4PV0A

Crystal structure of spleen tyrosine kinase (syk) in complex with an imidazopyrazine inhibitor
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
275
structure length
268
Chain Sequence
VYLDRKLLTLEDKELGSFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Discovery of GS-9973, a Selective and Orally Efficacious Inhibitor of Spleen Tyrosine Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 87
structure length 268
sequence length 275
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4pv0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4pv0A01
3EYHA 4MXXA 2FSLX 2PMNX 1PMEA 2C3IB 3GQLA 4F9YA 5EYMA 5CAPA 4G3GA 2BFYA 4HCUA 3E5AA 5G6VA 3QHRA 1WVYA 4O0RA 5CXZA 4ZJIA 4E3CA 5IQFA 3HA8A 3V04A 1TKIA 3ORPA 3NUXA 3R8PA 4ASDA 4RX8A 4UN0C 3F3TA 5CXHA 3FMNA 5IA2A 2GNFA 2FSMX 3PE2A 5C03A 2KTYA 4XRLA 4AAAA 4FKRA 5AADA 3C5UA 3Q4CA 5IU2A 3O7LD 3MVJA 4IAAA 4EK8A 4MWHA 3TNPC 1JQHA 4ZLYA 2B7AA 4IVAA 4RRVA 4PP7A 4IWPA 4BCQA 4PDPA 3OUKA 4I5CA 2XK6A 1YDRE 5A6OA 3MPMA 3OCBA 4EEVA 5DR6A 2VRXA 3T8OA 3U8WA 4F6SA 3DQXA 2QD9A 3BU5A 4EK5A 4UMRA 4NYEA 4YLLA 5CZHA 3UVPA 1JBPE 5HD7A 3UNZA 2CDZA 2PUNA 2R4BA 4FGRA 5HD4A 4BDIA 3LIJA 2GQGA 4LYNA 4FK6A 4RT7A 4TW9A 3TIZA 3VUDA 3QD3A 1PY5A 1ZYLA 4E6QA 5KKRB 2CGWA 4CT1A 4DEIA 5IEVA 5AAGA 4C59A 2YM3A 4JR7A 3OXIA 2B53A 3NNVA 4WHZA 2W17A 3S0OA 4N4SA 2QOHA 1OKVA 3RVGA 1VYWA 4RVLA 4S32A 3RCJA 4KIKA 5IA3A 5BVEA 5HZNA 3H9OA 3U6JA 3NSZA 4LRKA 3H0YA 3WYYA 3O23A 2ETMA 2UZWE 4RWJA 4UWBA 2C3LA 3WIKA 1PRYA 3COMA 3LXNA 4AW1A 3PVWA 4FKUA 3VUIA 2IZTA 4DA5A 2PE1A 1ZAOA 4NFMA 4DG2E 5CU0A 5B2LA 4TT7A 3F5PA 2GFCA 4LQMA 5E8UA 1H0WA 3RPSA 3L9MA 5CAQA 5IQHA 3LXKA 1H00A 1A48A 1ERKA 2C68A 3R7IA 3FKOA 3DBFA 3E7OA 4RJ5A 4YJPA 3QKMA 2EUFB 4O38A 3DKOA 2ERZE 4PWNA 4NCTA 3DB6A 3OY3A 5AV3A 4ZTRA 4FK3A 3VUHA 5I3RA 2BZKB 5T6KA 5DI1A 4IANA 5ANGA 3BBWA 3KY2A 3DK7A 4KSPA 3LQ8A 2OGVA 4BTMA 4L46A 1U5QA 4G3CA 2Z7LA 1B39A 1Q24A 2BZIB 3UPXA 1PKDA 2CHLA 3DB8A 3FPQA 4C4GA 3NIZA 1KV1A 5HNGA 3CKXA 3WBLA 2C6EA 4QO9A 4R77A 3D4QA 3QQFA 2PTKA 3GI3A 4C3RA 5LMAA 4G31A 4P7EA 1WFCA 3SD0A 2PVYA 4YC6A 5JFXA 1GIJA 2VTRA 4PX6A 4BI0A 2GHGA 4FV5A 4C35A 3IOKA 4RC4A 3O0GA 2FUMA 2C0IA 4J71A 5BVNA 2BROA 3IW4A 3A4PA 4FX3A 4IE9A 3VW8A 4O7SA 2GU8A 3NLBA 1RJBA 5J1VA 4MNEB 2WNTA 4LV8A 4I6QA 4GKIA 2X8IA 4EC8A 4NT4A 2W9FB 3ZC6A 4N6ZA 4U44A 4BN1A 2JDRA 4APCA 3FAAA 3E7VA 3EYGA 5J95A 4OT5A 4ANBA 3DK3A 3LVPA 5HO6A 3RK9A 2YM5A 3S95A 4FTLA 5TT7A 1OL6A 2OU7A 4L7SA 4FTNA 4O7VA 4FVPA 5BVWA 3D83A 3S1HA 2W1FA 3KMMA 3E8NA 2VTMA 4L8MA 4BDBA 2BDWA 1GOLA 4D4SA 4EHVA 4GIIA 5DMZA 4GS6A 4P90A 1H1PA 1XH8A 1YW2A 4YLKA 4Q5EA 4XBUA 1E1VA 3GT8A 5EI2A 3LJ1A 2W99B 2X2KA 4XUFA 3SOCA 3F2AA 3SKCA 4O7NA 3JPVA 3TIYA 4KSQA 4FOCA 2P3GX 2B9FA 2OI4X 3DJ5A 3LE6A 5AX9A 4ACCA 2UZUE 3KC3A 5M4FA 4U79A 4FTUA 2XF0A 4KBAA 4FIJA 4RLLA 4FNXA 3DOGA 4I0TA 5IMEA 5M4CA 4UEUA 2VWVA 3HMMA 2J7TA 5JGDA 3TUBA 5CEOA 4DH1A 2F2CB 3H3CA 4HZSA 5GZAA 3TKHA 3SA0A 4DEAA 4ENXA 5A54A 2PMLX 4XX9A 4L01A 3MB6A 3UYSA 3WF5A 3QLFA 4DTBA 5M07A 5JGBA 3SXSA 3TTIA 4C38A 3ACKA 2O8YA 3O96A 3QUPA 3FQHA 5DGZA 4IZYA 4RVKA 5KZIA 5LXMA 4KRDA 4IAZA 1M2RA 2WMUA 4NCTC 5L2SA 1ZARA 3L8VA 2W05A 1UU7A 3AC2A 3UIMA 3PJ1A 4CFXA 4HVGA 4CZUA 1OL7A 4QRCA 2HWOA 3P4KA 5CSVA 3MTFA 4JBQA 4GH2A 3DPKA 5JRSA 4K6ZA 4EZ7A 3KK8A 3SRVB 5CTPA 3VS3A 3O17A 4AG8A 4F99A 2RF9A 3NYXA 4J97A 4RMZA 4E73A 3TNWA 5E8VA 1GZKA 3EWHA 4TYHA 2VWXA 3D5WA 2ZYBA 3O8UA 4IAKA 4QTEA 3L8SA 5HX6A 4FEXA 4Z9LA 1ZZ2A 1H25A 