2HZNA

Abl kinase domain in complex with nvp-afg210
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
277
structure length
272
Chain Sequence
MDPSSPNYDKWEMERTDITMKHKLGGGEVYEGVWKKYSLTVAVKTLDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Structural biology contributions to the discovery of drugs to treat chronic myelogenous leukaemia.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 82
structure length 272
sequence length 277
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2hznA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2hznA01
3NUPA 4U3ZA 1SYKA 3KXMA 2VO7A 3LFFA 4M13A 2W9ZB 3R1YA 1B38A 1BUHA 3NUSA 4JVGA 2J0LA 2GHLA 5K9IA 3JPVA 2IW9A 5IF1A 4H3QA 2YHVA 1WVYA 4NJDA 4C0TA 3F66A 5GIPE 3ENHA 5CLPA 4G17A 4BI2A 3ZRMA 2PE1A 4DEDA 3LFEA 4PDOA 4B9DA 5HTCA 5M44A 5K3YA 4PV0A 2W4JA 2PU8A 3VHEA 2EXCX 1Q5KA 1WBVA 1ZYJA 5DRDA 3VAPA 5IEYA 4N6YA 3ZFXA 4IBMA 4O91A 5CU6A 4FSTA 2VTLA 1K2PA 3ULIA 3C7QA 3QD4A 3ZO4A 3N4UA 3LPBA 5D7VA 4O7YA 5EHLA 2JDOA 4BDGA 4C34A 4ZSJA 2PVNA 1H8FA 2Y6MA 2ZDTA 3EFJA 3BHYA 5GZ9A 5HCZA 5J5SA 2OLCA 4QPMA 3C9WA 3FPQA 4O6LA 4AZSA 4R1YA 3OY1A 3UNKA 2YLEA 3F5XA 4IX4A 4E4XA 3VN9A 3TI1A 1B39A 1OL7A 4TN6A 4FZAB 2CKEA 4FKIA 4AZTA 4YTIA 1S9JA 3EQHA 3Q9XA 3C5IA 4ZTNA 3FZPA 5AP6A 2BDJA 2YM6A 4BZOA 3UC4A 1W8CA 2BALA 2KTYA 2QO2A 3V8WA 4IJ9A 5L2WA 4ACDA 2UZWE 4FZFB 2UZNA 4EH4A 3ORLA 4IH8A 3LFAA 3ZHPC 3A8XA 5JFVA 4FSMA 3GFWA 5JQ8A 4O22A 1FGIA 4JQEA 5EHOA 3THBA 4AA0A 2W5BA 3C1XA 4EOOA 5TE0A 2EXMA 4PP9A 5HESA 4ZMEA 3BYOA 2CGUA 4GK2A 4NCTA 2F2UA 3O8UA 4YJVA 4WUNA 2Y6OA 3UPXA 2W96B 3FLWA 5K5NA 4RIYB 4NW6A 3FAAA 4AN3A 4DLIA 3HMMA 3AC4A 3OZ6A 4D55A 3SOAA 1BI8A 4PF4A 5LMBA 1XH4A 4R77A 3CKWA 1OBGA 4O0YA 3D2KA 1H08A 3VVHA 1YXXA 2XYUA 1LEZA 3PY0A 5M51A 4L42A 4H36A 4QP7A 2QR8A 4D5HA 1VEBA 2X7FA 3DBFA 3S95A 3W2RA 1ZLTA 2UW8A 3OMVA 1PMNA 2YJSA 1B6CB 4I20A 4BYJA 5JSMA 2PZYA 2VAGA 2BDFA 3MH0A 1FMKA 4DBXA 4U44A 4HVHA 3GC8A 4GT3A 4GMYA 2QU6A 4OTIA 3D14A 3OFMA 2YFXA 1YVJA 2ITUA 1H1SA 4M69B 3ZEPA 4X2JA 4YZ9A 4LQMA 4FTRA 4DEIA 3E3PA 5B2MA 4KKEA 3U6HA 5EOBA 2I0EA 3NNWA 4YPDA 3ZO3A 3D7TB 3VJOA 3C4EA 4GV1A 3R9OA 3QRKA 4WHZA 4APPA 2BRHA 5KHXA 3TNQB 2OF4A 3HUCA 1LP4A 2EU9A 3DQWA 4L7SA 4QMXA 5E92A 5BYZA 3MVJA 1FVVA 3U55A 3OOMA 4U5JA 4NFNA 4YPSA 4M3QA 5HG9A 1HCKA 2W1GA 4GVJA 4L43A 2Q0NA 5DA3A 3IW6A 4A9SA 2C6DA 4JR7A 1H1PA 2GNFA 3LXKA 1S9IA 4QMPA 3MV5A 5AV0A 3SG9A 4CMUA 4UWCA 4FF8A 3W33A 3DFCB 3UZRA 4JNWA 4CKIA 5KKRB 5HD7A 2CMWA 5FGKA 4X3FC 5C4KA 4RBLA 2GNIA 3FI4A 3R8ZA 1UU7A 1Y57A 4CLJA 2OIBA 3AMBA 2BKZA 4XG4A 3PJ3A 4LYNA 3VW6A 1LR4A 4AW1A 2IVUA 3H9OA 3MYGA 5LMKA 3I1AA 3UZPA 1KE8A 5I9ZA 1H0WA 4MBJA 3KULB 4I0SA 4TYHB 5M53A 5M08A 4G3CA 3TDVA 3WF8A 3HV5A 4EUTA 3OWJA 5J9LA 3LJ2A 2DWBA 2C0OA 3HDNA 3TUCA 3ZLYA 3K5UA 4GG5A 4P5QA 4UXQA 3ZXTA 2AUHA 4TWCA 4IWDA 5A4QA 4DGGA 2NPQA 4QPAA 4V0GA 4O0SA 4UMPA 2HZIA 4FE2A 4AP7A 1YDTE 1Y6AA 2HOGA 4NIFA 4S32A 1G8AA 5M4FA 3NVKI 3RNIA 1RW8A 4DTKA 3W2CA 4RZWA 4JX3A 4CT2A 3LLAA 2OJFE 3A7IA 5A4EA 3AG9A 5BUIA 4YLKA 4HPTE 2B0QA 4MD9E 3TUDA 3W16A 1P2AA 3O23A 4JI9A 1O6LA 1V1KA 3S2PA 4EH8A 2VTSA 2QOKA 3R9HA 4BIBA 4I6HA 4D58A 4HVDA 1R39A 4A9YA 3FZSA 4R7BA 2FB8A 2YA9A 4U43A 3ROCA 4DEAA 3BU6A 2IZSA 4C61A 3RNYA 4RX5A 1IASA 5CSHA 3KREA 3DTWA 3OBJA 3EKKA 5GJGA 1JSTA 1SZMA 4RVLA 4LM5A 1L8TA 1W84A 2RIOA 2LAVA 4CMTA 3PP1A 3NLBA 1FMOE 3PIZA 2WTIA 4L01A 3CD3A 4O2ZA 4TYEA 5HHWA 3G6GA 4UMUA 1Z5MA 4QMSA 3NUYA 1XJDA 1OMWA 3ZC6A 4G3FA 4KWPA 3SQQA 2Z7QA 3FLZA 5J5TA 3RALA 3D7TA 4UALA 2YM4A 5KZ0A 4BTFA 5L3AA 5L8JA 4CLIA 4BI0A 5CF4A 4MNEA 2F7XE 1JKTA 3G15A 5A6OA 3RVGA 1JBPE 2Z8CA 4BDEA 5JFWA 4O7NA 5B2KA 4QMOA 4ALVA 1OKYA 1MUOA 3F3WA 4JRVA 2IZTA 4KNBA 4JDIA 4ZJVA 2GDOA 5CWZA 4DFNA 2GHGA 2OXYA 4JG7A 4XBUA 3KEXA 3L9MA 2O8YA 4OTHA 3BWFA 4I5HA 4CCUA 4ZLOA 4IX6A 3LFNA 1QPJA 4FNZA 4KABA 5L2QA 4ZJJA 5KBQA 4C3PA 3R63A 4P7EA 5DHJA 5EI8A 5LVLA 4BF2A 4DFYA 4YMJA 3R7EA 1OB3A 4IHPA 2YABA 4AGUA 4G16A 3LQ5A 4W8EA 3EQIA 3PDTA 4E8AA 5J95A 5CEIA 4J1RA 5HNIX 3RPSA 2GQSA 4TTHB 5CASA 3PUPA 4BDKA 1F3MC 4I23A 1P14A 3KULA 4E4MA 4E73A 4DGMA 4ZZOA 2JDSA 2NRYA 4TYHA 1G5SA 4IXPA 5CTPA 4AW5A 4UWBA 4D0WA 5C27A 5IQHA 3EQCA 3ZLXA 2ZVAA 3HAVA 4H05A 2R3KA 2HZ4A 3L9PA 3NYNA 1KE7A 3C51A 4YO4A 2ERZE 4D1ZA 2EXEA 4EHEA 1CMKE 3P86A 4RJ5A 3DKOA 4I0TA 2C68A 2P55A 4K8AA 4QQCA 4D4YA 4KRCA 4TL0A 3F88A 4O2PA 5C8KA 1P4OA 2G2FA 1KE9A 5HG7A 2HZNA 4YNOA 2E2BA 4ASDA 5KO1A 3QTZA 5E90A 3GC9A 4OTWA 4RQVA 3RI1A 4PUZA 3SVVA 5I5ZA 2FUMA 1RE8A 3UQFA 4RC4A 3T8OA 2A27A 4WIHA 3IONA 4XS2A 2QU5A 4QQJA 5HZNA 3ZRKA 4ANLA 3QC9A 3C13A 2OFUA 4KS7A 1YXUA 4BDBA 3LQ3A 3HV7A 3LCSA 3FMLA 4USDA 1JKSA 2PSQA 3R2YA 3VUDA 3LFCA 4BTMA 4QNYA 2J5FA 3NYXA 4O7ZA 2QR7A 2VTAA 1XKKA 3P7AA 2CSNA 3A4PA 1M52A 1PXNA 2P2IA 2X8EA 4OBQA 3SAYA 4TZRA 3FZTA 4F1OA 4F7JA 2W4OA 4PMPA 2J0IA 4G3GA 2WQMA 3JVSA 4W9XA 3U4WA 3ORIA 2AYPA 1XR1A 1JKLA 2BHEA 3A7GA 4TW9A 4ZSLA 3TIYA 4MXZA 2GPHA 3MPMA 1IG1A 4J98A 3QKKA 2J51A 1T46A 4UEUA 2OO8X 3UMXA 5AUWA 3MFUA 5HO7A 4O38A 3VUKA 3W2SA 3KRJA 1ZOHA 4R3RA 4EHVA 4OAUC 4KKHA 2B53A 3TNPC 4ERKA 5M56A 