2HZNA

Abl kinase domain in complex with nvp-afg210
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
277
structure length
272
Chain Sequence
MDPSSPNYDKWEMERTDITMKHKLGGGEVYEGVWKKYSLTVAVKTLDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Structural biology contributions to the discovery of drugs to treat chronic myelogenous leukaemia.
pubmed doi rcsb
source organism Mus musculus
total genus 82
structure length 272
sequence length 277
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2hznA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2hznA01
4IAIA 2R3HA 2YERA 2VX0A 3AGMA 5M08A 3ZU7A 2ZV8A 4UWBA 2XKEA 2ZMDA 3DS6A 3AMAA 4BRXA 2ZYBA 3OCSA 2H34A 2H9VA 3NUUA 3NNWA 3RZFA 5L2IA 5A46A 3MTLA 3N4UA 4EH8A 2WKMA 2ITQA 3ELJA 1A48A 1EH4A 3R8LA 2W99B 3D5XA 2YAAA 3L8XA 3F5GA 3CPCA 3QQHA 4I6HA 4OAUC 2XM8A 4ZJJA 2FSMX 3D5VA 5CT7A 4ANMA 3SXFA 3H30A 2QOFA 4KRCA 2XJ1A 3DV3A 4AW1A 3BHYA 4OTQA 4FKJA 5BYYA 3P7AA 2UW0A 3PRIA 4OUCA 1MRVA 3FZPA 3IOPA 3F5XA 5LQFA 4RX7A 2ZV7A 5AP5A 3DT1A 2BTSA 4QMMA 5FD2A 3U9NA 3DY7A 3FXZA 1PF8A 2ITTA 4BI1A 4EBVA 3NW5A 4AE6A 2XBAA 3FY2A 4C4JA 2CNVA 3LMIA 2PVNA 3DBCA 1HOWA 4FZAB 4GG7A 4MAOA 5E8UA 3CSVA 2E9PA 4IWPA 4PTCA 1DAYA 1GAGA 4Y72A 3RPOA 2GQSA 3CQUA 3S0OA 3F5PA 2IO6A 3VS6A 1PXPA 5J8IA 2ITZA 2OZOA 5EDQA 4JQ8A 1UV5A 2G9XA 2I0EA 4R3CA 5CTPA 5JKGA 5EQEA 3GCUA 3VUTA 2CHLA 3BYVA 3E5AA 3TUDA 3QC9A 2OXXA 4O0TA 2O63A 1JSVA 4ZS4A 2ITWA 3CC6A 4MH7A 2W0JA 3TTJA 4AT3A 1JLUE 4DEIA 4M97A 3HECA 3TL8A 5M44A 4J8MA 3DNDA 2ZV2A 4UEUA 2WMVA 5ANJA 3ORTA 3ZDIA 4EQCA 5LOHA 5M4CA 4CZUA 3O50A 5C27A 2VX3A 2WMQA 4RLLA 4P90A 3C4CA 1W8CA 3CTQA 4FTMA 3R9OA 5IQGA 3VHEA 4D9UA 3Q3BA 3LFNA 2J9MA 3KN5A 5I3OA 4QYYA 3ZUUA 1K2PA 2JD5A 3WF9A 3LE6A 4HW7A 3UGCA 2QQ7A 5JFXA 2J90A 4DH8A 4JJRA 1OIRA 4FUYA 4O84A 2VTIA 4GT5A 3EQCA 5CU4A 4YJQA 4WNKA 1NVSA 4IZYA 5K0XA 3EN7A 3CY3A 4Q9ZA 3DAJA 4CG9A 5HNBA 3GOPA 1J7IA 1YHWA 4IX5A 4B4LA 3R9RA 3RWQA 4FL3A 1OUYA 2J0JA 3EN5A 4RC2A 5M56A 2B0QA 2BFXA 5FTOA 1CKPA 3O23A 4YNEA 4B8LA 3C0HA 4KSQA 3FKOA 4Q5EA 4M14A 5AR3A 4DG3E 1M7QA 3M42A 2F2UA 1UNLA 3ROCA 3W8QA 2BFYA 2Q0NA 4TXCA 3LM5A 1IAHA 4WUAA 2XNNA 2ZAZA 4I6BA 4ZJIA 2X7OA 3OF0A 3DLSA 4BWPA 4MTAA 2QOLA 3QQLA 3QGWA 4K9YA 3P4KA 4NM0A 2BR1A 4RIXB 5L2TA 3JY9A 3BKBA 4B7TA 5AV1A 3G51A 5EHYA 4NKSA 5BVFA 2DYLA 2QOKA 3KF4A 3RAHA 4BCOA 2VO0A 2W5AA 2VWZA 4X3JA 5H8GA 4GKIA 4WG4A 4WG5A 4JAJA 5B2KA 4NYEA 3PPJA 5AUTA 4KIPA 5DWRA 2UW4A 2Y0AA 3ZFYA 4EHZA 5IQIA 4FK6A 4FZ7A 1XH5A 1XKKA 4U3YA 2Z7QA 4CD0A 1RQQA 5H2UA 4C4HA 2E2BA 2IN6A 4OBOA 5DR9A 5DG5A 3EJ1A 3W2SA 4TY1A 3WE8A 4S32A 3RP9A 2ZDUA 3OBJA 1GZ8A 3ENHA 4AA5A 4M68A 3MVJA 4YO4A 3OW4A 4BI2A 4AS0A 4C34A 3JVSA 3OT3A 4I93A 5KUPA 3C4ZA 3DKFA 2R5TA 4O6EA 3SAYA 3VW8A 4RZVA 1BKXA 4LL5A 3TV4A 3W1FA 2GQGA 4KBAA 4JOAA 1STCE 5DT3A 4X2NA 5IMXA 2C5XA 1V0PA 2WTDA 3O96A 2IVSA 3SG8A 4V01A 2HWPA 4YJPA 2EB3A 3HV3A 3PPKA 2X4FA 3NUSA 4TWOA 2ITNA 2J0LA 3MSSA 4E7WA 4O7LA 3IW8A 3NLBA 5AR2A 5IQFA 3B8QA 3IKAA 4PL5A 3V01A 3A4OX 4CZTA 4I5PA 3UPZA 1TQPA 3Q9ZA 5JZNA 4ZTNA 4UWCA 3DK7A 4FKIA 4LMNA 1UKHA 3QQJA 5FEEA 3T3VA 3RK9A 3ZC6A 3POOA 2OKRA 4X2JA 4O0YA 2JKQA 4OGRA 2X2LA 3GGFA 3UVPA 5E8WA 3NNVA 5J1WA 5J9LA 1PY5A 4GVJA 2VO3A 3KMMA 2ITYA 4C59A 5AAEA 1Y8YA 1KV2A 2WGJA 2X4ZA 5LVOA 2F57A 3EL8A 4MWHA 5FWKK 1WFCA 1LUFA 5IA3A 2Z02A 4DFXE 2Z2WA 1FMKA 3EH9A 3MVMA 5DH3A 3SX9A 4P4CA 2WIHA 2QG7A 4I4EA 5CI7A 4C4FA 3G33A 3E8CA 1FVTA 3KRRA 3ENMA 3A7JA 5IQDA 1UA2A 3DQXA 1BL6A 3W10A 2CKEA 4XRLA 1H08A 3NUYA 3O17A 4FX3A 4YHTA 4D2TA 4JNWA 3SXSA 4BIEA 4BWXA 5JEBA 3U55A 4PV0A 3D14A 3HP2A 4NJDA 4XG3A 4BY9E 1KV1A 2Z7SA 4QMZA 4DGLC 3RINA 3GCQA 2YIXA 2QKWB 3BHUA 1MRYA 5EYCA 3EWHA 4QP2A 5EG3A 1DAWA 3LZBA 4AA4A 5CASA 3MH3A 1O6LA 4NT4A 5H9BA 2CN5A 2WNTA 4UALA 4ZP5A 3PLSA 5FEQA 2XEYA 2QR8A 1YDTE 2XEZA 4W8EA 1Q3WA 4G6NA 2R3NA 2UVXA 4APPA 3D2KA 1PXMA 3EQBA 4EH6A 2OJGA 4H05A 3MN3A 4FTOA 4YUQA 2QONA 4XH6A 3AT3A 3ODZX 4R5YA 4XG4A 4E4MA 5CSVA 3FMLA 5C01A 2V0DA 3I0OA 3C50A 5TT7A 1G3NA 5IA0A 2FUMA 4AOJA 3EB0A 3S3IA 2HW6A 4FZDB 3R28A 4BDJA 2JDOA 4IJ9A 5A4LA 4C4IA 1ZYSA 2E9NA 3ORMA 4EK3A 4R77A 4O7ZA 5AP1A 3BE9A 4EBWA 2YIQA 3ERKA 4LGGA 5A4EA 1FINA 4JDHA 2DWBA 4BCFA 3TV7A 3KVXA 5C03A 3U8WA 3ZHPC 3TNIA 3QALE 2EXCX 3BZ3A 1R0PA 3GC8A 3GEQA 3PXQA 5C26A 4DFUA 3OUKA 3OZ6A 4L43A 4Y5HA 2BZIB 4QQTA 2XS0A 4NL0A 4YC6A 3CGFA 2RGPA 3POZA 5A4CA 3PDTA 4L00A 4M13A 3HVCA 3QLGA 3EFWA 1R78A 5GNKA 4G3GA 2XIXA 4C4GA 4F7SA 4FTIA 3D83A 4YC8A 5CXHA 3G6HA 1PMEA 4P2KA 5EHOA 3ZZEA 2JKMA 3C0IA 3R7YA 4PDPA 3E3PA 2EB2A 4F64A 5DRDA 3OCGA 4R3PA 5CEPA 4KA3A 1CMKE 4C38A 1YI4A 2FSLX 4MKCA 3A62A 3ZMMA 2OJ9A 2REIA 2ETMA 2RG6A 4H36A 2BRGA 2JIIA 2VTAA 3D94A 3HMOA 4IB3A 4MXOA 4J1RA 3RK5A 3K5UA 3RZBA 5CVHA 5FUTA 5GJFA 3N51A 2XIYA 4P7EA 4F7LA 4PTEA 1W0XC 3R21A 3ZC5A 4Y46A 5DEWA 5JRSA 4MYGA 3RPVA 3F2AA 1GIJA 3UJGA 4ASXA 3HP5A 4RQKA 3VUHA 3SRVA 3CCNA 4RA4A 4FV8A 4RLKA 4XG6A 1JKTA 2PVRA 4Z55A 4TNDA 2CGUA 5KKRB 3M11A 1VYZA 2C0OA 3DOGA 4XV2A 2XNEA 5BVEA 5EQPA 1YKRA 4IC7A 3UNZA 4FOCA 3TDWA 4JL9A 4ANLA 2C3LA 3O8TA 4E6CA 2PY3A 1F5QA 3NMUF 4GCJA 