4RFMA 4A06A 2BRHA 2PVHA 2BRBA 2WTWA 3SG8A 4FKJA 4FSWA 1Q8YA 5IUHA 3BZ3A 3VS4A 5T3QA 3OFMA 3JR1A 4M0ZA 2WEIA 4WNPA 3QZGA 5I9UA 4RLKA 4MBIA 4O21A 4MNFA 1YI6A 2W1ZA 4FIHA 4BGQA 3RGFA 1PXMA 4BIBA 4C2VA 2BHHA 2OWBA 4BCPA 2WMWA 2VWUA 1W84A 3OXTA 5L2TA 3T9TA 3OW4A 2BUJA 5ANOA 1NW1A 5CANA 2BAKA 1REJA 2YDKA 4A4LA 5HQ0A 1Q3DA 5DBXA 2O3PA 5DRBA 4F08A 3UG1A 4ONAA 1H08A 4GW8A 4YJQA 3WZEA 3VHEA 4IFGA 1QPCA 2XM8A 3E3BX 4WG5A 4PQNA 4G5JA 3RPYA 1Z57A 2QO9A 3ZLSA 3ZSHA 3ZRKA 1YXSA 4Q2AA 4ENYA 3H10A 2VX3A 3MPAA 3TXOA 4DINA 3U9CA 2VTIA 2VGOA 3RHKA 1XBCA 1CTPE 4PL3A 2ETRA 3RAWA 4F7SA 3QRIA 3CY3A 4NM5A 3U55A 3ANRA 4H3BA 3WE8A 4I0SA 2PVLA 5FBOA 2GNJA 2JIVA 4QTBA 3R9DA 3LKMA 1UU3A 3AC1A 3SW7A 2HELA 5J1WA 4XRJA 3BI6A 3NW6A 1MRYA 2XH5A 1CMKE 2ZB1A 2VTPA 3MSSA 3PA3A 4QMMA 5ACKA 3VW6A 4ANQA 4CGAA 3QA8A 2QNJA 2E9VA 5CT0A 3Q5ZA 5DEWA 3K3JA 2UW5A 3GC7A 2ZAZA 1IAJA 4CKIA 2ITVA 2QO7A 4BDHA 5J7BA 4ZP5A 1JKTA 5I4NA 3JYAA 5D1JA 1YDSE 4R78A 2XNPA 1R39A 2J4ZA 3BPRA 1M52A 2V55A 4FC0A 1PMUA 4FUXA 4Y5QA 3S2PA 2VTLA 4BZNA 3ID6C 3QU0A 3FZRA 5IQAA 4H1MA 4IVDA 4QP8A 4FTQA 1NVQA 4GRBA 3QC9A 4L43A 4PNIA 4GK2A 4P4CA 4X6RA 4BL1A 2HZ0A 5AR4A 4CXAA 5IUIA 5K5XA 3UIUA 3R02A 2VX1A 5JQ8A 3CR0A 3ZXZA 5IA1A 4DGLC 5FEEA 3MGYA 1AD5A 4Z16A 2XKCA 4RFZA 3FY0A 4O84A 3ALNA 2XMYA 4O7YA 3IDPA 3MFSA 4AUAA 4AW2A 4UYNA 3A8XA 2QLQA 3UMXA 3O8PA 3DGKA 3PRFA 3K54A 5FEDA 5M51A 3MY5A 2I6LA 3BYOA 2BILB 3Q9ZA 3SXRA 4R1VA 4S33A 4AGUA 5FRIA 4FZAB 3NCZA 2BAQA 4FGBA 4FMQA 3TJCA 3KRXA 4HVSA 4B6LA 4YZDA 4JDHA 1KOAA 1PMVA 2PULA 4BWKA 3PRIA 2NO3A 2J9MA 4OTQA 4AT4A 5JFVA 3ZU7A 4F0IA 1F3MC 1QCFA 3POOA 4W4XA 3RALA 4BY9E 4ALUA 1CDKA 5HCXA 3TZ7A 2BDJA 4EOPA 4XG9A 2PU8A 2OFVA 4FKPA 2QG7A 4I21A 4I93A 3VS5A 4D1SA 3E8EA 2UZTA 4ZSEA 2UW4A 4J7BA 1V0OA 4NIFA 4YMJA 2XUUA 4LOQA 3NNWA 5ACBC 3SAYA 1YDTE 4RIXA 4IFCA 2FB8A 4L67A 1YVJA 1OECA 2XRUA 3DDQA 4LL5A 2R3RA 1H27A 2GDOA 3EFKA 4S2ZA 1KE8A 5CVHA 3FXZA 4DFBA 5DWRA 2PZ5A 4O0XA 3QRJA 3S00A 2PZRA 5AP2A 3V6RA 4EOOA 3LFDA 5AMNA 3TACA 3R6XA 3GUBA 4MHAA 4MH7A 1OIRA 2HY0A 2XJ1A 3HRCA 3LFAA 1LEWA 3PP1A 5JKGA 1H1RA 3POZA 4BCMA 2WD1A 3DY7A 4NU1A 2GFSA 2RFSA 4UMTA 2WMXA 4JX7A 2PVJA 4GYIA 4K9YA 2C5VA 3H30A 3OROA 2BZJA 4I0RA 3ZFXA 3F5UA 3RZFA 2JIIA 3OG7A 4EQMA 4BC6A 1YOLA 1STCE 3CD8A 4U41A 3TJDA 4BDGA 2VTQA 4LM5A 3A2CA 5FM2A 4M66A 2YIQA 1JVPP 5FXSA 3L9PA 5HO8A 2X7FA 3DLZA 5M09A 1VZOA 5H2UA 4KIOA 4AW5A 5K0KA 5FXRA 5AP5A 4DTAA 3A4OX 4BCHA 1FMOE 1LUFA 2BTRA 5G1XA 4BDCA 4KRCA 5AV1A 4CG9A 2YERA 2YWPA 3R63A 2WQOA 4E1ZA 2XCHA 1MUOA 1OUYA 2XKFA 3E8DA 4OBOA 4FVQA 1CKIA 1URCA 3KKVA 3KRLA 3QWKA 1ZLTA 4OUCA 3OW3A 5D12A 5GJDA 3RWQA 2A27A 4EOIA 2G1TA 3QYWA 3PWDA 3VQHA 3MA6A 5DVRA 5J5TA 5FP6A 2J0IA 4V04A 2XNBA 2F49A 4H36A 4YPDA 2YIYA 2YN8A 4PL4A 4XBRA 4XHKB 5C01A 5DFPA 3AC3A 3CGOA 1W83A 2RKUA 3QD2B 4MEDA 2JKOA 5DEYA 4ZTSA 2WMVA 3TDVA 5ETAA 3R30A 4QQ5A 3WZDA 3HP2A 4NW5A 1ZMUA 4FSNA 4W8EA 3HV6A 4GU9A 3R04A 4M15A 3LW0A 5AP3A 4D2WA 5HIEA 5E1EA 3EMGA 4OAVB 2B1PA 3AT4A 2E9UA 3M11A 4F7LA 4DGOA 4CRSA 2ACXA 4IAIA 4C0TA 4UY9A 3FQSA 4EOMA 1REKA 2QG5A 2QO2A 2FSOX 3GENA 2BRMA 2ERKA 2W1GA 3U4UA 2HK5A 3Q9YA 1PF8A 3HL7A 5EDRA 3ZMMA 2PUUA 2OFUA 2YFXA 2JFLA 1Q41A 3QUEA 4ZS4A 3UQGA 4HNFA 3UE4A 3NIEA 4FL3A 5HU3A 5I9WA 2R64A 3T3VA 2BAJA 4E8AA 4JXFA 4FIGA 4YTHA 4ZTNA 4I5PA 2F7XE 3FYJX 4OR5A 4L52A 3A7FA 4CLJA 3F6XA 3PG1A 3PVBA 5IDPA 3QBNA 5L8KA 2UZEA 5GHVA 4JL9A 5J9YA 3C4XA 2JDTA 3VJOA 3D5VA 3EL8A 3DBCA 3VF8A 1U59A 4UV0A 3BHTA 3ZUTA 3F82A 3IONA 