2HZNA

Abl kinase domain in complex with nvp-afg210
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
277
structure length
272
Chain Sequence
b'MDPSSPNYDKWEMERTDITMKHKLGGGEVYEGVWKKYSLTVAVKTLDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Structural biology contributions to the discovery of drugs to treat chronic myelogenous leukaemia.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 82
structure length 272
sequence length 277
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2hznA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2hznA01
2UV2A 5A14A 1BI8A 3S3IA 3QRIA 4U79A 4UEUA 3BBTB 2YM5A 3W32A 1QPJA 4AQCA 4MHAA 1XQZA 3VWAA 4FKJA 4D1ZA 1T45A 4LL5A 4XLVA 1R78A 4EC9A 5LMAA 2REIA 4QP2A 5C9CA 4BZDA 3CR0A 2W0JA 1Q41A 2Z7SA 1CM8A 4MKCA 5CT0A 3UZTA 2YLEA 5IU2A 2O2UA 3IS5A 2X7GA 1YXUA 4FTMA 5E90A 4DCEA 4TYGA 5IQFA 1BL7A 1CSNA 4E3CA 3QCXA 4XV3A 3NSZA 3NUYA 3D9VA 4U43A 3BV3A 4ZMEA 2UZBA 1XH8A 5HHWA 2OF4A 2ZV7A 3FQSA 3ZTXA 3RINA 2XJ0A 1UKIA 5DEYA 5JGBA 1WBTA 3L8SA 4BGQA 5AUUA 5EM8A 3KK8A 3C13A 1S9JA 4UMPA 5AIRA 1NT2A 2RFDA 1QMZA 4XJ0A 1K9AA 5IQBA 2VTQA 5FDXA 2Y8OA 3WZJA 1GIJA 2JDTA 2XMYA 3HUCA 4P4CA 4ZSEA 4CQGA 3EWHA 1Z5MA 3IW7A 3P7AA 3PXZA 4K9YA 4PDPA 4BGGA 4G1WA 4D4YA 3DNDA 1OL2A 2WU7A 3QXOA 3QRTA 4KBCA 2R0UA 2XF0A 3VHEA 3C1XA 5EHYA 3GQIA 3EFKA 2YIXA 4L3LA 2DS1A 3KC3A 2CNVA 4UZHA 3EHAA 1BX6A 5IQGA 3T3VA 3COIA 3HV7A 1BI7A 5AP1A 4AT4A 5EQEA 2BDFA 3GB2A 4BRXA 4RVTA 4KKEA 4DH1A 3BQRA 5HG9A 4RWLA 2OH4A 3OC1A 3Q4ZA 4A9RA 1JOWB 2BZKB 4LOOA 4BF2A 2ONLC 2KULA 2IZUA 1IA8A 4X3JA 4JDJA 1OBGA 3GCQA 5KHXA 3DZQA 3UE4A 2PY3A 3GENA 1LR4A 4BKJA 3VS2A 5DI1A 4MWHA 2Q0BA 4GRBA 5HESA 2BR1A 4F9WA 3GI3A 4RPVA 4EQMA 3L9NA 4QP3A 4BBEA 4D5KA 2OJFE 4JIAA 3FLQA 3ZO1A 3EN7A 2QURA 3FZSA 4QMOA 4QPSA 4UMTA 4IQ6A 3E63A 2FGIA 3FXWA 5H3QA 4FSMA 4I23A 4YO6A 5CYIA 4X6QC 4CEGA 3ORKA 4JLCA 4FKWA 2F7EE 4BR3A 3PSCA 2GS7A 3RM7A 3V8TA 2R3NA 2RFSA 3CGFA 3ETAA 2C0TA 1R0PA 2ETKA 4GK3A 5CNNA 3H30A 4TWCA 3GXLA 4UWCA 4IZYA 4MXYA 2JFLA 3KXNA 3GVUA 4K77A 4G3EA 4ZTHA 3W8QA 4ALWA 2C0OA 1XKKA 3DCVA 4YU2A 3DQXA 2BKKA 3TJCA 5HNBA 5H2UA 4UWBA 2HYYA 2VUWA 3KMMA 3E92A 3CTQA 4R7HA 5CXHA 3RNYA 4U3ZA 3BE2A 2O8YA 4OTPA 5FP6A 3GC9A 5BVEA 4MBJA 4FEXA 3KK9A 5JQ5A 4I6BA 4CT1A 3O8UA 3A7GA 4IAAA 4CYJA 5LXMA 2WMWA 4WG5A 3KXZA 3NNWA 4ZJJA 2PWLA 3DXNA 3VJOA 3C4XA 4C4IA 3GU5A 3A4OX 5AUYA 4G5PA 4IJ9A 4LG4A 4UX9A 3JVSA 1J1BA 4Z7HA 3COKA 1YHWA 1Z9XA 2XJ2A 3KY2A 3NPCA 4BCHA 4R77A 4Y72A 4FZAB 4UY9A 5JGDA 5DOSA 5K0XA 3OP5A 4A07A 1KE9A 5L2SA 2CJMA 2XM9A 2JAMA 4Q9SA 4CQEA 3SQQA 3BGPA 3O8TA 4XP3A 5IA4A 1YHSA 4QTEA 2OXYA 3LQ8A 3EFJA 3LCOA 3PXYA 3R8UA 4C4HA 3HAMA 3UZRA 4FKPA 3NUNA 4QO9A 4S30A 3HX4A 5IA5A 1W84A 3ZCLA 4F70A 2QONA 4RJ3A 4I22A 4PDYA 1NVSA 5JN2A 3HAVA 5AV0A 5FM2A 5HCXA 4R78A 5GZ9A 2BRNA 2CCHA 3I0QA 3V5WA 5IEYA 3PRIA 5M4IA 4RX8A 4FIFA 4BHNA 1ZLTA 4C37A 1U5RA 4FE2A 5L8LA 3GEQA 3NRMA 1RQQA 2C5NA 2ERKA 2XVDA 4DH5A 3VS5A 3CP9A 4YNOA 3EFLA 5C8KA 2JAVA 2XIXA 4U42A 4Y5HA 3TKHA 4F9AA 2QKRA 1DAWA 4FTNA 3D5UA 5LQFA 5IH4A 2XJ1A 1V0PA 3LW0A 4I5HA 3PIZA 5JMSA 4IFGA 4HOKA 4CMUA 1LEZA 1J7IA 5L4QA 4BGHA 1J91A 2JBPA 4CGAA 3PY3A 4I5MA 4C4GA 5B0XA 1JSTA 5IH5A 3BQCA 2JDOA 3Q9ZA 2R3MA 3MBLA 4AS0A 2O0UA 5E1SA 2XP2A 2W1HA 5DGZA 5HQ0A 5E7RA 1QPCA 4LGHA 3QBNA 2PVKA 5AWMA 3K3IA 1XHAA 1PHKA 3CQWA 4D1XA 4RJ7A 4DGGA 3GP0A 5KUPA 5KNJA 4A9SA 2WQOA 3QQUA 2ZM4A 2A1AB 2J0KA 4AFJA 4YSMA 4FV9A 2IJMA 1PXNA 3D5VA 3UP2A 4ALUA 1GZKA 4PWNA 3GOKA 5IUHA 4DBNA 4MK0A 2PZYA 3P0MA 4FTRA 4GG7A 4UBAA 2Z8CA 3KCKA 3ORLA 1PYXA 3FLNC 4F0GA 4RZWA 5EW8A 5CF5A 2NO3A 2ITZA 2VO3A 1A9UA 1F3MC 2OU7A 2OXXA 1OMWA 3BGQA 3MW1A 1QCFA 5EOLA 2IG7A 3MVLA 3V5QA 3TV6A 4FKRA 1R3CA 4FNYA 3CQEA 3SD0A 4J97A 1UU8A 3HL7A 2UZUE 5CXZA 1O6LA 3OCBA 4FEUA 5JZNA 1FMOE 2QOOA 1I44A 4PL4A 4XV2A 3C4CA 4GFGA 2B1PA 4M0YA 2VTJA 2Y4IB 3G2FA 1OPKA 1IAHA 3Q6UA 4KWPA 4NT4A 4RIXB 2HW6A 2XNNA 1YXXA 4WNMA 4EH4A 5IQHA 3A99A 2GFSA 4ZSLA 3PJ1A 3KRRA 4CFWA 2VU3A 5HG5A 3SA0A 2HAKA 3VF8A 4IZAA 2PUIA 1OBDA 3MVJA 3NUSA 4WD5A 2CN5A 4XS2A 5M06A 5D7VA 3SVVA 4CCBA 4DT9A 3OWKA 4JI9A 3A62A 3QC9A 4XCUA 5CSXA 3F3ZA 3QKMA 4RSSA 3DOGA 5H9BA 3PYYA 4EONA 4MYGA 4U9AA 5E8YA 2RG6A 1NVQA 3NUPA 2WTDA 3C0IA 3QU0A 5HE2A 4Z3VA 4JAIA 4QTCA 5FBNC 3FL5A 4F1MA 4KSPA 4MQ2A 1M2PA 4LGDA 5HOAA 1JLUE 4PTEA 4D2WA 4EHEA 2CCIA 3QLFA 3BIZA 3HLLA 3GC7A 4F6SA 2UZNA 1OL1A 4F7JA 3QZFA 5CEMA 5CF6A 5BYLA 3SRVB 1QPEA 2IZTA 3MYGA 3VBXA 4ZSAA 4L45A 4L42A 4YJSA 4E5AX 5ANOA 3KL8A 1CDKA 3S4QA 4DEAA 5A9UA 3HA8A 5DE2A 4BTKA 2A4LA 4WG4A 4M69B 2H8HA 5T3QA 2QC6A 3U6JA 4JG6A 2ZM3A 3FI4A 5DBXA 3EYHA 4ITJA 2HZ4A 1XBBA 3UO4A 3LXKA 4AP7A 3QD2B 2HZIA 2OIBA 3CIKA 3MN3A 4L43A 4L46A 5CLPA 2W1GA 2CNUA 4IC8A 1YKRA 3BEAA 4Z7GA 4LRKA 3DY7A 4U5JA 2I1MA 2XA4A 1H26A 3BYVA 2YM3A 2PVNA 3VS1A 2V55A 2YCQA 4UMRA 5AADA 3AMAA 2PMIA 4TNDA 3C4WA 2GS2A 3KXHA 3NGAA 3ODZX 1ZYSA 2UW9A 4IAZA 4O0TA 3C0HA 3MTLA 1UU9A 4ZY6A 3RJCA 4J1RA 3TT0A 3UO5A 3ZFMA 4IB1A 3R7UA 4BDDA 5K3YA 2WGJA 1Q62A 3OY3A 4PDSA 3OBJA 4ZTLA 2YEXA 4IAYA 3DNEA 4O2PA 4JX7A 4E8AA 1ZOEA 4EOOA 3QD3A 4PY1A 