4O0UA 3QRJA 5CSWA 3Q9YA 4I1ZA 3EQIA 4BTMA 4MXXA 2R3OA 4JRNA 2PU8A 5IF1A 3O71A 3VS5A 3F69A 3PSDA 3HAVA 4ENXA 3F2NA 2CGVA 4I22A 2XRUA 3U9CA 5EKOA 5FBNC 5HLNA 3VS3A 1LPUA 4CNHA 5IA4A 3IDCA 2HXLA 2PE0A 5GZAA 1ZWSA 3AD5A 3FY0A 2HENA 1GIIA 4MF0A 3PYYA 4A06A 4JG6A 4GSBA 3R2YA 4CKRA 1VYWA 4IW0A 4WSQA 4BCJA 2IW6A 2JKOA 3GCPA 1H1RA 4F9AA 4RGJA 4OBPA 2B1PA 2IW8A 3L9PA 3MPAA 4EI4A 3FZSA 2QHMA 2IVUA 1OIUA 4RG0A 2ZOQA 4FICA 4I4FA 2PZIA 1MRUA 4X2GA 2FSTX 5KBQA 1ZYLA 5EM6A 5DLSA 4FGRA 3FL4A 3EQDA 3A99A 3H3CA 3HRBA 2QOBA 4FK3A 4Z3VA 2R0UA 5CEMA 3R7UA 1Q62A 3R1QA 3MB6A 4WT6A 4YZBA 5LCJA 4B8MA 3VUDA 5EI2A 2QO7A 1FQ1B 3ORPA 4IDTA 4FYOA 4BDBA 3DFCB 3P79A 4D55A 1RE8A 4PDYA 4BR3A 2PUPA 2YM4A 4EOLA 4EEVA 2PMNX 4FVQA 1IR3A 4YNOA 4WRSA 5DR6A 3O7LD 5HNGA 3F3VA 3CKXA 4K2RA 5FRIA 3QRKA 4RC3A 3RPSA 3I5ZA 3FI2A 3TG1A 5CAPA 4ALUA 2WQNA 3NUXA 4GVAA 5CZHA 5IEVA 3B8RA 1JQHA 2SRCA 3VS1A 3C9WA 3D9VA 4F0IA 4EYMA 3CR0A 3G2FA 1M2QA 3KRXA 1CKIA 4LM5A 4ANBA 3FMHA 5HO6A 3MDYA 3PA4A 5IISA 4BCMA 5DE2A 1OKWA 2IVVA 2YDJA 3F6XA 4ZLYA 4OT5A 4QMQA 2J0IA 5HX6A 3MH0A 3B2TA 3ZTXA 3ZONA 4EOKA 2JIUA 3PJ8A 4BGHA 4YMJA 3IW6A 4RC4A 4W4VA 5JZJA 3UQCA 2J51A 1TQMA 4L8MA 5E1EA 4ANSA 4BICA 3WF6A 4A4LA 2YFXA 2ZV9A 3WOWA 3V5LA 3PFQA 2PMLX 3EL7A 3P86A 4KWPA 4DBNA 4EKLA 3DAKA 5LMBA 3HYHA 4E1ZA 3BLRA 3C0GA 2PUNA 1PXOA 4IEBA 5M57A 2W9FB 4XV9A 2VTTA 3OHTA 4I41A 4BCIA 2OIBA 3PIYA 4L46A 5EK7A 1ZYJA 5EW9A 5HCYA 5TKDA 2VTSA 1OZ1A 3HKOA 4DTBA 2B4SB 2BILB 5DYJA 3PVUA 4EL9A 4E6DA 4M7IA 3AD6A 3QXPA 2YAKA 4CTCA 4DH1A 5C1QB 2YZAA 3OXIA 5C8KA 3CJGA 2GNLA 1OKYA 5E8ZA 3HLLA 5IQCA 3Q4UA 3ETAA 4FKRA 2JDVA 4DEBA 3RBWA 4MNEA 4TYHB 4I5HA 3R7OA 2WMSA 1YHSA 1YVJA 2QLUA 5BUJA 5BVKA 4FV2A 4QMNA 3FMMA 4ITIA 2ITUA 4RJ8A 3MJ1A 4U0IA 1KE6A 2DUVA 3FXWA 3I4BA 3PZEA 3R63A 1J1CA 2YWPA 3ZBXA 4WO5A 4GUBA 4IAFA 4LOOA 3UMWA 2W1HA 2EU9A 4G16A 4ACMA 3QCSA 4F6UA 4F63A 4RVTA 3SVVA 4JR7A 4BDIA 3PXFA 2WELA 3M1SA 5F95A 4TN6A 3CTJA 2B53A 5JMSA 3VS2A 2X9EA 3VHKA 2CJMA 3DB8A 4AG8A 5EQYA 4H58A 5HG8A 2QURA 5I5ZA 1KE9A 5M51A 4EJ7A 3IDBA 5EM8A 1XBAA 4WRGA 4BCQA 5I9WA 4CMTA 2VTNA 3CJFA 4MXYA 4RX5A 4UMUA 5LVNA 2R3JA 1YDSE 2VNYA 3UNKA 2CCIA 2UZOA 3PG3A 4GFOA 4YSJA 4XLIA 5JH6A 2JDTA 4BCPA 4L68A 4QQCA 5L4QA 2FO0A 3PXYA 1Q61A 2LAVA 3CGOA 3NIEA 3CQWA 4QTAA 3QCQA 2NRUA 4AUAA 1NVQA 3FXXA 2HZ0A 1PHKA 4ZLZA 5J5TA 2XKDA 3FLWA 5HG9A 4ZIMA 3R6XA 2W5BA 3UP2A 1T46A 4OTWA 4TL0A 4DTAA 3NW6A 4IX4A 4ERWA 2RF9A 4PRJA 1IASA 2WEIA 4RJ3A 4GK4A 2UZBA 4FKGA 2VV9A 2W1ZA 4ASZA 3ZDUA 4AW5A 4CQGA 4XOYA 4YSMA 3ZFMA 1PKGA 5CLPA 4DGNA 1SVGA 3UTOA 5ANDA 3C5IA 3LLAA 4FSNA 5ETIA 4BDAA 2OGVA 1GZKA 3WYYA 3L8SA 5DRBA 3EFLA 4IMYA 4ZTSA 1OL5A 2UVZA 4IM2A 2OZAB 2PZ5A 4EK4A 2GFCA 2X8DA 3TT0A 1CTPE 4FKSA 4L52A 1F0QA 3TNHA 4EOPA 2PSQA 4DGMA 2F49A 1WVXA 3BWJA 2HZIA 5ANOA 3TZ9A 1U4DA 1PXNA 4CGAA 4RVLA 2BZJA 2RFDA 2WOUA 3HUCA 3R1SA 5DR2A 3F61A 3WZUA 4FV9A 3Q04A 5FG8A 2JBPA 3QBNA 4BTJA 4M0YA 4F70A 4DEEA 4LUDA 2VWIA 4KSPA 4O6LA 3FE3A 2X8EA 1IRKA 4Z9LA 4DFZE 1OUKA 2JDRA 4L45A 2C69A 4BB4A 2XM9A 3O0GA 4WHZA 4K11A 2QD9A 4LG4A 3VAPA 5D7AA 4YZDA 2P2IA 2OSCA 1XQZA 1W82A 2PVJA 5LWMA 4KUJA 5L2QA 4YPSA 4G3DA 5HU3A 5T6KA 4X2FA 4M0ZA 5HO8A 2A4LA 4QMTA 4F7JA 3R1YA 2WQEA 3JXWA 3QD2B 5DOSA 2QNJA 3FMNA 3JY0A 4GRBA 4KBKA 5A6OA 5B2LA 3T9TA 3AC1A 4PPBA 3BU3A 5JT2A 3HMIA 2B54A 4AE9A 2PVYA 2PVKA 3ZZWA 3OY1A 4D9TA 2I0VA 3BHHA 4IX3A 2QI8A 4PTGA 4KBCA 4C2VA 4EWQA 2J4ZA 4WNOA 4GJ2A 4PNIA 2X2MA 2R0IA 1SNXA 2CLQA 3GU7A 4BZOA 3SRVB 4F9CA 4JDIA 1YI3A 5HCXA 4EHVA 4BKYA 2E9VA 2PZYA 2PMIA 3DDPA 2HZ4A 3ODYX 1ZYDA 1M2PA 3DA6A 3TKIA 2YLEA 3B2WA 4BYJA 3S00A 2BVAA 3DKOA 5F94A 4FT3A 4EK6A 4CFNA 4UX9A 4BDCA 3TN8A 4RA5A 2XNOA 2A2AA 4C36A 2ZVAA 3QCYA 4FIEA 1ZOEA 4O0VA 4QRCA 5CEOA 4LI5A 4NM5A 1RDQE 1Q8YA 1WCCA 3FYKX 3PJ1A 3UMXA 2GNIA 5J7HA 4MD7E 4YO6A 3LFFA 4AF3A 2CDZA 4OTPA 4UMPA 4BBMA 5LWNA 4ZTLA 4BDHA 3KY2A 4PUZA 1P14A 2PK9A 3ORIA 3QAME 4QMLA 4XLVA 4YJUA 2YZLA 3COMA 2R3FA 4IVDA 3IOKA 4EUTA 2C4GA 2UVYA 1H26A 3QQUA 3QUEA 3R8ZA 3I79A 3KVWA 4GW8A 4U6RA 4JQ7A 3LJ0A 4O0RA 5FLFA 4RIYA 5D11A 4BF2A 5AV3A 4I5CA 5C8NA 5CEKA 3PRFA 5E92A 4RQVA 5AA9A 4KABA 3BYOA 3GOKA 2ITOA 3FKLA 4M69B 4L3PA 3CPBA 3P23A 4WNPA 4ACCA 5HIDA 2CPKE 2OFVA 2YLFA 3W55A 5DN3A 5CAVA 5CU0A 3S2PA 4DLJA 4UY9A 2RG5A 1UKIA 3FLNC 3KULA 1PXLA 4XOZA 4FTQA 4QYEA 5D12A 5HE2A 3RAWA 3ZLSA 4FIHA 3RPYA 3Q32A 4MEDA 1PW2A 2F9GA 1UNGA 3PJ2A 5IH5A 5FM2A 3P7CA 2QG5A 5LVLA 3NCGA 2BRNA 2B7AA 4EH4A 4F9BA 3OW3A 4E4XA 3PLAE 2UW3A 2PE1A 4M67A 3Q9WA 2GNFA 4NW5A 3CEKA 3LCDA 2YJSA 4GKHA 3S1HA 1YXVA 5ICPA 2WPAA 3P08A 5T68A 5BNJA 1O9UA 3TUCA 1YWRA 4BN1A 2A0CX 3HDMA 4BDDA 4IM3A 4O0SA 3F3WA 4HNIA 1CKJA 4I0RA 5EI8A 2YM8A 3MI9A 4IJPA 4J98A 3FLQA 4QMYA 4TWNA 4BYIA 2R9SA 5KCVA 3PJCA 3UOLA 3OWJA 4FOBA 2W05A 3G0EA 5ETCA 4G5JA 5AX3A 4TTHB 1PYXA 3GT8A 2WXVA 4R8QA 4K0YA 4C62A 5DNRA 5HQ0A 5KKRC 4USFA 4AZVA 4FKPA 1XH6A 4GMYA 3BV2A 3MPTA 4DFYA 5JK3A 3WE4A 4I92A 3SOCA 5KMIA 3Q53A 5A6NA 3EOCA 4AWIA 2RIOA 3CD3A 3Q5ZA 2XP2A 4D2VA 1H28A 1QPDA 3UO4A 4FT0A 1NA7A 4IZAA 3TJDA 4QMPA 5EH0A 3FKNA 4JQEA 3QX4A 4GV1A 4L42A 5KO1A 