3ZUUA 5EH0A 4PDSA 5LWNA 2Y0AA 3D5WA 4FUYA 4RVTA 3ZSGA 3R8MA 2VTOA 4AXAA 4M12A 4FVRA 3D5UA 2YITA 3FHRA 3N4TA 4ALUA 2H8HA 3VS0A 4J95A 3QRIA 1PXKA 4B8LA 3DXQA 3ZSHA 3UVRA 3L9LA 3NR9A 3COHA 3OWLA 4AFJA 5HBHA 4C57A 3BYVA 1G3NA 4CFXA 3FQEA 4G6NA 3PIXA 4ERWA 4RJ6A 4F65A 4O0RA 2ETMA 2WXVA 2BRMA 2P0CA 5HIEA 5IQBA 5CU0A 2G1TA 3PJCA 5C9CA 3ZFYA 4E26A 2BIYA 3CQWA 5EI6A 3TT0A 2OW3A 4BRXA 4KA3A 5DEWA 4WNMA 3TEIA 4PNKA 5J7HA 3IW4A 5KMJA 5FTGA 3OW4A 3TZ7A 3POZA 3ODZX 1NW1A 1U54B 2FSTX 3BGQA 4J99A 4BHNA 4CV8A 4F7SA 3RZBA 4BICA 4D1SA 3MB6A 1OUKA 3DLSA 3OD6X 2CLQA 4FV0A 3NYVA 4O27B 1DS5A 4JQ8A 3RAIA 2NP8A 5C1QB 4L44A 1WBWA 1VR2A 3KXXA 3C4XA 3IPHA 4BCGA 2CKPA 5TF9A 1IA9A 5B0XA 2X8DA 2ZJWA 2YJRA 4UMRA 3LLTA 5LXMA 3I7CA 5KCVA 4HNIA 3IQ7A 2GS6A 4BL1A 4RRVA 4RWIA 3R73A 1BMKA 2ITYA 2QOBA 5HVKA 1W82A 4OW8A 4BI1A 4FIGA 4H1JA 4CFNA 3BU5A 2CJMA 2JDVA 4WNKA 2XNMA 4LOQA 1R3CA 5BVWA 4AQCA 5CENA 1SVHA 4PMSA 3W32A 3M11A 3LMGA 3KXZA 4FSRA 4RIOA 5TKDA 5AADA 5M4IA 1M17A 2WIPA 3LHJA 1JWHA 3GOKA 4MD8E 5HCYA 4OTRA 3UODA 3Q2JA 2WZJA 3BHUA 4IB0A 4IZ7A 4HZRA 4Y95A 2C4GA 4WNOA 3WZKA 4A4XA 1Q4LA 2HW7A 4EQMA 5BVOA 1OL5A 4YJTA 4E3CA 2GS7A 3TKIA 1BYGA 3WILA 5FWKK 4HCVA 2UW6A 4PTCA 5AUUA 3PXRA 4FKSA 1GOLA 5HE0A 3OF0A 3V3VA 3R7IA 1ZOEA 1O9UA 2X2LA 2YIYA 5CEMA 2P2HA 5ETIA 4O7TA 4EUUA 1YOLA 5HIBA 5E1SA 3EFLA 3PVWA 4ID7A 5ANOA 4F63A 5DEYA 4RA4A 1J7LA 3A61A 3C0IA 4IEBA 5HI2A 2HK5A 5D9HA 4KUJA 3Q6UA 3FI3A 4L3LA 2WMUA 3DPKA 4UMQA 5TOZA 4HGTA 5GZ8A 1OECA 3OEZA 4R5YA 3GCVA 3V5PA 4ASXA 4CSVA 4ZAUA 1GIJA 2J5EA 4JL9A 4NCTC 4E4NA 2OXDA 3ENMA 4U41A 1PXIA 3FPMA 1OVEA 2XK9A 2W99B 5DVRA 4WOVA 3ZUVA 3MJ1A 3KN6A 3IKAA 3PVUA 4HVSA 4QMQA 4CCBA 4DEEA 1WCCA 4HGLA 5IEXA 2VGPA 4XMOA 2J2IB 3GGFA 3UO5A 4C35A 1PXPA 5J1WA 4LRJA 3AMAA 3OBGA 2W7XA 2OICA 5CY3A 4ZIMA 5AA9A 3C4WA 3H9FA 3SXSA 3FY0A 4M8TA 3WYYA 2OXXA 5LCJA 2C5YA 4AF3A 4DTAA 3GU6A 4G2FA 4FZ6A 1KE5A 2F7ZE 4NK9A 3HX4A 5J9ZA 2VX1A 3E7OA 1U54A 5JN2A 2VTIA 5E4HA 2QG5A 3MIAA 2I0YA 3Q04A 3TZ9A 3CEKA 4YTHA 3W55A 5JQ5A 2F2CB 3VULA 5KX8A 3VUHA 4JBVA 5LVNA 2FSOX 2BFYA 3CC6A 4H39A 4KS8A 1ZY4A 1XH7A 5F94A 2E9VA 3P7BA 3PXFA 2ESMA 4L46A 4DFBA 4J96A 3R1QA 4IZAA 3WF7A 4USEA 2EVAA 2OH4A 4L7FA 3TG1A 1PMEA 2OIQA 5ANEA 3MTFA 5ITAA 2CN8A 2X9FA 3KMWA 4OR5A 5ICPA 5AFVA 3MPAA 1XH6A 2WELA 3KFAA 3P08A 3NCZA 3Q5ZA 4G5PA 3ZSIA 5IU2A 3GENA 4LV5A 4L3JA 3A60A 2BAJA 4QMYA 3S3IA 3U9NA 4J7BA 2IVTA 2VO3A 5AR8A 3PJ1A 2FSLX 3R7VA 5IUIA 4BHZA 3CTJA 1OPKA 4FEQA 1YWNA 3NYOA 4QNAA 5TO8A 3HYHA 3TACA 5CAOA 2UW5A 2UZOA 3W2OA 5FDPA 3TN8A 3FLSA 3MSSA 3TZMA 4JG6A 2ZB1A 2BTRA 2WMRA 3NNXA 2PMOX 3IOPA 2C3IB 5CXHA 2VTNA 4O1PA 3TIZA 3UIXA 2ZM3A 2OBJA 5BX0A 3Q5IA 2VTPA 4QYFA 3W2QA 4CKRA 5BPYA 1ZZLA 3VBVA 3G9NA 1ZRZA 3WI6A 4D5KA 3LMIA 4RVMA 3ZH8A 1FVRA 4JXFA 2JLDA 2ZMCA 1JPAA 4I1ZA 4TNBA 4EWQA 2QOCA 4UB7A 5A4LA 3E93A 5CU4A 4YLLA 3CCNA 2YDKA 4EH3A 4F6WA 4LOOA 4D1XA 5BYYA 3BE9A 4RX9A 5CSPA 4IADA 5DFPA 1PXLA 3SX9A 5HORA 3W8LA 1ZXEA 1WZYA 4CXAA 5HLWA 1XO2B 1AQ1A 1RDQE 4B8MA 3NIEA 3DAKA 3QQGA 2WQOA 4X2NA 5I3OA 3A4OX 5HICA 4C8BA 4E6CA 5EOLA 2WHBA 2YN8A 4DEBA 5IZFA 4QQ5A 3U8WA 4JBPA 4JX7A 3G33A 3JY0A 1XH9A 2WTCA 3CSVA 4ZSAA 5AUZA 3UJGA 4E5AX 5JFSA 3S0OA 3GVUA 2UW7A 2IN6A 3V6RA 3ATTA 5AR4A 4QTEA 1M14A 1KUTA 2W17A 4FKWA 4XUFA 4G9RA 3TV6A 1HOWA 3BWJA 4DG0E 5CT0A 3BCEA 2UW4A 2OSCA 2PHKA 2R3LA 1Q8ZA 3EQRA 4FTLA 3PJ2A 3C4FA 5E8WA 4F9CA 3GU5A 3VS1A 4A7CA 3L8XA 4F7LA 1WBSA 2VTJA 3GBZA 4BVUA 4RX8A 4PL5A 1YI6A 4DFXE 5I9WA 2XBJA 4IAIA 5LMAA 5E9EA 2XKCA 3DK7A 5FBNC 4XX9A 2QKWB 4MAOA 5FTQA 4OGRA 4EI4A 4RFZA 5CZIA 4X2GA 2V22A 2WMBA 4LGDA 4D2PA 2Z7RA 4TPTA 4NM3A 3ZTXA 3OTVA 2UZDA 3QGYA 4GT5A 1V0OA 4P90A 3UIMA 2WMTA 3QTSA 4WRGA 3VS7A 2OF2A 2UZVA 1OZ1A 3AC5A 2HW6A 2XVDA 5IMXA 3LCTA 4KIOA 2E9PA 2W1ZA 1Y8GA 2HY81 2UUEA 3OOGA 4JIAA 3RJCA 2ZV9A 4AGCA 5KKRC 5HBEA 2VO0A 5DE2A 3EOCA 4IJPA 2XNNA 1YXVA 4O86A 1TQMA 4YJSA 3G0FA 5AIRA 2QO9A 4DHFA 1PKDA 1YHWA 2XS0A 4HGEA 4QO9A 2ITNA 1CKJA 3HECA 2DYLA 2UZUE 4BBFA 3G6HA 1GZ8A 1NXKA 2ZV7A 4U81A 3QTQA 4BZDA 4K11A 5GHVA 2GSFA 1OIQA 1P5EA 3KF7A 2B9FA 3CIKA 1GZOA 5HO6A 4HVIA 4Q5HA 4FKPA 5CNNA 1PMUA 3RMFA 4AT5A 4FKUA 1SNXA 1ZMWA 4RWJA 3MESA 3G9LX 5CAUA 2VU3A 5HNBA 4CFVA 2GNHA 3LFQA 3V5WA 3CJGA 3M42A 4ZSGA 3UBDA 3LXPA 3FC1X 4K6ZA 4EZ7A 5DT3A 4DCEA 4OTQA 4RWKA 3ZXZA 5TR6A 3R9NA 3ZLWA 5IDPA 4XG6A 2YWVA 4AZEA 3OROA 3D9VA 3FY2A 3QALE 4BDCA 4F99A 2I0VA 2VTTA 5BVFA 3CTHA 3OVVA 1UA2A 3UP7A 3Q4CA 5KMKA 3KF4A 1QMZA 4FIEA 2C1AA 4MD7E 3UNZA 4ORKA 3BQCA 1P4FA 5CX9A 3AC2A 4RC2A 2QOHA 5C03A 4KBAA 3BV3A 4IAZA 4TWNA 2VWXA 1OM1A 4QPSA 3PPJA 4WA9A 1YI4A 4R6VA 4CTCA 4F6SA 3HLLA 4C4IA 3FMJA 3GCSA 1NA7A 1NVRA 1I09A 2WTJA 3TNWA 3SRVA 4K9YA 4O0XA 5CEQA 3DAEA 4BR3A 5EQPA 3VWAA 3DB8A 2IJMA 3BLQA 3CTQA 4Y72A 4M0YA 3P5KA 4D9TA 2VX0A 2QQ7A 2XH5A 2Y4IB 3DJ6A 5H3QA 3VS2A 3R1SA 2ETKA 2GFCA 3V51A 3SW7A 1KV2A 3R71A 4V0GB 4EORA 4MTAA 4NJ3A 2R3GA 5FXSA 5J79A 3R21A 3TTIA 1H28A 5HX8A 4NIFB 3SD0A 4I41A 4JDKA 2XBAA 3F5UA 4Z9LA 5LCKA 2RFDA 3MFRA 4CMOA 3EFWA 4PQNA 2JD5A 4IAKA 3IGOA 1GJOA 5CVGA 2QOIA 5DPVA 4C2WA 3VJNA 3D5VA 5FDXA 1R0PA 