4ZY4A 4G17A 3MJ2A 5D11A 3UOKA 4C62A 2BMCA 2DWBA 2VTAA 3LM5A 3UIUA 4C34A 3E8CA 3FI2A 1UU7A 4IFCA 1XH4A 4OTRA 4O7NA 1Y57A 1R39A 3DAKA 4D58A 3OEFX 3QALE 4BL1A 5CZIA 2WMVA 3UQCA 2W96B 3HV4A 2ETRA 1GZ8A 5D9HA 4OTHA 4QMUA 3SG8A 4MQ1A 3U55A 2R7BA 3PVGA 4FKQA 4ONAA 3QL8A 3SG9A 2YIQA 2UVZA 2UZVA 2ZM1A 4YPSA 4MD7E 5J8IA 5KO1A 4FV2A 5HI2A 1PW2A 2OSCA 5AR2A 5ETCA 5IUIA 5IF1A 1TVOA 5BMSA 4AGCA 4BZOA 1QL6A 2W9ZB 4PDOA 4N6YA 1WBNA 1ZAOA 3TNHA 4F08A 4QTDA 4HZRA 4U3YA 4MX9A 1OKWA 4II5A 4EBWA 2Z7QA 5TT7A 3UC4A 3IW6A 4F64A 3MH0A 4RLKA 2JIVA 4AUAA 2W1FA 1G3NA 2UZDA 2W1DA 3KMUA 4DC2A 4EQUA 4O7SA 2P55A 2R3FA 5EM6A 3C4ZA 1PXJA 3ZS5A 2GNLA 2G2FA 3K3JA 3DAJA 4GG5A 4PTGA 4E4LA 5E4HA 1ZRZA 2YABA 2X8IA 4S33A 3SOAA 3CTHA 4E4XA 3G5DA 3KVXA 3QX2A 4MTAA 3BHHA 3HGKA 5KKRC 4FNXA 1NA7A 2JC6A 2BPMA 5E8VA 4BDAA 4MF1A 4E4MA 5LCJA 3CBLA 4DEEA 4PUZA 4QMPA 3LMHA 3VAPA 4N57A 2WTWA 4G5JA 3ANQA 3C4EA 3LFCA 4NM5A 2ITTA 4OLIA 1W8CA 1UV5A 5EHOA 5IA2A 4KA3A 4YTHA 4GMYA 1Q61A 4CMOA 4WRSA 2IW9A 4M0ZA 4AE9A 3ELJA 3OWPA 4FT0A 2BDJA 5EM7A 3S2PA 4X3FA 5ANGA 4EHGA 3RK5A 5J9LA 4BCGA 4YJTA 3LLAA 4YTIA 3MWUA 2JDVA 3VHKA 2QOQA 2GNHA 3TIZA 4V05A 2HENA 3U8WA 3TZMA 3NAXA 1KV2A 3G6GA 4F4PA 2WTKC 3OF0A 3I60A 4L67A 2PVMA 3ZH8A 4JBVA 4HNIA 1S9IA 2F7XE 3SXSA 5IEXA 2XH5A 5HU9A 2FB8A 1IG1A 2WAJA 2X81A 3ZU7A 3O71A 3HRBA 4F1OA 3S1HA 4FZ6A 1P4FA 1MQBA 2C69A 3R6XA 5JRSA 2F2UA 2QLUA 2ITQA 4FNWA 2VX3A 4FSTA 4ITHA 3Q4UA 3TZ7A 1YDTE 2GFCA 4D4RA 4GKIA 2YWVA 3FLZA 2VGOA 4JAJA 5DT0A 1W82A 5JFSA 3RPOA 3F2AA 3DTWA 1MRVA 5F9EA 4ZLOA 4BDFA 4YLKA 5KMOA 1PXKA 4BDHA 5DWRA 2J0LA 3PWYA 3VUKA 5LMBA 5AFVA 1KE6A 3QYZA 5J95A 1PY5A 3PSDA 5HU3A 2VWYA 4JXFA 5L2QA 2ITNA 2I0EA 4FVQA 5ANDA 3R21A 3UVRA 4L44A 2YCSA 3ALOA 1L8TA 2Z7LA 3TG1A 3R02A 4FC0A 4O0RA 2OFUA 3PXQA 2PK9A 3ENMA 4IJPA 5DR9A 3FJQE 2IZRA 5KBQA 3FMLA 3V5TA 4RIYA 2J7TA 4AF3A 5KMNA 5LVNA 4H3BA 3UTOA 3ATTA 2PVHA 2IO6A 3NEWA 3SX9A 4JBOA 4D4SA 4CKJA 3FPQA 5JH6A 3P9JA 4LGGA 3MH3A 4IB3A 4I6HA 3CD3A 4YR8A 4DA5A 4UB7A 2YM4A 4BCFA 4O81A 4I92A 3UNZA 3QWKA 3PJCA 3TCPA 1PRYA 1FBNA 3IW4A 3R7EA 2XB7A 4MNEA 2ZV8A 4BKYA 3CCNA 4D2SA 5CAVA 4OAUC 4ANSA 4EZ3A 2IZSA 3D7ZA 2JKMA 3E3PA 4A4OA 1U5QA 3R9OA 4EZ5A 2WIHA 3ZSHA 5BYZA 4G6LA 4W8DA 5AP3A 1J3HA 2OF2A 3WBLA 2YZLA 4RQVA 1JNKA 3DS6A 2VO7A 2IVTA 2VWZA 3AC8A 4EORA 2WO6A 4CFVA 1W7HA 3BE9A 5C8MA 2B7AA 4M66A 4EK3A 4EK4A 4O7YA 4EHZA 5GJFA 4BY9E 4W4XA 4OBOA 4KRCA 1IR3A 1B38A 1WFCA 4QP6A 4YBJA 3LXLA 4AG8A 4D1SA 4YSJA 4ORKA 2W05A 3RTPA 1H4LA 3A8XA 5FBOA 1ZMUA 3ZRKA 2NNWB 1TQMA 2CGWA 1WZYA 4GUEA 4MNFA 4DCAA 3V04A 2O65A 4NWMA 4AA4A 3D7TB 5JEBA 3G0EA 4RVLA 5AUVA 5A4CA 1Q5KA 2QHNA 4FV3A 3LFEA 4D5HA 4L52A 3DU8A 4EUUA 3JY0A 2WIPA 4BCJA 5CU4A 1V1KA 4NU1A 4FTLA 4DG0E 3QQLA 4ITIA 2QODA 5AR4A 3HVCA 2FSLX 2C6KA 4QYHA 5A6NA 3GBZA 4HVHA 4IZ7A 5IA1A 2XNGA 3FZPA 2I0VA 5IQDA 4DINA 3H4JA 2VWIA 2NPQA 1U59A 2YISA 3NLBA 4TY1A 4S31A 4K0YA 3LOKA 3FZTA 3PTGA 1Q99A 4O0SA 3UP7A 3ZOSA 4AW2A 4EQCA 2HIWA 3UYTA 2ITVA 5FD2A 3I1AA 3RPVA 3F3TA 4XX9A 4ASXA 3G9NA 4E20A 4EH9A 4PX6A 4AGUA 4H05A 2JD5A 4FIHA 3CD8A 3PPJA 3QX4A 4AZFA 5A6OA 1PXIA 4C3RA 3MVMA 5EDRA 3CSVA 3NVMB 1H00A 4HCVA 2QQ7A 3QWJA 1PKDA 5JT2A 4O82A 1OKZA 2XUUA 2CKEA 3DB6A 3P86A 5HE0A 4O7ZA 3R8LA 3POZA 5BYYA 5FG8A 3AGMA 2XM8A 3H9FA 3I6WA 3NVKI 4NCTA 3CY3A 4FV5A 4RQKA 4HVSA 4G6NA 4FX3A 3H0YA 3R01A 3LAUA 4HGEA 4AOIA 4Y73A 2QU5A 2YHVA 3I7BA 4AOTA 2VTSA 4FICA 4Y95A 1YDRE 2P3GX 4RVKA 3DDQA 3Q4CA 4WO5A 3VS0A 4E6QA 4HW7A 3EL8A 4FT5A 2AC5A 3PRFA 3U6HA 2OZOA 4HGSA 3QRJA 2CKPA 3H9OA 3E64A 4W8EA 3JR1A 5I3RA 1W83A 2CLQA 4ANQA 3OT8A 5EKOA 2PE2A 5CNOA 4YLJA 5HBHA 1MRYA 5HVJA 4DH3A 2W5BA 3U54A 3ACJA 3W2QA 3R22A 2Y7JA 4AE6A 3RI1A 3E7OA 4YTCA 3UJGA 1Q97A 3ERKA 4FKOA 4EH5A 5EQPA 1JSVA 3FI3A 4QMWA 3F7ZA 3WILA 3PDTA 2OO8X 2VO0A 3P1AA 3F5XA 4IVBA 5AR7A 5KX8A 4UXLA 1K3AA 1ATPE 2VTOA 5EI8A 1WBWA 2VTRA 3KEXA 2VNYA 5HIDA 4U97A 3IQ7A 5LVLA 2R3RA 3Q4TA 2JIUA 3ORZA 5J7BA 4ANLA 2QO7A 4FTKA 4R1VA 2BRBA 1HOWA 1GJOA 1Y6BA 4RX7A 5E8UA 4YNEA 4BB4A 4R7BA 3EYGA 2XKCA 5AV3A 1KWPA 2UW4A 4XG9A 2WHBA 4GFMA 4IAFA 4NW6A 5CANA 5EK7A 4KAOA 2RF9A 4O2ZA 2V7OA 5KCVA 2ITUA 4RMZA 4NW5A 3NNVA 5JQ8A 4UYNA 5AIKA 3I6UA 2R3KA 3F3WA 3ULIA 2YIRA 5DT4A 5A4LA 3QTQA 5BUEA 4RWKA 3I0OA 3AT2A 5HVYA 2QOIA 3O96A 4ZXTA 3U9NA 3O8PA 5DPVA 2IN6A 2F2CB 1Q8UA 3G33A 3CS9A 4N4SA 5D41A 4G16A 5H8GA 4BHZA 4XG7A 5KMKA 1IAJA 3KKVA 4JDIA 4EOQA 4I41A 1EH4A 1OPJA 2XRWA 3WZKA 2OI4X 2XNEA 4IDVA 4A9UA 1OL7A 4RWIA 5F1ZA 5AR5A 1QPDA 2JDRA 5E8TA 4J96A 4I20A 3BYSA 2J6MA 4ZLYA 3NWWA 2YJSA 4U81A 4FGBA 1REKA 4BZNA 1APME 3IG7A 3A4PA 4HVDA 4FV6A 4PV0A 2B52A 3MSSA 4HZSA 3WF8A 3R9NA 4BIDA 5C4LA 4Z9LA 3K2LA 3EKNA 4J98A 5A4TA 2EXEA 3FYKX 3JPVA 2QO9A 3FLWA 4LOQA 4ZLZA 3V5JA 3TDVA 2R5TA 2JDSA 4BDKA 4ANBA 3SLSA 1U54A 3KMWA 1FVRA 4QP8A 5DRBA 2Q83A 5LOHA 4RX9A 5CSVA 2J0MB 3OY1A 4RIXA 4K1BA 4KINA 3V3VA 3QQFA 4S32A 4IVCA 1H1RA 4WG3A 4FOBA 2PZPA 2J51A 4IX6A 5KE0A 4O91A 3MI9A 1W98A 4KBAA 3BWFA 2BKZA 2O64A 3GFEA 3F9NA 1Q8ZA 3HMNA 3M2WA 3HKOA 5E8ZA 2PVLA 3SC1A 1M14A 2XK7A 3TJDA 3TI1A 2I0HA 4IE9A 4PP7A 4E6DA 3LE6A 3DJ6A 