2OJFE 5CF4A 2YEXA 1DS5A 4MAOA 4CNHA 3RP9A 1IA8A 4EYMA 3DNDA 5KUPA 3Q2JA 2GSFA 4FTTA 2QKRA 5EHOA 1G8SA 3IW8A 3MH1A 4JDJA 3ULZA 3PXFA 5CI7A 2RFNA 4QP6A 3TZMA 2CGXA 2V22A 5ANIA 2CLQA 3RWPA 3QKLA 3UODA 3EQHA 3ZTXA 4B8LA 5H9BA 4AZEA 4BI2A 4TYGA 4QPAA 3ORKA 1J1CA 3IW5A 2EB2A 3QLGA 3T9IA 2ZOQA 1J7UA 2YCRA 3Q04A 2RGPA 2YLEA 3CY2A 3GFWA 3QL8A 4OTFA 3ZSIA 2Y4PA 4BKJA 4RJ4A 5JMSA 2IG7A 2YZAA 3LFBA 4FKLA 2HENA 4O96A 1SZMA 3R83A 2OLCA 3EN7A 5E92A 5M44A 4KUJA 1F0QA 4P5QA 4PF4A 3VBTA 5HU9A 4IWOA 5HGIA 3NWWA 2PK9A 3H0ZA 3Q32A 3AGMA 2I0VA 4O0VA 4NSTA 3PVGA 3E64A 3QTIA 5HNIX 3NZ0A 4RIWA 2XIRA 4FTJA 4YGAA 3V5QA 3OTVA 4IB3A 5EDQA 3C0IA 1QPDA 3C4WA 3FZPA 2VZ6A 4XG2A 3DXPA 3UZRA 3C4ZA 1I44A 1OUKA 3P9JA 3RBWA 1B38A 3PSBA 2OZAA 3OVVA 2Y6MA 5CYIA 4YP8A 4JG7A 5HTCA 4E5WA 4FBXA 4PDYA 2GNLA 3WZJA 4WUNA 2ITWA 3AT2A 3FDNA 4AS0A 5E9EA 1OIQA 4GYGA 3R21A 2PMIA 4FKGA 4MCVA 4YC8A 5CU6A 4ZZOA 2OJIA 4EZ3A 4O83A 3FZOA 5KHXA 5DN3A 4C02A 2XKDA 4M14A 5ETCA 4FSRA 4BZDA 2FVDA 2WMSA 4GJ2A 5EI8A 3HRFA 3MS9A 3VUGA 1SVGA 3MN3A 4LI5A 4NM7A 4APPA 4BCFA 3ORNA 4QOXA 4O2ZA 5C9CA 2E9PA 2GPHA 1YRPA 1J1BA 2WZJA 4FT5A 4ZMFA 3MWUA 5E8WA 4UALA 3U4WA 3LLAA 4G9CA 1APME 1BKXA 1K3AA 4ZLZA 2UVXA 2YCSA 4PNKA 2B55A 3GU8A 1DAWA 4A9TA 2VTHA 4FT0A 2CPKE 2XYNA 5AA9A 5K4JA 4CQGA 2ITYA 1UNHA 2B54A 3LFQA 3HKOA 4BCOA 3PIZA 4GMYA 2XZSA 3ZONA 4X3JA 5GZ9A 3I6UA 4G17A 1PXLA 4DH8A 4Y83A 3GCPA 5LARA 2Q0NA 2ZV2A 4IM0A 3K3IA 4RZVA 2FGIA 4FR4A 1YWRA 2IZRA 1WBNA 2W7XA 5EKNA 2ZM4A 4TYJA 2Y6OA 5FG8A 4PTCA 3F7ZA 3R1QA 2IJMA 3FI8A 4O82A 4U45A 4D4VA 2BCJA 5FUTA 3KXGA 1P4OA 2R3HA 5AR3A 1RQQA 3W1FA 3SHEA 5IMXA 4DN5A 4BGHA 3GGFA 4A9YA 3JVRA 2CMWA 4EH5A 5KMOA 4LMUA 3EQPA 4NK9A 1H01A 4Y46A 3NVMB 2SRCA 3B8RA 3A7HA 5DOSA 5KBRA 1H8FA 2VWZA 3H4JA 2R3KA 4ZIMA 2BTSA 4NFNA 5CAOA 4WBOA 5CEKA 1XR1A 1SVEA 3FLZA 3NW5A 5EYCA 5GINE 1OZ1A 4UXQA 4HCVA 2OG8A 5BYZA 4F9BA 3PFQA 4ITJA 3F3UA 2GNHA 3VBYA 3TV6A 4N70A 1U54A 2HIWA 5CAVA 3ZHPC 3O51A 3TG1A 2HCKA 2UW3A 2BKZA 3WZKA 4X3FB 1OL5A 4AACA 3NUNA 2VNWA 4TKSA 4IX5A 3AQVA 3R28A 5HI2A 4DFNA 4ASXA 4MD7E 3UGCA 1K9AA 5CQWA 1H1WA 4C4EA 5KO1A 3UDBA 3HA6A 3QCYA 4WA9A 3UOKA 3MW1A 4D2TA 1R3CA 2JDSA 3KMWA 3UOLA 4BDAA 4PY1A 4TRLA 4ASZA 1FPUA 2XA4A 1Q62A 3MA3A 3RK5A 1RE8A 3PJ8A 2UZVA 3GBZA 3EOCA 1FVTA 5TR6A 2B9IA 4HZRA 2QOBA 3GC9A 4D4YA 2XB7A 4F1OA 4OTHA 3SXFA 2FA2A 3PY3A 4DF3A 5K0XA 3DJ6A 4DT9A 3GU7A 3G33A 3ODYX 4FEUA 5HCYA 5BUIA 4IVBA 5EQYA 4AOIA 2UV2A 3ENHA 5CI6A 5TF9A 2QOLA 3MFRA 3JS2A 3OWJA 3HDNA 1XJDA 2PHKA 2R0UA 4G3FA 4O0UA 4K8AA 1KE6A 3FLNC 4NTTA 3IK3A 4BKZA 4RX7A 4KKHA 4RIYA 2VO7A 2HYYA 3PPJA 4QMXA 1YXUA 2I0EA 4AT3A 4IM2A 5JGAA 1SNXA 2WO6A 2C1BA 4RA4A 5HG7A 5CY3A 4AZTA 2J0LA 3ORIA 2I1MA 3AT3A 4FKWA 5DIAA 4DHFA 3RAIA 3RNYA 3AC4A 3BWJA 3BE9A 3C1XA 3ZXTA 4Q5HA 2Z2WA 3LM0A 2EXMA 2JDOA 3MJ1A 5CASA 5I9YA 2P4IA 4F0GA 1OB3A 3ZRLA 3PLSA 4C33A 1YOMA 4EHEA 3F5XA 4YJOA 5BVKA 3NDMA 1PXNA 2RG6A 3TNQB 4D9UA 4X2FA 3I81A 4U40A 2PPQA 1O6LA 5DT0A 2WB8A 3FL5A 3R22A 4BIEA 1XH7A 1L8TA 4O7WA 3Q6UA 4GU6A 1OPKA 2AUHA 4BKYA 2QURA 4GV1A 4QMLA 4Z3VA 1O6YA 3M1SA 4DH7A 5GNKA 5AV0A 4JG6A 3QTUA 3FL4A 4NL0A 3DBEA 4MD9E 4JJRA 5C8NA 1A06A 2X9EA 3TDWA 3BGQA 4ERWA 3NUAA 5AR5A 3LZBA 3R1NA 4RX9A 4Y8DA 3CPCA 3CGFA 3SX9A 2VTJA 1W7HA 4OTWA 4BHNA 1GZNA 4X2KA 4FKVA 3U87A 3A7JA 1E9HA 5EKOA 2CGVA 3F5GA 3HP5A 3RPOA 2YM8A 1UWJA 3TZ8A 1ZYDA 2WU7A 2UVZA 4LGGA 4ZZNA 1GIHA 4AA4A 2C1AA 3NAXA 2QOQA 3UC3A 3VIDA 1FMKA 1OIUA 1Q8UA 1ZRZA 3SQQA 3UIXA 3BLRA 3FKNA 3LCKA 