3ALNA 4LUEA 5AP2A 4RZVA 4UY9A 3MFSA 4A9TA 4FV6A 1YHVA 2XZSA 2WFYA 3F61A 4G5JA 3LCKA 4I6BA 3R04A 4FT5A 2VWUA 3UIUA 3UQCA 5HOAA 3E63A 3KN5A 3VC4A 3MDYA 2VO6A 1Q8UA 3QBNA 5DMZA 2YDJA 3OCTA 4IFGA 4JAJA 2V62A 5JZNA 4CG8A 4FT0A 3V6SA 5ANJA 5M4UA 5DR2A 5E8TA 4C36A 1H27A 2Z2WA 2HWOA 2WEVA 3PXZA 2VWVA 5IH6A 2ONLC 2I7QA 2FGIA 3SHEA 2B4SB 3LXNA 4DA5A 4IIRA 1H1WA 2VRXA 3BBWA 3RPRA 3D83A 4KBCA 3EWHA 1CSNA 3S1HA 3E8DA 4MK0A 4HPUE 4JAIA 4DBNA 2XRWA 4XG2A 4DFUA 3COIA 1LEWA 4IX3A 4F1TA 2VX3A 1PXMA 2QCSA 4QYYA 5AV3A 4LMNA 3BHTA 1QPDA 3AD5A 3DK3A 4IX5A 4MNEB 5EDQA 3V8SA 3HGKA 3VUIA 4BCQA 2JEDA 2BTSA 5L2SA 3ATSA 1WFCA 4NL0A 2OIDA 4R3CA 5EYCA 4QP3A 4IACA 4J8NA 5AR7A 4W4VA 1M7NA 2XB7A 3DNEA 3QWKA 4IAYA 5HKMA 2BKKA 3JR1A 3UTOA 2C0IA 4ASZA 5IQGA 4BWXA 4EOMA 5HVJA 3LFBA 4IQ6A 5FG8A 5ETFA 4EH7A 2PZ5A 4CRSA 4RJ8A 2V0DA 4FGBA 2BDWA 3CY2A 4U97A 5FEEA 1DI8A 2XIZA 3ORXA 3KCKA 4YLJA 3TXOA 4EK8A 5CAPA 5DN3A 3UOKA 5A14A 4D2TA 4EONA 5GINE 4ENYA 3DT1A 3BX5A 3ZRLA 4E5BA 3DTCA 4J97A 4C3FA 4EH5A 2YM7A 2YWPA 4IDTA 4HYIA 4OTGA 5AP3A 3TKUA 4ZY5A 1U5QA 4FIFA 3CGFA 3C50A 3R1NA 2I0HA 3U6IA 3PVGA 1GZNA 3BEAA 3GXLA 2OJIA 3C0GA 2OG8A 1YDRE 2G15A 4E6QA 2FH9A 4X6RA 4YC8A 3WZEA 2ZAZA 3BGPA 3QTRA 3L8SA 3MH1A 3R9DA 4C33A 4XG7A 3UVQA 2OGVA 4FSYA 5AV1A 4FK6A 2EWAA 4IM2A 4H3BA 3VBWA 5KHWA 3KCFA 5I9YA 3KB7A 3ZU7A 3D94A 1PXOA 3DQXA 3GB2A 4YSJA 5T6KA 1GIHA 4LGHA 4EH2A 2WU6A 3ZEWA 4FVPA 3NMUF 3SKCA 4MF0A 1MRYA 3IDBA 2Q0BA 3JUHA 2YEXA 4FSWA 3PA3A 4B4LA 4Y85A 1WBOA 2E9NA 4FT7A 5F4NA 5J7BA 3SW4A 3A7HA 5A9UA 3D4QA 4Y73A 2P33A 2F49A 2WMWA 4IZ5A 4FA2A 2JIUA 3DBDA 4KINA 2RL5A 2QG7A 2B54A 2XKEA 4YZCA 3I60A 4Z16A 4GU9A 4OBOA 4W4XA 4YZBA 3PA5A 3O8TA 4B6LA 2QI8A 4ZSEA 3Q2MA 4DE4A 2XA4A 3DAJA 4NTTA 1Q3WA 5AP5A 2EUFB 4U42A 1GIIA 4P4CA 4QYEA 3V5JA 4IW0A 3R8LA 5EK7A 4CZUA 4O7SA 3MB7A 2WMSA 1JVPP 3PY3A 4L8MA 5HE3A 4C62A 3HAMA 2VTHA 1H25A 3SGCA 2UW9A 2C6KA 3D2IA 3QF9A 4EYJA 4MVFA 5DWRA 4E7WA 3OG7A 1UNHA 4CD0A 4QYHA 3EHAA 2QOLA 3CR0A 1JSUA 5HLNA 4LRMA 3DA6A 1OL6A 5IQFA 3GU7A 4FG9A 4X6QC 3NEWA 3W10A 2HELA 4AN2A 5L6PA 4EBVA 4K77A 2BCJA 4FTUA 2JFMA 3ZLSA 4BGQA 5JGDA 3EFKA 5DI1A 4EOKA 3OWPA 4ZJIA 3NZ0A 3L1SA 4YURA 4AW0A 3PWDA 5CEKA 4YJRA 3FL5A 3KU2A 4FKRA 4BN1A 4ZLZA 3L9NA 4F7NA 3DS6A 3EN6A 3GCUA 5HE1A 4EL9A 3ZS5A 1AD5A 1O6KA 3UE4A 3V01A 4I4EA 2R3NA 3DJ7A 3LAUA 5KBRA 4EJ7A 4EBWA 2ZMDA 3O51A 4ARKA 1NVSA 2X81A 3EB0A 3LCOA 3U4UA 2YAKA 1BL6A 2EB3A 3H3CA 4UX9A 4Q5EA 1OKWA 2R3JA 3NUXA 3KY2A 4S33A 4K18A 5K0KA 4AZFA 1EH4A 4CFWA 5AJQA 2CCHA 4YC3A 4IWQA 4I24A 2BROA 4R8QA 5IPJA 2G2IA 1XWSA 1Q97A 1SVGA 2PVMA 4BC6A 3HZTA 5CU3A 4PPBA 3GOPA 4G31A 3HV4A 2GMXA 4QP8A 1UWJA 4HJOA 4PTGA 3Q9WA 3RWQA 2C5VA 2PL0A 2C6OA 1REJA 2WMQA 3Q6WA 1FINA 5G1XA 3BV2A 4ZS0A 4EH9A 2C3JA 2R3IA 3GFEA 3MVHA 4IFCA 1ZOGA 5CVHA 4OBPA 3R7OA 5GZAA 3C0HA 2WOUA 2VNWA 1L3RE 2Y7JA 2Z7SA 4PX6A 4W4WA 2XF0A 5B2LA 3JXWA 5T68A 2W1HA 4M97A 4KIQA 1YDSE 5CS6A 4FODA 2ZDUA 3CJFA 4WG3A 4L45A 2VNYA 1GNGA 2XJ1A 3G90X 3LZBA 2OJGA 4LOPA 5IQIA 2BZIB 2GNJA 3KK8A 4YSMA 3KXGA 3F69A 5CI6A 5JGAA 2A19B 4FYNA 3QC4A 5LVPA 1Q8TA 2QD9A 4I6FA 5M55A 4JDJA 2ZV2A 5LARA 5D7AA 2WMXA 1YXTA 3PG1A 2V7OA 3Q4TA 3ACJA 4FL2A 4FTNA 4EOJA 3ZC5A 3ZBXA 4GEOA 2C6MA 4YHTA 3ZYAA 3PLSA 4FKGA 3TL8A 2R9SA 1FBNA 3TUBA 3IS5A 4OT6A 4O0TA 4DINA 1DAWA 2O0UA 3CS9A 2B9IA 2BHHA 3PG3A 4UZDA 3TDWA 3NRMA 4I0RA 4L67A 2YAAA 4RFYA 2H34A 2WKMA 5HTBA 5M09A 4MCVA 4FNXA 4FL1A 3NUNA 2OJJA 2PY3A 4MXCA 3ITZA 4QTCA 2GU8A 3RKBA 4Y8DA 3QZFA 4WT6A 4EYMA 3QL8A 1UU8A 2P3GX 2A0CX 3MY0A 1W98A 5A4TA 5A3XA 3HV6A 2J0JA 4YHFA 1F0QA 3DZQA 2R7BA 4AE6A 1XH5A 4LG4A 4HCUA 5CYIA 4MKCA 2HIWA 1XQZA 4O0VA 5J8IA 1E1VA 3G2FA 3NDMA 4YR8A 1PYEA 4NKSA 2B7AA 2PE2A 4R1VA 5IEVA 5BYLA 4I3ZA 2WMAA 1OBDA 4FT9A 4QMMA 4CQGA 5K4IA 4ENXA 5AUXA 4DEGA 4CG9A 4CRLA 4NM5A 1V0PA 2BVAA 2IVVA 4LI5A 4NM7A 4U7ZA 1UWHA 4QMVA 3OXTA 2YIWA 3LOKA 5AMNA 3IW5A 4BCJA 4ZEGA 4AOJA 3QTIA 3CBLA 3QXPA 4BCHA 4TXCA 4TYJA 3PP0A 3TJDA 2QURA 4I6QA 1QPCA 3DKCA 4C59A 4PNIA 4AN9A 4ZY4A 4W8DA 3QTXA 3BLRA 4IVDA 3RWPA 4FTIA 3HL7A 4BGHA 2PUNA 4GUEA 4E20A 4ZXTA 3ZZEA 4FI1A 5CZHA 4DFZE 2HAKA 3FE3A 5IQCA 5A46A 1JSVA 3ZM9A 2JAVA 5M07A 4MHAA 4YZNA 3VBYA 4O0WA 3FSFA 4AX8A 2FSMX 1PKGA 1PY5A 4KKGA 4WBBB 4WO5A 5DIAA 3TKHA 5LQFA 2V5QA 3JYAA 1ND4A 4C58A 2RG6A 4FBXA 2UW3A 3PSCA 4V05A 3RHXA 4LL5A 1GZKA 3ORPA 4ZZMA 4M67A 1CKIA 4FNYA 3FMKA 3F7WA 5HGIA 5KUPA 3OHTA 1VJYA 5ANGA 4RLLA 4A9UA 4DITA 4IAFA 4CNHA 3Q9YA 3FQSA 4XOYA 3KVXA 3IW8A 4QP2A 4RA5A 3FSKA 2HY0A 1Q8YA 2ZOQA 3VUGA 4MXYA 2IW8A 5C4LA 4NUSA 3FHIA 1KWPA 2VWWA 3O0GA 3QCQA 2O65A 2EB2A 4I5MA 2CHLA 3ZBFA 1U5RA 3Q96A 4JBQA 3P1AA 4RPVA 1J7IA 2VTQA 3AD6A 4JR3A 5AR2A 4ACMA 3PY1A 3BBTB 5KNJA 2JC6A 3FMEA 3T9TA 2JITA 2HXLA 3QLFA 5H8EA 4C37A 2F7EE 2GFSA 2XNEA 4EWHA 2ITTA 1H07A 5EKNA 3HRFA 3VO3A 4G34A 3ZONA 3Q53A 4FV4A 4BCPA 2PTKA 1T45A 3FXWA 4PPAA 3E8CA 4U0IA 1J91A 2H96A 1FVTA 2GTMA 5IA1A 3TJCA 4AGDA 2W5AA 3OXZA 1OPLA 2QODA 2W9FB 4F6UA 3FI8A 5G6VA 3RK7A 5I9VA 2PMNX 5L2IA 1DI9A 4HYSA 5A6NA 3HV3A 4G6LA 4IANA 4OTDA 4FEUA 5EM7A 4E93A 3EQDA 2Y4PA 4MEDA 4TYIA 5KE0A 1OL2A 