4FKGA 4RGJA 4D2RA 4RC2A 3R7YA 3GGFA 5CVGA 4HYHA 2ERZE 1L3RE 3PY1A 4OTWA 3DKCA 2UZEA 4GK2A 3BYUA 4OBQA 1G8AA 2EXMA 5LCKA 1ZZLA 3ZLXA 1M52A 1JSUA 5IQAA 4LUEA 2BFXA 1H1QA 2WU6A 3LFDA 3ORMA 1ZYJA 3IDCA 4WNKA 3N9XA 3LZBA 4M84A 3G15A 3ALNA 2Y4PA 1YDSE 2BZHB 3U51A 5CAPA 2W4KA 2UW5A 2ITXA 3BRBA 3CC6A 4FVPA 4X7QA 4TXCA 4EOMA 4TYHA 3T9TA 3EZRA 3UBDA 5CWZA 4BDCA 4NL0A 3EIDA 3NUAA 2C68A 1OKYA 3VRZA 5DYJA 1PMUA 2X8EA 2WFYA 3QUDA 5JZJA 5LWMA 4J8MA 5KBRA 4ERKA 2C1AA 2YERA 4NM3A 2V5QA 4X2FA 1CKPA 3G51A 2OLCA 1VZOA 4C3FA 3ZXTA 4L8MA 3PP0A 5A3XA 3QQHA 4F99A 4RLLA 4QMXA 4CTBA 1OIQA 3QZIA 4NK9A 3PUPA 4MXAA 5AR8A 3TUCA 2VX1A 5LARA 5CAUA 2OJIA 1P4OA 3BEGA 4AN9A 2GQRA 3FZOA 3SGCA 5AV4A 5EH0A 2J0JA 5L8KA 3VUTA 2VWWA 4OTQA 4ZTMA 3EQHA 4YTFA 1B6CB 1KV1A 2O63A 4XG6A 2YIWA 4AN3A 3NYNA 3ULZA 2AUHA 4IDTA 4MD8E 1YOLA 5B2MA 4KD1A 3F5UA 4IX3A 1RDQE 2WQBA 4HPUE 4I0SA 2YACA 4FA2A 3QA0A 3OG7A 4AACA 3ANRA 3GU7A 5AP0A 1OL6A 3IOPA 5HBJA 3GU4A 4IX5A 5DN3A 4FV7A 3A7HA 4XEYA 3KRWA 4I4EA 5HD7A 3RZBA 3TZ8A 4GYIA 4NEUA 4ACCA 4GH2A 5A54A 3QHRA 5CS6A 5BVNA 5K4IA 5D12A 4J95A 3C9WA 5J79A 3P79A 3MH2A 5GJDA 5J5TA 5KKRB 4FTUA 4AA5A 2C3LA 4QRCA 4GT3A 2FSTX 4LFIA 1ND4A 1KSWA 1X8BA 4KIQA 5C4KA 3DXPA 1FPUA 5I5ZA 2X1NA 3JVRA 3PZHA 4JBPA 3AQVA 3ZSGA 4F6UA 4RT7A 3PXRA 3QQGA 3PA3A 1H01A 5AUWA 2BDWA 4FVRA 1A48A 1PYEA 2OBJA 4KABA 2PMNX 3DBEA 4JOAA 3WE4A 5AUTA 4BCKA 1G8SA 5AMNA 3RKBA 1Q8YA 1SM2A 3B2TA 3QZGA 4YJPA 4WT6A 3I79A 2UZTA 3MVHA 3KCFA 4DGLC 3LQ5A 4KIKA 5GINE 4YGAA 3Q53A 2PZ5A 4EOSA 2YITA 3Q32A 3GC8A 3ODYX 2VTIA 5BNJA 1FVTA 3H9RA 5IH6A 2P2IA 4IACA 4FIGA 5FXRA 3D83A 5EYMA 3OS3A 3OTUA 4S34A 2CHLA 3UNJA 4BDJA 3EL7A 5IG1A 5BX0A 2FYSA 3MB7A 3E5AA 1UU3A 2FVDA 4MXCA 5HGIA 2X7FA 4TWPA 4ACHA 4EJ7A 5HIBA 4YUQA 3V6SA 3KULB 4TTHB 4X6RA 1YI6A 2XK3A 3DKFA 3FMEA 4CFFA 3SDJA 2RGPA 2Q0NA 3IONA 5HG7A 4FSYA 4V0GB 2X6DA 3QUPA 1XBCA 4ID7A 4GIIA 5EYDA 3WF7A 5HBEA 5AA8A 5CI6A 4F9YA 3QTUA 2W1EA 3OBGA 3QYWA 3F5GA 4J71A 2HZ0A 3THBA 2ESMA 4FEQA 4B99A 4DFZE 2GHMA 4C2VA 1DM2A 4X3FC 4OT6A 1ZARA 2Y6MA 4V01A 4XP2A 1WAKA 4Q2AA 4PNKA 2BROA 4IWPA 3BWJA 1BL6A 3FZ1A 4R3RA 5ETFA 4HGTA 3OW4A 4DGMA 2HZNA 3R8ZA 3R7IA 2XKDA 1M7NA 4LMNA 5JRQA 4BWPA 2UZWE 3FSFA 2ZYBA 2G15A 4QT1A 3ZZEA 3V51A 3RGFA 2IVUA 5F94A 3VBVA 1PXLA 1TQPA 4M12A 5KMMA 3GNIB 5HICA 4CZYB 2GCDA 3V8SA 3LCSA 4EUTA 2X9EA 4FSWA 2WTCA 5CY3A 2WNTA 5DMZA 5EYKA 3VRYA 4XG3A 3S95A 4RZVA 2WQMA 2VTNA 4ZTSA 2WMBA 3R1NA 2EUFB 1UKHA 2VTPA 4CD0A 5HORA 3NMUF 5CEOA 4R6VA 2PMLX 3IO7A 4JRVA 4EHVA 2GU8A 3FC1X 4F6WA 4FR4A 3VBWA 3VUDA 4FKUA 2GHLA 4O0VA 1CKJA 1XJDA 3BU5A 2LGCA 3MPMA 3TUDA 4O84A 2WMAA 4EKKA 3L8XA 5EW3A 4B7TA 5FTGA 3FHIA 5FEEA 5IZFA 3BYMA 3ZMMA 3BU6A 3DZOA 4BI2A 3N51A 3AC2A 2R9SA 3JUHA 3L9PA 5EOBA 4ZZMA 2HWOA 1RW8A 4OR5A 4Q5EA 2I6LA 3EOCA 4X2KA 5I4NA 4FKSA 3JYAA 4IANA 2ZJWA 3FMDA 3R7VA 3UOJA 2VWBA 3GC0A 1CTPE 1FVVA 2R3JA 1FGKA 3EQRA 3D0EA 3LFBA 5HLNA 4BDBA 4ANOA 5C8NA 3W1FA 3RAKA 4EH2A 4YHTA 3W18A 1UNGA 2ZV9A 4P90A 1XH7A 2XBAA 2VAGA 2QU6A 3O7LB 4WSYA 2X4ZA 2HOGA 2HELA 3IGOA 4C0TA 5HO7A 1W0XC 4WOVA 3HEGA 3KVWA 4G3DA 4FG8A 4WBOA 1XR1A 4EOJA 3QD0A 1FQ1B 2BRMA 5CSHA 3LFSA 4H3QA 3F2NA 4C4FA 2QOCA 4R1YA 3GU6A 4PMMA 4AAAA 4IB5A 3HP5A 2BALA 4YC6A 3P23A 2C5YA 2B0QA 3FQHA 4YHFA 5ANKA 4G2FA 5JFXA 3L1SA 2PVYA 4O21A 4J8NA 1WCCA 4ZTRA 3BX5A 3L9MA 4GVJA 4YJUA 3DAEA 1GAGA 5FEQA 3R00A 4EK8A 2JFMA 4WSQA 2C6LA 3KRLA 2VD5A 3FLYA 3BU3A 2O5KA 2GNJA 1LPUA 2PVJA 2JLDA 4JS8A 5AUZA 3ET7A 3PE2A 4ANMA 4J52A 3LMIA 3FEGA 2R3IA 3QGYA 2HY0A 5T68A 5IISA 2J5EA 1UWJA 5ETIA 3Q5IA 3R83A 3VF9A 2B9IA 3IDBA 3RPYA 4QYGA 4D2TA 2FA2A 4FT9A 5J1VA 4ZP5A 5AUXA 4ERWA 4NIFA 4FUYA 3T9IA 3PPKA 4PPCA 2GPHA 2HK5A 3M11A 3VUGA 2WTIA 3ZRMA 4ZEGA 3Q04A 4DH8A 3UG2A 3F7WA 2FSOX 2XKEA 4O0XA 4OUCA 2BAQA 3EMGA 2WMTA 5M51A 4KSQA 1H08A 4E73A 5IQEA 1O6YA 3AT3A 1JKTA 5HNIX 3MS9A 4GVAA 2OZAA 5L8JA 4EH6A 4HYUA 3PA5A 3ZDUA 2P33A 4KBKA 3CLYA 2WMSA 4EOPA 3K5UA 2GTNA 3TACA 1JPAA 3IOKA 2X4FA 3AC3A 5J9ZA 1IRKA 3MY1A 1IASA 4TZRA 3WF6A 2ZB1A 2UW6A 1JKSA 3A7JA 4NTTA 1NVRA 3A60A 4U7ZA 5AP7A 3DFCB 3FLSA 4PMTA 3GCUA 2X8DA 3QCSA 5TR6A 3RPRA 1OKVA 4XBRA 3E8NA 3W2PA 4C8BA 1PJKA 3Q9YA 4MWIA 4G3FA 4JQ8A 4QMQA 5IUGA 3E62A 3PFQA 3QTRA 3L9LA 1YWNA 5LVMA 4RA4A 4U40A 5DG5A 5HE1A 3RAHA 4AX8A 4YJOA 2V62A 4NCTC 2CNQA 5AAGA 4NZWB 2R3HA 2F57A 4TWNA 4PMSA 2XK4A 3AXWA 5AX3A 5B2LA 3BI6A 4K8AA 2B4SB 2BILB 2HWPA 2VTTA 2X6EA 3Q96A 4GYGA 3P7BA 3E87A 4HCUA 4ZIMA 4BWKA 4O7LA 4FZ7A 4NKSA 3U87A 2EB3A 5LMKA 1H0VA 2X2LA 2YDIA 4JQEA 3RVGA 4R7IA 1PXPA 2YM6A 3ZUUA 3CEKA 5TO8A 2V0DA 3WIGA 3WZEA 4JT3A 2ITOA 3E8EA 4I3ZA 4IWQA 4FEVA 5IA0A 3QLGA 5E91A 3H3CA 1KE7A 2B54A 2X7OA 3PG1A 4TW9A 4FTJA 1E1XA 2WEVA 2Y0AA 4MD9E 4GUBA 3W33A 2PMOX 3KGAA 3MPAA 3ZC6A 2XIKA 3W16A 4XBUA 1AQ1A 2BFYA 4AZEA 4ZZOA 1GZNA 2H34A 4DG3E 3ZEPA 3QQJA 3ZO3A 3QTWA 3W2SA 3HMIA 1REJA 3KA0A 4O7VA 3FBVA 1ZYDA 4QMLA 3R04A 3QQKA 3KXMA 4RIWA 5GZAA 4UWYA 3KXGA 4F7SA 2OJ9A 4S2ZA 3F5PA 3ID6C 5L2IA 3VBQA 2JIIA 4G3CA 4QD6A 5H8BA 3TKUA 4AFEA 4CLJA 2XNMA 1OZ1A 4U0IA 3P5KA 3BLQA 4BICA 5IEVA 4Y83A 2NRUA 3PVUA 2OJJA 3A7IA 2W4OA 