4PV0A

Crystal structure of spleen tyrosine kinase (syk) in complex with an imidazopyrazine inhibitor
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
275
structure length
268
Chain Sequence
VYLDRKLLTLEDKELGSFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Discovery of GS-9973, a Selective and Orally Efficacious Inhibitor of Spleen Tyrosine Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 87
structure length 268
sequence length 275
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4pv0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4pv0A01
4J8NA 3A4OX 2C1BA 4CD0A 4UXLA 3U9CA 4FKWA 4O0VA 3N51A 4C4HA 4F4PA 3KF7A 1PF8A 1E1VA 3V5PA 4PP7A 2IWIA 4PPBA 3LXPA 3V3VA 4PDYA 2XCKA 2X81A 4K0YA 4E5WA 3V01A 3DXPA 4LOOA 2Z2WA 3MFUA 4KIPA 2P33A 3EQIA 1SM2A 5H3QA 3NW7A 4JNWA 2C5VA 4IWPA 2UUEA 3P7CA 3P1AA 4GG5A 2PVLA 2PZPA 4IH8A 4JJRA 4LRKA 2HELA 2VU3A 3FHRA 4K6ZA 3JS2A 3JR1A 1OL5A 2Z8CA 4HGTA 2J90A 3G9LX 4LRJA 4OTWA 2C5OA 4O0RA 3CKWA 5HE0A 5BYZA 2R3QA 5LCJA 3MA3A 3HRBA 3VUMA 1GJOA 4EORA 4FBXA 3RK5A 4UEUA 4O27B 4F9WA 4HZRA 3DAJA 4J1RA 4M97A 3QLFA 4G3EA 4C59A 3U6JA 4FNXA 4CMUA 4S31A 2YWVA 1JSVA 2YIRA 4QP9A 2WGJA 2XBJA 3QHWA 1Q5KA 1YW2A 3BV3A 3R21A 4MBLA 3CPCA 2Y9QA 3ZLXA 4YBJA 4C61A 3QD3A 5AV4A 4B6LA 2A4LA 2WMXA 2EB2A 2ITUA 3BLRA 4HOKA 3W2CA 4KUJA 4MTAA 2W9ZB 2WXVA 4UB7A 3RPRA 4D2PA 5DVRA 2XNMA 4FE2A 4FT5A 3LFBA 1EH4A 4M13A 3PVGA 3UVRA 5CXZA 4RRVA 5E8WA 4Z55A 2ITWA 2HZIA 4R5SA 3E93A 3R8UA 4NCTA 4UMRA 4ARKA 2WFYA 3KRLA 1V0PA 5TKDA 5TF9A 4ZJJA 3V8TA 5IEXA 3U87A 2PZYA 4U7ZA 1YHVA 5H2UA 1S9IA 2FYSA 2H34A 3A60A 3BLHA 4FK6A 4CZYB 4PDPA 2JBPA 4TNBA 2B9HA 2Z7RA 2KULA 4AXAA 2X39A 4IB1A 3QC9A 1HOWA 1KV1A 4L45A 4FTTA 1U54A 3QBNA 3NAYA 5ACBC 2GNHA 5H8BA 4C3RA 3LPBA 3TKIA 4ZTLA 4W4XA 5HGIA 3VIDA 4G6LA 4L8MA 4IAZA 5FTOA 3K2LA 3FMLA 1R0PA 2JDSA 3DDPA 4FG7A 4IZ7A 4FEXA 4V04A 2YLEA 4BC6A 4CTBA 4I6QA 4L3JA 5M56A 1UNGA 5DT4A 2LAVA 4RLLA 1OPLA 4JAJA 2RF9A 3D9VA 5DH3A 3ZOSA 4LOQA 3IKAA 4YJNA 3W10A 5E8TA 3VUKA 3ZO1A 5EG3A 3ZFXA 3HECA 2HYYA 3KK8A 1U5RA 2B52A 2I6LA 4B9DA 3TKHA 4FV3A 3PJ3A 3IDBA 1YHSA 1O9UA 3MIYA 4U6RA 2HK5A 3OCTA 4XG6A 4AGWA 4MH7A 3IPHA 1LEZA 5HORA 4FV0A 5BNJA 5CF8A 2PMIA 2W4KA 3PJ8A 1H25A 2YWPA 4FTJA 4GT3A 3COHA 4CKRA 4ACCA 5HTCA 3BGZA 4KKHA 4YLLA 3AT4A 4FVPA 4FTAA 2O65A 2VWZA 4DG0E 4J53A 2BRMA 3E8EA 4ACDA 5EQYA 2UW6A 1W98A 2FSOX 5IQDA 5AR2A 3FL4A 4O84A 3M2WA 4IQ6A 5J1WA 4C4IA 4H3PA 4IX3A 4KIQA 4M69B 3QC4A 2ZDUA 4ANBA 4BKYA 2GQRA 5GZ9A 5HCXA 4PL4A 4FICA 5HOAA 3TCPA 3UVPA 4FKOA 2C6MA 5KKRB 4O7WA 3FMNA 2A19B 1H8FA 3DFAA 3FXXA 5EYMA 2OZAA 4PV0A 3D7ZA 5GZ8A 1YWRA 1KE6A 5EDPA 5F1ZA 4ASDA 4QOXA 5CU3A 1ZOHA 4EWHA 4I5CA 3FZPA 3F3UA 2SRCA 5DE2A 1DI9A 4FL3A 4KINA 5M4UA 1BX6A 3R7UA 3T8OA 4BYJA 2HW7A 4UYAA 4XV3A 4PY1A 4DEEA 2QNJA 2BRHA 4ZP5A 5ETIA 3P9JA 4F6SA 1XO2B 3E5AA 4I0RA 3C0GA 1FOTA 4PMMA 1PMUA 4ACMA 1REJA 2GNFA 4M0YA 3GC7A 3CPBA 4YO4A 1PW2A 1SNUA 3GU5A 3PY3A 2XZSA 4RJ4A 3WZKA 2OSCA 5FEEA 2IPXA 3C5IA 2EUFB 3O96A 4JT3A 4E4NA 2R3JA 4F6UA 1YRPA 4PRJA 4EHZA 2B1PA 4O0XA 4DTKA 3IW5A 5CAUA 4ZLOA 3AT2A 5ITAA 4D0WA 4AS0A 1CSNA 2XB7A 4X2GA 1A48A 3IDPA 3QTWA 4WUNA 2JEDA 2QQ7A 4U79A 4EBWA 3F7WA 3T3VA 3ZH8A 3CLYA 3NIEA 5AUXA 1LR4A 2VTOA 3OUKA 4G16A 5IPJA 2PU8A 5T68A 4C02A 2H9VA 5J5SA 3PVBA 5AUVA 3S00A 1CKIA 3OG7A 5D7VA 4XLVA 2C47A 4RJ7A 1IR3A 3G6HA 4NWMA 4RX7A 2XP2A 4KIKB 3R1YA 5EI8A 4W4VA 2HWOA 4YC3A 4IX5A 3EQGA 2PUNA 4X6QC 3UPXA 4CRSA 4D55A 4ACHA 3PIXA 2VO3A 4L00A 1PKGA 2XCHA 4O0YA 3OXTA 4OR5A 4MXCA 4E7WA 5I9UA 4O7NA 4F9YA 1O6KA 2G01A 4FZ6A 5E91A 3QF9A 4QO9A 2Y4IB 4BCNA 4DEGA 3DB8A 3FKOA 3I60A 3AMYA 1SNXA 4MD9E 3Q4TA 3OHTA 2J0IA 2F4JA 3G5DA 4I3ZA 1Q97A 5LMAA 4QMLA 4AGCA 3NVMB 4KABA 4I93A 4PPCA 1FMKA 2X8EA 2ZOQA 3JPVA 4MX9A 4QP3A 2NP8A 4TWOA 4FK3A 5AA9A 1M2RA 1JBPE 1UU7A 3RGFA 4BCQA 2XM9A 4BKJA 3QQGA 4FT9A 4DFLA 4G6NA 3DT1A 4L9IA 4OTFA 3PVUA 5CAVA 5FDXA 3A7GA 3LJ0A 4E6DA 3PDTA 3ACJA 2WQNA 4I94A 5L8KA 5CTPA 5JK3A 3N9XA 3ZZWA 4IM3A 2FO0A 4LM5A 5EH0A 2CGWA 2VNYA 2WMTA 4CCUA 3WYYA 3LXKA 3QWKA 5J87A 4BHZA 3EQBA 2OJGA 4D2SA 1PXLA 4DCEA 4YSMA 3BEGA 5K3YA 2FH9A 2VWIA 4I6HA 4ANLA 4M3QA 3DV3A 3FJQE 3GGFA 1OKZA 2OWBA 4DE4A 5CAQA 5A9UA 1J1CA 4ERKA 2H8HA 1A06A 2RG6A 4YHTA 3PYYA 3HMOA 1URCA 3LFSA 4Q9ZA 5KZIA 3ULZA 4TNDA 5HLNA 4QYEA 3K3IA 5K0KA 3HUCA 3WE4A 2W0JA 4X21A 4DG3E 2R3FA 3NVKI 4BCGA 2JIIA 4F08A 4FTRA 2R3HA 2XKEA 4NM0A 3LCOA 2WU7A 3W33A 3ZBFA 4A9TA 5AM7A 2YIQA 2ZB0A 4E4LA 3QTXA 3E7OA 3P78A 3OT3A 4QNYA 1ZMWA 2HENA 5A4TA 4EUTA 5FUTA 4F0IA 3DAEA 5DR2A 3A8WA 3AT3A 3R1SA 5CANA 2CCIA 1PXNA 4YURA 5CU0A 4C57A 1IA9A 3NR9A 2QOOA 3NRMA 4AW0A 4KNBA 5B2KA 3TZMA 4BDHA 4FTUA 1YKRA 2ITPA 4AZFA 5KKRC 5M07A 5CSPA 5IUIA 3LLAA 3LE6A 3KCKA 3CE3A 2XA4A 3P7AA 4N6YA 4BZOA 3D0EA 4WBOA 5AR4A 5FM2A 3FXZA 3Q52A 4N57A 3RAKA 3SDJA 3QUPA 3ORKA 4LUDA 3BHUA 4OBPA 4RIXB 4RT7A 4Q5HA 3Q4CA 3W55A 2XJ2A 3C9WA 4EK8A 3MY5A 4NK9A 2Y6OA 3RTPA 4RFZA 2GU8A 3PY1A 3EFWA 3EZVA 1X8BA 3QGYA 4WG5A 3RHXA 5E8SA 3KULB 1GIHA 3ZXTA 4UMUA 4XEYA 5C03A 3F66A 2IVVA 4RJ6A 5E8ZA 1PYEA 2WMQA 3CS9A 4JBVA 1I44A 4YJVA 3I6UA 4D9TA 