5C01A 4DGNA 2YIXA 3FMDA 4Q9SA 4G1WA 4FTTA 1Q24A 3PSDA 4FKTA 5AX9A 4ZK5A 1J7UA 4BCOA 3Q32A 3PFQA 3KGAA 4L68A 4GFOA 3R0TA 3RAWA 3R30A 2WAJA 3ZDUA 2B9JA 3KMUA 3QA8A 1KE6A 4PY1A 3U54A 5JRSA 5IQEA 3HMPA 3L8PA 2XNOA 3PIYA 4QMZA 5H9BA 4DH8A 3OT3A 3NGAA 3MJ2A 5DOSA 3UYSA 4F4PA 5AAEA 1Z57A 3R01A 5CF8A 5C8MA 2JFLA 3BRBA 1PRYA 4B7TA 3QQJA 4O6EA 3FJQE 4YC6A 3WIGA 3PTGA 3E3BX 4ACHA 2BMCA 5A4CA 4YTCA 3ZMMA 1MQBA 2YACA 4WRSA 2C6LA 3UYTA 2ITQA 4DH5A 5T3QA 5J9YA 5IUHA 5HO8A 4A06A 3NAXA 2RGPA 3KK9A 2AC5A 1M7QA 3EZRA 4JDHA 4PPCA 1UV5A 2HYYA 3N4VA 1LPUA 3KMMA 5E7RA 4NEUA 2RF9A 4NSTA 1Q61A 5IH5A 4IWOA 3EL7A 1KOAA 4LL0A 3QLGA 5K5XA 1G8SA 4FGRA 3FMNA 4FIIA 2GHMA 1Q41A 4U8ZA 1A9UA 3HEGA 2XK6A 4QMTA 1NVQA 1Y91A 4FV1A 4NW5A 5JH6A 2HXQA 4O83A 4KIPA 3LCDA 5AAFA 3RP9A 2F9GA 1ZYSA 3A99A 3TWJA 3BQRA 3Q60A 4U9AA 3DXNA 3I5NA 4G6OA 3UG2A 4MQ2A 3HKOA 4FMQA 2OH0E 3HP5A 3K3IA 4C7TA 4EC9A 2BIKB 2GNGA 3KRLA 3KXHA 3NCGA 4GIHA 4RQKA 4S2ZA 3TNIA 4DG3E 4F0GA 4F64A 4NKAA 4XLIA 3F2NA 5AIKA 3WF9A 2YISA 3OUNB 5AEPA 4FK3A 3BGZA 4I93A 3II5A 4N4SA 5LMKC 2XNPA 3FZRA 3BZ3A 3GT8A 1PW2A 4LRKA 5DR9A 4M66A 5CSWA 4EK3A 5GIOE 2XMYA 1REKA 4M84A 4DH7A 3EJ1A 4YTFA 2XIRA 3FXZA 4IMYA 4NH1A 4IVCA 4RGJA 2PWLA 3MN3A 4FKLA 4FG7A 3KRXA 3DFAA 4RJ7A 2Y4IC 2VWYA 5I0BA 1YQJA 2PK9A 4S30A 4WNPA 4EEVA 2ITXA 1Q62A 3OWKA 4A9RA 2BILB 3JS2A 5IKWA 4FKJA 4EQUA 5FXRA 4F1MA 2J6MA 4QTDA 1ERKA 5FBOA 2UZTA 3QUPA 2BAQA 5H8GA 5IA4A 4ANQA 4EHGA 5CAQA 2O2UA 2WU7A 3BYSA 4AA5A 2VUWA 3AQVA 5HEZA 3PWYA 3PZHA 3QKMA 5ACKA 4XRJA 1LUFA 4XOZA 5EFQA 5F20A 5C8NA 4OAVB 3NNVA 3ZM4A 2PYWA 4WBOA 4BDJA 3HMIA 3QCSA 3UOJA 3SRVB 2PMIA 4GT4A 1RJBA 3CLYA 3TV4A 4PP7A 4GKHA 2UZLA 3GC7A 4B99A 3TZ8A 5EG3A 1XHAA 3IK3A 3EQPA 3QX4A 3FBVA 3TCPA 4BBMA 4YJUA 5F9EA 1DAYA 5M57A 3FQHA 4KBKA 2X1NA 3VHKA 4QMNA 2CPKE 3OTUA 4BFMA 4BKJA 2O5KA 2VWZA 2X7GA 2BUJA 3AGMA 3FKOA 4ITHA 2J90A 1VYWA 3RK9A 2XIYA 2Y9QA 3GI3A 3ZUTA 4O7WA 4I22A 4ASEA 2XNGA 4RIWB 3MVLA 3FMMA 3FWQA 5K4JA 5AUYA 2G2HA 3IECA 3R7YA 4FTCA 3FUPA 3ORNA 2WTVA 4TWPA 3LM0A 5HG8A 3VF8A 3MIYA 2PVHA 2X4ZA 4H58A 4L9IA 5CVFA 3DJ5A 3EQGA 4APCA 3PYYA 4GIIA 1STCE 4WG4A 3RGFA 3UGCA 3NW5A 4W9WA 2X7OA 3GQIA 3NAYA 3KA0A 3QUDA 2JDTA 2QONA 3JY9A 3SC1A 4CFUA 3VS6A 4DH1A 4BDHA 2W06A 5AUVA 4LUDA 3T3VA 5AP4A 4QT1A 2YCFA 3ET7A 2CKQA 3NNUA 3U6JA 3QA0A 5H2UA 4GSBA 3I0QA 4J8MA 4BCKA 3HRBA 3WE4A 4C2VA 2W1CA 2CN5A 3FLQA 4YUQA 1IAHA 4XV9A 4N0SA 4FKOA 4BCIA 3SG8A 2X0GA 3DOGA 4CFFA 5E8VA 4JIKA 2Z60A 4OUCA 5E8UA 3QU0A 1TKIA 3T3UA 5KMMA 3MTLA 3VIDA 4ITIA 4Q2AA 3RPOA 5CXZA 3P4KA 1OPJA 1H00A 1WVXA 2JKMA 3W8QA 4ZTHA 2H6DA 2X2MA 2X8IA 5E8XA 3WZDA 2Z7LA 2ACXA 3GQLA 4X21A 3VRYA 3RTPA 5DT0A 4PL4A 3FMHA 5BQ0A 4N70A 5JEBA 2R3FA 1IA8A 3QXOA 3RPVA 4KSPA 5C26A 3OEFX 4YNEA 3F2AA 5ETAA 4JT3A 5IUGA 4U79A 4XP3A 3LMHA 2VTRA 3REPA 4ZTLA 4GYGA 4K33A 2ZM1A 4IB5A 2G01A 4XJ0A 3QHWA 4RX7A 3P78A 1E9HA 1BL7A 3E88A 3NUUA 3GCQA 5DGZA 5DNRA 3HUBA 4JS8A 2QVSE 2PVRA 5FRIA 3O71A 3CPBA 4O21A 5D11A 3KXNA 4NTSA 3H30A 1H24A 4C4FA 5IQDA 5JRQA 5HU9A 3I0OA 4AGWA 2XCHA 3MA6A 3VBXA 4EZ3A 5FUTA 4RWLA 1OIYA 3VS5A 4DC2A 4JOAA 2CDZA 2WD1A 4IB1A 5L8LA 2CNVA 4NM0A 5DR6A 2C5XA 5HTIA 1PXJA 4FV5A 4KRDA 4LV8A 3R00A 4RT7A 2VTMA 4IDVA 4HNFA 4FSZA 5CANA 1UKIA 3UZTA 1ZY5A 3AXWA 3GNIB 2W5HA 3QD2B 3ODYX 4AW2A 3VUMA 3AOXA 5AX3A 1XBCA 4C4HA 1E1XA 3CPCA 3I7BA 4CEGA 4R7HA 3QD0A 2R64A 4BZNA 1H0VA 3EN9A 4DT8A 4BWKA 1WBNA 4FIHA 3F3ZA 2YZAA 3F3UA 2WNTA 3VQHA 3DBCA 4GK3A 3KQ7A 4QMWA 3ACKA 3FV8A 3PE1A 3B8RA 2FA2A 3Q4ZA 3WE8A 5DG5A 4CFMA 4FICA 4QTBA 4E4LA 5AWMA 4V01A 4M7IA 3QQHA 3F5PA 1JAMA 3MY5A 4RIWA 3FZOA 2IZRA 5CF5A 3MFTA 3BEGA 3VS3A 4AFEA 1SVEA 5J1VA 4GRBA 5EM6A 3SOCA 2O64A 4E6DA 4AG8A 3NWWA 5LWMA 4E6AA 1K3AA 2ITZA 3R8VA 3P7CA 2C5NA 1JKKA 1W0XC 2VN9A 2YM8A 4YZMA 4C02A 2CCIA 4QP1A 1FQ1B 5CALA 1YOMA 2ZM4A 3R02A 3BELA 3CD8A 5IA0A 3BHVA 1M2PA 2E9UA 4BY9E 3NUAA 1AGWA 3Q52A 5E8YA 3R9RA 2XP2A 3KL8A 3UO4A 2XK7A 4MH7A 5E8ZA 3H4JA 5EW9A 5AV2A 4K0YA 4ZZNA 2R0UA 1H4LA 4HGSA 5HD4A 5L6OA 2XK3A 4ZP5A 4YJQA 1URWA 1YOJA 3D0EA 3E92A 4TY1A 1IR3A 2PVKA 3ORMA 4XV2A 5HLPA 4FEVA 4F9YA 5JK3A 3K54A 4FT3A 2UVXA 3QFVA 3I4BA 2OZAB 3UIBA 4JJRA 1MRUA 2R3PA 3EKNA 2GQRA 1J3HA 3E8NA 3QQFA 2GTNA 3ZCLA 2P4IA 4RSSA 2FYSA 2YLFA 4L6QA 4A4LA 2PMLX 4BDAA 4WG5A 1J1CA 4F0IA 4DT9A 2UVZA 4EOIA 2W1FA 3IG7A 2WTWA 3UO6A 3HMOA 3O7LB 5AP0A 4CGAA 3QTUA 5BMSA 5AR3A 4QP6A 4F70A 3QYZA 3EL8A 4PMMA 4CYJA 3PRFA 4GKIA 4F08A 4DAWA 2XK4A 4GCJA 1YRPA 2B1PA 5ANKA 1O6YA 2OJ9A 4F9AA 4PL3A 3BI6A 2UV2A 1WVWA 2PZRA 4GU6A 4M0ZA 4JRNA 5IQAA 5AV4A 4C3RA 5CU2A 3P79A 4R5SA 2HENA 2XK8A 1GY3A 3UDBA 4D4SA 4YBJA 2GNLA 3AC3A 5DLSA 3DDQA 3SDJA 2BRGA 2NRUA 1WAKA 3IO7A 4UMTA 4F9BA 4NU1A 4A07A 2O63A 3WF6A 2ZB0A 3RM6A 4DGOA 5HU3A 4BWPA 3BKBA 4AE9A 3QZHA 1GAGA 1WBPA 4N6ZA 5IMEA 4DG2E 4FTKA 4O0UA 1JOWB 2XEZA 2ZYBA 3LXLA 4FX3A 5EDPA 5AA8A 2OFVA 3A62A 3D15A 3E7VA 4BTKA 5BUEA 4GG7A 3NW7A 3HA8A 3I81A 2IO6A 2PVYA 4JQ7A 1ZYDA 3BIZA 4H3PA 4M15A 5EYKA 5FQDC 3RPYA 2C6IA 4EK4A 4CT1A 4GVAA 4XV1A 2C6TA 3OS3A 4DFLA 3MWUA 2BR1A 5KMOA 1CTPE 4MQ1A 1URCA 4HVGA 5I9UA 1R0EA 4FV9A 5DYJA 