3OOMA 3W2RA 4BCOA 2PTKA 3LCDA 1DI8A 3BHYA 2VTMA 4BTJA 4LUDA 4E26A 4DN5A 1M7QA 3NW5A 1PMVA 3BLHA 2QR7A 1XO2B 3V01A 5EKNA 2J90A 4O7RA 3TL8A 5M4UA 4FG9A 5I0BA 4GL9A 5AA9A 4DE4A 5I9ZA 4O6LA 2AC3A 4P5ZA 3D94A 4UXQA 3UIMA 4TL0A 3F3UA 5HX8A 4C7TA 3RK7A 3AC1A 4B4LA 3RALA 1YOMA 4JBQA 4R5YA 5JK3A 4XV9A 3PSBA 4DLIA 3IW8A 3MFTA 1YWRA 3OCGA 3OT3A 4QP7A 4DTAA 3LIJA 5CENA 2VRXA 1H07A 2PPQA 1OPLA 4YHJA 3EN9A 2J4ZA 1T46A 3FC2A 5FP5A 5CSWA 4WA9A 4AGDA 4YC8A 3H0ZA 4FK3A 3QTIA 3VVHA 4HCTA 4C3PA 3CKWA 2UW7A 1YXSA 2IPXA 4I0RA 3WIKA 2XIYA 2ZMCA 1WVYA 4GKHA 3DJ5A 2FSMX 3T8OA 2QOHA 3E7VA 1ZOGA 2GSFA 3BV2A 4G9CA 4UZDA 2VTHA 2XK8A 5M55A 3TV7A 4NJ3A 4CG9A 4IVDA 3NYXA 1U4DA 2YM7A 3GCSA 3P4KA 3VUMA 3WF5A 4FI1A 2CKQA 2QO2A 3OHTA 1URCA 4FZDB 4E4NA 4FUXA 4O7TA 4F65A 4D9TA 3FAAA 3WOWA 4FKLA 5F4NA 4I5PA 3K54A 2UW8A 4PF4A 4F7LA 4EZ7A 4ZJVA 4DEBA 2IW6A 3M42A 3QRUA 2W7XA 3ROYA 1BKXA 3DK7A 3NCZA 3HDMA 1BMKA 3H10A 4XH6A 4EOKA 2A19B 5DR2A 1MUOA 3O23A 4YMJA 2W5HA 4DTKA 1TKIA 4TYEA 4C4EA 4QMNA 3OWJA 4HPTE 3UVPA 3PWDA 5CF4A 2JGZA 5CAOA 3O2MA 4QYFA 5ETAA 3KN6A 4KKHA 3B8QA 2Z2WA 3CPCA 3D5XA 3R8PA 1H28A 4FEWA 4BDEA 2OKRA 4QMMA 4I0TA 4JL9A 1WMKA 5DIAA 4EH8A 4USDA 5L6OA 5HTBA 5J87A 3G6HA 2QG7A 4ZAUA 2C3IB 3HUBA 3DBFA 4C59A 3I81A 5DVRA 4ZS0A 4EWHA 2FUMA 4X21A 4Y85A 4FIIA 3FY2A 5FDPA 4UYAA 3KFAA 3GFWA 3UDBA 5M09A 3F61A 5CEIA 4BDIA 2A27A 5FXSA 5K5NA 2WQNA 4P7EA 3VQUA 4OAVB 2XNBA 4QTAA 5AP5A 3DKGA 4IAKA 3EQDA 4DGOA 3VUHA 2H6DA 4AXAA 3CQUA 2GMXA 3LFFA 4UALA 4PQNA 3LXPA 3HRFA 4JVGA 2ZDUA 2GDOA 2XNOA 2CPKE 2JITA 3KF4A 4GU9A 4H3PA 4RJ6A 5C01A 5HKMA 4BCIA 2R3GA 1KOBA 3PXKA 3A61A 2Y6OA 2PU8A 4G9RA 3VN9A 4HVIA 5F95A 4QYEA 3VC4A 1YI4A 2PUPA 2GNFA 4RFYA 1ZY5A 3AD6A 5F20A 4MAOA 4XRJA 4IX4A 4NSTA 4H39A 3WZDA 3VS3A 3ZM9A 3HMMA 3F69A 1Q3DA 2BAKA 4IWDA 1CMKE 4BC6A 4C61A 2BRGA 5CTPA 2WXVA 3TN8A 5AP6A 3TWJA 4YO4A 1UNLA 4KIPA 3W55A 4DT8A 4IC7A 3RM6A 3LPBA 4J99A 4EJNA 4LV8A 3ZM4A 3O51A 2QI8A 4RA5A 4B8LA 4RJ4A 4H1MA 4EOLA 3UNKA 3N4VA 3O17A 4W4VA 5EI6A 5EG3A 3QRKA 4OGRA 3R9RA 3U9CA 4ZZNA 3CJGA 4K6ZA 4YZCA 5L2TA 5M4CA 2ACXA 4BIEA 4UMUA 3UQFA 4PRJA 3OZ6A 1NY3A 3EN4A 4TWOA 2WMQA 3RCJA 3D14A 2BHEA 2E9UA 1GNGA 5I9VA 4JG8A 2ZB0A 3ZBXA 4D0WA 3UMWA 5IMXA 4E1ZA 1ZWSA 1SZMA 3WF9A 4FSQA 4M68A 4FV0A 3R2BA 2E9PA 3VO3A 5AAFA 1OL5A 3O50A 4K33A 3W10A 3NDMA 2EU9A 3QUEA 3UOHA 2GQSA 5ITAA 2RG5A 2G2IA 4X2GA 3L8VA 3OTVA 4W4WA 4X3FB 1YOJA 2HY81 2YAKA 3MV5A 5LVPA 4DFUA 4CTCA 1JBPE 1H1SA 3K5VA 1H1PA 2C6DA 4KS8A 4M13A 1XWSA 4FMQA 3KU2A 4EYJA 4M97A 4GJ2A 4FV4A 1R0EA 2E9NA 3MA3A 3ZONA 1YQJA 2VWVA 4ACDA 2R3OA 2FO0A 4XG8A 4GJ3A 3RWPA 3A7FA 4DBXA 5D1JA 4Z55A 2YDJA 3DK6A 4C58A 4EH7A 2F7ZE 1OIUA 3TZ9A 4BVUA 5AP2A 4IW0A 4QP4A 3LQ3A 3EQBA 4ZSGA 5TE0A 3DV3A 3RPSA 2C4GA 2CSNA 1MP8A 3ZXZA 3CY2A 3BGZA 1HCKA 4V04A 3TTIA 4BCPA 1M17A 3II5A 4GW8A 4AW1A 3ATSA 4EKLA 3D2IA 2C6OA 4O1PA 5CU6A 4D28A 4L7FA 3IW5A 2RKUA 5ANIA 5FRIA 4BKZA 4PMPA 3ZFYA 3OD6X 3TNQB 5DFPA 3QTXA 2OW3A 5ANJA 4DFYA 2J2IB 4IH8A 3R7GA 5EM5A 4ZTNA 3LHJA 5JFVA 2YDKA 4AOJA 1A06A 1NW1A 2GQGA 1RE8A 3JS2A 3DB8A 3WYYA 5L2WA 3Q3BA 5JGAA 2RSVA 1TQIA 3U4UA 4AZTA 2YJRA 4D2PA 1XH9A 1FOTA 3FPMA 2ITPA 3MFUA 3P7CA 2QOFA 3PVWA 2V7AA 3DLSA 5KZIA 2PVRA 2OK1A 2WKMA 5I9YA 4FIJA 4O22A 4RIYB 5IDPA 2UVXA 5HIEA 1WBOA 4AT3A 4EYMA 1Y8GA 4FV1A 4UV0A 1SMHA 3VBTA 3ZLWA 4RRVA 4JR3A 2R0IA 4TKSA 5AR3A 2OH0E 3TXOA 3I5ZA 2XBJA 3HA6A 4J53A 4MBLA 2P4IA 4IBMA 2GS6A 3QF9A 4NKAA 5DNRA 5HCZA 5HLWA 4A9TA 3HDNA 4MNEB 4I6QA 4QMVA 2C3KA 3Q60A 1H1WA 4YZ9A 4O86A 4EBVA 5LVOA 3G0FA 4USFA 3F82A 2EWAA 4C35A 1ZOHA 3DK3A 4CLIA 4D4VA 3ZUVA 2EVAA 1YW2A 4DFLA 3F3VA 3C7QA 4AW0A 4QMZA 5DEWA 2WELA 4ASZA 5ICPA 2ZVAA 2ZMDA 2RIOA 4CFNA 4YZBA 3HMPA 4RFMA 4FTOA 1Q4LA 1OGUA 2W5AA 2YN8A 3KRJA 3BBWA 3C4FA 1OECA 5J5SA 3CPBA 3HNGA 2C0IA 4OTGA 3GQLA 1AGWA 1VYWA 2UZLA 4JQ7A 3Q9WA 4BYIA 4CFUA 1OUYA 4YP8A 2QKWB 3MH1A 3ROCA 3SRVA 4MF0A 3W8LA 3FV8A 2QNJA 2QOLA 5L3AA 3F2RA 3FXZA 4APPA 4DEDA 4AZSA 3FMJA 4U8ZA 3QKKA 3VIDA 2W99B 1JVPP 2IVVA 4M69A 5G1XA 4RFZA 5BUIA 5G6VA 5JKGA 2BHHA 2QD9A 5CSPA 1MRUA 2IVSA 2J0IA 1P5EA 3MIYA 4GCJA 5EHLA 5CX9A 4E6CA 3TV4A 3ZO2A 4BWXA 3PY0A 3VQHA 3LKMA 4L3PA 5HEZA 4DYMA 4WNOA 4X2NA 1O9UA 3UVQA 5H8EA 3KN5A 2OFVA 3HMOA 5CEPA 1JKKA 2OWBA 3LFQA 3FKOA 4FL2A 4L9IA 5BVDA 5GNKA 1OB3A 4TYIA 4C4JA 3GT8A 4W9WA 5TOZA 5DR6A 3D4QA 3OFMA 5D10A 4FL3A 5FGKA 5FLFA 4GU6A 1H8FA 3NCGA 4AWIA 3AMBA 4TPTA 5CQUA 4CFMA 4BI1A 4MEDA 5K0KA 5K4JA 2X39A 1ERKA 2ETMA 3FHRA 4LRMA 2FH9A 4ASEA 3EN5A 3RAWA 1URWA 1H24A 1SNUA 3FQEA 2JKKA 3EZVA 4L68A 1E9HA 2BCJA 4N6ZA 4YZMA 3LLTA 3WYXA 3R8MA 3OOGA 3F66A 3ZDIA 4YC3A 3IDPA 4C57A 2XS0A 1KOAA 2XIZA 2UW3A 4YJVA 4FTCA 4IMYA 3AC5A 4YLLA 3BPRA 2GTMA 4U6RA 1LUFA 3NR9A 5AM6A 1P14A 4CNHA 5DA3A 2W1CA 4O7WA 3HV5A 4HYIA 4QQJA 2WB8A 4L6QA 4L7SA 4EC8A 4J7BA 3QCQA 5IKWA 4UN0C 3LJ0A 1OITA 3AMYA 4U45A 1RJBA 4XG2A 3VNTA 2XKFA 3LFNA 5C26A 4X0MA 3TM0A 5FM3A 3PVBA 4CFXA 4M8TA 2HW7A 4YPDA 3VUIA 4O1OA 5DT3A 2WMXA 3ZLYA 3R0TA 1VYZA 5M53A 3E8DA 1F5QA 2C6EA 3P78A 2VWUA 5J9YA 4O83A 1WBPA 2HXLA 2WTJA 5HX6A 1PMNA 3IGGA 3V5PA 2W9FB 3UIXA 4A7CA 