1S9IA 1ATPE 3MVHA 4I1ZA 1H0VA 3GEQA 5CNOA 5CENA 5D7AA 4DBNA 5L6PA 3IPHA 3FQEA 4FIIA 4WSQA 2R3JA 4I4EA 4E4MA 3ZM9A 2ITQA 2Z60A 1FVVA 4G1WA 1KOBA 2WTDA 1B6CB 2Z02A 2B9JA 2GNGA 3GU6A 3FLQA 4FICA 4QMPA 3BHUA 2UUEA 1PHKA 4NKAA 2JBPA 3WARA 1Q99A 4UMPA 5L2IA 3ULIA 4O7LA 3G6HA 5LMKA 2R7BA 3M42A 2J6MA 2WTKC 3G9LX 3I7CA 3LFCA 3MTLA 1MQ4A 3QTXA 4E4XA 5AFVA 4JNWA 3F69A 5L8JA 4DFLA 3BYSA 3F88A 5LJJA 5C4LA 1NXKA 5A4QA 4FT7A 2C3KA 1UVRA 3LFNA 3Q9WA 1BMKA 3WF7A 3E3PA 3S3IA 3UMWA 5L6OA 3ZFYA 5CEQA 2J2IB 2C6MA 1ZOEA 3I5NA 1OKYA 2NRYA 3GCQA 2A2AA 4JLCA 4A07A 3AG9A 3BEGA 1ZXEA 3EL7A 3TNIA 4WRGA 3VWAA 5AA8A 4FV0A 5FQDC 1TQIA 2BIYA 3W2CA 4JQ8A 3Q9XA 3ZBXA 3V51A 3NRMA 4AXAA 1JOWB 1NVSA 2YISA 2PVRA 3CD3A 3OCTA 2BIKB 4CCBA 4M13A 3E87A 3LXPA 2IVVA 1W98A 2C0OA 5FDXA 4MTAA 3UQFA 4XP2A 4BR3A 1VJYA 3D7TA 1Y57A 1QMZA 3C4CA 1CM8A 3V5TA 4EK4A 4FV8A 2O64A 1BYGA 5K3YA 4TNDA 1JSVA 5IG1A 2WKMA 5H3QA 1V0BA 4L3LA 4D28A 3IOPA 5IQEA 3OXZA 3BE2A 3G2FA 1Y6AA 3BLHA 5J7HA 2YAAA 4R5YA 3PP0A 3KXZA 2VTOA 2E2BA 2ZVAA 4U5JA 3SLSA 3VS7A 3RPRA 3O50A 5BYYA 5AAFA 4XCUA 1QPEA 4AWIA 4GIHA 4H3QA 4QP4A 4CKRA 4C4IA 4RZWA 2W0JA 2XEZA 3R8LA 3FV8A 3UC4A 3IW7A 4H58A 5A14A 3ANQA 3KULA 3GOPA 4YPSA 2PUIA 5CVGA 3R8UA 4M12A 3FI2A 5KCVA 4YZBA 3EZRA 4NJDA 4JQ7A 2OICA 4RVTA 4TYIA 5KBQA 2GQRA 3E92A 1U4DA 4QP3A 4E7WA 2CN5A 2RFDA 3DKGA 3QD0A 3N51A 5BVOA 5FDPA 4DCAA 2OZOA 5KKRC 3V5JA 3BQCA 2QHMA 4K2RA 5CEPA 3QGYA 1URWA 1Q97A 4BWXA 5EQPA 2XK8A 2C30A 2XJ2A 3MPTA 1RW8A 4YHTA 4ACGA 2OJ9A 4CMUA 4F9WA 4F09A 2RG5A 3PLAE 2JD5A 2J5EA 5IA5A 2WTIA 4XNEA 4Z7HA 3G6GA 3PSCA 5CS6A 5A9UA 1F5QA 4G3DA 3WF9A 4L44A 5I9VA 4C37A 4CFUA 3GU4A 3BIZA 4CFFA 3ATTA 4A9UA 5LMKC 2VTSA 2YIWA 3UQCA 5J79A 4PTEA 3L1SA 4EOKA 1ZWSA 5IISA 1CSNA 4AA0A 4FUYA 5AM7A 3VBWA 4EHGA 3AMAA 5CVFA 4DGMA 5A4TA 4CKJA 3R9HA 3UZTA 1Q8TA 5LVLA 2CNQA 3H9FA 3R7YA 2PWLA 4XYFA 1XH4A 5DH3A 2VNYA 3DQWA 4IM3A 4KD1A 4MVFA 3RKBA 4TYHB 4BBEA 3FZSA 1ZZLA 3FKLA 3MYGA 1WBPA 4GEOA 2F7ZE 2EU9A 4ZTLA 4EH6A 2HXQA 5JRQA 2IVUA 3G90X 4AGWA 2W96B 4GK3A 2YCFA 4F7NA 4NJ3A 1AGWA 4S31A 4O81A 4ZMEA 5HLWA 4PDSA 4L9IA 1H1QA 3IQ7A 4O0SA 4NUSA 2X6DA 3RM7A 3ZYAA 4A7CA 3EQIA 2X2MA 4PTGA 3DS6A 3PXKA 4U43A 2X7OA 3JVSA 2ZB0A 4FTKA 5AM6A 3WF8A 5CF8A 4WG3A 5AP7A 1ZYCA 3CTJA 3OT3A 5HG5A 4AZFA 1M7QA 3DNEA 2UW7A 1P4FA 4EKKA 4RWIA 4AZWA 3FEGA 4EZ5A 5DPVA 4L3JA 3BGPA 3RK7A 5GIOE 4O6LA 3E88A 3RINA 4AZVA 4HVDA 5D7VA 3PZEA 4E6DA 3MY0A 4KIPA 3HDMA 3EQGA 4KB8A 4JOAA 2XIYA 5TOZA 5CEIA 3DCVA 3DDPA 1PJKA 4LGHA 4QQCA 2A1AB 2R3FA 4HGSA 2VU3A 4FEVA 5HIDA 3CS9A 3DV3A 2QQ7A 1GZOA 3R7GA 1GY3A 3CSVA 5GJFA 3E93A 1GNGA 2VN9A 4DGNA 3W55A 4JQEA 3I7BA 3DAKA 2VTNA 1JSTA 4RWLA 4QMYA 5BYLA 2O0UA 3AC8A 1KUTA 3OWLA 2ITNA 4H3PA 1XBAA 3FI4A 2YHVA 1BL6A 1JSUA 3MVMA 4FL2A 4IVCA 4UMQA 2JFMA 1QL6A 5AUZA 1WCCA 2YM6A 4BTJA 1WAKA 4JDIA 4N0SA 5JSMA 3R7VA 1OL1A 5M55A 1NY3A 4WG4A 3KXHA 4EH3A 4R6VA 3U51A 2AYPA 3NUYA 4IB5A 2WEVA 2XYUA 3ZLXA 2YITA 3AOXA 4LRMA 3VO3A 3II5A 2VGPA 3GOKA 4O1PA 4PMTA 2ITXA 5KNJA 1OVEA 5DYJA 3QTWA 4G2FA 3EFJA 3NR9A 3BELA 2CKQA 3VC4A 4G9RA 3QTSA 3QRTA 5KMKA 1YXTA 3PSDA 1YXVA 3NAYA 2XCKA 4I22A 5DG5A 4XOYA 3TKIA 4CRLA 4CV9A 4EH7A 5HX8A 2GTNA 5GJGA 4N57A 4M3QA 5DLSA 3E63A 3RI1A 3VBQA 5T68A 3NPCA 3V01A 3D0EA 4FTRA 5DT4A 1MP8A 2J0MB 4EOLA 4FTAA 4KS8A 2DYLA 2NP8A 4GFGA 2LAVA 4DG0E 3NNXA 1H26A 2EXCX 2QONA 3ZUVA 3OT8A 2WHBA 4M84A 4I6FA 3AD4A 2R3QA 4OBPA 2R3OA 3EQDA 3PUPA 3COKA 4ANMA 4ZOGA 4NIFB 3ZZEA 3MVLA 4TWOA 3D9VA 3FC1X 4QP2A 3PXYA 4A9SA 