4RIYA

Crystal structure of an egfr/her3 kinase domain heterodimer containing the cancer-associated her3-e909g mutation
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
281
structure length
269
Chain Sequence
VLARIFKETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNVLLKSPSQVQVADFGVADLLPPPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAEPYAGLRLAEVPDLLEKGGRLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Receptor tyrosine-protein kinase erbB-3
publication title Structural analysis of the EGFR/HER3 heterodimer reveals the molecular basis for activating HER3 mutations.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 269
sequence length 281
chains with identical sequence C
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4riyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4riyA01
4O7VA 3ZCLA 2H6DA 2JBOA 3UVQA 5H8EA 3RPYA 3IDPA 3R01A 4IAYA 4EOMA 2UW5A 3KMUA 4IADA 4GT3A 2B9FA 2J0JA 2R3FA 3AGMA 3FDNA 3LFQA 4MBIA 4NW6A 4PDOA 3V8WA 5CASA 3E93A 3TM0A 2NPQA 2JKMA 3R8ZA 4C8BA 4AW5A 1R1WA 3CLYA 2OKRA 2WIPA 4I3ZA 4AWIA 5FBOA 4BTJA 4IHPA 4ZY6A 4CZTA 4ACDA 2CGUA 1DI9A 2XRWA 4RZWA 3K5VA 4I93A 3QRTA 4XHKB 2VX1A 4NL0A 2UZEA 4YSJA 3MVHA 4G3CA 2CSNA 3R7UA 3LFDA 3P7AA 2CNVA 4QP6A 2HELA 3UIBA 1OVEA 4EORA 5DYJA 4M14A 2XZSA 4FKSA 3UOKA 3FYJX 3HRBA 3OXIA 4PTCA 5HNBA 4EK4A 4EYJA 3JS2A 2WMVA 2PVFA 1RQQA 3QAME 5HHWA 2H8HA 2HW6A 2X9FA 4ERKA 1M7QA 2CGVA 4EOPA 5IEVA 3AC3A 2SRCA 3KULA 3LXLA 4TT7A 3DTCA 2CGXA 5KX8A 3UJGA 5CQWA 1ZZLA 3O2MA 3U51A 1T46A 3SHEA 1KE5A 1JVPP 3N51A 5A4CA 3JYAA 3FQSA 4FSRA 5DWRA 3BHYA 3RAHA 3UDBA 3ORPA 5HCXA 4F1OA 5A3XA 3RPRA 4FOCA 3OFMA 5KMIA 5LMKC 2CNUA 3BIZA 3EKKA 2BFYA 5K4IA 4ACGA 3C4FA 4Y5HA 1OPLA 4U3YA 1OITA 4BCFA 5IH4A 4AGUA 3UC3A 1Y6BA 3OC1A 3RM6A 4F70A 3CTHA 4I6QA 1REKA 5BVKA 4CQGA 1L8TA 5H2UA 4MD8E 5CF4A 4CT1A 3FMJA 3LQ3A 3KXNA 4X21A 4UN0C 4JBQA 4ZSGA 5BYYA 1CDKA 3SRVA 3POZA 4XV3A 5CSXA 2WPAA 3WZUA 4BDHA 1GJOA 4CKJA 3QHWA 4QYYA 4H1MA 4AXAA 4EEVA 4XYFA 1W84A 2C5NA 3V5TA 5DR2A 2BZJA 4EHEA 1OPJA 5AEPA 3H0ZA 1MP8A 4FX3A 5AR4A 4RX5A 1XH4A 1PXLA 2VWUA 4X3FA 4NM0A 2OJIA 3U9CA 5KBRA 4S31A 1QL6A 1JLUE 4JXFA 5CQUA 4RWIA 5HO6A 3ZU7A 4HGEA 3ENMA 4Z55A 3FV8A 2QO2A 1YWNA 2XK8A 4CZYB 4O7WA 2G2IA 1MQ4A 1ZYLA 4M69A 5BX0A 1ZAOA 3TCPA 3HLLA 5C8KA 2YJSA 4OTHA 3UMWA 5EI8A 3ORXA 3V5WA 3VS6A 4CFFA 1B38A 3FMEA 5HZNA 4FEXA 4S34A 3VHEA 4C37A 1XR1A 4MAOA 1VYZA 4DCAA 4M84A 3NUUA 2UV2A 3M1SA 4QMXA 1H0WA 3PG3A 2R7BA 4IAFA 3L1SA 3H0YA 2OWBA 3MTLA 3UQCA 4FVQA 4D2WA 2B55A 4HCTA 5HE0A 4RFMA 4BCQA 4DCEA 4HVDA 2PUIA 5TOZA 2VTLA 5L8LA 5GINE 2PPQA 4IFGA 3TEIA 2WMRA 4E8AA 1MUOA 4AT5A 1OKVA 2GNFA 3AC5A 3LIJA 4FG7A 3DU8A 5AAEA 3QCQA 2YDIA 5LJJA 1XJDA 3PJCA 1Q8YA 3D0EA 3AT3A 4FODA 1R3CA 5E8YA 3QKLA 2JKOA 3I6UA 1QCFA 3IECA 3JVRA 4MF1A 4PMMA 3ELJA 1PF8A 4XH6A 4K1BA 3UO4A 5DG5A 1K2PA 2YEXA 5CZHA 1Y8YA 3A8XA 3OY1A 4N70A 4UEUA 4XS2A 5AA9A 2BKZA 4O27B 5HG5A 4BGQA 3G0EA 2J2IB 3ATTA 4IZ7A 2C6DA 3KKVA 3R73A 5EQPA 3HMIA 2GFCA 4PTEA 2Z7SA 2WZJA 5FXSA 1KE6A 2R3GA 4U6RA 3R30A 1R0EA 4UXQA 4ARKA 4AS0A 4L9IA 5HTCA 4ZLZA 4F09A 4YZ9A 3ZDUA 3R9RA 4FVRA 1UU9A 2C1BA 3MA6A 4OTRA 5E8XA 3SX9A 5HLWA 5K3YA 3ITZA 4MXCA 5AJQA 4ANQA 2W5AA 2OZOA 4LQMA 3HV7A 4TRLA 2CKQA 1GIHA 4X3JA 2O65A 4QMSA 3GVUA 4RWLA 2UZDA 4MWHA 1H8FA 4AW2A 3BV3A 4RMZA 4IIRA 3UIUA 5BNJA 1H1RA 3L9PA 1M7NA 2VAGA 3P1AA 3ZS5A 4C33A 2XK9A 2GFSA 3P9JA 5BVNA 1W82A 4KB8A 2QOBA 2BILB 2IZRA 3W2PA 5IZFA 3SW7A 3R9OA 5IPJA 3AMBA 2HENA 4YJSA 4CGAA 2JAMA 4ZTSA 4F65A 2A19B 5CEKA 2ZB1A 1IR3A 2WMQA 4CNHA 3G15A 4NM7A 2XVDA 4W8EA 2IZUA 2WIHA 3DBQA 4KS8A 4QMMA 2XRUA 2XB7A 3LQ5A 4UBAA 3U54A 3FC2A 2J50A 2UZVA 4A4LA 3RM7A 2UZOA 3C50A 3DQWA 4HW7A 4X2KA 2HWOA 3NSZA 3RGFA 3M11A 1V0BA 4XUFA 3GOKA 4AGCA 3PPJA 2Q83A 1M52A 4W9WA 5TE0A 5FEEA 1PRYA 4QP8A 2R3OA 4FZ6A 3BBWA 2B4SB 4F9BA 3IO7A 4UY9A 3QA0A 5DNRA 5AUZA 3LMIA 5ETAA 3LQ8A 2J4ZA 4OTQA 2JDOA 4IB3A 3VUMA 3U9NA 4ZTQA 2QO9A 1H08A 4JNWA 4XRJA 5CS6A 4MVFA 4IWQA 2EB2A 5BUIA 5JMSA 3LFBA 5DGZA 3KRLA 4K33A 5CEMA 4OAVB 5HVKA 5IU2A 4GH2A 1U5RA 4XG6A 5HX6A 5C1QB 1XBAA 2JAVA 4A9YA 5CAUA 4LL5A 4J96A 4UYNA 3F69A 4YP8A 2A27A 3DY7A 4LMNA 3DNEA 3IGOA 2YAAA 3OEFX 3OP5A 4CSVA 4FOBA 4KKGA 3NRMA 4RZVA 5BPYA 2RFNA 1JKTA 3BCEA 3MH2A 2XBAA 3VS0A 3AD5A 4PL5A 4BKYA 2XH5A 3C7QA 4DFZE 4AOTA 3SXFA 2GHMA 3E8NA 3GC0A 3KK8A 3FSKA 4C3RA 5IQIA 3BX5A 4I1ZA 4C2WA 5FD2A 3A61A 3KY2A 5CU2A 3R7YA 2W99B 2XYNA 5HLPA 3GQIA 4MF0A 3QTZA 3LMHA 1GZNA 3UP2A 3VWAA 4CG9A 3OCSA 1WBNA 2XNPA 5F95A 5A6OA 2YWVA 4G6LA 5A4EA 2ZV7A 1UNHA 3UODA 1PXOA 3D15A 3MPTA 4FZ7A 3DA6A 1GZOA 4EC9A 4GUBA 2XJ1A 4QMYA 1BL7A 4RGJA 3VW8A 5I3RA 3GENA 3LJ1A 4HYUA 3HECA 4W4WA 2E9NA 3QWJA 1H25A 4D2PA 5L8KA 4AFEA 3ORTA 4LI5A 4NJ3A 4PPBA 3VRZA 4QPMA 4DTBA 1Q8TA 3CP9A 3PA3A 3HV3A 2VWIA 3AXWA 4YGAA 3VS2A 4D2SA 4BICA 5JH6A 1T45A 1KSWA 4FTNA 3V04A 4DHFA 2YISA 5HGIA 4OTFA 4AW0A 5IMXA 4AZTA 3R7GA 3WBLA 3ORIA 4GIHA 4HYSA 2I0EA 3F7ZA 3ZM4A 4ENXA 4NTTA 3ZO4A 3ZOSA 4TWOA 4DINA 4HCUA 4JRVA 4XX9A 4GT4A 4YTHA 3R83A 3NUXA 4A7CA 4E4NA 4EKLA 5A14A 4BR3A 2YDJA 4Q2AA 4DE4A 4TXCA 4WRSA 4EOQA 3OMVA 4FTJA 3D7ZA 