOPA 4QYYA 3FL5A 1KSWA 1YXXA 2HY81 2H96A 1RJBA 2WTDA 2CSNA 2QONA 4N0SA 1Q8UA 4UXLA 4EH3A 1E1VA 4CFMA 2ITTA 2QLUA 2X1NA 3Q3BA 1Z9XA 2P4IA 4KD1A 3FMLA 4FT0A 2W1GA 2R3LA 5CAUA 5KX8A 5L8LA 4YTHA 3QFVA 4ZJJA 3ZS5A 5IH5A 4O7WA 4RGJA 3ZUVA 5C8KA 5CI7A 3UNZA 3LMHA 3EQRA 4FVQA 1R0EA 2WTWA 4TPTA 3OTUA 5KMOA 2W05A 3IG7A 2ZV8A 2V5QA 3OCSA 4QP2A 2UV2A 1DS5A 5ANKA 5E7RA 4E6CA 2IW6A 3B2TA 5A4CA 1ZZ2A 5HG8A 4DFNA 3UZPA 3KVWA 4CCUA 1Y8GA 4B6LA 1LEWA 4F63A 4N6YA 1OKZA 1DI8A 4ZSJA 5A4EA 3FSFA 2O3PA 2QVSE 2UVZA 3I7BA 2Z7RA 3LMGA 4ITHA 4KBAA 4RQKA 2J5EA 3OROA 4NJDA 1GZKA 2ONLA 1OKWA 3QTUA 2C5OA 3BGZA 4FTTA 4Q5EA 4CKJA 2WMAA 4B9DA 3P7CA 5H8GA 3VBWA 5KHXA 2XEYA 5HCXA 1ZY5A 4DEHA 4ID7A 3PJ3A 3FPQA 2H8HA 3KXGA 3O7LD 4DN5A 5BYZA 2YM4A 4WOVA 4M3QA 3FXWA 4UWBA 4YTFA 3QKLA 1WBTA 4HGEA 3PE2A 3C50A 2PVYA 3O23A 4R7IA 2WOUA 5K0KA 3WBLA 3FJQE 1J3HA 3CTHA 3BGQA 3A4OX 5KZ0A 4Z7HA 2YM3A 4FK3A 5DI1A 1FQ1B 3QCQA 3VNTA 3P9JA 3DKFA 2C6TA 4RVMA 2RG6A 4L3PA 5FP5A 4G1WA 2FA2A 4O0SA 4AACA 4EYJA 1URWA 4ANLA 4K0YA 5JK3A 3W8LA 4DFLA 2HELA 1R39A 3UTOA 4ZAUA 4AWIA 3NX8A 4IAZA 3ZO1A 4J99A 4ANNA 2ZV7A 2VTLA 4U8ZA 4CEGA 3COMA 3GCUA 3K3IA 3NUYA 4GIIA 2UZLA 4V0GB 3U9CA 3N4TA 2OJFE 4J53A 3UODA 2RFNA 3NW6A 4RIOA 3SG8A 4RLLA 5E8XA 3GC8A 2HOGA 4NCTC 5DRBA 4AW0A 3VRZA 4BI2A 5JGAA 1QPJA 2F7ZE 2J0KA 5HKMA 4O0WA 4YZ9A 4OBQA 4N4SA 4F9CA 3F7WA 3N9XA 5CENA 4C7TA 3DKCA 3CC6A 4L68A 4S30A 3DBEA 3MN3A 2JBOA 3VS0A 3IPHA 1TKIA 4AOTA 4FNWA 4PPBA 5DHJA 3KMUA 3PVGA 1G3NA 2Q0NA 3F5UA 4G3EA 5KHWA 3LFAA 5CNOA 4QQTA 3U8WA 4U79A 3UC3A 3FMDA 5K4JA 4FL1A 2RIOA 4M8TA 4IB0A 5FP6A 3G6HA 4FKGA 3CIKA 5JSMA 4FVPA 5CSWA 2JDVA 4DGLC 3R04A 4TRLA 1HCLA 2YZLA 4HGLA 4FNYA 4BI0A 3LJ1A 5L4QA 4BCFA 2C6MA 4IX5A 1OKYA 4C62A 4U81A 3FAAA 4H3BA 2X0GA 3A7FA 2GHMA 3R30A 5FGKA 4IJPA 3WZJA 5M51A 3OVVA 1Q3DA 4D55A 1IASA 4EBVA 2QLQA 1ZARA 3PP1A 5CU4A 3MTFA 2QOKA 4GH2A 3QAME 5EHOA 3TV4A 3UVQA 4Z7GA 5J7HA 4ORKA 2Y8OA 3ULZA 2OH4A 3GC7A 4HOKA 1U46A 4PX6A 3S0OA 1PXPA 3RPRA 4KKEA 4KRDA 5DR2A 5M4FA 2X2LA 2VX0A 3GI3A 4EQCA 3H0ZA 2WB8A 1YWRA 3PG3A 4CZYB 3DLSA 3LQ8A 4MXYA 2B9IA 1QPDA 4CQGA 3NW5A 4XHKB 3TZ9A 3ZSIA 4JLCA 4CD0A 3PZEA 4BCNA 2F9GA 3OBGA 3QUPA 3R7GA 2QU6A 3MBLA 3ID6C 2PVLA 5GJFA 3R7OA 2JKMA 3BZ3A 3BHVA 1W82A 3EFKA 4GT3A 1PY5A 4EK8A 3DCVA 1SVGA 4OUCA 5IG1A 1GJOA 3NCGA 4NW5A 5AWMA 3C4WA 4KKHA 4YZMA 4C34A 5L6WL 4E1ZA 3N4VA 2BALA 5IQDA 4RZVA 4AW5A 4NM7A 2VTRA 4AT3A 4MBJA 4UZHA 5M4IA 1OBDA 5C4LA 5IH4A 5HO7A 4B4LA 4EWQA 4ZTHA 3QUEA 4TKSA 3LAUA 3A99A 3QZIA 3VJOA 1J7IA 2R3HA 3F2RA 1W84A 1UKIA 3F66A 1XKKA 4JAIA 2UUEA 4HGTA 4AS0A 3PY1A 4PNIA 1ZMUA 3FHIA 2YIQA 1UWJA 4L8MA 3SXSA 4FKWA 4DITA 4ZZOA 3BYOA 3EKNA 4FTNA 4HCTA 4GKHA 3E93A 3SQQA 4JJRA 4K18A 4FUXA 3NUUA 3BYMA 3I60A 3CJFA 5HO6A 2ERZE 3ALNA 4DH5A 4IWQA 5CANA 2IN6A 3PG1A 4QP3A 5DBXA 3T8OA 2UW4A 3KXMA 5HNBA 4PP7A 3DB6A 3UP7A 4FEVA 5CEKA 5HX8A 4XOYA 3KCFA 3QQLA 2FGIA 5KKRB 2JIVA 2X6DA 4NFNA 4UBAA 1YI4A 1WZYA 5DPVA 4F1MA 5KUPA 3REPA 4XEYA 5B2LA 1H28A 