2B53A 2WQEA 3FE3A 5IQCA 2W1ZA 4QYYA 4IM0A 3POOA 3Q5ZA 4WBBB 4BFMA 1GIIA 2OIQA 2PL0A 4GSBA 4NM0A 2J5FA 3ENHA 3MFSA 5TF9A 3W2CA 1OIRA 2JEDA 3HECA 5HTCA 4G34A 1UNHA 5BUJA 1J1CA 2WTKB 3OUKA 5FTQA 3KF7A 4FT3A 2P0CA 3ZO4A 1P2AA 2YAAA 3PXFA 3R28A 2HXQA 3GCVA 4GK4A 4XV1A 4L53A 2R7IA 3R71A 2WPAA 3AD4A 1IA9A 3ZZWA 3FI8A 2G01A 4EEVA 5CF8A 1FMKA 2J9MA 2C6TA 4BN1A 4Y5QA 3IK3A 4FKIA 5A46A 4MH7A 2C47A 1YXVA 2GHGA 2VV9A 4JJRA 2PVFA 2R3PA 5IMEA 2G9XA 4DLJA 5CASA 5LMKC 5E8WA 4LQMA 4F63A 4DGNA 4B0GA 3JY9A 2CDZA 4KIOA 3TUBA 4FKVA 4EH3A 3MY5A 2B55A 3C50A 3BKBA 4AGWA 2PE1A 1SVHA 2JBOA 4H1JA 4QNYA 1I09A 1F0QA 4GT4A 3RHKA 4DG2E 2IW8A 5EDPA 2I40A 3G90X 4IHPA 3SAYA 2UVYA 1V0OA 1GIHA 1WVWA 4ZJIA 4BCQA 3PG3A 2P2HA 2Z60A 1ZMWA 3FY0A 1Z57A 4FSRA 2V22A 2XYUA 1FGIA 2CN8A 3AD5A 4FSZA 4M14A 4YJNA 2R64A 4K11A 3UO6A 1KE5A 3EN6A 4C33A 3FZRA 3E93A 5AJQA 3TTJA 2XNPA 1GY3A 4EL9A 4W9XA 2PSQA 3QCYA 4NM7A 1K2PA 4EOIA 5CEQA 3NS9A 1JKLA 3BZ3A 5AAEA 4LYNA 3QGWA 3FL4A 4F9CA 4RJ5A 2H96A 1JQHA 1ZMVA 3PJ2A 3R1QA 3BYOA 3D15A 4R3PA 4FSNA 1PXOA 2YZAA 2YIYA 4ZK5A 2OJGA 3B8RA 2ITWA 1CKIA 5BVKA 3DT1A 2I7QA 3QXPA 3REPA 2PYWA 5HG8A 2EB2A 1UVRA 1NXKA 2QG5A 2BTRA 4YJQA 3CTJA 4USEA 3KRXA 5J7HA 3LXNA 5I9WA 4I1ZA 3KXXA 4LMUA 3VS4A 1Q24A 4C02A 5M57A 1GZOA 2VN9A 1U54B 2BAJA 3GOPA 4JRNA 1MQ4A 4TYJA 4XMOA 3C0GA 1ZXEA 3QD4A 1YWVA 5AM7A 4XOYA 5EYCA 2CLXA 4QMYA 1UA2A 4HVGA 4H36A 3VULA 3NW6A 3ZEWA 3OW3A 4O6EA 3DTCA 4WNPA 2JKOA 4RBLA 3TEIA 4FKTA 4LOPA 2ONLA 4AW5A 2PUNA 4FTTA 4OT5A 2CGXA 5FEDA 4I94A 2F49A 3R9HA 2W17A 4Q9ZA 5BMMA 4OTFA 4A4XA 4MVFA 3VS6A 3QKLA 1AD5A 3NZ0A 4FYNA 4NFMA 3DBQA 4LM5A 4X2JA 4CZUA 1DI9A 5ACBC 4IAIA 3DKOA 4BBFA 3C5IA 3FWQA 5EFQA 3DBCA 5EI2A 3LCKA 3DQWA 3PIYA 3QTZA 2BZIB 3OXZA 3NYOA 3ZLSA 3I7CA 3WE8A 4TYHB 1H27A 5B7VA 4KB8A 3OVVA 2CMWA 1WBSA 4FG7A 4BYJA 3NUXA 4I5CA 4IXPA 4MXXA 3LFAA 2G1TA 4DFXE 4E7WA 2PHKA 2UZOA 2XK9A 4E6AA 3MA6A 4RC3A 4O38A 3F88A 3F6XA 3UC3A 5LWNA 2UUEA 2W1IA 2C1BA 2SRCA 5A4QA 3D7TA 4FF8A 4DFNA 5CAQA 4PL5A 3OUNB 5DHJA 3ZRLA 1E1VA 4CYIA 3DJ7A 3FKNA 3QTSA 4EK5A 3O7LD 3TDWA 4XG4A 3RMFA 4D2VA 4DH7A 3MFRA 1Q8WA 3OEZA 3VS7A 2I0YA 1Q8TA 2DYLA 2QLQA 2VGPA 5M56A 1STCE 3AT4A 3HP2A 2OG8A 4QNAA 4JNWA 3DBDA 3ITZA 3A2CA 2KTYA 2VTLA 3LVPA 4RIOA 4CRSA 3MESA 4O0WA 4JX3A 3SXRA 4RJ8A 3C5UA 3PLAE 3I4BA 4H58A 2A2AA 2CGUA 5M08A 3R1YA 3TKIA 5HD4A 3PZEA 5DRDA 3NNUA 3FMHA 4CCUA 3NUUA 4CMTA 4CKRA 2CGVA 2C3JA 5BQ0A 1V0BA 5AEPA 2YA9A 5C1QB 4YBKA 5KZ0A 5HTIA 3V5LA 3CGOA 3LCTA 4QQ5A 4WUAA 4XRLA 3ACKA 4R8QA 2LAVA 2W06A 1VJYA 3RZFA 3WZUA 4YURA 3CKXA 4ANNA 2J50A 4G31A 3DPKA 3PJ3A 4TN6A 4A4LA 5CVFA 3O0GA 4BTMA 2Z02A 1BLXA 3A8WA 3D2KA 3FMMA 3R2YA 4FODA 4IM3A 3TNWA 4BDGA 5LJJA 3COHA 1FINA 4QP1A 4ALVA 4Y46A 5I9UA 3RHXA 3UGCA 4F7NA 5BPYA 2WMUA 3IECA 5CU3A 4APCA 1ZYLA 2JKQA 3Q2JA 1PMEA 4D55A 3KQ7A 4K2RA 2ZAZA 1PXMA 1LEWA 5CI7A 3RBWA 1U46A 3B2WA 3CE3A 3Q52A 3M1SA 2C30A 4NH1A 2R4BA 4MCVA 2IWIA 2OIDA 2VO6A 3G9LX 3TIYA 1H25A 4KIKB 2PULA 5FUTA 2X0GA 3QC4A 4C36A 4XOZA 4CV8A 1SVGA 1VEBA 5CU0A 2QCSA 2WOTA 5C27A 5GIPE 2XK6A 3S0OA 1DS5A 3NIZA 5HCYA 3UQGA 1IEPA 5E1EA 3PIXA 3BHVA 2DUVA 4R5SA 3Q9XA 4U41A 5K9IA 3R73A 1ZZ2A 4L3JA 2X2KA 3ZYAA 5CALA 5M07A 4D9UA 3OXIA 3SW7A 3JXWA 3TNPC 3PPZA 4RC4A 2C6MA 4PTCA 5ACKA 5GIOE 1SVEA 2WTVA 1SNXA 3R1SA 5HLPA 4DEIA 3DA6A 3R8VA 3PA4A 1XH5A 2VWXA 4O96A 3RNIA 2XRUA 4BBMA 4W4YA 3EKKA 3N4UA 3IPHA 2RL5A 3GCPA 4DTBA 2ZV2A 3FMNA 3NW7A 5EW9A 3FUPA 2BUJA 4XUFA 4E5BA 3R9DA 3BELA 1G5SA 5I3OA 5AP4A 3SKCA 3LMGA 4NUSA 3HV3A 3T3UA 3OROA 5TKDA 4QMTA 4TNBA 5I9XA 4HGLA 4BI0A 4M67A 4FZFB 1YHVA 4CRLA 4NFNA 5EQYA 1OI9A 3V8WA 4ACMA 2PZIA 2F4JA 1SYKA 5BVOA 2WMRA 4IWOA 1OVEA 2BZJA 2B9FA 4YZNA 2DQ7X 4FGRA 3AC4A 4YJRA 4IB0A 4OW8A 4IADA 2RFEA 2XZSA 2YCFA 3KB7A 4QPMA 4QPAA 1H0WA 4E93A 4GFOA 4EI4A 5HNGA 4FNZA 3SXFA 4I6FA 1Y91A 1YVJA 4U80A 3ORXA 3UMXA 3ZBFA 3UZPA 4CKIA 2QHMA 2OICA 5E8XA 3CXWA 3NNXA 2ZDTA 5IPJA 3QAME 3VW6A 4AT5A 4C2WA 1O6KA 5FWKK 4DEHA 3AG9A 5CZHA 2XIRA 4EK6A 2QOKA 4CT2A 4ZMFA 4FV8A 4JIKA 5D7AA 3MDYA 5BVFA 4ZS4A 3AGLA 3S00A 4CXAA 5C03A 4NYEA 3FMKA 2QOBA 1VR2A 2QR8A 4O27B 3C51A 4WKQA 3V6RA 3WARA 5E92A 3OXTA 3BHTA 3RP9A 4ZTQA 3FKLA 5K5XA 4XP0A 4K18A 2Y9QA 3R30A 4BCMA 5HE3A 3VJNA 4C38A 3UIBA 2W4JA 3ORPA 1ZY4A 4FK6A 4M15A 4NJDA 5AV2A 3KREA 4LL0A 4IIRA 4ZOGA 4I4FA 1KE8A 2XCKA 4HYSA 4U44A 3FSKA 1PF8A 2QVSE 3OWLA 4JDKA 3HZTA 4YZDA 5KMLA 2YCRA 4I24A 3ZHPC 2ZOQA 4AZWA 1KUTA 4RWJA 4F09A 4OTDA 4BCNA 3MGYA 4I93A 5CU2A 4TRLA 4B6LA 2X2MA 3PP1A 3U4WA 4P5QA 2BVAA 5L6WL 4AA0A 2HCKA 2Y4IC 1ZYCA 3COMA 4A06A 4HNFA 5HO8A 5IQIA 3SW4A 1PKGA 4QP9A 1WBVA 4ZSJA 5FXQA 4FT7A 4RG0A 4AZVA 4A9YA 2E9VA 3MB6A 4B9DA 5DLSA 3MIAA 2WZJA 3OCTA 5DH3A 2GNGA 4LV5A 3QFVA 5J1WA 2ITYA 5FTOA 3DGKA 3NIEA 4TT7A 3RCDA 3UG1A 4GEOA 3PLSA 5FQDC 3UPXA 5E9EA 2X9FA 1Y8YA 4MXOA 4WIHA 5JFWA 5M44A 4L01A 3EH9A 1B39A 4F0FA 3SOCA 4L00A 2NP8A 4MBIA 2B9HA 3AOXA 5KMIA 3FXXA 4XYFA 1JAMA 3QZHA 1XBAA 3EQCA 3FDNA 4XLIA 3IKAA 5IDNA 4NTSA 2XYNA 4D0XA 3EQPA 3ZC5A 3RK9A 1J7LA 4KRDA 1Y6AA 4FTQA 3MJ1A 3SV0A 1R1WA 3ORNA 3SHEA 2NRYA 4F9BA 2E9OA 3DLZA 3I5NA 3MTFA 