2HZNA

Abl kinase domain in complex with nvp-afg210
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
277
structure length
272
Chain Sequence
MDPSSPNYDKWEMERTDITMKHKLGGGEVYEGVWKKYSLTVAVKTLDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural biology contributions to the discovery of drugs to treat chronic myelogenous leukaemia.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
total genus 82
structure length 272
sequence length 277
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2hznA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2hznA01
3OCSA 1GAGA 5I3OA 3E8EA 5GIPE 4KRCA 2YIWA 4DITA 2BZJA 2KULA 3NUNA 3TKUA 2R4BA 3MJ1A 2R2PA 4ANNA 1P2AA 1DAWA 1S9JA 3COIA 5M4CA 4O22A 3ODZX 3C1XA 3Q04A 4RLKA 3ZCLA 5HIBA 5C4KA 2PZIA 2O2UA 5AX9A 3JY9A 3OUNB 2CDZA 4FKVA 4HCTA 5GJGA 4CQEA 4OTWA 1PYEA 5HX6A 5FP5A 3E92A 5LVMA 3LLTA 1L8TA 1O6KA 4XOYA 1GZKA 4DGLC 3BYUA 4ZTSA 1P14A 3O8UA 4C61A 5E9EA 1IEPA 4KNBA 5EHLA 4FR4A 2LAVA 4F64A 1NVSA 3O51A 4FTQA 3V5TA 3VS7A 3ZH8A 4I3ZA 3ZRLA 4XV1A 1JWHA 3EQDA 3UJGA 3CTQA 4QMLA 4JX3A 1KSWA 1OL5A 4L45A 4C2WA 3FYJX 4WKQA 3JR1A 1ZLTA 4CSVA 4FV5A 5JKGA 2UW8A 3EL7A 3A61A 3JVSA 4FSZA 3HRFA 5I9YA 4O27B 3ANQA 3OBGA 1OL1A 5EI2A 1H28A 4NIFB 4WIHA 1JAMA 4AZWA 4U45A 5CWZA 5EKOA 3SG8A 3NZ0A 2C4GA 3C0GA 3Q96A 3DFCB 3TG1A 4BTFA 4E26A 3AOXA 2XS0A 4PF4A 2CKQA 2J0KA 2V7AA 3ZFXA 4KA3A 4BCHA 2X7FA 4AGDA 4CCBA 4YMJA 2YFXA 1W83A 5HO8A 3FDNA 1FVVA 3ULIA 5F9EA 2PUIA 4EH8A 4K77A 2QO2A 3I1AA 3IW6A 4GYIA 4XOZA 4IH8A 4MXCA 4XP0A 2G2HA 2RGPA 3PYYA 4CFMA 4L9IA 2OJGA 3CE3A 3P0MA 2UZDA 3LCSA 4RFYA 4IVDA 1Q4LA 3LCDA 5DOSA 4DGNA 4MHAA 4ENYA 3OXTA 1SVHA 4O96A 5IH4A 4ASEA 3F5GA 3D94A 2I0HA 4BCFA 2WQNA 1GIHA 4X21A 3ZSHA 4USEA 3NPCA 3QX2A 4FTAA 4RSSA 1OECA 4HOKA 3GCSA 5F1ZA 5FBNC 4FL2A 4D0WA 4TNDA 2XBAA 1LP4A 1REKA 5IPJA 2PVLA 3IK3A 3KRLA 5ANKA 4DG3E 2BROA 3RJCA 4BTMA 5ETFA 4EC9A 3VUTA 4MBIA 3IW5A 4CYIA 1GNGA 2BIKB 3DDPA 1IAHA 4NM0A 5KMJA 4DCAA 5IQCA 2GQRA 1LR4A 4YSMA 1YVJA 4CG8A 4TNBA 4XUFA 2RFDA 3A8WA 4LV8A 5IDPA 4AA4A 5CSPA 4JVGA 2J5EA 3ZBXA 4HNFA 4LV5A 4FTTA 3C4EA 2E9OA 4I6HA 4RA5A 5LOHA 2C5NA 2ITZA 2RFSA 1OI9A 3G5DA 4DC2A 5BMMA 3HVCA 2EXEA 2WMQA 4EK6A 1UA2A 4PDSA 1ZARA 5FEDA 4IC7A 1M2RA 5M06A 4MVFA 3NW7A 4RJ7A 4M69B 2BDWA 2GHMA 3DLZA 3EKKA 4IWDA 2XP2A 3DT1A 5B2KA 3VO3A 2WTKC 5LVPA 4FEVA 3C9WA 4ZLYA 5DGZA 2QVSE 4N70A 1U5RA 4BDBA 5IA4A 1V0OA 2QOLA 5EM6A 4EH7A 4NIFA 2YZLA 4TW9A 4L6QA 2WIHA 1JPAA 5FD2A 5GNKA 4UMTA 1K3AA 4G6LA 2R3QA 1PKDA 3MN3A 3KREA 2Y4IC 4FIIA 3V8WA 2WMVA 3UIBA 1QPJA 2QC6A 5E8UA 2EB2A 3EN7A 4GW8A 2B9JA 2GNHA 3IG7A 4ENXA 5EM7A 4DAWA 2PVKA 5I9UA 2KTYA 4JIAA 1Y8YA 3QYZA 4FTUA 3TNHA 5EYMA 4EQCA 5KBQA 1KE5A 3EN4A 3KY2A 4GL9A 2GNFA 4FTRA 5JRSA 3ZRKA 1EH4A 4J53A 5DFPA 2GS2A 3FI4A 4FTKA 4TWCA 2UVYA 2XK7A 2B9FA 4PPCA 2IZUA 4F6WA 4DFUA 1OKYA 3NYXA 3P79A 1KV2A 4I5PA 3TXOA 2WOTA 4I41A 2X8DA 3F6XA 4L00A 3VIDA 1GIJA 4F1MA 4CFNA 4WSYA 2ZM3A 3DDQA 2QQ7A 4R5YA 5AAGA 3QLGA 4CKRA 1HOWA 4IWOA 1PMUA 4KB8A 3HEGA 3QBNA 4YBJA 4EI4A 2WTCA 4RC2A 3PXRA 4BN1A 4D2TA 4EBVA 2QOFA 3DA6A 3UG1A 4K6ZA 2V7OA 3GBZA 3TNWA 4QTBA 4UMPA 5FTGA 4QYYA 4DTBA 5EDRA 5EH0A 1H1WA 4R7HA 4IZ5A 3QCSA 4XG4A 5CSWA 5AWMA 2HW6A 4YJVA 4AN9A 3QWKA 1E9HA 1H07A 2ITWA 3D9VA 4FV7A 4JIKA 2XNEA 2E2BA 3LHJA 4RJ6A 1KUTA 1GIIA 3GQLA 4U80A 3OF0A 3MV5A 4NT4A 3OWJA 3QD0A 3HUBA 4YP8A 4U6RA 5TO8A 2ITVA 3KRXA 5J7HA 4O7NA 1XWSA 1PMNA 2EU9A 3RM7A 3RPYA 1BI7A 4AS0A 4QYEA 4OAUC 3LCKA 2XM8A 3QUPA 3MVJA 3UZPA 2GNLA 3A99A 3FLSA 2B9IA 2YJRA 1XH8A 2BDJA 2BZHB 4MYGA 3SC1A 2YAKA 4ZK5A 3PVWA 3MY0A 1M2QA 2WQBA 2RSVA 4XP3A 4ZTMA 4WBOA 1CKIA 3GNIB 4IVBA 3THBA 3W2PA 2PUUA 3SQQA 3HV6A 5HIDA 3HZTA 4DH7A 3TIYA 3I6WA 2A1AB 5CT0A 1CKJA 4ZTRA 4JL9A 2YDJA 5B0XA 3FXZA 3WF9A 4B4LA 3TDVA 3ALNA 3ZYAA 3OY3A 2JKOA 4BZOA 1LEZA 3WF6A 3L8VA 2GTNA 3NGAA 3G51A 1FGKA 4FTOA 4FOBA 4FL3A 4C4IA 3LQ3A 2UZNA 5DA3A 4EKKA 2BKKA 1ZZ2A 3PWDA 3FC2A 2GTMA 3E5AA 4HZSA 1ZYCA 3VF8A 3ZDIA 5IH6A 1AD5A 2P2IA 4J99A 3ZM4A 3CPBA 3IDCA 3KB7A 4J7BA 5M55A 2X4FA 3F88A 3JYAA 3NUUA 4GK4A 3SKCA 5FUTA 3PY1A 3UZRA 4C3PA 2H8HA 4DTAA 4G9CA 3UP2A 4DF3A 4QYHA 4S30A 4CG9A 4AF3A 4ALWA 1BI8A 5AADA 5B2MA 5LVOA 3PXYA 2C5YA 5AP4A 5BYLA 3OUKA 4B0GA 1J91A 4F7JA 3VJOA 3QTSA 4ZJIA 4UXLA 3UNJA 2XNMA 5E8VA 3UQFA 2QU6A 1GZOA 3R04A 4ITIA 3LM5A 3EQBA 2PVYA 1MQ4A 3NVKI 3WYXA 5CX9A 3VULA 2UZBA 4A4LA 4F99A 3Q5IA 2A2AA 5CI7A 1OGUA 4LM5A 4YURA 3KMMA 3MH1A 3NWWA 2IWIA 2OO8X 4UB7A 4WNOA 3HMOA 2ZDUA 5CU4A 3ANRA 4OT6A 4HVHA 3E87A 4G3GA 4DYMA 2F7XE 2WTIA 3QUEA 2PUPA 3VUKA 1UU8A 1B39A 1JNKA 1CSNA 2QOHA 3GU5A 4BIDA 3RAHA 1R3CA 3H3CA 5HKMA 3B8RA 4F9CA 4F6UA 2F57A 2JDSA 3SRVA 2AC5A 1LEWA 3HA8A 3PA3A 5DI1A 3GXLA 3S4QA 3RZFA 3ZO4A 4EOIA 4HCUA 4FVRA 2BTSA 4RIWB 3MY1A 4YJNA 1U4DA 5CVGA 2Q0BA 2XK3A 4QP1A 2OXYA 3NSZA 4YJSA 5ANDA 2QG5A 3VVHA 2PWLA 1L3RE 5BUJA 5CS6A 3OT8A 3QRJA 1YWRA 4K0YA 4K2RA 2VTSA 1WCCA 1QCFA 1ZAOA 5FBOA 5FTOA 2C3LA 3WARA 2PZRA 3OCGA 4BDHA 4ERWA 5LMBA 3PXKA 3Q2JA 5CQUA 4YJQA 1OPJA 4AT4A 2IVUA 2YZAA 1JKLA 3CY3A 4FUXA 1OIUA 2R3KA 2UVZA 5IA0A 2BMCA 2XB7A 5CALA 5HORA 3NYVA 