4J8NA 5L4QA 4U7ZA 4BGHA 2CCIA 3IONA 3LLAA 3QL8A 2JIIA 1ZMUA 3AC2A 4LOPA 3B2TA 3I79A 2PMLX 4DT9A 4M3QA 3PIYA 3FL4A 2BAQA 3ZH8A 1NA7A 4ZTLA 2BRBA 5HI2A 2WFYA 2NRUA 3ET7A 1YHWA 4FBXA 4AACA 2W17A 3HUBA 3TUCA 4CG8A 3HA8A 2JLDA 4C34A 1YQJA 3BPRA 5ACBC 3W55A 5IA4A 4FR4A 3POOA 5AM7A 4L6QA 3FLWA 5FBNC 4CZUA 3LXKA 2IPXA 5FUTA 2R0UA 3LHJA 1DI8A 3MB6A 2QOHA 3QHRA 4O22A 4DG0E 5IQDA 3F7WA 5CALA 3GCVA 1NY3A 3KVWA 3MTFA 2EXEA 3ZSGA 2B0QA 2QLQA 4MHAA 1P14A 4QPAA 1V0OA 3ULIA 4BDIA 2UW8A 5J79A 4ZZNA 1WZYA 5GZ9A 4YNOA 3EFKA 3RALA 4EQUA 3ORKA 2XK3A 3F5XA 4A4OA 5I5ZA 4GFOA 4NTSA 3MIAA 4RJ3A 1P4FA 4O7NA 4HVSA 5DT3A 4BZNA 5JFSA 3LM0A 2IW9A 1O6YA 4RC2A 4R8QA 1JPAA 4A9UA 4UX9A 1J7UA 4FT0A 4ZJJA 4JVGA 4ITIA 4TPTA 1FMKA 1BI7A 3RCJA 5CAVA 3ANQA 1KV1A 3FXZA 4UXLA 4C35A 1IASA 4CCUA 4JQ8A 5K5XA 3EN5A 3GU8A 2OG8A 4FVPA 4O0WA 5M07A 1KWPA 5AV2A 4FV9A 4ANBA 2FYSA 2XNBA 4RJ4A 3Q4CA 4BL1A 3PZEA 4DEDA 4Z7HA 3IW8A 3MY1A 5CENA 5FG8A 3FI3A 4ZJIA 2XK6A 3R8LA 3IW4A 3VUDA 3E3PA 3OBGA 4TWPA 5D9HA 4B0GA 2PMIA 3BLRA 1Q8WA 3F2NA 4C57A 3OBJA 2XJ0A 1YXXA 2IVTA 2PVRA 4CV9A 2GHGA 1JSTA 1UKIA 4ALVA 2FB8A 3O8UA 3W32A 2CN8A 3ZXZA 1W8CA 2GNLA 4WUNA 5EHOA 5LCJA 3NAYA 5AFVA 3GGFA 4JBPA 5HBJA 3VVHA 2J6MA 2BDJA 1F3MC 3MH1A 4O38A 4D2VA 3OEZA 2VV9A 1SYKA 4JG8A 3BGPA 4DH8A 5BUJA 5A9UA 3W2OA 3PVWA 3QX4A 3PSBA 2W9ZB 4EOIA 2XK7A 4AFJA 4CYJA 2J90A 4PP7A 1PHKA 1ATPE 3GU6A 5EM8A 2I6LA 4AGWA 3KVXA 1GIIA 3KA0A 4M13A 4X2FA 4FEVA 4AZSA 4A9RA 4XLVA 4EK8A 4CTCA 2GS6A 1NVSA 3D7TB 3GP0A 2WGJA 5D41A 2GMXA 1KUTA 3NYOA 2J7TA 4YR8A 3ORNA 2QODA 5EI2A 1H00A 3HA6A 2X2KA 4D1ZA 3QBNA 3RZFA 2BHHA 3RAIA 4IDVA 3U8WA 3LCKA 4QRCA 4KS7A 4LGGA 4AP7A 1OIUA 1XWSA 3IW7A 2YIWA 2JDRA 3QC4A 4WIHA 5EKOA 3O96A 3EQBA 1YWVA 4EL9A 2F4JA 4J52A 4O6EA 5DH3A 4AZFA 1RW8A 2BTSA 3IS5A 4ZSAA 4K8AA 3REPA 3U87A 2E9PA 1UVRA 1Q8UA 2YCSA 3DJ5A 4G9CA 3UMXA 3LCTA 5CU0A 2VTAA 1OL7A 4TNDA 3WF7A 1Q5KA 5JQ5A 4E1ZA 2HW7A 5AA8A 1UNGA 4F6WA 1OKWA 2Y4IC 5FXQA 2C0TA 4ZY4A 2RGPA 3R04A 1SVEA 3OUNB 5HCZA 2GPHA 4AE9A 4M97A 3BE9A 3SV0A 3Q9XA 1ZARA 3FZ1A 3E92A 5CU4A 4HNIA 4WG4A 1APME 2HZ4A 3O71A 4UWCA 4D9UA 3EQCA 4I4FA 3EH9A 4JJRA 2YN8A 2NP8A 2C3LA 4O6LA 1IAJA 3QTIA 4PMSA 3L8VA 4JDIA 4C4FA 1ND4A 2Z8CA 1LR4A 3E3BX 2ETRA 2JFLA 5DOSA 5HIEA 3NUYA 5AWMA 3UZPA 2P4IA 4IAAA 3E87A 3FKNA 4FNWA 4XMOA 3ZC6A 3PLSA 1JWHA 5H8GA 5IG1A 3CQEA 4QYFA 3UQGA 3FWQA 4DH1A 2JEDA 4FSNA 4KSPA 5FP6A 2C6LA 4C4IA 4LMUA 1U4DA 4FV5A 4I23A 4F6UA 2PMOX 4FT7A 2XJ2A 2RFEA 4NH1A 3V5PA 4E93A 5HORA 4BCIA 5M53A 3KEXA 4FV7A 4N57A 2R3PA 3D5WA 4FYOA 2OK1A 3DCVA 4WD5A 3WIKA 4MD9E 2W4KA 3CJFA 3UQFA 4ASZA 3LVPA 4KWPA 5FTGA 3LXNA 4G3GA 4L3LA 2EXMA 4NT4A 4XRLA 2OICA 2B9HA 4ZS0A 4R78A 3G5DA 3V6SA 3LZBA 3MN3A 1YKRA 3L8PA 3UO6A 1XH9A 2QR7A 4HVGA 3PJ2A 4O7SA 1OBGA 2XBJA 3BEGA 2JKQA 3OZ6A 4FNZA 4JDHA 1BLXA 2YCFA 4WRGA 4OBOA 4LV5A 3LCDA 3EZVA 4D0WA 3UZTA 4EHVA 2I0HA 4KRDA 3AC8A 4QO9A 3ZDIA 2XK4A 4DG2E 1URCA 4D4SA 4KIOA 3VHKA 5CT7A 2F7XE 2XKDA 4YPDA 2HWPA 3ATSA 3BQRA 3PJ3A 2ITUA 3HMNA 3Q9YA 4XCUA 2H34A 3OCGA 1PKGA 1ZRZA 2X7GA 2O64A 2F49A 2XM8A 3UGCA 4A9TA 1WBOA 4E26A 3QLGA 3MJ2A 4FL2A 4IVCA 3VQUA 4ANSA 4YTCA 5F4NA 2X4ZA 2WOUA 2OXYA 3N9XA 3R8VA 3VUTA 3IDBA 3OW3A 4I92A 3KRJA 2W4JA 4EH4A 3KGAA 5IMEA 3R8UA 3GUBA 1R39A 4XV2A 3UYTA 3NLBA 3ZC5A 3GU5A 5JT2A 2YCQA 4DH5A 3RK5A 4OAUC 2WQOA 5AAFA 3VO3A 1FOTA 3D7TA 4F7SA 4BHNA 2OU7A 4FT9A 1QPCA 4P5ZA 5E1EA 4IM0A 2ERKA 3G9LX 5EYMA 2BPMA 2FGIA 1OECA 3ERKA 3U55A 2PZRA 3DBDA 3I4BA 3OXZA 2X4FA 3QZGA 2XA4A 2ZMCA 3KRWA 3MY0A 5LMKA 2W5BA 3TKIA 3GFWA 1NW1A 5IQGA 3WIGA 1Y91A 4FIHA 3VBXA 5IKWA 5E90A 3NCZA 4D4YA 4ZSLA 2ZAZA 3AC4A 4JAJA 1G8SA 3HAMA 5AMNA 5E92A 1M14A 2QNJA 3EJ1A 3KF4A 4RLKA 4O83A 3DAJA 3NS9A 4USFA 2QKWB 4G5PA 1G5SA 4DEHA 4AAAA 4E5AX 2PYWA 5KKRC 4JBOA 5TO8A 3FZPA 2QR8A 2BR1A 3OWKA 5L2WA 3LKMA 4QTDA 2V0DA 3QC9A 4MD7E 2CCHA 5KZ0A 3QUEA 4Y95A 2X39A 3T9TA 5J9ZA 4J95A 5GJGA 5IH6A 2BAKA 4BFMA 5EYDA 2QURA 4QQJA 3MA3A 2J0IA 4L00A 4OR5A 3NUPA 4K0YA 3M2WA 2GTNA 2XNOA 3W18A 5CY3A 5ANEA 1FVVA 3ZFMA 3BV2A 3FC1X 3P7BA 3KK9A 4B6LA 3DBEA 4HZSA 4L46A 2HK5A 3QA8A 3M42A 3QTSA 1YXUA 1MQBA 3BHUA 4BBFA 5CYIA 2IW6A 4C38A 4FG9A 4J1RA 1IA8A 2BCJA 5JQ8A 3HEGA 4F7JA 1TQPA 2Y6OA 4EH2A 1OIYA 2PK9A 4DTAA 2CLXA 2JC6A 2P33A 3UOLA 5DVRA 3A7IA 4FSWA 2IG7A 2BDWA 4R77A 5K9IA 4LG4A 3P78A 3TIZA 2CDZA 4YHTA 4FSMA 4FTLA 5LWMA 2ZM4A 4UV0A 2P55A 2QOKA 1NT2A 3CEKA 1ZMWA 4I5HA 2C5XA 4TW9A 4YZBA 5HICA 2QKRA 2DYLA 2J5EA 4MH7A 4JG6A 5HTIA 2EU9A 2ONLA 3PXRA 3V8TA 4PDYA 3BWJA 2R3JA 2W1CA 2WB8A 4XEYA 3FY0A 4DFYA 5KZIA 5DBXA 2UVZA 4R5YA 5E1SA 5JZNA 3MB7A 3R1QA 3TACA 5HD7A 4R7HA 5AV4A 2I40A 3UP7A 2ZM3A 3EYGA 5M57A 1ZZ2A 4EK6A 2UW6A 2PE2A 4FTQA 5L6WL 3VRYA 2VTHA 4CKRA 2CJMA 1DAWA 4L44A 3Q4TA 5IISA 4RWJA 5HO8A 1P2AA 3CKWA 4FZFB 3MFTA 4LRKA 4H05A 3NNUA 4YJNA 4BCJA 2GNJA 3CSVA 3TNWA 2I1MA 1O6KA 4S30A 3SD0A 5JRSA 3DK7A 2DS1A 2JDTA 3QD4A 4BHZA 4FK6A 3G9NA 4WO5A 4OTIA 5BVEA 4G17A 3V5JA 5AAGA 4TYHB 2HZ0A 3P7CA 4EKKA 3QQJA 5H8BA 4EJ7A 3SC1A 4B7TA 1QMZA 3DXPA 3I0OA 4Q5HA 4YPSA 1RDQE 4J71A 4DLJA 2W9FB 1ZYCA 1PKDA 3PPZA 3RK7A 4AOIA 3PDTA 1H1QA 3PRFA 3PZHA 4WNKA 5LVNA 5HNGA 