4PV0A

Crystal structure of spleen tyrosine kinase (syk) in complex with an imidazopyrazine inhibitor
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
275
structure length
268
Chain Sequence
VYLDRKLLTLEDKELGSFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase SYK
publication title Discovery of GS-9973, a Selective and Orally Efficacious Inhibitor of Spleen Tyrosine Kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 268
sequence length 275
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4pv0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4pv0A01
4C61A 4LUEA 4F99A 3KMWA 5AR8A 3V8WA 5FG8A 4BB4A 4FV7A 4N6ZA 5KZ0A 4EOSA 4QMTA 1WBTA 4IZ5A 4E4LA 1DI8A 4U41A 3VJOA 3RAHA 3QL8A 4DHFA 5EHOA 5CF4A 5AR2A 3OD6X 4AE9A 2BZIB 2J0KA 3IGOA 1W8CA 2XBJA 4UWYA 1CSNA 3BU3A 3KK9A 4L43A 3WIKA 2IVUA 1R78A 2PK9A 3NUAA 3R22A 2RFNA 4ALVA 2J7TA 4C7TA 2QHNA 4QMYA 1HCLA 1PMVA 4NW6A 3MY0A 4WRGA 5I9UA 3WF6A 4AW1A 2IG7A 2IPXA 5DN3A 4F9CA 2QOBA 2QOHA 1FPUA 3HNGA 4DEBA 5IPJA 5KMLA 1YKRA 3HLLA 3KEXA 4E20A 2FH9A 3HX4A 2J51A 3IQ7A 4RRVA 2PMOX 5GJDA 2HW7A 3VBTA 3ODYX 4NM7A 5IA0A 3BEAA 1RW8A 4H05A 1TKIA 3HMIA 5DRDA 2WGJA 1EH4A 2XK4A 3HAMA 3VS0A 5CT0A 5D11A 4R5YA 3TACA 2C3KA 4E73A 3QQUA 4GJ2A 4DH8A 3I1AA 3RM6A 3UYSA 4I6BA 3IECA 4F7LA 3CTQA 3O7LD 3LFQA 2IW9A 1YXVA 4HVIA 1M2QA 4QQTA 3HYHA 2GS7A 4TTHB 3A8XA 4NKAA 4OBOA 4UXQA 3A7IA 3H9RA 3P79A 3FYJX 4EH5A 2QODA 5AR3A 3TNWA 3ZOSA 4MQ2A 3GGFA 2V7AA 3QQLA 4IB1A 4DE4A 1VR2A 3A60A 3FC2A 5IUHA 2I7QA 5J8IA 2WTIA 3RJCA 1U46A 4FIGA 1RE8A 1I09A 2C6OA 2HK5A 4IWPA 3D94A 3K5VA 3FMJA 4GRBA 3OT8A 4YZMA 4ANBA 3LFFA 4G17A 2VO0A 4E6AA 3JS2A 4ZAUA 3BX5A 2F7EE 4FVQA 5DFPA 3EQFA 3G0EA 2YAAA 3ZZWA 3VHEA 4C4GA 3UIMA 2X2MA 2VAGA 1J7UA 5EK7A 4D2WA 2YM8A 1Q99A 3G0FA 1OL6A 2YEXA 3PJ2A 5BVOA 3DLSA 3Q4TA 5FTQA 5JEBA 1QPCA 2UW5A 3PIXA 3BE2A 4PWNA 5F1ZA 3RPSA 4FSRA 3SG8A 3BBWA 1MQ4A 1OPJA 2BR1A 4FSYA 4X6RA 4UB7A 5EYCA 4RG0A 3I79A 3C51A 1BUHA 5DMZA 1YDTE 3QD2B 4QMUA 3AD6A 2J5FA 3HAVA 4CCUA 2WQNA 2NO3A 1YDRE 4Y8DA 1G3NA 2HZ0A 3RNIA 4ZSEA 4S33A 3SKCA 3VJNA 4YJNA 2BFXA 2RFSA 4E4NA 4I5PA 4O27B 3MB6A 5D7AA 1LEZA 4FZ6A 5I9WA 1IA8A 2X2KA 2ZDUA 4O2PA 3DKOA 2J2IB 2CNUA 3AXWA 2EU9A 3MVJA 3VHKA 2VWZA 1IAJA 5DT0A 4LOPA 1REKA 3GOKA 1FMKA 3RPYA 4F4PA 3W8LA 4DFNA 3R7VA 3PPKA 5M44A 4ZTNA 4AOIA 3TNHA 3OC1A 4DFZE 1OVEA 2Q0BA 3ZRKA 2XK7A 2AYPA 3P7AA 3W10A 4BICA 5CAQA 3WARA 4YO4A 3EFKA 4FSWA 1ZARA 1KE8A 3ZLYA 1KE5A 4QMLA 3HV7A 2JKMA 3I5ZA 3W32A 3IPHA 1WBSA 3EQHA 3FPMA 4YJSA 1XQZA 1KSWA 2FUMA 3TI1A 4B9DA 1XKKA 4I0TA 4TYJA 4DEEA 5FD2A 5ANKA 4PDOA 2GHMA 5B0XA 4XMOA 2YM7A 5AIKA 1FQ1B 2UZOA 3AQVA 5HBEA 4HVGA 4C4IA 3F9NA 4AW0A 4BIBA 3VUDA 3ZC6A 4Z3VA 2WFYA 4QYHA 4IXPA 3R73A 4AAAA 4CZUA 3E8NA 4GK3A 1OKVA 2UW4A 3CQWA 3KCKA 4I0SA 3QGYA 4BI0A 1ZYSA 3H9FA 3WZEA 2W7XA 5BQ0A 3L8XA 3CTHA 3OCTA 4TWNA 2BAKA 4E6QA 4BTKA 3NSZA 4MEDA 2BIYA 2W5BA 3BELA 3KULA 3QBNA 4ZZNA 2PL0A 3H9OA 2XM9A 4GS6A 3PDTA 5M08A 5EDRA 4W4YA 4YJVA 4ANLA 3DTWA 2B7AA 5FDPA 4LFIA 4I1ZA 3UZTA 4GL9A 5IQHA 4XV2A 3ITZA 3EWHA 2W1ZA 4ARKA 4OW8A 5CWZA 4U79A 1ZWSA 4PUZA 2YERA 2YM6A 4C35A 4V05A 3QRKA 5ANJA 2W05A 3CD8A 2GNLA 3EN6A 2H34A 4DGLC 2ZMCA 4FIHA 2R3LA 4HVHA 4J53A 4XV1A 4F08A 4MBJA 5CSHA 3VBYA 3LJ2A 4IJ9A 2ZAZA 4KIKA 4RZWA 3SAYA 1V0PA 3QTWA 3FE3A 5ACKA 2HCKA 3DB8A 3FUPA 3NGAA 4A7CA 5C26A 3ZLSA 3A4PA 5KMNA 4KSQA 4HPTE 5HVKA 4EONA 4O96A 1Q62A 2P55A 4I5CA 4YP8A 4GMYA 5CEIA 4QMMA 4YZNA 4TW9A 3DAKA 1SNUA 3L9LA 3NNXA 4RIOA 5EKOA 3E64A 4XH6A 4USEA 3A7GA 3MFTA 2XRUA 3DQXA 3THBA 3IW7A 4BC6A 4TRLA 3TG1A 1GY3A 3P7BA 4EJ7A 5HO7A 3DAJA 4G6NA 2V62A 5IISA 4Z7GA 4XS2A 1OZ1A 5ICPA 3P86A 1IRKA 5L2QA 3GP0A 4UV0A 5GIPE 4QMVA 4EH6A 1TQPA 4QMNA 2ETMA 1OIYA 4EKKA 1YXUA 2WKMA 4C59A 4RJ3A 4JQEA 4PMPA 3FWQA 4XOYA 3GENA 3S3IA 2GCDA 3UMXA 5H8BA 3BYOA 4C4FA 3Q9ZA 4EOPA 1JBPE 1XBAA 4BDJA 3ATSA 4ERWA 2W5AA 5CI6A 5IQDA 3QTXA 4L42A 5IF1A 1OL1A 4LL0A 3UJGA 3P7CA 3QU0A 4F65A 2GDOA 5AP7A 3KRLA 2R3KA 2X7OA 1QPJA 2XA4A 4FTMA 2BDFA 1YOLA 4R7BA 5JMSA 3VS4A 5AV3A 3RWPA 3JR1A 4DCAA 4GJ3A 4FK6A 2HY0A 3ORKA 5EI8A 4F1TA 5DR9A 3BQCA 3G5DA 3KB7A 5IA5A 2OSCA 2DYLA 2JGZA 1FMOE 2QR7A 2V55A 3BLQA 4M84A 4QYEA 3VF8A 2C1AA 4CRLA 1PXMA 5BVDA 3R28A 4D0XA 5CEKA 3KGAA 1FGKA 1E1XA 1YWNA 4NW5A 3P08A 2W1HA 3ZYAA 4B6LA 4HW7A 2VV9A 3C1XA 3E8DA 4GEOA 5LMAA 4I20A 3VUGA 3I81A 4U6RA 4XHKB 4EH8A 3O8TA 5AX9A 2R3GA 3R2YA 4XRLA 5C9CA 3VO3A 4G5PA 3BLRA 3QKKA 4QMQA 2C3JA 2WELA 3DBQA 3SW7A 4X0MA 2UZEA 3JPVA 3LXKA 4DG3E 2WMBA 5E8VA 4KS8A 1V0BA 1K2PA 2CGUA 2JDOA 4KINA 3KULB 5T3QA 1TVOA 4QMZA 5CVFA 4CKRA 3PXRA 3CPBA 2ITNA 3FZ1A 4O1PA 3VN9A 4DINA 3DJ5A 4FZFB 4IB5A 3LKMA 4P5ZA 2J5EA 4MXYA 1XBCA 4C4JA 2BRBA 3MTFA 1M2RA 3CE3A 2JKOA 3BGPA 3TXOA 3EL7A 1NT2A 1P4OA 4A9SA 2PUNA 4ACDA 4IW0A 5DA3A 4L53A 4F09A 2H8HA 2F57A 3ORPA 5JRQA 4DG0E 2I1MA 2R3QA 2C6IA 3NYNA 4L44A 5JZJA 2QU5A 3UIUA 2WMUA 3NW6A 3OBGA 4QMWA 3TUCA 2WMRA 1QCFA 5JT2A 2C5YA 2XIYA 4FT7A 4PDSA 2C6TA 3PE1A 3P78A 4QP7A 3EN5A 2WQOA 3ANQA 4BDAA 5JZNA 5CEMA 1A48A 1ZMUA 4QQCA 3T9IA 3W16A 4WRSA 4U3YA 3MV5A 1DAYA 4XP0A 4O7RA 4YTCA 4FEVA 1UWJA 