3RHXA 1Q99A 4K1BA 2CNVA 1R78A 4FIFA 3AC4A 4GG5A 4LRKA 4C3RA 3W2OA 4JAJA 2YIRA 3MWUA 3OD6X 4TRLA 5IF1A 5K0KA 4GKIA 1H1SA 4W8EA 5DG5A 4FKPA 4PX6A 3V5PA 2R3IA 4FV8A 4Q5EA 3VUDA 3SW7A 3N4UA 2VTJA 3DJ7A 3C13A 3EQHA 1G8SA 3R01A 4FE2A 3KGAA 3QD3A 4MF1A 3UOJA 4EH2A 3GC0A 2WIPA 4DTKA 4QMUA 4DEDA 5CXZA 3UBDA 1CM8A 4FV2A 4XV3A 2P33A 4EK8A 1SVEA 3R9DA 4M69A 1ND4A 1OITA 2F4JA 2JDRA 4FIHA 5CU2A 4QQTA 2QG7A 3EFLA 4QTEA 2E9VA 3O7LB 1Q61A 2IZRA 1XHAA 1PW2A 3W18A 1J7IA 4WT6A 4F09A 3ACJA 2QOQA 5D10A 4FV0A 2PTKA 5BVDA 2J5FA 1FPUA 3R7GA 2GFSA 3OG7A 3EYGA 4ALVA 4V04A 5IQGA 4FNZA 4V0GB 5H8BA 1URCA 2VWWA 2YWPA 4XBRA 3W2SA 4DHFA 4I5CA 3BHYA 5HBEA 2BHHA 2FSTX 5AM6A 3G33A 3LOKA 4EYJA 5HBJA 2XM9A 4W4XA 5E8XA 3VJNA 4FK6A 4FSQA 2W1FA 2OIQA 4WUAA 4QNAA 2C47A 3ACKA 3MFTA 4R6VA 3WI6A 1YDSE 4J8MA 3DXNA 3C5UA 3DOGA 1YI4A 3CS9A 2Q0NA 1OL7A 3R71A 3UC3A 3CJGA 1PKGA 4PP7A 2OH0E 3KXGA 2V5QA 1ZOHA 4MD9E 4E73A 3AC1A 4BHZA 4RVTA 3BYMA 5EHYA 2G9XA 4O0SA 4O6LA 3O71A 3SLSA 1TKIA 3TV6A 5KMIA 1XJDA 2J0LA 1UV5A 1W84A 4PY1A 2YCRA 4TYEA 4IFCA 3ORIA 4BDEA 2W5BA 1OB3A 2VAGA 4HPUE 4I0TA 2RG6A 3LQ5A 4LMNA 4WA9A 2I0EA 3ITZA 1QPDA 2JEDA 3AT2A 2W1GA 4KBKA 4EORA 4O82A 4RRVA 2HK5A 3DJ6A 4GJ3A 4O81A 5AR7A 4L3PA 3ELJA 2BR1A 4D55A 4UN0C 4ZAUA 4Q9ZA 4FT9A 2J7TA 4CTBA 3RK7A 3WIKA 4CZYB 2I0VA 3MB6A 5KHXA 3R9NA 5IQEA 3CTJA 3NAYA 5CF6A 4F9YA 2W1IA 4R7BA 1JSTA 4GVAA 4AZVA 2PU8A 4D28A 2C3KA 3I6UA 1UKHA 5GZ9A 4CKIA 4BKZA 1H4LA 5A6NA 3MTFA 2VD5A 3KF7A 1MRUA 5FXRA 4JRNA 2H6DA 4D2VA 1FBNA 2IVVA 1U5QA 4O2ZA 2P2HA 4DCEA 3UYTA 5L2TA 2X7GA 3FY0A 3MJ2A 5IA5A 4AP7A 3TEIA 4AGCA 2BRHA 3NW5A 3PRIA 2WTKB 4Q2AA 2PVRA 2GS7A 5KNJA 2G15A 3MH0A 4BCQA 3QALE 4I20A 2O8YA 4V0GA 1KOBA 3R8PA 3MESA 3PE2A 2XK8A 2GS6A 1JBPE 4OTRA 4V05A 4N4SA 2HENA 5DR2A 2YDKA 5IQIA 4ZZNA 2SRCA 1XH6A 4N6ZA 3CY2A 3RNYA 2IN6A 4ZSEA 1YHSA 2CPKE 2P3GX 5DHJA 5AUXA 1GJOA 1XKKA 1SZMA 4O86A 2VX3A 3MIYA 3MSSA 4MEDA 4OBQA 2BIYA 2HZ0A 1Y6BA 3IGOA 5KBRA 3MB7A 2VWYA 3Q9YA 5C8NA 3DFAA 3WZEA 5K4IA 3GC9A 3MI9A 2VNWA 3OEZA 3S95A 2QOIA 3FMHA 5BX0A 2OICA 5CZHA 2UW6A 2XNOA 5E7RA 2V22A 4EONA 3VHEA 4F6SA 1ZYLA 3VUMA 4PNKA 3UOHA 4QO9A 4GS6A 3WIGA 4UALA 2LGCA 4NSTA 3E8NA 4K9YA 3LLAA 3TUBA 4FSYA 4YZDA 1V0PA 5JFVA 4IC8A 4E5WA 4U43A 1UNGA 4PL5A 2B52A 2OFVA 3QD4A 4L01A 4M14A 3ROCA 2QODA 4FG7A 3P7AA 4O7RA 3ZLXA 4FTMA 4QD6A 4XRJA 3W55A 3NR9A 4X6RA 2O64A 4RJ8A 4U5JA 5FRIA 5JFXA 2GNJA 4QMMA 3FHIA 2QOCA 5LXMA 4YNEA 4DLJA 2HW7A 2Z7QA 4G3FA 2EB3A 4U7ZA 3QZGA 1G3NA 5BUEA 4RX7A 4ZS4A 3MIAA 5JQ8A 3M1SA 3VF9A 2X1NA 4AACA 3KRJA 4I1ZA 3UIXA 4I0SA 4CEGA 4U44A 3VRZA 4DEIA 3F5XA 3FZ1A 4UX9A 3MPMA 3HAMA 3BELA 3GOPA 4G2FA 4KIKA 4FGBA 2Y4IB 3SRVB 3F2RA 2RF9A 3BEGA 3QD2B 4I4EA 4BZNA 3FMNA 4O1OA 1Z9XA 3CXWA 2XH5A 3PUPA 3Q6WA 4MXAA 5CEOA 3S3IA 1U54B 5GJFA 3LXNA 3D5WA 3DKGA 4FNWA 4KBCA 4FKGA 3UGCA 4BTKA 2HXQA 2WMWA 2CLQA 2UZUE 3FE3A 4X2GA 4FKUA 3KVXA 5DRDA 5JZNA 5IA3A 2XJ2A 4IFGA 4H1JA 3ZUTA 3W33A 2A27A 3F2NA 3DV3A 3L1SA 1Y91A 5M07A 4RVKA 4YO6A 2W99B 3HDNA 2ZVAA 1JSVA 3TNQB 4IQ6A 4ZSAA 2QNJA 2C0TA 2JDTA 3QXOA 4WBBB 3WE4A 3NEWA 5L2IA 3EQRA 2R3FA 3DB6A 2XJ1A 5K9IA 3GU6A 2CLXA 1ZMWA 3KMUA 2YEXA 4V01A 2JITA 3RP9A 3RCJA 5LVNA 5CSVA 2WOUA 2XNNA 3AQVA 1CMKE 4FF8A 4XP2A 3PIZA 4RGJA 2V55A 3QWJA 4D5KA 1CDKA 2Y9QA 4MXOA 4PPBA 3UMWA 4KBAA 3TKHA 4J8NA 4ZXTA 2PYWA 3BWJA 4YZBA 4RLLA 3MA3A 5F4NA 1H24A 2PZPA 3RINA 3SVVA 2VTRA 5M4UA 3C4XA 4WNMA 1V0BA 1WBTA 4FSTA 5LMKC 3F2AA 1Y6AA 2X2MA 4B9DA 4NCTA 5AV0A 4CRSA 1NW1A 3LMIA 2H96A 2ZV2A 3NIEA 3QQJA 5IZFA 1IRKA 2EXCX 4QQ5A 3A7HA 1UU7A 2YJSA 3COHA 4J71A 3P08A 3TJDA 2DWBA 2QOBA 2VNYA 4EWHA 3R73A 4RA4A 5BVNA 3PPKA 4F70A 3D7TB 3NUPA 3HMMA 4FC0A 2OXXA 4GFOA 3VS0A 3ZHPC 5IISA 2X4ZA 4ZOGA 3FMJA 3FZTA 3T8OA 3CCNA 1FVRA 4ZZMA 4IX5A 4IZAA 3EN6A 4DT9A 5J9LA 1ZMVA 4PMPA 5CF5A 2XEZA 1MQBA 4FOCA 3SOAA 3PSCA 2CMWA 3OOMA 3COMA 4L68A 3V5WA 4O7SA 1OKZA 3C50A 3RPRA 5EYDA 2ZV8A 1FINA 5AP7A 2UW4A 5ANJA 5LCJA 1UNHA 4D4RA 4GFGA 2IVSA 4QQJA 2HWPA 2BRGA 4I93A 2O63A 5C1QB 5C8KA 2R0UA 1GZNA 5HLPA 2C5OA 3QL8A 4IAKA 4F9AA 2OGVA 3R6XA 4I0RA 1TQPA 3LZBA 3ROYA 2YHVA 3L9PA 4FTJA 3EKNA 3LFBA 4QMPA 4IBMA 3BV2A 3LFQA 4GMYA 3SXFA 4CT1A 2ZJWA 1UU9A 2XKFA 3DJ5A 3BYSA 3FMKA 4X2FA 3FUPA 4EH9A 4HPTE 2XK9A 5E8YA 2C6KA 4CT2A 2PK9A 1JSUA 2C6IA 3IOPA 4JRVA 4KABA 3ORLA 5CAUA 4WD5A 2GDOA 3TT0A 4CFVA 1YI6A 2X0GA 3VS2A 4HW7A 3AD5A 1XR1A 2UZOA 3TWJA 5IA2A 5F95A 1WBOA 4BCIA 4Y5QA 4RFZA 3UYSA 4L7FA 4O0WA 5CU0A 4EJ7A 3JVRA 4AXAA 4G3CA 3R7EA 2W1ZA 2BCJA 5FXQA 3MH3A 3HP5A 1B38A 4E7WA 4JQEA 4PDYA 4JS8A 3QCQA 4QTAA 4D2PA 2ZDTA 4U9AA 4UEUA 3UOLA 4QP4A 4IDVA 3EIDA 4A9UA 3SA0A 3FJQE 3GP0A 4X7QA 5FDXA 4FMQA 3GOKA 4XV2A 4NL0A 2NRUA 1KV1A 1ZZLA 4BDIA 4LQMA 2YM5A 4M84A 5L8LA 3CPCA 3VAPA 5GZAA 2OIDA 2PY3A 3DTCA 1LPUA 3PPZA 3GU7A 3QCYA 4TT7A 1VR2A 3RZBA 4BCJA 4EEVA 5M4IA 2UZVA 3ZOSA 4IWPA 1DI8A 4L3LA 3QU0A 1APME 4IX3A 4TXCA 3ZXZA 4YZNA 4BCGA 3BX5A 3VS1A 4OTGA 1WBVA 3D7ZA 3HMNA 2QHMA 2PE2A 3MTLA 4FKSA 5FEEA 4QP8A 2FSMX 2JIIA 3GUBA 4XG9A 4UYNA 1JQHA 3OXIA 4FKTA 3RM6A 3T9IA 3ZTXA 1H1PA 5HHWA 3IW4A 3P23A 4A9SA 4YTHA 1YOLA 1XQZA 2BUJA 