2ZVAA 4CFVA 3FLQA 1MRVA 2O5KA 5GHVA 3FMMA 4IJ9A 4ZEGA 4PNIA 4OBPA 4X7QA 2WXVA 3EHAA 3HKOA 5BQ0A 4FSYA 4IX5A 3LPBA 4RRVA 3R7OA 2HYYA 2C47A 2ACXA 3QX2A 4A4XA 4BTMA 4DFUA 3ETAA 2J0LA 4EUTA 2DWBA 3S95A 4AN2A 4EBWA 1I44A 5EDRA 3RVGA 4EH7A 4RLLA 4U40A 3U6JA 2UZUE 1A48A 1UNLA 2GSFA 3A62A 4C2VA 2QLUA 4QQ5A 2RKUA 3H3CA 1XH8A 4Q9SA 3TNQB 1FPUA 3KMWA 5LVOA 2GNGA 1H28A 3Q53A 4OGRA 4QOXA 4E4MA 3ACJA 5ANDA 5TR6A 4EH6A 4RIXB 5HTBA 1YI3A 4YJTA 4QMQA 5M08A 3DK6A 4IX4A 2KULA 2OJJA 4H3QA 4FKIA 3E8CA 3FJQE 3PP1A 2HZNA 3DFAA 4TN6A 3ZLYA 4NCTC 3RPSA 2BTRA 2XIKA 4N4SA 3FLZA 4QMNA 2NNWB 1JSVA 4H36A 3ZSIA 3EFLA 3N4UA 3QCXA 4IAIA 4IE9A 4V01A 1ZYSA 5LCKA 3UNJA 4TKSA 5HX8A 3BWFA 4LUDA 2VTQA 1Q41A 3DBFA 4K11A 3ZLWA 3PA4A 3IKAA 4G3FA 4G31A 2UUEA 3ENHA 1H24A 4DYMA 4P2KA 3QD0A 4G34A 4IVBA 4P4CA 5A4TA 4RA5A 4I6FA 5E8UA 2R3RA 2F2CB 2R3KA 5L2IA 4BI2A 2UW9A 1YOJA 4LRMA 3AG9A 3PXKA 4IM3A 4LGHA 2V22A 4OLIA 1UU3A 4QP4A 4BCPA 2O3PA 4FTKA 4L3JA 5EW9A 1NXKA 3LXPA 3GFEA 3IOKA 4FKOA 4C59A 4EZ5A 2BVAA 2QHNA 3HAVA 4FV4A 4IVAA 2VNWA 4RPVA 4ACCA 1J1CA 2WNTA 3N4VA 2QQ7A 4BCOA 1OKYA 2ETKA 3CTQA 4QTEA 4JOAA 3OTUA 2OSCA 1FQ1B 4ZLOA 4MNEA 1H26A 2R3LA 3NNXA 4HVIA 3D5VA 4O1OA 4QQCA 5LARA 2H9VA 5HE2A 4XV9A 4D58A 4EOOA 5HCYA 4RFZA 4YZNA 3EWHA 1PXPA 3ODZX 3QCSA 3MFRA 5DFPA 4BRXA 3FZSA 2B1PA 1QPDA 4FIGA 5HG9A 3MIYA 3KQ7A 3PP0A 3UVRA 3W2QA 3W33A 1YHSA 4AF3A 5HKMA 1Y8GA 2WTVA 4F63A 3EQFA 5ANOA 3IPHA 3I6WA 4CQEA 3HMPA 1OGUA 4EOLA 5LWNA 4RJ7A 4JX7A 3NVKI 5JGBA 4V04A 3EKNA 4GU9A 2J0KA 1YI6A 2JDSA 2YFXA 2VTTA 3VS3A 3D83A 3DTWA 1K9AA 5KE0A 3O50A 4FTOA 4KIPA 4C3FA 3BU5A 3HMMA 3I7CA 4R3CA 2V7OA 4TYHA 5I3OA 3A4PA 5HEZA 2LAVA 3QQGA 2QOCA 4ZXTA 3O7LB 5KUPA 1U54A 1YW2A 2XKEA 4IH8A 4YJPA 4IVDA 1YOMA 5AR7A 3VNTA 2QCSA 5E8ZA 5BVFA 4DF3A 3Q9WA 3TN8A 3GU7A 1QPEA 2XMYA 4GFGA 3ZONA 2WTJA 5KMOA 3OT8A 3FXXA 4KUJA 4BN1A 3PVGA 2NO3A 4RX8A 3PWDA 4LRJA 3EZRA 3FZOA 2WQMA 3KXMA 4IANA 2PWLA 3IG7A 4L45A 3QWKA 3FBVA 4NFMA 4YLKA 1R78A 1E1VA 3UTOA 3FUPA 5T68A 4ZZOA 1KE7A 4CFXA 2XIYA 1ZMVA 4P5QA 3CGOA 2A0CX 3UG2A 3VN9A 1Q99A 3RHXA 5EM6A 4APPA 5LQFA 3VAPA 3COHA 5GJFA 3LJ2A 3SLSA 4OW8A 1UU8A 3VF8A 5C8NA 4XG9A 4DAWA 4XP0A 5ANIA 4YMJA 3DT1A 5LVLA 2F7EE 4I22A 1FMOE 2RFDA 4PQNA 5C8MA 2R3QA 4G3EA 4RIXA 3FMNA 2F57A 3AOXA 4G3DA 4I0SA 5DEWA 1XHAA 1Z9XA 2R3NA 4O21A 3T9IA 5CSWA 2JIUA 4G6NA 2ZJWA 3FQHA 4MQ2A 2VWVA 3TNIA 2V7AA 3RWQA 3BKBA 1TQMA 3BQCA 4ACHA 3TUBA 4YJQA 4DT8A 3E62A 3GCPA 5FQDC 2QU6A 2Q0NA 3A8WA 1XBBA 4X3FC 2WQEA 2E2BA 2VTRA 3EFWA 4XBUA 4XNEA 3TV7A 3VUIA 2Z02A 4DFBA 5AV1A 3SW4A 3TIYA 3VJOA 3KN6A 1DM2A 4V0GA 3W10A 5AADA 5IQAA 5EKNA 3BLHA 4DC2A 3C4WA 4DEBA 3EFJA 3DXQA 4EWQA 4LGDA 2YZLA 3CCNA 5E91A 3LLTA 3CXWA 3MPMA 4JT3A 4L43A 3CGFA 2PVLA 3BELA 4H58A 4BCMA 5IA3A 3N4TA 2XEZA 4RFYA 5IQCA 1G3NA 3FLNC 3L8SA 4L53A 5AM6A 3ZRLA 2WTWA 3G2FA 3TI1A 3DJ6A 3MFUA 3R28A 3DJ7A 4PV0A 4CVAA 2XNEA 2QOIA 3F9NA 3TKHA 4H3PA 4PUZA 3G51A 3F5PA 1GOLA 4BDKA 5DLSA 3RWPA 4FF8A 3NEWA 5JGDA 1U46A 4U80A 4JQ7A 2UW3A 4KIQA 4QPSA 5HE3A 2JKKA 4BDBA 2VWWA 4CFMA 3BGZA 2WEVA 5EG3A 4D5KA 4O82A 2WQBA 1WBTA 3GC7A 5CF5A 2P2IA 3GT8A 5HG8A 4ZTNA 2PU8A 4FTRA 1Q4LA 3SDJA 3WI6A 4ITJA 4D1SA 3I60A 4WBBB 5CX9A 5CI6A 4KABA 2QVSE 2C3IB 5AUUA 5HBHA 5DHJA 5CEOA 2VX0A 1GZKA 5HQ0A 4LL0A 3RINA 3PYYA 1UWHA 1AGWA 4MYGA 4QP7A 4F0IA 3OWPA 2VTSA 4O0UA 4XOYA 3Q6UA 1XH5A 3H9FA 1CKPA 3I5NA 4CT2A 4Z9LA 1JKKA 4FKGA 4YUQA 2C0IA 5FDXA 3TG1A 2IVVA 4CMOA 3U4WA 2O8YA 3A99A 3EN9A 3AD4A 2CPKE 5AUTA 2C5YA 3AQVA 4AW1A 2YA9A 4NUSA 4MTAA 3WZDA 4EUUA 5D1JA 2OI4X 3UPZA 5KHXA 1ZOGA 4P90A 3R2YA 1YWRA 4J53A 1YDSE 4E6AA 3R00A 4MXAA 3EQDA 3BHVA 2CGWA 4F7NA 3FXWA 4A07A 3UE4A 5K5NA 3NMUF 2ZOQA 4D55A 3ZYAA 4O0VA 4EH5A 1JNKA 1Q8ZA 2IVSA 4BYJA 3PE2A 3CC6A 3BHTA 3WOWA 4Y46A 3G33A 4D4VA 4S32A 3OF0A 4NM5A 2YIQA 3S2PA 1OL2A 4DBXA 2YM6A 3QZHA 4FIEA 4I6HA 4QMTA 3EQPA 2VO6A 2RG6A 4OTWA 4QMWA 3FZTA 4QP2A 4CTBA 3AT2A 3FPMA 4FV0A 4DTKA 3JR1A 4QMVA 2BRGA 3FYKX 4YJRA 2VTIA 5G6VA 2OW3A 4AA4A 3DDPA 1CM8A 2WTDA 5CSHA 4M66A 3VJNA 3IDCA 2UZBA 2G1TA 4D4RA 3D5UA 4I24A 2HAKA 1UU7A 3DB6A 2A4LA 3FSFA 5HG7A 4GKIA 5HBEA 1KOAA 5EDQA 3UPXA 4AX8A 1IG1A 4F4PA 4QQTA 4O7RA 2BZIB 2YM4A 3GNIB 4F9AA 3NWWA 2XUUA 3AC1A 1A9UA 1B6CB 2AUHA 4A9SA 5FWKK 2AC3A 3DAKA 2X2MA 4UMUA 4U45A 3VQHA 5L2TA 4C4HA 4PX6A 4FYNA 4BI1A 4F08A 4O81A 2PZ5A 3MDYA 2VU3A 4BCKA 3NVMB 1J1BA 3QLFA 5FM2A 4D0XA 4FGRA 1JBPE 3D9VA 2B7AA 4DLIA 3NUNA 4E20A 3ZO1A 2GQRA 3ZMMA 5CAPA 3O51A 4KBCA 4NFNA 1LUFA 4RJ6A 3T3VA 4NW5A 3WF9A 4QMPA 2WMUA 1YDRE 4QMUA 4HCVA 2ITOA 3A4OX 2I0VA 5M44A 4ALWA 4F99A 3S3IA 4WT6A 4O2ZA 5DPVA 1JQHA 5ETCA 3HGKA 2WU7A 3COIA 2QOOA 3MVMA 3Q60A 4GIIA 3HRFA 5EYKA 2C5VA 4BDGA 4E4LA 4F9CA 4Q5EA 3MVLA 4EH9A 4FE2A 2OIQA 4FV8A 4RQKA 4RT7A 4DEIA 4HVHA 3R63A 3HX4A 4TY1A 4XP2A 1JKSA 1M17A 2VGPA 4ITHA 3VUKA 4CXAA 3RNYA 2YM5A 4BCHA 3PVUA 4F9WA 1YDTE 2HZIA 5L6PA 1Q3WA 3Q4ZA 4FKLA 4QP3A 4JR3A 1GAGA 3UIMA 3TDWA 4IX3A 4G16A 3H10A 3DAEA 3PSCA 2VWZA 4DEEA 1J7IA 5TKDA 2BALA 2UZNA 1NVQA 3R9NA 3MV5A 4GK4A 4I4EA 2W1EA 2B53A 3SA0A 3OS3A 4JLCA 3SG9A 4AA0A 4JRNA 3PE1A 4I21A 3PG1A 4YZCA 3ALNA 5CNNA 1OIRA 4UMRA 1A06A 2OZAB 5IUGA 