4BBEA 2QG7A 2ITXA 4I6FA 1IA8A 1XH6A 3BRBA 3E3BX 3E7VA 3O8PA 5BUIA 2EB3A 3F69A 3DY7A 4YNEA 3DK6A 4FC0A 4JQ8A 4RVLA 5KCVA 3UMXA 3PSDA 4TY1A 4FL1A 4CKIA 4WSYA 3D7TB 3OUNB 4HVDA 5E4HA 1YXTA 4BBFA 3VWAA 1YDSE 3ORMA 3TV6A 4GK2A 4MWIA 4NM7A 2DQ7X 4RLKA 4A9SA 2VX0A 2YM6A 5A14A 1H1SA 4FKUA 4KS8A 3R9NA 2J0LA 1HCLA 2QKRA 2BCJA 5JH6A 2YN8A 4FL2A 2BHHA 3GC0A 5AP6A 3UJGA 3UZTA 3W2OA 4J96A 4NU1A 3R9RA 4DF3A 1FBNA 1SZMA 4JBQA 4U41A 2VTHA 4I5MA 2QU5A 3F3TA 2QOFA 2GNIA 3RCDA 4KBKA 4JRNA 3NNXA 3O23A 4ZJVA 2QI8A 3IECA 2F7XE 4AUAA 3BELA 4M15A 3VF9A 5M51A 3U8WA 3VW6A 1OI9A 4OTRA 5LVMA 2RGPA 3CTQA 4OLIA 4ZSJA 2BR1A 4GW8A 5CZHA 5IQEA 1H1RA 2ETKA 2BROA 3EKKA 4IC7A 1UKHA 3Q5ZA 4GU9A 4O96A 4MF1A 3OY1A 4BDCA 1IAJA 3Q9WA 4AOTA 4DHFA 2ZJWA 2REIA 3O7LD 1JKKA 4FVQA 4J95A 1APME 2QURA 3VS3A 3DQXA 5KHXA 3TDVA 1Q62A 4ZTSA 3LAUA 3UVQA 4AQCA 4EC8A 5HTBA 5LJJA 2XNOA 5J9LA 4YPDA 4CMTA 4ITJA 4CZUA 4EZ7A 3ORIA 2OBJA 1M2PA 4QMOA 1QPDA 4PTGA 3O7LB 3COMA 5IQIA 4AN2A 5K5NA 5L2QA 4ZSEA 4TYHB 4E3CA 1OUYA 5BUJA 3KRJA 4MXAA 2PL0A 4XJ0A 4EH9A 2PULA 4IWDA 4IVAA 3L9PA 4XV2A 2JKMA 3WF7A 1WAKA 3BQCA 1W83A 5BVEA 3UOHA 4X3FC 5EW8A 4JX7A 3BHVA 3W8QA 4M66A 4FZDB 3DXQA 3LMHA 3VW8A 2JAVA 1F0QA 4OTHA 3S95A 4B4LA 3GXLA 3FZTA 3F2RA 4ANQA 3LKMA 3V04A 3Q60A 3SRVA 3QQLA 3QX2A 4X2FA 5CI6A 4O38A 4IJPA 1PXOA 4IDVA 3UGCA 4DTBA 3V5WA 2BKKA 2YDIA 4RQKA 3LOKA 3VHEA 4LMNA 1OUKA 2OJ9A 4WNKA 3EIDA 3MTLA 4A7CA 4BKZA 5FBOA 4H36A 4QQJA 1PMNA 5DIAA 3TIZA 5JN2A 3FYJX 3ORTA 2GQGA 4XG4A 3O50A 3A61A 2YM4A 3RNIA 3EN7A 5AFVA 3PJ2A 4UY9A 1Q61A 2YCSA 3VBVA 3FAAA 3LCTA 2WMUA 3DA6A 2Y7JA 3PA4A 4PDOA 4I41A 3CEKA 3ZSGA 2ITTA 4AGDA 3V5TA 2VTSA 3DOGA 4NIFB 4R3RA 5JZNA 1G8SA 3UYTA 4P2KA 4W9XA 4BB4A 1H1PA 4EH5A 3AGLA 1QCFA 3OTUA 4U5JA 3EOCA 3DNEA 2B9IA 1UWJA 3GEQA 5ANKA 4HVIA 3TL8A 2X7FA 4HJOA 3UIUA 3AC2A 3NUYA 5IA0A 1FPUA 1H08A 2RFNA 2X8IA 3HGKA 4RG0A 4UALA 4BHNA 5CF6A 5FGKA 3IO7A 5AP4A 2E9PA 3AXWA 4UZDA 3H9RA 3HAMA 4QMQA 4BCIA 4FTKA 4J97A 2QOQA 4R1VA 5IQHA 5HG9A 5AR7A 2PUIA 3OWPA 2R3NA 3JY0A 3K5UA 4L43A 1H0VA 3NUPA 4IACA 4QP4A 1TKIA 1OITA 3IONA 4JVGA 4WBBB 1PKDA 3GENA 4YJRA 4DH8A 4O7YA 3D14A 3D15A 4Q5EA 3N4TA 2BDJA 2G2HA 2YIXA 3EWHA 1MQ4A 3EN5A 4EKKA 4FSRA 3ZEWA 4BFMA 4M8TA 4FV1A 3G51A 4D9UA 3HMMA 1JKLA 3ORXA 4IAYA 4O0SA 3RK7A 3KFAA 2JKKA 2PMOX 4RGJA 2JDRA 4L6QA 4YJTA 3ZRKA 2IO6A 1U59A 4UWYA 4K8AA 2VAGA 1V1KA 3ALOA 3CKXA 2CKPA 5DYJA 1FQ1B 1XH5A 5HO7A 4D2RA 3QRIA 4FSQA 2O0UA 3C1XA 2W5AA 4LG4A 4AFEA 4D5KA 3DU8A 2X9FA 4NJDA 3ENMA 3W2SA 4G3FA 3RAHA 3NCGA 2YAAA 2X4FA 3MYGA 3SHEA 4DITA 5IUGA 2YEXA 1Q8UA 5J9YA 1OPKA 2VTRA 5KMJA 2CGVA 1Y8YA 3DJ7A 1CM8A 4EUUA 2HCKA 3I1AA 2CNVA 3MY1A 2PE2A 4O82A 3S3IA 5KMLA 4YZMA 3I4BA 3E8CA 4Y46A 1AQ1A 4EHEA 2LGCA 3OW3A 4G34A 2WNTA 3MVMA 3NS9A 2UW7A 4U0IA 5LCKA 4RQVA 3DZQA 3D5UA 4AZSA 4YTCA 1YDTE 1VZOA 4JDJA 4DGLC 2W4OA 4IXPA 2Z7LA 2OJJA 4V0GB 3C4WA 3KMWA 5E90A 3PZEA 4RX9A 4ALVA 2C6KA 4E5AX 2PUPA 5ICPA 4ZMEA 5CEQA 2GHLA 3HV6A 3IQ7A 2XK6A 3ORPA 2UW4A 4YJPA 4R7BA 2CGUA 3JY9A 1MQBA 3LIJA 3Q5IA 3C7QA 2W17A 2RSVA 3PP0A 3ETAA 4X3JA 4APCA 3KREA 2VWVA 4ITIA 4QMWA 2UW9A 4IIRA 3KVXA 5LVPA 3ZZEA 4EH6A 3TTIA 4EZ3A 3TNPC 4ZK5A 4CCBA 2BZKB 2R7BA 4R8QA 5FP5A 4XRJA 4FKPA 4J52A 4U81A 4PF4A 1K2PA 2WU6A 4OT6A 5DOSA 1RE8A 5AV3A 4EKLA 4BI0A 5I0BA 3CSVA 2CLQA 3TACA 2WMSA 4R7HA 5D11A 5LVNA 3GQIA 3RPVA 3DLZA 4FKIA 4EEVA 5AV2A 4AFJA 1WBTA 3OWJA 4PX6A 4CFUA 3OWKA 2C68A 2R7IA 3PXZA 4IX4A 5AP7A 4EQCA 4CFXA 4QQTA 3UG1A 3UIMA 1FVRA 3UYSA 3VF8A 3KA0A 1M7NA 4CRLA 5KMIA 1SVGA 5CT0A 4NH1A 1VEBA 2H6DA 5H8EA 3OCGA 3COIA 4AT3A 4GFMA 2XNPA 2QLUA 5AP0A 4RC4A 5EYKA 4RMZA 2JBOA 4DFZE 3UOJA 4L46A 1ZYLA 4IM0A 3MA6A 3KF4A 3S4QA 1JVPP 2WQEA 4YTIA 4JQ7A 1L3RE 3TEIA 5AUZA 3CC6A 4D2TA 4RIYA 5AUYA 4L53A 3QCXA 5GJGA 5IQBA 4XG3A 4ZLZA 3N4UA 1KE5A 4U43A 3V8WA 5DI1A 3SQQA 2QVSE 2G15A 3ZDUA 4QMTA 2C3KA 5F9EA 5HD4A 1UV5A 5L8JA 5D41A 5JRQA 4CVAA 4GU6A 2P0CA 4QTDA 4FKQA 4DEDA 1J3HA 4XMOA 4FV5A 4BDGA 3BE9A 4WIHA 3HV7A 3VHKA 3N4VA 2Z02A 2DWBA 3QQHA 3TG1A 5M4FA 2J0KA 2I0HA 3TV4A 4WG4A 3KXZA 3RKBA 3C4ZA 3FZOA 4GJ2A 2XIZA 4QYFA 5HX6A 2FVDA 5J7HA 1VYZA 2NPQA 2WAJA 4C8BA 3K3JA 2J5EA 3Q9YA 1Z57A 3P7BA 4KA3A 5H8GA 3PA5A 3H0ZA 1J1BA 1SVHA 3SD0A 5FXRA 4GKIA 3ZLYA 2C0OA 4WG3A 3MPMA 4RC2A 4ASZA 2BPMA 1YOLA 1Q8WA 3OCSA 1ZY5A 3P5KA 2A27A 4RVTA 4L7SA 2ZYBA 4CXAA 4BRXA 2W1DA 2BZJA 2IN6A 3UOLA 3QD4A 3ODYX 3LJ2A 3QCYA 2WMWA 3BYVA 4XG2A 5E8VA 3VS5A 4FEUA 4BL1A 2X6DA 3FZRA 4N70A 4R1YA 2C3JA 2G2FA 3DFCB 5KMOA 5E8UA 5CU6A 1LP4A 3H3CA 1PMEA 4HYHA 4C4EA 3FQHA 3LCKA 5F95A 1UWHA 2PMNX 3CJGA 4UWCA 4YTFA 1JPAA 3ZMMA 4TWCA 5AV1A 2Z60A 5K5XA 1WBPA 1R78A 2F2CB 4U44A 3PFQA 1XR1A 4IZYA 5IA1A 1DAWA 2BZHB 2JC6A 5IKWA 3RM6A 4YLKA 4R77A 1DI8A 2GDOA 3RWQA 1KSWA 5AV0A 3SVVA 3T3UA 3MWUA 3QX4A 3ZU7A 3UE4A 5IA4A 2E9UA 1T45A 4AN9A 1NW1A 3G15A 5DMZA 4WRGA 3R02A 5JFXA 3EH9A 4ASXA 4IM2A 4YC6A 5KE0A 4GKHA 1P4FA 1Q41A 3F2NA 4DTAA 4XBUA 4XOZA 4W9WA 3R00A 2UZVA 5IQCA 2VWWA 3SOCA 3MY0A 4O6LA 3P79A 3ORNA 4X2NA 3BU5A 4AT4A 4IFGA 3VUTA 3G33A 3NYVA 4GCJA 3COKA 3L1SA 2E2BA 3KEXA 4MD7E 3E87A 1OL1A 4KIOA 2CKQA 5BMMA 4RA4A 