4FT9A 3NCGA 2XKDA 4CFXA 3MIYA 3L9NA 3WZJA 5B7VA 2PU8A 4B8LA 2XMYA 1FVTA 3UQCA 4WBBB 2Y8OA 5HIBA 5DH3A 3V6RA 1RJBA 5HE2A 5IH6A 3OF0A 3OW4A 4L67A 4DC2A 3JVRA 4XG8A 1WVXA 3FHRA 3S0OA 2X7GA 4EH3A 3AC2A 3GU4A 4KBKA 4WUNA 3NIEA 4ZSJA 2PTKA 3QZHA 1DM2A 5CALA 3EYHA 4O82A 2OJFE 4QTDA 3Q32A 3PJ8A 1GNGA 4K33A 2I0HA 1J1CA 5M4IA 3L8SA 3ORMA 4OTRA 2IO6A 3ZBFA 2I0EA 2VTIA 4UXLA 4BCHA 4IAAA 3DNEA 4HYSA 3FDNA 3GCPA 4YHFA 4KIOA 4CEGA 4YLKA 3QTSA 1QPEA 3M1SA 3PY3A 4HCTA 4IZAA 2WPAA 5CY3A 5L6WL 1T46A 5E4HA 4OTFA 4LM5A 4EI4A 3MN3A 4S34A 4UYAA 3AC8A 1ZY4A 1PXKA 2YHVA 2I0VA 3UOJA 5HBHA 2R3NA 4QRCA 3LXNA 2XIZA 3EFLA 4E7WA 5H2UA 2XIRA 4CKJA 4EOOA 2BRMA 4DH7A 4QYFA 4N6YA 3W2PA 1JSTA 2OZAB 3TT0A 3V5PA 1H00A 2Z2WA 3R7GA 1U59A 5AUXA 2Y4IC 4B4LA 4R7IA 1NXKA 2QOFA 1P4FA 4ZMEA 4C4EA 5C1QB 2WMQA 2ITVA 4K18A 2W1CA 4PL5A 5IA1A 4YPDA 3DXNA 5A3XA 4GVJA 1YXSA 4RX9A 4ZK5A 2WTKB 3PWDA 4F6SA 1B6CB 5HNGA 2XVDA 4WNMA 2CNQA 5HD7A 3NNVA 5FBOA 1BMKA 3ACKA 1ZMVA 4RIXA 3LIJA 4YJTA 1OIQA 2X9EA 3MFUA 4GVAA 2CGVA 3LCDA 4ZS0A 5IU2A 4RIWA 4FL2A 1VJYA 2B9FA 3H10A 4FV1A 2KULA 2PZRA 3EJ1A 5ANIA 1BYGA 3ZDUA 3ZZEA 4UBAA 2O2UA 4QP4A 2B52A 3OG7A 3CY2A 1J7IA 3NX8A 1YDSE 4RWLA 3FC1X 3OUKA 2XNBA 5I4NA 4BI2A 2W1DA 4IMYA 4YLJA 1H8FA 5F20A 4B0GA 4V01A 4DTKA 3LXLA 2J50A 3VF9A 4LRJA 4U80A 2HW6A 5ANOA 4DH5A 5M4FA 4RFZA 4HNFA 5FXRA 3Q3BA 5I3RA 1XH8A 2XB7A 3G6HA 5LCKA 4CFVA 2VO3A 2BPMA 1PMUA 1ZLTA 3ORNA 2WOUA 4ZOGA 2R9SA 4FNZA 3R21A 2ZM4A 4I22A 2IJMA 2G2HA 4M67A 4F6UA 4DFBA 5TR6A 1SVHA 2CKQA 3HA6A 3TTJA 4L7SA 5A4CA 2V5QA 5HGIA 5TE0A 3SHEA 3U4UA 4RLLA 3C5UA 4BWXA 1JKSA 5B2LA 3AMYA 3KK8A 2YIQA 4ZLYA 4DBXA 1UKHA 3QD3A 4U81A 1ATPE 2F49A 4PL3A 3TWJA 2NRYA 3PSDA 4FYNA 4AX8A 2OJJA 3BHTA 5GHVA 3RTPA 3BCEA 4J97A 5CU2A 3VVHA 4CSVA 3SOCA 3D2IA 3DY7A 3HRBA 5BYZA 3NYXA 3VBVA 3CPCA 4G3CA 4S32A 3VW8A 4BL1A 5A6NA 1PXNA 2QLUA 1T45A 2YACA 3KF7A 3DBFA 3GU8A 3OTUA 2BUJA 4TN6A 4ZZOA 4FX3A 3CKXA 3PA3A 3C5IA 1PRYA 5TO8A 2OFUA 1JKTA 3W18A 2GHGA 3VUMA 3NVMB 5BX0A 4J8MA 4IAKA 3UZPA 3HL7A 4CXAA 3H3CA 3P9JA 4DEAA 4QMXA 5AUVA 3VS2A 4IAZA 3OHTA 4GT5A 4C62A 5G6VA 3V5JA 3CCNA 2R0IA 2EUFB 5AAGA 3AC4A 4ZY4A 4UALA 2DS1A 2J0IA 4BY9E 3OT3A 3V04A 2ITUA 1ZYLA 3TNIA 1VYWA 3D4QA 3PYYA 1H4LA 1NVRA 4UMQA 4EHVA 4GYIA 4D2RA 1YOJA 2WTVA 4EYMA 3SGCA 4ASDA 4RVKA 4DLIA 3NUNA 4YNOA 5L2TA 4QP3A 4WG5A 2BRHA 2WU7A 4FIEA 2YIWA 2HYYA 3Q2MA 4FL3A 3JVSA 5AJQA 2B55A 3Q52A 2HXLA 4EHEA 3HVCA 2PVLA 5EHYA 2ETKA 4IM2A 4KIQA 5DNRA 2UZUE 4C02A 5A6OA 4GSBA 4D28A 3EFJA 1OL7A 2W4JA 3NUXA 4RIXB 4MF1A 2GNGA 2XP2A 3SC1A 2WB8A 4W9XA 5IKWA 1GZ8A 1PXOA 3F69A 5EI6A 1GOLA 4RIWB 4FTOA 3QXPA 3TZ7A 5EW3A 1UNLA 4L52A 2QU6A 2PPQA 4G34A 4M69A 4KWPA 1JSVA 4UEUA 2YCSA 1XH6A 1OKWA 2VTMA 4EK6A 3ENMA 5CT7A 4Z9LA 4JX3A 1Y8YA 3WE4A 4BHNA 4LMUA 4TWPA 4W4VA 4NU1A 3BV3A 1H1PA 4XRJA 4F1MA 1PXIA 3V51A 2F9GA 4F63A 4J98A 3GI3A 2X8DA 3LFEA 3IK3A 5AP0A 4AS0A 2B9IA 4D1XA 4PNIA 1WBNA 3PSCA 4MXOA 4XLVA 2AUHA 4V0GA 4ZSLA 3BGQA 4L7FA 3WF5A 3GC9A 4G31A 2C5XA 4ITJA 4NM5A 5DEWA 5AR4A 3VUHA 4AFEA 2UW9A 4YU2A 2C47A 2XYNA 4J52A 4C0TA 4FT3A 4IHPA 3R8VA 4HVDA 2QG7A 3BHHA 4GCJA 2WQEA 5CYIA 5AFVA 5H9BA 2WHBA 5HKMA 2UZDA 1YVJA 1UV5A 3LMIA 5DRBA 4XBRA 4O84A 5HE1A 1M2PA 3C9WA 3BEGA 2ZV9A 2PZYA 2VTOA 5FTOA 3RPOA 1SVGA 4MXZA 5FGKA 5J1VA 3KXXA 4BTMA 3KU2A 3DJ6A 3DV3A 3FZPA 4IZYA 5AMNA 2BZJA 2P2IA 2ESMA 2OZOA 4KSPA 1PKDA 3FZOA 4U40A 4AG8A 4CVAA 4F64A 4L6QA 2BMCA 3EOCA 4NIFA 3EQDA 4ZTMA 2PVKA 4MKCA 1UKIA 5GJGA 3OWPA 5IMEA 2ZV7A 2Q83A 2PVRA 3CGFA 3V3VA 5IEVA 3DBEA 2ITPA 3FY2A 4FI1A 4I24A 2YZAA 4JDIA 3WF7A 2X81A 4UYNA 4FF8A 4RJ8A 3BYUA 3OOMA 2CGXA 3G9NA 5C01A 2C69A 3CEKA 2J90A 1BLXA 4FMQA 4CT2A 3LHJA 5IDPA 4NT4A 3B8QA 5JFVA 2RSVA 2C5OA 4FV8A 3RPRA 3BPRA 4FOBA 5K9IA 4U5JA 5JK3A 4HGEA 2OXYA 3OROA 4R3CA 5D9HA 5FM2A 5FP6A 5IA2A 4D5HA 4UWCA 1OKYA 4WT6A 1REJA 4IACA 4U8ZA 4Q5EA 4USFA 4A06A 3HRCA 4ONAA 5HU9A 5HLWA 3FKNA 4OT6A 4DCEA 4MK0A 1Q8WA 4XNEA 1U4DA 4ZS4A 2C6MA 2IW6A 5LVMA 1CDKA 1PXPA 2BVAA 4XJ0A 4FICA 2CSNA 1DAWA 4RWKA 4FTLA 3CY3A 2ITTA 1JPAA 3E87A 2E9OA 4LQMA 4IAIA 4YJPA 4F6WA 4QO9A 5C03A 3TKUA 4QTCA 3IDPA 3UG1A 5B2MA 1Z5MA 1GAGA 2I6LA 3PP0A 1XHAA 4OLIA 5AR5A 1U5QA 3TNPC 4RFYA 4J1RA 4BDIA 4KKGA 4Y85A 1YW2A 2PMNX 2WXVA 3D7TA 3VWAA 4FODA 1O6YA 2IZUA 5TOZA 3R7UA 3ZMMA 1PMEA 2YN8A 4EH4A 4M69B 2V0DA 1PJKA 4WBOA 4H3QA 2R0UA 3FKLA 3I60A 1MQBA 3Q5ZA 3Q6UA 4CZYB 4TL0A 2RFDA 3Q4ZA 2YIXA 2C6KA 3HMPA 4NFNA 4IDVA 3WE8A 4MCVA 1M7NA 3Q4CA 5CAVA 1IEPA 2HELA 3TV4A 2FO0A 1W82A 3QA8A 4LGHA 4F7NA 4DTAA 4FT5A 4NJDA 4CV9A 5EHLA 3EQBA 4V0GB 4NSTA 4AUAA 4F70A 4TNDA 2BAJA 5FXQA 2Z02A 3VS7A 4GG7A 1JVPP 4IFGA 3RCJA 3HV4A 4HZRA 5L4QA 2PE2A 1Q8UA 2BHEA 2RIOA 4JS8A 4QYGA 4IAYA 5DR2A 2W4KA 2JIVA 3U4WA 4JG8A 4U45A 1G5SA 4EHGA 3UNZA 3ZUTA 4R7HA 4OTQA 5F95A 4XP2A 3MS9A 3RBWA 3FMDA 5IQEA 2YABA 3PPZA 4WNKA 4GT3A 3KXMA 4ZSGA 1CKJA 2FSOX 2OICA 3QXOA 4JBVA 5J9YA 4WNOA 5AR7A 4AP7A 3RZBA 5KE0A 3VUTA 4O83A 4XLIA 3ZU7A 3R8ZA 4NIFB 5LWNA 2C3IB 4X6QC 4Y5HA 3CQEA 3F7WA 4QNYA 2PZIA 5HQ0A 3MY5A 3LFCA 4LV5A 1NVQA 4M15A 5AP4A 3TZ8A 3DGKA 3UOKA 5AA9A 5IQBA 3AOXA 4LV8A 2C3LA 4UMPA 