1YXSA 3COMA 5FM3A 5HD4A 2PVMA 2X7OA 3G6HA 1SM2A 4L42A 5IA5A 2RFSA 3TZ8A 3ZRMA 3R9HA 2YIXA 2E9OA 5AP6A 2JIVA 4BZDA 4ORKA 2C3JA 4U5JA 2PVNA 4NZWB 4FEUA 3VC4A 1Y57A 3PY3A 2Y9QA 4UZDA 5IQBA 3FMLA 3NW7A 5CEIA 3H4JA 4E5BA 3MS9A 3ZFYA 3BU6A 4WUAA 5CSPA 2V62A 4IM2A 1EH4A 2ITZA 2PHKA 4I6BA 4CLIA 5ACKA 4R5SA 1P5EA 1O9UA 4YHJA 4MWIA 3VS1A 4EQCA 4JBVA 4FKVA 4BTFA 4TL0A 5CU3A 2W06A 1JAMA 2C1AA 3ACKA 5CVFA 3RP9A 3NZ0A 3CD8A 3K3JA 4TYJA 5TF9A 1GZ8A 4RJ5A 4I41A 3KCFA 4GW8A 4XV1A 1IA9A 3FLYA 5LVPA 2O2UA 4RWKA 4D5HA 1B39A 3DZOA 1J91A 2C6IA 4PTGA 3QUDA 5HVJA 4NKAA 4ALUA 1TQIA 3KF7A 4RIWB 4FGBA 4GL9A 4YBKA 1Z5MA 4FKTA 4II5A 3UBDA 1Q24A 1JKLA 4IMYA 4FSTA 3W8LA 4CMTA 4Z7GA 4KAOA 5HO7A 4W4XA 3ZEPA 4EYMA 2V55A 4MEDA 5ITAA 4F1TA 3O8PA 3NIZA 5ETIA 4QP1A 4HGSA 3QRIA 4XG3A 5EOBA 3LE6A 3RPVA 2CN5A 2REIA 5L8JA 5FGKA 2ZV8A 3BYSA 5IA0A 2XEYA 2RSVA 2UW4A 1OIQA 5HU3A 2PMNX 4L7SA 3EQGA 4IC7A 4AZWA 1H4LA 3F82A 2B9JA 3DK3A 5FEQA 3E63A 4K2RA 3ZTXA 4JIAA 4UMPA 4FK3A 3TKUA 3KXGA 3V5LA 4O2PA 4PDSA 3U4UA 4EQMA 3SOAA 4GG5A 2PY3A 4ZY5A 3F3ZA 2PZYA 5AV0A 3JY0A 3WE8A 1VEBA 4WNMA 5C4LA 3U6HA 1TKIA 3DKFA 4RSSA 1PYEA 4QYGA 5J87A 5C01A 4C7TA 3TXOA 5A54A 4HPUE 5BMSA 2OF2A 2VRXA 4DEGA 1H1WA 2G2HA 4RX7A 2WD1A 5C03A 4CKIA 3CY3A 4LUEA 3GEQA 3Q32A 4KSQA 5FP5A 4DGLC 4FNXA 5J95A 1BUHA 3DBCA 1VZOA 4PL3A 4RIYB 3TZMA 4MBLA 1ZOHA 4O0SA 5AIKA 4O1PA 3W1FA 4AG8A 2C5OA 4FTTA 3A7HA 5DIAA 3RJCA 4AOJA 3BBTB 4FV3A 2WO6A 2NRYA 2YM3A 4U42A 1YXTA 4IB1A 4B8MA 3EMGA 3EOCA 2W1ZA 3JUHA 3R1YA 4PWNA 3ANRA 2ZMDA 4YBJA 4E3CA 2BDFA 3HV5A 2XF0A 5B7VA 4DGMA 3W16A 3DS6A 2OZAA 3IW6A 3DB8A 3NYNA 2G9XA 2QHMA 2X1NA 3PY1A 4RA4A 4TYIA 3KXXA 2EB3A 4HJOA 3Q4UA 4L52A 4RG0A 4RVKA 3FMHA 4BF2A 4EOKA 1O6LA 5BVDA 3PLAE 3BYOA 4KBAA 4BBEA 1HOWA 2YZAA 4ZTHA 1PXIA 3V51A 4DITA 3KREA 3TUDA 4U81A 2WTKB 4ZJVA 5L2QA 4C62A 4BCNA 4RIOA 3FEGA 4M67A 4FKPA 5D7VA 4ASDA 2VO7A 3FAAA 1BYGA 1OL5A 3F6XA 4GU6A 3MW1A 3ZO3A 4I0TA 5JFXA 5M56A 4USEA 2ITVA 4U97A 3SQQA 4FMQA 1Y6AA 3P0MA 5BYZA 4CFWA 3C0GA 4O7YA 3GOPA 3R1NA 4YLLA 3BZ3A 4KKHA 4I20A 3MFSA 5BVWA 3R0TA 1WBSA 5IDPA 2XNNA 2BRHA 4WBOA 4E7WA 4RQVA 3AMAA 4O96A 3F3UA 3H9OA 4ZAUA 1ZWSA 3QD2B 3H30A 3V5QA 2HXLA 2UZWE 4EHZA 5FRIA 3JVSA 2ESMA 3NAXA 4FSZA 4HNFA 1ERKA 4JS8A 5IEYA 4MNFA 1OZ1A 3VS4A 3PY0A 3GC8A 3LMGA 1FVRA 2C68A 2OJ9A 5JGAA 5I9WA 3FHIA 3DKCA 3MESA 5CT0A 3ROYA 3VBYA 3WARA 3QCYA 1LP4A 2VGOA 4NKSA 3KXHA 3H9RA 1VYWA 4RIWA 4UALA 2IZTA 4EK3A 4DH7A 4NIFB 4IWDA 5CI7A 1UWJA 4GEOA 3WF6A 3CD3A 4FUYA 4R1YA 3MSSA 4FIIA 3AMYA 3HRCA 3D2KA 4K77A 4F1MA 1HCLA 3KU2A 4IFCA 4WSYA 5BUEA 2C0OA 2J51A 3DLSA 4GG7A 5DRDA 2A2AA 5K0KA 1UV5A 3VBQA 3KMMA 4O0TA 4D2TA 1PMNA 1Z57A 2GNHA 3GCUA 4JDKA 5E8TA 2RF9A 4IBMA 4ZS4A 4GCJA 2WAJA 3NNVA 4AT4A 4BWXA 3ZUUA 4WA9A 1AD5A 3PWYA 3Q04A 4K18A 4O0RA 5AP0A 5FXRA 2WQNA 3QZIA 2W96B 3DXNA 3ZO2A 4E5WA 2FH9A 3ORLA 1FGKA 1PYXA 1P4OA 3R8MA 4BB4A 2V5QA 2WMTA 5E8VA 4IZ5A 1SNUA 4Q9ZA 4GK3A 4DGGA 2DUVA 2IN6A 2PZPA 3BYVA 3FI4A 4JIKA 4CFNA 4EWHA 1PXJA 2ZDTA 4L68A 4E6DA 4YJUA 4EC8A 4FZAB 3DQXA 2PVJA 3ORMA 1WBVA 2VTOA 4I0RA 2PVKA 4MNEB 4O0YA 1FBNA 2PZIA 2BRNA 2R3IA 4CCBA 3R6XA 4U8ZA 4YC8A 1FGIA 4EK5A 3UNZA 2PULA 3R7EA 2OH4A 3C0HA 2ITYA 4JQEA 4IAKA 4IJPA 4E6CA 3DLZA 4D28A 3ALOA 3TJDA 3L9NA 4FL3A 1URWA 2WMBA 3P23A 4U0IA 5AUYA 3TL8A 5J9LA 5M06A 3W2CA 5JRQA 4RIYA 3NCGA 3QD3A 5FTQA 4O84A 3DKGA 4WNPA 5HOAA 3TTIA 2VZ6A 5JFWA 3V01A 3I7BA 1J3HA 3V3VA 3NPCA 3WZEA 3E8DA 3L8XA 4J98A 4WG5A 4G1WA 1OKZA 2H96A 3QKMA 3R9DA 5CF6A 4H39A 4GVAA 2EXCX 4NK9A 1V0PA 2OIDA 1QPJA 4TWNA 4FEQA 4XG4A 3NDMA 2OO8X 2GU8A 2WKMA 5C26A 3GBZA 3P79A 4YO6A 1U54B 3CIKA 3VULA 3WE4A 4GRBA 4RC4A 4GKHA 4HZRA 4QD6A 2QU5A 3TZ9A 3FI8A 2C6OA 3TV4A 2UW7A 3Q52A 4BDDA 2F2UA 5HU9A 5ANGA 4O0XA 4I94A 5LMAA 2ERZE 2UW0A 2Y0AA 3PA5A 3FL5A 2FA2A 3COKA 5H9BA 3L9LA 4ANOA 4JR7A 2GNIA 3PXQA 2Y6MA 3R7VA 4C4GA 2WELA 5GJDA 3QF9A 2HIWA 5F9EA 4IZAA 3E5AA 3R21A 3ZBFA 4JAIA 4QMOA 1YI4A 1K3AA 2X9EA 1W83A 1ZYJA 4B8LA 2BIYA 3NGAA 4FEWA 4QMZA 1OUKA 2ITNA 5AUVA 3LFNA 4W4VA 3D5XA 5ICPA 3R02A 5EH0A 2OJGA 3P5KA 3PXYA 3KL8A 1BX6A 5CVGA 3P86A 5EM5A 5KMMA 3OY3A 4USDA 2W05A 4K9YA 4YLJA 4IWOA 5E8WA 4WOVA 1KE8A 3VS7A 3VS5A 5IF1A 4DG3E 4DH3A 4EZ7A 3C13A 4KA3A 3ZUTA 3O7LD 4FTCA 1GIJA 4PP9A 3RZBA 3ORZA 3UVPA 1XH6A 3QQKA 4L3PA 2PL0A 5ETFA 5GNKA 5G1XA 1S9JA 3ZEWA 3ZXTA 2X2LA 2X6DA 4V0GB 4CLJA 5AIRA 2YJRA 4NIFA 1BL6A 4ZTMA 1HCKA 3EQRA 5GZAA 4YZMA 4MXYA 2X8EA 4KNBA 5H3QA 1SVGA 3FY2A 1BI8A 3R7IA 4F64A 5JKGA 3UIXA 4YTFA 3GI3A 3FE3A 4J97A 3Q2MA 3QRKA 1M2QA 3QTRA 4E4XA 1U59A 2R7IA 2GQGA 3SXSA 1CSNA 2BZKB 2YLEA 4XJ0A 3T8OA 4ENYA 3TNPC 1IRKA 4UWBA 5J1VA 2UVYA 4X2JA 2XCHA 5DR9A 4WNOA 5AP1A 1S9IA 2BHEA 2X0GA 5JK3A 4GMYA 4RVLA 2C6MA 3F5GA 3MYGA 4YJOA 3A2CA 2F9GA 4EOJA 2DQ7X 3EL8A 3SGCA 4MKCA 2WMAA 4MX9A 4EH3A 3DGKA 4FV2A 4W8DA 4E73A 2BROA 1OBDA 4O7ZA 4ZIMA 4IW0A 2XM9A 3EB0A 5L3AA 3PXFA 2B54A 3QKKA 2E9VA 5AUWA 4A06A 3HZTA 3QYZA 4C61A 5TT7A 5KHWA 3CR0A 3NUSA 2UVXA 1TVOA 2RIOA 4IEBA 3UOHA 2ONLC 5L6OA 4KBKA 1YOLA 1PXNA 3WYYA 3NW6A 4FKJA 4MCVA 5CWZA 4PL4A 2W1GA 4FT3A 1J7LA 4QNAA 4BI0A 2W5HA 3MBLA 4N0SA 4FV6A 3IOPA 5A4LA 3HV6A 3QGWA 1RE8A 