5HLWA 3LMHA 1WMKA 4N6ZA 4AW0A 3ATSA 2UV2A 3G5DA 1PMUA 3AT2A 4JDJA 4MXCA 1FMOE 3CIKA 4EOIA 3V8TA 4HGLA 4OLIA 2C6KA 3ITZA 1TQIA 4X2KA 2CN8A 5HOAA 3ZO2A 4E73A 4W9WA 3N4TA 2Y7JA 2GTNA 3NEWA 1ZY4A 4FV7A 4FUXA 4AP7A 4N4SA 4NCTC 1XBBA 3UIMA 4JIAA 2JAVA 3QKMA 4AX8A 4E6AA 3DZOA 1H1SA 5KMOA 4KIKB 2W1CA 2R64A 4F1TA 4C3RA 3NYXA 3QTRA 5LARA 3C4XA 4DEHA 3BQCA 3Q5IA 3UZTA 5EYKA 1WBPA 4PMPA 3SG9A 3I0QA 1OL1A 2PTKA 3G0FA 5FXRA 2PMOX 5AUVA 4IZ7A 3WZJA 5BYZA 2WHBA 4MNEB 1SVEA 5IQEA 2BPMA 3AQVA 3R8VA 4FC0A 3RWPA 2VTHA 4HVIA 3RHKA 1U5RA 4NFNA 5IUIA 2YM7A 4ZSLA 5HHWA 4YURA 1TKIA 1KOBA 4BBFA 4IIRA 3SA0A 3QQFA 4JBVA 4OTGA 3VVHA 2WMBA 1B39A 3FI4A 1P5EA 3KK9A 3G15A 3LHJA 2XB7A 3NYVA 5HG5A 3IK3A 4FKTA 2C6OA 2WOTA 2W5HA 1A06A 4TWPA 1H1PA 3DKGA 5CS6A 4YPDA 2C68A 4R1YA 2XNBA 2C1BA 4MCVA 4XG7A 1PMVA 3H9FA 1XH8A 3TZ8A 4CCUA 5TOZA 4L3LA 4YTFA 4O83A 1Q5KA 4UZDA 5FP6A 2OJIA 2R3MA 3HUBA 3KQ7A 4FYNA 2XUUA 4L7SA 4HNFA 2C3JA 2FA2A 2HAKA 3KFAA 4GT3A 1UU7A 2C5OA 2WD1A 3DK3A 3E7OA 4WUNA 2C5YA 2IZUA 4QYGA 2C0TA 1NY3A 4CVAA 3CD8A 3DDQA 4MK0A 1V0BA 3VBXA 1PXIA 1H0WA 4AOIA 2UW8A 2JFLA 3EFJA 4M3QA 2QR7A 3D7TB 3BYUA 5AAGA 4AU8A 2YCSA 3E87A 4FSZA 1Q3DA 3JR1A 5A4QA 4DINA 2CKOA 4IX6A 3OUNB 3I7BA 4RWLA 5E90A 4BDGA 4RWKA 2RKUA 2KULA 4K18A 4MD8E 2NPQA 4H3PA 3FHRA 3KMUA 4JAIA 1Z9XA 3Q4CA 1OBGA 1LEWA 2W1FA 4FKWA 2A1AB 2VTPA 3PSCA 1X8BA 2JBOA 2PWLA 4FIGA 4IAZA 5AR4A 1OM1A 2UZDA 2PZRA 1LR4A 4K1BA 3VW6A 3SQQA 5FDXA 4C3FA 3TXOA 1PJKA 3SHEA 3BE2A 3GCVA 4WNMA 1OITA 4HOKA 4MBLA 2OXYA 4K8AA 3NZ0A 4YU2A 5DPVA 3R01A 2OBJA 4XNEA 2ZJWA 3D15A 2P4IA 2G15A 4M15A 5CX9A 3GP0A 1ZYCA 4IAKA 3ORXA 1YW2A 4TYHA 3R8MA 3MW1A 4NEUA 2BCJA 5E1SA 5E8YA 3EFKA 4ITJA 5B2MA 5L8LA 2BAJA 3ZXZA 4CRLA 3OEFX 4RSSA 3VO3A 3I6UA 3DGKA 5HVYA 1GIHA 1O6YA 3OTUA 4V05A 3IONA 3FZ1A 4FZFB 4MF1A 2YM5A 5LJJA 4L7FA 5FTQA 3FC1X 4F7NA 1XHAA 1OB3A 1Q24A 3CKWA 3D0EA 3BU6A 2VWWA 4FSRA 3LKMA 2O8YA 2CGWA 2VTJA 2AUHA 3AGLA 5FM3A 2YHVA 2R2PA 3FUPA 4JXFA 3C4FA 1PKDA 1BX6A 3BCEA 1R0EA 1YOJA 5AP7A 5CEQA 4CQEA 5L6WL 2WTJA 3ANRA 3FZOA 3R02A 4PDSA 2O65A 1OL2A 3NAXA 4R7HA 1YHVA 3U4UA 2X9FA 3KU2A 2OU7A 5M06A 2ERZE 1YXUA 2WAJA 1SZMA 4RJ5A 4HCUA 4RT7A 3UPXA 3KB7A 4BZNA 5BQ0A 3GI3A 5BVNA 3NGAA 5I0BA 4O27B 1JBPE 4GIIA 4BGGA 4FV4A 1LP4A 2BAKA 3FZRA 2BROA 3G90X 5EYDA 1AQ1A 5KZ0A 5IA2A 2BAQA 3VWAA 4CT1A 3NYNA 2UW5A 2X8IA 3OS3A 4IZ5A 4EC8A 2J0MB 4CKJA 4D2WA 4N57A 2H8HA 4GK2A 4EH7A 2BDJA 3LPBA 4UYAA 1OVEA 5DBXA 3W32A 5ITAA 1XWSA 3PXRA 3RM7A 2V7OA 4DT8A 4L3JA 3PVGA 3L9NA 4I20A 4A4XA 4CFXA 4XV1A 3V3VA 4IFGA 3MV5A 3NDMA 1J1BA 4FNWA 4IB0A 5FGKA 3TNPC 3MFRA 3OY3A 4PMSA 4L53A 4JVGA 4EZ7A 4YC3A 4CV8A 5AUYA 2OZAA 3OTVA 3UIBA 3ZFXA 3V5PA 4YZNA 2C6MA 3OMVA 1IA8A 2VZ6A 3NAYA 2OFUA 1H1WA 4X6RA 3VBYA 1FGIA 2BKZA 3GU5A 2OO8X 5CF4A 3AD4A 4RBLA 4C7TA 1ZMUA 2P55A 2WMAA 5AR5A 3A4PA 5L6PA 3GBZA 3HV6A 2RSVA 3UG2A 4AN9A 5HU9A 3MA3A 4W9XA 5DEYA 3HAMA 3BYMA 3QL8A 1XO2B 4LRKA 5JGBA 3SOAA 3VN9A 5AA8A 3MWUA 5J95A 4ZY6A 3TZ7A 1Y57A 4ARKA 3UVQA 2EVAA 3HL7A 4RIYB 2OF4A 3DXQA 2WU6A 3MY5A 1FOTA 4B9DA 4MHAA 5D9HA 3FPQA 2CMWA 3TNQB 4O22A 3JPVA 5AIKA 4ZTQA 4DYMA 1BUHA 2PVFA 3U4WA 5CF8A 5G6VA 2IW9A 4KS7A 1UU3A 3RPRA 1H27A 2G01A 4FBXA 5HD7A 3FLSA 4JIKA 5KMMA 4BCNA 4FA2A 4KIQA 3LFSA 3NS9A 3KULB 2I7QA 5ETAA 3FMJA 4R6VA 4IFCA 5G1XA 3R7VA 4YR8A 2XK7A 4ZZNA 2J2IB 2ZMCA 5DVRA 3NW7A 2HY0A 3D7ZA 5EM7A 4FEWA 2C30A 4P5ZA 5B0XA 5GZ8A 4QOXA 4YTCA 5IUHA 3F2RA 3SW7A 5EW3A 4CRSA 2A27A 3QTUA 4GFMA 4N70A 2W4OA 1MP8A 2VUWA 4S2ZA 4X0MA 5FXQA 5JGAA 1OL7A 2YCRA 5AUXA 2X81A 2WO6A 4JX3A 5I9XA 4TKSA 2VX1A 1JAMA 4RVKA 1APME 5TR6A 4U9AA 4RVMA 4DAWA 3K5VA 4L6QA 4AGDA 1K9AA 1OKVA 3MTFA 2F2CB 4RWIA 4QTCA 4V04A 5DGZA 2B9HA 3ZS5A 2PPQA 5CEIA 3ATTA 3PVWA 4A9RA 5IQBA 4C0TA 3TTIA 3Q6WA 2V62A 4IWQA 3THBA 3UOKA 5AADA 1Y91A 3E7VA 2H96A 4K6ZA 3UVRA 4DFNA 4Y85A 1U54A 3KXXA 3NUPA 4H1JA 1Q41A 4FEQA 1A9UA 2O0UA 4FZ6A 2HWOA 4RX9A 5LMKA 3FDNA 3W2OA 4DCAA 1ZZ2A 3BGPA 4FV3A 3C7QA 5AUUA 4M84A 2WEVA 3JYAA 4KD1A 3PZHA 2YCFA 3Q2MA 2CSNA 2F7EE 2O3PA 3JS2A 4QTEA 5M09A 5LMKC 4FTUA 4FTNA 4PPCA 4ANOA 4WG3A 4QPAA 1GZOA 3BGQA 5EI6A 4L9IA 1PRYA 5L3AA 3D2IA 4DGGA 3E62A 4GJ3A 4B6LA 4USDA 1ERKA 1OKZA 2B55A 4BWKA 4M69A 1E1VA 3HA6A 2EXEA 2IVTA 2C6IA 3QX2A 3KXZA 4QD6A 2YM6A 1H0VA 4G3EA 4TPTA 2Y9QA 3C13A 4F65A 2Q83A 5M4FA 1ZOHA 4NWMA 4FIIA 1BLXA 3UYSA 3VULA 4D0XA 3R1NA 4K33A 4DH3A 2PVMA 3NPCA 4E5WA 1FVRA 3QHWA 1YDRE 4FTLA 3SDJA 4BCGA 3WI6A 4WIHA 4A4OA 3FMKA 1H01A 1DS5A 3OEZA 4U41A 1XH4A 3PSBA 3VQUA 3Q52A 5HESA 1QPEA 3GC9A 4CFVA 5ACBC 3OWPA 5AM6A 2VWVA 3BI6A 4ONAA 1JSUA 3BPRA 2Z8CA 3QZGA 4HVGA 3ZEWA 4FV5A 3HMNA 2V5QA 3O8UA 3ZXTA 5BUIA 4AW2A 4NSTA 1BMKA 4AT5A 2RFSA 3QFVA 4BIDA 4N6YA 4NTSA 3KC3A 3DJ7A 2XH5A 4RIWA 3DXPA 4CKIA 3BLQA 4U44A 2CNUA 3VUMA 5CWZA 5KHXA 5AFVA 4ASDA 2C5NA 3ZRKA 3ZM4A 2BRMA 1Q97A 3FBVA 4LOQA 5E8VA 1SNUA 4KKEA 2GQRA 4A7CA 3KCKA 3SKCA 5CAOA 5E91A 4J96A 1H24A 3BWFA 4QMUA 3U87A 4E5AX 4IH8A 2Y6OA 3DJ5A 4J97A 4FTTA 4ZEGA 2R3IA 3VRYA 4AOTA 2GTMA 3U51A 4J7BA 4FTAA 2HELA 4EORA 2C6TA 4YJSA 1J7UA 3VS0A 3O51A 4FIFA 2GSFA 4UMQA 1H00A 3PY3A 3FWQA 5HTCA 