3N51A 3IGGA 4KAOA 1H26A 5CAVA 5LJJA 2HZ0A 4GW8A 4XNEA 5E8SA 2RFSA 3POOA 2WTKC 4BBEA 5FXQA 3U51A 3EMGA 4Z7HA 3PA4A 4LGGA 1F5QA 5LOHA 2C5OA 3WARA 5DH3A 4YJOA 1UVRA 1Z9XA 3RM7A 5IISA 2R5TA 4RC3A 2SRCA 4R78A 3C4ZA 4N57A 3ZOSA 2X9EA 5F1ZA 1IAJA 5EQYA 2PUIA 3NIZA 3V5TA 4RVKA 3R28A 4EKKA 5FP5A 4D2VA 4ZS4A 5EQEA 3OW3A 4FV8A 3OY3A 4PRJA 4I92A 4EZ5A 4L3PA 5CNOA 3G5DA 3NS9A 3VNTA 3ORTA 4I5PA 2DUVA 2WQBA 3A8WA 4XV3A 1J1BA 2W1IA 4QTAA 2XIKA 3W18A 4RG0A 4ACCA 4RIYA 5AAGA 5KMLA 3CP9A 2XKFA 4L52A 4D4RA 2RKUA 1YI3A 3DXPA 3AT3A 2OZAA 3HNGA 2PVFA 3CXWA 3K5VA 5IH4A 5CEPA 2R0IA 3PLAE 4UWYA 4IM3A 1OGUA 3BYMA 4KB8A 3DDPA 4MXOA 3B8QA 3PXQA 2CGWA 5E1EA 3RHKA 4FTAA 4UN0C 3O50A 2J0MB 3WZJA 4BIDA 4Y83A 1SMHA 2JKKA 2VZ6A 4W4YA 2WGJA 4ZTSA 4JLCA 2BAKA 2PULA 4CKJA 4FG8A 2J9MA 4QQTA 2X6EA 4CZYB 1ZAOA 3D5XA 4GYIA 4ANSA 3BHHA 4U3YA 1YW2A 3O8PA 2BRBA 5EYMA 4AACA 4M69A 2REIA 3FXXA 5M4CA 2O3PA 3E8EA 2KULA 3W2PA 4BKYA 2QC6A 1MQ4A 3LFSA 3O96A 3UMWA 4D28A 3F3TA 1WBTA 2QLUA 4FOCA 3RK5A 4WSQA 2LGCA 3UP2A 3EQFA 3VBQA 2RFNA 5CEOA 3LKMA 4MNFA 1X8BA 3DK6A 3PXKA 4TKSA 3H9RA 4XHKB 1KOBA 2YCRA 4MXXA 3ZZWA 4NYEA 4FC0A 3W1FA 3RAKA 4MWIA 3VS4A 1VZOA 4JBOA 3HMNA 2WTDA 3K2LA 2IG7A 2XYNA 3UVPA 2V7AA 2J4ZA 1A48A 3EN7A 3LW0A 4IVBA 3UG1A 4AT3A 4CZTA 4IAAA 4PDYA 3A7JA 3R22A 4C4GA 5B7VA 2YM3A 3M1SA 4XG3A 3RCJA 3MVMA 3MY1A 3FEGA 3FYJX 3MH2A 3R6XA 1QL6A 4O82A 2CKOA 5KMNA 1Y8YA 4IVAA 2WOTA 4O81A 2ZV8A 3GCPA 3ZO1A 3P9JA 2RFEA 2XRUA 3AT4A 4FSNA 1TQIA 4AOTA 3NX8A 5LVMA 5EM5A 3EQBA 4BCFA 1PMVA 5EW3A 2I6LA 2PUPA 3F2RA 4ALWA 2C30A 1DM2A 3WZUA 4XP2A 4J71A 5D41A 2XNBA 4P2KA 3CQEA 1V0BA 1QCFA 4U80A 4TRLA 4ZMFA 3G0EA 4XG9A 3QWJA 5FEDA 2WPAA 3VRZA 4EOLA 3QHRA 1UKHA 2A4LA 3DBQA 2CGVA 3LJ0A 4YGAA 3UQGA 3V5QA 5L2TA 3ERKA 2J50A 2WEIA 4M68A 5DRBA 4GL9A 3HDMA 2QLQA 3N9XA 3OT8A 3P23A 2PVJA 5D12A 3A2CA 5GJFA 3F5GA 4BCNA 4X3FB 3I79A 1XH8A 5AP1A 4ANBA 1OITA 4PMTA 2UZEA 4K2RA 4MXAA 5HG5A 3VQUA 4BDFA 1YWRA 3KVWA 2NO3A 4S31A 4J53A 5AM7A 2PVLA 1PF8A 3DB6A 3WIKA 3QRTA 3K3JA 2C47A 1CKPA 4FKQA 1R78A 3LQ8A 4BDIA 4F0FA 4E5WA 4HYHA 2VV9A 3A7FA 4UYNA 3KC3A 2WTKB 4YO6A 1ZMVA 2I40A 3HVCA 4X2KA 5ANIA 4P5ZA 4ITJA 4HYUA 1OIUA 3OP5A 3AGLA 4MWHA 4EJNA 2BRNA 3GU4A 4OTFA 5FM3A 3SV0A 4C38A 4G3EA 2R3HA 3UPZA 2AC3A 3G51A 4A4OA 5BMMA 3BYUA 4HOKA 3ANRA 3JVRA 3CQUA 2C6EA 4YHJA 3ELJA 4UYAA 3LFDA 5H8BA 4AA4A 4EOPA 2WQNA 3CE3A 3KKVA 2YDIA 2BPMA 3QAME 2XM9A 3BPRA 3KRWA 4GK4A 3COMA 5FP6A 3QCXA 4MBLA 4CV9A 5I4NA 4FZ7A 2QOFA 4RFMA 4U6RA 1SNUA 3RCDA 4AU8A 2YIQA 2OZOA 3ALOA 4TWOA 4AZWA 4RMZA 4Q9ZA 1OUYA 4QRCA 5L6WL 3VUTA 1UU9A 3PZEA 2UW0A 3WBLA 2J7TA 5BVDA 2R4BA 4QMUA 2PZPA 2OKRA 3R8UA 2XUUA 3EN4A 3D7ZA 2Y8OA 4FV3A 4AZVA 2E9OA 3MA3A 3BE2A 1SM2A 4RIXB 3ETAA 4XLVA 3UNJA 3ORKA 2BZHB 1BLXA 4BCMA 1JLUE 3WOWA 1Q99A 4TNDA 2ONLA 1H01A 3M2WA 5AP7A 4F09A 5EDRA 4U45A 4PWNA 3QQKA 4V04A 1ZYCA 4LFIA 5D1JA 4IC8A 4D2RA 5CF6A 4HZSA 4FTMA 3WF5A 4R3PA 2YZLA 3GUBA 3H0YA 1CDKA 4QMLA 1U46A 3PE2A 3ID6C 1OIRA 5IA2A 3QQLA 4Z7GA 2OI4X 3CKXA 4FIJA 1M2RA 4QOXA 1APME 5JKGA 5FD2A 4O84A 5JZJA 1HCLA 1KSWA 4QYGA 3SXRA 2IW6A 1NY3A 4C4EA 4O7LA 4E1ZA 3B2WA 2WO6A 1JQHA 3PVBA 3RAHA 2PZIA 2YCQA 2PE0A 4UBAA 2I1MA 2UVYA 2XCKA 3OCGA 2B55A 4Y46A 3FKLA 1FGKA 1W7HA 1ZWSA 3TV7A 1PJKA 2QNJA 2BZJA 1PHKA 4FTQA 3HRCA 3FL4A 3L8VA 3DKFA 3MPTA 5BVKA 5HBJA 3DLZA 4FVQA 4II5A 3SLSA 2ITWA 4AAAA 3IOKA 3NVMB 3LIJA 2ITVA 5HX6A 4X3FA 2YM5A 4DTBA 4NT4A 4Z3VA 3EYGA 2GS2A 4EHZA 4DF3A 4CTBA 1JNKA 3QUEA 4FSUA 1OL1A 4FL3A 2GCDA 3DCVA 4O1OA 3ORZA 1K9AA 3QCYA 4B0GA 3TM0A 2IWIA 5KZIA 3OC1A 3QRJA 2XJ0A 5FEQA 5CSVA 3U87A 4BB4A 4DH3A 3S00A 5L8KA 2QOQA 4BYIA 3CGOA 2G9XA 4O7RA 4PDPA 2B9HA 2F57A 4F9WA 1CM8A 5F95A 2V55A 2C69A 3PPKA 1ATPE 1NT2A 2CLXA 4XG8A 3I5ZA 2JGZA 2VWBA 2RSVA 3P0MA 2JDRA 2QKRA 1A06A 4EOSA 2JAMA 5ACBC 3C4CA 3VF9A 4O7VA 1TQPA 2HWPA 3I6WA 2F4JA 4MF1A 4ZLYA 2XEYA 3Q4UA 3AD4A 2GQGA 2X2KA 3EH9A 4HCTA 4L00A 4YJNA 3S4QA 2C3KA 4CYIA 4ZTMA 2C1BA 3DKGA 2QHNA 3QKLA 3WYXA 3F7ZA 3ZFMA 3FZ1A 3U9CA 5IA3A 5AM6A 5CI7A 2X39A 3R7GA 2OK1A 3DU8A 3EN5A 1XBBA 3AC1A 1ZMUA 4DN5A 1QPEA 3FLNC 3NSZA 4OTPA 1ZYLA 4IWPA 4ZTQA 3OUKA 5I3RA 5A54A 3QX2A 4RIXA 4H1MA 5DBXA 1WMKA 4TYGA 4IE9A 5EM8A 2VD5A 3DGKA 5EYDA 4UXLA 4NFMA 5IA5A 3TTJA 4WKQA 2DS1A 5AR5A 1PYXA 5JGBA 3IW7A 2X4FA 2XIXA 3COKA 4IZYA 3HA6A 4GFGA 4XCUA 3QYWA 3ROYA 3CY3A 1BI7A 2X6DA 4D2SA 3T9IA 4FOBA 3ZO2A 4CQEA 2WMVA 3MS9A 5JMSA 4I4FA 2R3OA 4UZHA 4KD1A 2XKDA 5HCXA 3PXYA 3ULZA 5HQ0A 3LE6A 4QP9A 2JBOA 2W0JA 3NW6A 2JBPA 1YWVA 3E5AA 4X0MA 1H1QA 2QHMA 2IPXA 4FEXA 4YJPA 2UZBA 3GEQA 1YKRA 3QQUA 4FYOA 4I21A 4FTJA 4XRLA 3B2TA 4BDDA 3LVPA 1U59A 3UOHA 1TVOA 3FC2A 4USFA 2W1EA 4GS6A 4Y5HA 3R83A 2Q83A 3MI9A 1YHSA 4XYFA 4YZDA 4EKLA 4KSQA 5L4QA 3FDNA 4FUXA 4D4VA 2PUUA 5BUJA 2WB8A 3AC8A 3AMYA 3GC0A 3EZVA 1RQQA 1FPUA 3QD3A 5HVYA 3ZDIA 2BFXA 1Y6BA 1MRVA 3O7LD 4G3DA 2W05A 3QTWA 1M2QA 2YERA 1VYZA 3H10A 4TT7A 1IEPA 5FTOA 4GFMA 4XEYA 4I5CA 3F82A 4AOIA 2XJ2A 4YU2A 3BU3A 3UOLA 3QRUA 2QOOA 4OT5A 3VW8A 1OI9A 4WUAA 5BVNA 2C0TA 3F9NA 3PRIA 3OCSA 4FSQA 4EH6A 4FKVA 4RJ4A 2XM8A 2Z02A 5ETCA 2OU7A 5GJDA 4BGGA 