5AUVA 1BYGA 3VQUA 2YA9A 4IB1A 3O23A 4PDPA 1IR3A 2ERKA 3D83A 1KE9A 1VEBA 3PJ3A 2R9SA 4A9YA 5M09A 3HDMA 4BICA 4QYGA 3UODA 4EOSA 3R21A 1M14A 3FAAA 1I09A 1YDRE 4S34A 4EQMA 4Y5HA 2EUFB 5AP6A 5IEYA 1J3HA 2GFCA 3KCFA 5CSXA 5IUHA 2QCSA 1FGIA 4M3QA 3LE6A 4F0IA 4II5A 4NTTA 3C0IA 2HZ4A 3ZFMA 4EK3A 5EK7A 4BGGA 3N4TA 3C4FA 4MWIA 3JXWA 3LQ8A 4WHZA 5HE2A 4JR3A 5IKWA 2VO0A 2VWBA 2YABA 4O0VA 4O0UA 3Q2MA 5EDQA 3DLSA 3BQCA 1S9IA 2EXMA 5I5ZA 2CHLA 3P4KA 4L42A 3R8UA 5HICA 4IVCA 5KZIA 3O8TA 3R0TA 3HX4A 1REJA 2ESMA 3Q4TA 2FO0A 5J95A 2W5HA 3ID6C 2OIBA 5I3RA 3QFVA 4E4NA 4HVDA 3WILA 4RX5A 4QYFA 3T3UA 2YISA 1UU3A 4XYFA 4QMQA 2X6EA 1SMHA 2IZSA 3CEKA 4G6OA 4S33A 4TTHB 2I1MA 2CSNA 3NIZA 3LFAA 3FY2A 3M2WA 3IDPA 3BI6A 5AMNA 3SOCA 5KE0A 5HU3A 2HY0A 3O0GA 5L8JA 4K11A 4B7TA 2JKMA 2JDOA 5J1WA 2VWUA 4J52A 5HZNA 3ATSA 3MFUA 3EMGA 4LL5A 3F69A 4ANLA 4F1TA 4S31A 1YXVA 4W8DA 3PP1A 5HVYA 4X3FA 4YC8A 4JXFA 4B6LA 2R3JA 2YM3A 2ITXA 2BKZA 4ACHA 4FKQA 5LWNA 4PL3A 1KWPA 1A48A 3LKMA 3BCEA 3GFEA 3GEQA 2ONLA 4G5JA 1OUYA 3BIZA 5L8KA 4EOKA 2XBJA 2CKEA 2DUVA 5ANGA 5JGBA 4L52A 3HUCA 4D4VA 4I6FA 4RIXB 3PWYA 3U51A 3BLRA 3PXZA 3K54A 5DWRA 4EH6A 4FV4A 5I0BA 5CEMA 5JGAA 2BFYA 1ATPE 2IW6A 4XNEA 5HNBA 4C58A 2W4KA 4ASDA 4CMUA 5HQ0A 5AP2A 5HE3A 3QCXA 2WMBA 4I23A 1ZYJA 2QR7A 4BF2A 3KN5A 4C38A 2R3PA 4F08A 4CV9A 5I9XA 2BZKB 2VO7A 2VTQA 4JDJA 3RAWA 4ZLOA 1H27A 2YN8A 5ICPA 4CFXA 2W06A 4FTLA 4YC3A 3LPBA 3IPHA 4FYNA 5HG7A 1DAYA 4W9WA 3TI1A 3TV4A 4NUSA 4E93A 2C6TA 1AQ1A 3DBDA 1WBWA 4YC6A 5IUGA 4L53A 1Z57A 2BALA 4FKWA 1STCE 4C59A 3EH9A 3ZSGA 3NNVA 5CYIA 2R7BA 4QP7A 3FSKA 4JNWA 4XG7A 1PXKA 5EOBA 4IX4A 2E9UA 3N51A 3ET7A 3GVUA 4FNXA 4EQUA 3KRRA 1HCKA 3CJFA 4YUQA 5LARA 5LQFA 4ONAA 3BYOA 3Q9XA 1YQJA 4YPDA 3EJ1A 2UV2A 4BBFA 3F82A 4JDKA 3E93A 2UZWE 4LOOA 2WTDA 4QMZA 4DEEA 2WEVA 4NW5A 2I7QA 4HVIA 3HRCA 5ANEA 5H2UA 4F0FA 5CF4A 3MW1A 5JSMA 4I94A 4N6YA 4KIPA 4FUYA 4FK3A 4AU8A 2WPAA 3G0FA 4U40A 5CT7A 4FV9A 3R02A 3DAEA 4JQ7A 4CFWA 4K8AA 2OI4X 1ZMUA 3TCPA 3UO6A 4Y85A 3IKAA 3K5UA 4TYIA 4BCOA 4EL9A 4ASZA 3S2PA 5HG5A 3R7OA 1PXNA 1WMKA 4GJ2A 4LI5A 4MNEA 5J79A 4E6AA 4U3ZA 3IW7A 3R22A 3QX4A 5EDPA 4EUUA 4PMSA 5EKNA 5HG8A 2PPQA 3Q4CA 3C5IA 3ZMMA 2X8IA 1QPEA 2ERZE 2W1HA 4NU1A 4I21A 4QTCA 5AR3A 4G16A 3P7CA 1J1CA 4RWLA 3S00A 1W82A 2R3MA 3QUDA 5EM5A 4CV8A 2G01A 2OSCA 1P4FA 2PMNX 4EC8A 4EYMA 3SV0A 2WGJA 3G9LX 4FA2A 4W4WA 2OLCA 3R9RA 4DH5A 4BIBA 1H0VA 5DE2A 2VO6A 2CGUA 3HP2A 4AN2A 2BVAA 5AP0A 3BHVA 5HESA 4I92A 4GG7A 4ZSGA 2QLQA 5CVHA 2H9VA 4FIGA 3ORPA 5T6KA 4NEUA 4D1XA 2NNWB 5AAEA 2FSLX 2HOGA 4LOPA 3QRIA 4RC3A 5FXSA 3DBEA 1FMKA 4MF0A 3VW6A 2GMXA 4DFYA 3VQHA 4J1RA 5L3AA 1P4OA 2I6LA 5F94A 4B8LA 2GHGA 4Y72A 4C0TA 2JGZA 3R1NA 3R83A 5IA1A 3II5A 5HU9A 3H9OA 4YTFA 3DKFA 5L6OA 3AT4A 2BTRA 3EFKA 4KAOA 4XH6A 2W1EA 3ZUUA 2WMXA 4ANSA 1GOLA 4BKJA 5JH6A 1R0EA 2X2KA 4AFEA 4PTGA 4FZ7A 3FKOA 4EH3A 3QA0A 3FEGA 2QO7A 2PE0A 3KXZA 3QC4A 2G1TA 4RPVA 2CCHA 4BDGA 5ANOA 1QL6A 3K2LA 5DT4A 2W5AA 5BQ0A 3QTWA 5B7VA 3PLAE 4AE9A 1ERKA 4KUJA 2A19B 2XYNA 3ZS5A 5HVJA 3EYHA 4A06A 4FSRA 4F7NA 3R8MA 4GEOA 5EI8A 3H9RA 1J7LA 3KF4A 3EL8A 3UDBA 2X9FA 5DYJA 2RFNA 3E64A 3V5QA 4QMYA 4E4LA 2WQOA 2Y4PA 4FTIA 3BU6A 3O50A 4C57A 4FNYA 3UG2A 3PG3A 3LVPA 5M4FA 3FKLA 1BL7A 2VZ6A 4GV1A 3AC5A 4TWNA 3V51A 5DR6A 5JEBA 2PE1A 1O6YA 2QONA 4ITHA 4KWPA 4C36A 2C30A 5ETCA 4L7SA 4PTCA 4D9UA 4WRSA 4IDTA 2FGIA 3QQUA 1Z5MA 4OAVB 4EZ3A 5E8WA 4EOOA 2WU7A 5BVEA 3D2KA 3IGGA 5A14A 4IAIA 5HGIA 2EVAA 4H3PA 4GU9A 2W9FB 2VRXA 2BHEA 4ZS0A 4R8QA 4NFMA 3FMEA 4YZ9A 4CCUA 4MAOA 4NZWB 5HCXA 1OKWA 2YM7A 3RK5A 5CNOA 2R3OA 5CANA 3C4WA 4ZP5A 3L9MA 3ENMA 4FTNA 3RPOA 4BYIA 3LJ0A 4UWYA 3S0OA 4Y83A 5D11A 2W96B 2NP8A 2OZAA 3PXQA 5M08A 2Z7SA 3HA6A 1PMVA 2Y8OA 3ZZWA 2XEYA 4G5PA 3NCZA 5E8TA 3VNTA 5CENA 3LJ1A 4UMRA 3MFSA 4FG9A 2C3JA 3LXKA 2IVTA 3IONA 1CTPE 3PJCA 5IQFA 3BHHA 2C6LA 2XKEA 4NM5A 1JOWB 4BCPA 5HX8A 2P4IA 1ZXEA 5ETAA 5J5TA 4OTFA 1PXOA 4C4JA 5H8EA 2GNGA 2Y7JA 3QYWA 4YHTA 5TF9A 5AX3A 5LVLA 3FKNA 2X7OA 2YIQA 5IG1A 1TQIA 5FLFA 2H34A 3I4BA 3L8PA 2IZTA 4BI0A 5KMKA 3R9HA 3P5KA 4OUCA 4XX9A 3RK9A 3PRFA 1MP8A 4MKCA 2PVMA 4OTHA 4WNKA 2XYUA 3A62A 5CU3A 1SNUA 4IADA 4F4PA 1UWJA 4YBKA 4D1ZA 4GIHA 4R78A 1ZY5A 3OTUA 3R63A 3R8VA 4HZRA 2UW3A 2W7XA 2YITA 4WNPA 3SXSA 3AGLA 3D15A 3LW0A 3A8XA 3FHRA 3PVUA 1YHWA 2W4JA 4BWXA 1VZOA 3U9CA 4FICA 4O7VA 5D7AA 4BHNA 1T46A 3N4VA 4QPMA 4C37A 3F61A 5T68A 5BVFA 2VTNA 4IB5A 2FVDA 3E8CA 2WNTA 4HJOA 4DLIA 3A7JA 4M0ZA 4MBJA 3R00A 2JDVA 3AMYA 2VTHA 4A4OA 3U4UA 4FL1A 2C1AA 3E62A 3OBJA 3FL4A 5K3YA 4BTJA 4ORKA 4GK3A 2YIYA 4GRBA 1KOAA 2YM8A 3GU4A 4XV9A 1H1RA 4MWHA 3A2CA 3OS3A 5E8ZA 3KULB 4TN6A 3DPKA 3D5VA 3VS4A 4AZEA 5CAQA 4EH4A 3ZRMA 3MPAA 1M17A 4O7YA 4BVUA 3U6JA 3OHTA 2HZIA 4KINA 3OCBA 4IB0A 2I40A 4UY9A 4N57A 2XUUA 1G5SA 3P1AA 3OVVA 3PZEA 2CKPA 3HMIA 5H9BA 1Q41A 3DXQA 5HNIX 3HECA 3RHKA 4GSBA 3RI1A 4G1WA 4YHFA 3VC4A 3MY5A 4AWIA 2WMAA 2UVXA 3DB8A 3REPA 4O84A 1F0QA 4NFNA 4GKHA 4CLJA 4KIQA 4IVAA 4Z55A 3VBTA 3U8WA 4EOJA 4PMTA 2J9MA 4IE9A 5AV1A 1RE8A 5CI6A 4BWKA 1A9UA 5L2QA 2XK4A 1LUFA 2J6MA 2YDIA 2B53A 3QQHA 