5IMEA 4IACA 3QTIA 3ACKA 3OD6X 2WTWA 4GYIA 3AC4A 3SD0A 3ET7A 3HNGA 5DA3A 5TF9A 2X0GA 2BZKB 4KIKA 1Q8UA 4XP0A 5GJGA 4AZSA 4ZSJA 3QD0A 3QZHA 3ROYA 1K3AA 1YOMA 3E93A 5HVJA 3FL5A 4O7TA 2YCQA 2XK3A 3MPMA 4KAOA 1U59A 4Q5HA 2VTLA 3AC2A 2OWBA 3HV4A 4JT3A 3TEIA 5AJQA 3MBLA 4KIOA 2W4JA 5AV0A 3WIKA 4D4VA 4EOQA 1KSWA 5BVDA 3VUKA 5AP3A 3LXNA 3LJ1A 2PUIA 4LMUA 3R2BA 5TE0A 4HCTA 4WBOA 1WBOA 5IQAA 3OWKA 3BX5A 3LAUA 3KMWA 3A7HA 4M12A 3V5JA 4CXAA 3EQRA 4IM0A 5JGDA 3UOHA 3ORLA 3BELA 4EWHA 5JFSA 3GQLA 1KE7A 2BRHA 3DQWA 5J87A 5IZFA 2R3RA 2VWYA 4AFJA 3RNYA 3LM0A 1R39A 4X3FC 4FR4A 4RPVA 4NIFB 3TKUA 4EJNA 5HD4A 4GG5A 3QQKA 3ZRLA 5GINE 2I6LA 2XRWA 2BIKB 4HZRA 1UVRA 3BEGA 4FSWA 3LOKA 4RFZA 3P78A 2IG7A 4HYHA 3OCTA 3DLZA 2QOCA 2BALA 4TRLA 3VQHA 2YJRA 3KXGA 5AM7A 3OP5A 1ND4A 2PULA 2F4JA 3F88A 5JFVA 4FG8A 2G1TA 2QLQA 5KMKA 3AC8A 4RFMA 4U97A 4A9TA 1BI8A 3QRUA 4QP8A 2XJ2A 4YJNA 3RJCA 4FEVA 4FKQA 1IEPA 4H39A 4R1VA 4ALWA 4TWCA 4DLIA 3V6RA 3FLZA 4IHPA 4HYIA 2AYPA 2VNWA 2Y8OA 4WSYA 4D4YA 3UC3A 4KB8A 2VTQA 2VO7A 5LMAA 3WF7A 1L3RE 2IZTA 3QF9A 3QGYA 4II5A 1M17A 4O0WA 3D7TA 3HRCA 3L1SA 4QMSA 5CT0A 5H8BA 3GENA 3KKVA 4H3QA 1P2AA 4MBJA 4NH1A 4YLKA 5AWMA 2ZB0A 4EOMA 2UZTA 4NKAA 5DFPA 3BV3A 1CM8A 3RM6A 3VBWA 3H0YA 4HGTA 1HCKA 2OXDA 4QMWA 5I9YA 3GU4A 4G34A 4JBOA 4TNBA 1MQBA 3LFQA 4IANA 3V6SA 2UZWE 5A9UA 3COIA 3Q2JA 5AUWA 4DGOA 1G8AA 3QCXA 1KE5A 1P4OA 1RW8A 4FF8A 4HVSA 2WMXA 4BIBA 1WVYA 4CCBA 4QP6A 3WZDA 3ORKA 4D5KA 4PNKA 2GS2A 2ETRA 2NP8A 3Q96A 3ULIA 4ZMFA 5CXZA 5K3YA 1H8FA 4BDKA 3QWJA 3LCSA 4BTFA 1MUOA 1ZMVA 4CMOA 1M7NA 2ACXA 4GIHA 4PDOA 5KZIA 4APCA 4DN5A 2ESMA 2C1AA 2B52A 3E8EA 3MA6A 2XCKA 4JR3A 3Q6UA 4LYNA 3BBWA 3DB6A 3DXNA 3FQHA 4XG8A 5FEDA 1KWPA 5LVPA 2XNMA 1AGWA 3OVVA 4H1MA 4EK8A 3BQRA 2AC5A 3DTCA 4G3FA 2BZHB 4YJVA 2V55A 1ZXEA 4C35A 3HMMA 4CTBA 4ZSAA 2OLCA 2RFEA 3F3UA 5EYMA 3UIUA 4FODA 3A8XA 4IAYA 2QOIA 3EIDA 2XK9A 2W1EA 3T9IA 3QTXA 3ANQA 3ZLXA 4OTDA 1VJYA 4U79A 4XX9A 2C3IB 2UUEA 3H4JA 3KCFA 2R7IA 4FG9A 4PP9A 5EDRA 4YLLA 3UP7A 2UZLA 3HV7A 4MXZA 4J53A 3I7CA 4KKHA 3JUHA 3QLFA 5IA5A 4LFIA 1IA9A 2O5KA 4F9WA 3WZKA 3QYWA 5AIRA 4O7SA 3P1AA 2BTRA 3A7FA 4IWDA 4F08A 3KF7A 2YIWA 4GEOA 5J9ZA 4UZHA 1Y8GA 3WYXA 2NNWB 2YIYA 3KRWA 5CF6A 4EOJA 4UN0C 4RJ7A 4BGQA 2BRBA 2HCKA 2OJJA 4PL3A 5H3QA 2GHLA 3W2RA 5E4HA 3OOMA 4QQ5A 3DBQA 4IWOA 2HYYA 4IB1A 4U40A 3RGFA 4AZFA 2BHEA 4ZTMA 3TNWA 4O91A 3RNIA 4ZTRA 3OC1A 5CF5A 3AOXA 4Y73A 5J9YA 5K0KA 3RCDA 4YLJA 3DZQA 2UZNA 3HGKA 4I5MA 5I9VA 4XV3A 4DTKA 1S9JA 2YM3A 1WBNA 1Q8WA 3LQ8A 3DBFA 2W4KA 3A7GA 4DA5A 3ZEPA 3ID6C 4F1OA 3W2PA 3W18A 4ACHA 3FEGA 1OPLA 3I60A 3W33A 2GFSA 3ZO4A 3NUAA 4O82A 4Y83A 1U54B 1GOLA 4F99A 5GIOE 3ALOA 4D2PA 5BX0A 4D2RA 3R73A 5E9EA 5HLPA 1H07A 3PG1A 2WB8A 2XZSA 5JRQA 4EH2A 1JPAA 5FBOA 1Q8ZA 3QQGA 4JDKA 3V5QA 2X6DA 4O7YA 4FI1A 2G2IA 3VRZA 1B38A 4O38A 4C58A 2GNJA 2XA4A 3GU8A 1ZOGA 5CU6A 4CG8A 1WBWA 3EN6A 4O0XA 3S95A 1W83A 2BDWA 3UE4A 4ZAUA 2OICA 4C8BA 1V1KA 5AV2A 3TJCA 4FKUA 2YITA 5AR8A 3R30A 1UWHA 2VTRA 2OJFE 3R8PA 2CKPA 3NVMB 5ANGA 2WQMA 3UNJA 3OROA 4IB5A 4IVBA 5AR7A 1XR1A 2G2HA 3ULZA 2WQBA 5ANKA 4FIJA 5JQ8A 2Y6MA 2R3KA 3OXTA 3GXLA 5A14A 1L8TA 3ZOSA 2FYSA 4C33A 3SXRA 3TUBA 3ORZA 3NWWA 3RVGA 3ZO1A 2GNGA 3IGOA 4O1PA 4U5JA 1W98A 4DC2A 2PHKA 3CTHA 1E9HA 1H4LA 5H8EA 2W1IA 4GYGA 2F7ZE 3LIJA 1SMHA 4R7IA 3WILA 5CAUA 1KOAA 4EUUA 4NM7A 2UW9A 2IPXA 3VS4A 4FTRA 4JX7A 4TZRA 4QO9A 4QQJA 2O64A 4EK5A 3OCBA 3TDVA 5DHJA 4BDFA 5M4UA 4QMOA 5FP5A 5HE3A 3F3TA 4RIWB 3QTZA 4CZYB 4DH7A 3QUDA 4FSQA 4MWIA 4WD5A 4KKGA 3N4VA 3MB7A 3GCSA 3MJ2A 5DT0A 4AAAA 3ZYAA 4RX8A 3KN6A 3LW0A 4TYIA 4I6QA 3TACA 3PA3A 3R71A 3UIXA 4ZY4A 5HIEA 3F9NA 4CLJA 4ACDA 4F4PA 5A54A 4QP4A 4LQMA 4XP3A 3IPHA 3IECA 3IW4A 3ZLWA 1ATPE 3TZMA 5K5XA 4O81A 1UU9A 3R7GA 3QD4A 5EOLA 4KS8A 1OI9A 2X2KA 2QO2A 3FMEA 4YHFA 3KEXA 4MQ1A 3ALNA 3I1AA 4NCTA 1RJBA 1DM2A 4I23A 4AZWA 3BGZA 5HNIX 3KL8A 2Q0BA 1O6KA 4NZWB 2YACA 1FGKA 3EZVA 4I3ZA 3PXZA 4ZS0A 5CQUA 5IG1A 4D5HA 2VAGA 5CENA 4ZSEA 4V0GB 1NXKA 4QYHA 2C0IA 4XG2A 2OG8A 3MH1A 4W4YA 2ITXA 2YISA 3KXNA 1DI8A 1VR2A 1U5QA 2VWXA 5KHWA 3FC2A 4Y5QA 5J7BA 4R3RA 4W4XA 5CU3A 4HVDA 5DMZA 3QYZA 1OIQA 1REJA 2YIRA 4GK3A 4IC8A 2H6DA 4YHJA 4UMRA 4U8ZA 3KREA 1OPKA 1URWA 3F3ZA 4FNZA 4EH9A 2F7XE 4TYGA 4J8NA 3E64A 4X3FB 1U46A 4E6QA 4CV9A 3F7ZA 4GS6A 5ETFA 2JC6A 2RFNA 4D58A 3BHTA 3BIZA 2WTKC 3R00A 4GT4A 4BBEA 3H10A 4EC9A 1LEZA 1J3HA 2C3KA 2XYUA 5FDPA 4MVFA 4QYFA 3RCJA 2R3GA 4S33A 5D1JA 4BZDA 3ZRMA 1WAKA 3GUBA 3LCTA 4DG2E 5CNNA 2IWIA 4EYJA 3ACJA 3Q60A 4UWYA 3A7IA 4YZ9A 3TIZA 3V5WA 2IJMA 5CU2A 3QTWA 2BKKA 4J52A 2W9ZB 2V7AA 4O86A 4O2ZA 4BVUA 4D1XA 3LXKA 4YJTA 1M52A 1FBNA 2HZNA 3AXWA 2KTYA 4EHEA 5F1ZA 4AN2A 4XP2A 2LGCA 2Z60A 4USEA 2C6EA 2AC3A 5KMLA 4LRJA 5JFWA 3RTPA 4FT7A 4QPSA 4CYIA 2XJ0A 2DS1A 4RIOA 1GY3A 3F7WA 3K3IA 3I5NA 4U80A 4F0GA 2OW3A 4N0SA 2IZRA 4G31A 1R1WA 5CSXA 3RALA 2WTIA 2R3PA 3D4QA 5JSMA 1JOWB 3JVRA 5LXMA 1OPJA 4HGEA 3FSKA 3DPKA 4TYEA 5M55A 4HVHA 1PXJA 3NSZA 3A60A 2VWBA 4P5QA 4XEYA 4C2WA 4CFMA 3FV8A 4G9RA 2W96B 3GFWA 4AZTA 5IU2A 5KBRA 4X6QC 4W4WA 4ZTHA 4O7VA 3V5TA 4AXAA 