5ANJA 1Q61A 3OCGA 2G01A 5E8YA 3GVUA 4C36A 3V8TA 4D1XA 3PWYA 2BRNA 4I3ZA 4XOZA 3BV3A 5DR9A 2W5BA 3UTOA 5J5SA 4DEDA 3KGAA 3BU3A 4C34A 3G9NA 1H1SA 4BIDA 5KZ0A 2F7EE 5CSXA 2Y4IB 2NNWB 1Y6BA 2PE0A 1HOWA 1R0EA 4UBAA 2CKOA 4R3PA 2WMBA 3W32A 3HGKA 1V1KA 2R5TA 3D15A 3MBLA 5HE1A 3ZOSA 2QOIA 4QMUA 2JKKA 4TPTA 3NW7A 2F9GA 4Q9ZA 4USEA 4MK0A 3QCSA 4GSBA 5LCJA 2F57A 3A7GA 3BYVA 3QXOA 4S30A 4C4FA 3KCKA 1WVWA 5TE0A 3OEFX 1OBDA 2OF2A 4F6UA 4FKQA 4DFYA 2HZNA 4H1JA 5HE3A 4AZSA 4FZ7A 2JEDA 2O63A 5EW9A 2JLDA 2X4ZA 5AV2A 4IX4A 4DFUA 3VS6A 4YC3A 5FM3A 4BCIA 3CJGA 4I4FA 5HTIA 2ZDTA 3OD6X 3QAME 1R0PA 4ZSGA 3N4TA 3LJ0A 5JEBA 1A9UA 3R1SA 2I0HA 3KVXA 2UZBA 5F95A 3PJ3A 3DKFA 4PUZA 3ALOA 3BWFA 3PY0A 5HICA 5IKWA 3V5LA 1XH6A 5HE2A 2HW7A 1M17A 4XV9A 2WGJA 5BMMA 5A6NA 3IDCA 2HZIA 4GT3A 1UNLA 2Y7JA 5F4NA 5AUVA 4DC2A 3MH3A 5IH4A 5A4LA 3UO5A 3R2BA 4K0YA 2W9ZB 4OT6A 5IA0A 4ORKA 4RG0A 3CP9A 4QNYA 3FXWA 2R3IA 4U8ZA 1KV2A 4L68A 4IZ7A 4C62A 4XMOA 4D0WA 4YTIA 2W5AA 3T3UA 3P79A 4ID7A 1Y8GA 2VTTA 2YACA 4KABA 4XV2A 1T46A 3TCPA 1IASA 3R73A 3ZDUA 3P7CA 4U80A 2XJ0A 2XNMA 3D2IA 5LVMA 4EH8A 5D41A 2X8EA 3UOJA 2XBAA 4C2WA 2IPXA 4IB1A 4DEGA 3EQFA 2IWIA 3GCSA 4QYEA 2CKPA 2Z7QA 3Q4TA 4KWPA 3HMIA 4QT1A 1YWNA 4FTIA 5EOLA 5E4HA 4LUEA 5JN2A 4QTDA 3KL8A 3N4VA 5ETIA 5EYDA 2WAJA 2W1EA 4BCNA 4S34A 4O7ZA 4LRJA 2C6LA 4C8BA 4YSJA 1I09A 5C8KA 4CCUA 3LFFA 4IAFA 5GZ8A 4MBJA 2QCSA 2BPMA 5I3OA 2YAKA 2GS7A 4X0MA 4USFA 4FSTA 4P2KA 2ZV7A 3SG9A 4IQ6A 2ITOA 3BU6A 4FSMA 5BUEA 3H9RA 3EHAA 2R2PA 4DFXE 2QC6A 2P2HA 4JVGA 2W4JA 5FGKA 1UV5A 4E20A 2HXLA 5ITAA 3SOAA 2ZM3A 3BCEA 4FF8A 3UVRA 4M69A 2QOFA 3LMGA 4V0GB 5E8SA 4MBLA 3Q60A 4YJNA 5L4QA 1S9JA 5I5ZA 4FEQA 3VS1A 4Y73A 4BDJA 3D7ZA 1R78A 3WF6A 3AGLA 2VWIA 3VS2A 4EORA 4O7RA 3C51A 3R8MA 2V62A 3QKKA 1J91A 4F0FA 1VYZA 4EJ7A 1SMHA 3F9NA 5B7VA 4QYGA 4YURA 3A62A 1Q3WA 4F9CA 4QMSA 3K5UA 3V5PA 1FINA 2DQ7X 1TQPA 3DFCB 3PA4A 2GHLA 2O2UA 2PVNA 3KN6A 2QU5A 2QOOA 2UW9A 1U5RA 4EYJA 2X7GA 2CCIA 4RQKA 2IO6A 3CBLA 5HVYA 2ZMDA 3ZO1A 2YJRA 3GCUA 3UIBA 5E7RA 3TNHA 2WQMA 3LCOA 4IC7A 4JIAA 5J8IA 4PDOA 3ZBFA 5IEYA 4ITHA 1U46A 4GVJA 4CFNA 3MI9A 4G6OA 2XIXA 1Q4LA 3PE1A 4PP9A 4AGDA 3LLTA 2EVAA 3U54A 4FZDB 4AE6A 3RZBA 4H05A 4YJTA 4OTDA 2W1CA 2ZDUA 4FNYA 3B2WA 2O5KA 3TUCA 3JY9A 1H4LA 4G6LA 3DXQA 5F1ZA 2PL0A 2WQBA 5HIBA 4WKQA 4DGGA 2EB3A 4QYHA 4BICA 2VX0A 4ZY5A 3B8QA 5EW3A 3QQHA 2FH9A 5HVKA 4FYNA 3IGOA 5JFSA 5CSWA 2XNGA 4IC8A 5HBJA 3EQCA 1LPUA 3G51A 4WT6A 3ERKA 2CKEA 3I5ZA 5HKMA 5KE0A 2BVAA 4X2GA 3TWJA 4EI4A 2CJMA 2J50A 2RFEA 3ZEWA 5HCZA 3QHWA 1UU9A 4BDFA 4B7TA 2X6EA 4K11A 5CWZA 4FOBA 4EH9A 3V3VA 2PUPA 1G3NA 4EH4A 3FXXA 3SW4A 2OXYA 4FYOA 1P2AA 5IQBA 4YZNA 4QMOA 3EB0A 3FY2A 1JKSA 4IWQA 3AMYA 3QGWA 4WIHA 2YWVA 4FV3A 3NUPA 1R1WA 3C7QA 3I60A 5E91A 5EM7A 3BEAA 5KMNA 5EM6A 4HPUE 3ZEPA 3V8WA 3PIXA 4CV8A 5IZFA 3IECA 4X2JA 4W4VA 4Y72A 1J7IA 1IG1A 4TN6A 4JBPA 2YZLA 1W8CA 3IDBA 3OF0A 4DBXA 4FEWA 2F2UA 2R9SA 1ZYJA 3A7IA 4YBJA 5CNNA 3VQUA 4F1MA 3KREA 1PW2A 3RNIA 5HHWA 2YA9A 4TL0A 2WTVA 4BGGA 3FLWA 3QZHA 2WELA 5C26A 1IA9A 4CFVA 1IRKA 4JX3A 3EN4A 3R00A 4RQVA 5IF1A 3FLSA 4O91A 2LGCA 3QTQA 3VS0A 4R7IA 3GCVA 3ZLYA 5CX9A 2OXXA 3WE4A 4A4XA 3C13A 3C4EA 5DHJA 2CGUA 2OJGA 1RDQE 1IEPA 3CIKA 3G5DA 3W16A 4IDVA 3FBVA 4OLIA 3JY0A 2GQSA 3L9NA 4R8QA 1SVHA 1Q8WA 1YI4A 3CKWA 5J9ZA 3I4BA 3KXXA 4NKSA 2JAVA 4YNEA 3O8TA 3ITZA 3EZVA 5A46A 1U54B 4EBVA 4UZHA 5BNJA 4MXZA 4QTCA 3R8ZA 4R5SA 4MQ1A 4JRVA 4NEUA 5AP4A 1GZ8A 3UJGA 4P5ZA 2HOGA 5A4EA 1DAYA 