3KRJA 3PIZA 4I5MA 4X7QA 5EQYA 5ANEA 4E1ZA 3QAME 1AGWA 2JBOA 1IA9A 1OPLA 2C6EA 4G9CA 3KCFA 3CTJA 4TYHA 4UY9A 5G1XA 5F9EA 4FT0A 2UW8A 3BU5A 3HV6A 3DLZA 3OFMA 2WEIA 2G2FA 3QFVA 2VO7A 4RWIA 4WHZA 3P1AA 3O71A 4GH2A 1HOWA 4X3FC 4ACHA 4BDFA 3NWWA 2VRXA 3BRBA 2YIYA 3R02A 3R71A 4D4VA 4D9UA 2ZJWA 2BIKB 3MGYA 5A4LA 2ITOA 2BTRA 1P14A 3TV7A 3EN4A 2B9HA 2JD5A 4TWCA 3QLFA 4ORKA 3I6UA 1R1WA 5L6PA 3DFAA 4NM3A 1JWHA 5HCYA 4Q9ZA 4FZDB 2FB8A 3SVVA 4CG9A 1GZOA 2OKRA 4CRSA 1O6KA 3GCVA 3V01A 4L9IA 4HOKA 4O7VA 4G2FA 4TZRA 4Y83A 3ZM9A 3NNWA 4EZ7A 3QUEA 4FKTA 2VZ6A 2BKKA 2A0CX 2PSQA 4FV4A 4LGGA 5BNJA 2YDKA 5AM6A 5GZ8A 1H0WA 3FZRA 4CV8A 3BYSA 3MVLA 3QRTA 4IVAA 4BZDA 4AA4A 4EZ3A 4Z55A 2QO2A 3KN5A 2WTDA 3OUNB 4L68A 4LOQA 2EVAA 4AWIA 4D0WA 3D7TB 4YJUA 3JUHA 4JQ7A 4FTUA 2GQRA 4TYIA 2R3MA 5FEQA 3R9DA 2JFMA 4QMPA 4ZSAA 5HX8A 3FI4A 2WIPA 3ORIA 4PV0A 1PKGA 4YO6A 3QHWA 4M97A 4EYJA 3PZHA 5FEDA 4DTBA 4FKOA 4O0RA 3VS6A 5EM8A 1ZYCA 3HECA 1FOTA 2WQMA 3MTLA 5HTCA 4DAWA 4F1OA 2R3PA 3F82A 2XNEA 3C13A 2CLXA 4TNBA 5HG5A 3DKFA 3RPVA 4E4MA 2A2AA 4EWQA 1TQIA 5BVNA 3LW0A 1KOBA 4DGOA 4O6LA 4FE2A 1JOWB 1H1WA 2ZMDA 3NUSA 4RA4A 4XYFA 3SRVA 3JY9A 5DBXA 1IR3A 3Q96A 4GIHA 4O7WA 4YZ9A 4YGAA 5KMIA 5HBJA 4NTTA 4XUFA 3EL8A 3GU7A 4ALWA 4EK3A 4PF4A 5E91A 5LOHA 4M0ZA 1PY5A 3QC4A 2P33A 4LUDA 4CCBA 4F7SA 2ZVAA 1JQHA 4HGLA 2PMIA 4PRJA 3ORZA 4USDA 3RZFA 2QO7A 2BRNA 4ANOA 4JX7A 2BALA 1CTPE 3SLSA 2GNIA 2PVJA 4FSZA 4BI1A 4C8BA 4CYJA 3OXTA 4I21A 4KABA 4O2ZA 3ZBXA 4EK8A 3AC3A 3R9NA 4FKIA 1UNGA 4RJ6A 4YSMA 4Y5QA 1YHSA 5M06A 3DK6A 3L8VA 3H4JA 5M57A 3LMHA 4I3ZA 2Z7RA 4BGQA 2XK9A 2Z7LA 3EQGA 4C33A 5E90A 4Y73A 4MXCA 3VQHA 3W33A 2UZNA 5BUIA 3VAPA 3O8UA 5A4QA 2JKQA 3MVHA 1Z9XA 4D5KA 1LP4A 5IQCA 4FGRA 5C8MA 4TYHB 5JN2A 2QOKA 5CTPA 3W2SA 3LM0A 2ITWA 1Y8GA 2OWBA 2VTLA 4LG4A 4YNEA 4XG9A 2OGVA 1JAMA 2WNTA 4QPSA 4E26A 1V0OA 4ZP5A 3ID6C 3QYZA 4IWQA 3C4WA 4G3EA 4B8MA 4O7YA 2C4GA 4WIHA 5E92A 3ULIA 4K0YA 4FNXA 4JVGA 4NCTA 4ZZMA 2JIUA 3PVBA 4DEGA 1WBPA 5M4UA 5J87A 3FHIA 2QOQA 3DZOA 3HP5A 5AA8A 5FBNC 3F3WA 2FSMX 4EOLA 4EH9A 2H6DA 3NR9A 2XS0A 5I5ZA 4IWOA 3BHVA 3CR0A 2OU7A 1MRYA 4MAOA 3S00A 2WD1A 1Q3DA 4NUSA 4U42A 4IX5A 4ITHA 3RGFA 3ZFYA 3TDWA 1S9IA 2E2BA 4H36A 4CFMA 1XR1A 3DOGA 3O2MA 2E9VA 1K9AA 2Y6MA 3K2LA 2W99B 2W0JA 4Q2AA 4WG4A 1QMZA 2XJ0A 3ORLA 3FLYA 4LMNA 5FLFA 4RBLA 4FL1A 3CP9A 5CNOA 5CASA 4PDPA 4JI9A 5D10A 4BDEA 4HZSA 3HP2A 2UZBA 5J79A 4K11A 4QPMA 4GUBA 2QD9A 2XIXA 3PXKA 5CXHA 5L2SA 5FWKK 4C4HA 3EH9A 4G16A 4KRDA 4M0YA 3ELJA 5M51A 3SRVB 4RIYB 2XCKA 2YM3A 5IH4A 4O7LA 5AP5A 2PVNA 3E88A 4C3FA 4BKZA 2JDTA 2GSFA 1I44A 4OR5A 5HCXA 4RJ7A 2OJIA 2R3HA 5FTGA 3ORTA 2BHHA 3F61A 4QNAA 4BGHA 3FLNC 4CFNA 3TN8A 3EFWA 3L9PA 1PXLA 5DOSA 2XF0A 5HORA 3IS5A 3LFNA 1YXTA 2OZAA 2QO9A 5E1EA 3O0GA 2WMAA 2WMTA 4EJNA 3PVUA 3Q04A 4BCFA 5JSMA 3WI6A 4O7ZA 1TQMA 4O21A 2YDJA 5EDPA 1HCKA 3LOKA 5JQ8A 3KKVA 4IC7A 2UZLA 3F7ZA 3FXZA 4KBAA 2C6DA 3WZKA 3HKOA 4TY1A 4YZBA 3NZ0A 5AEPA 3N9XA 4EOMA 1ZYJA 4PTEA 3QCSA 2QCSA 3E5AA 2OJ9A 4KKHA 3HV5A 4PP9A 5BVKA 3WF9A 3HDMA 3DK7A 2O0UA 2PWLA 2XH5A 3C0GA 3POOA 4BDKA 3WBLA 5I9YA 4LRMA 4YR8A 3OTVA 1YWVA 4O0VA 3QALE 4N4SA 3Q9YA 4CTBA 4KRCA 3BIZA 1E1VA 2E9NA 3MSSA 4U0IA 3VUIA 4DEDA 3RVGA 3G2FA 4JAIA 3V5QA 4NYEA 2LGCA 2BAQA 4I4EA 3LQ3A 3SDJA 5HI2A 3R04A 4XG2A 2IWIA 5IA3A 4CFWA 4OTDA 4GK4A 4EC8A 4YZCA 4DLJA 3M2WA 2VD5A 3PVWA 1H07A 3FMKA 4NFMA 1J7LA 2Y4PA 5GINE 3A2CA 3QWJA 4L01A 1WCCA 3F3TA 3MYGA 5HG9A 5A9UA 1JNKA 5FRIA 4C38A 4O81A 5CX9A 4QTBA 3QWKA 2PE1A 3GC8A 3CJGA 1Q8ZA 3QTQA 1B39A 2C68A 1UU8A 4H1JA 4ZXTA 5AV4A 5M4CA 5IQIA 4YTHA 2W9FB 3LCKA 3Q9XA 5EG3A 3MESA 4DEHA 3UDBA 2QURA 4X2JA 4GIIA 4I4FA 4AZWA 5CZHA 3BE9A 2REIA 4FTNA 4CLIA 3N51A 1GIHA 4BZNA 4NKSA 4WNPA 5K0XA 3Q60A 2X0GA 3C50A 1KE6A 2OXDA 1FGIA 2R7IA 3IW4A 4RC3A 5GNKA 3IG7A 4YTFA 4FVRA 3U87A 2XKFA 2PUIA 2UW6A 3NUYA 2P2HA 1JLUE 4IEBA 4KS7A 4LGDA 4XBUA 4PDYA 3LCSA 2XYUA 3EZVA 3LXPA 4B99A 4DFXE 2YFXA 4OUCA 4G6LA 4A9YA 2A4LA 2XIKA 4M14A 4M68A 4AGCA 3D15A 3UNJA 4FYOA 4FKSA 2O63A 4I41A 2GS6A 3ZC5A 3F6XA 4AGWA 3PWYA 4RGJA 3IOKA 5KX8A 3R6XA 4JG7A 4K2RA 4NH1A 4TT7A 1OECA 4A4OA 2GTNA 1GIIA 1SVEA 2NPQA 4M13A 4QP8A 4QQJA 4C3PA 4YHJA 1Q8YA 3CSVA 2UZWE 3HZTA 4KA3A 3O50A 1H28A 5CS6A 1H1QA 1ZOGA 3F88A 5CSWA 5JGDA 3AG9A 2QLQA 5M53A 3T3UA 3RAIA 2BRGA 3A7FA 5HD4A 2JDSA 4UMTA 4MXXA 2W17A 2X4FA 3IKAA 4YPSA 2E9PA 4R6VA 5TF9A 2G9XA 5GJFA 3V8SA 5IH5A 4G6OA 5E1SA 5L2WA 5HG8A 5CEPA 4ZY6A 5H8GA 1OUYA 3RP9A 3HA8A 1Q24A 4AOJA 1MRVA 2QONA 3DBDA 3RHXA 3G15A 1GZKA 3C4XA 3MH0A 3QX4A 4PNKA 1P5EA 2CN5A 3VS1A 3QCXA 4Y46A 4CFFA 2JFLA 4BTFA 4FOCA 2QC6A 4F7JA 3ZFMA 4FIIA 4UZDA 3VUKA 3A61A 4M3QA 5DG5A 4B7TA 3E3PA 2C1BA 4DFUA 1M52A 1SM2A 2VN9A 4XV3A 1Q8TA 5LMKA 1WAKA 1AQ1A 2VTHA 3ZO3A 4FNYA 4XG7A 3R1YA 2OIDA 2P3GX 4YJRA 4BGGA 4PP7A 4MWHA 3PXFA 3MH3A 2JLDA 4BKYA 2Y4IB 5IMXA 1PYEA 1UNHA 2XCHA 3R8MA 4JRVA 2G1TA 4FG8A 4FTRA 1OUKA 5EFQA 2GNJA 3FQHA 3ERKA 4CZTA 3UZRA 3UVQA 4JBOA 4IFCA 1ZOHA 3EN9A 3OZ6A 3BHUA 3AMAA 3DAEA 1PHKA 5HOAA 4FEXA 5FUTA 4ANSA 4O0XA 2DQ7X 5DVRA 3R9RA 5L8JA 3Q4UA 2F4JA 2BROA 1NVSA 3NRMA 4L3LA 4RPVA 