4A4XA 3RBWA 1OUKA 4HVGA 4B8MA 5EW9A 4APCA 3TNPC 1MRYA 2HWOA 3Q9WA 1R39A 2ITTA 2F7EE 2PVFA 3R7YA 4ZJVA 5TT7A 4NYEA 3Q60A 5AP5A 3CTHA 4C02A 1IA8A 2OG8A 4RT7A 3ZU7A 4B99A 2IG7A 3BBTB 3BZ3A 4CVAA 4O7WA 2WTWA 3M11A 1JVPP 2IJMA 3FPMA 2VWVA 3QHWA 5AR8A 2WB8A 4A9RA 4RX8A 3AC3A 4AUAA 5CAVA 4ZMFA 5AFVA 5CTPA 2C6DA 4BC6A 1SNXA 4KD1A 3Q4UA 4KKEA 4D58A 2BRMA 2VTPA 5KCVA 2XIKA 4LYNA 3COKA 3OP5A 4DA5A 4F65A 4Z16A 1T45A 4AW1A 5C4LA 4BBEA 2B1PA 4IAZA 3TN8A 3I0QA 3Q52A 4YZCA 4NK9A 4RMZA 2R64A 5DBXA 3GCQA 5AEPA 2C0OA 2XKCA 3PJ1A 4ZLZA 5HD4A 3QRUA 3LFDA 4ITJA 3R2BA 4C4HA 4DE4A 2E9NA 3UO4A 3PG1A 4ASXA 3F3ZA 3CQUA 2PVJA 4C62A 4QP6A 2VTIA 3NDMA 2QR8A 2R5TA 2WHBA 1HCLA 4PV0A 4FBXA 1WVWA 3MA6A 3OCTA 2OW3A 4CD0A 3MYGA 4JQ8A 1E1VA 4WO5A 2FSOX 1SM2A 1TVOA 3V5JA 3WE8A 5IQDA 4LRMA 3I79A 3DZQA 5J8IA 4OTQA 4JBVA 2IO6A 3G6GA 4ZY4A 4CMOA 2YM4A 2ZOQA 5FWKK 2WTVA 1Q8UA 1JKKA 3EWHA 3LAUA 3F3UA 3PZHA 3TUCA 1YKRA 2Z7RA 1Q8ZA 2C6OA 2YERA 4RG0A 1J7UA 2JIUA 5A4EA 1W8CA 4YNOA 1BUHA 4DEAA 3QRKA 3ZO1A 4ERKA 4IM3A 1YOJA 3VUGA 3ORMA 2J51A 3OT3A 4U0IA 4R7IA 2GHLA 2PZYA 2P55A 3FQSA 4FYOA 3SX9A 1UKIA 1YXTA 3GC7A 2B9HA 3TJCA 4BDKA 3NRMA 4DH3A 2BZIB 3QZFA 4KSQA 5IQAA 3TKIA 3R28A 3M42A 3FI8A 3AMBA 2YCSA 2OJFE 3W16A 4YJTA 2WFYA 3I7BA 4BCNA 4CZTA 2PUNA 1UVRA 3ZFYA 4FV6A 3EQFA 5GINE 5HCYA 3LM0A 4O38A 3CD3A 3Q32A 4E6CA 3BV3A 2XCKA 3NUXA 4EBWA 3ZO2A 4J96A 3R7VA 3UPZA 3KA0A 3MPTA 3GENA 3W10A 3ZONA 3DXPA 5FP6A 4JDIA 5DIAA 4GFMA 3ZEPA 1YW2A 1W7HA 4O21A 4W4YA 5EG3A 5HNGA 2W1DA 4F9WA 2VX1A 4DT8A 2PVNA 4RBLA 3TDWA 5FGKA 2Z60A 4FSMA 3IO7A 4UZHA 4A07A 4OGRA 5LCKA 3VUIA 2CN8A 4CLIA 4TWOA 2QKWB 4E1ZA 4M0YA 2B7AA 3PJ8A 1QMZA 2VWZA 4KKHA 4L44A 5HE1A 4P5ZA 1KE6A 4F7SA 2IPXA 3HNGA 4X0MA 3VS6A 4ZSLA 4IJPA 4Z3VA 3FLQA 2Y6MA 1XBAA 2NPQA 3D4QA 3RPVA 5EW8A 1DS5A 3K3JA 3QTQA 5CQWA 5CASA 2UZTA 3E3BX 3R2YA 4PRJA 2OJIA 3LCTA 2ITPA 4RJ3A 5KHWA 1Q97A 5AUZA 1UNLA 2BILB 2JC6A 3KULA 5DNRA 3BEAA 4D0XA 3GB2A 2OXDA 4F1OA 4JLCA 4YLJA 5ITAA 3W8LA 3ZC6A 1FOTA 3FI2A 4C4EA 4AGWA 1M2PA 5E1SA 3W2QA 2VN9A 4H05A 3DBQA 4X6QC 2NO3A 1W0XC 2VU3A 3BGQA 4AT5A 4MNFA 3PE1A 2JKQA 2R3LA 3GCPA 2W05A 3EZVA 2VGOA 3IS5A 2W0JA 3KCKA 2RFEA 3BQRA 3LFEA 3MVLA 3O2MA 4R3PA 4O7ZA 2YLFA 4Y8DA 3BYVA 3DNEA 4IWQA 1XBCA 3SW4A 2FB8A 2WEIA 3UOKA 3U55A 3E3PA 5AIKA 5TOZA 4U8ZA 4IAYA 1Q24A 5AM7A 1WBSA 4NW6A 4OTIA 3FLNC 4BDCA 3FLZA 3O17A 5FG8A 4JG8A 3GT8A 4G31A 4W9XA 4HVSA 2G2FA 4BWPA 3KN6A 2PZ5A 3HLLA 3NW6A 3K5VA 4FEQA 4AGUA 4F7LA 4P7EA 4UMQA 4IACA 1OVEA 4DGOA 3KK8A 3IW8A 4BGQA 2OBJA 3A4PA 1OIYA 3POZA 4AT3A 5A4CA 4G3EA 4JT3A 1OL2A 2C3IB 3FPQA 1RDQE 4EHVA 5DMZA 5CEQA 2DYLA 3EQCA 3IQ7A 4EOMA 5TE0A 2Q83A 1OZ1A 4OW8A 1NT2A 5AA8A 3FYKX 3PFQA 3ODYX 3U6IA 2O0UA 1PMEA 4XG3A 1Y8GA 2BPMA 3R9OA 4Y95A 2VTAA 3BPRA 3KXNA 4M97A 4DINA 1Y57A 1Q5KA 2VWXA 4JOAA 1XH9A 2YCQA 4FKIA 4QRCA 4U97A 3U6HA 1OIRA 2O65A 5KKRB 3DK7A 3QZHA 1P5EA 5L4QA 4I5MA 3ORXA 4J98A 3KKVA 3UVPA 4EOPA 5HTBA 5A9UA 2UZLA 2JFMA 3AMAA 3ATTA 4FVPA 4DN5A 4H3BA 2JAMA 2YCFA 3A4OX 2BRNA 4HYUA 3UNZA 3FSFA 4NTSA 3RMFA 2A0CX 3EQGA 3V6RA 5FEQA 2UZEA 2WMRA 3DQWA 3PTGA 3PXFA 2W1CA 4YLLA 2OKRA 3AD6A 4AW2A 5DR9A 5E90A 2XA4A 4BGHA 3UVQA 2GSFA 4FT7A 2HYYA 3AD4A 5IMEA 5GJDA 4L43A 4FZ6A 4TKSA 4TZRA 4YTIA 3DTWA 5HTIA 5DLSA 4TYJA 2X8EA 2J0JA 3DY7A 3EOCA 2C5VA 4FV1A 4AE6A 4IJ9A 2PULA 3WZKA 1DI9A 2XNPA 3EFJA 3HV7A 3D5UA 3U54A 5EYKA 3KU2A 2OFUA 3V5LA 4C33A 5J9YA 3UO5A 1JKTA 2WQMA 2JFLA 3G9NA 4JI9A 4UYAA 4C8BA 3TL8A 3RKBA 4BDJA 1JLUE 3BU3A 4OT5A 4YU2A 5CEPA 1Q8YA 1R1WA 3LCOA 3Q53A 4J95A 4RZVA 4DH8A 1URWA 3FI3A 2I0YA 3QGYA 4IANA 1H25A 1ZYDA 4ACMA 4BI1A 4MXZA 5AUYA 3QXPA 3O8PA 4EOQA 1YI3A 3I7CA 3OROA 1M52A 5CZIA 3FL5A 1RW8A 4ZMEA 2PMIA 1WBPA 3W2RA 2ITUA 2PMLX 4R3CA 2Z7LA 5KZ0A 4D1SA 1F5QA 2BDFA 5FM3A 2XK6A 4H1MA 2XIRA 4LGHA 4EOLA 5A4TA 5DVRA 3VUHA 3FXXA 2ZV9A 2XIXA 4P4CA 5AR2A 5I9WA 3CQWA 3RPSA 3PIXA 2AC3A 2J0IA 3BKBA 2R3GA 3HV5A 3F3VA 3LFCA 4RWJA 3CGOA 5CEKA 3LXPA 2BAKA 3EN5A 3JPVA 3A7IA 4WG4A 5IUIA 4BCMA 2F49A 5ETIA 4FODA 4GT4A 4P90A 1YXUA 4DGGA 4FEUA 1SVGA 3LMGA 3VS5A 4PPAA 3R7UA 4DEBA 4AW5A 4AG8A 5DN3A 4O0YA 2IW9A 4I6BA 5AV2A 5C27A 4RWIA 3EFWA 3PP0A 3HKOA 4O91A 2UW0A 3UVRA 4IAAA 5C8MA 4A9TA 3L8SA 1WFCA 2F9GA 2UUEA 4QMWA 3RGFA 3TIZA 1BLXA 2JBPA 4TY1A 4RJ5A 1OIQA 2WKMA 3PLSA 3OW3A 3VRYA 3WYYA 4ACGA 4YO4A 4YR8A 5HE0A 1FVTA 3D7TA 4XG6A 5D7VA 4FZFB 5L2SA 3P78A 1BKXA 3QAME 5DT3A 3W8QA 5IQHA 5D41A 2WO6A 3H4JA 3UQGA 2G2IA 1IAJA 2C6EA 1WVXA 1M7QA 2XCHA 3DAJA 3P9JA 3U4WA 2Y6OA 4DBXA 5KMLA 2CGWA 4IB3A 4X3JA 1PXJA 2XMYA 1ZRZA 2WU6A 4JAIA 4BBMA 4AQCA 1XH5A 3NCGA 4I4FA 2OWBA 2QURA 3RTPA 5JMSA 2ZYBA 3KQ7A 4PP9A 4JG7A 2HAKA 4LFIA 4NM3A 4CXAA 3NUSA 4DFXE 3JY0A 1DM2A 4ZIMA 4M66A 5C26A 4PL4A 4F63A 4YSJA 4QPAA 4X3FB 5AUWA 4UMUA 3OXZA 3T9TA 1M7NA 2CGVA 3W2CA 5K4JA 2ITOA 5EM8A 3FQEA 3RWQA 2B4SB 4JJRA 3NAXA 3PVBA 5HLWA 1O9UA 1OM1A 4PDOA 3BWFA 5EW3A 4FSUA 5DPVA 2F2UA 2ZMCA 1KE8A 5M57A 4XS2A 2GCDA 5AP3A 4D4YA 3AGMA 1BX6A 3RAIA 2GQSA 2QHNA 3UNKA 3FC1X 4GUEA 1XBBA 3AC8A 1IASA 3QZIA 3G0EA 5H3QA 3HAVA 4IHPA 2XJ0A 4RVLA 5C9CA 3R8LA 2RIOA 2ETMA 4FSNA 4ZJJA 