2YDIA 5I9ZA 5CNOA 3VJOA 4AT4A 4TT7A 3LFEA 4DG0E 4OTFA 3HV5A 4M66A 5CI6A 2GHMA 2W1GA 3QA8A 4IVAA 5C4KA 4G6OA 4LV5A 1GNGA 4CYJA 2Z7RA 5HX8A 3O7LB 2JFMA 3EZRA 4E93A 4Z7HA 3P0MA 1MQ4A 3DBDA 3EYGA 2FVDA 4Q9SA 1J7LA 5HG7A 5BYLA 2B9JA 4ENYA 2VU3A 2J50A 3TCPA 4ASEA 3FHIA 4AFEA 4ERKA 4A07A 4F6WA 3QKLA 5I9UA 5DIAA 2WTCA 4E4NA 4GU6A 3PIXA 2XCHA 4FNXA 5HE0A 4HGSA 4Q2AA 4G3CA 2XKCA 3M2WA 3QD3A 5HTIA 1ZMWA 3U6IA 4XCUA 4JRVA 3C51A 3MY1A 2YEXA 5HEZA 4NIFA 1H1QA 4O96A 5D41A 3EQFA 3KRJA 4Y8DA 4ZOGA 3TKHA 4XRJA 2ZM4A 3UBDA 2QODA 3ZLYA 3BEAA 1Q99A 3MIAA 1Y6AA 3V8WA 5T3QA 5AEPA 2J6MA 5IH6A 4NJ3A 3RKBA 5L2SA 3MESA 3KGAA 4G1WA 4L67A 4UB7A 3NX8A 5FTGA 4O7NA 3D5WA 4RZWA 2GU8A 1ZY5A 2JIVA 4FSUA 5HZNA 3NUNA 4AGUA 3O2MA 4UBAA 3DFAA 3LLTA 4QP1A 1URCA 4AQCA 4I6FA 3DCVA 3PTGA 1BI7A 3C1XA 3EQGA 5C8MA 1E1XA 3RHXA 2WFYA 1TVOA 3IO7A 2QU6A 3QKKA 3TIYA 3V04A 3DKCA 3QTQA 2YWVA 1JKKA 3C5UA 4J95A 4D28A 4EQUA 4CFWA 5BMMA 4UXQA 2CLXA 2HIWA 4FTKA 4FV6A 4Y95A 4H3BA 2Z7LA 4BCHA 5AV4A 4FEUA 5LVMA 2YN8A 3IW5A 5CQWA 4A9UA 2OH0E 4XG9A 3VIDA 3W2CA 3V8SA 3LJ2A 2UW7A 2ZDTA 2XKFA 3UODA 5C4LA 3LFBA 1VZOA 4RJ4A 4C3PA 4YTHA 1Z57A 2I40A 4B0GA 2C6DA 4F09A 5K4IA 4FSTA 4XHKB 4FTJA 4BHZA 2R3QA 4XYFA 4KINA 2BHHA 3HMPA 4NUSA 4XMOA 3E92A 4FL1A 1IAJA 4DF3A 5M07A 2E9OA 5F20A 3PWYA 4GH2A 5AP6A 3WF5A 3BU5A 3FQEA 4MX9A 5BUEA 3QWKA 4QPMA 3UC4A 3OWLA 2HY81 3LXLA 4LUEA 4TYJA 3R7EA 1ZLTA 5CVFA 3WF8A 1VEBA 3P7BA 4O1OA 5TO8A 4ZLOA 3QRIA 4C02A 2OIDA 4PMTA 3KXMA 4JI9A 1Y6BA 3ZM9A 1T45A 3H9RA 4MBIA 4U42A 4HPUE 2BUJA 4HYSA 4IDVA 3CQEA 3GC7A 4QT1A 4ZJVA 4FE2A 4D4SA 3L8PA 2ZB1A 3NNUA 4NTTA 3QHRA 1WZYA 3ZO3A 1SM2A 4PPAA 5DT4A 5KE0A 4DEGA 3QRTA 2PZPA 2QVSE 1YI6A 4GL9A 5JN2A 3KRLA 4FEXA 2EXMA 4FMQA 4GU9A 3VUGA 2P2HA 1XH7A 3FLYA 1YWVA 1UWJA 3LXPA 5CALA 5E8SA 4YTIA 4ITHA 3EKNA 3F66A 3LFAA 5BVWA 1KUTA 4QNYA 3T8OA 4E5BA 4I94A 5J79A 1CDKA 3N9XA 4ZZOA 3QC4A 5KMNA 1AD5A 3ZH8A 4DEDA 4OTIA 5GJDA 4U43A 3DU8A 3MIYA 4DCEA 2Y4PA 2GNHA 3MGYA 2R7BA 3MS9A 4I21A 4FKLA 3HA8A 4D4RA 3R8UA 2C6LA 2NRYA 3MYGA 4XUFA 5IKWA 4QMVA 5HTBA 2VWUA 4MD9E 5M53A 3QXOA 2O2UA 3AC5A 4IE9A 2IZSA 4IAAA 5HO7A 3IQ7A 2PL0A 1BYGA 3KA0A 2XK4A 1DI9A 4JLCA 2ZM1A 5D10A 3ZUTA 3G9NA 4E26A 4OBQA 4J99A 5FQDC 5HBEA 4EONA 4R7BA 3UQFA 5E8TA 3EHAA 2B9IA 3REPA 4ORKA 3QTSA 4FGBA 4ZZMA 3UDBA 5HBJA 3IS5A 4FSYA 5AAFA 3WARA 5KNJA 2J7TA 2X7GA 5HE1A 4Z7GA 1G8SA 1Q8TA 4PWNA 5BMSA 4UMTA 2GCDA 2QOQA 2BDFA 4D0WA 4EH5A 4ZMEA 5HICA 3AT4A 5IA1A 4I0SA 5B7VA 5D7VA 2W1DA 3CBLA 4JBPA 2UZVA 3SW4A 3UZPA 3LCOA 3PY0A 3WZEA 3ZSGA 5L8JA 1G5SA 4G2FA 4HCVA 3SGCA 2JITA 4G6LA 2XK6A 2R4BA 5C9CA 3RMFA 3VC4A 4R5SA 2UZEA 3VBVA 4AN3A 5IEXA 4S30A 3HX4A 4WOVA 2XIKA 4BHNA 3PA5A 3I81A 2Y4IC 5EHLA 4YBKA 5K5NA 5L6OA 2XK8A 3EN4A 2ITVA 3Q9XA 4S34A 4ZSGA 4LL0A 3PWDA 4YJRA 1QL6A 2OK1A 2EWAA 1GJOA 4NM3A 2ONLA 3AG9A 3CS9A 4L01A 2WTKB 2C47A 3LQ5A 2OIQA 3H9OA 4CEGA 4C57A 4DHFA 5CAQA 5IPJA 5L2WA 3QZFA 5I3RA 1QCFA 2ONLC 1XJDA 3PJ3A 5HI2A 4PY1A 2WU7A 4ZK5A 3C4WA 4NW6A 4DH5A 3NCZA 3A61A 4BL1A 3AMYA 4EZ3A 3GFEA 2I1MA 3FSFA 3P9JA 2XNPA 4KRDA 4ANQA 5AP0A 5FXSA 2P3GX 5KX8A 5AP2A 2GMXA 4CFFA 2DQ7X 4OW8A 1JKLA 4RWJA 3MVLA 5ACKA 4DEAA 4B99A 5EOBA 2WMTA 4RFYA 4BFMA 3F82A 4J71A 4BC6A 3PP0A 4XBRA 4RRVA 4EOSA 3NNXA 1BL7A 5KMJA 1UNHA 1QPCA 3W2QA 4E3CA 3AC3A 2J5FA 4AGWA 5AP4A 5IQHA 4MQ2A 4PP7A 1JNKA 2V22A 1S9IA 3G6GA 4OTRA 4QTBA 4HZSA 5BPYA 4WBBB 3EQPA 1OBDA 1H25A 2WMRA 3R9HA 5I4NA 3FI3A 4OAVB 2W7XA 2WIPA 2FGIA 3R9NA 2PVHA 3V51A 4U7ZA 1ZARA 2CNQA 5HCZA 3TI1A 1SYKA 2XF0A 3RI1A 5K9IA 3FAAA 2XYNA 3TWJA 3VF8A 2UZUE 1ZRZA 5CANA 5DI1A 5J5SA 2HK5A 2J0KA 4Z16A 2ERKA 3MFUA 4XJ0A 1XBCA 5AUZA 5HORA 3LVPA 3RAIA 4C4EA 2BIYA 4FT5A 2FSOX 2OF2A 4QP9A 1PXKA 4V0GA 5A4TA 1F3MC 5HBHA 3AMBA 2E9UA 4IADA 4FKOA 2QU5A 1I09A 3NYOA 4LOPA 4DITA 2XNGA 3WBLA 4UYNA 3UZRA 5L8KA 2X1NA 5EM5A 2P33A 2I0HA 3R9DA 3ZSHA 4D1ZA 3OXZA 3R83A 3CLYA 4UV0A 4EZ5A 2JLDA 3DAEA 4PL4A 3F5UA 4LGHA 3MFTA 4FSMA 3PE2A 3FYJX 5EW8A 4X3FA 5GZ9A 4YGAA 3GB2A 3IDPA 4YBJA 2VO6A 4BDEA 1NW1A 5M4IA 2VTOA 1UU8A 3VJNA 2QO9A 1M2RA 4S31A 3UYTA 1JKSA 3PY1A 3OOGA 4CSVA 3NVKI 4E4LA 3EQHA 4DFLA 1OGUA 2PE2A 5K4JA 4NU1A 5IUGA 3QUPA 1WBSA 4JG7A 1QMZA 1I44A 4F6SA 5CSHA 4PQNA 3K3JA 4QMXA 2X39A 1ZZLA 2CKQA 4HJOA 1Q4LA 5CZIA 4OT6A 2JAMA 3C4EA 3QA0A 3GVUA 3DNEA 5ANEA 5EFQA 4BTKA 4CT2A 3I6WA 2BMCA 4YP8A 1SVHA 4NK9A 3K54A 3PIZA 5EDPA 4AACA 4JG8A 1YRPA 3R22A 4GUEA 1PMNA 2WZJA 1JSTA 4GFGA 4HPTE 3E3BX 4RIXA 3DTWA 2CGXA 4O7WA 1WBVA 3G9LX 3A2CA 3FJQE 5CSPA 1FVVA 4AA0A 3VS7A 3U54A 3ZUVA 2ITPA 4A9SA 1NVRA 2GHGA 4EOOA 1R3CA 3PPZA 4K77A 1V0OA 4OTHA 3E8DA 2GS7A 2XMYA 4M8TA 3MFSA 2NO3A 3TM0A 1CSNA 1PYEA 1W7HA 2VGPA 3BLHA 4PF4A 3OBGA 5CVGA 3SC1A 1XH9A 3EN9A 3COKA 1WBTA 1B6CB 3LMGA 2P0CA 4XS2A 3PE1A 4LRMA 3DK6A 3HZTA 3NIZA 3LQ3A 4ANNA 5IDNA 4C61A 4ID7A 4C37A 2R3LA 5EKNA 3ZCLA 3TV6A 4BI0A 5JQ5A 1YXXA 3QZIA 3UO6A 5F9EA 1OIYA 4PX6A 4E20A 2YABA 3O8PA 3SLSA 4BKZA 4YJOA 4RMZA 1Z5MA 3W16A 2QC6A 3VBQA 1HCLA 3EYHA 2PYWA 3VUIA 2GS6A 2ZM3A 4L44A 3UOJA 1WVWA 2RL5A 4AZEA 2HOGA 5GIPE 1OECA 2YDKA 4NFMA 1KE8A 4F1MA 2QOHA 2GPHA 3GC0A 1OL6A 