4EJNA 3RNYA 2OW3A 4AOIA 1SVEA 2I0EA 3L8SA 4BI2A 2GNJA 1OIQA 3SW7A 1ZLTA 2KTYA 3I0OA 3LFQA 3ODZX 2W05A 3HRFA 4Y8DA 4YGAA 3CQUA 2XKCA 4IAIA 3GU7A 3TZ9A 3HNGA 3DDQA 3RAIA 3UQGA 4MVFA 3ZRLA 4F1MA 3F5GA 5IMXA 2J0JA 3FL5A 4HYSA 4EH2A 4ZAUA 5DT0A 4DFBA 2VTPA 5ETCA 4UMPA 3RMFA 3UO6A 4F65A 1KOBA 3EB0A 4Z16A 2XRWA 4XG7A 3CD3A 3OROA 4FSNA 1KE8A 3EFJA 3IOPA 5DFPA 4FOCA 2GFCA 2J2IB 1O6YA 2BALA 3ZHPC 3PPKA 2A2AA 2HXLA 4FKSA 2CPKE 4TZRA 5CU4A 5CEIA 3VC4A 3GNIB 2W5HA 3VQUA 1LPUA 1JSTA 5FP6A 4NKAA 1H00A 4FT3A 4RJ8A 2A0CX 4LUEA 2Q83A 1VJYA 4YO6A 4CV9A 4M68A 1WZYA 3GP0A 5HLPA 3VS1A 2W1ZA 2XMYA 5CXHA 3PXYA 2NRYA 4DN5A 4W4YA 5JEBA 1VYWA 4PMTA 4CLIA 4IJ9A 4TRLA 2XJ1A 5AA8A 1DAYA 1P4OA 2V62A 3MH2A 4RWJA 2J4ZA 3R83A 2PPQA 3ANQA 3LVPA 3K5VA 2VTQA 5GNKA 1BKXA 2CLXA 5A3XA 2VTTA 4FYNA 3UDBA 3PG3A 3S2PA 4EOSA 5DA3A 5TO8A 4FODA 1WBVA 5AP1A 2XEYA 4HVSA 5J79A 2VX3A 3OOMA 3FC1X 3RAWA 4RZVA 4HVHA 2OIBA 4FUYA 4P90A 5CWZA 4AZVA 5CSHA 3NIZA 4QQCA 4PP9A 2QR7A 1XH4A 4EOPA 5HU9A 4YC8A 2EXEA 4BBMA 3QQUA 2E9VA 3FPMA 4DT8A 5HIDA 2HZNA 4BTKA 5ANGA 2Y6MA 4FTOA 2CGXA 3FI2A 1H0WA 5HE3A 5C4LA 2C6TA 2YERA 3GCVA 3QQKA 3RM7A 2JGZA 3RCJA 4QP2A 1QPJA 3TDWA 2R3RA 3QHRA 5FRIA 3MDYA 3PIZA 3D94A 4IMYA 3VS7A 1OZ1A 1OGUA 3KN5A 4XX9A 2BDWA 3R1NA 4QMXA 4WOVA 2ZMDA 3MVHA 3F5UA 2WQBA 2I1MA 1A9UA 3LMGA 2JFLA 1Z5MA 3V6RA 5CQWA 4IZ5A 1BI7A 1U54B 3CQWA 3BI6A 3HUBA 4XV9A 4JG7A 3QL8A 3RZBA 4ZTQA 3Q96A 4MKCA 4X3FA 5EYCA 3SG9A 2HY81 5FTQA 4MQ1A 2XK3A 3QTRA 5EQPA 1W8CA 5CENA 1E9HA 2NRUA 2WELA 4A9UA 3FLSA 4FYOA 4ZZOA 3HZTA 3GFWA 3UOKA 1ZARA 4MD8E 4ACGA 2YM7A 5KZ0A 3R8LA 4AE6A 4KKEA 2P55A 4I92A 1OL6A 4PWNA 3C4XA 3PVWA 3FMJA 4GJ3A 5EHOA 3ZCLA 4I20A 3AC5A 4RZWA 2V7OA 2OJFE 4O0WA 2VNWA 3NNVA 3C51A 2VWBA 4USFA 1CDKA 4GK3A 4LQMA 4XP0A 4V01A 4R3PA 3CD8A 4KBAA 3EQDA 3VN9A 4BCHA 5AP2A 2BVAA 2QC6A 4AW2A 1CKJA 2J0MB 2O3PA 1IRKA 5CLPA 3OS3A 2V55A 3PLAE 1GZKA 2FGIA 3FMKA 2UW8A 3D5VA 4YBKA 4ZSAA 5CI7A 2WTKB 3VJOA 2QOKA 2V5QA 4QYYA 1XWSA 2VGOA 3POZA 2WIHA 3RHKA 1UNHA 2W96B 3GC9A 3R63A 2CNQA 5AUTA 3K54A 3SX9A 3ELJA 4FKTA 2BFYA 4QD6A 4CYJA 1XQZA 3UZPA 4AZWA 3BBWA 1E1XA 1WBSA 4TWPA 3RPYA 2OU7A 3V5LA 5CAPA 4G1WA 1QPEA 2FSTX 3T9IA 3PSCA 4M0ZA 1R3CA 4J99A 4PNKA 4DC2A 3TWJA 1ZMVA 4MNFA 5FEQA 3SV0A 5KMKA 3QCSA 2B7AA 3HV4A 3NW6A 2OZAB 4E5BA 4FEVA 3OXZA 4K18A 4MBIA 5L3AA 3JVRA 3EN4A 4U8ZA 5FXSA 3NEWA 3QD2B 2PE1A 2VV9A 5CSXA 1XBCA 2R2PA 4I24A 3BPRA 4BGQA 4ZZNA 4DAWA 1QMZA 4O81A 1GOLA 5HU3A 1XBBA 5IU2A 3AQVA 3KRXA 4AW5A 3I79A 3A2CA 4BCJA 5BVNA 2HZ0A 3F5XA 3BYOA 4G9CA 3IOKA 5EM5A 3F7ZA 3REPA 4S34A 4AZEA 2P4IA 1REKA 4F9CA 5L6OA 2UVYA 3GBZA 4GUBA 4M12A 4FKRA 4LFIA 5L2TA 3PRIA 1OMWA 4FSTA 4D4VA 4GIHA 4WUAA 2PTKA 2QOIA 1MP8A 2PVKA 1J91A 3EFLA 3B2WA 3R28A 3WZJA 4D5HA 4F63A 2R3LA 4IB0A 4M84A 5E1SA 3WF8A 3R73A 2C6LA 3BV2A 5FLFA 2IZSA 2YABA 5AX3A 4C0TA 2OXDA 2OF4A 4E93A 3AC4A 3MGYA 3QQFA 1JKSA 2PZ5A 4RX8A 4XS2A 3SOAA 4CKJA 2FUMA 4UXQA 4Y5QA 2PHKA 1Q3WA 4B8LA 4ZZMA 4DH5A 5HBJA 5ANIA 1CTPE 5KNJA 5FM3A 2QO7A 2XYNA 4A4XA 5IF1A 4HCTA 3FMDA 3ZUVA 4HVGA 1UU3A 2PVRA 1KV2A 5HLWA 3LFCA 2XKDA 3C5UA 4F0FA 4EL9A 4K9YA 4A9RA 2YZLA 4BY9E 3VBTA 3WF5A 4H3BA 3RZFA 5FD2A 1QL6A 2W9FB 1BL6A 4DYMA 4C3FA 3AG9A 4HYUA 4JG6A 3QTZA 4U42A 5CU2A 1W7HA 4DFUA 3DZOA 4G3CA 4HNFA 5IMEA 4XRLA 2OIQA 3KCFA 4BWPA 4EQMA 4O7VA 3KRRA 4YHFA 2OJIA 1J7LA 5FQDC 5HTIA 2XNGA 3OF0A 3ZDIA 4EOIA 4MXOA 4NSTA 3IW4A 4PTCA 5EFQA 3VO3A 4HYIA 3ZXZA 2RL5A 5CY3A 2R4BA 4K77A 3QYZA 4G5PA 3D2KA 4FG9A 5FG8A 2EXCX 1BLXA 4F1TA 4O83A 1JWHA 1XKKA 2ESMA 3HX4A 4C7TA 3MJ1A 2VGPA 2JDOA 1YI3A 5C4KA 5CEMA 3QCQA 4ZMFA 2JKQA 5HEZA 4OTIA 4CT1A 1BUHA 3LZBA 2OXYA 5EOLA 4GVJA 4II5A 3R7EA 4C37A 3MH0A 3DAKA 5CASA 5BVWA 5E9EA 4LGDA 5AR8A 4XHKB 1OPJA 4AA4A 4F7SA 3FWQA 1Q8ZA 4OGRA 2OH4A 3PA3A 5M4CA 4RFMA 4A07A 4EYMA 4OT5A 3BZ3A 4HGSA 1OKYA 1TVOA 4KD1A 1JKTA 1Q8YA 4NZWB 4UMQA 2PK9A 5A4CA 4IAKA 1SYKA 2XRUA 4QPAA 4LV8A 5EHLA 2CKOA 3GVUA 4FNZA 4I0TA 5IQGA 3G2FA 5GJFA 3ZRMA 5M06A 4KSQA 3MPTA 3NYNA 3SG8A 3MFSA 4EHGA 3ZFYA 4C4JA 3S0OA 3RPOA 3R0TA 3NCZA 4TN6A 2I7QA 2CDZA 3JYAA 4M14A 3R22A 4XBRA 4CSVA 2GSFA 3R30A 2F7ZE 4KAOA 4M7IA 3VBWA 4FKVA 5BQ0A 5IZFA 1IAHA 1Y6BA 5HVJA 4IC8A 4O1PA 3FI3A 3R8VA 5C26A 4YR8A 3L9LA 3QXOA 4GYGA 4U9AA 1GZNA 2V0DA 5C27A 2ZMCA 2W1HA 4FKLA 2PVYA 2YISA 2R0UA 3MI9A 5AADA 4ZJIA 3QLGA 5M4IA 2BRGA 2X7OA 4FIFA 2YCQA 3WZDA 1IG1A 3LQ8A 2R3MA 3SXFA 3TUBA 2Y4IC 4IFCA 4JDKA 2PZIA 2RG5A 1ZZLA 4IEBA 3HL7A 4ZY4A 3HP5A 2WEIA 3IW8A 2BIYA 4NM3A 4B0GA 2GS2A 4ITHA 3MPAA 4O7ZA 2BTRA 2BDFA 2C69A 2CHLA 3SC1A 4E20A 2YJRA 4MXZA 1JOWB 3W18A 5JGBA 1IEPA 3EQRA 1T46A 4PMPA 1ZYJA 2J5FA 3UBDA 2BIKB 4G9RA 5TR6A 2YACA 3HA6A 4O0UA 1G5SA 5FBNC 4LMUA 2ZV2A 2OO8X 3BBTB 3GCPA 3PRFA 5KBRA 3IK3A 5AAFA 4S33A 4BWKA 4FT0A 4NW5A 5EHYA 5KMNA 1R0EA 3FZ1A 2ITQA 3DKCA 5HD7A 5HG8A 2VTJA 3RJCA 3TN8A 3TNQB 3JVSA 4RIWA 3ZFMA 3FLYA 2WMRA 3KC3A 5DWRA 3QRJA 4BGHA 2OGVA 4DGOA 3ROCA 4EK5A 5FEDA 1XBAA 4U3YA 1BL7A 5AAGA 3RALA 2G9XA 3QA0A 1SMHA 4I4FA 2OF2A 3BE2A 3FYKX 3QGWA 3W8LA 3NLBA 3WOWA 4YUQA 5JT2A 1KE7A 4PPAA 5LWMA 3DBEA 1GZ8A 3D2IA 1XH8A 4I22A 4K33A 3L8VA 3NWWA 