4ASDA 3Q2MA 2XEYA 4N0SA 3UODA 4WUNA 5CT7A 2VNWA 3E88A 4QOXA 2R3QA 3GUBA 4DHFA 1M2RA 5GHVA 4RVMA 1Q3WA 4WHZA 3FYJX 5GZ8A 4ENXA 4NIFB 4PPAA 4LRJA 3DXQA 1J7UA 3LM0A 1JWHA 3MPTA 5ANEA 4AN2A 4M7IA 3EFWA 1M2QA 3PJ8A 4CZTA 4DITA 3BHUA 1UWHA 4WRGA 5HVKA 5CVHA 3RWQA 2R3LA 3PE1A 2VZ6A 4OTIA 5B2KA 4HJOA 2OZAB 3D5WA 4FYOA 2WD1A 4FSUA 3UPZA 5T6KA 5IA3A 5E8SA 4IVAA 2PZRA 2RFNA 4FIEA 4IZ5A 1DAYA 3EJ1A 4KS7A 3P08A 4PNIA 3NX8A 4FTIA 3EQGA 4AU8A 1XH6A 3HRCA 3ZFXA 3R63A 2BRHA 4BIBA 4CG8A 5A4EA 3L8PA 2BIKB 4JG7A 2XEZA 3NYVA 1LP4A 3WI6A 3ZUTA 2F9GA 4IM2A 4JR7A 4G3GA 3LJ1A 2OGVA 2AYPA 3QA8A 4B8MA 3GU8A 3Q6WA 5JSMA 4O0YA 4KKGA 4DFBA 5CQWA 2C5OA 2YFXA 4P2KA 2WEIA 4ARKA 3EB0A 2C5VA 4Q5HA 4BTFA 4PL3A 3OCSA 2XCHA 4QQCA 4FOCA 1OUKA 4N70A 3U6IA 5CEKA 1YRPA 4QTBA 2WOUA 4ACGA 4GS6A 2G2HA 3BCEA 4KNBA 4PPBA 1OIYA 4FTAA 4I21A 4F1TA 4EWQA 2UW0A 5AV1A 1OM1A 2YWPA 2Z7RA 4Y8DA 3HYHA 4DAWA 2C6IA 5KHWA 4DF3A 4ENYA 3CJFA 4KUJA 4DEGA 4FL1A 4CV9A 4M3QA 4O0UA 4QQTA 2EXCX 2OXDA 4JDHA 4XNEA 3R7OA 4CVAA 5L6PA 3TNIA 4CSVA 1YXTA 4QMSA 4GV1A 5AX9A 5KMJA 2E2BA 2PUUA 2GNIA 1YI3A 2O3PA 3DDPA 4MXZA 3EQIA 5EDQA 1HCLA 3E3BX 3VW8A 3UOLA 5HZNA 3BLRA 3NAYA 4GIHA 5GJGA 4RX5A 4XHKB 3VBYA 4F0IA 4FBXA 3MY0A 1BYGA 2H9VA 2CKOA 2A0CX 1BUHA 3ORTA 4G6OA 4IEBA 2C5XA 2YLFA 3ORIA 4R3CA 3W2OA 2PE0A 4RIWB 3ZSIA 3KULA 4ZY5A 1WVXA 3HV6A 2VX0A 4UMQA 4OBPA 2B9JA 3UYSA 4E5WA 1GOLA 3LJ2A 3OMVA 5M4FA 2YM8A 4V0GA 3DFAA 5BVWA 4Z16A 2BIYA 3QHWA 2R2PA 2BTSA 4LI5A 4PP9A 5HO6A 3N4TA 3RAIA 4GT5A 3EQFA
chains in the Genus database with same CATH superfamily
2UV2A 5A14A 1BI8A 3S3IA 3W0QA 3QRIA 4U79A 4UEUA 3BBTB 2YM5A 3W32A 1QPJA 4AQCA 4MHAA 1XQZA 3VWAA 4FKJA 4D1ZA 1T45A 4LL5A 4XLVA 1R78A 4O4EA 5LMAA 2REIA 4EC9A 4QP2A 5C9CA 4BZDA 3CR0A 2W0JA 1Q41A 2Z7SA 1CM8A 4MKCA 5CT0A 3UZTA 2YLEA 5IU2A 2O2UA 3IS5A 2X7GA 2ZFYA 1YXUA 4FTMA 5E90A 4DCEA 4TYGA 5IQFA 1BL7A 1CSNA 4E3CA 3QCXA 4XV3A 3NSZA 3NUYA 3D9VA 4U43A 3BV3A 4ZMEA 2UZBA 1XH8A 5HHWA 2OF4A 2ZV7A 3FQSA 3ZTXA 3RINA 2XJ0A 1UKIA 5DEYA 5JGBA 1WBTA 3L8SA 4BGQA 5AUUA 5EM8A 3KK8A 3C13A 1S9JA 4UMPA 5AIRA 1NT2A 2RFDA 1QMZA 4XJ0A 1K9AA 5IQBA 2VTQA 5FDXA 2Y8OA 3WZJA 1GIJA 2JDTA 2XMYA 3HUCA 4P4CA 4ZSEA 4CQGA 3EWHA 1Z5MA 3IW7A 3P7AA 3PXZA 4K9YA 4PDPA 4BGGA 4G1WA 4D4YA 3DNDA 1OL2A 2WU7A 3QXOA 3QRTA 4KBCA 2R0UA 2XF0A 3VHEA 3C1XA 5EHYA 3GQIA 3EFKA 2YIXA 4L3LA 2DS1A 3KC3A 2CNVA 4UZHA 3EHAA 1BX6A 5IQGA 3T3VA 3COIA 3HV7A 1BI7A 5AP1A 4AT4A 5EQEA 2BDFA 3GB2A 4BRXA 4RVTA 4KKEA 4DH1A 3BQRA 5HG9A 4RWLA 2OH4A 3OC1A 3Q4ZA 4A9RA 1JOWB 2BZKB 4LOOA 4BF2A 2ONLC 2KULA 2IZUA 1IA8A 4X3JA 4JDJA 1OBGA 3GCQA 5KHXA 3DZQA 3UE4A 2PY3A 3GENA 1LR4A 4BKJA 3VS2A 5DI1A 4MWHA 2Q0BA 4GRBA 5HESA 2BR1A 4F9WA 3GI3A 4RPVA 4EQMA 3L9NA 4QP3A 4BBEA 4D5KA 2OJFE 4JIAA 3FLQA 3ZO1A 3EN7A 2QURA 3FZSA 4QMOA 4QPSA 4UMTA 4IQ6A 1OGYA 3E63A 2FGIA 3FXWA 5H3QA 4FSMA 4I23A 4YO6A 5CYIA 4X6QC 4CEGA 3ORKA 4JLCA 4FKWA 2F7EE 4BR3A 3PSCA 2GS7A 3RM7A 3V8TA 2R3NA 2RFSA 3CGFA 3ETAA 2C0TA 1R0PA 2ETKA 4GK3A 5CNNA 4AXEA 3H30A 4TWCA 3GXLA 4UWCA 2NYAA 4IZYA 4MXYA 2JFLA 3KXNA 3GVUA 4K77A 4G3EA 4ZTHA 3W8QA 4ALWA 2C0OA 1XKKA 3DCVA 4YU2A 3DQXA 2BKKA 3TJCA 5HNBA 5H2UA 4UWBA 2HYYA 2VUWA 3KMMA 3E92A 3CTQA 4R7HA 5CXHA 3RNYA 4U3ZA 3BE2A 2O8YA 4OTPA 5FP6A 3GC9A 5BVEA 4MBJA 4FEXA 3KK9A 5JQ5A 4I6BA 4CT1A 3O8UA 3A7GA 4IAAA 4CYJA 5LXMA 2WMWA 4WG5A 3KXZA 3NNWA 4ZJJA 2PWLA 3DXNA 3VJOA 3C4XA 4C4IA 3GU5A 3A4OX 5AUYA 4G5PA 4IJ9A 4LG4A 4UX9A 3JVSA 1J1BA 4Z7HA 3COKA 1YHWA 1Z9XA 2XJ2A 3KY2A 3NPCA 4BCHA 4R77A 4Y72A 4FZAB 4UY9A 5JGDA 5DOSA 5K0XA 3OP5A 4A07A 1KE9A 5L2SA 2CJMA 2XM9A 2JAMA 4Q9SA 4CQEA 3SQQA 3BGPA 3O8TA 4XP3A 5IA4A 1YHSA 4QTEA 2OXYA 3LQ8A 3EFJA 3LCOA 3PXYA 3R8UA 4C4HA 3HAMA 3UZRA 4FKPA 3NUNA 4QO9A 4DHJA 4S30A 3HX4A 5IA5A 1W84A 3ZCLA 4F70A 2QONA 4RJ3A 4I22A 4PDYA 1NVSA 5JN2A 3HAVA 5AV0A 5FM2A 5HCXA 4R78A 5GZ9A 2BRNA 2CCHA 3I0QA 3V5WA 5IEYA 3PRIA 5M4IA 4RX8A 4FIFA 4BHNA 1ZLTA 4C37A 1U5RA 4FE2A 5L8LA 3GEQA 3NRMA 1RQQA 2C5NA 2ERKA 2XVDA 4DH5A 3VS5A 3CP9A 4YNOA 3EFLA 5C8KA 2JAVA 2XIXA 4U42A 4Y5HA 3TKHA 4F9AA 2QKRA 1DAWA 4FTNA 3D5UA 5LQFA 5IH4A 2XJ1A 1V0PA 3LW0A 4I5HA 3PIZA 5JMSA 4IFGA 4HOKA 4CMUA 1LEZA 1J7IA 5L4QA 4BGHA 1J91A 2JBPA 4CGAA 3PY3A 4I5MA 4C4GA 5B0XA 1JSTA 5IH5A 3BQCA 2JDOA 3Q9ZA 2R3MA 3MBLA 4AS0A 2O0UA 5E1SA 2XP2A 2W1HA 5DGZA 5HQ0A 5E7RA 1QPCA 4LGHA 3QBNA 2PVKA 5AWMA 3K3IA 1XHAA 3UDZA 1PHKA 3CQWA 4D1XA 4RJ7A 4DGGA 3GP0A 5KUPA 5KNJA 4A9SA 2WQOA 3QQUA 2ZM4A 2A1AB 2J0KA 4AFJA 4YSMA 4FV9A 2IJMA 1PXNA 3D5VA 3UP2A 4ALUA 1GZKA 4PWNA 3GOKA 5IUHA 4DBNA 4MK0A 2PZYA 3P0MA 4FTRA 4GG7A 4UBAA 2Z8CA 3KCKA 4DHZA 3ORLA 1PYXA 3FLNC 4F0GA 4RZWA 5EW8A 5CF5A 2NO3A 2ITZA 2VO3A 1A9UA 1F3MC 2OU7A 2OXXA 1OMWA 3BGQA 3MW1A 1QCFA 5EOLA 2IG7A 3MVLA 3V5QA 3TV6A 4FKRA 1R3CA 4FNYA 3CQEA 3SD0A 4J97A 1UU8A 3HL7A 2UZUE 5CXZA 1O6LA 3OCBA 4FEUA 5JZNA 1FMOE 2QOOA 1I44A 4PL4A 4XV2A 3C4CA 4GFGA 2B1PA 4M0YA 2VTJA 2Y4IB 3G2FA 1OPKA 1IAHA 3Q6UA 4KWPA 4NT4A 4RIXB 2HW6A 2XNNA 1YXXA 4WNMA 4EH4A 5IQHA 3A99A 2GFSA 4ZSLA 3PJ1A 3KRRA 4CFWA 2VU3A 5HG5A 3SA0A 2HAKA 3VF8A 4IZAA 2PUIA 1OBDA 3MVJA 3NUSA 4WD5A 