4FL2A 3RAKA 4BCKA 2JGZA 3BYSA 1YQJA 1NT2A 4D1SA 1FPUA 4EH3A 2PUUA 2WTVA 5A3XA 4G9CA 3NR9A 4DFBA 4ZXTA 1JWHA 5IH4A 5HIBA 4JBQA 4LV8A 1YXSA 3PXKA 5GHVA 4CLIA 4WKQA 3BBTB 4G5PA 3L9LA 5E8XA 2GDOA 4R78A 3WIGA 3SV0A 3COHA 3EKKA 4QP7A 4IBMA 2JEDA 2QCSA 4IQ6A 1YXTA 2X7FA 2W17A 4FTCA 5J1VA 3Q4ZA 3BRBA 3LFDA 2EUFB 3U6HA 4MNFA 1YWNA 4X21A 3UQGA 1QPJA 2QKRA 5HGIA 3GU6A 2JKKA 4FVRA 3ORNA 4IXPA 3OG7A 4CFUA 4WA9A 2C5VA 3FPMA 3UO5A 4QNAA 3NRMA 5BVOA 3QU0A 2XIZA 2FH9A 3VBTA 3A8WA 3S4QA 3E63A 2VD5A 2QHNA 4OR5A 4JS8A 3Q4TA 3HEGA 3K2LA 4YZMA 3ZSIA 3CP9A 3LCKA 3L8VA 4O7RA 4DE4A 2ETKA 2HXQA 2WQOA 4ALVA 3IGGA 4EHGA 2G2FA 3PVBA 4I24A 2J5EA 3GNIB 3IG7A 3BHVA 3MVHA 3II5A 3FZTA 3MY0A 5HVKA 1YOLA 2QOOA 3U6JA 1GZNA 4EQMA 5AMNA 4F0FA 4ACGA 2B9FA 3CY2A 1OMWA 2UW6A 4EKKA 4IVCA 4XBUA 5HKMA 5LCKA 3VNTA 2WMUA 5E7RA 2WMWA 2PVLA 3P5KA 3FI8A 4D2SA 3PUPA 3GQIA 5IDPA 5IEYA 2VGOA 4FG7A 4O2PA 4DBXA 3R0TA 3HRFA 3KK8A 4KNBA 3RK7A 3ZBFA 2XBJA 1P4FA 5CY3A 4RJ6A 3T3UA 2OH4A 4I0TA 4TW9A 3FMDA 1REKA 2VRXA 1M14A 3CE3A 4YZCA 2VTMA 4FNYA 4A9YA 3D5UA 3IW7A 3PP1A 4UXLA 3EMGA 4DT9A 3OT8A 4G17A 4QTDA 4F9YA 4FVPA 3DBEA 3OFMA 3LFCA 3R7IA 3UG1A 2VN9A 4X7QA 4FKVA 2X6EA 3E8NA 2XIRA 3DJ6A 3HDNA 4FV0A 2XVDA 2Y4IB 4U3ZA 4U81A 2CCHA 2FB8A 4CMUA 4FT9A 3FQSA 2OI4X 3W8LA 1J91A 5CYIA 4AGCA 3CXWA 3E88A 3R04A 1ZAOA 4HYUA 4QP3A 3MH2A 4U45A 5AX9A 3H0ZA 2YA9A 2A19B 4W8DA 4LGDA 2W06A 5F4NA 4BKJA 1IG1A 1W84A 3KXHA 3L9MA 4PMMA 5ANIA 4E8AA 4ZY5A 2JDSA 2HW7A 4MXAA 3VF9A 4O21A 2I0YA 1JVPP 4FV1A
chains in the Genus database with same CATH superfamily
4IAIA 2R3HA 2YERA 2VX0A 3AGMA 5M08A 3ZU7A 2ZV8A 4UWBA 2XKEA 2ZMDA 3O5AA 3DS6A 3AMAA 4BRXA 2ZYBA 3OCSA 2H34A 2H9VA 4DHZA 3NUUA 3NNWA 3RZFA 5L2IA 5A46A 3MTLA 3N4UA 4EH8A 2WKMA 2ITQA 3ELJA 1A48A 1EH4A 3R8LA 2W99B 3D5XA 2YAAA 3L8XA 3F5GA 3CPCA 3QQHA 4I6HA 4OAUC 2XM8A 4ZJJA 2FSMX 3D5VA 5CT7A 4ANMA 3SXFA 3H30A 2QOFA 4KRCA 2XJ1A 3DV3A 4AW1A 3BHYA 4OTQA 4FKJA 5BYYA 3P7AA 2UW0A 3PRIA 4OUCA 1MRVA 3FZPA 3IOPA 3F5XA 5LQFA 4RX7A 2ZV7A 5AP5A 3DT1A 2BTSA 4QMMA 5FD2A 3U9NA 4AXCA 3DY7A 3FXZA 1PF8A 2ITTA 4BI1A 4EBVA 3NW5A 4AE6A 2XBAA 3FY2A 4C4JA 2CNVA 3LMIA 2PVNA 3DBCA 1HOWA 4FZAB 4GG7A 4MAOA 5E8UA 3CSVA 4MUQA 2E9PA 4IWPA 4PTCA 1DAYA 1GAGA 4Y72A 3RPOA 2GQSA 3CQUA 3S0OA 3F5PA 2IO6A 3VS6A 1PXPA 1XMLA 5J8IA 2ITZA 2OZOA 5EDQA 4JQ8A 1UV5A 2G9XA 2I0EA 4R3CA 5CTPA 5JKGA 5EQEA 3GCUA 3VUTA 2CHLA 3BYVA 3E5AA 3TUDA 3QC9A 2OXXA 4O0TA 2O63A 1JSVA 4ZS4A 2ITWA 3CC6A 4MH7A 2W0JA 3TTJA 4AT3A 1JLUE 4DEIA 4M97A 3HECA 3TL8A 5M44A 4J8MA 3DNDA 2ZV2A 4UEUA 2WMVA 5ANJA 3ORTA 3ZDIA 4EQCA 5LOHA 5M4CA 4CZUA 3O50A 5C27A 2VX3A 2WMQA 4RLLA 4P90A 3C4CA 1W8CA 3CTQA 4FTMA 3R9OA 5IQGA 3VHEA 4D9UA 3Q3BA 3LFNA 2J9MA 3KN5A 5I3OA 4QYYA 3ZUUA 1K2PA 2JD5A 3WF9A 4O4EA 3LE6A 4HW7A 3UGCA 2QQ7A 5JFXA 2J90A 4DH8A 1W2DA 4JJRA 1OIRA 4FUYA 4O84A 2VTIA 4GT5A 3EQCA 5CU4A 4YJQA 4WNKA 1NVSA 4IZYA 5K0XA 3EN7A 3CY3A 4Q9ZA 3DAJA 4CG9A 5HNBA 3GOPA 1J7IA 1YHWA 4IX5A 4B4LA 3R9RA 3RWQA 4FL3A 1OUYA 2J0JA 3EN5A 4RC2A 5M56A 2B0QA 2BFXA 5FTOA 1CKPA 3O23A 4YNEA 4B8LA 3C0HA 4KSQA 3FKOA 4Q5EA 4M14A 5AR3A 4DG3E 1M7QA 3M42A 2F2UA 1UNLA 3ROCA 3W8QA 2BFYA 2Q0NA 4TXCA 3LM5A 1IAHA 4WUAA 2XNNA 2ZAZA 4I6BA 4ZJIA 2X7OA 3OF0A 3BL7A 3DLSA 4BWPA 4MTAA 2QOLA 3QQLA 3QGWA 4K9YA 3P4KA 4NM0A 2BR1A 4RIXB 5L2TA 3JY9A 3BKBA 4B7TA 5AV1A 3G51A 5EHYA 4NKSA 5BVFA 2DYLA 2QOKA 3KF4A 3RAHA 4BCOA 2VO0A 2W5AA 2VWZA 4X3JA 5H8GA 4GKIA 4WG4A 4WG5A 4JAJA 5B2KA 4NYEA 3PPJA 5AUTA 4KIPA 5DWRA 2UW4A 2Y0AA 3ZFYA 4EHZA 5IQIA 4FK6A 4FZ7A 1XH5A 1XKKA 4U3YA 2Z7QA 4CD0A 1RQQA 5H2UA 4C4HA 2E2BA 2IN6A 4OBOA 5DR9A 5DG5A 3EJ1A 3W2SA 4TY1A 3WE8A 4S32A 3RP9A 2ZDUA 3OBJA 1GZ8A 3ENHA 4AA5A 4M68A 3MVJA 4YO4A 3OW4A 4BI2A 4AS0A 4C34A 3JVSA 3OT3A 4I93A 5KUPA 3C4ZA 3DKFA 2R5TA 4O6EA 3SAYA 3VW8A 4RZVA 1BKXA 4LL5A 3TV4A 3W1FA 2GQGA 4KBAA 4JOAA 1STCE 5DT3A 4X2NA 5IMXA 2C5XA 1V0PA 2WTDA 3O96A 2IVSA 3SG8A 4V01A 2HWPA 4YJPA 2EB3A 3HV3A 3PPKA 3W0QA 2X4FA 3NUSA 4TWOA 2ITNA 2J0LA 3MSSA 4E7WA 4O7LA 3IW8A 3NLBA 5AR2A 5IQFA 3B8QA 3IKAA 4PL5A 3V01A 3A4OX 4CZTA 4I5PA 3UPZA 1TQPA 3Q9ZA 5JZNA 4ZTNA 4UWCA 3DK7A 4FKIA 4LMNA 1UKHA 3QQJA 5FEEA 3T3VA 3RK9A 3ZC6A 3POOA 2OKRA 4X2JA 4O0YA 2JKQA 4OGRA 4F78A 2X2LA 3GGFA 3UVPA 5E8WA 3NNVA 5J1WA 5J9LA 1PY5A 4GVJA 2VO3A 3KMMA 2ITYA 4C59A 5AAEA 1Y8YA 1KV2A 2WGJA 2X4ZA 5LVOA 2F57A 3EL8A 4MWHA 5FWKK 1WFCA 1LUFA 5IA3A 2Z02A 4DFXE 2Z2WA 1FMKA 3EH9A 3MVMA 5DH3A 3SX9A 4P4CA 2WIHA 2QG7A 4I4EA 5CI7A 4C4FA 3G33A 3E8CA 1FVTA 3KRRA 3ENMA 3A7JA 5IQDA 1UA2A 3DQXA 1BL6A 3W10A 2CKEA 4XRLA 1H08A 3NUYA 3O17A 4FX3A 4YHTA 4D2TA 4JNWA 3SXSA 4BIEA 4BWXA 5JEBA 3U55A 4PV0A 3D14A 3HP2A 4NJDA 4XG3A 4BY9E 1KV1A 2Z7SA 4QMZA 4DGLC 3RINA 3GCQA 2YIXA 2QKWB 3BHUA 1MRYA 5EYCA 3EWHA 4QP2A 5EG3A 1DAWA 3LZBA 4AA4A 5CASA 3MH3A 1O6LA 4NT4A 5H9BA 2CN5A 2WNTA 4UALA 4ZP5A 3PLSA 5FEQA 2XEYA 2QR8A 1YDTE 2XEZA 4W8EA 1ST4A 1Q3WA 4G6NA 2R3NA 2UVXA 4APPA 3D2KA 1PXMA 3EQBA 4EH6A 2OJGA 4H05A 3MN3A 4FTOA 4YUQA 2QONA 4XH6A 3AT3A 3AKKA 3ODZX 4R5YA 4XG4A 4E4MA 5CSVA 3FMLA 5C01A 2V0DA 3I0OA 3C50A 5TT7A 1G3NA 5IA0A 2FUMA 4AOJA 3EB0A 