4W4WA 4BDFA 2B9JA 3SKCA 2Y4PA 2ZV8A 3R1QA 1V0OA 1YXXA 1AD5A 3FMEA 1XH7A 3ANRA 3GOKA 2RFDA 3O51A 5DN3A 3TJCA 1PMVA 1TQIA 3F9NA 5HNBA 1Y57A 2VTIA 3VAPA 2F2UA 3QUDA 4V0GA 3MW1A 1UU9A 4EK4A 4GK4A 4R7IA 4G2FA 2WPAA 5EKOA 4CYIA 4R6VA 4IE9A 3THBA 4Z7GA 4O22A 3W16A 4F64A 2X4ZA 5M55A 2ZM3A 2XIKA 4ZTNA 4BCKA 1WVWA 4GFOA 3TKUA 1OECA 4QMVA 3CGOA 3RPSA 1FVTA 2WTVA 4J98A 4YTHA 4CZTA 3Q6UA 3HV3A 4ZS4A 3CR0A 3H4JA 4MXYA 3A4PA 1K3AA 4FSUA 1TQMA 5ACKA 4MNEB 3PE2A 2CCHA 3UP2A 2IW6A 4IDTA 2UZEA 1P2AA 2C30A 3R7GA 3ORZA 4P5ZA 1OKWA 3UTOA 4JDIA 1YOMA 1PXPA 5HQ0A 1FMOE 5L6PA 5M08A 3HVCA 3M1SA 4O21A 1WBNA 2XM8A 3LM5A 4F09A 1F5QA 5CF4A 4QPMA 4PUZA 2VTLA 3NNUA 3MB6A 4IAFA 3I5ZA 3MS9A 2UZWE 4AG8A 1KOAA 4JOAA 4B7TA 2X0GA 5HNIX 5HIEA 4NUSA 4DCAA 2CN8A 3R7IA 4U80A 5KHWA 4F7NA 3VBXA 4LYNA 3ULIA 3VUHA 4Z3VA 4C35A 3D4QA 4Q9SA 5HE2A 4ZTMA 3MFTA 3DB6A 4L42A 4RFYA 4C3PA 1OB3A 3TNHA 3P0MA 4YJQA 4XV1A 4O91A 4NFMA 3GB2A 2QO2A 2VUWA 4FMQA 3GQLA 1FGKA 1WVXA 2PVHA 4APPA 2WTJA 2GHMA 5C1QB 3SRVB 2XBAA 3WIKA 4OAVB 4K2RA 4BZDA 2C6DA 3IGOA 3OZ6A 2R3PA 4A4LA 4C36A 4CLJA 3Q32A 3UNKA 2PMLX 5GIPE 4PL3A 2BILB 1LEWA 4QMUA 3O8UA 3Q2JA 5I9XA 3W2PA 3R71A 4CTCA 4Y85A 3DBQA 1MRVA 3RVGA 3VRYA 1H24A 1RQQA 2VX1A 5JSMA 4IB5A 5CVFA 3TJDA 5C8KA 5CYIA 2R3GA 4C38A 4S2ZA 1LUFA 3UO5A 1RJBA 2JIVA 3DNDA 3Q9XA 5IQFA 3F2AA 4MBJA 5DHJA 3F3ZA 4RVMA 4TTHB 2ITYA 2DYLA 1Z9XA 4BYIA 3VRZA 4GFGA 4BDKA 3KRWA 3EYGA 3KVWA 5BPYA 1YXUA 5JFVA 1GIIA 4QYHA 5J1VA 4C34A 3QA8A 5IA5A 4FZAB 5G1XA 4ALWA 1ZZ2A 4EZ5A 2B0QA 5HG7A 2HXQA 3EL7A 1NVRA 3FC2A 4KBCA 4CMOA 2R3IA 5HICA 3EQCA 3VS4A 4J8MA 3QRUA 3NMUF 2VWXA 5KX8A 4YPSA 4BTJA 3Q4UA 2XK7A 4BDEA 4YU2A 5FWKK 4MQ2A 2ITZA 5HZNA 5DPVA 4QPSA 3CY2A 4FX3A 2DS1A 5J5TA 2QG5A 2JLDA 1YWVA 4W8DA 5BYLA 4ALUA 2O63A 4DH7A 1H27A 1YI4A 3V5JA 2IVSA 1YWNA 3SXSA 4G31A 4IVBA 4FIIA 3O71A 4OTDA 5IEVA 3F82A 3P86A 2B9FA 2I0YA 1Y6AA 4FOBA 4FV8A 4GT4A 4HGLA 4QMYA 3Q9ZA 1NA7A 5I3OA 5JRSA 3SXRA 4ERWA 5IDPA 2C4GA 3B2TA 5D10A 3IDCA 4UMTA 3WE8A 5A46A 4Y83A 3ZO4A 4BCMA 4EOOA 4DG2E 2JIUA 3TZ7A 4L44A 3QUEA 4JL9A 1M17A 2YLFA 3HYHA 2PVNA 5AMNA 2NO3A 2XH5A 2YFXA 4QTEA 3QTSA 2R9SA 2WTWA 5HBHA 5JGDA 2XIRA 4DEIA 1W82A 4IX6A 4RX5A 3I81A 5CALA 3PJCA 3DQWA 4YHJA 2ETRA 1ZOEA 5IDNA 4H1MA 3MB7A 3UP7A 2YM5A 5BVDA 2IW9A 2Q0NA 3MV5A 4TYEA 1YXSA 3SAYA 4AOJA 4N4SA 5K4JA 5DR9A 5KBQA 4QMZA 4NT4A 5L2SA 5EW3A 3IGGA 1M14A 4JLCA 1OIRA 1FGIA 2PE0A 2ITVA 2ZVAA 3MH3A 4IHPA 5CVHA 3VNTA 3L9NA 4JX3A 4O0TA 5AJQA 3DCVA 2JFMA 2P3GX 3KQ7A 4Y5HA 4ENXA 2XK9A 3HAVA 5LMBA 3BHTA 4EK3A 5GJDA 3HP2A 5L6WL 2C6IA 3AD6A 4EH3A 3R2BA 1Y8GA 2ONLC 2G1TA 5CF5A 1PXJA 3CJFA 2O5KA 4ZTHA 2QHNA 3CCNA 4I21A 4FSZA 3EJ1A 2AYPA 4ZOGA 2OZOA 4QTAA 4EWQA 1Q99A 3MVJA 1ZXEA 1YOJA 2ETMA 3UQFA 4FG8A 4XH6A 4KB8A 3BYMA 4YZBA 5KMMA 4NTSA 2VWUA 3AC3A 2WQOA 2AC5A 3CTJA 2ZM4A 4AA5A 3ZC6A 3A7IA 3QALE 3OEZA 4BTFA 3TNWA 5J8IA 2XUUA 5AUWA 2WMVA 4FI1A 5AIKA 3TIYA 3KMUA 3P23A 3VBYA 3FLQA 4USDA 4WRSA 3U54A 3UG2A 3AGMA 4N0SA 4NEUA 3IG7A 4OBQA 1OM1A 4YJUA 3R9OA 4UBAA 1OBDA 1ZY4A 4Y95A 3OP5A 3FLZA 5HE1A 3LQ5A 5CSVA 2JDVA 2GS6A 3EQFA 3QTIA 2AUHA 3AMAA 2IW8A 2XIYA 2OFUA 5M09A 4WNPA 5IA3A 2WD1A 2YCFA 4EONA 3A7HA 1KE9A 2BUJA 3Q4ZA 4C2VA 4IW0A 3LMIA 5TE0A 2WKMA 3GU6A 3VUGA 4C4GA 1YQJA 4J71A 5AUUA 2UZBA 4C2WA 2YCRA 3Q3BA 4NJ3A 4RBLA 2EVAA 1NT2A 1ZYCA 3FBVA 4LI5A 4EQUA 5AWMA 4U97A 3CP9A 4FUXA 5TOZA 3UIBA 3FLNC 2J9MA 3W2QA 4O7TA 4O2PA 1CKPA 1ZWSA 2YJSA 2QOCA 5EM8A 2OK1A 2W1CA 2WOUA 3F61A 3KMMA 2WZJA 4WA9A 5I9VA 4U3ZA 3WI6A 4GMYA 1K9AA 2E9NA 3MH1A 3LJ1A 3QKLA 1YHWA 3LW0A 4M69A 3KXXA 4A4OA 2WTDA 4RIYB 3VS0A 4WD5A 3DBDA 5HHWA 3TUCA 3LHJA 4FF8A 4KRCA 1KWPA 4BI1A 5LXMA 2V7AA 4RWLA 5T3QA 2BRBA 1W0XC 1Q3DA 3DTWA 3PSBA 4LV5A 3JXWA 4PL5A 4C33A 4DEAA 3B8RA 3DLSA 4HZSA 4USEA 2ZV9A 4CNHA 3U4UA 3CXWA 5LMKC 4S30A 4BCOA 2C3IB 1ZYSA 4H3QA 4Y73A 4HCUA 2CJMA 3KU2A 3BGPA 3HEGA 5CQUA 3FZSA 2IZRA 3L9MA 4D28A 4ID7A 3MIAA 4FGBA 3B8QA 3Q04A 1B39A 2B54A 2XK4A 2B4SB 3U6HA 2DUVA 2XNEA 5M57A 1NY3A 1YVJA 1JQHA 5AX9A 4RVKA 5I9ZA 4Q2AA 5ANOA 4RWKA 2WB8A 4FKJA 4GV1A 3NSZA 3OC1A 4GEOA 4JBPA 4TYJA 4UWBA 4ZIMA 4DLJA 2Z7QA 2YHVA 5IH5A 2C0IA 5IG1A 2UZOA 2W1GA 5TT7A 3U4WA 4CQGA 5DEYA 3R9HA 2E9OA 2Q0BA 4BTMA 4E26A 2CN5A 5ANDA 1PJKA 2J7TA 2AC3A 4TPTA 2I0VA 3BKBA 2UV2A 5HI2A 2JD5A 3C0HA 2QOBA 2GMXA 4BIDA 4E73A 1JAMA 3D83A 2W99B 5GINE 3ERKA 4AGUA 4QMSA 5I9YA 1GZOA 5HCZA 3VJNA 3ZLSA 5B2MA 3H9OA 3BGQA 4MYGA 4CQEA 5L2WA 3TUDA 4IAAA 4AT5A 2YZAA 5DEWA 3C0IA 5K9IA 3MVLA 2JITA 2VWYA 3NUAA 4F6WA 5JQ8A 1NVSA 5CNOA 2ZM1A 5EI6A 3UC4A 4KIKA 4ZY5A 2RKUA 2UW5A 2BAKA 3GCQA 4MWHA 1VR2A 4OW8A 2GCDA 2CNUA 3ZTXA 3FV8A 4GG7A 4KSPA 4MCVA 5KO1A 1UKIA 5HO6A 5JFSA 2C5XA 2YM8A 3HLLA 3NX8A 3RI1A 3UODA 5L8LA 2GTNA 4BF2A 3E3PA 3AC8A 3KXNA 4MF0A 4EOMA 4ZS0A 3KN6A 3PUPA 4ZXTA 3OW4A 3R01A 1L8TA 4F7LA 1WBOA 5EM6A 1MRUA 5FDPA 5LQFA 1ND4A 3AC1A 2QODA 3HA8A 3SA0A 1W84A 1ZOGA 4QQ5A 3MTFA 5L2IA 1Q24A 1ZRZA 3FHIA 2P2HA 3C4CA 4FEQA 5ETAA 4FNYA 2W06A 3ZSHA 3OOGA 2BKZA 2C0TA 3CBLA 3LFAA 5CEOA 1H4LA 2R3OA 3R04A 3FDNA 3TT0A 5CSWA 1Q4LA 4WSQA 1KUTA 2VO0A 4AZTA 3CGFA 5JFWA 1J7IA 3E64A 