4CNHA 5E7RA 5KO1A 3C4FA 3PUPA 2XKEA 2YITA 5HICA 3OS3A 3OW3A 3NLBA 3PA4A 4DT8A 4FTCA 1UU9A 4YJOA 3BGZA 3U51A 5KMOA 1G8SA 5TKDA 2R7BA 1VEBA 3NYVA 2R3OA 4ZTHA 3CC6A 4FTQA 2GS2A 2ZM3A 3PG3A 4KD1A 2ONLA 4HCVA 5FM3A 1BI8A 2PMLX 4AZEA 4FEQA 4ZTQA 5AV1A 3E3BX 3VQUA 4ANNA 3FPQA 5C8NA 3TZ9A 3L1SA 2BILB 3PJ1A 3GU6A 3LMGA 2X8IA 3RI1A 2I40A 3LAUA 4R3PA 4JAJA 5D1JA 4OBPA 2CKEA 2QNJA 2RFEA 4FKWA 4I0RA 4Y72A 3UIXA 1SYKA 3FLSA 3HUBA 4ANMA 3IONA 2RG5A 5LWMA 3TM0A 3PSBA 1VYZA 1Y57A 2PUUA 2CNVA 2OBJA 4A9TA 3RWQA 3CQUA 5I9ZA 3GNIB 1CKIA 4JOAA 5AWMA 5J9ZA 2IVVA 3HUCA 1YRPA 4AZVA 4MH7A 2VWUA 1P2AA 2VX0A 1A9UA 5M56A 4QQ5A 3VNTA 5ANDA 4ENXA 1ZY5A 4BDDA 4CMOA 5KMMA 5DEYA 4ASZA 1BL6A 3BWJA 2YCFA 3QZGA 1OL2A 4AOTA 4EZ5A 5D12A 3PP1A 2VTQA 1YQJA 4O6EA 4JQ8A 4HVSA 2HZ4A 5A4EA 3ODZX 4PMMA 4DITA 3KL8A 3FZSA 4ITIA 2ZV8A 3COKA 3VRZA 3EYGA 3RK9A 4MHAA 5K3YA 4HNIA 4YURA 3KQ7A 1XBBA 4EOQA 3ZHPC 4BDGA 2G2IA 4CG8A 3BU6A 3IW5A 4F0GA 3UOHA 2R3IA 3Q53A 4BCJA 4APCA 1R39A 3GQIA 3SXFA 5ETAA 4NEUA 5GZ9A 3SQQA 3FMMA 1J91A 4A9RA 2OH4A 3FSFA 4EQMA 5IEXA 4I6HA 1OI9A 3AT3A 3KREA 3T3VA 2O65A 3EQCA 5C27A 2VTAA 3OWJA 3FQEA 3QCYA 3QRUA 4RX5A 2QOIA 1IASA 3LCTA 2WAJA 4C36A 1OPKA 3OXZA 2RF9A 3O7LB 2YZLA 3W2QA 3E62A 3R30A 3W55A 5KNJA 4R1YA 4FUXA 5KCVA 5CVGA 3LFDA 4D9TA 5E8SA 3F66A 2VTNA 2WMWA 4DGMA 4FKGA 3UBDA 3R7EA 3A7JA 3I6WA 1OBDA 4BCPA 4ZJVA 3F5PA 3G90X 4RQKA 3U6HA 2ZOQA 3GEQA 4DH1A 2P0CA 2QKRA 4FKQA 4GYGA 2J0MB 2IVTA 4YHTA 2XZSA 3B2TA 4WSYA 2PHKA 3IW6A 2X8EA 3P4KA 4Q9SA 3QTIA 3O51A 5DT4A 2BFYA 3V6SA 4FA2A 2RGPA 3DS6A 2YJRA 4BWKA 4L00A 2FGIA 4RT7A 4IJPA 1KV1A 3TCPA 3D9VA 5J95A 4FEWA 4DA5A 3PXYA 4I92A 4BKJA 3R1QA 4FG7A 3SD0A 3CJFA 3TNQB 2BKZA 2NNWB 4I6FA 2YM4A 1H0VA 1XO2B 3G33A 1LEWA 5CAUA 1IG1A 4DH3A 3H0YA 4MBLA 4FKVA 4FR4A 4PMSA 3LLAA 2PVHA 3FKOA 3P23A 4MD7E 3AC1A 3H30A 4NM0A 4AXAA 3GT8A 4CMTA 5BUJA 4WO5A 4FV0A 5ETCA 1GIJA 4WG3A 5K0KA 4AGUA 1DS5A 2R3RA 4JXFA 4CTCA 2W9ZB 4BCKA 5KKRC 4BWPA 5CU6A 4JDHA 5C8KA 3NIZA 2J0JA 1OL5A 1SNXA 2WIHA 4PTCA 3QUPA 4UZHA 5L8KA 1MRUA 2HWOA 5CVHA 1WFCA 5AP2A 3ACJA 2XEZA 3G51A 3UODA 5A46A 2ZM1A 4C2WA 4OAVB 3FI8A 4RJ4A 3DDQA 4XEYA 2CLQA 4RVTA 4CMUA 5JFSA 4FSUA 2YIRA 1XH7A 3PRIA 5J7HA 4W4XA 4EOIA 2BZKB 3RCDA 4ZTLA 3GB2A 4QMSA 3H0ZA 3NNUA 4K6ZA 3TJCA 3V8TA 2VTJA 1YI6A 2NP8A 2Z7SA 3FI3A 2XNGA 4OGRA 4YC8A 4EKLA 3WF8A 4EL9A 3PRFA 5L8LA 2CHLA 2ITXA 2PZPA 2R3JA 2OO8X 2VTTA 2FSTX 4J7BA 5E8TA 3OEZA 1WBVA 4UMRA 3SX9A 3BHYA 1ZRZA 2BCJA 1O6LA 3L8PA 2JKKA 1FVVA 2UW3A 3AGLA 5B2KA 5LARA 5CU3A 3FSKA 5KBQA 3HMMA 4BDBA 4O1OA 4RQVA 1WVYA 4ACMA 1H1RA 2HZIA 4IANA 3OMVA 1F5QA 2JC6A 3A62A 3FQSA 3HMOA 2C5NA 3KVXA 4O0WA 2FSLX 4YBJA 5CEOA 2B0QA 2GQSA 4OTPA 4FIFA 3QRJA 5IQAA 4KAOA 4ZLOA 1OM1A 4YBKA 2EXCX 3UE4A 3W2RA 3FY0A 1KOAA 2UVXA 3RK7A 3ZRMA 4EK4A 3IDBA 3ATTA 1BL7A 4Q5HA 4R8QA 2XJ1A 2H9VA 3CS9A 4RVLA 1R0EA 3UP7A 4IX3A 4DEIA 5CF8A 3FXXA 3QQKA 4FVPA 4XX9A 4GKHA 2IVSA 5ACBC 5FDXA 2W1FA 5F4NA 3HRFA 4FKRA 4FSQA 3U6JA 4MBIA 5JQ5A 1CM8A 2FYSA 2AC5A 1X8BA 4RX8A 3GC7A 4QP2A 4HYIA 1URCA 2XBAA 5FP5A 1W98A 4EUTA 4E5AX 3D5XA 3PJ3A 4EUUA 2CCIA 3C7QA 2VWXA 3A4OX 4D4RA 4BCIA 3R9HA 4IX4A 3OEFX 3NW7A 2JEDA 5EW8A 2X39A 3QZFA 3SOAA 5EYKA 5HNIX 5K5XA 3I0OA 1A06A 3C4EA 1RQQA 4RWJA 3SW4A 3O8PA 3EKNA 3QHRA 2CN8A 2VTRA 4L3JA 2I0YA 4AA5A 5IEYA 4C37A 4R3RA 3UTOA 3DXPA 5CENA 2GFCA 3N4UA 2CJMA 4BBEA 1OITA 2WTWA 1W83A 2RL5A 3FBVA 3NMUF 3RALA 3F3UA 5HIDA 4AT5A 3RAKA 2O3PA 4F0FA 4BTJA 5A14A 4FZ7A 4N70A 5CXZA 2GMXA 3TUDA 5EDQA 4ZJJA 5DT3A 3EIDA 3TEIA 5ITAA 5JFWA 4DG2E 3QRIA 3O96A 5C4KA 4QPAA 4JBPA 5AUYA 3B2WA 5CSVA 3KN6A 4KB8A 5AP6A 2QR8A 2WQBA 4FTAA 3MA6A 3R1SA 5HTIA 2JDVA 4JRNA 3W2OA 3AD5A 3S1HA 1QL6A 4IVBA 4V04A 2PE0A 4YC6A 2OF4A 4ZLZA 3OP5A 5AUZA 3U9CA 4QTEA 2CKPA 1LPUA 4UWBA 1M14A 1KE9A 1OIRA 1UU3A 3E92A 4O38A 4O91A 3GOPA 4U43A 1XH4A 5AAEA 4BDCA 2R2PA 2O5KA 3ZEWA 4O7NA 4ACGA 4LOOA 2VWIA 3PFQA 4FZAB 1H01A 4OT5A 4F9WA 3KRXA 3R7YA 4IQ6A 3FMEA 3DNDA 4AN2A 3TUBA 3E93A 2AC3A 3FYKX 3ZO2A 3FI2A 4KBCA 1PW2A 4ZEGA 2XNOA 2IW8A 4AT3A 2Y9QA 2JDRA 3DBCA 2WMSA 5KUPA 4WOVA 3OVVA 1SMHA 3P0MA 1SZMA 4Z16A 1G8AA 4X3FB 5AP1A 3AC5A 4CYIA 5JKGA 4FNWA 5CU0A 3QQGA 2XUUA 5DWRA 5BYLA 4P90A 3LPBA 3QX2A 2UZTA 3IW8A 4AFJA 3U55A 3QGWA 4I23A 3FZTA 3QZIA 3R01A 2EWAA 4ERKA 4IAFA 4HGSA 3VRYA 5EI2A 4A07A 1NY3A 5DLSA 4BCQA 3E63A 2YWPA 4E5WA 2W1EA 3WOWA 5DGZA 3AMBA 3FMNA 5HO6A 3MPAA 2FVDA 3FXWA 5KMKA 2ITZA 1WBOA 3FLQA 4MNEA 2QKWB 4MX9A 5ETIA 4RIYA 1STCE 3PPJA 3UC3A 4C57A 4E93A 3OBJA 3R0TA 4D1SA 4WSQA 5J7BA 2J6MA 2OI4X 4BHZA 2QOLA 2X4ZA 3E8CA 3F3ZA 3OY1A 4YLLA 3A99A 4QD6A 3NS9A 2HENA 4XOZA 4HJOA 5AX3A 1LUFA 4FSNA 5H3QA 4N0SA 4QP1A 3AGMA 5IUIA 3UMWA 2LAVA 4DN5A 3FEGA 3MWUA 4JNWA 3CKWA 2WMXA 5JGBA 3KXNA 2OXXA 5AIRA 4FIJA 5H8EA 3MPTA 4FG9A 4H39A 4WA9A 4PPCA 3NYOA 2CMWA 3K3JA 3FMHA 3R8LA 3F3VA 3LJ1A 3COIA 4E3CA 3GQLA 1ERKA 2XNPA 3PY1A 3R2BA 4DFLA 4TPTA 2IZTA 4PX6A 3E7OA 5IDNA 4R5SA 5TT7A 4ZJIA 3TJDA 3UQFA 3UPZA 1H24A 3LJ0A 4XG6A 3DJ7A 5J5TA 2CDZA 4AW2A 1NW1A 3DT1A 4FV9A 2V22A 4AU8A 5C4LA 2F2CB 4J96A 4AN9A 1F3MC 1OB3A 3DDPA 4H1MA 4UX9A 4ZIMA 3EQRA 4BCOA 2WZJA 