2R3RA 3MW1A 2FVDA 4ONAA 2QO7A 4IB3A 2YIRA 4J52A 4KIKB 4S34A 2R3QA 4XH6A 3Q9ZA 5FM2A 3OCBA 1H1RA 1W83A 4EQCA 1R1WA 4UV0A 4ACGA 5CQUA 3NPCA 4L53A 4BIEA 3BLHA 5CSXA 3SXFA 2A2AA 3V04A 3RINA 5K0XA 5ANDA 5EI2A 5LVOA 3R7UA 2WIHA 4ZOGA 3Q3BA 4FNWA 1IRKA 4ANMA 1Q3DA 4XP0A 5HE2A 4X7QA 3FKNA 4IM0A 4WD5A 3IDPA 3MH3A 3LJ1A 4C4JA 4CVAA 2VGOA 4EOQA 4GJ2A 2JIVA 5E91A 3UC3A 1U4DA 3V8TA 3H0ZA 5HNGA 4NWMA 4MYGA 3E62A 4X3JA 2R7IA 3RZFA 2C3LA 3O17A 3RBWA 2W4KA 3TNHA 3V5LA 2CNQA 4IC7A 4RJ3A 4FEWA 4AT4A 3O2MA 1UU3A 2WQEA 4FR4A 3C5UA 3AT2A 4AUAA 3R2BA 3E64A 3LM5A 4FTOA 4RLKA 4ZY6A 2JIIA 4EK5A 2IVSA 3FI2A 4Y5QA 4JG8A 3DY7A 3ANQA 4FV7A 5IG1A 4XBRA 1OKVA 4AS0A 4BTJA 2R2PA 2DQ7X 4ANNA 3MBLA 3OXIA 4K1BA 5DT4A 1Q8WA 5BNJA 4R7IA 5CT7A 5AUTA 1OKZA 5D10A 5FLFA 1XBAA 2H9VA 5JT2A 2BZKB 3MGYA 4GUBA 4MBIA 2ITOA 4PTEA 4DCAA 4G9CA 4DLJA 3DNDA 4YP8A 4GJ3A 4LMUA 2VWIA 4DGLC 3R8PA 4FZDB 4YBKA 2A1AB 1I44A 3GP0A 4EC8A 5I9XA 3E87A 5EHYA 1FOTA 3FYKX 4DEHA 5HIDA 1UNGA 4DYMA 5GNKA 4ANOA 2ITPA 4NZWB 2PPQA 3QZGA 4M14A 2YCSA 3DBEA 3IDCA 4D9UA 2R3MA 5EKOA 4D2WA 3F6XA 3EIDA 4MX9A 2CNUA 4WSYA 3QGWA 4FV2A 5EW8A 2RG5A 4D0XA 4ZTRA 3SA0A 4OLIA 5J87A 1YXSA 1ZARA 2J0KA 5M06A 3QZIA 1UNLA 4QP4A 3KRRA 5BVEA 4HW7A 2CGXA 2ETRA 5JFXA 5TT7A 2HCKA 4X2FA 1BX6A 4GH2A 2FO0A 3HP2A 2OWBA 1BKXA 3I6UA 4QD6A 5CQWA 1ZZ2A 4Z55A 2JKOA 4BKZA 4I94A 1MP8A 2NNWB 1KV1A 3F3VA 3FLYA 4EK6A 2ERKA 2W1DA 4O96A 2JKQA 5IDNA 3PSBA 3VBTA 2IZUA 2B52A 4U40A 5KMIA 3EYHA 3GU8A 4AWIA 4KIKA 3DZOA 3PJ8A 3DV3A 3PPZA
chains in the Genus database with same CATH superfamily
3NUPA 4U3ZA 1SYKA 3KXMA 2VO7A 3LFFA 4M13A 2W9ZB 3R1YA 1B38A 1BUHA 3NUSA 4JVGA 2J0LA 2GHLA 5K9IA 3JPVA 2IW9A 5IF1A 4H3QA 2YHVA 1WVYA 4NJDA 4C0TA 3F66A 5GIPE 3ENHA 5CLPA 4G17A 4BI2A 3ZRMA 2PE1A 4DEDA 3LFEA 4PDOA 4B9DA 5HTCA 5M44A 5K3YA 3AKJA 4PV0A 2W4JA 2PU8A 3VHEA 2EXCX 1Q5KA 1WBVA 1ZYJA 5DRDA 3VAPA 5IEYA 4N6YA 3ZFXA 4IBMA 4O91A 5CU6A 4FSTA 2VTLA 1K2PA 3ULIA 3C7QA 3QD4A 3ZO4A 3N4UA 3LPBA 5D7VA 4O7YA 5EHLA 2JDOA 4BDGA 4C34A 4ZSJA 2PVNA 1H8FA 2Y6MA 2ZDTA 3EFJA 3BHYA 5GZ9A 5HCZA 5J5SA 2OLCA 4QPMA 3C9WA 3FPQA 4O6LA 4AZSA 4R1YA 3OY1A 3UNKA 2YLEA 3F5XA 4IX4A 4E4XA 3VN9A 3TI1A 1B39A 1OL7A 4TN6A 4FZAB 2CKEA 4FKIA 4AZTA 4YTIA 1S9JA 3EQHA 3Q9XA 3C5IA 4ZTNA 3FZPA 5AP6A 2BDJA 2YM6A 4BZOA 3UC4A 1W8CA 2BALA 2KTYA 2QO2A 3V8WA 4IJ9A 5L2WA 4ACDA 2UZWE 4FZFB 3TYKA 2UZNA 4EH4A 3ORLA 4IH8A 3LFAA 3ZHPC 3A8XA 5JFVA 4FSMA 3GFWA 5JQ8A 4O22A 4FJVA 1FGIA 4JQEA 5EHOA 3THBA 4AA0A 2W5BA 3C1XA 4EOOA 5TE0A 2EXMA 4PP9A 5HESA 4ZMEA 3BYOA 2CGUA 4GK2A 4NCTA 2F2UA 3O8UA 4YJVA 4WUNA 2Y6OA 3UPXA 2W96B 3FLWA 5K5NA 4RIYB 4NW6A 3FAAA 4AN3A 4DLIA 3HMMA 3AC4A 3OZ6A 4D55A 3SOAA 1BI8A 4PF4A 5LMBA 1XH4A 4MUQA 3CKWA 1OBGA 4O0YA 3D2KA 4R77A 1H08A 3VVHA 1YXXA 2XYUA 1LEZA 3PY0A 5M51A 4L42A 4H36A 4QP7A 2QR8A 4D5HA 1VEBA 2X7FA 3DBFA 3S95A 3W2RA 1ZLTA 2UW8A 3OMVA 1PMNA 2YJSA 1B6CB 4I20A 4BYJA 5JSMA 2PZYA 2VAGA 2BDFA 3MH0A 1FMKA 4DBXA 4U44A 4HVHA 3GC8A 4GT3A 4GMYA 2QU6A 4OTIA 3D14A 3OFMA 2YFXA 1YVJA 2ITUA 1H1SA 4M69B 3ZEPA 4X2JA 4YZ9A 4LQMA 4FTRA 4DEIA 3E3PA 5B2MA 4KKEA 3U6HA 5EOBA 2I0EA 3NNWA 4YPDA 3ZO3A 3D7TB 3VJOA 3C4EA 4GV1A 3R9OA 3QRKA 4WHZA 4APPA 2BRHA 5KHXA 3TNQB 2OF4A 3HUCA 1LP4A 2EU9A 3DQWA 4L7SA 4QMXA 5E92A 5BYZA 3MVJA 1FVVA 4O4FA 3OOMA 4U5JA 4NFNA 4YPSA 4M3QA 5HG9A 1HCKA 2W1GA 4GVJA 4L43A 2Q0NA 5DA3A 3IW6A 4A9SA 2C6DA 4JR7A 1H1PA 2GNFA 3LXKA 1S9IA 4QMPA 3MV5A 5AV0A 3SG9A 4CMUA 4UWCA 4FF8A 3W33A 3DFCB 3UZRA 4JNWA 4CKIA 5KKRB 5HD7A 2CMWA 5FGKA 4X3FC 5C4KA 4RBLA 2GNIA 3FI4A 3R8ZA 1UU7A 1Y57A 4CLJA 2OIBA 3AMBA 2BKZA 4XG4A 3PJ3A 4LYNA 3VW6A 1LR4A 4AW1A 2IVUA 3H9OA 3MYGA 5LMKA 3I1AA 3UZPA 1KE8A 5I9ZA 1H0WA 4MBJA 3KULB 4I0SA 4TYHB 5M53A 5M08A 4G3CA 3TDVA 3WF8A 3HV5A 4EUTA 3OWJA 5J9LA 3LJ2A 2DWBA 2C0OA 3HDNA 3TUCA 3ZLYA 3K5UA 4GG5A 4P5QA 4UXQA 3ZXTA 2AUHA 4TWCA 4IWDA 5A4QA 1XMMA 4DGGA 2NPQA 4QPAA 2A98A 4V0GA 4O0SA 4UMPA 2HZIA 4FE2A 4AP7A 1YDTE 1Y6AA 2HOGA 4NIFA 4S32A 1G8AA 5M4FA 3NVKI 3RNIA 1RW8A 4DTKA 3W2CA 4RZWA 4JX3A 4CT2A 3LLAA 2OJFE 3A7IA 5A4EA 3AG9A 5BUIA 4YLKA 4HPTE 2B0QA 4MD9E 3TUDA 3W16A 1P2AA 3O23A 4JI9A 1O6LA 1V1KA 3S2PA 4EH8A 2VTSA 2QOKA 3R9HA 4BIBA 4I6HA 4D58A 4HVDA 1R39A 4A9YA 3FZSA 4AXEA 4R7BA 2FB8A 2YA9A 4U43A 3ROCA 4DEAA 3BU6A 2IZSA 4C61A 3RNYA 4RX5A 1IASA 5CSHA 3KREA 3DTWA 3OBJA 3EKKA 5GJGA 1JSTA 1SZMA 4RVLA 4LM5A 1L8TA 1W84A 2RIOA 2LAVA 4CMTA 3PP1A 3NLBA 1FMOE 3PIZA 2WTIA 4L01A 3CD3A 4O2ZA 4TYEA 5HHWA 3G6GA 4UMUA 1Z5MA 4QMSA 3NUYA 1XJDA 1OMWA 3ZC6A 4G3FA 4KWPA 3SQQA 2Z7QA 3FLZA 5J5TA 3RALA 3D7TA 4UALA 2YM4A 5KZ0A 4BTFA 5L3AA 5L8JA 4CLIA 4BI0A 5CF4A 4MNEA 2F7XE 1JKTA 3G15A 5A6OA 3RVGA 1JBPE 2Z8CA 4BDEA 5JFWA 4O7NA 5B2KA 4QMOA 4ALVA 1OKYA 1MUOA 3F3WA 4JRVA 2IZTA 4KNBA 4JDIA 4ZJVA 2GDOA 5CWZA 4DFNA 2GHGA 2OXYA 4JG7A 4XBUA 3KEXA 3L9MA 2O8YA 4OTHA 3BWFA 4I5HA 4CCUA 4ZLOA 4IX6A 3LFNA 1QPJA 4FNZA 4KABA 5L2QA 4ZJJA 5KBQA 4C3PA 3R63A 4P7EA 5DHJA 5EI8A 5LVLA 4BF2A 4DFYA 4YMJA 3R7EA 1OB3A 4IHPA 2YABA 4AGUA 4G16A 3LQ5A 4W8EA 3EQIA 3PDTA 4E8AA 5J95A 5CEIA 4J1RA 5HNIX 3RPSA 2GQSA 4TTHB 5CASA 3PUPA 4BDKA 1F3MC 