5HKMA 3TNIA 3E92A 4X2KA 4G17A 5AR5A 2UZTA 4TYGA 3U9NA 4C62A 5M53A 3C13A 2UZNA 4WO5A 2F49A 4FV4A 2HAKA 4JIKA 3QKMA 4V05A 3BEAA 4L3LA 1H07A 3Q6WA 1PYXA 3ZO3A 2I40A 4DGMA 4EI4A 5I5ZA 5AM6A 4OAUC 4R5YA 5CAOA 4I4EA 5A6OA 2XNNA 3NW5A 3POOA 4RJ3A 3ID6C 1H28A 2WMAA 4RA5A 2GHGA 1CMKE 1UVRA 3BX5A 4ANMA 3DKOA 3F3VA 3R8ZA 4FIJA 3P4KA 5K0XA 3NZ0A 4AN3A 1PXKA 1M7QA 2QOLA 3QAME 4GRBA 3HRCA 3QYWA 1FVVA 3EHAA 5D1JA 2F7EE 3WF9A 4BWXA 4FVRA 3GOPA 1XH9A 4DFNA 5A4EA 4BCFA 5IEYA 1OL2A 5HNGA 5BUEA 5IA2A 3BHYA 4MXXA 4HNIA 4FNWA 2BHEA 4AE9A 5EDRA 4CFNA 2FB8A 3QTQA 4ANNA 4CFWA 1OIYA 5D9HA 4E4XA 3NUNA 4E4MA 2BMCA 3H0YA 4FEWA 1U5QA 2ERZE 2C3LA 2VTMA 2Y0AA 3L8PA 3VBQA 4TL0A 3KL8A 4D1XA 4J7BA 1TQPA 4IZAA 4JXFA 2VTNA 1P14A 5B7VA 4QMNA 5G6VA 1AGWA 4H05A 3ZBXA 5CEPA 2UZDA 4YP8A 5JKGA 3GCSA 4GL9A 4WNOA 4NM5A 4XP2A 2NNWB 4F9BA 4IVDA 2UW3A 2PWLA 4GH2A 2ERKA 1GAGA 3VQHA 1G3NA 4XLIA 5DLSA 4DINA 1Y91A 3BYUA 4QT1A 2BZIB 2WTIA 4E1ZA 4F9AA 3KKVA 3A8XA 4PDSA 5IISA 1BMKA 4XG8A 3V8SA 4KKGA 2PUUA 1I09A 4O1OA 3OFMA 2ZAZA 4YSJA 1U46A 4BDJA 4RIXA 4E6AA 1B38A 2PZRA 3UIXA 4X0MA 4JI9A 2GNLA 3ENHA 1B6CB 1DM2A 3NPCA 4L7FA 3ROYA 3DJ6A 3KULA 4D4SA 2EU9A 3TV7A 2UZLA 3FI8A 4IANA 3TM0A 3Q2MA 5E8YA 3H10A 3G9NA 3KGAA 4C4FA 1WFCA 5E7RA 3OT8A 1NXKA 3GU4A 2X2KA 2YITA 4NW6A 4EH7A 1UA2A 3EZRA 5JMSA 1WCCA 4YLJA 4E8AA 4QMMA 2BTSA 2GS7A 2FSLX 4PTEA 4RPVA 1WVYA 3PLSA 4BIEA 4GT5A 4CG8A 4X3FB 3D7TA 3H30A 3FI4A 3NDMA 3HDMA 5A6NA 2QD9A 1ZAOA 4UYNA 3R7VA 3ZUTA 1QPCA 4YNOA 5C01A 4OTGA 1BYGA 3I0QA 1JSUA 3LCSA 4FSYA 4FV2A 3FXWA 3UNJA 3BQRA 3CTHA 4NYEA 3O2MA 3LLTA 5AAEA 2OG8A 3TXOA 3BCEA 3DTCA 3BHHA 4O6EA 4D1SA 3DXNA 2O2UA 4D0XA 4RC3A 5HO8A 4AWIA 3WARA 4EOLA 3A99A 4BIBA 2O8YA 4O7LA 4WNMA 1YDRE 3FSKA 2J6MA 4I5PA 2QLQA 4FTMA 3FPQA 3VUIA 4CFMA 4EOQA 2GFSA 4PMSA 4UV0A 4DGGA 2X8DA 4F99A 5LARA 2WTCA 3PG1A 4WT6A 2C5YA 1PHKA 4QTCA 5EYDA 4I23A 3KXMA 3RINA 2HIWA 4BICA 5LWNA 5I4NA 2YIYA 4DLIA 4HCVA 3QRTA 4FZ7A 3C50A 2WO6A 5ANJA 3V51A 4DEHA 4RIOA 5BMSA 4M67A 2ACXA 4YZDA 2EXMA 2QR8A 3PPZA 5BX0A 4L68A 3DPKA 4L67A 3QRKA 4HGEA 4JRVA 3FY2A 4ENYA 3OEFX 2OI4X 3ZC5A 1YXVA 4NCTC 4E6CA 3R2YA 2PSQA 4AX8A 3EN9A 5HESA 5IH4A 1U4DA 3GU8A 4AF3A 2GNGA 2OKRA 3BYSA 5FTGA 5E8XA 4TYHA 4XYFA 1UU8A 2XS0A 4ZSGA 3TZ8A 5AEPA 3PXKA 3FSFA 3ZYAA 4ZY6A 3AOXA 3H9FA 3S1HA 2XKFA 4CFFA 3O17A 4DH3A 2A1AB 4DH1A 2HY0A 4KRDA 3QZFA 3G0FA 2OICA 4JQEA 4IWOA 3W1FA 5AP5A 4R78A 3PTGA 2X6EA 3DK3A 2PYWA 4EBVA 2PY3A 4JBOA 5EI2A 4L3PA 4ANSA 4F0GA 3FQSA 4CV8A 1WMKA 3HKOA 3LFDA 4A06A 4ORKA 5EKNA 4GIIA 5HBEA 3DKFA 4YMJA 4NKSA 3I7CA 4GYIA 3ZONA 3VS6A 4O7SA 1WBWA 2BAQA 2WHBA 4JR7A 3V6SA 5K4IA 1F3MC 4BVUA 4NFNA 3AMBA 4FSMA 3UMWA 3PY0A 4FV6A 2GPHA 3GCUA 3R6XA 4YZ9A 2QKWB 3WF6A 4AA0A 2IZUA 4BN1A 3FQEA 3PP1A 4JG8A 5A4LA 3WZUA 5GZAA 3DGKA 4BDAA 4DBXA 3OBGA 2R3KA 5LOHA 3MESA 5T6KA 4P4CA 3ATTA 2VN9A 3DBFA 3R8PA 5AIRA 2GQSA 4NIFA 3E88A 4B8MA 3QZGA 4QYGA 3G6GA 3PXRA 3EN6A 4BR3A 4BZNA 3DJ5A 3LXLA 4GVAA 4EYJA 2HOGA 1RW8A 5CT7A 4EK6A 3VULA 4D2WA 1G8AA 2ONLA 2WTKC 3O0GA 2ZB1A 3QZHA 3QTUA 5E92A 1R1WA 4AW1A 3PZHA 3LCDA 4QP7A 1URWA 1PXMA 4BCPA 3EKNA 4DBNA 2RFSA 2YDJA 2Z7SA 5A54A 5B0XA 3M42A 2EWAA 2ZDTA 4B99A 4XOYA 2F57A 5AP3A 5H9BA 3QFVA 3R8MA 4O86A 3LFEA 3RK9A 4XP3A 3MN3A 3LFFA 4MNEA 2UVZA 3D5XA 4LOPA 4LL0A 1ATPE 2Y8OA 4LRMA 3SLSA 3TTJA 4KS7A 4QNAA 5KUPA 2X1NA 3D5WA 3P08A 3F88A 4FIEA 3ZEPA 3HMIA 5ETFA 3EL8A 3U55A 5HVYA 4G5JA 3BWJA 2BAJA 4G3GA 2XF0A 4FSWA 4EH8A 1P5EA 3FUPA 2W7XA 3I5NA 4RJ5A 5BVKA 3A7FA 5CNNA 2CKEA 3BIZA 2VTAA 5M44A 4TT7A 4I6BA 3CY3A 2WEVA 3HDNA 1OL7A 3G90X 4O2ZA 4JAIA 2X2MA 3NUSA 2OFVA 2BRNA 3FMHA 3MJ2A 4I5HA 3E8DA 3FE3A 1OIUA 3GUBA 4GSBA 1UNLA 4GS6A 4U40A 3W2RA 4BDBA 4Z7HA 4FTLA 4XNEA 4FZFB 4HPTE 3WILA 5AR3A 2VD5A 1FINA 5EM7A 3LFNA 2OLCA 5DBXA 1R39A 3FKLA 3KXHA 4NL0A 2F9GA 3F5PA 4MK0A 4ZLYA 3OBJA 4H1JA 3UQCA 2ITOA 3GT8A 5GHVA 4C58A 4AU8A 5BYYA 3QKKA 3V5QA 2VZ6A 4PNIA 4CEGA 1OKVA 4D2VA 4UX9A 4TWNA 3RBWA 4P5QA 3FLWA 3PXQA 4JR3A 3R9DA 4DA5A 2OXXA 4G6OA 1GNGA 3DBCA 4YZNA 1RDQE 5HVKA 4H39A 4YJOA 3QQJA 3TI1A 1GIJA 4FV7A 3ITZA 3ZS5A 2UVXA 4TW9A 3HMNA 3NAXA 3PWYA 2JAMA 5GIOE 5HX8A 5LMKA 2HZ4A 4FTNA 1JLUE 4Y72A 2J50A 3NGAA 4ZEGA 3ET7A 4IB3A 3ZO2A 2ITNA 3OVVA 3Q53A 1ZMUA 3MSSA 5DRDA 3PPJA 2PVJA 3QD0A 1PRYA 4XG9A 3II5A 3PXFA 3R7YA 2R0IA 5I3RA 3CIKA 3UC3A 1PY5A 1M52A 1HCKA 4BDDA 3EQPA 5JZJA 2JKOA 4F1OA 5A4QA 3IS5A 4TXCA 3WIGA 3FEGA 4OUCA 2B55A 4RWIA 3FY0A 3I6WA 4UN0C 3GC8A 3QU0A 3A62A 1ZYDA 1JNKA 2C6OA 5CEKA 4G3DA 4TKSA 4JDHA 3VVHA 4WKQA 2B53A 1XJDA 2WOTA 2XYUA 4OTPA 2IJMA 2QO9A 2PVMA 2ZV7A 4S32A 5F20A 4D58A 2BFXA 3CQEA 3RWPA 1O6LA 4EH4A 3C4EA 4FTIA 4HPUE 1Q8TA 2XEZA 4W8EA 3GI3A 4BDIA 4IBMA 5HCYA 4DFYA 1V0BA 3IW7A 3LM0A 4QP1A 5J7BA 4IWQA 2OIDA 1H01A 4RIWB 3W32A 4CFVA 2G2IA 5IUHA 4DT9A 5J9ZA 2RFEA 4LL5A 3BLQA 5CX9A 2YM3A 3G0EA 4MEDA 2IZTA 5DGZA 3WYXA 4YZCA 2R5TA 2IG7A 3ATSA 3L8XA 1YI6A 4E6QA 3RP9A 4FTCA 3KB7A 4H58A 4X7QA 3KK9A 4UZHA 2V22A 2C5NA 3HMPA 4RSSA 3E63A 1BI8A 2W1EA 2XIXA 2IVUA 3EYHA 4A9YA 2QCSA 4FA2A 5JGAA 2QONA 5EK7A 5C8NA 3PJ1A 4ANOA 4FT7A 2YIWA 3BWFA 3ZM4A 4IADA 1DS5A 3LXNA 4O7RA 