4MNEB 4LOPA 3P5KA 4IWPA 1M2RA 3KRLA 2Y9QA 5BMSA 1GZ8A 1WBPA 4RVKA 5AA8A 1RE8A 4ACMA 3PXQA 4XV1A 4GG7A 3V51A 4IC8A 4X2JA 4RIWB 5K5NA 4C3FA 3UQFA 1EH4A 5EI6A 4ASZA 5A6OA 1R78A 2J0IA 3UVPA 3EWHA 4NFMA 3Q2JA 3MESA 4RQVA 2XRUA 3ZUUA 4FOBA 2C6OA 4F7SA 3PXZA 4M84A 1M2PA 3MFTA 4X3FC 4L3LA 3C4CA 4KB8A 3ORIA 4NK9A 4XNEA 1GAGA 5DT0A 2UW0A 2C3KA 3WE4A 4EUTA 4LGGA 5CXHA 4O7YA 3COIA 3SW4A 1U54A 3BLQA 2G2IA 3U6HA 4YC8A 3UOKA 1FVTA 2Z7LA 3F61A 4PDSA 3KULB 3ORZA 3UDBA 1H8FA 3CE3A 3H3CA 2O64A 5CT0A 2VV9A 4FTUA 2B1PA 4IJ9A 3NVMB 2C5NA 5I9ZA 4QMUA 2YCQA 3EN6A 1BX6A 2PK9A 3QRJA 1NVRA 3SOAA 3V8WA 3QRIA 4GV1A 4LRJA 4OTPA 4OAUC 3D5UA 4G6LA 4GUBA 3VUTA 3QKMA 3SW7A 3ODZX 3OW4A 4A4XA 4GFOA 5CEQA 3RPYA 3E8NA 4K1BA 2BRBA 5FXQA 5I0BA 2YM8A 4RVLA 3UOLA 3BLRA 3V01A 4D9UA 3QBNA 3QLGA 3V5QA 2YABA 2QURA 1BYGA 4BDBA 2BROA 1WBWA 5AX3A 2R3QA 2UW7A 3IDPA 1YDSE 3VF8A 1UNGA 3ZHPC 3R0TA 3WILA 5M44A 4XP0A 4YLKA 1M52A 2PMLX 2UZDA 5D1JA 2PVFA 2J2IB 5DLSA 3SXRA 5I3RA 3MB6A 3OCTA 5FLFA 2I0HA 4WUAA 1QPEA 3CSVA 2HXQA 2YHVA 3BHHA 2BKZA 3F7ZA 3QXOA 1GOLA 4Y5QA 3BEAA 4QRCA 3V3VA 2YDKA 3UO5A 1Z57A 2R3MA 2VWBA 4K9YA 2C5YA 3PXRA 4DYMA 2WIPA 4BY9E 4DGOA 1KOAA 2DUVA 1JKSA 2GNJA 3UE4A 3OS3A 4RSSA 3HMOA 4YO4A 1KE7A 3R02A 5CEIA 3FC2A 3ZUTA 2OIQA 4UYNA 4F6SA 4B99A 4F0FA 5CEMA 4EHZA 1CM8A 3OWJA 3KL8A 2OICA 2OFVA 1WBVA 4HPUE 2VTPA 5J5TA 1YXVA 5M57A 2B9FA 3KMMA 3QU0A 3TWJA 4CG8A 2PY3A 1FGKA 3Q96A 3HKOA 4H3PA 4BKZA 2VWXA 4AFEA 4O21A 4F6WA 5HI2A 3S2PA 2VZ6A 2ITUA 4KKGA 5T6KA 3ZH8A 4A07A 4BDGA 4F65A 4OGRA 3OWKA 4KIKA 4DLIA 2YFXA 3I1AA 5AV1A 4ACDA 4U42A 1V0OA 4USDA 3WF7A 3Q52A 1DI9A 4EOQA 1JQHA 3AMYA 2X9FA 3LFEA 4B0GA 4TYEA 5LVLA 2HYYA 3P7AA 4K2RA 5BUEA 3FI3A 2QO7A 1PKDA 4J8MA 4OTHA 4R5SA 4APCA 4LUDA 4BWKA 3W32A 5DT3A 4N57A 3OBJA 4OBPA 5C9CA 1PKGA 4E93A 3BQCA 1YHWA 3PXFA 4IH8A 3HMMA 4FV5A 4YU2A 3AD5A 5B0XA 3HRBA 4IM3A 4BTFA 2C4GA 2X7OA 3OEZA 5HESA 2WOTA 5AUZA 2VTJA 3M42A 5BVNA 1IA8A 4FF8A 3FPMA 3MV5A 2QOFA 2IZUA 2XNNA 5JFVA 2GNIA 4MF0A 5LVNA 1IR3A 2XBJA 2VTOA 4AZFA 3H30A 2G2HA 3ERKA 3CQEA 5HZNA 4PTEA 2R2PA 3EQPA 2FVDA 3QC4A 2VAGA 2ZB1A 5FG8A 4BVUA 4ASDA 4NEUA 2X8EA 3TJCA 1OIRA 1A48A 1J91A 2I0EA 1LEZA 2RG5A 4DAWA 2QC6A 5HTBA 5L2TA 4CZTA 4AT5A 5M08A 4FNXA 2O0UA 3G9LX 4I0RA 4HVHA 4YUQA 3WZEA 2RFSA 2JKOA 1UVRA 4RJ4A 5KE0A 2JLDA 4I94A 1HOWA 3QHRA 5GJDA 3LLAA 4O7TA 4H1JA 1A9UA 2OZAA 3FBVA 4NWMA 4WIHA 5EYDA 3W8QA 4EH8A 3VWAA 4MQ1A 3R1QA 4EBWA 3BRBA 3BYUA 4FZ7A 5HBJA 3E87A 3P1AA 3AGMA 1XHAA 3HVCA 3IECA 4J98A 2UW3A 3W55A 4EK3A 5GNKA 1XO2B 1BUHA 2AC5A 2VNWA 4ITJA 4LOOA 2WFYA 5HCYA 3R1NA 3R7UA 4QMWA 3WYYA 4DBNA 5ICPA 5K9IA 4EYMA 3FMJA 3O8UA 4R3PA 4QNYA 2PUNA 2IPXA 3A62A 4MX9A 1XBCA 2GS7A 1YI3A 3BWJA 3W2PA 3FY0A 2H34A 4CFNA 1YKRA 4Z9LA 2W1CA 2O5KA 3PJ1A 4PMSA 4HVGA 4BL1A 3HV4A 3RNIA 4YTCA 3F2NA 4RIWA 5I9VA 2UW5A 2YCSA 4DBXA 3EQGA 3Q6WA 4PMMA 1PF8A 1F3MC 3UP2A 4BBMA 1M2QA 3O8TA 1IAHA 2WEVA 4PMTA 2JAMA 2W1IA 4NSTA 4U3ZA 1H07A 3N51A 4KA3A 5GIOE 3R22A 2Y4PA 2EXEA 4F9WA 