1YI3A 4OTHA 4CKIA 4UMUA 5CAPA 4CGAA 5I9VA 3BI6A 3GUBA 2HZNA 3FL4A 4H58A 2VUWA 4IM3A 2ACXA 5DE2A 1PYXA 3PVGA 3IDCA 2KTYA 4XV9A 5ETFA 3D83A 4R77A 4GT4A 3QKLA 3TL8A 3VS3A 2R64A 4N57A 4GFGA 4LYNA 4X2NA 4ASXA 1LR4A 3M11A 4BVUA 4BCMA 3W2CA 3GCQA 4MXAA 4M8TA 2XK3A 3ENHA 3FAAA 2O64A 2QVSE 2XK8A 1XWSA 4K77A 5LMBA 3PY0A 4AE6A 5EKNA 3VBQA 3A7HA 3FMLA 3U6IA 2YDIA 4JLCA 3R9OA 3F2RA 1BI7A 4FUYA 3PZEA 2UVZA 3N4VA 2BTSA 2ZDTA 4D4YA 5E8YA 2A19B 1NA7A 4U3ZA 2HIWA 3WZDA 3G9LX 3UYTA 4IIRA 3COMA 3R00A 4AA0A 4MVFA 5CF5A 1YHVA 3UO5A 5BVWA 3ULZA 1ZZLA 2HWPA 1UVRA 3ZS5A 5A54A 3PXQA 2QOCA 1VZOA 3DFCB 4MYGA 4BRXA 1JKLA 4AGDA 3RK5A 1S9JA 2OJGA 1OMWA 5E8WA 3QQJA 5HHWA 4I6QA 3PLAE 4GKIA 4BR3A 3KRWA 4FEUA 3C0HA 2BDWA 2C5VA 3DTCA 3DKCA 4IX6A 5HZNA 5K4JA 1M17A 2RG6A 3OCSA 5LQFA 3MY1A 2W06A 2GU8A 2PVMA 3R83A 3MI9A 1R0PA 3Q2JA 1V1KA 4KKEA 4MNEB 5AM7A 3WYXA 3DB6A 4A9UA 3FL5A 2J9MA 4GW8A 5BYYA 3MJ2A 3R1NA 2YLFA 1YXXA 4F0IA 4H3BA 4ZMFA 4JL9A 5EQEA 4AZFA 1JKKA 1H08A 4K9YA 3UP2A 3BV2A 2HY81 4C58A 2X2LA 4P4CA 2BZHB 4ID7A 5AV2A 4DF3A 3QCQA 4D2PA 2VNWA 2VU3A 2ITYA 4JR7A 3BWFA 4S30A 2DWBA 4MWIA 3R8PA 3U9NA 2Q0NA 3GFWA 3I4BA 4GFMA 2R4BA 3ETAA 1CKPA 4D58A 2YCRA 1Z57A 2EB3A 4EORA 5CANA 3QTZA 4D2TA 4YZDA 2GNHA 4RLKA 3S4QA 2VTSA 1ZAOA 4WUAA 5CQWA 4EOJA 3P5KA 1KE7A 5AP3A 3I0QA 4BCNA 3EQIA 1L3RE 2R5TA 3LCOA 4PMTA 3VBWA 4L45A 2G01A 3ALNA 3TDVA 5CSXA 3UO4A 3B8RA 3OY3A 3SG9A 4MD8E 2VNYA 2A27A 3JXWA 3GXLA 5E8UA 4NCTC 3TZMA 2VGPA 4O0UA 3OCGA 3QD4A 4J95A 2W5HA 3ZDIA 5LJJA 5IA4A 4BBMA 4ALUA 3VBXA 5I0BA 3KA0A 2GFSA 4BCGA 3KXZA 4XG4A 3BYVA 4IC8A 2Z60A 1OIUA 4ACCA 5IQGA 3DA6A 2ZV2A 3NUUA 5JRSA 3BZ3A 2UZVA 2R3FA 2VWVA 2XRWA 4IADA 4Y95A 5LVLA 3RMFA 4PL4A 3HV3A 3RHKA 2OIBA 3ZONA 4BFMA 1WVWA 1E9HA 4O7SA 3ZFXA 4TWOA 5LVOA 1Q97A 1Y6BA 3E7VA 4PPAA 4D1ZA 3LFAA 5FXSA 4X2GA 5KHXA 3N4TA 4J71A 5L6OA 4FV6A 2OLCA 2VX1A 4L8MA 3ZCLA 3TKHA 4XP3A 3DCVA 5M55A 4RSSA 4KIKB 3KRRA 5E9EA 2PVFA 1W0XC 2OH0E 3MVMA 1Q4LA 3EQPA 5HU3A 2YJSA 1J3HA 3CGOA 2RKUA 1B38A 3WYYA 5T68A 3UPXA 3RINA 3UOLA 2XEYA 3FLWA 3QKMA 2VWWA 4GK2A 4U97A 4AZSA 2F7XE 1J1BA 4RA5A 4ZTSA 2WMVA 2J4ZA 3EMGA 4F9BA 3NW5A 1W7HA 3MH2A 4F9AA 2NRUA 4KUJA 4BDHA 2VGOA 4O7TA 4II5A 4Z7HA 1UWHA 4QYYA 5HIEA 2OK1A 1ZYDA 2XNMA 5BVFA 4NWMA 4AQCA 5EYMA 3F5XA 4OTGA 4CT1A 4JIKA 3I7CA 3I5NA 2C0OA 3AT4A 4JT3A 3MA3A 3KMMA 4FV3A 4A4LA 1PMNA 3DKGA 4FTIA 4P7EA 2OF2A 4DGGA 3KXHA 3QQHA 4X21A 4IBMA 3LQ8A 3EB0A 5EQPA 5K4IA 4FV2A 5DHJA 3U54A 4FKLA 2V7OA 5IUGA 5DR6A 2WTKC 1FVRA 3LE6A 4JR3A 1U54A 3OOGA 3TIYA 5AADA 4HCUA 2UW0A 4IB3A 3ZEPA 4IVCA 2GQGA 1ZZ2A 3QLGA 3ZLWA 5CEQA 4D2VA 4FTTA 3NVKI 5BPYA 1APME 3D7ZA 1Q61A 4MD9E 1PF8A 4RFMA 1M7QA 4E5BA 4GFOA 4XCUA 2HXQA 3CLYA 3F5GA 5LXMA 4QMOA 5LVPA 2IZSA 3II5A 4L46A 3NCZA 4OBQA 5DI1A 4C3RA 3VC4A 4HGTA 3ZH8A 3ZO4A 4D2SA 5AUUA 2B54A 2GTMA 2HAKA 4QT1A 3TTIA 4BYJA 3D5VA 3JY0A 1Y6AA 5EM6A 3SXRA 2JBPA 4U44A 4M66A 3UGCA 5HX6A 1KV2A 4K1BA 5DYJA 4E8AA 3ZSHA 3MIAA 3NDMA 2QG5A 3QTRA 3ZM4A 4DYMA 5HTBA 2YCQA 1R3CA 4IM0A 3KFAA 5AV0A 1JSUA 3ZSGA 2W96B 2YISA 1GJOA 1Q41A 4G3DA 3EKKA 3LFBA 4XG3A 3ZUUA 4CQGA 5CU4A 5HLNA 4TYEA 3ZUVA 4IE9A 3QYWA 3G6GA 3K5UA 4FBXA 4W9WA 2W4OA 2PZ5A 1KUTA 2XNNA 3KXGA 4G3FA 3D5UA 4BN1A 2WU6A 1K3AA 5HESA 4CLJA 4DGNA 4EBWA 1H27A 4AACA 3D0EA 2JAMA 3IOPA 3WIGA 5K5NA 3D2KA 4D4SA 4APPA 4YTIA 2FA2A 1XH9A 3W8QA 3O23A 3O17A 4NTSA 3SXSA 4MTAA 2GHLA 2E9UA 3MFRA 2PY3A 2XM8A 3I7BA 4QP6A 5EM5A 2EXMA 4AN3A 4EEVA 5A4TA 2C30A 3ZTXA 3ET7A 5J1WA 4ZY5A 3KC3A 3Q6WA 1OGUA 2X6DA 5HO8A 2WTCA 4W8DA 3DXQA 4FK3A 3LFSA 1KWPA 3PE2A 1YWRA 2B1PA 4FGBA 1XJDA 1Q5KA 3QA0A 4PQNA 5I3OA 3UC4A 3ZXTA 4P5QA 4PY1A 3ROCA 4DBNA 4BIEA 2YM5A 4WD5A 1YOMA 3GFEA 3GCUA 1O9UA 5HE3A 5CAOA 4FTJA 3EN7A 4PPBA 5IQFA 4I5HA 5GZAA 2HOGA 1CMKE 4GU6A 2C0TA 4K8AA 5L3AA 3PJCA 3NPCA 5BMSA 2QOOA 4P2KA 4YUQA 4R78A 2B9JA 3U8WA 1MUOA 1FINA 2QI8A 2Y0AA 3IGGA 3SV0A 4EOKA 4RC2A 3HEGA 2X6EA 5KHWA 5M09A 4AF3A 5J9LA 1L8TA 2O8YA 3FV8A 2UW7A 1YI4A 3EZRA 2DUVA 1AD5A 3F2NA 3HGKA 4EHZA 5KBRA 2EB2A 1BKXA 3R7IA 3LM5A 4JBQA 3L9MA 4W4WA 3SA0A 5JFXA 3S2PA 4PTGA 4U7ZA 3HMNA 1Y91A 5EM7A 1FBNA 4FKPA 5HLPA 3UO6A 1U54B 2OFVA 1RDQE 4EWHA 2BDJA 3AD4A 3BQRA 4A4XA 4DT9A 4YC3A 3C4CA 3R8UA 4JIAA 3TKIA 2VO6A 2VX3A 3F5UA 4FC0A 4OTWA 4IB0A 3M42A 3MJ1A 5BUEA 5GIOE 4GV1A 2X7FA 4RJ5A 3WZUA 4G5JA 5KMJA 4QOXA 4FTKA 2YAKA 3PA5A 1PXJA 2ITQA 5AAFA 5LCJA 3R63A 4FKJA 4EC9A 2VTPA 4F9YA 3IO7A 4D55A 4G3GA 1DI9A 5L2IA 5J5SA 4MF0A 2G15A 1F0QA 3CXWA 2W1GA 5DPVA 5I9XA 5CQUA 5E8XA 5LMKC 4IVDA 5AUWA 3NAYA 3OXIA 3QF9A 4OTIA 4QP9A 3D5WA 3MFSA 1U5RA 4KNBA 4QTAA 4RC4A 5EW9A 4ENYA 4YSJA 4O0YA 5HVJA 3KY2A 4CFUA 4M12A 4YMJA 2WTJA 3T8OA 4IDTA 3WILA 2F7ZE 4HPUE 4C2VA 4EQCA 4ANQA 4FV5A 4LL5A 3OWLA 2ETRA 3POZA 4I94A 4MNFA 5F94A 4BBFA 4TKSA 4BF2A 3GC0A 2IN6A 3DU8A 5D7VA 1H26A 4CD0A 2QQ7A 4TXCA 3T9TA 4BYIA 2X1NA 2PUPA 4W8EA 3BYMA 3OWKA 4G1WA 1MP8A 2UUEA 5HG7A 5HEZA 5EOBA 4E6CA 2SRCA 3QC9A 3AT2A 4BZOA 3HDNA 3LZBA 2XKCA 4X3JA 3QTUA 3K3IA 3ZRLA 3RKBA 5JH6A 5CI7A 3NEWA 4J8NA 4S2ZA 5CF6A 3ROYA 3BKBA 3LLTA 3W1FA 1ND4A 5HCZA 1OBGA 5CNNA 2UV2A 3QUDA 4LI5A 3COHA 3D14A 