3NUUA 3UPZA 4EJ7A 2HW6A 4MAOA 3HV5A 5L4QA 4DEBA 1ERKA 2YA9A 3EMGA 3PWDA 3AD4A 4LGHA 3BU3A 3OWLA 4OBOA 5DRBA 4FGRA 3VS2A 5DR6A 2JDTA 1MRYA 2RIOA 4CGAA 3NYXA 5IQAA 1OBGA 5DNRA 3E62A 4D1ZA 2XVDA 2IVTA 4AAAA 4JIAA 2GTMA 4D4YA 2XNBA 2QHMA 4CT2A 3ORLA 4QRCA 4FIGA 1NVQA 2X2LA 3DS6A 5ANEA 3T9TA 5EW9A 4BGGA 3ACKA 3UO4A 3OCBA 2C1AA 5CS6A 3R7OA 4FTQA 3C4FA 2UW0A 4WHZA 3SW4A 2P2IA 2W4JA 5FXQA 4FKGA 4I0SA 3VUDA 3DK7A 3PIYA 5EQEA 3OD6X 3M11A 4FIHA 1J7UA 3ALNA 2YAKA 4I1ZA 5F94A 4K11A 5I9WA 4YJSA 4K1BA 4GUEA 1GY3A 3U51A 2QOHA 5LVOA 5DT3A 3MBLA 5BVOA 4CG9A 5EOBA 2WQMA 3QXPA 5HIBA 4EC9A 2WIPA 2PVFA 3AD5A 4MHAA 1OVEA 2VO7A 4OTQA 1IASA 4U45A 3SGCA 4ASEA 2HWPA 3FMMA 4X6RA 3WZEA 3O8TA 4X2JA 3BU6A 1MUOA 2XK8A 4ONAA 4F70A 3PE1A 3I7BA 3NYOA 1S9JA 5HG5A 5DG5A 5C8MA 3KXGA 3WBLA 4HW7A 5D7AA 5F4NA 5EDQA 3A7JA 3NNWA 3UNZA 3EFKA 2FA2A 4QTBA 4DGNA 3ZM9A 2R64A 4IVCA 1M2QA 5B2LA 3DKGA 4L01A 2CMWA 2YDKA 4F7JA 4ZTRA 4QP6A 5E1EA 3ZLWA 4N6ZA 1H1QA 4EOKA 3GFEA 1H26A 4TYIA 2XJ0A 4R3CA 1H1WA 4DFXE 4L52A 3IW6A 1PXIA 1XHAA 5C9CA 3ZUUA 3U6IA 4Z9LA 2VO6A 5BVFA 5IH6A 5CVGA 4XCUA 4PQNA 4XUFA 2W1FA 3QWJA 4QP8A 3JUHA 4NTTA 4QMPA 4AACA 3ZSIA 3NUXA 5J95A 2W1IA 4LGGA 1STCE 3FKNA 3OXIA 3OY3A 4EHVA 2VRXA 2C6EA 5CZIA 2W5BA 4ZSLA 2O64A 3EQHA 2WMBA 4FR4A 2H96A 2CSNA 3E8NA 2FSMX 4KWPA 3MFRA 2J51A 4EOJA 4FV9A 2X9EA 2UZUE 4AP7A 4D4RA 2X7GA 5D12A 2QU6A 2OH0E 3OMVA 3KY2A 3LQ3A 3UZRA 4JS8A 5LVLA 3F3WA 5JQ5A 4P7EA 3F6XA 3OTVA 3QZIA
chains in the Genus database with same CATH superfamily
4J8NA 3A4OX 2C1BA 4CD0A 4UXLA 3U9CA 4FKWA 4O0VA 3N51A 4C4HA 4F4PA 3KF7A 1PF8A 1E1VA 3V5PA 4PP7A 2IWIA 4PPBA 3LXPA 3V3VA 4PDYA 2XCKA 2X81A 4K0YA 4E5WA 3V01A 3DXPA 4LOOA 2Z2WA 3MFUA 4KIPA 2P33A 3EQIA 3VONA 1SM2A 5H3QA 3NW7A 4JNWA 2C5VA 4IWPA 3NFGB 2UUEA 3P7CA 3P1AA 4GG5A 2PVLA 2PZPA 4IH8A 4JJRA 4LRKA 2HELA 2VU3A 3FHRA 4K6ZA 3JS2A 3JR1A 1OL5A 2Z8CA 4HGTA 2J90A 3G9LX 4LRJA 4OTWA 2C5OA 4O0RA 3CKWA 5HE0A 5BYZA 2R3QA 5LCJA 3MA3A 3HRBA 3VUMA 1GJOA 4EORA 4FBXA 3RK5A 4UEUA 4O27B 4F9WA 4HZRA 3DAJA 4J1RA 4M97A 3QLFA 4G3EA 4C59A 3U6JA 4FNXA 4CMUA 4S31A 2YWVA 1JSVA 2YIRA 4QP9A 2WGJA 3W0RA 2XBJA 3QHWA 1Q5KA 1YW2A 3BV3A 3R21A 4MBLA 3CPCA 2Y9QA 3ZLXA 4YBJA 4C61A 3QD3A 5AV4A 4B6LA 2A4LA 2WMXA 2EB2A 2ITUA 3BLRA 4HOKA 3W2CA 4KUJA 4MTAA 2W9ZB 2WXVA 4UB7A 3RPRA 4D2PA 5DVRA 2XNMA 4FE2A 4FT5A 3LFBA 1EH4A 4M13A 3PVGA 3UVRA 5CXZA 4RRVA 5E8WA 4Z55A 2ITWA 2HZIA 4R5SA 3E93A 3R8UA 4NCTA 4UMRA 4ARKA 2WFYA 3KRLA 1V0PA 5TKDA 5TF9A 4ZJJA 3V8TA 5IEXA 3U87A 2PZYA 4U7ZA 1YHVA 5H2UA 1S9IA 2FYSA 2H34A 3A60A 3BLHA 4FK6A 4CZYB 4PDPA 2JBPA 4TNBA 2B9HA 2Z7RA 2KULA 4AXAA 2X39A 4IB1A 3QC9A 1HOWA 1KV1A 4L45A 4FTTA 1U54A 3QBNA 3NAYA 5ACBC 2GNHA 5H8BA 4C3RA 3LPBA 3TKIA 4ZTLA 4W4XA 5HGIA 3VIDA 4G6LA 4L8MA 4IAZA 5FTOA 3K2LA 3FMLA 1R0PA 2JDSA 3DDPA 4FG7A 4IZ7A 4FEXA 4V04A 2YLEA 4BC6A 4CTBA 4I6QA 4L3JA 5M56A 1UNGA 5DT4A 2LAVA 4RLLA 1OPLA 4JAJA 2RF9A 3D9VA 5DH3A 3ZOSA 4LOQA 3IKAA 4YJNA 3W10A 5E8TA 3VUKA 3ZO1A 5EG3A 3ZFXA 3HECA 2HYYA 3KK8A 1U5RA 2B52A 2I6LA 4B9DA 3TKHA 4FV3A 3PJ3A 3IDBA 1YHSA 1O9UA 3MIYA 4U6RA 2HK5A 3OCTA 4XG6A 4AGWA 4MH7A 3IPHA 1LEZA 5HORA 4FV0A 5BNJA 5CF8A 2PMIA 2W4KA 3PJ8A 1H25A 2YWPA 4FTJA 4GT3A 3COHA 4CKRA 4ACCA 5HTCA 3BGZA 4KKHA 4YLLA 3AT4A 4FVPA 4FTAA 2O65A 2VWZA 4DG0E 4J53A 2BRMA 3E8EA 4ACDA 5EQYA 2UW6A 1W98A 2FSOX 5IQDA 5AR2A 3FL4A 4O84A 3M2WA 4IQ6A 5J1WA 4C4IA 4H3PA 4IX3A 4KIQA 4M69B 3QC4A 2ZDUA 4ANBA 4BKYA 2GQRA 5GZ9A 5HCXA 4PL4A 4FICA 5HOAA 3TCPA 3UVPA 4FKOA 2C6MA 5KKRB 1G8JA 3FMNA 4O7WA 2A19B 1H8FA 3DFAA 3FXXA 5EYMA 2OZAA 4PV0A 3D7ZA 5GZ8A 1YWRA 1KE6A 5EDPA 5F1ZA 4ASDA 4QOXA 5CU3A 1ZOHA 4EWHA 4I5CA 3FZPA 3F3UA 2SRCA 5DE2A 1DI9A 4FL3A 4KINA 5M4UA 1BX6A 3R7UA 3T8OA 4BYJA 5BV3A 2HW7A 4UYAA 4XV3A 4PY1A 4DEEA 2QNJA 2BRHA 4ZP5A 5ETIA 3P9JA 4F6SA 1XO2B 3E5AA 4I0RA 3C0GA 1FOTA 4PMMA 1PMUA 4ACMA 1REJA 2GNFA 4M0YA 3GC7A 3CPBA 4YO4A 1PW2A 1SNUA 3GU5A 3PY3A 2XZSA 4RJ4A 3WZKA 2OSCA 5FEEA 2IPXA 3C5IA 2EUFB 3O96A 4JT3A 4E4NA 2R3JA 4F6UA 1YRPA 4PRJA 4EHZA 2B1PA 4O0XA 4DTKA 3IW5A 5CAUA 4ZLOA 3AT2A 5ITAA 4D0WA 4AS0A 1CSNA 2XB7A 4X2GA 1A48A 3IDPA 3QTWA 4WUNA 4LV7A 2JEDA 2QQ7A 4U79A 4EBWA 3F7WA 3T3VA 3ZH8A 3CLYA 3NIEA 5AUXA 1LR4A 2VTOA 3OUKA 4G16A 5IPJA 2PU8A 5T68A 3KIOC 4C02A 2H9VA 5J5SA 3PVBA 5AUVA 3S00A 1CKIA 3OG7A 5D7VA 3W0QA 4XLVA 2C47A 4RJ7A 1IR3A 3G6HA 4NWMA 4RX7A 2XP2A 4KIKB 3R1YA 5EI8A 4W4VA 2HWOA 1G8KA 3W0SA 4YC3A 4IX5A 2XALA 3EQGA 2PUNA 4X6QC 3UPXA 4CRSA 4D55A 4ACHA 4DHIB 3PIXA 2VO3A 4L00A 1PKGA 2XCHA 4O0YA 3OXTA 4OR5A 4MXCA 4E7WA 5I9UA 4O7NA 4F9YA 1O6KA 2G01A 4FZ6A 5E91A 3QF9A 4QO9A 4QEBA 2Y4IB 4BCNA 4DEGA 3DB8A 3FKOA 3I60A 3AMYA 1SNXA 4MD9E 3Q4TA 3OHTA 2J0IA 2F4JA 3G5DA 4I3ZA 1Q97A 5LMAA 4QMLA 4AGCA 3NVMB 4KABA 4I93A 4PPCA 1FMKA 2X8EA 2ZOQA 3JPVA 4MX9A 4QP3A 2NP8A 4TWOA 4FK3A 5AA9A 1M2RA 1JBPE 1UU7A 3RGFA 4BCQA 2XM9A 4BKJA 3QQGA 4FT9A 4DFLA 4G6NA 3DT1A 4L9IA 4OTFA 3PVUA 5CAVA 5FDXA 3A7GA 3LJ0A 4E6DA 3PDTA 3ACJA 2WQNA 4I94A 5L8KA 5CTPA 5JK3A 3N9XA 3ZZWA 4IM3A 2FO0A 4LM5A 5EH0A 2CGWA 2VNYA 2WMTA 4CCUA 3WYYA 3LXKA 3QWKA 5J87A 4BHZA 3EQBA 2OJGA 4D2SA 