2CN5A 4XS2A 5M06A 5D7VA 3SVVA 4CCBA 4DT9A 3OWKA 4JI9A 3A62A 3QC9A 4XCUA 5CSXA 3F3ZA 3QKMA 4RSSA 3DOGA 5H9BA 3PYYA 4EONA 4MYGA 4U9AA 5E8YA 2RG6A 1NVQA 3NUPA 2WTDA 3C0IA 3QU0A 5HE2A 4Z3VA 4JAIA 4QTCA 5FBNC 3FL5A 4F1MA 4KSPA 4MQ2A 1M2PA 4LGDA 5HOAA 1JLUE 4PTEA 4D2WA 4EHEA 2CCIA 3QLFA 3BIZA 3HLLA 3GC7A 4F6SA 2UZNA 1OL1A 4F7JA 3QZFA 5CEMA 5CF6A 5BYLA 3SRVB 1QPEA 2IZTA 3MYGA 3VBXA 4ZSAA 4L45A 4L42A 4YJSA 4E5AX 5ANOA 3KL8A 1CDKA 2X0QA 3S4QA 4DEAA 3HA8A 5DE2A 5A9UA 4BTKA 2A4LA 4WG4A 4M69B 2H8HA 5T3QA 2QC6A 3U6JA 4JG6A 2ZM3A 3FI4A 5DBXA 3P5JC 3EYHA 4ITJA 2HZ4A 1XBBA 3UO4A 3LXKA 4AP7A 3QD2B 2HZIA 2OIBA 3CIKA 3MN3A 4L43A 4L46A 5CLPA 2W1GA 2CNUA 5BV3A 4IC8A 1YKRA 3BEAA 4Z7GA 4LRKA 3DY7A 4U5JA 2I1MA 2XA4A 1H26A 3BYVA 2YM3A 2PVNA 3VS1A 2V55A 2YCQA 4UMRA 5AADA 3AMAA 2PMIA 4TNDA 3C4WA 2GS2A 3KXHA 3NGAA 3ODZX 1ZYSA 2UW9A 4IAZA 4O0TA 3C0HA 3MTLA 1UU9A 4ZY6A 3RJCA 4J1RA 3TT0A 3UO5A 3ZFMA 4IB1A 3R7UA 4BDDA 5K3YA 2WGJA 1Q62A 3OY3A 4PDSA 3OBJA 4ZTLA 2YEXA 4IAYA 3DNEA 4O2PA 4JX7A 4E8AA 1ZOEA 4EOOA 3QD3A 4PY1A 4ZY4A 4G17A 3MJ2A 5D11A 3TYKA 3UOKA 4C62A 2BMCA 2DWBA 2VTAA 3LM5A 3UIUA 4C34A 3E8CA 3FI2A 1UU7A 4IFCA 1XH4A 4OTRA 4O7NA 1Y57A 1R39A 3DAKA 4D58A 3BL9A 3OEFX 3AKKA 3QALE 4BL1A 5CZIA 2WMVA 3UQCA 2W96B 3HV4A 2ETRA 1GZ8A 5D9HA 4OTHA 4QMUA 3SG8A 4MQ1A 3U55A 2R7BA 3PVGA 4FKQA 4ONAA 3QL8A 3SG9A 2YIQA 2UVZA 2UZVA 2ZM1A 4YPSA 4MD7E 5J8IA 5KO1A 4FV2A 5HI2A 1PW2A 2OSCA 5AR2A 5ETCA 5IUIA 5IF1A 1TVOA 5BMSA 4AGCA 4BZOA 1QL6A 2W9ZB 4PDOA 4N6YA 1WBNA 1ZAOA 3TNHA 4F08A 4QTDA 4HZRA 4U3YA 4MX9A 1OKWA 4II5A 4EBWA 2Z7QA 5TT7A 3UC4A 3IW6A 4F64A 3MH0A 4RLKA 2JIVA 4AUAA 2W1FA 1G3NA 2UZDA 2W1DA 3KMUA 4DC2A 4EQUA 4O7SA 2P55A 2R3FA 5EM6A 3C4ZA 1PXJA 3ZS5A 2GNLA 2G2FA 3K3JA 3DAJA 4GG5A 4PTGA 4E4LA 5E4HA 1ZRZA 2YABA 2X8IA 4S33A 3SOAA 3CTHA 4E4XA 3G5DA 3KVXA 3QX2A 4MTAA 3BHHA 3HGKA 5KKRC 4FNXA 1NA7A 2JC6A 2BPMA 5E8VA 4BDAA 4MF1A 4E4MA 5LCJA 3CBLA 4DEEA 4PUZA 4QMPA 3LMHA 3VAPA 4N57A 2WTWA 4G5JA 3ANQA 3C4EA 3LFCA 4NM5A 2ITTA 4OLIA 1W8CA 1UV5A 5EHOA 5IA2A 4KA3A 4YTHA 4GMYA 1Q61A 4CMOA 4WRSA 2IW9A 4M0ZA 4AE9A 3ELJA 3OWPA 4FT0A 2BDJA 5EM7A 3S2PA 4X3FA 5ANGA 4EHGA 3RK5A 5J9LA 4BCGA 4YJTA 3LLAA 4YTIA 3MWUA 2JDVA 3VHKA 2QOQA 2GNHA 3TIZA 4V05A 2HENA 3U8WA 3TZMA 3NAXA 1KV2A 3G6GA 4F4PA 2WTKC 3OF0A 3I60A 4L67A 2PVMA 3ZH8A 4JBVA 4HNIA 1S9IA 2F7XE 3SXSA 5IEXA 2XH5A 5HU9A 2FB8A 1IG1A 2WAJA 2X81A 3ZU7A 3O71A 3HRBA 4F1OA 3S1HA 4FZ6A 1P4FA 1MQBA 2C69A 3R6XA 5JRSA 2F2UA 2QLUA 2ITQA 4FNWA 2VX3A 4FSTA 4ITHA 3Q4UA 3TZ7A 1YDTE 2GFCA 4D4RA 4GKIA 2YWVA 3FLZA 2VGOA 4JAJA 5DT0A 1W82A 5JFSA 3RPOA 3F2AA 3DTWA 1MRVA 5F9EA 4ZLOA 4BDFA 4YLKA 5KMOA 1PXKA 4BDHA 5DWRA 2J0LA 3PWYA 3VUKA 5LMBA 5AFVA 1KE6A 3QYZA 5J95A 1PY5A 3PSDA 5HU3A 2VWYA 4JXFA 5L2QA 3BL7A 2ITNA 2I0EA 4FVQA 5ANDA 3R21A 3UVRA 4L44A 2YCSA 3ALOA 1L8TA 2Z7LA 3TG1A 3R02A 4FC0A 4O0RA 2OFUA 3PXQA 2IF8A 2PK9A 3ENMA 4IJPA 5DR9A 3FJQE 2IZRA 5KBQA 3FMLA 3V5TA 4RIYA 2J7TA 4AF3A 5KMNA 5LVNA 4H3BA 3UTOA 3ATTA 2PVHA 2IO6A 3NEWA 3SX9A 4JBOA 4D4SA 4CKJA 3FPQA 5JH6A 3P9JA 4LGGA 3MH3A 4IB3A 4I6HA 3CD3A 4YR8A 4DA5A 4UB7A 2YM4A 4BCFA 4O81A 4I92A 3UNZA 3QWKA 3PJCA 3TCPA 1PRYA 1FBNA 3IW4A 3R7EA 2XB7A 4MNEA 2ZV8A 4BKYA 3CCNA 4D2SA 5CAVA 4OAUC 4ANSA 4EZ3A 2IZSA 3D7ZA 2JKMA 3E3PA 4A4OA 1U5QA 3R9OA 4EZ5A 2WIHA 3ZSHA 5BYZA 4G6LA 4W8DA 5AP3A 1J3HA 2OF2A 3WBLA 2YZLA 4RQVA 1JNKA 3DS6A 2VO7A 2IVTA 2VWZA 3AC8A 4EORA 2WO6A 4CFVA 1W7HA 3BE9A 5C8MA 2B7AA 4M66A 4EK3A 4EK4A 4O7YA 4EHZA 5GJFA 4BY9E 4W4XA 4OBOA 4KRCA 1IR3A 1B38A 1WFCA 4QP6A 4YBJA 3LXLA 4AG8A 4D1SA 4YSJA 4ORKA 2W05A 3RTPA 1H4LA 3A8XA 5FBOA 1ZMUA 3ZRKA 2NNWB 1TQMA 2CGWA 1WZYA 4GUEA 4MNFA 4DCAA 3V04A 2O65A 4NWMA 4AA4A 3D7TB 5JEBA 3G0EA 4RVLA 5AUVA 5A4CA 1Q5KA 2QHNA 4FV3A 3LFEA 4D5HA 4L52A 3DU8A 4EUUA 3JY0A 2WIPA 4BCJA 5CU4A 1V1KA 4NU1A 4FTLA 4DG0E 3QQLA 4ITIA 2QODA 5AR4A 3HVCA 2FSLX 2C6KA 4QYHA 5A6NA 3GBZA 4HVHA 4IZ7A 5IA1A 2XNGA 3FZPA 2I0VA 5IQDA 4DINA 3H4JA 2VWIA 2NPQA 1U59A 2YISA 3NLBA 4TY1A 4S31A 4K0YA 3LOKA 3FZTA 3PTGA 1Q99A 4O0SA 3UP7A 3ZOSA 4AW2A 4EQCA 2HIWA 3UYTA 2ITVA 5FD2A 3I1AA 3RPVA 3F3TA 4XX9A 4ASXA 3G9NA 4E20A 4EH9A 4PX6A 4AGUA 4H05A 2JD5A 4FIHA 3CD8A 3PPJA 3QX4A 4AZFA 5A6OA 1PXIA 4C3RA 3MVMA 5EDRA 3CSVA 3NVMB 1H00A 4HCVA 2QQ7A 3QWJA 1PKDA 5JT2A 4O82A 1OKZA 2XUUA 2CKEA 3DB6A 3P86A 5HE0A 4O7ZA 3R8LA 3POZA 5BYYA 5FG8A 3AGMA 2XM8A 3H9FA 3I6WA 3NVKI 4NCTA 3CY3A 4FV5A 4RQKA 4HVSA 3AKJA 4G6NA 4FX3A 3H0YA 3R01A 3LAUA 4HGEA 4AOIA 4Y73A 2QU5A 2YHVA 3I7BA 4AOTA 2VTSA 4FICA 4Y95A 1YDRE 2P3GX 4RVKA 3DDQA 3Q4CA 4WO5A 3VS0A 4E6QA 4HW7A 3EL8A 4FT5A 2AC5A 3PRFA 3U6HA 2OZOA 4HGSA 3QRJA 2CKPA 3H9OA 3E64A 4W8EA 3JR1A 5I3RA 1W83A 2CLQA 4ANQA 3OT8A 5EKOA 2PE2A 5CNOA 4YLJA 5HBHA 1MRYA 5HVJA 4DH3A 2W5BA 3U54A 3ACJA 3W2QA 3R22A 2Y7JA 4AE6A 3NFGB 3RI1A 3E7OA 4YTCA 3UJGA 1Q97A 3ERKA 4FKOA 4EH5A 5EQPA 1JSVA 3FI3A 4QMWA 3F7ZA 3WILA 3PDTA 2OO8X 2VO0A 3P1AA 3F5XA 4IVBA 5AR7A 5KX8A 4UXLA 1K3AA 1ATPE 2VTOA 5EI8A 1WBWA 4QDVA 2VTRA 3KEXA 2VNYA 5HIDA 4U97A 3IQ7A 5LVLA 2R3RA 3Q4TA 2JIUA 3ORZA 5J7BA 4ANLA 2QO7A 4FTKA 4AAYA 4R1VA 2BRBA 1HOWA 