1Q61A 3HV4A 4FUXA 4UZHA 5GZ8A 1X8BA 3W8QA 4GT5A 3NW5A 4QYEA 4CEGA 3MH3A 3HDMA 4H3BA 5AUXA 2Y8OA 3NIEA 3PXZA 4APCA 2IZSA 2WOTA 4FTUA 3S00A 1DAYA 4NM3A 4XOZA 4AN9A 4CRSA 4DGNA 2BRMA 3II5A 4FICA 2Z7RA 3OUKA 2BAJA 3QUPA 4NU1A 5HIBA 4UWYA 4BCGA 2OLCA 4AA5A 3PUPA 1VR2A 4X0MA 1I09A 4IDTA 4U9AA 2XKFA 3PIZA 5CF8A 1PMEA 4R3RA 3HL7A 3A60A 2QO7A 1RJBA 1YRPA 3B2WA 4YU2A 2VTJA 3KCKA 3TZ7A 2R64A 5CXZA 5KMNA 4FKRA 3A7GA 3MI9A 5CXHA 3BU3A 2CHLA 4HYHA 4IX6A 1CMKE 4ZSEA 2ITXA 4GYIA 4DN5A 3GQLA 5IA1A 5EDPA 4TTHB 5AX3A 2OGVA 1CKIA 3UG1A 2Y4IB 5F94A 4D1XA 4PPCA 3R22A 5DA3A 3DFCB 3R71A 5EHLA 2J0MB 3QTUA 1GY3A 3F3WA 4Y73A 3V8SA 5JZJA 2JBPA 3QALE 3QQFA 1F0QA 5FEDA 3PTGA 3QTQA 1KE9A 2IJMA 2WTKC 3D2IA 3D94A 4L01A 1ZY5A 4P7EA 2Z2WA 2ZYBA 1KOBA 3EQIA 3LFAA 3G90X 3OW4A 2IWIA 3OT3A 1PMVA 4TZRA 4BC6A 1CKJA 4GVJA 1LEZA 3C4CA 5D7AA 4M68A 3FLSA 4BDJA 4DFLA 5GIPE 5EW8A 4UB7A 4C02A 1NVRA 2VWBA 3UOJA 1DS5A 4C4JA 1G8AA 1WVWA 5AV3A 4BWPA 2AC5A 4LV8A 5HESA 4BIDA 5EFQA 2YCRA 3PJ1A 3THBA 2Q0BA 5CEPA 2C6TA 4NEUA 4XG2A 3Q6WA 4YHFA 5DI1A 5A6NA 5C9CA 2R4BA 5CNOA 4Y83A 5CAOA 4QP9A 2OF4A 1WBPA 3E88A 3L9MA 5E4HA 3GB2A 5T3QA 4ANNA 5D12A 2I7QA 1BKXA 1U5QA 4FKQA 5DMZA 4DFNA 2C69A 3E7OA 5DT0A 3CPCA 5E8SA 4EZ3A 4XG8A 5J7HA 3Q3BA 2XIZA 2XP2A 5J9YA 1UKHA 2VO0A 2X7FA 3D4QA 4FV1A 4EHGA 3VBWA 4NJDA 3UYSA 3K2LA 5A4QA 4R1VA 2ITPA 4KD1A 4YO4A 4BDFA 1OMWA 2XKCA 5AR5A 5FLFA 2WHBA 3HNGA 3QRUA 5BYLA 4OUCA 2EUFB 4PRJA 3VW6A 4HOKA 2YITA 3QXOA 4U3ZA 3G0FA 3RCDA 4QYHA 5D10A 3P08A 2PSQA 2XCKA 3PRIA 4D9TA 2W4OA 4R7BA 3QGYA 3Q5IA 4DEAA 2OFVA 2YM8A 2QI8A 2R3HA 3NYVA 4FT5A 4G9RA 5LXMA 4GYGA 2P3GX 2QD9A 2WMWA 2PTKA 4MK0A 5CSVA 1IEPA 3C4EA 5EYCA 3ULZA 3ZHPC 3QZFA 2FSOX 4XLIA 5AP3A 2CNQA 3OROA 5ANJA 3A7JA 4EOSA 2KTYA 4RC3A 1REJA 4PY1A 5I9VA 1PMUA 2G2FA 4FC0A 4H1JA 4IWPA 2YIYA 1PY5A 1WAKA 1M2PA 1Q3DA 4ZSJA 4BBMA 3F5UA 1R0PA 2X8DA 3MH0A 4JL9A 3ZRKA 4B4LA 4YSMA 2FSTX 3C9WA 3QRJA 2JDVA 3F88A 3C4ZA 4G2FA 4KRCA 3RMFA 4R6VA 5I9ZA 4C36A 1OB3A 4TYGA 1F5QA 5FDPA 2GDOA 2OJFE 3IQ7A 3FQEA 4G6OA 1ZYDA 2OXXA 4FG8A 2W0JA 5I0BA 4HGLA 3QQUA 1JOWB 4NWMA 4OT5A 1WMKA 3DKOA 4D2RA 4JG7A 5AP2A 4B9DA 3RKBA 4GK2A 2GCDA 2P2HA 4FTMA 4ONAA 5CTPA 4F7LA 2W1HA 1PXMA 2J5FA 2WTIA 3CE3A 3ZLSA 3G6GA 4M0YA 2QG7A 3IK3A 4S33A 3UC4A 5M4IA 1WVYA 4M12A 5EM7A 4PDPA 4ERWA 3F2RA 4ZLYA 4RBLA 4C3PA 4EI4A 2W1IA 5KO1A 3HP5A 2IO6A 3PSDA 4CYIA 3C5UA 5KKRB 3PVBA 3OWJA 4N6YA 2RL5A 2OXDA 5BVOA 2PUPA 2IVUA 2X8IA 2OH0E 4FKWA 5AR3A 5M09A 5AP4A 3AGLA 2YAKA 1ZXEA 2HY0A 4Y5QA 2ZV2A 2ZB0A 3WILA 4AZVA 5EHYA 3B8RA 3CTJA 5IH5A 1OI9A 3HMOA 4YC6A 3C5IA 1OM1A 4WHZA 3LFFA 3SVVA 4WSQA 5DRBA 5EK7A 4OTPA 5M4UA 3LOKA 5HLNA 4ANMA 3EN7A 3RTPA 5EW3A 1FINA 3HVCA 2XIXA 4FZDB 2W7XA 4V05A 3RK9A 5J5TA 3BYMA 3FMKA 1FVTA 3AD6A 2VTMA 4KKEA 3NUAA 5HVYA 1WVXA 2Y7JA 3DNDA 1L3RE 4L67A 4O91A 4KIKB 5CU6A 5EOLA 4ASXA 3PJ8A 4ZZMA 2IW8A 4AN3A 2YHVA 3QXPA 3WF8A 4C4EA 1ZOEA 1E1XA 2W1FA 2PUUA 1XKKA 3TWJA 3R2BA 3C0IA 4WG3A 5E9EA 2C6KA 4AE6A 3TNHA 2A1AB 1H01A 1ZY4A 5C27A 4YTIA 2VN9A 3K5UA 3MWUA 5CEQA 3SXRA 5I4NA 3I5ZA 4L8MA 3R1SA 1YHVA 5B2MA 3BE2A 2XIRA 3KRXA 1H07A 4OBQA 4C58A 3JY9A 5B0XA 3U6IA 1WFCA 1ZLTA 3LJ0A 4XP3A 3OWLA 4U43A 3TJCA 3TV6A 3FZRA 3OD6X 4FI1A 5HE1A 2PUNA 3SOCA 3KC3A 2BFXA 5GIOE 3EYHA 4IZYA 3DDQA 2R2PA 3QQLA 3VIDA 2VO3A 4CV8A 3B8QA 5EQYA 3S0OA 2RG5A 4J99A 2P0CA 3OVVA 2ZM1A 2BKKA 1H27A 1SVHA 2VTPA 5IDNA 1CTPE 5LVMA 4GJ3A 4FNYA 4BZOA 3EQHA 1KV2A 2FO0A 3GXLA 4LFIA 4CFUA 2WTCA 4LOQA 4LYNA 3TT0A 4PPAA 2R9SA 4O7LA 2F7ZE 3DOGA 5CLPA 3Q5ZA 4R7IA 4UMQA 4X6QC 4E6QA 2J9MA 1SZMA 1OPKA 5DR6A 5FTOA 2W1DA 4UYAA 3ZUVA 4DBNA 4MXOA 3CS9A 5IA2A 4TWCA 5I9XA 2CKOA 5KMJA 3UZRA 3NYXA 4DFXE 5IQFA 4PMPA 2ZDUA 5I9YA 2O0UA 4IXPA 4J7BA 3BI6A 4I5MA 3AT4A 2PE0A 3QYWA 4Z16A 3RNIA 4YJVA 3GCSA 4F0GA 4ACMA 4TYEA 5AX9A 5JFVA 5KMLA 1MRYA 2GQSA 3ZSHA 3F3VA 4QTBA 4PMTA 3WYXA 5IQHA 2OIBA 2EWAA 3RAWA 5M4FA 4FSUA 3WF5A 2O63A 2BZHB 3Q9ZA 4WKQA 4AQCA 4OTDA 4AT3A 2HXQA 2WEIA 3C4XA 4GFMA 4Y8DA 4BWKA 4M7IA 2JD5A 3PIXA 2HCKA 2CMWA 3Q2JA 4O86A 5K0XA 3PPKA 4OT6A 3LM5A 3JXWA 4L7FA 5J8IA 3KB7A 4F9YA 5DT4A 2PVHA 4NYEA 4FSQA 5AR8A 3K54A 1XQZA 3O0GA 4UMTA 3F3TA 3VUGA 3VF9A 2R0IA 3S1HA 3OOMA 3BGQA 4HGTA 4DA5A 3OG7A 4U44A 2FSLX 4GJ2A 2I0YA 1E9HA 3QFVA 4IACA 5IEXA 2C6EA 3NR9A 3OXTA 2QONA 3S4QA 5E7RA 2BUJA 3LFEA 4Y72A 2OFUA 2VUWA 3NX8A 1H1SA 2C4GA 4QTCA 4X2GA 1GNGA 3VBVA 2OBJA 4FTAA 4EJNA 3LFCA 3ZBXA 5A46A 4W9XA 4MXXA 3QTWA 5DEYA 2GTMA 2R3MA 3E8EA 3FPQA 3RI1A 1OUYA 2PVYA 4AGDA 2CKEA 4Z3VA 2C3KA 4HPTE 1BMKA 3SAYA 5IQEA 3CKXA 2BMCA 2Z7LA 4RX9A 4O7TA 3DV3A 2XNGA 4BY9E 4IAZA 4N6ZA 2E9UA 5M4CA 4NSTA 4FIJA 2FVDA 2VNYA 2CKPA 3ODYX 4KIKA 3C1XA 3I81A 5KBQA 5JEBA 3KRRA 2ITWA 1LPUA 3OCBA 5EQEA 4U79A 2LGCA 4QTAA 1VJYA 4PF4A 1WCCA 4IB0A 3ROCA 4B99A 1OL1A 2C30A 3ZFXA 1PJKA 4AU8A 4FL1A 5K4JA 2QG5A 5BMMA 2JITA 4ZTRA 3DPKA 3F61A 3RBWA 1PXKA 3A7FA 4K6ZA 4FA2A 3IGGA 1W0XC 2YLFA 3QU0A 3ZZWA 4OTGA 1XBCA 1SMHA 2YIRA 4IB5A 3CBLA 1AQ1A 3T3UA 1H1PA 3K3IA 3ZZEA 4JI9A 4BYIA 4ANLA 3EN4A 1W7HA 3EIDA 4U41A 5M55A 1SNXA 3TTJA 4QMLA 3HYHA 5JSMA 5IUHA 3P4KA 2YERA 2AYPA 3OTVA 1M2RA 2YDKA 3KFAA 3MY5A 1MRUA 2QOLA 