4JDKA 4NK9A 3MW1A 3PIYA 5EYDA 3DPKA 2Y6OA 4BIDA 2X9FA 4OAUC 1W84A 1Q3WA 4L3PA 2OG8A 3DZQA 4HYUA 4R1VA 3ZXZA 4CQEA 4O86A 5JGAA 3RAWA 2JAVA 2UVYA 2ONLC 3F2AA 3FLZA 5BMMA 3CD3A 2YWVA 2CPKE 3GBZA 4RX7A 5CZIA 2VWBA 3MPMA 3BBTB 1H1SA 2JITA 3CIKA 3GU5A 5CSPA 3K54A 4AT4A 3ZSIA 3MH1A 2J0LA 2YA9A 4EK5A 4ZTRA 3RNYA 3DQWA 3UG2A 3A8WA 4E6DA 4NZWB 3EHAA 5LVNA 1GZNA 2PULA 4KIPA 3Q9WA 3S95A 5IZFA 3BLHA 3CBLA 3OCBA 4NJ3A 3E8EA 3MB7A 4FKUA 2CGWA 5KZIA 3UQGA 2A1AB 2EXEA 2CCHA 4JJRA 4RVMA 1XH5A 1YHWA 3ANRA 1QPDA 3UIBA 4S31A 4EBVA 4X2KA 4GG5A 5CLPA 3TV6A 3PG1A 2WO6A 4HYHA 3LQ5A 4WKQA 2ZYBA 3C4ZA 3R7OA 2XJ2A 4O0TA 5IG1A 5M07A 4AW5A 3FJQE 2ERZE 4J99A 4O22A 3ORXA 2WOTA 3C0IA 4G9RA 4JG6A 4FSTA 3NUPA 5EOLA 2GPHA 4X2FA 5BVEA 3UVPA 5EH0A 1UA2A 3PXZA 4DFYA 1URWA 4E4XA 3UNKA 2P4IA 4EH2A 5D41A 4MQ1A 2OW3A 4GU9A 5FQDC 2ZB1A 5E8ZA 5AUTA 2XK6A 4EH7A 4C34A 1WMKA 5HNBA 2C6LA 4I93A 1OKZA 3JYAA 4AZTA 5DIAA 3GVUA 3KVWA 2Z8CA 3KF4A 4H3PA 2QHMA 4FSMA 3MBLA 2WEVA 2IZRA 4GUEA 3UVRA 3VS5A 1WZYA 4RZVA 2Y7JA 3V5WA 2H96A 3VULA 3DK3A 4TYGA 2PYWA 1UU7A 4U9AA 3RM7A 2CKOA 3TIZA 4IWDA 1WBWA 3V5TA 2ERKA 2YLEA 3NAXA 1BX6A 3QQFA 3PTGA 2ZB0A 5T6KA 2JIIA 3GCSA 4RMZA 1H25A 4O0SA 3PLSA 4M7IA 3KMUA 4EQUA 4IZ7A 4X3FA 2B4SB 3ALOA 4UN0C 2OIQA 5HVYA 4JDJA 4YJQA 2B53A 3MDYA 2Z7QA 5FEEA 2GNFA 5HE0A 5KKRB 3LVPA 4LRKA 2PVYA 2W1IA 2VWYA 3REPA 3VW6A 1ZOEA 3QD0A 2C0IA 2F2UA 4IH8A 3V5LA 3VIDA 3ZO1A 1IAHA 4ASEA 5ANGA 4NL0A 3ZLXA 3Q5IA 1ZMWA 1ZXEA
chains in the Genus database with same CATH superfamily
4C61A 4LUEA 4F99A 3KMWA 5AR8A 3V8WA 5FG8A 4BB4A 4FV7A 4N6ZA 5KZ0A 4EOSA 4QMTA 1WBTA 4IZ5A 4E4LA 1DI8A 4U41A 3VJOA 3RAHA 3QL8A 4DHFA 5EHOA 5CF4A 5AR2A 3OD6X 4AE9A 2BZIB 2J0KA 3IGOA 1W8CA 2XBJA 4UWYA 1CSNA 3BU3A 3KK9A 4L43A 3WIKA 1TFFA 2IVUA 1R78A 2PK9A 3NUAA 3R22A 2RFNA 4ALVA 2J7TA 4C7TA 2QHNA 4QMYA 1HCLA 1PMVA 4NW6A 3MY0A 4WRGA 5I9UA 3WF6A 4AW1A 2IG7A 2IPXA 3O5AA 5DN3A 4F9CA 2QOBA 2QOHA 1FPUA 3HNGA 4DEBA 5IPJA 5KMLA 1YKRA 3HLLA 3KEXA 4E20A 2FH9A 3HX4A 2J51A 3IQ7A 4RRVA 2PMOX 5GJDA 2HW7A 3VBTA 3ODYX 4NM7A 5IA0A 3BEAA 1RW8A 4H05A 1TKIA 3HMIA 5DRDA 2WGJA 1EH4A 2XK4A 3HAMA 3VS0A 5CT0A 5D11A 4R5YA 3TACA 2C3KA 4E73A 3QQUA 4GJ2A 4DH8A 3I1AA 3RM6A 3UYSA 4I6BA 3IECA 4F7LA 3CTQA 3O7LD 3LFQA 2IW9A 1YXVA 4HVIA 1M2QA 4QQTA 3HYHA 2GS7A 4TTHB 3A8XA 4NKAA 4OBOA 4UXQA 3A7IA 3H9RA 3P79A 3FYJX 4EH5A 2QODA 5AR3A 3TNWA 3ZOSA 4MQ2A 3GGFA 2V7AA 3QQLA 1W2CA 4IB1A 4DE4A 1VR2A 3A60A 3FC2A 5IUHA 2I7QA 5J8IA 2WTIA 3RJCA 1U46A 4FIGA 1RE8A 1I09A 2C6OA 2HK5A 4IWPA 3D94A 3K5VA 3FMJA 4GRBA 3OT8A 4YZMA 4ANBA 3LFFA 4G17A 2VO0A 4E6AA 3JS2A 4ZAUA 3BX5A 2F7EE 4AXEA 2X0PA 4FVQA 5DFPA 3EQFA 3G0EA 2XAMA 2YAAA 3ZZWA 3VHEA 4C4GA 3UIMA 2X2MA 2VAGA 1J7UA 5EK7A 4D2WA 2YM8A 1Q99A 3G0FA 1OL6A 2YEXA 3PJ2A 5BVOA 3DLSA 3Q4TA 5FTQA 5JEBA 1QPCA 2UW5A 3PIXA 3BE2A 4PWNA 5F1ZA 3RPSA 4FSRA 3SG8A 3BBWA 1MQ4A 1OPJA 2BR1A 4FSYA 4X6RA 4UB7A 3PUFC 5EYCA 4RG0A 3I79A 3C51A 1BUHA 5DMZA 1YDTE 3QD2B 4QMUA 3AD6A 2J5FA 3HAVA 4CCUA 2WQNA 2NO3A 1YDRE 4Y8DA 1G3NA 2HZ0A 3RNIA 4ZSEA 4S33A 3SKCA 3VJNA 4YJNA 2BFXA 2RFSA 4E4NA 4I5PA 4O27B 3MB6A 5D7AA 1LEZA 4FZ6A 5I9WA 1IA8A 2X2KA 2ZDUA 4O2PA 3DKOA 2J2IB 2CNUA 3AXWA 2EU9A 3MVJA 3VHKA 2VWZA 1IAJA 5DT0A 4LOPA 1REKA 3GOKA 1FMKA 3RPYA 4F4PA 3W8LA 4DFNA 3R7VA 3PPKA 5M44A 4AQKA 4ZTNA 4AOIA 3TNHA 1TZDA 3OC1A 4DFZE 1OVEA 2Q0BA 3ZRKA 2XK7A 2AYPA 3P7AA 3W10A 4BICA 5CAQA 3WARA 4YO4A 3EFKA 4FSWA 1ZARA 1KE8A 3ZLYA 1KE5A 4QMLA 3HV7A 2JKMA 3I5ZA 3W32A 3IPHA 1WBSA 3EQHA 3FPMA 4YJSA 1XQZA 1KSWA 2FUMA 3TI1A 4B9DA 1XKKA 4I0TA 4TYJA 4DEEA 5FD2A 5ANKA 4PDOA 2GHMA 5B0XA 4XMOA 2YM7A 5AIKA 1FQ1B 2UZOA 3AQVA 5HBEA 4HVGA 4C4IA 3F9NA 4AW0A 4BIBA 3VUDA 3ZC6A 4Z3VA 2WFYA 4QYHA 4IXPA 3R73A 4AAAA 4CZUA 3E8NA 4GK3A 1OKVA 2UW4A 3CQWA 3KCKA 4I0SA 3QGYA 4BI0A 2XALA 1ZYSA 3H9FA 3WZEA 2W7XA 5BQ0A 3L8XA 3CTHA 3OCTA 4TWNA 2BAKA 4E6QA 4BTKA 3NSZA 4MEDA 2BIYA 2W5BA 3BELA 3KULA 3QBNA 4ZZNA 2PL0A 3H9OA 2XM9A 4GS6A 3PDTA 5M08A 5EDRA 4W4YA 4YJVA 4ANLA 3DTWA 2B7AA 5FDPA 4LFIA 4I1ZA 3UZTA 4GL9A 5IQHA 4XV2A 3ITZA 3EWHA 4LV7A 2W1ZA 4ARKA 4OW8A 5CWZA 4U79A 1ZWSA 4PUZA 2YERA 2YM6A 4C35A 4V05A 3QRKA 5ANJA 2W05A 3CD8A 2GNLA 3EN6A 2H34A 4DGLC 2ZMCA 4FIHA 2R3LA 4HVHA 4J53A 4XV1A 4F08A 4MBJA 5CSHA 3VBYA 3LJ2A 4IJ9A 2ZAZA 4KIKA 4RZWA 3SAYA 1V0PA 3QTWA 3FE3A 5ACKA 2HCKA 3DB8A 3FUPA 3NGAA 4A7CA 5C26A 3ZLSA 3A4PA 5KMNA 4KSQA 4HPTE 5HVKA 4EONA 4O96A 1Q62A 2P55A 4I5CA 4YP8A 4GMYA 5CEIA 4QMMA 4YZNA 4TW9A 3DAKA 1SNUA 3L9LA 3NNXA 4RIOA 5EKOA 3E64A 4XH6A 4USEA 3A7GA 4BJJA 3MFTA 2XRUA 3DQXA 3THBA 3IW7A 4BC6A 4TRLA 3TG1A 1GY3A 3P7BA 4EJ7A 5HO7A 3DAJA 4G6NA 2V62A 5IISA 4Z7GA 4XS2A 1OZ1A 5ICPA 3P86A 1IRKA 5L2QA 3GP0A 4UV0A 5GIPE 4QMVA 4EH6A 1TQPA 4QMNA 2ETMA 1OIYA 3ML1A 4EKKA 1YXUA 2WKMA 4C59A 4RJ3A 4JQEA 4PMPA 3FWQA 4XOYA 3GENA 3S3IA 2GCDA 3UMXA 5H8BA 3BYOA 4C4FA 3Q9ZA 4EOPA 1JBPE 1XBAA 4BDJA 3ATSA 4ERWA 2W5AA 5CI6A 5IQDA 3QTXA 4L42A 5IF1A 1OL1A 4LL0A 3UJGA 3P7CA 3QU0A 4F65A 2GDOA 5AP7A 3KRLA 2R3KA 2X7OA 1QPJA 2XA4A 4FTMA 2BDFA 1YOLA 4R7BA 5JMSA 3VS4A 2AQXA 5AV3A 3RWPA 3JR1A 4DCAA 4GJ3A 4FK6A 2HY0A 3ORKA 5EI8A 