3WZUA 5FQDC 4FGRA 3F3TA 2OK1A 2VO3A 4ZSJA 4S2ZA 4LG4A 3V01A 5EI6A 4ALUA 4XRLA 2BAJA 2ZMDA 2X2LA 3NNXA 2V0DA 5HCZA 4O7TA 2F2CB 1WBNA 1SYKA 4E6DA 4Z7HA 3OFMA 4MK0A 1QPCA 4M13A 4FZDB 4C2VA 2CNUA 3TTJA 3ZC5A 4YJOA 1F3MC 5JRQA 2C5XA 4XHKB 4FIEA 4M67A 4YJPA 3D2IA 2Y0AA 2X81A 3PY0A 5LMAA 5JZJA 4YZMA 2F7ZE 4M8TA 5HO6A 1BL6A 2YACA 4K18A 3UMXA 2JBOA 1Q62A 4IM0A 4AW0A 5D12A 3CQEA 2ITYA 1GY3A 4E4MA 3ENHA 1TQMA 2R3HA 4NWMA 4HCVA 2B54A 4HYIA 4YLKA 2CCIA 4YHJA 3NYOA 2JAVA 4I22A 4RIYA 5CY3A 2W4OA 2WQEA 3IDBA 3OZ6A 3QQGA 5CLPA 3KRWA 5ACBC 4DG0E 5K0XA 4ZTQA 3PVGA 4CZUA 4KIOA 3WF8A 3RALA 4FTCA 5J7BA 3G2FA 3AT3A 3OTVA 5BNJA 5GZ8A 1YRPA 3OC1A 5G1XA 2B55A 3C51A 3FMLA 4GT3A 3UTOA 3ZBFA 2OF4A 4GU6A 3GFWA 3UE4A 4HNIA 4APPA 2XIZA 5IEXA 4EWQA 4RVMA 3SGCA 2ZB1A 4PWNA 1VJYA 2ZM1A 4O7LA 3GQIA 4OLIA 2C68A 1FMOE 4FG8A 2VTLA 2EWAA 4FX3A 1H01A 3FZPA 5EQEA 3ZM9A 4BDFA 1YDTE 3QLFA 2GQGA 5BYZA 1PXMA 3EZRA 3OEFX 4MBLA 4D2RA 4CGAA 4QNYA 5BVOA 1RQQA 5B2LA 1YXSA 2CN5A 1A06A 1UWHA 2Z8CA 4RFMA 5DEYA 5IH5A 4DFLA 4RZWA 4PUZA 3PPJA 2FH9A 4Z9LA 1GZ8A 1ZWSA 3MDYA 4GK2A 4QP2A 3EB0A 4GH2A 4JBOA 4RIXA 4XMOA 3OW4A 1VYWA 4IEBA 1PY5A 4EK5A 4F9BA 5A4LA 2HZNA 4QMXA 5CNNA 3ORKA 3WZDA 3FZSA 1H0WA 3D14A 5HVKA 5JT2A 5KMMA 3BHTA 4AN3A 5DRBA 2W9ZB 2WZJA 4BCKA 1PXLA 4CYJA 4AZFA 3PJ2A 5IEVA 3I5NA 4CTCA 4MCVA 2R3RA 3QGWA 3ERKA 4O1PA 2WMUA 3VBXA 4E4XA 3RNIA 2J4ZA 5L6PA 3MFRA 4YPSA 3KEXA 3DCVA 4E5BA 2RL5A 5T3QA 3FLWA 4DG2E 4L67A 3T3VA 3KK9A 4QP9A 5LJJA 2QD9A 5CAPA 3E88A 3ORNA 3QF9A 3ZLSA 5IU2A 4EUTA 3PDTA 5AAFA 3F9NA 4H58A 4EHEA 5A6OA 2HCKA 3TM0A 4RIYB 2RG5A 3Q6UA 4FKRA 5FTQA 3QTZA 1OBDA 3VWAA 3R1YA 4M68A 3LMHA 4X2JA 2PMOX 3TZMA 4YTCA 4C35A 4U42A 3CKWA 3QA8A 4OTDA 4AAAA 3UQCA 3H9FA 3NVMB 2VTTA 3DKCA 2XKDA 2CGXA 3O96A 3NYNA 3AC2A 1G8AA 4EH5A 3HMPA 4O83A 2JLDA 2JIVA 3DBFA 1H00A 1NXKA 4UV0A 4QMOA 4H36A 4XBUA 5DH3A 3OWLA 4BI2A 1WZYA 3I5ZA 4K33A 3NX8A 1AGWA 3U9NA 3BLQA 3K3IA 1H26A 4DFZE 1OL6A 3ALOA 3UZTA 5TKDA 4BKYA 2QKRA 3WF7A 1H1QA 3DK3A 4CKJA 2R7IA 3A7GA 3I81A 4ANQA 1I44A 5I9VA 3DZOA 2R3NA 5AP1A 1IG1A 1PXPA 3ZLWA 2VWIA 4BR3A 4O2PA 1ZOGA 4Y46A 4S32A 2PHKA 4DEHA 4FZAB 4GIIA 4WG5A 3FZRA 4CQGA 5TR6A 3F5PA 5HG9A 3B8QA 3TZ7A 2ZM4A 4UWCA 1Q3WA 3DS6A 5BUIA 2JKKA 3WF5A 5IMXA 5D9HA 3CLYA 4Q5HA 3NS9A 2XF0A 4PQNA 4YGAA 5BMSA 5AV4A 5CF8A 5AJQA 1RJBA 3Q4ZA 4JX7A 4Z7GA 3TNIA 2J0MB 4I5HA 5HIEA 3TV7A 3TZ8A 4BB4A 4CFFA 4ZY6A 4OR5A 5BVWA 5M53A 3QTUA 5M56A 4D2WA 5CXHA 2YWVA 3AG9A 4EKLA 5I4NA 1NY3A 3VS3A 4UWBA 4EHGA 5JK3A 5HO7A 1JKSA 2OF2A 2FYSA 4WG3A 3G90X 2C6MA 4X3FC 4MD8E 3BRBA 3D5XA 3GCUA 2OH4A 3BHUA 5L6WL 4OTPA 4ANMA 4E20A 1X8BA 3UIMA 4E8AA 4IAFA 2QOKA 2O5KA 3PSDA 3KXMA 3F66A 4MNEB 1WVYA 4TYHA 3FBVA 2GU8A 1OPLA 2QOOA 2QI8A 3QRTA 3R1QA 4KS7A 3V8TA 4AOJA 3BLHA 2ZAZA 1CKPA 5D1JA 3ULZA 4FEWA 4NKSA 4RWKA 4ANBA 5HTCA 3RWPA 2V62A 4L3JA 4LGDA 1YOMA 4IXPA 4RC4A 4U81A 2CNQA 5GIOE 3C4CA 2ETRA 5HBHA 5HOAA 4EHZA 3FV8A 4G9RA 4LRJA 4G34A 4W4VA 4HGLA 4KIKB 3L9LA 4BYJA 2XVDA 2DQ7X 3NMUF 3QHRA 2C0IA 1PJKA 1NVQA 3U87A 5HD7A 2PVHA 4FT0A 2OJ9A 3E8DA 4IW0A 1MUOA 4DBNA 2WMTA 2NRYA 4QMSA 2ONLC 4RX9A 1U54A 3R7IA 2ITNA 2WXVA 4YJRA 4FIJA 3MS9A 4ACDA 2WD1A 3W1FA 3SD0A 4AZTA 2VV9A 3IOKA 2VTOA 4FI1A 4MD7E 4HGEA 1H8FA 3L9NA 5CEIA 4QMTA 3GU8A 4ZZOA 5JQ5A 1E1XA 3IECA 1YWNA 4TPTA 4LOQA 4ZTLA 4G17A 4ZEGA 3ZO3A 1XH7A 5HLNA 5GHVA 3E63A 4KSPA 4RJ4A 2UW7A 3OMVA 4O0XA 1Q3DA 4C3FA 4C4GA 5FM2A 2FUMA 3I60A 3CKXA 4M7IA 1VYZA 1OBGA 2AUHA 2J90A 3KC3A 2W17A 4WSQA 4ANOA 5KO1A 3JUHA 4BRXA 3TUDA 4MTAA 5JGDA 4ID7A 2OZAB 5DEWA 4RQVA 4D5HA 3LJ2A 4X2KA 5AV3A 5KX8A 5KUPA 4MQ1A 1ZOEA 5L2WA 3POOA 2VX0A 3Q3BA 2XZSA 2P0CA 2UW9A 3H0ZA 4BZDA 3V04A 3MGYA 1PHKA 2WMSA 3H0YA 3HV4A 4MXXA 3QQFA 3V6SA 3ZSIA 4NJDA 5E91A 4AFJA 4C4FA 3AXWA 3LIJA 4DGMA 1J1BA 1YXXA 3WZJA 1PRYA 4R5SA 2VGPA 3NUYA 3O7LD 5JN2A 3VBQA 3DU8A 3L8XA 3LFNA 4YJUA 3DKOA 1K2PA 2IW8A 4USFA 4HGTA 5J87A 3FXWA 1H08A 4IZ7A 5J5SA 4R1VA 3ETAA 4HGSA 2OZOA 3TACA 3SG9A 4HYHA 4JBQA 4ARKA 2CJMA 2WAJA 2C69A 1ZY4A 3KMWA 4BL1A 4I6QA 5IDNA 4FV3A 3QTIA 5JFSA 2J2IB 4BIEA 3R1SA 4GCJA 3GC8A 3MBLA 5CVFA 5J1VA 4NCTC 4QQCA 4G6NA 4TWPA 4WUNA 3TTIA 3NNUA 5J9ZA 4LL0A 5HEZA 3CP9A 4J97A 3WBLA 4QMNA 4R77A 3HGKA 3UPXA 3CD8A 3B2TA 3QC9A 4ZTHA 1Q8WA 2VUWA 3OWPA 4LMUA 4P2KA 4AOTA 5CU6A 3NNWA 2X39A 5BVKA 2YLEA 3ZEWA 4FEXA 4KKGA 3LFFA 3KFAA 3RAKA 4IIRA 2XIYA 4U79A 4KRDA 4NH1A 3EHAA 4H39A 4R3RA 5G6VA 4CNHA 4EZ5A 3G6HA 5ACKA 4DH1A 1NA7A 5H8GA 3ORTA 2Z02A 5EOLA 3WOWA 4ACCA 1U59A 4IZYA 4LUEA 3UIUA 3MH2A 3QKMA 4GVJA 4BDDA 4O0RA 4XEYA 1O6LA 4L8MA 4GYGA 3FWQA 2R0IA 3KXHA 4ZY5A 1YWVA 4WRGA 5AR5A 4IMYA 2XNGA 3F3WA 4OBPA 4QTDA 3TZ9A 4XJ0A 4D9TA 4F0GA 5AUTA 5A3XA 2Z2WA 3P86A 3DBCA 1WAKA 3NUAA 4QPSA 2HXLA 1ZYSA 4H3QA 1W98A 4MX9A 3QKLA 1B6CB 2REIA 2PSQA 1U46A 3F7ZA 3VBWA 2B0QA 3EN9A 4CMTA 4IX6A 2A4LA 3ZXTA 4D2SA 5A46A 4NM7A 3BE9A 3P7BA 4IM2A 2XRUA 1XH4A 3BBWA 4L46A 3EQPA 3UC4A 3Q5ZA 4O0TA 3MVMA 3PSBA 3VBYA 5AA9A 2X6DA 5ANIA 4UXQA 4BDAA 3ZDUA 5A54A 3QQKA 1Q8TA 5C01A 4PNIA 5EHOA 4XLVA 4CFUA 3F5UA 5DT0A 4DFBA 4AA5A 5E92A 2YIXA 4JBPA 3VN9A 3LXLA 3HRBA 5CSHA 3S1HA 