4YC3A 4MBJA 2R5TA 2XYUA 3FKLA 4TNBA 2QOQA 2B52A 4X6RA 5KMKA 3ZM9A 3I0QA 4M0ZA 3WZJA 1WBWA 3KN5A 5EI6A 4QT1A 4XBRA 3CY2A 2JGZA 3BRBA 5CVHA 5J1WA 2BIKB 3KXZA 4QNYA 4BDEA 5I9UA 1V1KA 2GS2A 2VWYA 2X6EA 2XNMA 4YZDA 4CRLA 3GU4A 4R3PA 4EH8A 2XS0A 1PW2A 4GUEA 3R8PA 3Q96A 5JN2A 5F1ZA 4BIEA 3E64A 3DZQA 3HUCA 4BDCA 5KCVA 4AUAA 4ZMEA 5C4KA 3MPAA 3SKCA 3OHTA 3NNWA 2YACA 3CPBA 3D14A 3SG8A 2QOFA 5L2SA 5J5SA 1XO2B 3LCSA 4ZK5A 3FMDA 2VX3A 3F66A 3KULB 4KINA 5F20A 3CJGA 4RJ8A 3VBTA 5CANA 3FHRA 4LM5A 4C0TA 3O8TA 5KNJA 4GSBA 2FUMA 4IQ6A 3W2SA 1W98A 4RVTA 5DE2A 5M51A 5HNIX 4EONA 3E7VA 3C51A 3IW5A 3LAUA 3O17A 3VUHA 5B2KA 4JX3A 3GC9A 3F2AA 4G5JA 3OOGA 4HYIA 4BGGA 4DGOA 5LMBA 2HY81 5LOHA 2GHLA 3UNKA 2ETMA 2UZLA 2Z60A 4M15A 2B9IA 2ITQA 4Y85A 1YVJA 3V6RA 3MJ1A 2WMXA 3EL7A 1Q62A 4JDJA 2VTNA 4I5PA 3CQUA 3MVJA 4YURA 4GS6A 3HP2A 2UZTA 4IC8A 5CAQA 4EBVA 3W2RA 1LEWA 3GCQA 3PFQA 5ANKA 3SRVB 4ASEA 3RPOA 2VWXA 4FIFA 4NCTA 3I1AA 1STCE 1Q97A 5HIDA 3BLQA 3LCOA 3QTXA 4YNEA 2X81A 4FKUA 1OL6A 3BYUA 4BDAA 2G01A 2WU6A 3LFSA 3LW0A 5CZIA 4ZOGA 5DN3A 2VD5A 4X3FB 3CQWA 2FSMX 1H0VA 4MXZA 3BEAA 4F0FA 4GV1A 3QQHA 2GS7A 4AZEA 1XH7A 2QC6A 5IUIA 1YXVA 4LOOA 4BKZA 4BTKA 4ID7A 3FKOA 4M69B 4X2NA 2YM7A 4PNKA 4BVUA 2PE1A 3RHKA 1UA2A 4W4YA 5AP5A 3TDVA 4F6SA 4CD0A 4M8TA 5AP7A 3O23A 3BHHA 2EVAA 5B2LA 2JFMA 4S2ZA 5AR2A 2WMSA 4I5CA 2YWPA 3EN6A 3JPVA 4ZMFA 2Y4PA 3ZLXA 2Z7QA 4J8MA 4RVMA 1IAHA 4XG7A 3HDNA 3UO5A 2CLQA 3WZKA 5J7BA 4BIBA 2G15A 2HOGA 3RAKA 2YABA 3ID6C 2ZV9A 4MQ1A 3OCTA 4CMUA 1JSUA 4FTIA 4BKJA 3MGYA 4ZP5A 5T6KA 3FI2A 2ITTA 5D11A
chains in the Genus database with same CATH superfamily
4O7VA 3ZCLA 2H6DA 2JBOA 3UVQA 5H8EA 3RPYA 3IDPA 3R01A 4IAYA 4EOMA 2UW5A 3KMUA 4IADA 4GT3A 2B9FA 2J0JA 2R3FA 3AGMA 3FDNA 3LFQA 4MBIA 4NW6A 4PDOA 3V8WA 5CASA 3E93A 3TM0A 2NPQA 2JKMA 3R8ZA 4C8BA 4BJJB 4AW5A 1R1WA 3CLYA 2OKRA 2WIPA 4I3ZA 4AWIA 5FBOA 4BTJA 4IHPA 4ZY6A 4CZTA 4ACDA 2CGUA 1DI9A 2XRWA 4RZWA 3K5VA 4I93A 3QRTA 4XHKB 2VX1A 4NL0A 2UZEA 4YSJA 3MVHA 4G3CA 2CSNA 3R7UA 3LFDA 3P7AA 2CNVA 4QP6A 2HELA 3UIBA 1OVEA 4EORA 5DYJA 4M14A 2XZSA 4FKSA 3UOKA 3FYJX 3HRBA 3OXIA 4PTCA 5HNBA 4EK4A 4EYJA 3JS2A 2WMVA 2PVFA 1RQQA 3QAME 5HHWA 1XMLA 2H8HA 2HW6A 2X9FA 4ERKA 1M7QA 2CGVA 4EOPA 5IEVA 3AC3A 2SRCA 3KULA 3LXLA 4TT7A 3DTCA 2CGXA 5KX8A 3UJGA 5CQWA 1ZZLA 3O2MA 3U51A 1T46A 3SHEA 1KE5A 1JVPP 3N51A 5A4CA 3JYAA 3FQSA 4FSRA 5DWRA 3BHYA 3RAHA 3UDBA 3ORPA 5HCXA 4F1OA 5A3XA 3RPRA 4FOCA 3OFMA 5KMIA 5LMKC 2CNUA 3BIZA 3EKKA 2BFYA 5K4IA 4ACGA 1W2DA 3C4FA 4Y5HA 1OPLA 4U3YA 1OITA 4BCFA 5IH4A 4AGUA 3UC3A 1Y6BA 3OC1A 3RM6A 4F70A 3CTHA 4I6QA 1REKA 5BVKA 4CQGA 1L8TA 5H2UA 4MD8E 5CF4A 4CT1A 3FMJA 3LQ3A 3KXNA 4X21A 4UN0C 4JBQA 4ZSGA 5BYYA 1CDKA 3SRVA 3POZA 4XV3A 5CSXA 2WPAA 3WZUA 4BDHA 1GJOA 4CKJA 3QHWA 4QYYA 4H1MA 4AXAA 4EEVA 4XYFA 1W84A 2C5NA 3V5TA 5DR2A 2BZJA 4EHEA 1OPJA 5AEPA 3H0ZA 1MP8A 4FX3A 5AR4A 4RX5A 1XH4A 1PXLA 2VWUA 4X3FA 4NM0A 2OJIA 3U9CA 5KBRA 4S31A 1QL6A 1JLUE 4JXFA 5CQUA 4RWIA 5HO6A 3ZU7A 4HGEA 3ENMA 4Z55A 3FV8A 2QO2A 1YWNA 2XK8A 4CZYB 4O7WA 2G2IA 1MQ4A 1ZYLA 4M69A 5BX0A 1ZAOA 3TCPA 3HLLA 5C8KA 2YJSA 4OTHA 3UMWA 5EI8A 3ORXA 3V5WA 3VS6A 4CFFA 1B38A 3FMEA 5HZNA 4FEXA 4S34A 3VHEA 4C37A 1XR1A 4MAOA 1VYZA 4DCAA 4M84A 3NUUA 2UV2A 3M1SA 4QMXA 1H0WA 3PG3A 2R7BA 4IAFA 3L1SA 3H0YA 2OWBA 3MTLA 3UQCA 4FVQA 4D2WA 2B55A 4HCTA 5HE0A 4RFMA 4BCQA 4DCEA 4HVDA 2PUIA 5TOZA 2VTLA 5L8LA 5GINE 2PPQA 4IFGA 3TEIA 2WMRA 4E8AA 1MUOA 4AT5A 1OKVA 2GNFA 3AC5A 3LIJA 4FG7A 3DU8A 5AAEA 3QCQA 2YDIA 5LJJA 1XJDA 3PJCA 1Q8YA 3D0EA 3AT3A 4FODA 1R3CA 5E8YA 3QKLA 2JKOA 3I6UA 1QCFA 3IECA 3JVRA 4MF1A 4PMMA 3ELJA 1PF8A 4XH6A 4K1BA 3UO4A 5DG5A 4BJJA 1K2PA 2YEXA 5CZHA 3AKJA 1Y8YA 3A8XA 3OY1A 4N70A 4UEUA 4XS2A 5AA9A 2BKZA 4O27B 5HG5A 4BGQA 3G0EA 2J2IB 3ATTA 4IZ7A 2C6DA 3KKVA 3R73A 5EQPA 3HMIA 3VONA 2GFCA 4PTEA 2Z7SA 2WZJA 5FXSA 1KE6A 2R3GA 4U6RA 3R30A 1R0EA 4UXQA 4ARKA 4AS0A 4L9IA 5HTCA 4ZLZA 4F09A 4YZ9A 3ZDUA 3R9RA 4FVRA 1UU9A 2C1BA 3MA6A 4OTRA 5E8XA 3SX9A 5HLWA 5K3YA 3ITZA 4MXCA 5AJQA 4ANQA 2W5AA 2OZOA 4LQMA 3HV7A 4TRLA 2CKQA 1GIHA 2AQXA 4X3JA 2O65A 4QMSA 3GVUA 4RWLA 2UZDA 4MWHA 1H8FA 4AW2A 3BV3A 4RMZA 4IIRA 3UIUA 5BNJA 1H1RA 3L9PA 1M7NA 2VAGA 3P1AA 3ZS5A 4C33A 2XK9A 2GFSA 3P9JA 5BVNA 1W82A 4KB8A 2QOBA 4AXFA 2BILB 2IZRA 3W2PA 5IZFA 3SW7A 3R9OA 5IPJA 3AMBA 2HENA 4YJSA 4CGAA 2JAMA 4ZTSA 4F65A 2A19B 5CEKA 2ZB1A 1IR3A 2WMQA 4CNHA 3G15A 4NM7A 4DDIA 2XVDA 4W8EA 2IZUA 2WIHA 3DBQA 4KS8A 4QMMA 2XRUA 2XB7A 3LQ5A 4UBAA 3U54A 3FC2A 2J50A 2UZVA 4A4LA 3RM7A 2UZOA 3C50A 3DQWA 4HW7A 4X2KA 2HWOA 3NSZA 3RGFA 3M11A 1V0BA 4XUFA 3GOKA 4AGCA 3PPJA 4O4BB 2Q83A 1M52A 4W9WA 1G8KA 5TE0A 5FEEA 1PRYA 4QP8A 2R3OA 4FZ6A 3BBWA 2B4SB 4F9BA 3IO7A 4UY9A 3QA0A 5DNRA 5AUZA 3LMIA 5ETAA 3LQ8A 2J4ZA 4OTQA 2JDOA 4IB3A 3VUMA 3U9NA 4ZTQA 2QO9A 1H08A 4JNWA 4XRJA 5CS6A 4MVFA 4IWQA 2EB2A 5BUIA 5JMSA 3LFBA 5DGZA 3KRLA 4K33A 5CEMA 4OAVB 5HVKA 5IU2A 4GH2A 1U5RA 4XG6A 5HX6A 5C1QB 1XBAA 2JAVA 4A9YA 5CAUA 4LL5A 4J96A 4UYNA 3F69A 4YP8A 2A27A 3DY7A 4LMNA 3DNEA 3IGOA 2YAAA 3OEFX 3OP5A 4CSVA 4FOBA 4KKGA 3NRMA 4RZVA 5BPYA 2RFNA 1JKTA 3BCEA 3MH2A 2XBAA 3VS0A 3AD5A 