4F1TA 5DR9A 3BQCA 3G5DA 3KB7A 5IA5A 2OSCA 2DYLA 2JGZA 1FMOE 2QR7A 2V55A 3BLQA 4M84A 4QYEA 3VF8A 2C1AA 4CRLA 1PXMA 5BVDA 3R28A 4D0XA 5CEKA 3KGAA 1FGKA 1E1XA 1YWNA 4AXFA 4NW5A 3P08A 2W1HA 3ZYAA 4B6LA 4HW7A 2VV9A 3C1XA 3E8DA 4GEOA 5LMAA 4I20A 3VUGA 3I81A 4U6RA 4XHKB 4EH8A 3O8TA 5AX9A 2R3GA 3R2YA 4XRLA 5C9CA 3VO3A 4G5PA 3BLRA 3QKKA 4QMQA 2C3JA 2WELA 3DBQA 3SW7A 4X0MA 2UZEA 3JPVA 3LXKA 4DG3E 2WMBA 5E8VA 4KS8A 1V0BA 1K2PA 2CGUA 2JDOA 4KINA 3KULB 5T3QA 1TVOA 4QMZA 5CVFA 4CKRA 3PXRA 3CPBA 2ITNA 3FZ1A 4O1PA 3VN9A 4DINA 3DJ5A 4FZFB 4IB5A 3LKMA 4P5ZA 2J5EA 4MXYA 1XBCA 4C4JA 2BRBA 3MTFA 3TMOA 1M2RA 3CE3A 2JKOA 3BGPA 3TXOA 3EL7A 1NT2A 1P4OA 4A9SA 2PUNA 4ACDA 4IW0A 5DA3A 4L53A 4F09A 2H8HA 2F57A 3ORPA 5JRQA 4DG0E 2I1MA 4DDIA 2R3QA 2C6IA 3NYNA 4L44A 5JZJA 2QU5A 3UIUA 2WMUA 3NW6A 3OBGA 4QMWA 3TUCA 2WMRA 1QCFA 5JT2A 2C5YA 2XIYA 4FT7A 4PDSA 2C6TA 3PE1A 3P78A 1W2DA 3EN5A 4QP7A 2WQOA 3ANQA 4BDAA 5JZNA 5CEMA 1A48A 1ZMUA 4QQCA 3T9IA 3W16A 4WRSA 4U3YA 3MV5A 1DAYA 4XP0A 4O7RA 4YTCA 4FEVA 1UWJA 4FT9A 3NCGA 2XKDA 4CFXA 3MIYA 3L9NA 3WZJA 5B7VA 2PU8A 4B8LA 2XMYA 1FVTA 3UQCA 4WBBB 2Y8OA 5HIBA 5DH3A 3V6RA 1RJBA 5HE2A 5IH6A 3OF0A 3OW4A 4L67A 4DC2A 3JVRA 4XG8A 1WVXA 3FHRA 3S0OA 2X7GA 4EH3A 3AC2A 3W0MA 3GU4A 4KBKA 4WUNA 3NIEA 4ZSJA 2PTKA 3QZHA 1DM2A 5CALA 3EYHA 4O82A 2OJFE 4QTDA 3Q32A 3PJ8A 1GNGA 4K33A 2I0HA 1J1CA 5M4IA 3L8SA 3ORMA 4OTRA 2IO6A 3ZBFA 2I0EA 2VTIA 4UXLA 4BCHA 4IAAA 3DNEA 4HYSA 3FDNA 3GCPA 4YHFA 4KIOA 4CEGA 4YLKA 3QTSA 1QPEA 3M1SA 3PY3A 4HCTA 4IZAA 2WPAA 5CY3A 5L6WL 1T46A 5E4HA 4OTFA 4LM5A 4EI4A 3MN3A 4S34A 4UYAA 3AC8A 1ZY4A 1PXKA 2YHVA 2I0VA 3UOJA 5HBHA 2R3NA 4QRCA 3LXNA 2XIZA 4DHJA 3EFLA 4E7WA 5H2UA 2XIRA 4CKJA 4EOOA 2BRMA 4DH7A 4QYFA 4N6YA 3W2PA 1JSTA 2OZAB 3TT0A 3V5PA 1H00A 2Z2WA 3R7GA 1U59A 5AUXA 2Y4IC 4B4LA 4R7IA 1NXKA 2QOFA 1P4FA 4ZMEA 4C4EA 5C1QB 2WMQA 2ITVA 4K18A 2W1CA 4PL5A 5IA1A 4YPDA 3DXNA 5A3XA 4GVJA 1YXSA 4RX9A 4ZK5A 2WTKB 3PWDA 4F6SA 1B6CB 5HNGA 2XVDA 4WNMA 2CNQA 5HD7A 3NNVA 5FBOA 1BMKA 3ACKA 1ZMVA 4RIXA 3LIJA 4YJTA 1OIQA 2X9EA 3MFUA 4GVAA 1G8KA 2CGVA 3LCDA 4ZS0A 5IU2A 4RIWA 4FL2A 1VJYA 2B9FA 3H10A 4FV1A 2KULA 2PZRA 3EJ1A 5ANIA 1BYGA 3ZDUA 3ZZEA 4UBAA 2O2UA 4QP4A 2B52A 3OG7A 3CY2A 1J7IA 3NX8A 1YDSE 4RWLA 3FC1X 3OUKA 2XNBA 5I4NA 4BI2A 2W1DA 4IMYA 4YLJA 1H8FA 5F20A 4B0GA 4V01A 4DTKA 3LXLA 2J50A 3VF9A 4LRJA 4U80A 2HW6A 5ANOA 4DH5A 5M4FA 4RFZA 4HNFA 5FXRA 3Q3BA 5I3RA 1XH8A 2XB7A 3G6HA 5LCKA 4CFVA 2VO3A 2BPMA 1PMUA 1ZLTA 3ORNA 2WOUA 4ZOGA 2R9SA 4FNZA 3R21A 2ZM4A 4I22A 2IJMA 2G2HA 4M67A 4F6UA 4DFBA 5TR6A 1SVHA 2CKQA 3HA6A 3TTJA 4L7SA 5A4CA 2V5QA 5HGIA 5TE0A 3SHEA 3U4UA 4RLLA 3C5UA 4BWXA 1JKSA 5B2LA 3AMYA 3KK8A 2YIQA 4ZLYA 4DBXA 1UKHA 3QD3A 4U81A 1ATPE 2F49A 4PL3A 3TWJA 2NRYA 3PSDA 4FYNA 4AX8A 2OJJA 3BHTA 5GHVA 3RTPA 3BCEA 4J97A 5CU2A 3VVHA 4CSVA 3SOCA 3D2IA 3DY7A 3HRBA 5BYZA 3NYXA 3VBVA 3CPCA 4G3CA 4S32A 3VW8A 4BL1A 5A6NA 1PXNA 2QLUA 1T45A 2YACA 3KF7A 3DBFA 3GU8A 3OTUA 2BUJA 4TN6A 4ZZOA 4FX3A 3CKXA 3PA3A 3C5IA 1PRYA 5TO8A 2OFUA 1JKTA 3W18A 2GHGA 3VUMA 3NVMB 5BX0A 4J8MA 4IAKA 3TYKA 3UZPA 3HL7A 4CXAA 3H3CA 3P9JA 4DEAA 4QMXA 5AUVA 3VS2A 4IAZA 3OHTA 4GT5A 4C62A 5G6VA 3V5JA 3CCNA 2R0IA 2EUFB 5AAGA 3AC4A 4ZY4A 4UALA 2DS1A 2J0IA 4BY9E 3OT3A 3V04A 2ITUA 1ZYLA 3TNIA 1VYWA 3D4QA 3PYYA 1H4LA 1NVRA 4UMQA 4EHVA 4GYIA 4D2RA 1YOJA 2WTVA 4EYMA 3SGCA 4ASDA 4RVKA 4DLIA 3NUNA 4YNOA 5L2TA 4QP3A 4WG5A 2BRHA 2WU7A 4FIEA 2YIWA 2HYYA 3Q2MA 4FL3A 3JVSA 5AJQA 2B55A 3Q52A 2HXLA 4EHEA 3HVCA 2PVLA 5EHYA 2ETKA 4IM2A 4KIQA 5DNRA 2UZUE 4C02A 5A6OA 4GSBA 4D28A 3EFJA 1OL7A 2W4JA 3NUXA 4RIXB 4MF1A 2GNGA 2XP2A 3SC1A 2WB8A 4W9XA 5IKWA 1GZ8A 1PXOA 3F69A 5EI6A 1GOLA 4RIWB 4FTOA 3QXPA 3TZ7A 5EW3A 1UNLA 4L52A 2QU6A 2PPQA 4G34A 4M69A 4KWPA 1JSVA 4UEUA 2YCSA 1XH6A 1OKWA 2VTMA 4EK6A 3ENMA 5CT7A 4Z9LA 4JX3A 1Y8YA 3WE4A 4BHNA 4LMUA 4TWPA 4W4VA 4NU1A 3BV3A 1H1PA 4XRJA 4F1MA 1PXIA 3V51A 2F9GA 4F63A 4J98A 3GI3A 2X8DA 3LFEA 3IK3A 5AP0A 3W0QA 4AS0A 2B9IA 4D1XA 4PNIA 1WBNA 3PSCA 4MXOA 4XLVA 2AUHA 4V0GA 4ZSLA 3BGQA 4L7FA 3WF5A 3GC9A 2NYAA 4G31A 2C5XA 4ITJA 4NM5A 5DEWA 5AR4A 3VUHA 4AFEA 2UW9A 4YU2A 2C47A 2XYNA 4J52A 4C0TA 4FT3A 4IHPA 3R8VA 4HVDA 2QG7A 3BHHA 4GCJA 2WQEA 5CYIA 5AFVA 5H9BA 2WHBA 5HKMA 2UZDA 1YVJA 1UV5A 3LMIA 5DRBA 4XBRA 4O84A 5HE1A 1M2PA 3C9WA 3BEGA 2ZV9A 2PZYA 2VTOA 5FTOA 3RPOA 1SVGA 4MXZA 5FGKA 5J1VA 3KXXA 4BTMA 3KU2A 3DJ6A 3DV3A 3FZPA 4IZYA 5AMNA 2BZJA 2P2IA 2ESMA 2OZOA 4KSPA 1PKDA 3FZOA 4U40A 4AG8A 4CVAA 4F64A 4L6QA 2BMCA 3EOCA 4NIFA 3EQDA 4ZTMA 2PVKA 4MKCA 1UKIA 5GJGA 3OWPA 5IMEA 2ZV7A 2Q83A 2PVRA 3CGFA 3UDSA 3V3VA 5IEVA 3DBEA 2ITPA 3FY2A 4FI1A 4QDEA 4I24A 2YZAA 4JDIA 3WF7A 2X81A 4UYNA 4FF8A 4RJ8A 3BYUA 3OOMA 2CGXA 3G9NA 5C01A 2C69A 3CEKA 2J90A 1BLXA 4FMQA 4CT2A 3LHJA 5IDPA 4NT4A 3B8QA 5JFVA 2RSVA 2C5OA 4FV8A 3RPRA 3BPRA 4FOBA 5K9IA 4U5JA 4FRFA 5JK3A 4HGEA 2OXYA 3OROA 4R3CA 5D9HA 5FM2A 5FP6A 5IA2A 4D5HA 4UWCA 1OKYA 4WT6A 1REJA 4IACA 4U8ZA 4Q5EA 4USFA 4A06A 3HRCA 4ONAA 5HU9A 5HLWA 3FKNA 4OT6A 4DCEA 4MK0A 1Q8WA 4XNEA 1U4DA 4ZS4A 2C6MA 2IW6A 5LVMA 1CDKA 1PXPA 2BVAA 4XJ0A 4FICA 2CSNA 1DAWA 