1YHVA 4FKLA 4N0SA 4XCUA 3C4ZA 2HY81 5FDPA 5EQYA 2BFXA 3QKKA 3KXXA 4D4SA 2JD5A 4QOXA 4MH7A 1BMKA 3B2WA 3QTXA 4JG6A 4TYHB 3LFSA 5EFQA 2GNIA 3Q9ZA 3BE2A 4QT1A 4RQKA 4M15A 3UP7A 3VW8A 5CAOA 5K5XA 5AR4A 4ZTNA 5LWMA 3PIYA 4BY9E 3E7VA 4FVQA 2ITQA 3PA5A 4Y73A 5HI2A 4Q9SA 5A4QA 4U3YA 3OWKA 2O3PA 2HELA 3A60A 2BAQA 3VHKA 2QLUA 4P5QA 2PL0A 4PTEA 1PYXA 4QMVA 4TYGA 4XG8A 4E3CA 3MVHA 4PMMA 5LMKA 4AA0A 4GT5A 4XG2A 5M51A 4AOIA 3BU5A 3H30A 4EK4A 3RVGA 1PF8A 5M44A 3A7FA 2XRWA 3CR0A 3CC6A 3OY1A 5EYCA 3DGKA 4USDA 3I0OA 3QTRA 3SDJA 1OPKA 5C03A 2OJJA 4C7TA 3CGFA 2WELA 2BRBA 4O6EA 4FT5A 4QP3A 5E1EA 5BYYA 3PY3A 3ZUVA 3F7WA 4X2NA 4C34A 3V8SA 1K9AA 3CIKA 4FSWA 5JFWA 3V3VA 3SAYA 3DQXA 2XNBA 3CBLA 1V1KA 5AIRA 2X9EA 4AZSA 3NLBA 4FKJA 1XO2B 3FLYA 3N9XA 3DAKA 3KVWA 2FA2A 4LGGA 3ZZEA 2QU5A 2YAAA 3OOGA 4GUBA 4UBAA 4BFMA 2C1BA 1R0PA 4DEGA 2UW5A 4EJNA 2HIWA 3QQLA 2VTMA 4A7CA 4HYSA 3R30A 3HL7A 4LUDA 4TL0A 3FZOA 3DK6A 2QO9A 5F20A 3JS2A 4I24A 4XLIA 3BGZA 3W32A 1KE7A 3PA4A 5E8SA 3FMMA 3KL8A 1NVRA 4MXYA 4NJ3A 3HYHA 5KMOA 5E4HA 2ACXA 5I9ZA 4FT3A 3CSVA 1FQ1B 4DFNA 2OU7A 4KS8A 3D0EA 3FMDA 3GGFA 3E7OA 1OKVA 4OBOA 2YM6A 5KKRC 3GCVA 3ORZA 3H10A 4JDHA 4E6QA 4UZDA 3FQHA 4M12A 3G15A 2DS1A 4WOVA 4FKOA 2AYPA 2WTJA 3RCDA 3SXRA 3GI3A 4U41A 4AX8A 3EQIA 1OMWA 3ZLYA 1MRVA 2RKUA 3SHEA 4RIWA 2ZB0A 2CKOA 3C0HA 4RIOA 3VBVA 1IA9A 4CRLA 4R1YA 3C7QA 3HV3A 5EQPA 5K5NA 3R8ZA 4E5AX 4NKAA 2J50A 4MQ2A 4G3DA 4EZ7A 5AUUA 5IQBA 2GPHA 4JR7A 2ETKA 2E9PA 5KMNA 2ZV7A 3BGPA 3DNDA 5BPYA 1PXIA
chains in the Genus database with same CATH superfamily
3OCSA 1GAGA 5I3OA 3E8EA 5GIPE 4KRCA 2YIWA 4DITA 2BZJA 2KULA 3NUNA 3TKUA 2R4BA 3MJ1A 2R2PA 4ANNA 1P2AA 1DAWA 1S9JA 2X0PA 3COIA 4O22A 3ODZX 5M4CA 3C1XA 3Q04A 4RLKA 3ZCLA 5HIBA 5C4KA 2PZIA 2O2UA 5AX9A 3JY9A 3OUNB 2CDZA 4FKVA 4HCTA 5GJGA 4CQEA 4OTWA 1PYEA 5HX6A 5FP5A 3E92A 5LVMA 3LLTA 1L8TA 1O6KA 4XOYA 1GZKA 4DGLC 3BYUA 4ZTSA 1P14A 3O8UA 4C61A 5E9EA 1IEPA 4KNBA 5EHLA 4FR4A 2LAVA 4F64A 1NVSA 3O51A 4FTQA 3V5TA 3VS7A 3ZH8A 4I3ZA 3ZRLA 4XV1A 1JWHA 3EQDA 3UJGA 3CTQA 4QMLA 4JX3A 1KSWA 1OL5A 4L45A 4C2WA 3FYJX 4WKQA 3JR1A 1ZLTA 4CSVA 4FV5A 5JKGA 2UW8A 3EL7A 3A61A 3JVSA 4FSZA 3HRFA 5I9YA 4O27B 3ANQA 3OBGA 1OL1A 5EI2A 1H28A 4NIFB 4WIHA 1JAMA 4AZWA 4U45A 5CWZA 5EKOA 3SG8A 3NZ0A 2C4GA 3C0GA 3Q96A 3DFCB 3TG1A 4BTFA 4E26A 3AOXA 2XS0A 4PF4A 2CKQA 2J0KA 2V7AA 3ZFXA 2XAMA 4KA3A 4BCHA 2X7FA 4AGDA 4CCBA 4YMJA 2YFXA 1W83A 5HO8A 3FDNA 1FVVA 3ULIA 5F9EA 2PUIA 4EH8A 4K77A 2QO2A 3I1AA 3IW6A 4GYIA 4XOZA 4IH8A 4MXCA 4XP0A 2G2HA 2RGPA 3PYYA 4CFMA 4L9IA 2OJGA 3CE3A 3P0MA 2UZDA 3LCSA 4RFYA 4IVDA 1Q4LA 3LCDA 5DOSA 4DGNA 4MHAA 4ENYA 3OXTA 1SVHA 4O96A 5IH4A 4ASEA 3F5GA 3D94A 2I0HA 4BCFA 2WQNA 1GIHA 4X21A 3ZSHA 4USEA 3NPCA 3QX2A 4FTAA 4RSSA 1OECA 4HOKA 3GCSA 5F1ZA 5FBNC 4FL2A 4D0WA 4TNDA 2XBAA 1LP4A 1ST0A 1REKA 5IPJA 2PVLA 3IK3A 3KRLA 5ANKA 4DG3E 2BROA 3RJCA 4BTMA 5ETFA 4EC9A 3VUTA 4MBIA 3IW5A 4CYIA 1GNGA 2BIKB 3DDPA 1IAHA 4NM0A 5KMJA 4DCAA 5IQCA 2GQRA 1LR4A 4YSMA 1YVJA 4CG8A 4TNBA 4XUFA 2RFDA 3A8WA 4LV8A 5IDPA 4AA4A 5CSPA 4JVGA 2J5EA 3ZBXA 4HNFA 4LV5A 4FTTA 3C4EA 2E9OA 4I6HA 4RA5A 5LOHA 2C5NA 2ITZA 1XMLA 4FRFA 2RFSA 1OI9A 3G5DA 4DC2A 5BMMA 3HVCA 2EXEA 2WMQA 4EK6A 1UA2A 4PDSA 1ZARA 5FEDA 4IC7A 1M2RA 5M06A 4MVFA 3NW7A 4RJ7A 4M69B 2BDWA 2GHMA 3DLZA 3EKKA 4IWDA 2XP2A 3DT1A 5B2KA 3VO3A 2WTKC 5LVPA 4FEVA 3C9WA 4ZLYA 5DGZA 2QVSE 4N70A 1U5RA 4BDBA 5IA4A 1V0OA 2QOLA 5EM6A 4EH7A 4NIFA 2YZLA 4TW9A 4L6QA 2WIHA 1JPAA 5FD2A 5GNKA 4UMTA 1K3AA 4G6LA 2R3QA 1PKDA 3MN3A 3KREA 2Y4IC 4FIIA 3V8WA 2WMVA 3UIBA 1QPJA 2QC6A 5E8UA 2EB2A 3EN7A 4GW8A 2B9JA 2GNHA 3IG7A 4ENXA 5EM7A 4DAWA 2PVKA 5I9UA 2KTYA 4JIAA 1Y8YA 3QYZA 4FTUA 3TNHA 5EYMA 4EQCA 5KBQA 1KE5A 3EN4A 3KY2A 4GL9A 2GNFA 4FTRA 5JRSA 3ZRKA 1EH4A 4J53A 5DFPA 2GS2A 3FI4A 4FTKA 4TWCA 2UVYA 2XK7A 2B9FA 4PPCA 2IZUA 4F6WA 4DFUA 1OKYA 3NYXA 3P79A 1KV2A 4I5PA 3TXOA 2WOTA 4I41A 4DTBA 2X8DA 3F6XA 4L00A 3VIDA 1GIJA 4F1MA 4CFNA 4WSYA 2ZM3A 3DDQA 2QQ7A 4R5YA 5AAGA 3QLGA 4CKRA 1HOWA 4IWOA 1PMUA 4KB8A 3HEGA 3QBNA 4YBJA 4EI4A 2WTCA 4RC2A 3PXRA 4BN1A 4D2TA 4EBVA 2XAOA 2QOFA 3DA6A 3UG1A 4K6ZA 2V7OA 3GBZA 3TNWA 4QTBA 4UMPA 5FTGA 4QYYA 3W0PA 5EDRA 5EH0A 1H1WA 4R7HA 4IZ5A 3QCSA 4XG4A 5CSWA 5AWMA 2HW6A 4YJVA 4AN9A 3QWKA 1E9HA 1H07A 2ITWA 3D9VA 4FV7A 4JIKA 2XNEA 2E2BA 3LHJA 4RJ6A 1KUTA 1GIIA 3GQLA 4U80A 3OF0A 3MV5A 4NT4A 3OWJA 3QD0A 3HUBA 4YP8A 4U6RA 5TO8A 2ITVA 3KRXA 5J7HA 4O7NA 1XWSA 1PMNA 2EU9A 3RM7A 3RPYA 1BI7A 4AS0A 4QYEA 4OAUC 3LCKA 2XM8A 3QUPA 3MVJA 3UZPA 2GNLA 3A99A 3FLSA 2B9IA 2AEGA 2YJRA 1XH8A 2BDJA 2BZHB 4MYGA 3SC1A 2YAKA 4ZK5A 3PVWA 3MY0A 1M2QA 2WQBA 2RSVA 4XP3A 2AQXA 4ZTMA 4WBOA 1CKIA 3GNIB 4IVBA 3THBA 3W2PA 2PUUA 3SQQA 3HV6A 5HIDA 3HZTA 4DH7A 3TIYA 3I6WA 2A1AB 5CT0A 1CKJA 4ZTRA 4JL9A 2YDJA 5B0XA 3FXZA 3WF9A 4B4LA 3TDVA 3ALNA 3ZYAA 3OY3A 2JKOA 4BZOA 1LEZA 3WF6A 3L8VA 2GTNA 3NGAA 3G51A 1FGKA 4FTOA 4FOBA 4FL3A 4C4IA 3LQ3A 2UZNA 5DA3A 4EKKA 2BKKA 1ZZ2A 3PWDA 3FC2A 2GTMA 3E5AA 4HZSA 1ZYCA 3VF8A 3ZDIA 5IH6A 1AD5A 2P2IA 4AQKA 4J99A 3ZM4A 3CPBA 3IDCA 3KB7A 4J7BA 5M55A 2X4FA 3F88A 3JYAA 