4PL5A 4BKYA 2XH5A 3C7QA 4DFZE 4AOTA 3SXFA 2GHMA 3E8NA 3GC0A 3KK8A 3FSKA 4C3RA 5IQIA 3BX5A 4I1ZA 4C2WA 5FD2A 3A61A 3KY2A 5CU2A 3R7YA 2W99B 2XYNA 5HLPA 3GQIA 4MF0A 3QTZA 3LMHA 1GZNA 3UP2A 3VWAA 4CG9A 3OCSA 1WBNA 2XNPA 5F95A 5A6OA 2YWVA 4G6LA 5A4EA 2ZV7A 1UNHA 3UODA 1PXOA 3D15A 3MPTA 4FZ7A 3DA6A 1GZOA 4EC9A 4GUBA 2XJ1A 4QMYA 1BL7A 4RGJA 3VW8A 5I3RA 3GENA 3LJ1A 4HYUA 3HECA 4W4WA 2E9NA 4QEBA 3QWJA 1H25A 4D2PA 5L8KA 4AFEA 3ORTA 4LI5A 4NJ3A 4PPBA 3VRZA 4QPMA 4DTBA 1Q8TA 3CP9A 3PA3A 3HV3A 2VWIA 3AXWA 4YGAA 3VS2A 4D2SA 4BICA 5JH6A 1T45A 1KSWA 4FTNA 3V04A 4DHFA 2YISA 5HGIA 4OTFA 4AW0A 5IMXA 4AZTA 3R7GA 3WBLA 3ORIA 4GIHA 4HYSA 2I0EA 3F7ZA 3ZM4A 4ENXA 4NTTA 3ZO4A 3ZOSA 4TWOA 4DINA 4HCUA 4JRVA 4XX9A 4GT4A 4YTHA 3R83A 3NUXA 4A7CA 4E4NA 4EKLA 5A14A 4BR3A 2YDJA 4Q2AA 4DE4A 4TXCA 4WRSA 4EOQA 3OMVA 4FTJA 3D7ZA 4J8NA 5L4QA 4U7ZA 4BGHA 2CCIA 3IONA 3LLAA 3QL8A 2JIIA 1ZMUA 3AC2A 4LOPA 3B2TA 3I79A 2PMLX 4DT9A 4M3QA 3PIYA 3FL4A 2BAQA 3ZH8A 1NA7A 4ZTLA 2BRBA 5HI2A 2WFYA 2NRUA 3ET7A 1YHWA 4FBXA 4AACA 2W17A 3HUBA 3TUCA 4CG8A 3HA8A 2JLDA 4C34A 3BPRA 1YQJA 5ACBC 3W55A 5IA4A 4FR4A 3POOA 5AM7A 4L6QA 3FLWA 5FBNC 4CZUA 3LXKA 2IPXA 5FUTA 2R0UA 3LHJA 1DI8A 3MB6A 2QOHA 3QHRA 4O22A 4DG0E 5IQDA 3F7WA 5CALA 3GCVA 1NY3A 3KVWA 3MTFA 2EXEA 3ZSGA 2B0QA 2QLQA 4MHAA 1P14A 4QPAA 1V0OA 3ULIA 4BDIA 2UW8A 5J79A 4ZZNA 1WZYA 5GZ9A 4YNOA 3EFKA 3RALA 4EQUA 3ORKA 2XK3A 3F5XA 3W0QA 4A4OA 5I5ZA 4GFOA 4NTSA 3MIAA 4RJ3A 1P4FA 4O7NA 4HVSA 5DT3A 4BZNA 5JFSA 3LM0A 2IW9A 1O6YA 4RC2A 4R8QA 1JPAA 4A9UA 4UX9A 1J7UA 4FT0A 4ZJJA 4JVGA 4ITIA 4TPTA 1FMKA 1BI7A 4DHZA 3RCJA 5CAVA 3ANQA 1KV1A 3FXZA 4UXLA 4C35A 1IASA 4CCUA 4JQ8A 5K5XA 3EN5A 3GU8A 2OG8A 4FVPA 4O0WA 2NYAA 5M07A 1KWPA 5AV2A 4FV9A 4ANBA 2FYSA 2XNBA 4RJ4A 3Q4CA 4BL1A 3PZEA 4DEDA 4Z7HA 3IW8A 3MY1A 5CENA 5FG8A 3FI3A 4ZJIA 2XK6A 3R8LA 3IW4A 3VUDA 4LV7A 3E3PA 3OBGA 4TWPA 5D9HA 4B0GA 2PMIA 3BLRA 1Q8WA 3F2NA 4C57A 3OBJA 4O4DA 2XJ0A 1YXXA 2IVTA 2PVRA 4CV9A 2GHGA 1JSTA 1UKIA 4ALVA 2FB8A 3O8UA 3W32A 2CN8A 3ZXZA 1W8CA 2GNLA 4WUNA 5EHOA 5LCJA 3NAYA 5AFVA 3GGFA 4JBPA 5HBJA 3VVHA 2J6MA 2BDJA 1F3MC 3MH1A 4O38A 4D2VA 3OEZA 2VV9A 1SYKA 4JG8A 3BGPA 4DH8A 5BUJA 5A9UA 3W2OA 3PVWA 3QX4A 3PSBA 2W9ZB 4EOIA 2XK7A 4AFJA 4CYJA 2J90A 4PP7A 1PHKA 1ATPE 3GU6A 5EM8A 2I6LA 4AGWA 3KVXA 1GIIA 3KA0A 4M13A 4X2FA 4FEVA 4AZSA 3W0MA 4A9RA 4XLVA 4EK8A 4CTCA 2GS6A 1NVSA 3D7TB 3GP0A 2WGJA 5D41A 2GMXA 1KUTA 3NYOA 2J7TA 4YR8A 3ORNA 2QODA 5EI2A 1H00A 3HA6A 2X2KA 4D1ZA 3QBNA 3RZFA 2BHHA 3RAIA 4IDVA 3U8WA 3LCKA 4QRCA 4KS7A 4LGGA 4AP7A 1OIUA 1XWSA 3IW7A 2YIWA 2JDRA 3QC4A 4WIHA 5EKOA 3O96A 3EQBA 1YWVA 4EL9A 4DHIB 2F4JA 4J52A 4O6EA 5DH3A 4AZFA 1RW8A 2BTSA 3IS5A 4ZSAA 4K8AA 3REPA 3U87A 2E9PA 1UVRA 1Q8UA 2YCSA 3DJ5A 4G9CA 4DHJA 3UMXA 3LCTA 5CU0A 2VTAA 1OL7A 4TNDA 3WF7A 1Q5KA 5JQ5A 4E1ZA 2HW7A 5AA8A 1UNGA 4F6WA 1OKWA 2Y4IC 5FXQA 2C0TA 1TFFA 4ZY4A 2RGPA 3R04A 1SVEA 3OUNB 5HCZA 2GPHA 4AE9A 3PUFC 4M97A 3BE9A 3SV0A 3Q9XA 1ZARA 3FZ1A 3E92A 5CU4A 4HNIA 4WG4A 1APME 2HZ4A 3O71A 4UWCA 4D9UA 3EQCA 4I4FA 3EH9A 4JJRA 2YN8A 2NP8A 2C3LA 4O6LA 1IAJA 3QTIA 4PMSA 3L8VA 4JDIA 4C4FA 1ND4A 2Z8CA 1LR4A 3E3BX 2ETRA 2JFLA 5DOSA 5HIEA 3NUYA 5AWMA 3UZPA 2P4IA 4IAAA 3E87A 3FKNA 4FNWA 4XMOA 3ZC6A 3PLSA 1JWHA 5H8GA 5IG1A 3CQEA 4QYFA 3UQGA 3FWQA 4DH1A 2JEDA 4FSNA 4KSPA 5FP6A 2C6LA 4C4IA 4LMUA 1U4DA 4FV5A 4I23A 4F6UA 2PMOX 4FT7A 2XJ2A 2RFEA 4NH1A 3V5PA 4E93A 5HORA 4BCIA 5M53A 3KEXA 4FV7A 4N57A 2R3PA 3D5WA 4FYOA 2OK1A 3DCVA 4WD5A 3WIKA 4MD9E 3AKLA 2W4KA 3CJFA 3UQFA 4ASZA 3LVPA 4KWPA 5FTGA 3LXNA 4G3GA 4L3LA 2EXMA 4NT4A 4XRLA 2OICA 2B9HA 4ZS0A 4R78A 3G5DA 3V6SA 3LZBA 3PFYA 3MN3A 1YKRA 3L8PA 3UO6A 1XH9A 2QR7A 4HVGA 3PJ2A 4O7SA 1OBGA 2XBJA 3BEGA 2JKQA 3OZ6A 4FNZA 4JDHA 1BLXA 2YCFA 4WRGA 4OBOA 4LV5A 3LCDA 3EZVA 4D0WA 3UZTA 4EHVA 2I0HA 4KRDA 3AC8A 4QO9A 3ZDIA 2XK4A 4DG2E 1URCA 4D4SA 4KIOA 3VHKA 5CT7A 2F7XE 2XKDA 4YPDA 2HWPA 3ATSA 3BQRA 3PJ3A 2ITUA 3HMNA 3Q9YA 4XCUA 2H34A 3OCGA 1PKGA 1ZRZA 2X7GA 2O64A 2F49A 2XM8A 3UGCA 4A9TA 1WBOA 4E26A 3QLGA 3MJ2A 4FL2A 4IVCA 3VQUA 4ANSA 4YTCA 5F4NA 2X4ZA 2WOUA 2OXYA 3N9XA 3R8VA 3VUTA 3IDBA 3OW3A 4I92A 3KRJA 2W4JA 4EH4A 3KGAA 5IMEA 3R8UA 3GUBA 1R39A 4XV2A 3UYTA 3NLBA 3ZC5A 3GU5A 1G8JA 5JT2A 2YCQA 4DH5A 3RK5A 4OAUC 2WQOA 5AAFA 3VO3A 1FOTA 3D7TA 4F7SA 4BHNA 2OU7A 4FT9A 1QPCA 4P5ZA 5E1EA 4IM0A 2ERKA 3G9LX 5EYMA 2BPMA 2FGIA 1OECA 3ERKA 3U55A 2PZRA 3DBDA 3I4BA 3OXZA 2X4FA 3QZGA 2XA4A 2ZMCA 3KRWA 3MY0A 5LMKA 2W5BA 3TKIA 3GFWA 1NW1A 5IQGA 3WIGA 1Y91A 4FIHA 3VBXA 5IKWA 5E90A 3NCZA 4D4YA 4ZSLA 2ZAZA 3AC4A 4JAJA 1G8SA 3HAMA 5AMNA 5E92A 1M14A 2QNJA 3EJ1A 3KF4A 4RLKA 4O83A 3O5AA 3DAJA 3NS9A 4USFA 2QKWB 4G5PA 1G5SA 4DEHA 4AAAA 4E5AX 2PYWA 5KKRC 4JBOA 5TO8A 3FZPA 2QR8A 2BR1A 3OWKA 5L2WA 3LKMA 4QTDA 2V0DA 3QC9A 4MD7E 2CCHA 5KZ0A 3QUEA 4Y95A 2X39A 3T9TA 5J9ZA 4J95A 5GJGA 5IH6A 2BAKA 4BFMA 5EYDA 2QURA 4QQJA 3MA3A 2J0IA 4L00A 4OR5A 3NUPA 4K0YA 3M2WA 2GTNA 2XNOA 3W18A 5CY3A 5ANEA 1FVVA 3ZFMA 3BV2A 3FC1X 3P7BA 3KK9A 4B6LA 3DBEA 4HZSA 4L46A 2HK5A 3QA8A 3M42A 3QTSA 1YXUA 1MQBA 3BHUA 4BBFA 5CYIA 2IW6A 4C38A 4FG9A 4J1RA 1IA8A 2BCJA 5JQ8A 3HEGA 4F7JA 