3S3IA 2HW6A 4FZDB 3R28A 4BDJA 2JDOA 4IJ9A 5A4LA 4C4IA 1ZYSA 2E9NA 3ORMA 4EK3A 4R77A 4O7ZA 5AP1A 3BE9A 4EBWA 2YIQA 3ERKA 4LGGA 5A4EA 1FINA 4JDHA 2DWBA 4BCFA 3TV7A 3KVXA 5C03A 3U8WA 3ZHPC 3TNIA 3QALE 2EXCX 3BZ3A 1R0PA 3GC8A 3GEQA 3PXQA 5C26A 4DFUA 3OUKA 3OZ6A 4L43A 4Y5HA 2BZIB 4QQTA 2XS0A 4NL0A 4YC6A 3CGFA 2RGPA 3POZA 5A4CA 3PDTA 4L00A 4M13A 3HVCA 3QLGA 3EFWA 1R78A 5GNKA 4G3GA 2XIXA 4C4GA 4F7SA 4FTIA 3D83A 4YC8A 5CXHA 3G6HA 1PMEA 4P2KA 5EHOA 3ZZEA 2JKMA 3C0IA 3R7YA 4PDPA 3E3PA 2EB2A 4F64A 5DRDA 3OCGA 4R3PA 5CEPA 4KA3A 1CMKE 4C38A 1YI4A 1W2CA 2FSLX 3A62A 4MKCA 3ZMMA 2OJ9A 2REIA 2ETMA 2RG6A 4H36A 2BRGA 2JIIA 2VTAA 3D94A 3HMOA 4IB3A 4MXOA 4J1RA 3RK5A 3K5UA 3RZBA 5CVHA 5FUTA 5GJFA 3N51A 2XIYA 4P7EA 4F7LA 4PTEA 1W0XC 3R21A 3ZC5A 4Y46A 5DEWA 5JRSA 4MYGA 3RPVA 3F2AA 1GIJA 3UJGA 4ASXA 4FJVA 3HP5A 4RQKA 3VUHA 3SRVA 3CCNA 4RA4A 4FV8A 4RLKA 4XG6A 1JKTA 2PVRA 4Z55A 4TNDA 2CGUA 5KKRB 3M11A 1VYZA 2C0OA 3DOGA 4XV2A 2XNEA 5BVEA 5EQPA 1YKRA 4IC7A 3UNZA 4FOCA 3TDWA 4JL9A 4ANLA 2C3LA 3O8TA 4E6CA 2PY3A 1F5QA 3NMUF 4GCJA 4O0UA 3QRJA 5CSWA 3Q9YA 4I1ZA 3EQIA 4BTMA 4MXXA 2R3OA 2X0OA 4JRNA 2PU8A 5IF1A 3O71A 3VS5A 3F69A 3PSDA 3HAVA 4ENXA 3F2NA 2CGVA 4I22A 2XRUA 3U9CA 5EKOA 5FBNC 5HLNA 3VS3A 1LPUA 4CNHA 5IA4A 3IDCA 2HXLA 2PE0A 5GZAA 1ZWSA 3ML1A 3AD5A 3FY0A 2HENA 1GIIA 4MF0A 2AEGA 3PYYA 4A06A 4JG6A 4GSBA 3R2YA 4CKRA 1VYWA 4IW0A 4WSQA 4BCJA 2IW6A 2JKOA 3GCPA 1H1RA 4F9AA 4RGJA 4OBPA 2B1PA 2IW8A 3L9PA 3MPAA 4EI4A 3FZSA 2QHMA 2IVUA 1OIUA 4RG0A 2ZOQA 4FICA 4I4FA 2PZIA 1MRUA 4X2GA 2FSTX 5KBQA 1ZYLA 5EM6A 5DLSA 4FGRA 3FL4A 3EQDA 3A99A 3H3CA 3UDSA 3HRBA 4QDVA 2QOBA 4FK3A 4Z3VA 2R0UA 5CEMA 3R7UA 1Q62A 3R1QA 3MB6A 4WT6A 4YZBA 5LCJA 4B8MA 3VUDA 5EI2A 2QO7A 1FQ1B 3ORPA 4IDTA 4FYOA 4BDBA 3DFCB 3P79A 4D55A 1RE8A 4PDYA 4BR3A 2PUPA 2A98A 2YM4A 4EOLA 4EEVA 2PMNX 4FVQA 1IR3A 4YNOA 4WRSA 5DR6A 3O7LD 5HNGA 3F3VA 3CKXA 4K2RA 5FRIA 3QRKA 4RC3A 3RPSA 3I5ZA 3FI2A 3TG1A 5CAPA 4ALUA 2WQNA 3NUXA 4GVAA 5CZHA 5IEVA 3B8RA 1JQHA 2SRCA 3VS1A 3C9WA 3D9VA 4F0IA 4EYMA 3CR0A 3G2FA 1M2QA 3KRXA 1CKIA 4LM5A 4ANBA 3FMHA 5HO6A 3MDYA 3PA4A 5IISA 4BCMA 5DE2A 1OKWA 2IVVA 2YDJA 3F6XA 4ZLYA 4OT5A 4QMQA 2J0IA 5HX6A 3MH0A 3B2TA 3ZTXA 3ZONA 4EOKA 2JIUA 3PJ8A 4BGHA 4YMJA 3IW6A 4RC4A 4W4VA 5JZJA 3UQCA 2J51A 1TQMA 4L8MA 5E1EA 4ANSA 4BICA 3WF6A 4A4LA 2YFXA 2ZV9A 3WOWA 3V5LA 3PFQA 2PMLX 3EL7A 3P86A 4KWPA 4DBNA 4EKLA 3DAKA 5LMBA 3HYHA 4E1ZA 3BLRA 3C0GA 2PUNA 1PXOA 4IEBA 5M57A 4AXDA 2W9FB 4XV9A 2VTTA 3OHTA 4I41A 4BCIA 2OIBA 3PIYA 4L46A 5EK7A 1ZYJA 5EW9A 5HCYA 5TKDA 2VTSA 1OZ1A 3HKOA 4DTBA 2B4SB 2BILB 5DYJA 3PVUA 1TZDA 4E6DA 4EL9A 4M7IA 3AD6A 3QXPA 2YAKA 4CTCA 4DH1A 5C1QB 4BJJB 2YZAA 3OXIA 5C8KA 3CJGA 2GNLA 1OKYA 5E8ZA 3HLLA 5IQCA 3Q4UA 3ETAA 4FKRA 2JDVA 4DEBA 3RBWA 4MNEA 4TYHB 4I5HA 3R7OA 2WMSA 1YHSA 1YVJA 2QLUA 5BUJA 5BVKA 4FV2A 4QMNA 3FMMA 4ITIA 2ITUA 4RJ8A 3MJ1A 4U0IA 1KE6A 2DUVA 3FXWA 3I4BA 3PZEA 3R63A 1J1CA 2YWPA 3ZBXA 4WO5A 4GUBA 4IAFA 4LOOA 3UMWA 2W1HA 2EU9A 4G16A 4ACMA 3QCSA 4F6UA 4F63A 4RVTA 3SVVA 4JR7A 4BDIA 3PXFA 2WELA 3M1SA 5F95A 4TN6A 2B53A 3CTJA 5JMSA 3VS2A 2X9EA 3VHKA 2CJMA 3DB8A 4AG8A 5EQYA 4H58A 5HG8A 2QURA 5I5ZA 2XARA 1KE9A 5M51A 2XAOA 4EJ7A 3IDBA 5EM8A 1XBAA 4WRGA 4BCQA 5I9WA 4CMTA 2VTNA 3CJFA 4MXYA 4RX5A 4UMUA 5LVNA 2R3JA 1YDSE 2VNYA 3UNKA 2CCIA 2UZOA 3PG3A 4GFOA 4YSJA 4XLIA 5JH6A 2JDTA 4BCPA 4L68A 4QQCA 5L4QA 2FO0A 3PXYA 1Q61A 2LAVA 3CGOA 3NIEA 3CQWA 4QTAA 3QCQA 2NRUA 4AUAA 1NVQA 3FXXA 2HZ0A 1PHKA 4ZLZA 5J5TA 2XKDA 3FLWA 5HG9A 4ZIMA 3R6XA 2W5BA 3UP2A 1T46A 4OTWA 4TL0A 4DTAA 3NW6A 4IX4A 4ERWA 2RF9A 4PRJA 1IASA 2WEIA 4RJ3A 4GK4A 2UZBA 4FKGA 2VV9A 2W1ZA 4ASZA 3ZDUA 4AW5A 4CQGA 4XOYA 4YSMA 3ZFMA 1PKGA 5CLPA 4DGNA 1SVGA 3UTOA 5ANDA 3C5IA 3LLAA 4FSNA 5ETIA 4BDAA 2OGVA 1GZKA 3WYYA 3L8SA 5DRBA 3EFLA 4IMYA 4ZTSA 1OL5A 2UVZA 4IM2A 2OZAB 2PZ5A 4EK4A 2GFCA 2X8DA 3TT0A 1CTPE 4FKSA 4L52A 1F0QA 3TNHA 4EOPA 2PSQA 4DGMA 2F49A 1WVXA 3BWJA 2HZIA 5ANOA 3TZ9A 1U4DA 1PXNA 4CGAA 4RVLA 2BZJA 2RFDA 2WOUA 3HUCA 3R1SA 5DR2A 3F61A 3WZUA 4FV9A 3Q04A 5FG8A 2JBPA 3QBNA 4BTJA 4M0YA 4F70A 4DEEA 4LUDA 2VWIA 4KSPA 4O6LA 3FE3A 2X8EA 1IRKA 4Z9LA 4DFZE 1OUKA 2JDRA 4L45A 2C69A 4BB4A 2XM9A 3O0GA 4WHZA 4K11A 2QD9A 4LG4A 3VAPA 5D7AA 4YZDA 2P2IA 2OSCA 1XQZA 1W82A 2PVJA 5LWMA 4KUJA 5L2QA 4YPSA 4G3DA 5HU3A 3W0PA 5T6KA 4X2FA 4M0ZA 5HO8A 2A4LA 4QMTA 4F7JA 3R1YA 2WQEA 3JXWA 3QD2B 5DOSA 2QNJA 3FMNA 3JY0A 4GRBA 4KBKA 5A6OA 5B2LA 3T9TA 3AC1A 4PPBA 3BU3A 5JT2A 3HMIA 2B54A 4AE9A 2PVYA 2PVKA 3ZZWA 3OY1A 4D9TA 2I0VA 3BHHA 4IX3A 2QI8A 4PTGA 4KBCA 4C2VA 4EWQA 2J4ZA 4WNOA 4GJ2A 4PNIA 4AXEA 2X2MA 2R0IA 1SNXA 2CLQA 3GU7A 4BZOA 3SRVB 4F9CA 3NFFB 4JDIA 1YI3A 5HCXA 4EHVA 4BKYA 2E9VA 2PZYA 2PMIA 3DDPA 2HZ4A 3ODYX 1ZYDA 1M2PA 3DA6A 3TKIA 2YLEA 3B2WA 4BYJA 3S00A 2BVAA 3DKOA 5F94A 4FT3A 4EK6A 4CFNA 4UX9A 4BDCA 3TN8A 4RA5A 2XNOA 2A2AA 4C36A 2ZVAA 3QCYA 4FIEA 1ZOEA 4O0VA 4QRCA 5CEOA 4LI5A 4NM5A 1RDQE 1Q8YA 1WCCA 3FYKX 3PJ1A 3UMXA 2GNIA 2AQXA 5J7HA 4MD7E 4YO6A 3LFFA 4AF3A 2CDZA 4OTPA 4UMPA 4BBMA 5LWNA 4ZTLA 4BDHA 3KY2A 4PUZA 1P14A 2PK9A 3ORIA 3QAME 4QMLA 4XLVA 