1PXLA 4DCEA 4YSMA 3BEGA 5K3YA 2FH9A 2VWIA 4I6HA 4ANLA 4M3QA 3DV3A 3FJQE 3GGFA 1OKZA 2OWBA 4DE4A 5CAQA 5A9UA 1J1CA 4ERKA 2H8HA 1A06A 2RG6A 4YHTA 3PYYA 3HMOA 1URCA 3LFSA 4Q9ZA 5KZIA 3ULZA 4TNDA 5HLNA 4QYEA 3K3IA 5K0KA 3HUCA 3WE4A 2W0JA 4X21A 4DG3E 2R3FA 3NVKI 4BCGA 2JIIA 4F08A 3AKKA 4FTRA 2R3HA 2XKEA 4NM0A 3LCOA 2WU7A 3W33A 3ZBFA 4A9TA 5AM7A 2YIQA 2ZB0A 4E4LA 3QTXA 3E7OA 3P78A 3OT3A 4QNYA 1ZMWA 2HENA 5A4TA 4EUTA 5FUTA 4F0IA 3DAEA 5DR2A 3A8WA 3AT3A 3R1SA 5CANA 2CCIA 1PXNA 4YURA 5CU0A 4C57A 1IA9A 3NR9A 2QOOA 3NRMA 4AW0A 4KNBA 5B2KA 3TZMA 1OGYA 4BDHA 4FTUA 1YKRA 2ITPA 4AZFA 5KKRC 5M07A 5CSPA 5IUIA 3LLAA 3LE6A 3KCKA 3CE3A 2XA4A 3P7AA 4N6YA 4BZOA 3D0EA 4WBOA 5AR4A 5FM2A 3FXZA 3Q52A 4N57A 3RAKA 3SDJA 3QUPA 3ORKA 4LUDA 3BHUA 4OBPA 4RIXB 4RT7A 4Q5HA 3Q4CA 3W55A 2XJ2A 3C9WA 4EK8A 3MY5A 4NK9A 2Y6OA 3RTPA 4RFZA 2GU8A 3PY1A 3EFWA 3EZVA 1X8BA 3QGYA 4WG5A 3RHXA 5E8SA 3KULB 1GIHA 3ZXTA 4UMUA 4XEYA 5C03A 3F66A 2IVVA 4RJ6A 5E8ZA 1PYEA 2WMQA 3CS9A 4JBVA 1TFFA 1I44A 4YJVA 3I6UA 4D9TA 4BBEA 2QG7A 2ITXA 4I6FA 1IA8A 1XH6A 3BRBA 3E3BX 3E7VA 3O8PA 1W2DA 5BUIA 2EB3A 2XANA 3F69A 3DY7A 4YNEA 3DK6A 4FC0A 4JQ8A 4RVLA 5KCVA 3UMXA 3PSDA 4TY1A 4FL1A 4CKIA 4WSYA 3D7TB 3OUNB 4HVDA 5E4HA 1YXTA 4BBFA 3VWAA 1YDSE 3ORMA 3TV6A 4GK2A 4MWIA 4NM7A 2DQ7X 4RLKA 4A9SA 2VX0A 2YM6A 5A14A 1H1SA 4FKUA 4KS8A 3R9NA 2J0LA 1HCLA 2QKRA 4DHZA 2BCJA 5JH6A 2YN8A 4FL2A 2BHHA 3GC0A 5AP6A 3UJGA 3UZTA 3W2OA 4J96A 4NU1A 3R9RA 4DF3A 1FBNA 1SZMA 4JBQA 4U41A 2VTHA 4I5MA 2QU5A 3F3TA 2QOFA 2GNIA 3RCDA 4KBKA 4JRNA 3NNXA 3O23A 4ZJVA 2QI8A 3IECA 2F7XE 4AUAA 3BELA 4M15A 3VF9A 5M51A 3U8WA 3VW6A 3NFFB 1OI9A 4OTRA 5LVMA 2RGPA 3CTQA 4OLIA 4ZSJA 2BR1A 4GW8A 5CZHA 5IQEA 1H1RA 2ETKA 2BROA 3EKKA 4IC7A 1UKHA 3AKJA 4BJJB 3Q5ZA 4GU9A 4O96A 4MF1A 3OY1A 4BDCA 1IAJA 3Q9WA 4AOTA 4DHFA 2ZJWA 2REIA 3O7LD 1JKKA 4FVQA 4J95A 1APME 2QURA 3VS3A 3DQXA 5KHXA 3TDVA 1Q62A 4ZTSA 3LAUA 3UVQA 4AQCA 4EC8A 5HTBA 5LJJA 2XNOA 5J9LA 4YPDA 4CMTA 4ITJA 4CZUA 4EZ7A 3ORIA 2OBJA 1M2PA 4QMOA 1QPDA 4PTGA 3O7LB 3COMA 5IQIA 4AN2A 5K5NA 5L2QA 4ZSEA 4TYHB 4E3CA 1OUYA 5BUJA 3KRJA 4MXAA 2PL0A 4XJ0A 4EH9A 2PULA 4IWDA 4IVAA 3L9PA 4XV2A 2JKMA 3WF7A 1WAKA 3BQCA 1W83A 5BVEA 3UOHA 4X3FC 5EW8A 4JX7A 3BHVA 3W8QA 4M66A 4FZDB 3DXQA 3LMHA 3VW8A 2JAVA 1F0QA 4OTHA 3S95A 4B4LA 3GXLA 3FZTA 3F2RA 4ANQA 3LKMA 3V04A 3Q60A 3SRVA 3QQLA 3QX2A 4X2FA 5CI6A 4O38A 4IJPA 1PXOA 4IDVA 3UGCA 4DTBA 3V5WA 2BKKA 2YDIA 4RQKA 3LOKA 3VHEA 4LMNA 1OUKA 2OJ9A 4WNKA 3EIDA 3MTLA 4A7CA 4BKZA 5FBOA 4H36A 4QQJA 1PMNA 5DIAA 3TIZA 5JN2A 3FYJX 3ORTA 2GQGA 4XG4A 3O50A 3A61A 2YM4A 3RNIA 3EN7A 5AFVA 3PJ2A 4UY9A 1Q61A 2YCSA 3VBVA 3FAAA 3LCTA 2WMUA 3DA6A 2Y7JA 3PA4A 4PDOA 4I41A 3CEKA 3ZSGA 2ITTA 4AGDA 3V5TA 2VTSA 3DOGA 4NIFB 4R3RA 5JZNA 1G8SA 3UYTA 4P2KA 4W9XA 4BB4A 1H1PA 4EH5A 3AGLA 1QCFA 3OTUA 4U5JA 3EOCA 3DNEA 2B9IA 1UWJA 3GEQA 5ANKA 4HVIA 3TL8A 2X7FA 4HJOA 3UIUA 3AC2A 3NUYA 5IA0A 1FPUA 1H08A 2RFNA 2X8IA 3HGKA 4RG0A 4UALA 4BHNA 5CF6A 5FGKA 3IO7A 5AP4A 2E9PA 3AXWA 4UZDA 3H9RA 3HAMA 4QMQA 4BCIA 4FTKA 4J97A 2QOQA 4R1VA 5IQHA 5HG9A 5AR7A 2PUIA 3OWPA 2R3NA 3JY0A 3K5UA 4L43A 1H0VA 3NUPA 4IACA 4QP4A 1TKIA 1OITA 3IONA 4JVGA 4WBBB 1PKDA 3GENA 4YJRA 4DH8A 2XAMA 3D14A 3D15A 4Q5EA 3N4TA 4O7YA 2BDJA 2G2HA 2YIXA 3EWHA 1MQ4A 3EN5A 4EKKA 4FSRA 3ZEWA 4BFMA 4M8TA 4FV1A 3G51A 4D9UA 3HMMA 1JKLA 3ORXA 4IAYA 4O0SA 3RK7A 3KFAA 2JKKA 2PMOX 4RGJA 2JDRA 4L6QA 4YJTA 3ZRKA 2IO6A 1U59A 4UWYA 4K8AA 2VAGA 1V1KA 3ALOA 3CKXA 2CKPA 5DYJA 1FQ1B 1XH5A 5HO7A 4D2RA 3QRIA 4FSQA 2O0UA 3C1XA 2W5AA 4LG4A 4AFEA 4D5KA 3DU8A 2X9FA 4NJDA 3ENMA 3W2SA 4G3FA 3RAHA 3NCGA 3UDZA 2YAAA 2X4FA 3MYGA 3SHEA 4DITA 5IUGA 2YEXA 1Q8UA 5J9YA 1OPKA 2VTRA 5KMJA 2CGVA 1Y8YA 3DJ7A 1CM8A 4EUUA 2HCKA 3I1AA 2CNVA 3MY1A 2PE2A 4O82A 3S3IA 5KMLA 4YZMA 3I4BA 3E8CA 4Y46A 1AQ1A 4EHEA 2LGCA 3OW3A 4G34A 2WNTA 3MVMA 3NS9A 2UW7A 4U0IA 5LCKA 4RQVA 3DZQA 3D5UA 4AZSA 4YTCA 1YDTE 1VZOA 4JDJA 4DGLC 2W4OA 4IXPA 2Z7LA 2OJJA 4V0GB 3C4WA 3KMWA 5E90A 3PZEA 4RX9A 4ALVA 2C6KA 4E5AX 2PUPA 5ICPA 4ZMEA 5CEQA 2GHLA 3HV6A 3IQ7A 2XK6A 3ORPA 2UW4A 4YJPA 4R7BA 2CGUA 3JY9A 1MQBA 3LIJA 3Q5IA 3C7QA 2W17A 2RSVA 3PP0A 3ETAA 4X3JA 4APCA 3KREA 2VWVA 4ITIA 4QMWA 2UW9A 4IIRA 3KVXA 5LVPA 3ZZEA 4EH6A 3TTIA 4EZ3A 3TNPC 4ZK5A 4CCBA 2BZKB 2R7BA 4R8QA 5FP5A 4XRJA 4FKPA 4J52A 4U81A 4PF4A 1K2PA 2WU6A 4OT6A 5DOSA 1RE8A 5AV3A 4EKLA 4BI0A 5I0BA 3CSVA 2CLQA 3TACA 2WMSA 4R7HA 5D11A 5LVNA 3GQIA 3RPVA 3DLZA 4FKIA 4EEVA 5AV2A 4AFJA 1WBTA 3OWJA 4PX6A 4CFUA 3OWKA 2C68A 2R7IA 3PXZA 4IX4A 5AP7A 4EQCA 4CFXA 4QQTA 3UG1A 3UIMA 1FVRA 3UYSA 3VF8A 3KA0A 1M7NA 4CRLA 5KMIA 1SVGA 5CT0A 4NH1A 1VEBA 2H6DA 5H8EA 3OCGA 3COIA 4AT3A 4GFMA 2XNPA 2QLUA 5AP0A 4RC4A 5EYKA 4RMZA 2JBOA 4DFZE 3UOJA 4L46A 1ZYLA 4IM0A 3MA6A 3KF4A 3S4QA 1JVPP 2WQEA 4YTIA 4JQ7A 1L3RE 3TEIA 5AUZA 3CC6A 4D2TA 4RIYA 5AUYA 4L53A 3QCXA 5GJGA 5IQBA 4XG3A 4ZLZA 3N4UA 1KE5A 4U43A 3V8WA 5DI1A 3SQQA 2QVSE 2G15A 3ZDUA 4QMTA 2C3KA 5F9EA 5HD4A 1UV5A 5L8JA 5D41A 5JRQA 4CVAA 4GU6A 2P0CA 4QTDA 4FKQA 4DEDA 1J3HA 4XMOA 4FV5A 4BDGA 3BE9A 4WIHA 3HV7A 3VHKA 3N4VA 2Z02A 2DWBA 3QQHA 3TG1A 5M4FA 