3NUUA 4GK4A 3SKCA 5FUTA 3PY1A 3UZRA 4C3PA 2H8HA 4DTAA 4G9CA 3UP2A 4DF3A 4QYHA 4S30A 4CG9A 4AF3A 4ALWA 1BI8A 5AADA 5B2MA 5LVOA 3PXYA 2C5YA 5AP4A 5BYLA 3OUKA 4B0GA 1J91A 4F7JA 3VJOA 3QTSA 4ZJIA 4UXLA 3UNJA 2XNMA 5E8VA 3UQFA 2QU6A 1GZOA 3R04A 4ITIA 3LM5A 3EQBA 2PVYA 1MQ4A 3NVKI 3WYXA 5CX9A 3VULA 2UZBA 4A4LA 4F99A 3Q5IA 2A2AA 5CI7A 1OGUA 4LM5A 4YURA 3KMMA 3P5JC 3MH1A 3NWWA 2IWIA 2OO8X 4UB7A 4WNOA 3HMOA 2ZDUA 5CU4A 1OGYA 3ANRA 4OT6A 4HVHA 3E87A 4G3GA 4DYMA 2F7XE 2WTIA 3QUEA 2PUPA 3VUKA 1UU8A 1B39A 1JNKA 1CSNA 2QOHA 3GU5A 4BIDA 3RAHA 1R3CA 3H3CA 5HKMA 3B8RA 4F9CA 4F6UA 2F57A 2JDSA 3SRVA 2AC5A 1LEWA 3HA8A 3PA3A 5DI1A 3GXLA 3S4QA 3RZFA 3ZO4A 4EOIA 4HCUA 4FVRA 2BTSA 4RIWB 4AXDA 3MY1A 4YJNA 1U4DA 5CVGA 2Q0BA 2XK3A 4QP1A 2OXYA 3NSZA 4YJSA 5ANDA 2QG5A 3VVHA 2PWLA 1L3RE 5BUJA 5CS6A 3OT8A 3QRJA 1YWRA 4K0YA 4K2RA 2VTSA 1WCCA 1QCFA 1ZAOA 5FBOA 5FTOA 2C3LA 3WARA 2PZRA 3OCGA 4BDHA 4ERWA 5LMBA 3PXKA 3Q2JA 5CQUA 4YJQA 1OPJA 4AT4A 2IVUA 2YZAA 1JKLA 3CY3A 4FUXA 1OIUA 2R3KA 2UVZA 5IA0A 2BMCA 2XB7A 5CALA 5HORA 3NYVA 3RHXA 1Q99A 4K1BA 2CNVA 1R78A 4FIFA 3AC4A 4GG5A 4LRKA 4C3RA 3W2OA 4JAJA 2YIRA 3MWUA 3OD6X 4TRLA 5IF1A 5K0KA 4GKIA 1H1SA 4W8EA 5DG5A 4FKPA 4PX6A 3V5PA 2R3IA 4FV8A 4Q5EA 3VUDA 3SW7A 3N4UA 4QDEA 2VTJA 3PFYA 3DJ7A 3C13A 3EQHA 1G8SA 3R01A 4FE2A 3KGAA 3QD3A 4MF1A 3UOJA 4EH2A 3GC0A 2WIPA 4DTKA 4QMUA 4DEDA 5CXZA 3UBDA 1CM8A 4FV2A 4XV3A 2P33A 4EK8A 1SVEA 3R9DA 4M69A 1ND4A 1OITA 2F4JA 2JDRA 4FIHA 5CU2A 4QQTA 2QG7A 3NFGB 3EFLA 4QTEA 2E9VA 3O7LB 1Q61A 2IZRA 1XHAA 1PW2A 3W18A 1J7IA 4WT6A 4F09A 3ACJA 2QOQA 5D10A 4FV0A 2PTKA 5BVDA 2J5FA 1FPUA 3R7GA 2GFSA 3OG7A 3EYGA 4ALVA 4V04A 5IQGA 4FNZA 4V0GB 5H8BA 1URCA 2VWWA 2YWPA 4XBRA 3W2SA 4DHFA 4I5CA 3BHYA 1TZDA 2BHHA 2FSTX 5HBEA 5AM6A 3G33A 3LOKA 4EYJA 5HBJA 2XM9A 4W4XA 5E8XA 3VJNA 4FK6A 4FSQA 2W1FA 2OIQA 4WUAA 4QNAA 2C47A 3ACKA 3MFTA 4R6VA 3WI6A 1YDSE 4J8MA 3DXNA 3C5UA 3DOGA 1YI4A 3CS9A 2Q0NA 1OL7A 3R71A 3UC3A 3CJGA 1PKGA 4PP7A 2OH0E 3KXGA 2V5QA 3W0OA 1ZOHA 4MD9E 4E73A 3AC1A 4BHZA 4RVTA 3BYMA 5EHYA 2G9XA 4O0SA 4O6LA 3O71A 3SLSA 1TKIA 3TV6A 5KMIA 1XJDA 2J0LA 1UV5A 1W84A 4PY1A 2YCRA 4TYEA 4IFCA 3ORIA 4BDEA 2W5BA 1OB3A 2VAGA 4HPUE 4I0TA 2RG6A 3LQ5A 4LMNA 4WA9A 2I0EA 3ITZA 1QPDA 2JEDA 3AT2A 2W1GA 4KBKA 4EORA 4O82A 4RRVA 2HK5A 3DJ6A 4GJ3A 4O81A 5AR7A 4L3PA 3ELJA 2BR1A 4AAYA 4D55A 4UN0C 4ZAUA 4Q9ZA 4FT9A 2J7TA 4CTBA 3RK7A 3WIKA 4CZYB 2I0VA 3MB6A 5KHXA 3R9NA 5IQEA 3CTJA 3NAYA 5CF6A 4LV7A 4F9YA 2W1IA 4R7BA 1JSTA 4GVAA 4AZVA 2PU8A 4D28A 2C3KA 3I6UA 1UKHA 5GZ9A 4CKIA 4BKZA 1H4LA 5A6NA 3UDTA 3MTFA 2VD5A 3KF7A 1MRUA 5FXRA 4JRNA 2H6DA 4D2VA 1FBNA 2IVVA 1U5QA 4O2ZA 2P2HA 4DCEA 3UYTA 4QDVA 5L2TA 2X7GA 3FY0A 3MJ2A 5IA5A 4AP7A 3TEIA 4AGCA 2BRHA 3NW5A 3PRIA 2WTKB 4Q2AA 2PVRA 2GS7A 5KNJA 2G15A 3MH0A 4BCQA 3QALE 4I20A 2O8YA 4V0GA 1KOBA 3R8PA 3MESA 3PE2A 2XK8A 2GS6A 1JBPE 4OTRA 4V05A 4N4SA 2HENA 3BLAA 5DR2A 2YDKA 5IQIA 4ZZNA 2SRCA 1XH6A 4N6ZA 3CY2A 3RNYA 2IN6A 4ZSEA 1YHSA 2CPKE 2P3GX 5DHJA 5AUXA 1GJOA 1XKKA 1SZMA 4O86A 2VX3A 3MIYA 3MSSA 4MEDA 4OBQA 2BIYA 2HZ0A 1Y6BA 3IGOA 5KBRA 3MB7A 2VWYA 3Q9YA 5C8NA 3DFAA 3WZEA 5K4IA 3GC9A 3MI9A 2VNWA 4O4CA 3OEZA 3S95A 2QOIA 3FMHA 5BX0A 2OICA 5CZHA 2UW6A 2XNOA 5E7RA 2V22A 4EONA 3VHEA 4F6SA 1ZYLA 3VUMA 4PNKA 3UOHA 4QO9A 4GS6A 3WIGA 4UALA 2LGCA 4NSTA 3E8NA 4K9YA 3LLAA 3TUBA 4FSYA 4YZDA 1V0PA 5JFVA 4IC8A 4E5WA 4U43A 1UNGA 4PL5A 2B52A 2OFVA 3QD4A 4L01A 4M14A 3ROCA 2QODA 4FG7A 3P7AA 4O7RA 3ZLXA 4FTMA 4QD6A 4XRJA 3W55A 3NR9A 4X6RA 4I6LA 2O64A 4RJ8A 4U5JA 5FRIA 5JFXA 2GNJA 4QMMA 2ZFYA 3FHIA 2QOCA 5LXMA 4YNEA 4DLJA 2HW7A 2Z7QA 4G3FA 2EB3A 4U7ZA 3QZGA 1G3NA 5BUEA 4RX7A 4ZS4A 3MIAA 5JQ8A 3M1SA 3VF9A 2X1NA 4AACA 3KRJA 4I1ZA 3UIXA 4I0SA 4CEGA 4U44A 3VRZA 4DEIA 3F5XA 3FZ1A 4UX9A 3MPMA 3HAMA 3BELA 3GOPA 4G2FA 4KIKA 4FGBA 2Y4IB 2XALA 3SRVB 1TFFA 3F2RA 2RF9A 3BEGA 3QD2B 4I4EA 4BZNA 3FMNA 4O1OA 1Z9XA 3CXWA 2XH5A 3PUPA 3Q6WA 4MXAA 5CEOA 3S3IA 1U54B 5GJFA 3LXNA 3D5WA 3DKGA 4FNWA 4KBCA 4FKGA 3UGCA 4BTKA 2HXQA 2WMWA 2CLQA 2UZUE 3FE3A 4X2GA 4FKUA 3KVXA 5DRDA 5JZNA 5IA3A 4DDIA 2XJ2A 4IFGA 4H1JA 3ZUTA 3W33A 2A27A 3F2NA 3DV3A 3L1SA 1Y91A 5M07A 4RVKA 4YO6A 2W99B 3HDNA 2ZVAA 1JSVA 3TNQB 4IQ6A 4ZSAA 2QNJA 2C0TA 2JDTA 3QXOA 4WBBB 3WE4A 3NEWA 5L2IA 3EQRA 2R3FA 3DB6A 2XJ1A 5K9IA 3GU6A 2CLXA 1ZMWA 3KMUA 2YEXA 4V01A 2JITA 3RP9A 3RCJA 5LVNA 5CSVA 2WOUA 2XNNA 3AQVA 1CMKE 4FF8A 4XP2A 3PIZA 4RGJA 2V55A 3QWJA 4D5KA 1CDKA 2Y9QA 4MXOA 4PPBA 3UMWA 4KBAA 3TKHA 4J8NA 4ZXTA 2PYWA 3BWJA 4YZBA 4RLLA 3MA3A 5F4NA 1H24A 2PZPA 3RINA 3SVVA 2VTRA 5M4UA 3C4XA 4WNMA 1V0BA 1WBTA 4FSTA 5LMKC 3F2AA 1Y6AA 2X2MA 4B9DA 4NCTA 5AV0A 4CRSA 1NW1A 3LMIA 2H96A 2ZV2A 3NIEA 3QQJA 5IZFA 1IRKA 2EXCX 4QQ5A 3A7HA 1UU7A 2YJSA 3COHA 4J71A 3P08A 3TJDA 2DWBA 2QOBA 2VNYA 4EWHA 3R73A 4O4DA 4RA4A 5BVNA 3PPKA 4F70A 3D7TB 3NUPA 3HMMA 4FC0A 2OXXA 4GFOA 3VS0A 3ZHPC 5IISA 2X4ZA 4ZOGA 3FMJA 3FZTA 3T8OA 3CCNA 1FVRA 4ZZMA 4IX5A 4IZAA 3EN6A 4DT9A 5J9LA 1ZMVA 4PMPA 5CF5A 2XEZA 1MQBA 4FOCA 3SOAA 3PSCA 2CMWA 3OOMA 3COMA 4L68A 3V5WA 4O7SA 1OKZA 3C50A 3RPRA 5EYDA 2ZV8A 1FINA 5AP7A 2UW4A 