4E73A 4M0YA 2BFXA 5I4NA 5F20A 4YSJA 5M4UA 2W5AA 2OKRA 2X81A 5CVFA 5A3XA 1BL7A 4O6LA 1S9JA 3SKCA 3MVMA 3FKLA 4AN9A 3SGCA 5H2UA 3PSBA 2REIA 1PXKA 2ZM1A 3OD6X 2WNTA 4OTIA 3NNVA 3R6XA 4IAAA 4EH2A 3Q6UA 5CSPA 2WTCA 2X7GA 3U4UA 4FTQA 3CGFA 4FTIA 3MH3A 5EM7A 4CKIA 3BYVA 3O96A 4MXAA 3MVLA 4BCQA 4F99A 3I0QA 4XCUA 4ACHA 2EXMA 3QZGA 4L6QA 4M69A 3TJDA 2A0CX 1P14A 3A7HA 3AXWA 3CPBA 4IAKA 3RWQA 4EKLA 2RGPA 4CVAA 5LVMA 3ALOA 2ZM4A 3EN4A 5A4TA 5LQFA 2F2UA 4JDJA 4O0UA 2WMVA 5E92A 5D9HA 3II5A 4YLLA 2R3JA 3VUDA 3ZLXA 3KK8A 3EQCA 3AMAA 3UZRA 1FINA 2DQ7X 2VGPA 3QXPA 3ZYAA 3ZZEA 4AZSA 4RWJA 3CLYA 3F3ZA 4BWXA 2W1EA 4FZAB 4WRSA 1JWHA 1JVPP 4QPAA 2ERKA 2AC3A 3HGKA 3FLQA 3U51A 4DTAA 5AAEA 3EL7A 5JGDA 4CTCA 3NIZA 3G9NA 3I79A 2F7XE 3TXOA 1SZMA 3H10A 2J0LA 4QMLA 4BDAA 4WG4A 2XNBA 4J71A 5IMXA 1H1SA 2PZIA 4ENYA 4TZRA 1OIQA 3QZFA 3B2WA 1LR4A 2OBJA 4D2SA 4U0IA 3QA8A 2WQBA 3PPZA 4NM3A 4R3CA 4OR5A 4IE9A 4UALA 1GZNA 3IDBA 4OW8A 5AFVA 5BVEA 3U55A 4QMSA 5IQGA 4HVDA 3THBA 2GHGA 4I4EA 4I3ZA 2BZHB 3OWPA 4YNOA 5FBOA 5JRSA 3E3BX 3F3UA 3LFCA 4M66A 4UMUA 4Z55A 2C6IA 3FEGA 2X39A 2XA4A 4BIBA 5T68A 4QT1A 3VQUA 3KREA 5CVHA 3GENA 3FWQA 3QUDA 3WARA 1XH7A 4L53A 4MD9E 4U6RA 3U9NA 1LPUA 3R7EA 3TEIA 1UNLA 4C2WA 5FDPA 3DAKA 2PMOX 2GFSA 4FT5A 4F7NA 5HE3A 5LOHA 3IW8A 3LLTA 5CSHA 3H9RA 4J1RA 1OMWA 4ZTQA 3R7VA 3ZTXA 5IF1A 1IAJA 4F7JA 3C7QA 3EKKA 2QOLA 4MXCA 1DAWA 3EOCA 3WIGA 4Z16A 3R8VA 3IGGA 4IB5A 3UPXA 3ZRLA 3RPOA 4L3JA 3KY2A 4XMOA 4GL9A 3ZONA 2HCKA 4BTJA 4L7SA 1FPUA 2PZ5A 4RZWA 2BILB 4G31A 2FSLX 3W16A 5CF5A 4QMTA 3E7VA 4CFFA 4BF2A 1NY3A 4M7IA 4O81A 4PDYA 2VWUA 2C5XA 3GC0A 4L46A 2J50A 1FOTA 1Q61A 2I0VA 3EQHA 4RWLA 5HG9A 4I0SA 3OXZA 3QZHA 5EH0A 4NCTA 2WMTA 3BV2A 1W8CA 5CZHA 4I22A 3IQ7A 4PY1A 3PLAE 1M7NA 1VEBA 2WELA 2XIRA 4AA5A 3DK3A 4BYJA 4E4LA 3GFWA 3BELA 5HIBA 2XH5A 2BRGA 2WPAA 3LFNA 5GJGA 5T3QA 4YO6A 4NT4A 3R1SA 5FTQA 4CKRA 2FYSA 3TV7A 2PPQA 5HIDA 3PE1A 1PXIA 3SLSA 2JDSA 2WU7A 5J5SA 5BVFA 5JN2A 2Q83A 3DZQA 3PA3A 1O6KA 5C4KA 4OTQA 1Q8TA 3VS1A 4XUFA 3WIKA 2CKQA 4EC9A 3OWLA 4BDDA 1J1CA 2QOOA 2C6EA 2C6DA 3BU6A 5BVKA 3OXTA 5E1SA 1Y57A 4S34A 3QKKA 4UN0C 4G6OA 1Q99A 2VTHA 4O0XA 3OY3A 4CGAA 1G8SA 3W2SA 4RIXA 3GVUA 2EWAA 3EQDA 3LZBA 4FEXA 3UIUA 4C4GA 5B2KA 4YC3A 4GVAA 3EQBA 1QCFA 1VYWA 2W1ZA 3F2AA 3L9PA 3D5VA 4ZEGA 4I41A 4FKPA 2IZRA 4IM2A 3EL8A 5AADA 4HCVA 2PUPA 3Q4CA 4DFYA 4XX9A 4L52A 5CEPA 2VTTA 1LP4A 5KMKA 1S9IA 3KKVA 3RMFA 2V22A 1NVSA 1YXSA 2X2MA 4A06A 3PIXA 5AIKA 5DRDA 3ROYA 5CEOA 1AQ1A 5DMZA 3L8XA 4MH7A 5EDQA 2UZEA 5EK7A 4XYFA 4CFUA 1OUKA 3QD4A 3FMNA 4RJ3A 2ACXA 2OFUA 3MJ2A 3DJ5A 3CKWA 4IAIA 2W4OA 5D12A 4JBOA 3ATTA 1MP8A 4H58A 5DEYA 3NS9A 3RINA 1B38A 3C4FA 2ITZA 4E6AA 1U4DA 4E4NA 2GSFA 3Q53A 4AN3A 4NU1A 5FWKK 2JKQA 4AGDA 2Z02A 4M0ZA 3FLYA 2HENA 4C58A 4FODA 4PUZA 3AQVA 4JR3A 2JIUA 3FLWA 4BTKA 4ZJVA 3C0HA 4I6QA 4ANSA 4ACGA 1KOBA 5EQYA 1UU3A 2VGOA 5I9XA 4O0YA 5FTGA 3NYNA 5ETAA 4BCJA 5IEXA 2P2HA 5L8KA 4AA0A 5IQHA 2XVDA 1JSTA 4USEA 5AUXA 3IW5A 5TR6A 