2J0KA 2I0HA 3TV4A 4WG4A 3KXZA 3RKBA 3C4ZA 3FZOA 4GJ2A 2XIZA 4QYFA 5HX6A 2FVDA 5J7HA 1VYZA 2NPQA 2WAJA 4C8BA 3K3JA 2J5EA 3Q9YA 1Z57A 3P7BA 4KA3A 5H8GA 3PA5A 3H0ZA 1J1BA 1SVHA 3SD0A 5FXRA 4GKIA 3ZLYA 2C0OA 4WG3A 3MPMA 4RC2A 4ASZA 2BPMA 1YOLA 1Q8WA 3OCSA 1ZY5A 3P5KA 2A27A 4RVTA 4L7SA 2ZYBA 4CXAA 4BRXA 2W1DA 2BZJA 2IN6A 3UOLA 3QD4A 1W2CA 3LJ2A 3ODYX 3QCYA 2WMWA 3BYVA 4XG2A 5E8VA 3VS5A 4FEUA 4BL1A 2X6DA 3FZRA 4N70A 4R1YA 2C3JA 2G2FA 3DFCB 5KMOA 5E8UA 5CU6A 1LP4A 3H3CA 1PMEA 4HYHA 4C4EA 3FQHA 3LCKA 5F95A 1UWHA 2PMNX 3CJGA 4UWCA 4YTFA 1JPAA 3ZMMA 4O4DA 4TWCA 2Z60A 5AV1A 5K5XA 1WBPA 1R78A 2F2CB 3TMOA 4U44A 3PFQA 1XR1A 4IZYA 5IA1A 1DAWA 2BZHB 2JC6A 5IKWA 3RM6A 4DDGA 4YLKA 4R77A 1DI8A 2GDOA 3RWQA 1KSWA 5AV0A 3SVVA 3T3UA 3MWUA 3QX4A 3ZU7A 3UE4A 5IA4A 2E9UA 1T45A 4AN9A 1NW1A 3G15A 5DMZA 4WRGA 3R02A 5JFXA 3EH9A 4ASXA 4IM2A 4YC6A 5KE0A 4GKHA 1P4FA 1Q41A 3F2NA 4DTAA 4XBUA 4XOZA 4W9WA 3R00A 2UZVA 5IQCA 2VWWA 3SOCA 3MY0A 4O6LA 3P79A 3ORNA 4X2NA 3BU5A 4AT4A 4IFGA 3VUTA 3G33A 3NYVA 4GCJA 3COKA 3L1SA 2E2BA 3KEXA 4MD7E 3E87A 1OL1A 4KIOA 2CKQA 5BMMA 4RA4A 4EJNA 3RNYA 2OW3A 4AOIA 1SVEA 2I0EA 3L8SA 4BI2A 2GNJA 1OIQA 3SW7A 1ZLTA 2KTYA 3I0OA 3LFQA 3ODZX 2W05A 3HRFA 4Y8DA 4YGAA 3CQUA 2XKCA 4IAIA 3GU7A 3TZ9A 3HNGA 3DDQA 3RAIA 3UQGA 4MVFA 3ZRLA 4F1MA 3F5GA 5IMXA 2J0JA 3FL5A 4HYSA 4EH2A 4ZAUA 5DT0A 4DFBA 2VTPA 5ETCA 4UMPA 3RMFA 3UO6A 4F65A 1KOBA 3EB0A 4Z16A 2XRWA 4XG7A 3CD3A 3OROA 4FSNA 1KE8A 3EFJA 3IOPA 5DFPA 4FOCA 2GFCA 2J2IB 3UDSA 1O6YA 2BALA 3ZHPC 4JMQA 3PPKA 2A2AA 2HXLA 4FKSA 2CPKE 4TZRA 5CU4A 5CEIA 3VC4A 3GNIB 2W5HA 3VQUA 1LPUA 1JSTA 5FP6A 4NKAA 1H00A 4FT3A 4RJ8A 2A0CX 4LUEA 2Q83A 1VJYA 4YO6A 4CV9A 4M68A 1WZYA 3GP0A 3P5JC 5HLPA 3VS1A 2W1ZA 2XMYA 5CXHA 3PXYA 2NRYA 4DN5A 4W4YA 5JEBA 1VYWA 4PMTA 4CLIA 4IJ9A 4TRLA 2XJ1A 5AA8A 1DAYA 1P4OA 2V62A 3MH2A 4RWJA 2J4ZA 3R83A 2PPQA 3ANQA 3LVPA 3K5VA 3PUFC 2VTQA 5GNKA 1BKXA 2CLXA 5A3XA 2VTTA 4FYNA 3UDBA 3PG3A 3S2PA 4EOSA 5DA3A 5TO8A 4FODA 1WBVA 5AP1A 2XEYA 4HVSA 5J79A 2VX3A 3OOMA 3FC1X 3RAWA 4RZVA 4HVHA 2OIBA 4FUYA 4P90A 5CWZA 4AZVA 5CSHA 3NIZA 4QQCA 4PP9A 2QR7A 1XH4A 4EOPA 5HU9A 4YC8A 2EXEA 4BBMA 3QQUA 2E9VA 3FPMA 4DT8A 5HIDA 2HZNA 4BTKA 5ANGA 2Y6MA 4FTOA 2CGXA 3FI2A 1H0WA 5HE3A 5C4LA 2C6TA 2YERA 3GCVA 3QQKA 3RM7A 1XMMA 2JGZA 3RCJA 4QP2A 1QPJA 3TDWA 2R3RA 3QHRA 5FRIA 3MDYA 3PIZA 3PFYA 3D94A 4IMYA 3VS7A 1OZ1A 1OGUA 3KN5A 4XX9A 2BDWA 3R1NA 4QMXA 4WOVA 2ZMDA 3MVHA 3F5UA 4O4FA 2WQBA 2AEGA 2I1MA 1A9UA 3LMGA 2JFLA 1Z5MA 3V6RA 5CQWA 4IZ5A 1BI7A 1U54B 3CQWA 3BI6A 3HUBA 4XV9A 4JG7A 3QL8A 3RZBA 4ZTQA 3Q96A 4MKCA 4X3FA 5EYCA 3SG9A 2HY81 5FTQA 4MQ1A 2XK3A 3QTRA 5EQPA 1W8CA 5CENA 1E9HA 2NRUA 2WELA 4A9UA 3FLSA 4FYOA 4ZZOA 3HZTA 3GFWA 3UOKA 1ZARA 4MD8E 4ACGA 2YM7A 5KZ0A 3R8LA 4AE6A 4KKEA 2P55A 4I92A 1OL6A 4PWNA 3C4XA 3PVWA 3FMJA 4GJ3A 5EHOA 3ZCLA 4I20A 3AC5A 4RZWA 2V7OA 2OJFE 4O0WA 2VNWA 3NNVA 3C51A 2VWBA 4USFA 1CDKA 4GK3A 4LQMA 4XP0A 4V01A 4R3PA 3CD8A 4KBAA 3EQDA 3VN9A 4BCHA 2IEWA 5AP2A 2BVAA 2QC6A 4AW2A 1CKJA 2J0MB 3W0PA 2O3PA 1IRKA 5CLPA 3OS3A 2V55A 3PLAE 1GZKA 2FGIA 3FMKA 2UW8A 3D5VA 4YBKA 4ZSAA 5CI7A 2WTKB 3VJOA 2QOKA 2V5QA 4QYYA 1XWSA 2VGOA 3POZA 2WIHA 3RHKA 1UNHA 2W96B 3GC9A 3R63A 2CNQA 5AUTA 3K54A 3SX9A 3ELJA 4FKTA 2BFYA 4QD6A 4CYJA 1XQZA 3UZPA 4AZWA 3BBWA 1E1XA 1WBSA 4TWPA 3RPYA 2OU7A 3V5LA 5CAPA 4G1WA 1QPEA 2FSTX 3T9IA 3PSCA 4M0ZA 1R3CA 4J99A 4PNKA 4DC2A 3TWJA 1ZMVA 4MNFA 5FEQA 3SV0A 5KMKA 3QCSA 2B7AA 3HV4A 3NW6A 2OZAB 4E5BA 4FEVA 3OXZA 4K18A 4MBIA 5L3AA 3JVRA 3EN4A 4U8ZA 5FXSA 3NEWA 3QD2B 2PE1A 2VV9A 5CSXA 1XBCA 1W2FA 2R2PA 4I24A 3BPRA 4BGQA 4ZZNA 4DAWA 1QMZA 4O81A 1GOLA 5HU3A 1XBBA 5IU2A 3AQVA 3KRXA 4AW5A 3I79A 3A2CA 4BCJA 5BVNA 2HZ0A 3F5XA 3BYOA 4G9CA 3IOKA 5EM5A 3F7ZA 3REPA 4S34A 4AZEA 2P4IA 1REKA 4F9CA 5L6OA 2UVYA 3GBZA 4GUBA 4M12A 4FKRA 4LFIA 5L2TA 3PRIA 1OMWA 4FSTA 4D4VA 4GIHA 4WUAA 2PTKA 2QOIA 1MP8A 2PVKA 1J91A 3EFLA 3B2WA 3R28A 3WZJA 4D5HA 4F63A 2R3LA 4IB0A 4M84A 5E1SA 3WF8A 3R73A 2C6LA 3BV2A 5FLFA 2IZSA 2YABA 5AX3A 4C0TA 2OXDA 2OF4A 4E93A 3AC4A 3MGYA 3QQFA 1JKSA 2PZ5A 4RX8A 4XS2A 3SOAA 4CKJA 2FUMA 4UXQA 4Y5QA 2PHKA 1Q3WA 4B8LA 4ZZMA 4DH5A 5HBJA 5ANIA 1CTPE 5KNJA 5FM3A 2QO7A 2XYNA 4A4XA 5IF1A 4HCTA 3FMDA 3ZUVA 4HVGA 1UU3A 2PVRA 1KV2A 5HLWA 3LFCA 2XKDA 3C5UA 4F0FA 4EL9A 4K9YA 4A9RA 2YZLA 4BY9E 3VBTA 3WF5A 4H3BA 3RZFA 5FD2A 1QL6A 2W9FB 1BL6A 4DYMA 4C3FA 3AG9A 4HYUA 4JG6A 3QTZA 4U42A 5CU2A 1W7HA 4DFUA 3DZOA 4G3CA 4HNFA 5IMEA 4XRLA 2OIQA 3KCFA 4BWPA 4EQMA 4O7VA 4BJJA 4O4EA 3KRRA 4YHFA 2OJIA 1J7LA 5FQDC 5HTIA 2XNGA 3OF0A 3ZDIA 2X0QA 4EOIA 4MXOA 4NSTA 3IW4A 4PTCA 5EFQA 3VO3A 4HYIA 3ZXZA 2RL5A 5CY3A 1XMLA 2R4BA 4K77A 3QYZA 4G5PA 3D2KA 4FG9A 5FG8A 2EXCX 1BLXA 4F1TA 4O83A 1JWHA 1XKKA 2ESMA 3HX4A 4C7TA 3MJ1A 2VGPA 2JDOA 1YI3A 5C4KA 5CEMA 3QCQA 4ZMFA 2JKQA 5HEZA 4OTIA 4CT1A 1BUHA 3LZBA 2OXYA 5EOLA 4GVJA 4II5A 3R7EA 4C37A 3MH0A 3DAKA 5CASA 5BVWA 5E9EA 4LGDA 5AR8A 4XHKB 1OPJA 4AA4A 4F7SA 3FWQA 1Q8ZA 4OGRA 2OH4A 3PA3A 5M4CA 4RFMA 4A07A 4EYMA 4OT5A 3BZ3A 4HGSA 1OKYA 1TVOA 4KD1A 1JKTA 1Q8YA 4NZWB 4UMQA 2PK9A 5A4CA 4IAKA 1SYKA 2XRUA 4QPAA