1TQPA 2Y6OA 4EH2A 1OIYA 2PK9A 4DTAA 2CLXA 2JC6A 2P33A 3UOLA 5DVRA 3A7IA 4FSWA 2IG7A 2BDWA 4R77A 5K9IA 4LG4A 3P78A 3TIZA 2CDZA 4YHTA 4FSMA 4FTLA 5LWMA 2ZM4A 4UV0A 2P55A 3UDSA 2QOKA 1NT2A 1OGYA 3CEKA 1ZMWA 4I5HA 2C5XA 4TW9A 4YZBA 5HICA 2QKRA 2DYLA 2J5EA 4MH7A 4JG6A 5HTIA 2EU9A 2ONLA 3PXRA 3V8TA 4PDYA 3BWJA 2R3JA 2W1CA 2WB8A 4XEYA 3FY0A 4DFYA 5KZIA 5DBXA 2UVZA 4R5YA 5E1SA 5JZNA 3MB7A 3R1QA 3TACA 5HD7A 4R7HA 5AV4A 2I40A 3UP7A 2ZM3A 3EYGA 5M57A 1ZZ2A 4EK6A 2UW6A 2PE2A 4FTQA 5L6WL 3VRYA 2VTHA 4CKRA 2CJMA 1DAWA 4L44A 3Q4TA 5IISA 4RWJA 5HO8A 1P2AA 3CKWA 3UDZA 4FZFB 3MFTA 4LRKA 4H05A 3NNUA 4YJNA 4BCJA 2GNJA 3CSVA 3TNWA 2I1MA 1O6KA 4S30A 3SD0A 4FRFA 3DK7A 5JRSA 2DS1A 2JDTA 3QD4A 4BHZA 4FK6A 3G9NA 4WO5A 4OTIA 5BVEA 4G17A 3V5JA 5AAGA 4TYHB 2HZ0A 3P7CA 4EKKA 3QQJA 5H8BA 4EJ7A 3SC1A 4B7TA 1QMZA 3DXPA 3I0OA 4Q5HA 4YPSA 1RDQE 4J71A 4DLJA 2W9FB 1ZYCA 1PKDA 3PPZA 3RK7A 4AOIA 3PDTA 1H1QA 3PRFA 3PZHA 4WNKA 5LVNA 5HNGA 2ZVAA 4CFVA 3FLQA 1MRVA 2O5KA 5GHVA 3FMMA 4IJ9A 4ZEGA 4PNIA 4OBPA 4X7QA 2WXVA 3EHAA 3HKOA 5BQ0A 4FSYA 4IX5A 3LPBA 4RRVA 3R7OA 2HYYA 2C47A 2ACXA 3QX2A 4A4XA 4BTMA 4DFUA 3ETAA 2J0LA 4EUTA 2DWBA 3S95A 4AN2A 4EBWA 1I44A 5EDRA 3RVGA 4EH7A 4RLLA 4U40A 3U6JA 2UZUE 1A48A 1UNLA 2GSFA 3A62A 4C2VA 2QLUA 4QQ5A 2RKUA 3H3CA 1XH8A 4Q9SA 3TNQB 1FPUA 3KMWA 5LVOA 2GNGA 1H28A 3Q53A 4OGRA 4QOXA 4E4MA 3ACJA 5ANDA 5TR6A 4EH6A 4RIXB 5HTBA 1YI3A 4YJTA 4QMQA 5M08A 3DK6A 4IX4A 2KULA 3UDTA 2OJJA 4H3QA 4FKIA 3E8CA 3FJQE 3PP1A 2HZNA 3DFAA 4TN6A 3ZLYA 4NCTC 3RPSA 2BTRA 2XIKA 4N4SA 3FLZA 4QMNA 2NNWB 1JSVA 4H36A 3ZSIA 2XAMA 3EFLA 3N4UA 3QCXA 4IAIA 4IE9A 4V01A 1ZYSA 5LCKA 3UNJA 4TKSA 5HX8A 3BWFA 4LUDA 2VTQA 1Q41A 3DBFA 4K11A 3ZLWA 3W0NA 3PA4A 3IKAA 4G3FA 4G31A 2UUEA 3ENHA 1H24A 4DYMA 4P2KA 3QD0A 4G34A 4IVBA 4P4CA 5A4TA 4RA5A 4I6FA 5E8UA 2R3RA 2F2CB 2R3KA 5L2IA 4BI2A 2UW9A 1YOJA 4LRMA 3AG9A 3PXKA 4F78A 4IM3A 4LGHA 2V22A 4OLIA 1UU3A 4QP4A 4BCPA 2O3PA 4FTKA 4L3JA 5EW9A 1NXKA 3LXPA 3GFEA 3IOKA 4FKOA 4C59A 4EZ5A 2BVAA 2QHNA 3HAVA 4FV4A 4IVAA 4QDVA 2VNWA 4RPVA 4ACCA 1J1CA 2WNTA 3W0SA 3N4VA 2QQ7A 4BCOA 1OKYA 2ETKA 3CTQA 4QTEA 4JOAA 3OTUA 2OSCA 1FQ1B 4ZLOA 4MNEA 1H26A 2R3LA 3NNXA 4HVIA 3D5VA 4O1OA 4QQCA 5LARA 2H9VA 5HE2A 4XV9A 4D58A 4EOOA 5HCYA 4RFZA 4YZNA 3EWHA 1PXPA 3ODZX 3QCSA 3MFRA 5DFPA 4BRXA 3FZSA 2B1PA 1QPDA 4FIGA 5HG9A 3MIYA 3KQ7A 3PP0A 3UVRA 3W2QA 3W33A 1YHSA 4AF3A 5HKMA 1Y8GA 2WTVA 4F63A 3EQFA 5ANOA 3IPHA 3I6WA 4CQEA 3HMPA 1OGUA 4EOLA 5LWNA 4RJ7A 4JX7A 3NVKI 4O4EA 5JGBA 4V04A 3EKNA 4GU9A 2J0KA 1YI6A 2JDSA 2YFXA 2VTTA 3VS3A 3D83A 3DTWA 1K9AA 5KE0A 3O50A 4FTOA 4KIPA 4C3FA 3BU5A 3HMMA 3I7CA 4R3CA 2V7OA 4TYHA 5I3OA 3A4PA 5HEZA 2LAVA 3QQGA 2QOCA 4ZXTA 3O7LB 3TMOA 5KUPA 1U54A 1YW2A 2XKEA 4IH8A 4YJPA 4IVDA 1YOMA 5AR7A 3VNTA 2QCSA 5E8ZA 5BVFA 4DF3A 3Q9WA 3TN8A 3GU7A 1QPEA 2XMYA 4GFGA 3ZONA 2WTJA 5KMOA 3OT8A 3FXXA 4KUJA 4BN1A 3PVGA 2NO3A 4RX8A 3PWDA 4LRJA 3EZRA 3FZOA 2WQMA 3KXMA 4IANA 2PWLA 3IG7A 4L45A 3QWKA 3FBVA 4NFMA 4YLKA 1R78A 1E1VA 3UTOA 3FUPA 5T68A 4ZZOA 1KE7A 4CFXA 2XIYA 1ZMVA 4P5QA 3CGOA 2A0CX 3UG2A 3VN9A 1Q99A 3RHXA 5EM6A 4APPA 5LQFA 3VAPA 3COHA 5GJFA 3LJ2A 3SLSA 4OW8A 1UU8A 3VF8A 5C8NA 4XG9A 4DAWA 4XP0A 5ANIA 4YMJA 3DT1A 5LVLA 2F7EE 4I22A 1FMOE 2RFDA 4PQNA 5C8MA 2R3QA 4G3EA 4RIXA 3FMNA 2F57A 3AOXA 4G3DA 4I0SA 5DEWA 1XHAA 1Z9XA 2R3NA 4O21A 3T9IA 5CSWA 2JIUA 4G6NA 2ZJWA 3FQHA 4MQ2A 2VWVA 3TNIA 2V7AA 3RWQA 3BKBA 1TQMA 3BQCA 4ACHA 3TUBA 4YJQA 4DT8A 3E62A 3GCPA 5FQDC 2QU6A 2Q0NA 3A8WA 1XBBA 4X3FC 2WQEA 2E2BA 2VTRA 3EFWA 4XBUA 4XNEA 3TV7A 3VUIA 2Z02A 4DFBA 5AV1A 3SW4A 3TIYA 3VJOA 3KN6A 1DM2A 4V0GA 3W10A 5AADA 5IQAA 5EKNA 3BLHA 4DC2A 3C4WA 4DEBA 3EFJA 3DXQA 4EWQA 4LGDA 2YZLA 3CCNA 5E91A 3LLTA 3CXWA 3MPMA 4JT3A 4L43A 3CGFA 1TZDA 2PVLA 3BELA 4H58A 4BCMA 5IA3A 3N4TA 2XEZA 4RFYA 5IQCA 1G3NA 3FLNC 3L8SA 4L53A 5AM6A 3ZRLA 2WTWA 3G2FA 3TI1A 3DJ6A 3MFUA 3R28A 3DJ7A 4PV0A 4CVAA 2XNEA 2QOIA 3F9NA 3TKHA 4H3PA 4PUZA 3G51A 3F5PA 1GOLA 4BDKA 5DLSA 2ZFYA 3RWPA 4FF8A 3NEWA 5JGDA 3W0RA 1U46A 4U80A 4JQ7A 2UW3A 4KIQA 4QPSA 5HE3A 2JKKA 4BDBA 2VWWA 4CFMA 3BGZA 2WEVA 5EG3A 4D5KA 4O82A 2WQBA 1WBTA 3GC7A 5CF5A 2P2IA 3GT8A 5HG8A 4ZTNA 2PU8A 4FTRA 1Q4LA 3SDJA 3WI6A 4ITJA 4D1SA 3I60A 4WBBB 5CX9A 5CI6A 4KABA 2QVSE 2C3IB 5AUUA 5HBHA 5DHJA 5CEOA 2VX0A 1GZKA 5HQ0A 4LL0A 3RINA 3PYYA 1UWHA 1AGWA 4MYGA 4QP7A 4F0IA 3OWPA 2VTSA 4O0UA 4XOYA 3Q6UA 1XH5A 3H9FA 1CKPA 3I5NA 4CT2A 4Z9LA 1JKKA 4FKGA 4YUQA 2C0IA 5FDXA 3TG1A 2IVVA 4CMOA 3U4WA 2O8YA 3A99A 3EN9A 3AD4A 2CPKE 5AUTA 2C5YA 3AQVA 4AW1A 2YA9A 4NUSA 4MTAA 3WZDA 4EUUA 5D1JA 2OI4X 3UPZA 5KHXA 1ZOGA 4P90A 3R2YA 1YWRA 4J53A 1YDSE 4E6AA 3R00A 4MXAA 3EQDA 3BHVA 2CGWA 4F7NA 3FXWA 4A07A 3UE4A 5K5NA 3NMUF 2ZOQA 4D55A 3ZYAA 4O0VA 4EH5A 1JNKA 1Q8ZA 2IVSA 4BYJA 3PE2A 3CC6A 3BHTA 3WOWA 4Y46A 3G33A 4D4VA 4S32A 3OF0A 4NM5A 2YIQA 3S2PA 1OL2A 4DBXA 2YM6A 3QZHA 4FIEA 4I6HA 4QMTA 3EQPA 2VO6A 2RG6A 4OTWA 4QMWA 3FZTA 4QP2A 4CTBA 3AT2A 3FPMA 4FV0A 4DTKA 3JR1A 4QMVA 2BRGA 3FYKX 4YJRA 2VTIA 5G6VA 2OW3A 4AA4A 3DDPA 1CM8A 2WTDA 5CSHA 4M66A 3VJNA 3IDCA 2UZBA 2G1TA 4D4RA 3D5UA 4I24A 2HAKA 1UU7A 3DB6A 2A4LA 3FSFA 2X0OA 5HG7A