5IMEA 4L00A 4B8MA 3LCTA 1KE8A 4PTGA 5L6OA 4X21A 3KQ7A 5DEWA 4ZP5A 2HW6A 4BCMA 4DTKA 3HYHA 4FV0A 4Y95A 5AM6A 1FGIA 4OBOA 4FV3A 3L8PA 3FMMA 5JGBA 4QD6A 5J8IA 2BUJA 4KSPA 3NVKI 3MY1A 2JFMA 3G90X 4RWKA 3KRXA 5AIRA 3T9IA 5L6PA 4FGBA 1I09A 4FIFA 4UB7A 3R71A 4P4CA 3VW8A 1Q62A 4JVGA 3N4UA 2C1BA 3KFAA 5CY3A 3LXLA 4MBLA 4UYAA 4UMTA 4ALUA 3FQHA 3V04A 1J7UA 3E92A 1U54B 2PZPA 4FG8A 1PXOA 2YEXA 4E26A 4C02A 3FKNA 3L9NA 3PYYA 1MRYA 4Y46A 5BNJA 4Y83A 2DYLA 5A54A 5KNJA 3FY2A 3VULA 3DTWA 4S33A 2PYWA 5IEVA 4E5BA 4UMQA 2CLXA 3WF5A 4L01A 3G15A 2R3PA 1Q41A 2OH0E 3COHA 2UZOA 3KU2A 4LV5A 2UZUE 3BCEA 4X3FA 3RK9A 2HZ0A 2SRCA 4A9TA 2C5VA 2VWIA 5AR5A 1RW8A 5CTPA 5HNGA 5E91A 5LMAA 4ZOGA 2ITOA 2J90A 3SAYA 3DXPA 4FT3A 2QOQA 3UG1A 3BI6A 3EZVA 3RALA 3L9LA 3SA0A 4YURA 3MIAA 3LFFA 3RTPA 4K33A 1JSVA 4QTBA 3SD0A 5AV0A 2WQNA 5EYCA 5EDPA 2GS6A 4AX8A 4ALWA 5JEBA 5LMBA 4NL0A 4YZBA 4MHAA 3JUHA 4RJ5A 2YIXA 4H39A 2Y4IC 3S1HA 4IACA 3GXLA 3FZPA 2X4ZA 4DEIA 3V6RA 3I6UA 2XJ2A 5AV4A 4IZAA 4I20A 3GCPA 5ANEA 3SG9A 4AU8A 2QKWB 3NUAA 2YISA 4TL0A 5L8JA 4IVBA 4XOZA 3ORXA 3DAJA 4TN6A 2PMNX 2E9UA 5E90A 5F95A 4ZTRA 3R8MA 4HVIA 4ZLZA 1FVVA 4D28A 5A46A 4QMVA 2CNVA 3AMBA 3PTGA 1IEPA 3GU4A 3HRFA 3Q2MA 4RA4A 4ANMA 3HMNA 3ZCLA 4AZTA
chains in the Genus database with same CATH superfamily
1ZMVA 4FKQA 1V0BA 3ULIA 5BX0A 5AJQA 2ZMCA 3EFLA 4D4SA 5J95A 4LQMA 3ZFMA 4KIKB 4DF3A 3C13A 2XKFA 5LCKA 2C30A 3R83A 5I9UA 1A06A 2BDJA 3CKXA 3EYGA 4FV7A 4EL9A 5E8UA 2NO3A 4ZZNA 4V04A 3CY3A 3HUBA 3VQHA 4DH1A 5FEDA 3FL4A 4O1PA 2GTNA 2W4JA 2XBAA 4L43A 1OKVA 4GK2A 3OTVA 4X2KA 4IFCA 4HVSA 5L3AA 4IX6A 2G1TA 3ZLWA 4D4YA 4ANQA 3WI6A 4CG9A 4I92A 4IDVA 1ZOEA 2J4ZA 3HV6A 1JKKA 5HE1A 5L2QA 4CZUA 3ETAA 4A9UA 2E9PA 3UIMA 4WG3A 4FIGA 4HYUA 5AP2A 2OXDA 3I0OA 3ZXTA 4BFMA 1Q4LA 3DU8A 4BBEA 1YRPA 3PZHA 3CEKA 4ZTMA 4M15A 2WIHA 4AG8A 1H0VA 5J79A 3HRCA 1ST4A 3T3UA 4FG9A 3UC4A 5A4LA 2IO6A 3NR9A 3QCXA 1UA2A 1PXLA 3IS5A 4MNFA 2CLQA 4TNBA 3DY7A 5TT7A 4EEVA 1H00A 4KUJA 4KBKA 3D5XA 4C33A 3I7CA 5KZIA 5J1WA 3MIYA 1O6YA 2WXVA 1BI8A 3SDJA 2CKOA 3UJGA 4AOIA 3JY0A 4Q9SA 2VO3A 3WF8A 1REJA 3C0GA 1KWPA 1ZLTA 3R28A 5G1XA 3VBXA 1Q8WA 2BAKA 3IGOA 1YXTA 3TZMA 1AD5A 2PZYA 4FA2A 3GC9A 4I6HA 1O6LA 3FZSA 3MB7A 3HDMA 4BCGA 3FLNC 4CTBA 3U6JA 4DHFA 2CN8A 2PTKA 2XIXA 4KS7A 2OZAB 4W8EA 1CSNA 5CAPA 3KRRA 3LJ0A 4BDHA 4ZSAA 1BMKA 1H25A 2NP8A 4DINA 4N6ZA 4IZYA 2B52A 3F69A 4YPDA 3TN8A 3LHJA 4DGNA 1TQMA 2C6LA 5AX9A 4GUEA 3TUCA 3DFAA 5LWNA 2J7TA 2JD5A 3ZEWA 2GPHA 4R6VA 1JOWB 3OY1A 4EZ3A 4BICA 2NNWB 3QYZA 4DDIA 3ZRKA 2X8IA 4LGDA 3FZRA 4NUSA 3IW7A 4YC6A 3WYXA 4EOPA 5D7VA 5AR4A 3PDTA 3JR1A 4S31A 4XV3A 4FSZA 4GIHA 4YHJA 1JBPE 4J7BA 2GNGA 2X0OA 3OCBA 3PVBA 4P2KA 2KTYA 3MVHA 5JMSA 2PVRA 5EI2A 2O63A 2BAQA 5HCZA 2BCJA 3VF9A 4J95A 5HVKA 1PJKA 2HW7A 4YJTA 3DKOA 3QL8A 5CASA 2UZTA 3CTJA 2B54A 3TCPA 2GS2A 3MVJA 3NW7A 2VX1A 4FNZA 4HJOA 1W0XC 1NVQA 1GY3A 2GQGA 4FV2A 4L9IA 3QCSA 4CYIA 4XJ0A 3LOKA 3WOWA 3EJ1A 3ZO3A 3R00A 4DEDA 3UMXA 4E20A 