5ANJA 5LCJA 4BJJA 1UNHA 4D4RA 4GFGA 2IVSA 4QQJA 2HWPA 2BRGA 4I93A 2O63A 5C1QB 5C8KA 2R0UA 1GZNA 5HLPA 2C5OA 3QL8A 4IAKA 4F9AA 2OGVA 3R6XA 4I0RA 1TQPA 3LZBA 3ROYA 2YHVA 3L9PA 4FTJA 3EKNA 3LFBA 4QMPA 4IBMA 3BV2A 3LFQA 4GMYA 3SXFA 4QEBA 4CT1A 2ZJWA 1UU9A 2XKFA 3DJ5A 3BYSA 3FMKA 4X2FA 3FUPA 4EH9A 4HPTE 2XK9A 5E8YA 2C6KA 4CT2A 2PK9A 1JSUA 2C6IA 3IOPA 4JRVA 4KABA 3ORLA 5CAUA 4WD5A 2GDOA 3TT0A 4CFVA 1YI6A 2X0GA 3VS2A 4HW7A 3AD5A 1XR1A 2UZOA 3TWJA 5IA2A 5F95A 1WBOA 4BCIA 4Y5QA 4RFZA 3UYSA 4L7FA 4O0WA 5CU0A 4EJ7A 3JVRA 4AXAA 4G3CA 3R7EA 2W1ZA 2BCJA 5FXQA 3MH3A 3HP5A 1B38A 4E7WA 4JQEA 4PDYA 4JS8A 3QCQA 4QTAA 4D2PA 2ZDTA 4U9AA 3W0RA 4UEUA 3UOLA 4QP4A 4IDVA 3EIDA 4A9UA 3SA0A 3FJQE 3GP0A 4X7QA 5FDXA 4FMQA 3GOKA 4XV2A 4NL0A 2NRUA 4DHJA 1KV1A 1ZZLA 4BDIA 4LQMA 2YM5A 4M84A 5L8LA 3CPCA 3VAPA 5GZAA 2OIDA 2PY3A 3DTCA 1LPUA 3PPZA 3GU7A 3QCYA 4TT7A 1VR2A 3RZBA 4BCJA 4EEVA 5M4IA 2UZVA 3ZOSA 4IWPA 1DI8A 4L3LA 3QU0A 1APME 4IX3A 4TXCA 3ZXZA 4YZNA 4BCGA 3BX5A 3VS1A 4OTGA 1WBVA 3D7ZA 3HMNA 2QHMA 2PE2A 3MTLA 4FKSA 5FEEA 4QP8A 2FSMX 2JIIA 3GUBA 4XG9A 4UYNA 1JQHA 3OXIA 4FKTA 3RM6A 3T9IA 3ZTXA 1H1PA 5HHWA 3IW4A 3P23A 4A9SA 4YTHA 1YOLA 1XQZA 2BUJA 5AUVA 1BYGA 3VQUA 2YA9A 4IB1A 3O23A 4PDPA 1IR3A 2ERKA 3D83A 1KE9A 1VEBA 3PJ3A 2R9SA 4A9YA 5M09A 3HDMA 4BICA 4QYGA 3UODA 4EOSA 3R21A 1M14A 3FAAA 1I09A 1YDRE 4S34A 4EQMA 4Y5HA 2EUFB 5AP6A 5IEYA 1J3HA 2GFCA 3KCFA 5CSXA 5IUHA 2QCSA 1FGIA 4M3QA 3LE6A 4F0IA 3ML1A 4II5A 4NTTA 3C0IA 2HZ4A 3ZFMA 4EK3A 5EK7A 4BGGA 3N4TA 3C4FA 4MWIA 3JXWA 3LQ8A 4WHZA 5HE2A 4JR3A 5IKWA 2VO0A 2VWBA 2YABA 4O0VA 4O0UA 3Q2MA 5EDQA 3DLSA 3BQCA 1S9IA 2EXMA 5I5ZA 2CHLA 3P4KA 4L42A 3R8UA 5HICA 4IVCA 5KZIA 3O8TA 3R0TA 3HX4A 1REJA 2ESMA 3Q4TA 2FO0A 5J95A 2W5HA 3ID6C 2OIBA 5I3RA 3QFVA 4E4NA 4HVDA 3WILA 4RX5A 4QYFA 3KIOC 3T3UA 2YISA 1UU3A 4XYFA 4QMQA 2X6EA 1SMHA 2IZSA 3CEKA 4G6OA 4S33A 4TTHB 2I1MA 2CSNA 3NIZA 3LFAA 3FY2A 3M2WA 3IDPA 3BI6A 5AMNA 3SOCA 5KE0A 5HU3A 2HY0A 3O0GA 5L8JA 4K11A 4B7TA 2JKMA 2JDOA 5J1WA 2VWUA 4J52A 5HZNA 3ATSA 3MFUA 3EMGA 4LL5A 3F69A 4ANLA 4F1TA 4S31A 1YXVA 4W8DA 3PP1A 5HVYA 4X3FA 4YC8A 4JXFA 4B6LA 2R3JA 2YM3A 2ITXA 2BKZA 4ACHA 4FKQA 5LWNA 4PL3A 1KWPA 1A48A 3LKMA 3BCEA 3GFEA 3GEQA 2ONLA 4G5JA 1OUYA 3BIZA 5L8KA 4EOKA 2XBJA 2CKEA 2DUVA 5ANGA 5JGBA 4L52A 3HUCA 4D4VA 4I6FA 4RIXB 3PWYA 3U51A 3BLRA 3PXZA 3K54A 5DWRA 4EH6A 4FV4A 5I0BA 5CEMA 5JGAA 2BFYA 1ATPE 2IW6A 4XNEA 5HNBA 4C58A 2W4KA 4ASDA 4CMUA 5HQ0A 5AP2A 5HE3A 1G8JA 3QCXA 2IEWA 2WMBA 4I23A 1ZYJA 2QR7A 4BF2A 3KN5A 4C38A 2R3PA 4F08A 4CV9A 5I9XA 2BZKB 2VO7A 2VTQA 4JDJA 3RAWA 4ZLOA 1H27A 2YN8A 5ICPA 4CFXA 2W06A 4FTLA 4YC3A 3LPBA 3IPHA 4FYNA 5HG7A 1DAYA 4W9WA 3TI1A 3TV4A 4NUSA 4E93A 2C6TA 1AQ1A 3DBDA 1WBWA 4YC6A 5IUGA 4L53A 1Z57A 2BALA 4FKWA 1STCE 4C59A 3EH9A 3ZSGA 3NNVA 5CYIA 1G8KA 2R7BA 4QP7A 3FSKA 4JNWA 4XG7A 1PXKA 5EOBA 4IX4A 2E9UA 3PUFC 3N51A 3ET7A 3GVUA 4FNXA 4EQUA 3KRRA 1HCKA 3CJFA 4YUQA 5LARA 5LQFA 4ONAA 3BYOA 3Q9XA 1YQJA 4YPDA 3EJ1A 2UV2A 4BBFA 3F82A 4JDKA 3E93A 2UZWE 4LOOA 2WTDA 4QMZA 4DEEA 2WEVA 4NW5A 2I7QA 4HVIA 3HRCA 5ANEA 5H2UA 4F0FA 5CF4A 3MW1A 5JSMA 4I94A 4N6YA 4KIPA 4FUYA 4FK3A 4AU8A 2WPAA 3G0FA 4U40A 5CT7A 4FV9A 3R02A 3DAEA 4JQ7A 4CFWA 4K8AA 2OI4X 1ZMUA 3TCPA 3UO6A 4Y85A 3IKAA 3K5UA 4TYIA 4BCOA 4EL9A 4ASZA 3S2PA 5HG5A 3R7OA 1PXNA 1WMKA 4GJ2A 4LI5A 4MNEA 5J79A 4E6AA 4U3ZA 3IW7A 3R22A 3QX4A 5EDPA 4EUUA 4PMSA 5EKNA 5HG8A 2PPQA 3Q4CA 3C5IA 3ZMMA 2X8IA 1QPEA 2ERZE 2W1HA 4NU1A 4I21A 4QTCA 5AR3A 4G16A 3P7CA 1J1CA 4RWLA 3S00A 1W82A 2R3MA 3QUDA 5EM5A 4CV8A 2G01A 2OSCA 1P4FA 2PMNX 4EC8A 4EYMA 3SV0A 2WGJA 3G9LX 4FA2A 4W4WA 2OLCA 3R9RA 4DH5A 4BIBA 1H0VA 5DE2A 3TMOA 2VO6A 2CGUA 3HP2A 4AN2A 2BVAA 5AP0A 3BHVA 5HESA 4I92A 4GG7A 4ZSGA 2QLQA 5CVHA 3TYKA 2H9VA 4FIGA 3ORPA 5T6KA 4NEUA 4D1XA 2NNWB 5AAEA 2FSLX 2HOGA 4LOPA 3QRIA 4RC3A 5FXSA 3DBEA 1FMKA 4MF0A 3VW6A 2GMXA 4DFYA 3VQHA 4J1RA 5L3AA 1P4OA 2I6LA 5F94A 4B8LA 2GHGA 4Y72A 4C0TA 2JGZA 3R1NA 3R83A 5IA1A 3II5A 5HU9A 3H9OA 4YTFA 3DKFA 5L6OA 3AT4A 2BTRA 3EFKA 4KAOA 4XH6A 2W1EA 3ZUUA 2WMXA 4ANSA 1GOLA 4BKJA 5JH6A 1R0EA 2X2KA 4AFEA 4PTGA 4FZ7A 3FKOA 4EH3A 3QA0A 3FEGA 2QO7A 2PE0A 3KXZA 3QC4A 2G1TA 4RPVA 3AKKA 2CCHA 4BDGA 5ANOA 1QL6A 3K2LA 5DT4A 2W5AA 5BQ0A 3QTWA 5B7VA 3PLAE 4AE9A 1ERKA 4KUJA 2A19B 2XYNA 3ZS5A 5HVJA 3EYHA 4A06A 4FSRA 4F7NA 3R8MA 4GEOA 5EI8A 3H9RA 1J7LA 3KF4A 3EL8A 3UDBA 2X9FA 5DYJA 2RFNA 3E64A 3V5QA 4QMYA 4E4LA 2WQOA 2Y4PA 4FTIA 3BU6A 3O50A 4C57A 4FNYA 3UG2A 3PG3A 3LVPA 5M4FA 3FKLA 1BL7A 2VZ6A 4GV1A 3AC5A 4TWNA 3V51A 5DR6A 5JEBA 2XARA 2PE1A 1O6YA 2QONA 4ITHA 4KWPA 4C36A 2C30A 5ETCA 4L7SA 4PTCA 4D9UA 4WRSA 4IDTA 2FGIA 3QQUA 1Z5MA 4OAVB 4EZ3A 5E8WA 4EOOA 2WU7A 5BVEA 3D2KA 3IGGA 5A14A 4IAIA 4DDGA 5HGIA 2EVAA 4H3PA 4GU9A 2W9FB 2VRXA 2BHEA 4ZS0A 4R8QA 4NFMA 3FMEA 4YZ9A 4CCUA 4MAOA 4NZWB 5HCXA 1OKWA 2YM7A 3RK5A 5CNOA 2R3OA 5CANA 3C4WA 4ZP5A 3L9MA 3ENMA 4FTNA 3RPOA 4BYIA 3LJ0A 4UWYA 3S0OA 4Y83A 4O4BB 5D11A 2W96B 2NP8A 2OZAA 3PXQA 5M08A 2Z7SA 3HA6A 3BL7A 1PMVA 2Y8OA 3ZZWA 2XEYA 4G5PA 3NCZA 5E8TA 3VNTA 5CENA 3LJ1A 4UMRA 3MFSA 4FG9A 2C3JA