5FTGA 3D94A 3VBVA 2C3JA 1ZMWA 2BMCA 3KEXA 4MXYA 3ZCLA 1OIYA 5D10A 4HOKA 1FGKA 4X3FA 3HAMA 1P5EA 3Q6WA 2NRUA 2PMOX 4EBWA 4IB0A 4G16A 2JAMA 2J0KA 5CU4A 5E1SA 1WBOA 3G0EA 5L3AA 4FV9A 4E6CA 2IZUA 2G9XA 4A4OA 2R3PA 5K5NA 2QLUA 3WYXA 3BX5A 2QKWB 3QX2A 4RJ7A 4YJVA 1OGUA 5B2KA 4EWHA 5AR8A 4BTKA 5D11A 5H8BA 3VAPA 2DS1A 4II5A 3BHVA 4EOQA 2WXVA 2OW3A 4OTRA 4J8MA 4JAJA 4RA5A 2Z8CA 3MH2A 4FKTA 3P08A 2YDIA 4FNWA 4JS8A 4HYHA 2YCQA 2WMQA 4IDTA 5L6WL 3DA6A 3OOMA 4NZWB 2HY81 4W4WA 4D5HA 4DT8A 4XP0A 4AP7A 3I79A 3ZM4A 2XEYA 4WO5A 2C69A 2VWWA 3W2PA 3PDTA 5EM5A 4DFZE 2XM9A 3KRRA 3BYMA 1M7NA 2WQEA 4FTCA 4GT5A 4U9AA 4IX3A 3OCSA 4YJUA 2IVTA 2V5QA 2ITUA 4IBMA 4O1OA 3R2YA 1OM1A 2VWBA 4I20A 3DK6A 2GHMA 3DFAA 3GP0A 4U0IA 1CKPA 2OXDA 4TWNA 3GC0A 4HVHA 3Q2MA 4LG4A 2C5XA 3LJ2A 5IEXA 5EQEA 5JFWA 4C3PA 3Q4UA 5M4IA 3ORMA 2OK1A 4FKOA 4JR3A 4PMMA 5HBEA 3VRYA 2JBOA 4YZMA 4W4YA 5CF6A 2Y0AA 2IW8A 2OH0E 1JKLA 3VULA 3SVVA 2R3GA 1OPLA 3QQJA 4V01A 3P78A 3I1AA 4AN9A 5C4KA 5IQDA 4FKIA 3MESA 1XH9A 5JH6A 3ZUUA 4F4PA 4YUQA 5M06A 4DEHA 3FMEA 3D5XA 3PZHA 3W10A 1UWHA 3QZIA 4ARKA 4AT5A 1FQ1B 3KA0A 4XLVA 2CNUA 3NYNA 4NW6A 3KRWA 2QOKA 4F6WA 5AUUA 3HAVA 2OIQA 3QRUA 4JAIA 3LQ3A 5FXQA 1OKWA 4O0YA 2WFYA 3HVCA 3EQBA 3R7UA 4E26A 5A3XA 1M14A 3C9WA 2NPQA 2XKEA 3K2LA 4FV1A 3NYVA 4TNBA 5KMIA 1XH5A 4KIQA 2UW8A 2E9OA 4DEBA 4FSYA 4NM3A 3V5WA 4LOPA 4U3ZA 3BBTB 3LXLA 3VHKA 3ATSA 5EHLA 5AP6A 4JBVA 4W8DA 1P14A 2J90A 1JLUE 3CXWA 4QMVA 5CZIA 3KK9A 2VAGA 1OI9A 4KIKB 4G34A 5KMLA 5LMBA 5JZNA 1XWSA 3OP5A 2W4KA 2Z7RA 3LM5A 2PYWA 3HMOA 4X3FC 4DEEA 4FTOA 1PXIA 2OJJA 3V6SA 4D0XA 2B4SB 4XJ0A 1VR2A 4R1YA 4IWDA 4XV1A 3LAUA 2ZV8A 4LV5A 5AUTA 3DLSA 2JITA 4BDEA 3AD6A 3RTPA 4EWQA 3FMMA 5AP0A 3F7WA 2R0IA 4TY1A 2QVSE 5EOBA 4EK6A 5L8LA 5ANEA 2IW9A 4D9TA 4CMTA 3HEGA 4CFWA 3LMHA 2Z7SA 4RSSA 4O0TA 4I5MA 3QA0A 2ONLA 3QTZA 5H8GA 3I6WA 3FSFA 3TEIA 3ZSGA 3MJ2A 3EN9A 3FMJA 2XIZA 4BHZA 1T45A 5DE2A 4RVMA 4BCGA 3QQLA 3CQUA 4YJRA 2R7IA 4YU2A 1XHAA 5HLNA 2BZHB 2R3LA 5EG3A 2WMTA 3S4QA 3SC1A 3N9XA 3QALE 4E5BA 4ANSA 3EH9A 4FNZA 4Z7GA 1G8AA 3G0FA 3WOWA 3F66A 4GFMA 4RIOA 2JKQA 5IUGA 4D2PA 2HWPA 4ZTMA 4YBKA 3OBJA 2P33A 1TQMA 4QD6A 1SNUA 3DTWA 5EI6A 3DTCA 4QQTA 2BALA 1M2PA 4KA3A 3CTQA 3TT0A 1HCLA 3TN8A 1H07A 4EJNA 5KMJA 4IH8A 5KHWA 2C5YA 5EK7A 2WOTA 2X9FA 3Q96A 4LL0A 3O2MA 3HLLA 5HG8A 1FBNA 5LVOA 2QI8A 3GXLA 4QP7A 3PXZA 4GG5A 4FZ6A 3RHXA 5J9LA 2UZDA 5IH6A 2ZM1A 5BX0A 1AQ1A 4OTGA 1OKZA 3R1YA 1CKJA 1Q8ZA 2H34A 4GT4A 3L9LA 5CAUA 5LCKA 1HCKA 2QR8A 5HEZA 4CTCA 3P1AA 4YHFA 4N6YA 3D7TB 2REIA 4ALVA 4FIEA 4ALWA 3K5VA 3BHYA 4JI9A 4QNAA 4BFMA 1NA7A 5E8TA 2HW6A 3ZFMA 4ACMA 4DG3E 1MRVA 4HVIA 4MNEA 4KKEA 4ZTHA 4OTIA 4WBBB 3UYTA 4DCEA 2RIOA 3RJCA 2WTCA 4MQ2A 4DH5A 5DNRA 5DT3A 1XQZA 3UNJA 3DJ7A 3ORXA 3CCNA 4EKLA 2UW0A 5K4IA 3MDYA 2H96A 3JXWA 3QCQA 3ORZA 4ANLA 2J51A 4GG7A 5HG9A 1J7LA 2PZPA 4LFIA 4WNOA 4KBCA 4PPAA 4X2NA 2V7OA 4AFJA 3KULB 3ENMA 4L3PA 4JDKA 4K18A 1DI8A 4ZY4A 2YABA 3QQGA 2ZMCA 4D1ZA 3OHTA 3HX4A 4I94A 4C61A 4ZK5A 3R01A 4AOTA 2WIPA 4JT3A 4TWCA 2G15A 2CNVA 3WZUA 2F4JA 3GNIB 5CLPA 3QCXA 3R9NA 4B9DA 3P7BA 2UVYA 2XNEA 3COIA 3VN9A 4O7TA 3BHHA 4QQJA 3BRBA 1OITA 3PYYA 4E6AA 4F65A 4IZ5A 5HOAA 4D5KA 4IJPA 5CU3A 3WIGA 4FVRA 1YQJA 5EHYA 2XVDA 4EUUA 3UNKA 1M2QA 3MH0A 2ONLC 3KVWA 5FWKK 4QP1A 4RC3A 4L7FA 2XNOA 4PPBA 1GAGA 5L2WA 3FC2A 5KX8A 2A4LA 3F61A 3D5UA 2H9VA 3LCSA 4HPTE 4R3RA 1MRUA 3TL8A 5AV4A 4YSMA 1UU8A 4ACHA 4BRXA 4M67A 2YIRA 2CCHA 3RAKA 3DAJA 3GU5A 3KMUA 5AIRA 3OEZA 