1O9UA 3SV0A 4O7RA 1JAMA 4BJJA 4MWIA 4U45A 4W4YA 3UOJA 4JT3A 1BL6A 4O86A 4YJNA 4JRNA 3HUCA 3NGAA 4NKAA 4XLVA 5JZJA 4HZSA 4W8DA 5CQWA 1W2DA 1G5SA 5BYLA 1R0PA 4HNIA 1T45A 3TNQB 2B53A 3IKAA 4EHGA 3OT3A 4WUNA 4QDEA 4R8QA 4DH8A 2Z7SA 4KAOA 1F0QA 2BVAA 4WSQA 3PVUA 4IVAA 5BVOA 4TXCA 5IPJA 4G3DA 2XK8A 4QMPA 2PL0A 4M69B 3E64A 4QYEA 4UXQA 3Q60A 5IQBA 3AD4A 3BBWA 5C26A 4FZDB 2CNQA 2AYPA 4BCHA 4EOMA 5E4HA 4ZS4A 3FZ1A 4DG2E 3DKGA 4KS8A 4F64A 5IDNA 1JSUA 1FVRA 5AR8A 3NPCA 5ETIA 5FEEA 3TUDA 4JI9A 3DNEA 4K8AA 4CLJA 2XF0A 2WTJA 3TACA 4BCOA 4FYNA 4FL3A 4XP2A 4C4IA 4XG9A 4GKIA 3A7JA 4ASEA 2QOHA 3K54A 4GFGA 2GDOA 4D2VA 2VO7A 2XYNA 5IU2A 2I7QA 4F1OA 4EJNA 5AA9A 2W99B 5HTIA 2G9XA 2W1DA 4O7NA 2CGVA 4IWOA 4LYNA 1CKJA 4FSNA 3P4KA 4JS8A 2YIRA 3IDCA 5ANJA 2GNHA 4AW1A 1XH8A 4G34A 4RC2A 5EFQA 5EOBA 3ZM9A 3NIEA 5E8TA 2YAKA 3RZBA 3RGFA 3FYJX 4EC8A 2OIDA 3ZM4A 4X6RA 1DM2A 4RX8A 3TTIA 5CF4A 1PYXA 1YXUA 2WTVA 3A7IA 3F88A 3HNGA 3HP5A 3B8RA 2B9HA 4O96A 4TYGA 4WSYA 3LXKA 5DFPA 3VVHA 4FK6A 4P90A 2DS1A 5CT7A 3F6XA 3EQIA 2A2AA 3EMGA 3ZZWA 2YWVA 3HMPA 3UQGA 1ZYLA 4UX9A 3IW6A 1VZOA 3A8XA 3ATSA 4FX3A 3KK9A 3RK7A 3A61A 5A14A 3ENMA 2QI8A 3V5WA 3AG9A 3UNJA 4XS2A 1OL6A 4NTSA 1E1XA 4PQNA 1QMZA 1ATPE 4U40A 4OLIA 5F94A 3PFQA 3CP9A 2JFLA 1WAKA 4FYOA 4GJ2A 4R7BA 3ODYX 2XAMA 3ORPA 3TG1A 3O17A 1E9HA 2PE2A 4LRKA 2O2UA 4AQCA 3FZOA 5EW9A 2VWYA 2YLEA 4FKUA 3AC3A 3GCVA 5HGIA 3F3WA 4BTMA 4QQCA 3V6SA 5CX9A 4CXAA 3ZFYA 3ACKA 3D2IA 3OP5A 5DG5A 3VAPA 4O0VA 1L8TA 3CGOA 4TTHB 4JG8A 5JFSA 4KSQA 4I1ZA 4WBBB 2W5HA 1H1RA 2IVTA 3LQ5A 3QQFA 3TL8A 4BDEA 3TMOA 4BI1A 3OFMA 3W0OA 4DA5A 4GMYA 3E63A 4J96A 4X2NA 3RK5A 4I4FA 1Q24A 2AUHA 4IX3A 5GINE 4KWPA 4XG8A 3HV5A 4CSVA 5HG5A 1REKA 4P5ZA 3BU5A 2YIWA 4RLKA 3OUKA 4O0RA 4W4VA 3D2KA 3VS7A 3TUBA 4I6LA 1RDQE 4HCUA 2C0IA 2Y4IB 5EQEA 3NYXA 4H1MA 3CR0A 2VWZA 1BKXA 4MVFA 3UG2A 1NA7A 2F2CB 4DT9A 5AEPA 3VIDA 4BKJA 3I81A 2P3GX 1FMKA 2OF2A 3KXXA 4ONAA 1ZYCA 2WTIA 3SXFA 3EB0A 4EHVA 4JX7A 4AUAA 4EH6A 3FHRA 4USFA 3QRKA 2IF8A 4J97A 4DTBA 2V7AA 2HZIA 1PHKA 4AE6A 4RIXB 3Q5IA 4W4XA 4Q2AA 2I0YA 4N70A 1Y91A 2VTIA 4HW7A 2WQEA 1OZ1A 3HV7A 2ITYA 2B4SB 2WKMA 4JBQA 3VC4A 2E9OA 4AZEA 2YCRA 5H3QA 4R78A 4XLIA 2Z8CA 3K2LA 3ZFXA 1QL6A 4YNEA 5AR7A 2FO0A 5J1VA 5C03A 5HVYA 4ACCA 2R9SA 3R63A 3I5ZA 3ORLA 4P5QA 1JKLA 2HY0A 2XKEA 1R1WA 5HNIX 3FDNA 4EOSA 3UO4A 5IA4A 3BPRA 3AOXA 3E7OA 1YDRE 4XP3A 3R7YA 5DR6A 1SM2A 3GQLA 3SOCA 5DYJA 4H36A 3GT8A 4ZTSA 5HU9A 1P2AA 2XP2A 1M17A 3Q04A 5M56A 3TI1A 2ZVAA 4YSMA 3BBTB 4BZOA 3FC1X 5CZIA 4OTWA 4XG3A 4YJUA 4YLJA 3MWUA 1KE9A 3C0IA 4I93A 4DG3E 5HBEA 1STCE 2PMIA 2W9FB 3FYKX 3PUPA 2Y6MA 4LRMA 1OGUA 3PJ8A 4QMZA 5FD2A 2IVUA 3RM6A 2RF9A 2XAOA 3R9NA 3HA6A 1T46A 3PXKA 1OI9A 3GEQA 3PPKA 3POZA 1WBNA 5TO8A 3P0MA 2PVKA 2OIBA 3R2YA 3RAIA 4F0GA 3OCGA 2C0OA 5EI8A 3ELJA 5K0XA 3G0EA 4TW9A 5DVRA 3BHYA 2IEWA 2G15A 4MEDA 2QCSA 4C38A 4KIPA 1WFCA 1R3CA 2P0CA 3TDVA 5C27A 3GBZA 4CV9A 4DEGA 3V8TA 3LCKA 4WA9A 5ACKA 4OT6A 4QMMA 4W9XA 5CVGA 4MD7E 