1GJOA 1Y6BA 4RX7A 5E8UA 4YNEA 4BB4A 4R7BA 3EYGA 2XKCA 5AV3A 1KWPA 2UW4A 4XG9A 2WHBA 4GFMA 1G8KA 4IAFA 4NW6A 5CANA 5EK7A 4KAOA 2RF9A 4O2ZA 4AXCA 2V7OA 5KCVA 2ITUA 4RMZA 4NW5A 3NNVA 4O4BB 4UYNA 5AIKA 5JQ8A 3I6UA 2R3KA 3F3WA 3ULIA 2YIRA 4JMQA 5DT4A 5A4LA 3QTQA 5BUEA 4RWKA 3I0OA 3AT2A 5HVYA 2QOIA 3O96A 4ZXTA 3U9NA 3O8PA 5DPVA 2IN6A 2F2CB 1Q8UA 3G33A 3CS9A 4N4SA 5D41A 4G16A 5H8GA 4BHZA 4XG7A 5KMKA 1IAJA 3KKVA 4JDIA 4EOQA 4I41A 1EH4A 1OPJA 2XRWA 3WZKA 2OI4X 2XNEA 4IDVA 4A9UA 1OL7A 4RWIA 5F1ZA 5AR5A 1QPDA 2JDRA 5E8TA 4J96A 4I20A 3BYSA 2J6MA 4ZLYA 3NWWA 2YJSA 4U81A 4FGBA 1REKA 4BZNA 1APME 3IG7A 3A4PA 4HVDA 4FV6A 4PV0A 2B52A 3MSSA 4HZSA 3WF8A 3R9NA 4BIDA 5C4LA 4Z9LA 3K2LA 3EKNA 4J98A 5A4TA 2EXEA 3FYKX 3JPVA 2QO9A 3FLWA 4LOQA 4ZLZA 3V5JA 2XALA 3TDVA 2R5TA 2JDSA 4BDKA 4ANBA 3SLSA 1U54A 3KMWA 1FVRA 4QP8A 5DRBA 2Q83A 5LOHA 4RX9A 5CSVA 2J0MB 3OY1A 4RIXA 4K1BA 4KINA 3V3VA 3QQFA 4S32A 4IVCA 1H1RA 4WG3A 4FOBA 2PZPA 2J51A 4IX6A 5KE0A 4O91A 3MI9A 1W98A 4KBAA 3BWFA 2BKZA 2O64A 3GFEA 3F9NA 1Q8ZA 3HMNA 3M2WA 3HKOA 5E8ZA 2PVLA 3SC1A 1M14A 2XK7A 3TJDA 3TI1A 2I0HA 4IE9A 4PP7A 4E6DA 3LE6A 3DJ6A 4FKGA 4RGJA 4D2RA 4RC2A 3R7YA 3GGFA 1ST0A 5CVGA 4HYHA 2ERZE 1L3RE 3PY1A 4OTWA 3DKCA 2UZEA 4GK2A 3BYUA 4OBQA 1G8AA 2EXMA 5LCKA 1ZZLA 3ZLXA 1M52A 1JSUA 5IQAA 4LUEA 2BFXA 1H1QA 2WU6A 3LFDA 3ORMA 1ZYJA 3IDCA 4WNKA 3N9XA 3LZBA 4M84A 3G15A 3ALNA 2Y4PA 1YDSE 2BZHB 3U51A 5CAPA 2W4KA 2UW5A 2ITXA 3BRBA 3CC6A 4FVPA 4X7QA 4TXCA 4EOMA 4TYHA 3T9TA 3EZRA 3UBDA 5CWZA 4BDCA 4NL0A 3EIDA 3NUAA 2C68A 1OKYA 3VRZA 5DYJA 1PMUA 2X8EA 2WFYA 3QUDA 5JZJA 5LWMA 4J8MA 5KBRA 4ERKA 2C1AA 2YERA 2AQXA 2V5QA 4NM3A 4X2FA 1CKPA 3G51A 2OLCA 1VZOA 4C3FA 3ZXTA 4L8MA 3PP0A 5A3XA 3QQHA 4F99A 4RLLA 4QMXA 4CTBA 1OIQA 3QZIA 4NK9A 3PUPA 4MXAA 5AR8A 3TUCA 2VX1A 5LARA 5CAUA 2OJIA 1P4OA 3BEGA 4AN9A 2GQRA 3FZOA 3SGCA 5AV4A 5EH0A 2J0JA 5L8KA 3VUTA 2VWWA 4OTQA 4ZTMA 3EQHA 4YTFA 1B6CB 1KV1A 2O63A 4XG6A 2YIWA 4AN3A 3NYNA 3ULZA 2AUHA 4IDTA 4MD8E 1YOLA 5B2MA 4KD1A 3F5UA 4IX3A 1RDQE 2WQBA 4HPUE 4I0SA 2YACA 4FA2A 3QA0A 3OG7A 4AACA 3ANRA 3GU7A 5AP0A 1OL6A 3IOPA 5HBJA 3GU4A 4IX5A 4BJJB 5DN3A 4FV7A 3A7HA 4XEYA 3KRWA 4I4EA 5HD7A 3RZBA 3TZ8A 3W0SA 4GYIA 4NEUA 4ACCA 4GH2A 5A54A 3QHRA 5CS6A 5BVNA 5K4IA 5D12A 4J95A 3C9WA 5J79A 3P79A 3MH2A 5GJDA 5J5TA 5KKRB 4FTUA 4AA5A 2C3LA 4QRCA 4GT3A 2FSTX 4LFIA 1ND4A 1KSWA 1X8BA 4KIQA 5C4KA 3DXPA 1FPUA 5I5ZA 2X1NA 3JVRA 3PZHA 4JBPA 3AQVA 3ZSGA 4F6UA 4RT7A 3PXRA 3QQGA 3PA3A 1H01A 5AUWA 2BDWA 4FVRA 1A48A 1PYEA 2OBJA 4KABA 2PMNX 3DBEA 4JOAA 3WE4A 5AUTA 4BCKA 1G8SA 5AMNA 3RKBA 1Q8YA 1SM2A 3B2TA 3QZGA 4YJPA 4WT6A 3I79A 2UZTA 3MVHA 3KCFA 4DGLC 3LQ5A 4KIKA 5GINE 4YGAA 3Q53A 2PZ5A 4EOSA 2YITA 3Q32A 3GC8A 3ODYX 2VTIA 5BNJA 1FVTA 3H9RA 5IH6A 2P2IA 4IACA 4FIGA 5FXRA 3D83A 5EYMA 3OS3A 3OTUA 4S34A 2CHLA 3UNJA 4BDJA 3EL7A 5IG1A 1XMLA 5BX0A 2FYSA 3MB7A 3E5AA 1UU3A 2FVDA 4MXCA 5HGIA 2X7FA 4TWPA 4ACHA 4EJ7A 5HIBA 4YUQA 3V6SA 3KULB 4TTHB 4X6RA 1YI6A 2XK3A 3DKFA 3FMEA 4CFFA 3SDJA 2RGPA 2Q0NA 3IONA 5HG7A 4FSYA 4V0GB 2X6DA 3QUPA 1XBCA 4ID7A 4GIIA 5EYDA 3WF7A 5HBEA 5AA8A 5CI6A 4F9YA 3QTUA 2W1EA 3OBGA 3QYWA 3F5GA 4J71A 2HZ0A 3THBA 2ESMA 4FEQA 4B99A 4DFZE 2GHMA 4C2VA 1DM2A 4X3FC 4OT6A 1ZARA 2Y6MA 4V01A 4XP2A 1WAKA 4Q2AA 4PNKA 2A98A 2BROA 4IWPA 3BWJA 1BL6A 3FZ1A 4R3RA 5ETFA 4HGTA 3OW4A 4DGMA 2HZNA 3R8ZA 3R7IA 2XKDA 1M7NA 4LMNA 5JRQA 4BWPA 2UZWE 3FSFA 2ZYBA 2G15A 4QT1A 3ZZEA 3V51A 3RGFA 3W0NA 2IVUA 5F94A 3VBVA 1PXLA 1TQPA 4M12A 5KMMA 3GNIB 5HICA 4CZYB 2GCDA 3V8SA 3UDSA 3LCSA 4EUTA 2X9EA 4FSWA 2WTCA 5CY3A 2WNTA 5DMZA 5EYKA 3VRYA 4XG3A 3S95A 4RZVA 2WQMA 2VTNA 4ZTSA 2WMBA 3R1NA 2EUFB 1UKHA 2VTPA 4CD0A 5HORA 3NMUF 5CEOA 4R6VA 2PMLX 3IO7A 4JRVA 4EHVA 2GU8A 3FC1X 4F6WA 4FR4A 3VBWA 3VUDA 4FKUA 2GHLA 4O0VA 1CKJA 1XJDA 3BU5A 2LGCA 3MPMA 3TUDA 4O84A 3TMOA 2WMAA 4EKKA 3L8XA 5EW3A 4B7TA 5FTGA 3FHIA 5FEEA 5IZFA 3BYMA 3ZMMA 3BU6A 3DZOA 4BI2A 3N51A 3AC2A 2R9SA 3JUHA 3L9PA 5EOBA 4ZZMA 2HWOA 1RW8A 4OR5A 4Q5EA 2I6LA 3EOCA 4X2KA 5I4NA 4LDTA 4FKSA 3JYAA 4IANA 2ZJWA 3FMDA 3R7VA 3UOJA 2VWBA 3GC0A 1CTPE 1FVVA 2R3JA 1FGKA 3EQRA 3D0EA 3LFBA 5HLNA 4BDBA 4ANOA 4DHIB 5C8NA 3W1FA 3RAKA 4EH2A 4YHTA 3W18A 1UNGA 2ZV9A 4P90A 1XH7A 2XBAA 2VAGA 2QU6A 3O7LB 4WSYA 2X4ZA 2HOGA 2HELA 3IGOA 4C0TA 5HO7A 1W0XC 4WOVA 3HEGA 3KVWA 4G3DA 4FG8A 4WBOA 1XR1A 4EOJA 3QD0A 1FQ1B 2BRMA 5CSHA 3LFSA 4H3QA 3F2NA 4C4FA 2QOCA 4R1YA 3GU6A 4PMMA 4AAAA 4IB5A 3HP5A 2BALA 4YC6A 3P23A 3O5AA 2C5YA 2B0QA 3FQHA 4YHFA 5ANKA 4G2FA 5JFXA 3L1SA 2PVYA 4O21A 4J8NA 1WCCA 4ZTRA 3BX5A 3L9MA 4GVJA 4YJUA 3DAEA 1GAGA 5FEQA 3R00A 4EK8A 2JFMA 4WSQA 2C6LA 3KRLA 2VD5A 3FLYA 3BU3A 2O5KA 2GNJA 1LPUA 2PVJA 2JLDA 4JS8A 5AUZA 3ET7A 3PE2A 4ANMA 4J52A 3LMIA 3FEGA 2R3IA 3QGYA 2HY0A 5T68A 5IISA 2J5EA 1UWJA 5ETIA 3Q5IA 3R83A 3VF9A 2B9IA 3IDBA 3RPYA 4QYGA 4D2TA 2FA2A 4FT9A 5J1VA 4ZP5A 5AUXA 4ERWA 4NIFA 4FUYA 3T9IA 3PPKA 4PPCA 2GPHA 2HK5A 3M11A 3VUGA 2WTIA 3ZRMA 4ZEGA 3Q04A 4DH8A 3UG2A 3F7WA 2FSOX 2XKEA 4O0XA 4OUCA 2BAQA 3EMGA 2WMTA 5M51A 4KSQA 1H08A 4E73A 5IQEA 1O6YA 3AT3A 1JKTA 5HNIX 3MS9A 4GVAA 2OZAA 5L8JA