4I23A 1P14A 3KULA 4E4MA 4E73A 4DGMA 4ZZOA 2JDSA 2NRYA 4TYHA 1G5SA 4IXPA 5CTPA 4AW5A 4UWBA 4D0WA 5C27A 5IQHA 3EQCA 3ZLXA 2ZVAA 3HAVA 4H05A 2R3KA 2HZ4A 3L9PA 3NYNA 1KE7A 3C51A 4YO4A 3TMOA 2ERZE 4D1ZA 2EXEA 4EHEA 1CMKE 3P86A 4RJ5A 3DKOA 4I0TA 2C68A 2P55A 4K8AA 4QQCA 4D4YA 4KRCA 4TL0A 3F88A 4O2PA 5C8KA 1P4OA 2G2FA 1KE9A 5HG7A 2HZNA 4YNOA 2E2BA 4ASDA 5KO1A 3QTZA 5E90A 3GC9A 4OTWA 4RQVA 3RI1A 4PUZA 3SVVA 5I5ZA 2FUMA 1RE8A 3UQFA 4RC4A 3T8OA 2A27A 4WIHA 3IONA 4XS2A 2QU5A 4QQJA 5HZNA 3ZRKA 4ANLA 3QC9A 3C13A 2OFUA 4KS7A 1YXUA 4BDBA 3LQ3A 3HV7A 3LCSA 3FMLA 4USDA 1JKSA 2PSQA 3R2YA 3VUDA 3LFCA 4BTMA 4QNYA 2J5FA 3NYXA 4O7ZA 2QR7A 2VTAA 1XKKA 3P7AA 2CSNA 3A4PA 1M52A 1PXNA 2P2IA 2X8EA 4OBQA 3SAYA 4TZRA 3FZTA 4F1OA 4F7JA 2W4OA 4PMPA 2J0IA 4G3GA 2WQMA 3JVSA 4W9XA 3U4WA 3ORIA 2AYPA 1XR1A 1JKLA 2BHEA 3A7GA 4TW9A 4ZSLA 3TIYA 4MXZA 2GPHA 3MPMA 1IG1A 4J98A 3QKKA 2J51A 1T46A 4UEUA 2OO8X 3UMXA 5AUWA 3MFUA 5HO7A 4O38A 3VUKA 3W2SA 3KRJA 1ZOHA 4R3RA 4EHVA 4OAUC 4KKHA 2B53A 3TNPC 4ERKA 5M56A 3ZUUA 5EH0A 4PDSA 5LWNA 2Y0AA 3D5WA 4FUYA 4RVTA 3ZSGA 3R8MA 2VTOA 4AXAA 4M12A 4FVRA 3D5UA 2YITA 3FHRA 3N4TA 4ALUA 2H8HA 3VS0A 4J95A 3QRIA 1PXKA 4B8LA 3DXQA 3ZSHA 3UVRA 3L9LA 3NR9A 3COHA 3OWLA 4AFJA 5HBHA 4C57A 3BYVA 1G3NA 4CFXA 3FQEA 4G6NA 3PIXA 4ERWA 4RJ6A 4F65A 4O0RA 2ETMA 2WXVA 2BRMA 2P0CA 5HIEA 5IQBA 5CU0A 2G1TA 3PJCA 5C9CA 3ZFYA 4E26A 2BIYA 3CQWA 5EI6A 3TT0A 2OW3A 4BRXA 4KA3A 5DEWA 4WNMA 3TEIA 4PNKA 5J7HA 3IW4A 5KMJA 5FTGA 3OW4A 3TZ7A 3POZA 3ODZX 1NW1A 1U54B 2FSTX 3BGQA 4J99A 4BHNA 4CV8A 4F7SA 3RZBA 4BICA 4D1SA 3W0MA 3MB6A 1OUKA 3DLSA 3OD6X 2CLQA 4FV0A 3NYVA 4O27B 1DS5A 4JQ8A 3RAIA 2NP8A 5C1QB 4L44A 1WBWA 1VR2A 3KXXA 3C4XA 3IPHA 4BCGA 2CKPA 5TF9A 1IA9A 5B0XA 2X8DA 2ZJWA 2YJRA 4UMRA 3LLTA 5LXMA 3I7CA 5KCVA 4HNIA 3IQ7A 2GS6A 4BL1A 4RRVA 4RWIA 3R73A 1BMKA 2ITYA 2QOBA 5HVKA 1W82A 4OW8A 4BI1A 4FIGA 4H1JA 4CFNA 3BU5A 2CJMA 2JDVA 4WNKA 2XNMA 4LOQA 1R3CA 5BVWA 4AQCA 5CENA 1SVHA 4PMSA 3W32A 3M11A 3LMGA 3KXZA 4FSRA 4RIOA 5TKDA 5AADA 5M4IA 1M17A 2WIPA 3LHJA 1JWHA 3GOKA 4MD8E 5HCYA 4OTRA 3UODA 3Q2JA 2WZJA 3BHUA 4IB0A 4IZ7A 4HZRA 4Y95A 2C4GA 4WNOA 3WZKA 4A4XA 1Q4LA 2HW7A 4EQMA 5BVOA 1OL5A 4YJTA 4E3CA 2GS7A 3TKIA 1BYGA 3WILA 5FWKK 4HCVA 2UW6A 4PTCA 5AUUA 3PXRA 4FKSA 1GOLA 5HE0A 3OF0A 3V3VA 3R7IA 1ZOEA 1O9UA 2X2LA 2YIYA 5CEMA 2P2HA 5ETIA 4O7TA 4EUUA 1YOLA 5HIBA 5E1SA 3EFLA 3PVWA 4ID7A 5ANOA 4F63A 5DEYA 4RA4A 1J7LA 3A61A 3C0IA 4IEBA 5HI2A 2HK5A 5D9HA 4KUJA 3Q6UA 3FI3A 4DDIA 4L3LA 2WMUA 3DPKA 4UMQA 5TOZA 4HGTA 5GZ8A 1OECA 3OEZA 4R5YA 3GCVA 3V5PA 4ASXA 4CSVA 4ZAUA 1GIJA 2J5EA 4JL9A 4NCTC 4E4NA 2OXDA 3ENMA 4U41A 1PXIA 3FPMA 1OVEA 2XK9A 2W99B 5DVRA 4WOVA 3ZUVA 3MJ1A 3KN6A 3IKAA 3PVUA 4HVSA 4QMQA 4CCBA 4DEEA 1WCCA 4HGLA 5IEXA 2VGPA 4XMOA 2J2IB 3GGFA 3UO5A 4C35A 1PXPA 5J1WA 3U55A 4LRJA 3AMAA 3OBGA 2W7XA 2OICA 5CY3A 4ZIMA 5AA9A 3C4WA 3H9FA 3SXSA 3FY0A 4M8TA 3WYYA 2OXXA 5LCJA 2C5YA 4AF3A 4DTAA 3GU6A 4G2FA 4FZ6A 1KE5A 2F7ZE 4NK9A 3HX4A 4JMQA 5J9ZA 2VX1A 3E7OA 1U54A 5JN2A 2VTIA 5E4HA 2QG5A 3MIAA 2I0YA 3Q04A 3TZ9A 3CEKA 4YTHA 3W55A 5JQ5A 2F2CB 3VULA 5KX8A 3VUHA 4JBVA 5LVNA 2FSOX 2BFYA 3CC6A 4H39A 4KS8A 1ZY4A 1XH7A 5F94A 2E9VA 3P7BA 3PXFA 2ESMA 4L46A 4DFBA 4J96A 3R1QA 4IZAA 3WF7A 4USEA 2EVAA 2OH4A 4L7FA 3TG1A 1PMEA 3AKKA 2OIQA 5ANEA 3MTFA 5ITAA 2CN8A 2X9FA 3KMWA 4OR5A 5ICPA 5AFVA 3MPAA 1XH6A 2WELA 3KFAA 3P08A 3NCZA 3Q5ZA 4G5PA 3ZSIA 5IU2A 3GENA 4LV5A 4L3JA 3A60A 4O4BB 2BAJA 4QMYA 3S3IA 3U9NA 4J7BA 2IVTA 2VO3A 5AR8A 3PJ1A 2FSLX 3R7VA 5IUIA 4BHZA 3CTJA 1OPKA 4FEQA 1TFFA 1YWNA 3NYOA 4QNAA 5TO8A 3HYHA 3TACA 5CAOA 2UW5A 2UZOA 3W2OA 3AKLA 5FDPA 3TN8A 2XANA 3FLSA 3MSSA 3TZMA 4JG6A 2ZB1A 2BTRA 2WMRA 3NNXA 2PMOX 3IOPA 2C3IB 5CXHA 2VTNA 4O1PA 3TIZA 3UIXA 2ZM3A 2OBJA 5BX0A 3Q5IA 2VTPA 4QYFA 3W2QA 4CKRA 5BPYA 1ZZLA 3VBVA 3G9NA 1ZRZA 3WI6A 4D5KA 3LMIA 4RVMA 3ZH8A 1FVRA 4JXFA 2JLDA 2ZMCA 1JPAA 4I1ZA 4TNBA 4EWQA 2QOCA 4UB7A 5A4LA 3PFYA 3E93A 5CU4A 4YLLA 3CCNA 2YDKA 4EH3A 4F6WA 4LOOA 4D1XA 5BYYA 3BE9A 4RX9A 5CSPA 4IADA 5DFPA 1PXLA 3SX9A 5HORA 3W8LA 1ZXEA 1WZYA 4CXAA 5HLWA 3O5AA 1XO2B 1AQ1A 1RDQE 4B8MA 3NIEA 3DAKA 3QQGA 2WQOA 4X2NA 5I3OA 3A4OX 5HICA 4C8BA 4E6CA 5EOLA 2WHBA 2YN8A 4DEBA 5IZFA 4QQ5A 3U8WA 4JBPA 4JX7A 3G33A 3JY0A 1XH9A 2WTCA 3CSVA 4ZSAA 5AUZA 3UJGA 4E5AX 5JFSA 3S0OA 3GVUA 2UW7A 2IN6A 3V6RA 3ATTA 5AR4A 4QTEA 1M14A 1KUTA 2W17A 4FKWA 4XUFA 4G9RA 3TV6A 1HOWA 3BWJA 4DG0E 5CT0A 3BCEA 2UW4A 2OSCA 2PHKA 2R3LA 1Q8ZA 3EQRA 4FTLA 3PJ2A 3C4FA 5E8WA 4F9CA 3GU5A 3VS1A 4A7CA 3L8XA 4F7LA 1WBSA 2VTJA 3GBZA 4BVUA 4RX8A 4PL5A 1YI6A 4DFXE 5I9WA 2XBJA 4IAIA 5LMAA 5E9EA 2XKCA 3DK7A 5FBNC 4XX9A 2QKWB 4MAOA 5FTQA 4OGRA 4EI4A 4RFZA 5CZIA 4X2GA 2V22A 2WMBA 4LGDA 4D2PA 2Z7RA 4TPTA 4NM3A 3ZTXA 3OTVA 1G8KA 2UZDA 3QGYA 4GT5A 1V0OA 4P90A 3UIMA 2WMTA 3QTSA 4WRGA 3VS7A 2OF2A 2UZVA 1OZ1A 3AC5A 2HW6A 2XVDA 5IMXA 3LCTA 1OGYA 4KIOA 2E9PA 2W1ZA 1Y8GA 2HY81 2UUEA 3OOGA 4JIAA 3RJCA 2ZV9A 4AGCA 5KKRC 4QDVA 5HBEA 2VO0A 5DE2A 3EOCA 4IJPA 2XNNA 1YXVA 4O86A 1TQMA 4YJSA 3G0FA 5AIRA 2QO9A 4DHFA 1PKDA 1YHWA 2XS0A 4HGEA 4QO9A 2ITNA 1CKJA 3HECA 