3KEXA 4G5JA 4PRJA 4QQJA 3RCJA 2UW9A 2VWWA 1RQQA 5FRIA 4G3CA 2JKKA 2BTSA 3D94A 3MI9A 3ZOSA 2WGJA 4Y8DA 5HOAA 5CF8A 2XCKA 3JY9A 3M1SA 2EVAA 5E8SA 3TTJA 3E3PA 3AGLA 4ZTLA 2XK3A 5HLNA 2UVYA 2CPKE 2YITA 3BV3A 4QP7A 3ZBFA 2CGUA 4MXXA 4XG7A 3KGAA 3VHKA 1PMEA 4C0TA 5IQFA 5KMJA 4D1SA 2WMUA 2BIKB 2R3OA 5M4CA 3DV3A 3QHWA 5C1QB 1PXMA 1CKIA 3UQCA 1PXNA 4O7ZA 3DBDA 4RRVA 4RX5A 3AC1A 5M07A 2XJ0A 4HNFA 5ITAA 4IC7A 3S4QA 3HAMA 2F7EE 3HL7A 4LL0A 3BIZA 3MS9A 5ETCA 2F49A 2JDRA 2YACA 3R8ZA 4O83A 2PUIA 5H8EA 3PLSA 2FUMA 2PE1A 4MAOA 1OECA 4TYHA 4R1VA 2CJMA 4U80A 5F1ZA 4Q9ZA 4C4HA 4ASXA 3JYAA 3ZC5A 4YJOA 3W0PA 4WG5A 1L3RE 3G5DA 1XWSA 3PWDA 2QHNA 4FT7A 4A4LA 3S00A 3HX4A 4FSUA 1MQBA 4QPSA 2CMWA 4YZCA 2YDIA 4JDHA 4JQEA 5J87A 5IQAA 5KMMA 4E4MA 1NXKA 3VS6A 3PIZA 4X3FB 4IX4A 5JRQA 3D7ZA 5HD4A 5BVWA 4LG4A 4BGQA 2YN8A 4BZDA 3KXHA 3W2OA 5AP7A 5E8VA 3TKHA 3O0GA 2JGZA 5EOLA 4TWCA 5J9YA 2XIKA 2C3JA 2R7BA 3UYTA 4L67A 3MTLA 2YM6A 4FKLA 3NLBA 2WMBA 4ZSGA 5HD7A 2VTNA 4FIHA 5FXSA 4IAYA 1UV5A 2ITWA 4JDKA 1OM1A 5IA3A 5TF9A 3ORTA 4I21A 4QTAA 4RC3A 2Y6OA 1TZDA 2J0JA 2UZBA 3EFWA 3JS2A 4FSWA 3K5VA 2LGCA 3ZU7A 2X6EA 2NRUA 4ERKA 4D58A 2XZSA 3VBYA 5D41A 3WF9A 3F3VA 3MA6A 4F70A 2HZ4A 4FTRA 5LVPA 4YR8A 2YAAA 4L7FA 3W18A 2QR7A 3VS3A 5HEZA 1UWHA 3CCNA 3KF7A 3Q5ZA 1MRUA 1XBBA 1YWNA 3LCDA 4QYHA 5EM6A 3NWWA 4J8NA 4XH6A 4BDIA 5M09A 3GB2A 1H4LA 4YJVA 4QMOA 3A8WA 5IA2A 3AC4A 3QX4A 2BKKA 2W17A 4DFXE 2Z7QA 4FI1A 2BDWA 3QLFA 2JEDA 5BYYA 4R77A 4U9AA 3MYGA 2X8DA 4LFIA 1MUOA 2RSVA 2PVNA 5AR3A 4IXPA 3PIYA 2PVHA 4II5A 4XV9A 1FBNA 4E5AX 4FC0A 4PPAA 3POOA 5CSXA 3F82A 2YM5A 4R5YA 2ZAZA 4I6FA 2WMQA 5DN3A 5EKOA 3TNWA 3D15A 2PVMA 5GZAA 3FXZA 4MK0A 5I9YA 1YI6A 4TT7A 1W7HA 5CS6A 4V05A 3EYHA 3DTCA 4F7LA 1YQJA 4FT9A 2A19B 2IVVA 3PSCA 5CU3A 4JL9A 4U5JA 1WBSA 4FKTA 4L42A 1IG1A 2B0QA 4HYIA 1PMVA 5F4NA 1K9AA 3QD3A 2R0UA 3NMUF 3DBQA 5GIPE 4UZDA 1G8AA 3GP0A 3UVRA 3L8VA 3C1XA 5HQ0A 3QQUA 1MRVA 5HVJA 3F5XA 3UPZA 5J9LA 3MJ1A 1PW2A 4EONA 4AA4A 4EOOA 4A9SA 4D4RA 1Y6BA 4CT1A 4FRFA 1ZOHA 2B55A 1KV1A 4DEBA 3UZTA 2XK7A 3KCKA 4JQ7A 4FMQA 4C3PA 1WVYA 2CCIA 3HMIA 3PA4A 4TYIA 3VN9A 5A6NA 4GW8A 5JQ8A 4FTCA 5I9WA 2QG7A 2ETRA 3IO7A 5IISA 3R73A 4WD5A 2OJ9A 3R01A 5DT4A 4RFYA 3LFBA 2BZJA 3E8CA 3OG7A 3UIXA 3R8UA 2I1MA 5JFXA 5BPYA 2GHLA 1H0WA 4YMJA 3GU7A 4FV4A 3QRUA 3DJ6A 4WO5A 3KRJA 4U43A 5H8BA 3VRYA 5AAGA 4EOJA 4F4PA 1SMHA 3BLAA 4EQMA 4OTGA 5AMNA 2J6MA 1U59A 4WT6A 3PRIA 3HLLA 1SNXA 2VWVA 3V5TA 2J9MA 5HLPA 4RX7A 1OUYA 3DDPA 5M06A 3RVGA 5CI6A 3DXNA 3PJCA 3ZSHA 1OB3A 4DCEA 3UOHA 3B8QA 4B8LA 3P78A 4ZSEA 2BPMA 4BDFA 4D2TA 4QTEA 4D2WA 1XH6A 3QRTA 4FIEA 5HO8A 3LKMA 5FBNC 1BI7A 4FGRA 2W9ZB 2XMYA 3KXZA 4PMPA 4O82A 3TZ8A 4MCVA 4C4EA 2UVXA 2QU5A 2VTMA 3GGFA 4J52A 3EH9A 4KABA 3RKBA 4PWNA 1V0PA 5DNRA 1G8KA 3LW0A 4QP8A 4O2ZA 5LMKA 3PWYA 1XJDA 3PY3A 3DB8A 1BLXA 2HWPA 4CQEA 3ORMA 4DT8A 4FIIA 5EQPA 3MW1A 1NT2A 3NAXA 3FLSA 3VBVA 4ZY5A 5KMLA 4XBRA 4APPA 2QO9A 3VBQA 3W33A 2PZRA 4YJSA 5DE2A 4OTFA 1H24A 4DHJA 