4YJUA 2YZLA 3COMA 2R3FA 4IVDA 3IOKA 4EUTA 2C4GA 2UVYA 1H26A 3QQUA 3QUEA 3R8ZA 3I79A 3KVWA 4GW8A 4U6RA 4JQ7A 3LJ0A 4O0RA 5FLFA 4RIYA 5D11A 4BF2A 5AV3A 4I5CA 5C8NA 5CEKA 3PRFA 5E92A 4RQVA 5AA9A 4KABA 3BYOA 3GOKA 2ITOA 3FKLA 4M69B 4L3PA 3CPBA 3P23A 4WNPA 4ACCA 5HIDA 2CPKE 2OFVA 2YLFA 3W55A 5DN3A 5CAVA 5CU0A 3S2PA 4DLJA 4UY9A 2RG5A 1UKIA 3FLNC 3KULA 1PXLA 4XOZA 4FTQA 4QYEA 5D12A 5HE2A 3RAWA 3ZLSA 4FIHA 3RPYA 3Q32A 4MEDA 1PW2A 2F9GA 1UNGA 3PJ2A 5IH5A 5FM2A 3P7CA 2QG5A 5LVLA 3NCGA 2BRNA 2B7AA 4EH4A 4F9BA 3OW3A 4E4XA 3PLAE 2UW3A 2PE1A 4M67A 3Q9WA 2GNFA 4NW5A 3CEKA 3LCDA 2YJSA 4GKHA 3S1HA 1YXVA 5ICPA 2WPAA 3P08A 5T68A 5BNJA 1O9UA 3TUCA 1YWRA 4BN1A 2A0CX 3HDMA 4BDDA 4IM3A 4O0SA 3F3WA 4HNIA 1CKJA 4I0RA 5EI8A 2YM8A 3MI9A 4IJPA 4J98A 3FLQA 4QMYA 4TWNA 4BYIA 2R9SA 5KCVA 3PJCA 3UOLA 3OWJA 4FOBA 2W05A 3G0EA 5ETCA 4G5JA 5AX3A 4TTHB 1PYXA 1W2FA 3GT8A 2WXVA 4R8QA 4K0YA 4C62A 5DNRA 5HQ0A 5KKRC 4USFA 4AZVA 4FKPA 1XH6A 4GMYA 3BV2A 3MPTA 4DFYA 5JK3A 3WE4A 4I92A 3SOCA 5KMIA 3Q53A 5A6NA 3EOCA 4AWIA 2RIOA 3CD3A 3Q5ZA 2XP2A 4D2VA 1H28A 1QPDA 3UO4A 4FT0A 1NA7A 4IZAA 3TJDA 4QMPA 5EH0A 3FKNA 4JQEA 3QX4A 4GV1A 4L42A 5KO1A 5HLWA 3LMHA 1WMKA 4N6ZA 4AW0A 3ATSA 2UV2A 3G5DA 1PMUA 3AT2A 4JDJA 4MXCA 1FMOE 3CIKA 4EOIA 3V8TA 4HGLA 4OLIA 2C6KA 3ITZA 1TQIA 4X2KA 2CN8A 5HOAA 3ZO2A 4E73A 4W9WA 3N4TA 2Y7JA 2GTNA 3NEWA 1ZY4A 4FV7A 4FUXA 4AP7A 4N4SA 4NCTC 1XBBA 3UIMA 4JIAA 2JAVA 3QKMA 4AX8A 4E6AA 3DZOA 1H1SA 5BV3A 5KMOA 4KIKB 2W1CA 2R64A 4F1TA 4C3RA 3NYXA 3QTRA 5LARA 3C4XA 4DEHA 3BQCA 3Q5IA 3UZTA 5EYKA 1WBPA 4PMPA 3SG9A 3I0QA 1OL1A 2PTKA 3G0FA 5FXRA 2PMOX 5AUVA 4IZ7A 3WZJA 5BYZA 2WHBA 4MNEB 1SVEA 5IQEA 2BPMA 3AQVA 3R8VA 4FC0A 3RWPA 2VTHA 4HVIA 3RHKA 1U5RA 4NFNA 5IUIA 2YM7A 4ZSLA 5HHWA 4YURA 1TKIA 1KOBA 4BBFA 4IIRA 3SA0A 3QQFA 4JBVA 4OTGA 3VVHA 2WMBA 1B39A 3FI4A 1P5EA 3KK9A 3G15A 3LHJA 2XB7A 3NYVA 4O4FA 5HG5A 3IK3A 4FKTA 2C6OA 2WOTA 2W5HA 1A06A 4TWPA 1H1PA 3DKGA 5CS6A 4YPDA 2C68A 4R1YA 2XNBA 2C1BA 4MCVA 4XG7A 1PMVA 3H9FA 1XH8A 3TZ8A 4CCUA 5TOZA 4L3LA 4YTFA 4O83A 1Q5KA 4UZDA 5FP6A 2OJIA 2R3MA 3HUBA 3KQ7A 4FYNA 2XUUA 4L7SA 4HNFA 2C3JA 2FA2A 2HAKA 3KFAA 4GT3A 1UU7A 2C5OA 2WD1A 3DK3A 3E7OA 4WUNA 2C5YA 2X0PA 4O4DA 2IZUA 4QYGA 2C0TA 1NY3A 4CVAA 3CD8A 3DDQA 4MK0A 1V0BA 3VBXA 1PXIA 1H0WA 4AOIA 2UW8A 2JFLA 3EFJA 4M3QA 2QR7A 3D7TB 3BYUA 5AAGA 4AU8A 2YCSA 3E87A 4FSZA 1Q3DA 3JR1A 5A4QA 4DINA 2CKOA 4IX6A 3OUNB 3I7BA 4RWLA 5E90A 4BDGA 4RWKA 2RKUA 2KULA 4K18A 4MD8E 2NPQA 4H3PA 3FHRA 3KMUA 4JAIA 1Z9XA 3Q4CA 1OBGA 1LEWA 2W1FA 4FKWA 2A1AB 2VTPA 3PSCA 1X8BA 2JBOA 2PWLA 4FIGA 4IAZA 5AR4A 1OM1A 3TMOA 2UZDA 2PZRA 1LR4A 4K1BA 3VW6A 3SQQA 5FDXA 4C3FA 4I6LA 3TXOA 1PJKA 3SHEA 3BE2A 3GCVA 4BJJA 4WNMA 1OITA 4HOKA 4MBLA 2OXYA 4K8AA 3NZ0A 4YU2A 5DPVA 3R01A 2OBJA 4XNEA 2ZJWA 3D15A 2P4IA 2G15A 4M15A 5CX9A 3GP0A 1ZYCA 4IAKA 3W0OA 3ORXA 1YW2A 4TYHA 3R8MA 3MW1A 4NEUA 2BCJA 5E1SA 5E8YA 3EFKA 4ITJA 5B2MA 5L8LA 2BAJA 3ZXZA 4CRLA 3OEFX 4RSSA 3VO3A 3I6UA 3DGKA 5HVYA 1GIHA 1O6YA 3OTUA 4LDTA 4V05A 3IONA 3W0RA 3FZ1A 4FZFB 4MF1A 2YM5A 5LJJA 4L7FA 5FTQA 3FC1X 4F7NA 1XHAA 1OB3A 1Q24A 3CKWA 3D0EA 4QEBA 3BU6A 2VWWA 4FSRA 3LKMA 2O8YA 2CGWA 2VTJA 2AUHA 3AGLA 5FM3A 2YHVA 2R2PA 3FUPA 4JXFA 3C4FA 1PKDA 1BX6A 3BCEA 1R0EA 1YOJA 5AP7A 5CEQA 4CQEA 5L6WL 2WTJA 3ANRA 3FZOA 3AKLA 3R02A 4PDSA 2O65A 1OL2A 3NAXA 4R7HA 1YHVA 3U4UA 2X9FA 3KU2A 2OU7A 5M06A 2ERZE 1YXUA 2WAJA 1SZMA 4RJ5A 4HCUA 4RT7A 3UPXA 3KB7A 4BZNA 5BQ0A 3GI3A 5BVNA 3NGAA 5I0BA 4O27B 1JBPE 4GIIA 4BGGA 4FV4A 1LP4A 2BAKA 3FZRA 2BROA 3G90X 5EYDA 1AQ1A 5KZ0A 5IA2A 2BAQA 3VWAA 4CT1A 3NYNA 2UW5A 2X8IA 3OS3A 4IZ5A 4EC8A 2J0MB 4CKJA 4D2WA 4N57A 2H8HA 4GK2A 4EH7A 1TFFA 2BDJA 3LPBA 4UYAA 1OVEA 5DBXA 3W32A 5ITAA 1XWSA 3PXRA 3RM7A 2V7OA 4DT8A 4L3JA 3PVGA 3L9NA 4I20A 4A4XA 4CFXA 4XV1A 3V3VA 4IFGA 3MV5A 3NDMA 1J1BA 4FNWA 4IB0A 5FGKA 3TNPC 3MFRA 3OY3A 4PMSA 4L53A 4JVGA 4EZ7A 4YC3A 4CV8A 5AUYA 2OZAA 3OTVA 3UIBA 3ZFXA 3V5PA 4YZNA 2C6MA 3OMVA 1IA8A 2VZ6A 3NAYA 2OFUA 1H1WA 4X6RA 3VBYA 1FGIA 2BKZA 3GU5A 2OO8X 5CF4A 3AD4A 4RBLA 4C7TA 1ZMUA 2P55A 2WMAA 5AR5A 3A4PA 5L6PA 3GBZA 3HV6A 2RSVA 3UG2A 4AN9A 5HU9A 3MA3A 4W9XA 5DEYA 3HAMA 3BYMA 3QL8A 1XO2B 4LRKA 5JGBA 3SOAA 3VN9A 5AA8A 3MWUA 5J95A 4ZY6A 3TZ7A 1Y57A 4ARKA 3UVQA 2EVAA 3HL7A 4RIYB 2OF4A 3DXQA 2WU6A 3MY5A 1FOTA 4B9DA 4MHAA 5D9HA 3FPQA 2CMWA 3TNQB 4O22A 3JPVA 5AIKA 4ZTQA 4DYMA 1BUHA 2PVFA 3U4WA 5CF8A 5G6VA 2IW9A 4KS7A 1UU3A 3RPRA 1H27A 2G01A 4FBXA 5HD7A 3FLSA 4JIKA 5KMMA 4BCNA 4FA2A 4KIQA 3LFSA 3NS9A 3KULB 2I7QA 5ETAA 3FMJA 4R6VA 4IFCA 5G1XA 3R7VA 4YR8A 2XK7A 4ZZNA 2J2IB 2ZMCA 5DVRA 3NW7A 2HY0A 3D7ZA 5EM7A 4FEWA 2C30A 4P5ZA 5B0XA 5GZ8A 4QOXA 4YTCA 5IUHA 3F2RA 3SW7A 5EW3A 4CRSA 1ST0A 2A27A 3QTUA 4GFMA 4N70A 2ZFYA 2W4OA 1MP8A 2VUWA 4S2ZA 4X0MA 5FXQA 5JGAA 1OL7A 2YCRA 5AUXA 2X81A 2WO6A 4JX3A 5I9XA 4TKSA 4LV7A 2VX1A 1JAMA 4RVKA 1APME 5TR6A 4U9AA 4RVMA 4DAWA 3K5VA 4L6QA 4AGDA 1K9AA 1OKVA 3MTFA 2F2CB 4RWIA 4QTCA 4V04A 5DGZA 2B9HA 3ZS5A 2PPQA 5CEIA 3ATTA 3PVWA 4A9RA 5IQBA 4C0TA 3TTIA 3KIOC 3Q6WA 2V62A 4IWQA 3THBA 3UOKA 5AADA 1Y91A 3E7VA 2H96A 4K6ZA