4RWKA 4FTLA 3CY3A 2ITTA 1JPAA 3E87A 2E9OA 4LQMA 4IAIA 4YJPA 4F6WA 4QO9A 5C03A 3TKUA 4QTCA 3IDPA 3UG1A 5B2MA 1Z5MA 1GAGA 2I6LA 3PP0A 1XHAA 4OLIA 5AR5A 1U5QA 3TNPC 4RFYA 4J1RA 4BDIA 4KKGA 4Y85A 1YW2A 2PMNX 2WXVA 3D7TA 3VWAA 4FODA 1O6YA 2IZUA 5TOZA 3R7UA 3ZMMA 1PMEA 2YN8A 4EH4A 4M69B 2V0DA 1PJKA 2ZFYA 4WBOA 4H3QA 2R0UA 3FKLA 3I60A 1MQBA 3Q5ZA 3Q6UA 4CZYB 4TL0A 2RFDA 3Q4ZA 2YIXA 2C6KA 4QDVA 3HMPA 4NFNA 3AKKA 4IDVA 3WE8A 4MCVA 1M7NA 3Q4CA 5CAVA 1IEPA 2HELA 3TV4A 2FO0A 1W82A 3QA8A 4LGHA 4F7NA 4DTAA 4FT5A 4NJDA 4CV9A 5EHLA 3EQBA 4V0GB 4NSTA 4AUAA 4F70A 4TNDA 2BAJA 2X0QA 5FXQA 2Z02A 3VS7A 4GG7A 1JVPP 4IFGA 3RCJA 3HV4A 4HZRA 5L4QA 2PE2A 1Q8UA 2BHEA 2RIOA 4JS8A 4QYGA 4IAYA 5DR2A 2W4KA 4JMQA 2JIVA 3U4WA 4JG8A 4U45A 1G5SA 4EHGA 3UNZA 3ZUTA 4R7HA 4OTQA 5F95A 4XP2A 3MS9A 3RBWA 3FMDA 5IQEA 2YABA 3PPZA 4WNKA 4GT3A 3KXMA 4ZSGA 1CKJA 2FSOX 2OICA 3QXOA 4JBVA 5J9YA 4WNOA 5AR7A 4AP7A 3RZBA 5KE0A 3VUTA 4O83A 4XLIA 3ZU7A 3R8ZA 4NIFB 5LWNA 2C3IB 4X6QC 4Y5HA 3CQEA 3F7WA 4QNYA 2PZIA 5HQ0A 3MY5A 3LFCA 4LV5A 1NVQA 4M15A 5AP4A 3TZ8A 3DGKA 3UOKA 5AA9A 5IQBA 3AOXA 4LV8A 2C3LA 4UMPA 3KRJA 3PIZA 4I5MA 4X7QA 5EQYA 5ANEA 4E1ZA 3QAME 1AGWA 2JBOA 1IA9A 1OPLA 2C6EA 4G9CA 3KCFA 3CTJA 4TYHA 4UY9A 5G1XA 5F9EA 4FT0A 2UW8A 3BU5A 3HV6A 3DLZA 3OFMA 2WEIA 2G2FA 3QFVA 2VO7A 4RWIA 4WHZA 3P1AA 3O71A 4GH2A 1HOWA 4O4EA 4X3FC 4ACHA 3NWWA 2VRXA 3BRBA 2YIYA 3R02A 3R71A 4D4VA 4D9UA 2ZJWA 2BIKB 3MGYA 5A4LA 2ITOA 2BTRA 1P14A 3TV7A 3EN4A 2B9HA 2JD5A 4TWCA 3QLFA 4ORKA 3I6UA 1R1WA 5L6PA 3DFAA 4NM3A 1JWHA 5HCYA 4Q9ZA 4FZDB 2FB8A 3SVVA 4CG9A 1GZOA 2OKRA 4CRSA 1O6KA 3GCVA 3V01A 4L9IA 4HOKA 4O7VA 4G2FA 4TZRA 4Y83A 3ZM9A 3NNWA 4EZ7A 3QUEA 4BDFA 4FKTA 2VZ6A 2BKKA 2A0CX 2PSQA 4FV4A 4LGGA 5BNJA 2YDKA 5AM6A 5GZ8A 1H0WA 3FZRA 4CV8A 3BYSA 3MVLA 3QRTA 4IVAA 4BZDA 4AA4A 4EZ3A 4Z55A 2QO2A 3KN5A 2WTDA 3OUNB 4L68A 4LOQA 2EVAA 4AWIA 4D0WA 3D7TB 4YJUA 3JUHA 4JQ7A 4FTUA 2GQRA 4TYIA 2R3MA 5FEQA 3R9DA 2JFMA 4QMPA 4ZSAA 5HX8A 3FI4A 2WIPA 3ORIA 4PV0A 1PKGA 4YO6A 3QHWA 4M97A 4EYJA 3PZHA 5FEDA 4DTBA 4FKOA 4O0RA 3VS6A 5EM8A 1ZYCA 3HECA 1FOTA 2WQMA 3MTLA 5HTCA 4DAWA 4F1OA 2R3PA 3F82A 2XNEA 3C13A 2CLXA 4TNBA 5HG5A 3DKFA 3RPVA 4E4MA 2A2AA 4EWQA 1TQIA 5BVNA 3LW0A 1KOBA 4DGOA 4O6LA 4FE2A 1JOWB 1H1WA 2ZMDA 3NUSA 4RA4A 4XYFA 3SRVA 3JY9A 5DBXA 1IR3A 3Q96A 4GIHA 4AAYA 4O7WA 4YZ9A 4YGAA 5KMIA 5HBJA 4NTTA 4XUFA 3EL8A 3GU7A 4ALWA 4EK3A 4PF4A 5E91A 5LOHA 4M0ZA 1PY5A 3QC4A 2P33A 4LUDA 4CCBA 4F7SA 2ZVAA 1JQHA 4HGLA 2PMIA 4PRJA 3ORZA 4USDA 3RZFA 2QO7A 2BRNA 4ANOA 4JX7A 2BALA 1CTPE 3SLSA 2GNIA 2PVJA 4FSZA 4BI1A 4C8BA 4CYJA 3OXTA 4I21A 4KABA 4O2ZA 3ZBXA 4EK8A 3AC3A 3R9NA 4FKIA 1UNGA 4RJ6A 4YSMA 4Y5QA 1YHSA 5M06A 3DK6A 3L8VA 3H4JA 5M57A 3LMHA 4I3ZA 2Z7RA 4BGQA 2XK9A 2Z7LA 3EQGA 4C33A 5E90A 4Y73A 4MXCA 3VQHA 3W33A 2UZNA 5BUIA 3VAPA 3O8UA 5A4QA 2JKQA 3MVHA 1Z9XA 4D5KA 1LP4A 5IQCA 4FGRA 5C8MA 4TYHB 5JN2A 2QOKA 5CTPA 3W2SA 3LM0A 2ITWA 1Y8GA 2OWBA 2VTLA 4LG4A 4YNEA 4XG9A 2OGVA 1JAMA 2WNTA 4QPSA 4E26A 1V0OA 4ZP5A 3ID6C 3QYZA 4IWQA 3C4WA 4G3EA 4B8MA 4O7YA 2C4GA 4WIHA 5E92A 3ULIA 4K0YA 4FNXA 4JVGA 4NCTA 4ZZMA 2JIUA 3PVBA 4DEGA 1WBPA 5M4UA 5J87A 3FHIA 2QOQA 3DZOA 3HP5A 5AA8A 5FBNC 3F3WA 2FSMX 4EOLA 4EH9A 2H6DA 3NR9A 2XS0A 5I5ZA 4IWOA 3BHVA 3CR0A 2OU7A 1MRYA 4MAOA 3S00A 2WD1A 1Q3DA 4NUSA 4U42A 4IX5A 4ITHA 3RGFA 3ZFYA 3TDWA 1S9IA 2E2BA 4H36A 4CFMA 1XR1A 3DOGA 3O2MA 2E9VA 1K9AA 2Y6MA 3K2LA 2W99B 2W0JA 3AKLA 4Q2AA 4WG4A 1QMZA 2XJ0A 3ORLA 3FLYA 4LMNA 5FLFA 4RBLA 4FL1A 3CP9A 5CNOA 5CASA 4PDPA 4JI9A 5D10A 4BDEA 4HZSA 3HP2A 2UZBA 5J79A 4K11A 4QPMA 4GUBA 2QD9A 2XIXA 3PXKA 5CXHA 5L2SA 5FWKK 4C4HA 3EH9A 4G16A 4KRDA 4M0YA 3ELJA 5M51A 3SRVB 4RIYB 2XCKA 2YM3A 5IH4A 4O7LA 5AP5A 2PVNA 3E88A 4C3FA 4BKZA 2JDTA 2GSFA 1I44A 4OR5A 5HCXA 4RJ7A 2OJIA 2R3HA 5FTGA 3ORTA 2BHHA 3F61A 4QNAA 4BGHA 3FLNC 4CFNA 3TN8A 3EFWA 3L9PA 1PXLA 5DOSA 2XF0A 5HORA 3IS5A 3LFNA 1YXTA 2OZAA 2QO9A 5E1EA 3O0GA 2WMAA 2WMTA 4EJNA 3PVUA 3Q04A 4BCFA 5JSMA 3WI6A 4O7ZA 1TQMA 4O21A 2YDJA 5EDPA 1HCKA 3LOKA 5JQ8A 3KKVA 4IC7A 2UZLA 3F7ZA 3FXZA 4KBAA 2C6DA 3WZKA 3HKOA 4TY1A 4YZBA 3NZ0A 5AEPA 3N9XA 4EOMA 1ZYJA 4PTEA 3QCSA 2QCSA 3E5AA 2OJ9A 4KKHA 3HV5A 4PP9A 5BVKA 3WF9A 3HDMA 3DK7A 2O0UA 2PWLA 2XH5A 3C0GA 3POOA 4BDKA 3WBLA 5I9YA 4LRMA 4YR8A 3OTVA 1YWVA 4O0VA 3QALE 4N4SA 3Q9YA 4CTBA 4KRCA 3BIZA 4DHIB 1E1VA 2E9NA 3MSSA 4U0IA 3VUIA 4DEDA 3RVGA 3G2FA 4JAIA 3V5QA 4NYEA 2LGCA 2BAQA 4I4EA 3LQ3A 3SDJA 5HI2A 3R04A 4XG2A 2IWIA 5IA3A 4CFWA 4OTDA 4GK4A 4EC8A 4YZCA 4DLJA 3M2WA 2VD5A 3PVWA 1H07A 3FMKA 4NFMA 1J7LA 2Y4PA 5GINE 3A2CA 3QWJA 4L01A 1WCCA 3F3TA 3MYGA 1W2FA 5HG9A 5A9UA 1JNKA 5FRIA 4C38A 4O81A 5CX9A 4QTBA 3QWKA 2PE1A 3GC8A 4FJVA 3CJGA 1Q8ZA 3QTQA 1B39A 2C68A 1UU8A 4H1JA 4ZXTA 5AV4A 5M4CA 5IQIA 4YTHA 2W9FB 3LCKA 3Q9XA 5EG3A 3MESA 4DEHA 3UDBA 2QURA 4X2JA 4GIIA 4I4FA 4AZWA 5CZHA 3BE9A 2REIA 4FTNA 4CLIA 3N51A 1GIHA 4BZNA 4NKSA 4WNPA 5K0XA 3Q60A 2X0GA 3C50A 1KE6A 2OXDA 1FGIA 2R7IA 3IW4A 4RC3A 5GNKA 3IG7A 4YTFA 4FVRA 3U87A 2XKFA 2PUIA 2UW6A 3NUYA 2P2HA 1JLUE 4IEBA 4KS7A 4LGDA 4XBUA 4PDYA 3LCSA 2XYUA 3EZVA 3LXPA 4B99A 4DFXE