5DWRA 2XB7A 2BDFA 3RNYA 4WHZA 2V0DA 3U4WA 4JNWA 1I44A 1APME 3JPVA 3R2BA 2CDZA 5EW8A 4BJJB 4LMNA 5E8ZA 2YERA 4X7QA 2WO6A 4XBUA 5J9ZA 3FV8A 2GQSA 5K4IA 4PNKA 5DGZA 1ZMWA 2IG7A 2G2FA 3VUGA 4FV8A 3UBDA 4MF1A 4EUUA 2QO2A 4RJ8A 2OWBA 3PRFA 4TWNA 4E6QA 5AP1A 3BGPA 5CLPA 2DWBA 3O8PA 4BGHA 3QTIA 3QWKA 4JAJA 4D1XA 3M11A 4NM5A 5D7AA 2OO8X 3GU8A 3ZLYA 4RMZA 1QPCA 1CMKE 3GU6A 3V5LA 3W1FA 3D9VA 4XG6A 1GIIA 5JH6A 4C37A 3JVRA 3NZ0A 4RFZA 1YVJA 4RT7A 3D4QA 4AZWA 3SC1A 3C5IA 2C6KA 2EUFB 4QQ5A 5GZ8A 4ZLYA 3ANQA 5HX6A 2FH9A 4I5MA 4G3GA 4ZK5A 2GU8A 4MD8E 1H1PA 2GNFA 3FI4A 4YHFA 1XH4A 5AUWA 3R9RA 4R1YA 4TYJA 4EHEA 1NW1A 4WNKA 4L44A 2GCDA 2WMXA 3TNHA 4FR4A 5LJJA 3TM0A 3E88A 2IJMA 2ZYBA 5FXRA 3OOGA 2WHBA 2YDJA 2YJSA 4NH1A 3P7BA 3KN5A 2V7OA 3AC8A 4E5WA 4JXFA 1OL5A 5M55A 3ZLSA 1JLUE 4JBPA 3G0FA 4UEUA 4NIFB 3ZDUA 2ITPA 4I5HA 2BRNA 4IQ6A 3Q4ZA 2XK9A 4DH7A 4YBJA 1MQ4A 2HIWA 2YCFA 3Q4TA 4KIQA 2C3LA 5CU6A 1Y8YA 3H0YA 4BRXA 3CS9A 3QTQA 3DGKA 2BIYA 2ETMA 3DJ7A 3EZRA 4ANOA 4JIAA 3RPVA 4E6DA 4D5HA 1PMNA 2IZTA 5IA5A 4UWYA 2WEIA 4OTDA 3Q9ZA 4DFZE 3D7TA 1IA9A 1K3AA 4S2ZA 4GU9A 3FLZA 4PP9A 4C4FA 5IA0A 4CMOA 3FQEA 3QQJA 4GEOA 3COKA 4XV2A 4D0WA 3LQ3A 4TNDA 4ENXA 3P23A 3CD8A 4FKIA 4MKCA 4RIYB 4EJ7A 4R3RA 4M97A 2VUWA 4I24A 3DK6A 4NTTA 5EG3A 3V5PA 4D9TA 3G33A 3S95A 3PA5A 4AAAA 4JX3A 3OZ6A 4FE2A 4YJRA 4LUEA 4YP8A 4CV8A 4FSQA 5LVOA 1OPJA 3ZO2A 1SVEA 4RX9A 3PJ2A 2XIZA 5HORA 3MY0A 3ZEPA 3SRVA 2R7IA 4F9YA 5L2WA 3OEFX 4PF4A 4FTOA 4PL3A 1Q97A 4A7CA 4LI5A 4D5KA 4BWPA 4O7LA 3DBFA 3MPMA 3U6IA 4A9YA 3EHAA 2WD1A 1YOMA 1Q8YA 2X9EA 3NUNA 4G16A 2EB2A 3TDWA 3OC1A 4CMUA 3BE9A 4QYGA 1OL1A 4M14A 4D1ZA 5FM3A 4EK4A 1CTPE 2BMCA 5AUUA 3CQUA 3O71A 3P79A 3LE6A 5EW3A 3I5NA 3P08A 5IQIA 2BRMA 4AXDA 4TWOA 3D14A 5EDRA 4GVJA 1SYKA 2PE0A 3I4BA 4DG0E 2ZJWA 5E8YA 3TZ7A 4ZMFA 3MA3A 3BLHA 3IK3A 3LCOA 3MFRA 4JDIA 3DNDA 4LV8A 4NYEA 5JKGA 3QTRA 5CU2A 4ZS0A 3MPTA 5AV2A 5HE2A 2A1AB 4C2VA 2VO6A 4YBKA 3RM7A 2G01A 3QF9A 3RAHA 3NFGB 2YIYA 2XRWA 2YLFA 3NNUA 3KN6A 2ZMDA 4B7TA 4YPSA 2XNGA 1PXJA 2OSCA 4FSYA 5ANIA 4O84A 3U54A 1H01A 4O7VA 3JVSA 4QDVA 3OF0A 4WNPA 3R8LA 2I6LA 3LXNA 3EFJA 1WVWA 4CMTA 4GK3A 2GTMA 4RJ7A 2WU6A 3DPKA 5LMKC 3DFCB 4FEQA 3QQGA 2IW9A 1URCA 5CF6A 3AKJA 2C47A 4ZMEA 2CHLA 4MBIA 5BVDA 3NYVA 1ZRZA 5KBRA 4FOCA 1VYZA 4G9RA 4IANA 4FVRA 5AV3A 3U87A 3O7LB 5LARA 1H08A 4AT4A 4PDPA 4IAFA 3KXNA 3MH1A 4QNAA 3UYSA 1GIHA 3AD6A 1UU9A 5L2IA 1P4FA 5CU0A 1XBAA 1Y6AA 2OU7A 2XALA 1ZYDA 4O2PA 2ONLC 3HV3A 4ZY6A 2B9JA 4BDCA 1JNKA 5CSVA 1GZOA 5CALA 4GYGA 1ZZLA 4BKYA 4IB3A 4ANBA 2WMWA 4YZNA 2WZJA 3ITZA 3F5PA 4IB1A 5AUVA 2OXXA 1Z5MA 3BEGA 4FEWA 3H9OA 2W06A 2C0TA 3LFSA 2J51A 4W9WA 5FDXA 3NUXA 2OGVA 3H9FA 3RZFA 4C8BA 2PHKA 4FV9A 3UGCA 3TNPC 1H26A 3TKUA 4G2FA 4O7SA 2LAVA 3MFSA 4O91A 3ZXZA 4GS6A 3E8EA 3IONA 4FUYA 5CWZA 4BDKA 2EU9A 3QD2B 4U7ZA 4U97A 2V55A 4CFXA 4I6BA 4JBVA 2FSOX 4WBOA 4ZZMA 3RP9A 3QTSA 4PTCA 3FMKA 3ORKA 2XUUA 4OT5A 3OXIA 1OIYA 4AGWA 2XK6A 3G51A 4BCIA 4RPVA 2X2KA 3ROCA 3SX9A 