2DYLA 2UZUE 4BBFA 3G6HA 1GZ8A 1NXKA 2ZV7A 4U81A 3QTQA 4BZDA 4K11A 5GHVA 2GSFA 1OIQA 1P5EA 3KF7A 2B9FA 3CIKA 1GZOA 5HO6A 4HVIA 4Q5HA 2AEGA 4FKPA 5CNNA 1PMUA 3RMFA 4AT5A 4FKUA 1SNXA 1ZMWA 4RWJA 3MESA 3G9LX 5CAUA 2VU3A 5HNBA 4CFVA 2GNHA 3LFQA 3V5WA 3CJGA 3M42A 4ZSGA 3UBDA 3LXPA 3FC1X 4K6ZA 4EZ7A 5DT3A 4DCEA 4OTQA 4RWKA 3ZXZA 5TR6A 3R9NA 3ZLWA 5IDPA 4XG6A 2YWVA 4AZEA 3OROA 3D9VA 3FY2A 4LDTA 4I6LA 3QALE 4BDCA 4F99A 2I0VA 2VTTA 5BVFA 3CTHA 3OVVA 1UA2A 3UP7A 3Q4CA 5KMKA 3KF4A 1QMZA 4FIEA 2C1AA 4MD7E 3UNZA 4ORKA 3BQCA 1P4FA 5CX9A 3AC2A 4RC2A 2QOHA 5C03A 4KBAA 3BV3A 4IAZA 4TWNA 2VWXA 1OM1A 4QPSA 3PPJA 4WA9A 1YI4A 4R6VA 4CTCA 4F6SA 3HLLA 4C4IA 3FMJA 3GCSA 1NA7A 1NVRA 1I09A 2WTJA 3TNWA 3SRVA 4K9YA 4O0XA 5CEQA 3DAEA 3ML1A 4BR3A 5EQPA 3VWAA 3DB8A 2IJMA 3BLQA 3CTQA 4Y72A 4M0YA 3P5KA 4D9TA 2VX0A 2QQ7A 2XH5A 2Y4IB 3DJ6A 5H3QA 3VS2A 3R1SA 2ETKA 2GFCA 3V51A 3SW7A 1KV2A 3R71A 4V0GB 4EORA 4MTAA 4NJ3A 2R3GA 5FXSA 5J79A 3R21A 3TTIA 1H28A 5HX8A 4NIFB 3SD0A 4I41A 4JDKA 2XBAA 3F5UA 4Z9LA 5LCKA 2RFDA 3MFRA 4CMOA 3EFWA 4PQNA 2JD5A 4IAKA 3IGOA 1GJOA 5CVGA 2QOIA 5DPVA 4C2WA 3VJNA 3D5VA 5FDXA 1R0PA 3ALNA 4LUEA 5AP2A 4RZVA 4UY9A 3MFSA 4A9TA 4FV6A 1YHVA 2XZSA 2WFYA 3F61A 4G5JA 3LCKA 4I6BA 3R04A 4FT5A 2VWUA 3UIUA 3UQCA 5HOAA 3E63A 3KN5A 3VC4A 3MDYA 2VO6A 1Q8UA 3QBNA 5DMZA 2YDJA 3OCTA 4IFGA 4JAJA 2V62A 5JZNA 4CG8A 4FT0A 4AXFA 3V6SA 5ANJA 5M4UA 5DR2A 5E8TA 4C36A 1H27A 2Z2WA 2HWOA 2WEVA 3PXZA 2VWVA 5IH6A 2ONLC 2I7QA 2FGIA 3SHEA 2B4SB 3LXNA 4DA5A 4IIRA 1H1WA 2VRXA 3BBWA 3RPRA 3D83A 4KBCA 3EWHA 1CSNA 3S1HA 3E8DA 4MK0A 4HPUE 4JAIA 4DBNA 2XRWA 4XG2A 3W0PA 4DFUA 3COIA 1LEWA 4IX3A 4F1TA 2VX3A 1PXMA 2QCSA 4QYYA 5AV3A 4LMNA 3BHTA 1QPDA 3AD5A 3DK3A 4IX5A 4MNEB 5EDQA 3V8SA 3HGKA 3VUIA 4BCQA 2JEDA 2BTSA 5L2SA 3ATSA 1WFCA 4NL0A 2OIDA 4R3CA 5EYCA 4QP3A 4IACA 4J8NA 5AR7A 4W4VA 1M7NA 2XB7A 3DNEA 3QWKA 4IAYA 5HKMA 2BKKA 3JR1A 3UTOA 2C0IA 4ASZA 5IQGA 4BWXA 4EOMA 5HVJA 3LFBA 4IQ6A 5FG8A 5ETFA 4EH7A 2PZ5A 4CRSA 4RJ8A 2V0DA 4FGBA 2BDWA 3CY2A 4U97A 5FEEA 1DI8A 2XIZA 3ORXA 3KCKA 4YLJA 3TXOA 4EK8A 5CAPA 5DN3A 3UOKA 5A14A 4D2TA 4EONA 5GINE 4ENYA 3DT1A 3BX5A 3ZRLA 4E5BA 3DTCA 4J97A 4C3FA 4EH5A 2YM7A 2YWPA 4IDTA 4HYIA 4OTGA 5AP3A 3TKUA 4ZY5A 1U5QA 4FIFA 3CGFA 3C50A 3R1NA 2I0HA 3U6IA 3PVGA 1GZNA 3BEAA 3GXLA 2OJIA 3C0GA 1W2FA 2OG8A 1YDRE 2G15A 4E6QA 2FH9A 4X6RA 4YC8A 3WZEA 2ZAZA 3BGPA 3QTRA 3L8SA 3MH1A 3R9DA 4C33A 2X0QA 4XG7A 3UVQA 2OGVA 4FSYA 5AV1A 4FK6A 2EWAA 4IM2A 4H3BA 3VBWA 5KHWA 3KCFA 5I9YA 3KB7A 3ZU7A 3D94A 1PXOA 3DQXA 3GB2A 4YSJA 5T6KA 1ST0A 1GIHA 4LGHA 4EH2A 2WU6A 3ZEWA 4FVPA 3NMUF 3SKCA 4MF0A 1MRYA 3IDBA 2Q0BA 3JUHA 2YEXA 4FSWA 3PA3A 4B4LA 4Y85A 1WBOA 2E9NA 4FT7A 5F4NA 5J7BA 3SW4A 3A7HA 5A9UA 3D4QA 4Y73A 2P33A 2F49A 2WMWA 4IZ5A 4FA2A 2JIUA 3DBDA 4KINA 2RL5A 2QG7A 2B54A 2XKEA 4YZCA 3I60A 4Z16A 4GU9A 4OBOA 4W4XA 4YZBA 3PA5A 3O8TA 4B6LA 2QI8A 4ZSEA 3Q2MA 4AXDA 4DE4A 2XA4A 3DAJA 4NTTA 1Q3WA 4BJJA 5AP5A 2EUFB 4U42A 1GIIA 4P4CA 4QYEA 3V5JA 4IW0A 3R8LA 5EK7A 4CZUA 4O7SA 3MB7A 2WMSA 1JVPP 3PY3A 4L8MA 5HE3A 4C62A 3HAMA 2VTHA 1H25A 3SGCA 2UW9A 2C6KA 3D2IA 3QF9A 4EYJA 4MVFA 5DWRA 4E7WA 3OG7A 1UNHA 4CD0A 4QYHA 3EHAA 2QOLA 3CR0A 1JSUA 5HLNA 4LRMA 3DA6A 1OL6A 5IQFA 3GU7A 4FG9A 4X6QC 3NEWA 3W10A 2HELA 4AN2A 5L6PA 4EBVA 4K77A 2BCJA 4FTUA 2JFMA 3ZLSA 4BGQA 5JGDA 3EFKA 5DI1A 4EOKA 3OWPA 4ZJIA 3NZ0A 3L1SA 4YURA 4AW0A 3PWDA 5CEKA 4YJRA 3FL5A 3KU2A 4FKRA 4BN1A 4ZLZA 3L9NA 4F7NA 3DS6A 3EN6A 3GCUA 5HE1A 4EL9A 3ZS5A 1AD5A 1O6KA 3UE4A 3V01A 4I4EA 2R3NA 3DJ7A 3LAUA 5KBRA 4EJ7A 4EBWA 2ZMDA 3O51A 4ARKA 1NVSA 2X81A 3EB0A 3LCOA 3U4UA 2YAKA 1BL6A 2EB3A 3H3CA 4UX9A 4Q5EA 1OKWA 2R3JA 3NUXA 3KY2A 4S33A 4K18A 5K0KA 4AZFA 1EH4A 4CFWA 5AJQA 1XMLA 2CCHA 4YC3A 4IWQA 4I24A 2BROA 4R8QA 5IPJA 2G2IA 1XWSA 1Q97A 1SVGA 2PVMA 4BC6A 3HZTA 5CU3A 4PPBA 3GOPA 4G31A 3HV4A 2GMXA 4QP8A 1UWJA 4HJOA 4PTGA 3Q9WA 3RWQA 2C5VA 2PL0A 2C6OA 1REJA 2WMQA 3Q6WA 1FINA 5G1XA 3BV2A 4ZS0A 4EH9A 2C3JA 2R3IA 3GFEA 3MVHA 4IFCA 1ZOGA 5CVHA 4OBPA 3R7OA 5GZAA 3C0HA 2WOUA 2VNWA 1L3RE 2Y7JA 2Z7SA 4PX6A 4W4WA 2XF0A 5B2LA 3JXWA 5T68A 2W1HA 4M97A 4KIQA 1YDSE 5CS6A 4FODA 2ZDUA 3CJFA 4WG3A 4L45A 2VNYA 1GNGA 2XJ1A 3G90X 3LZBA 2OJGA 4LOPA 5IQIA 2BZIB 2GNJA 3KK8A 4YSMA 3KXGA 3F69A 5CI6A 5JGAA 2A19B 4FYNA 3QC4A 5LVPA 1Q8TA 2QD9A 4I6FA 3W0NA 5M55A 4JDJA 2ZV2A 5LARA 5D7AA 2WMXA 1YXTA 3PG1A 2V7OA 3Q4TA 3ACJA 4FL2A 4FTNA 4EOJA 3ZC5A 3ZBXA 4GEOA 2C6MA 4YHTA 3ZYAA 3PLSA 4FKGA 3TL8A 2R9SA 1FBNA 3TUBA 3IS5A 4OT6A 4O0TA 4DINA 1DAWA 3W0QA 2O0UA 3CS9A 2B9IA 2BHHA 3PG3A 4UZDA 3TDWA 3NRMA 4I0RA 4L67A 5BV3A 2YAAA 4RFYA 2H34A 2WKMA 5HTBA 5M09A 4MCVA 4FNXA 4FL1A 3NUNA 2OJJA 2PY3A 4MXCA 3ITZA 4QTCA 2GU8A 3RKBA 4Y8DA 3QZFA 4WT6A 4EYMA 3QL8A 1UU8A 2P3GX 2A0CX 3MY0A 1W98A 5A4TA 5A3XA 2XALA 3HV6A 2J0JA 4YHFA 1F0QA 3DZQA 2R7BA 4AE6A 1XH5A 4LG4A 4HCUA 5CYIA 4MKCA 2HIWA 1XQZA 4O0VA 5J8IA 1E1VA 3G2FA 3NDMA 4YR8A 1PYEA 4NKSA 2B7AA 2PE2A 4R1VA 5IEVA 5BYLA 4I3ZA 2WMAA 1OBDA 4FT9A 4QMMA 4CQGA 5K4IA 4ENXA 5AUXA 4DEGA 4CG9A 4CRLA 4NM5A 1V0PA 2BVAA 2IVVA 4LI5A 4NM7A 4U7ZA 1UWHA 4QMVA 3OXTA 2YIWA