3OY1A 3VUMA 1XBBA 5AIKA 3MB7A 4ZLOA 4ZJVA 2C4GA 1YXXA 2WOUA 3CQWA 5E90A 3WILA 3TV7A 3NUUA 2VO0A 4DAWA 4WUAA 5LWMA 1BUHA 1Y91A 2P55A 2OO8X 3SRVA 4K77A 4FSUA 3Q5IA 3EFWA 1NT2A 4QMNA 2YIXA 4CT2A 3ZZWA 4AF3A 2XIKA 3WI6A 2BHEA 4BTFA 3RCDA 4YTCA 4L42A 2UZNA 4TZRA 5H8EA 3COHA 4K1BA 2JGZA 4KS7A 4LGDA 5LOHA 2W1DA 2XRWA 3KCFA 5IPJA 4XG8A 2A0CX 1WBSA 2OH4A 2HZ4A 3KQ7A 3OUNB 4FKSA 4QYFA 4B8MA 4PL5A 1Z5MA 3QWJA 3Q52A 2AC5A 2QR7A 5EYKA 3HECA 4FV4A 1Q5KA 3ZO2A 2PZIA 4WNMA 2JKMA 2VD5A 3NUSA 5C27A 3QXPA 4J1RA 4HYIA 5TKDA 2GS2A 5CEMA 1OPJA 3D14A 3KFAA 3R7OA 1PXOA 5JK3A 5I9XA 2QODA 1TVOA 5HORA 3RPVA 4HJOA 2KULA 3ODZX 5DR2A 5JT2A 3KB7A 2OIBA 3MY1A 4FODA 3EN6A 4HW7A 4D2SA 1ZOGA 3RMFA 4YHJA 4K33A 3TKUA 2V7AA 3DT1A 4X6QC 4D2RA 3C0GA 4UYAA 3HZTA 3F3WA 4FE2A 3PY1A 4RJ6A 1VEBA 2DUVA 3HRBA 4R7BA 4IEBA 4BVUA 4I41A 2B9HA 4XG4A 2VO3A 4XH6A 3UP7A 4KBKA 3VBXA 1J3HA 3TZ9A 4W9XA 1E1XA 2P0CA 3QFVA 2W1HA 2WQNA 1PKGA 3D2KA 4AW0A 4FTMA 5CSHA 5AP1A 5F94A 1Y8YA 4L6QA 2XS0A 4IMYA 2VUWA 2AC3A 4FL1A 4IX6A 4B4LA 4V05A 3C50A 4U7ZA 2X39A 5B2MA 2JDVA 4X7QA 5IQCA 2W5HA 3I0QA 2XBJA 3CQEA 3VNTA 3W2OA 5CSPA 1OL2A 4QMWA 5AX3A 3VUTA 2Q83A 3W2RA 4FT3A 5M57A 1K2PA 4XP3A 3CLYA 4FI1A 4IXPA 4IADA 1EH4A 4MF1A 2Y9QA 4I6HA 3P7AA 3QTRA 5HVJA 1JNKA 2PVFA 3EFLA 5CF5A 3LCDA 3UO4A 3LHJA 4Y85A 1O9UA 2VTAA 5LWNA 3ET7A 4TTHB 4D55A 5F9EA 5M53A 3QYZA 3E8CA 4CG8A 3NNUA 1XKKA 1ZY5A 2A19B 5J87A 4HYSA 2BDFA 4C4HA 3C5IA 4FG8A 4XS2A 2ITTA 4MWIA 4EQCA 4O22A 4YO4A 4XLIA 1G5SA 4C4JA 4YJSA 3CTHA 2YJSA 4CYJA 3HMPA 1KE7A 2EXEA 2C6KA 3HUBA 4J52A 1FOTA 4CMOA 3ROYA 3PA5A 2ITPA 4ZEGA 5BVFA 1YI3A 4RIXB 4BCJA 5C1QB 3CE3A 1IAHA 3TUDA 2BRGA 4QPSA 3ETAA 2XK3A 2ZV9A 2XP2A 2YLFA 3P23A 3PXRA 3MFUA 4L53A 2WPAA 3R0TA 1IR3A 3EKKA 5E8ZA 3F2NA 4AU8A 4BI1A 4RX5A 4J96A 4UZDA 3ZH8A 1YOJA 4ZZMA 3UVQA 4AOJA 1L3RE 2VV9A 4FG9A 3IW6A 1FGIA 4FSQA 3BGZA 3ACJA 4R7HA 4G5PA 4ASEA 4DTKA 3A8WA 4GJ3A 4KKGA 4D2VA 1WZYA 4U42A 3FI3A 4NM0A 2J0JA 3SGCA 3KXNA 4G6NA 3QD4A 2C6IA 4AFEA 1FVRA 2RL5A 4HNIA 3I0OA 4DE4A 4OTPA 4QTAA 3QX4A 5TO8A 4ANNA 4BBFA 3C0HA 3W18A 4TXCA 4J53A 3F3ZA 4GCJA 4EUTA 3NMUF 4RBLA 3OC1A 3PJCA 5JQ5A 4E4NA 3OTUA 2C5OA 3W8LA 1OBGA 3HV7A 2XK9A 4BBMA 2R3NA 5AAEA 1V0PA 4B99A 3CJFA 3C4FA 1ZMVA 2YDJA 4MXAA 3MFTA 2X8DA 4XG7A 2IZSA 3EN5A 3QUDA 1GIIA 4J8NA 1ZYSA 4WNKA 1ZOHA 3LQ5A 5M4UA 3NS9A 3R71A 2PZYA 4IJ9A 3UZPA 4BDKA 2E9NA 4GFOA 1WBVA 3B2TA 4BCKA 5BMSA 4M97A 4PMSA 1BX6A 5GIPE 4KINA 4X21A 4XV3A 4DH3A 4ITIA 4E4LA 3QQKA 2YM7A 5M56A 4OAUC 2W06A 4EQUA 4MD8E 4I23A 3ZS5A 3LCTA 4J95A 5LVNA 5HO7A 3VUKA 4MYGA 2C47A 4GK4A 4CSVA 4GVAA 3A61A 3FLYA 4QYYA 4LMNA 4YR8A 4I6BA 3FJQE 4U3YA 5C8MA 3TM0A 4KNBA 3BLQA 2FO0A 3GB2A 1UA2A 1OMWA 3P0MA 5HLPA 3PPKA 4EOSA 4IW0A 3E62A 4AN3A 3DZOA 4C58A 3GC8A 4RGJA 1KE9A 4QMZA 1YHWA 3OS3A 4IZAA 3FMHA 3REPA 3U9NA 4D58A 5IQGA 4KAOA 3N4UA 1JWHA 2V0DA 4E93A 4EL9A 4CQEA 4YTFA 3IS5A 3FWQA 1PXKA 3PVUA 4U81A 4TWPA 1PYXA 3PXQA 4FA2A 2FYSA 1XO2B 4O6EA 1QPJA 4BWPA 3P86A 3DU8A 4QMTA 2PY3A 4OW8A 3ZRMA 3TTJA 5I9ZA 4AGCA 1ZY4A 3GQIA 4YZCA 1Z9XA 3MV5A 3TI1A 2W4OA 2B52A 3HNGA 1JKKA 4GUEA 3W2QA 4F9AA 4RFYA 4Y95A 5AEPA 4WRSA 3R7EA 5I0BA 3PJ2A 3ZO4A 5BPYA 4C7TA 3O7LB 3AMBA 3G15A 1KE5A 2OF4A 3KRJA 1LR4A 4ACDA 1W82A 2GTMA 3FMDA 3NEWA 3FE3A 4UWCA 4WD5A 2CN8A 3VJNA 4JG8A 3BYUA 2UZOA 4ANOA 4OBQA 3CC6A 4M69B 5D9HA 4M0YA 2UW6A 4RJ8A 2Y4IC 1YHVA 4M7IA 4PPCA 4Z55A 4USDA 4CYIA 3NX8A 5HESA 3HYHA 2GMXA 4L45A 4HCTA 2O65A 3LFEA 4EOJA 5AR7A 4F7JA 5FP5A 3ORLA 4ZSJA 4F1TA 5AWMA 