2EXCX 4FKSA 4HYSA 4YJPA 4I5CA 4RJ6A 5KMNA 2A27A 2P55A 1CKPA 4QP1A 4JR7A 4O1OA 4X2GA 1OVEA 2JIIA 3PP0A 4C59A 5CYIA 4I0TA 4K77A 5A4QA 2XM9A 4FV6A 3KRWA 4XRJA 4EH7A 3QCYA 4X6QC 5IUIA 3EN9A 3WZDA 3ZMMA 4C61A 4CYJA 4BYIA 4EKKA 2WQOA 4QOXA 3WZUA 3FE3A 2VD5A 1OIUA 1XR1A 2XJ1A 3LPBA 3QA0A 4XG4A 3QALE 2W1HA 2O8YA 3QWJA 3A2CA 4IBMA 5TKDA 2OF4A 2CCHA 4FG7A 2HXLA 4RBLA 1KE5A 4IDTA 2X7FA 4HPTE 3NSZA 4WKQA 3QGYA 3QTWA 3LM0A 3RAWA 2UZNA 5IH6A 5M53A 4M67A 3DK7A 3DOGA 3F9NA 2QD9A 1M14A 3JXWA 2GNLA 4DE4A 2BHEA 4KINA 4V0GA 4F09A 2JITA 3RBWA 4YZDA 1UU7A 5CAVA 4NIFA 4UY9A 2XNMA 4H05A 2H6DA 4EWHA 4FTAA 2ETKA 1K2PA 2OK1A 3C4XA 5JT2A 3NAYA 1ZXEA 4U3YA 3RJCA 4DEAA 3LVPA 4G5PA 3MH2A 5KO1A 4BGGA 2R3GA 1XH9A 4G6NA 3W10A 4ARKA 1ERKA 4EH5A 4MWHA 4DGMA 3DS6A 3DXQA 4QP9A 1SVHA 2ZB0A 4IM0A 3PXYA 4I23A 4F6UA 4BB4A 1TQPA 3FQSA 1ZAOA 2BRHA 3MDYA 3OOMA 4TYHB 4GJ3A 4P7EA 2JBPA 4GG5A 3KB7A 1YHSA 5BUIA 4IHPA 5DA3A 2XS0A 3UNKA 3FKOA 3CY2A 4ZJIA 2UZWE 3C4ZA 5C8NA 2VX3A 4BHNA 5KCVA 2R3KA 2FB8A 2BAJA 3K3JA 4PDOA 4AGUA 1OPKA 2VNYA 2QOCA 3VUHA 3A60A 2PSQA 1IRKA 2QOBA 3OT8A 3VUIA 1LUFA 4RIYA 2ITVA 2P2IA 3NNWA 3F3TA 3KA0A 3FUPA 5FTOA 2XYUA 4D2PA 1DAYA 3KMWA 2IWIA 2R64A 2WTKC 3DBCA 4QYFA 4MTAA 4BBFA 3CXWA 2Y7JA 3V5JA 4EZ5A 2W7XA 4GCJA 2HK5A 3NUPA 2C3IB 4PPCA 2HAKA 4RC4A 4TY1A 5IA1A 3VS5A 4DGGA 4QMNA 2PWLA 4C57A 4F9BA 4Z3VA 1UKHA 5A9UA 2J5FA 3G2FA 5AP5A 2A4LA 2QKRA 3P86A 1WBOA 5L2SA 4RWIA 4O22A 4EI4A 1AGWA 4AZVA 4NKSA 3S3IA 5KBQA 1XH5A 3BL9A 4YTIA 3OHTA 4FSTA 1B39A 2J0MB 4LMUA 4NW6A 3BWFA 1ZYSA 3TKIA 4AXEA 3WZKA 4C36A 1XQZA 5AR2A 4CT2A 4V01A 3OW3A 4A4OA 1YWVA 4QMQA 4M12A 1ZWSA 2OW3A 3NNXA 3RWPA 4X2FA 3W2RA 5HBHA 4C3RA 1ZYJA 2ITNA 1M7QA 3E5AA 1Q5KA 4GYIA 4EOKA 2HWOA 3ENHA 5ANDA 1U5QA 3R1YA 3ZSGA 3HAVA 5CQUA 2HZNA 2C68A 1GIJA 1Q8ZA 4CRLA 5CAOA 1WCCA 3W0RA 2R3IA 4Y72A 4EZ7A 2YM7A 3BE2A 3RAKA 4H3QA 4Y85A 4YGAA 1P4OA 4XRLA 3TIZA 3LFQA 3UIBA 4F0IA 3DQWA 3VBTA 2BTRA 2OG8A 2R5TA 4IWDA 5EM8A 4CRSA 5I3OA 3BYSA 3Q4UA 4JRVA 5CAQA 4WRGA 2PVJA 5JZNA 4CLIA 2YA9A 3GCQA 4EOIA 4ZY4A 1WMKA 4K11A 5HG7A 2C1AA 3HEGA 1G8JA 4AN2A 2VTQA 1JPAA 1YOLA 2VU3A 4KRCA 3ZO4A 4C4JA 5I5ZA 5IUHA 3LCSA 5DIAA 1JKTA 1B6CB 2V62A 4Y73A 3A4PA 3R9DA 3RHXA 4M13A 4EH4A 4S32A 4YHTA 3R8PA 5IZFA 3C9WA 2YJRA 2R0IA 3VHEA 5LWMA 5AM7A 2X4FA 5E8WA 2ITXA 4QMYA 1PRYA 3RCDA 4IW0A 2E9VA 5EHLA 4FEUA 3HA8A 4BN1A 2VO0A 5AAFA 4BZNA 2F4JA 4GFMA 3T9TA 4EOLA 3R7IA 4GRBA 5C8MA 3IW4A 3LJ2A 2QOIA 3R21A 4LM5A 3IOKA 1YDTE 3GQIA 3FMHA 2P33A 3ACJA 4O4CA 3AT2A 3SHEA 4FSRA 2OJJA 4FL2A 4G17A 3OUNB 4FTLA 5AP0A 3RPSA 3CTQA 3V8SA 4DEEA 2WMSA 1OITA 3CPCA 2CGWA 3M2WA 2ZV2A 4IVDA 3LXPA 4X0MA 2IW8A 4MXZA 2WAJA 4IIRA 4MNEA 3FI8A 3GNIB 3ANRA 2FSMX 3BX5A 4DDGA 2Y0AA 1KUTA 3VS2A 2ZOQA 3Q32A 4GSBA 2JC6A 4FBXA 2YZAA 3QC9A 3C5UA 3ZC6A 5FQDC 1Q3WA 2W4KA 3VO3A 4IVCA 4KIOA 4AP7A 3PPJA 4DH3A 4RFMA 2BFYA 4F1TA 2B7AA 3LMIA 4JG6A 1H1WA 5HICA 3UDZA 2UW8A 4HZRA 4FTMA 4C35A 3BHUA 5IUGA 4O4FA 2Q0BA 2NRYA 2C69A 1PYEA 3LFDA 5CNNA 2QODA