3QF9A 5HNBA 3ZC5A 4A9RA 3O71A 4CD0A 4CZYB 5LVPA 4EC9A 5ANKA 5FBNC 1LEZA 2Y8OA 4RIWB 4V0GA 2XNNA 4FV2A 3L8XA 1GJOA 3U6IA 2ZJWA 3CPBA 5ICPA 2C6DA 4ZSLA 4ZXTA 3Q53A 2OSCA 4FSZA 3FHIA 3FSKA 2VWYA 4JBOA 4Q9SA 4WOVA 4F63A 2X81A 4GL9A 3DBDA 2OZAB 3QC4A 4M68A 5CT7A 1W0XC 5B0XA 5AJQA 3OBGA 2XK4A 4F70A 5FTQA 2PSQA 4OGRA 4C57A 2OBJA 3FMLA 5FTOA 3PG3A 2EWAA 3NGAA 4ZJJA 3L8PA 4ZSAA 5IDNA 5AUWA 2WTJA 3RM6A 3BKBA 3LOKA 3ZLWA 1KSWA 3DBQA 5FD2A 3IGGA 1PMNA 3HV5A 3MIAA 3FYKX 2I40A 1BI7A 1DM2A 2C6TA 4C3FA 4M8TA 1KWPA 4O2PA 4RWKA 4RJ3A 1H28A 4YLJA 2B0QA 3MIYA 3OMVA 3OWPA 5FLFA 4FT9A 1H24A 5EW8A 2C0TA 4H39A 3FZTA 4XEYA 3ZDIA 4DLIA 4UB7A 2G2IA 4IHPA 5LQFA 2CLXA 4HGEA 3W33A 2QOCA 4RC2A 3A60A 5FEQA 4FG7A 3UBDA 4BYIA 5CU2A 1JAMA 3PPZA 3IKAA 3JUHA 5HE0A 1YKRA 3QQUA 3HV4A 3KF7A 3THBA 3FHRA 4MX9A 4MF0A 2YM4A 3HV3A 3RAHA 5ANDA 4J98A 3KF4A 4MXCA 4D4RA 4EHZA 3NCGA 4O27B 4WSYA 4I24A 3LFSA 3SDJA 3DKCA 1PXJA 2CSNA 4HYUA 3TV4A 4L00A 5JZJA 4U6RA 4XG6A 2ETKA 2GNIA 1YHSA 2QU6A 1UKHA 4NH1A 4ZY6A 4BB4A 1UNGA 4U97A 4QP9A 4Y5HA 2OKRA 2X2LA 4CEGA 2QHNA 5IH5A 3V8SA 4AE9A 1NVRA 3OWKA 3AC5A 2PE2A 5EDPA 2C5NA 3KN5A 4JIKA 4ERKA 2Q0BA 2PVMA 5AUYA 5DRDA 5EH0A 5HBHA 1BI8A 3EJ1A 4LUDA 5AUXA 4QMQA 2I0YA 5E8XA 1WBTA 4J99A 3DAEA 4I5HA 5CQUA 3UOHA 3ZO3A 4GUBA 4CTBA 4DLJA 3R8VA 3W2SA 4EK3A 2X1NA 3EQRA 3LPBA 2JIUA 2JC6A 4UX9A 1PXPA 3KXMA 1SYKA 4NTSA 4AQCA 3ROCA 4G3EA 4I92A 4O0WA 2BFXA 2H6DA 4PV0A 4CZTA 5F20A 2X0GA 4O86A 4NWMA 5BQ0A 4BF2A 4HGLA 5BVDA 4CLIA 2UZLA 4IIRA 4FIFA 4EH2A 3LMIA 3EKNA 2IN6A 5M08A 4MXOA 3OOGA 4AN2A 4MKCA 1ND4A 4FV7A 1JPAA 3W8QA 3ELJA 3Q4ZA 4ZAUA 3BQRA 5L2QA 3QZFA 2IVSA 2VO6A 3EIDA 3FZ1A 3UPZA 2BKKA 5IA4A 5A4CA 4W9WA 5IQIA 1X8BA 2BR1A 3DZQA 3NYOA 4QPMA 3CEKA 5KMMA 1LP4A 2P2IA 4F64A 3VF9A 3KU2A 1BLXA 4PMPA 3UG2A 3GFEA 2G2HA 4CVAA 2GCDA 2FSTX 1SM2A 4GKHA 4ZS0A 3P5KA 5EFQA 4RPVA 1MQBA 4TYEA 4CFMA 2RSVA 4DITA 5K9IA 2X4FA 2G2FA 4R3CA 3UO6A 3FMKA 3R9RA 3Q3BA 3BV2A 4ZTQA 2C6OA 2PVKA 4UXLA 3PTGA 4LOOA 5AR2A 1YWVA 5ETFA 2I7QA 2R3MA 3DXNA 3F3VA 3VRZA 4BYJA 4DYMA 4EONA 4PRJA 2ESMA 1UKIA 3NVKI 4IAYA 5HTBA 3OZ6A 5BUJA 2WTKB 3IG7A 2XK7A 3PIYA 2GS6A 2OIDA 3AXWA 2W1IA 2ITZA 1WMKA 4FV6A 5DA3A 3R9OA 4UMUA 4FZFB 1PYEA 4UWYA 3A99A 4IACA 3HMNA 4YZ9A 4BDDA 4RIYB 3ORTA 2HAKA 2DWBA 2J5FA 1BL7A 1O6KA 2WU6A 3AD5A 3FUPA 3HUCA 4E5AX 3F2RA 4XG3A 3UP2A 4JRNA 4HGTA 3SV0A 4YO6A 3QRKA 5EM8A 3IO7A 4BZOA 2WMRA 5CALA 2WMAA 4YNOA 2WIHA 3VVHA 4AX8A 2H8HA 4B0GA 4AA5A 1WVXA 3M2WA 3U6HA 1WBWA 3FPMA 1DI9A 2IW6A
chains in the Genus database with same CATH superfamily
3EYHA 4MXXA 2FSLX 2PMNX 1PMEA 2C3IB 3GQLA 4F9YA 5EYMA 5CAPA 4G3GA 2BFYA 4HCUA 3E5AA 5G6VA 3QHRA 1WVYA 4O0RA 5CXZA 4ZJIA 4E3CA 5IQFA 3HA8A 3V04A 1TKIA 3ORPA 3NUXA 3R8PA 4ASDA 4RX8A 4UN0C 3F3TA 5CXHA 3FMNA 5IA2A 2GNFA 2FSMX 3PE2A 5C03A 2KTYA 4XRLA 4AAAA 4FKRA 5AADA 3C5UA 3Q4CA 5IU2A 3O7LD 3MVJA 4IAAA 4EK8A 4MWHA 3TNPC 1JQHA 4ZLYA 2B7AA 4IVAA 4RRVA 4PP7A 4IWPA 4BCQA 4PDPA 3OUKA 4I5CA 2XK6A 1YDRE 5A6OA 3MPMA 3OCBA 4EEVA 5DR6A 2VRXA 3T8OA 3U8WA 4F6SA 3DQXA 2QD9A 3BU5A 4EK5A 4UMRA 4NYEA 4YLLA 5CZHA 3UVPA 1JBPE 5HD7A 3UNZA 2CDZA 2PUNA 2R4BA 4FGRA 5HD4A 4BDIA 3LIJA 2GQGA 4LYNA 4FK6A 4RT7A 4TW9A 3TIZA 3VUDA 3QD3A 1PY5A 1ZYLA 4E6QA 5KKRB 2CGWA 4CT1A 4DEIA 5IEVA 5AAGA 4C59A 2YM3A 4JR7A 3OXIA 2B53A 3NNVA 4WHZA 4PDYA 2W17A 3S0OA 4N4SA 2QOHA 1OKVA 3RVGA 1VYWA 4RVLA 4S32A 3RCJA 4KIKA 5IA3A 5BVEA 5HZNA 3H9OA 3U6JA 3NSZA 4LRKA 3H0YA 3WYYA 3O23A 2ETMA 2UZWE 4RWJA 4UWBA 2C3LA 3WIKA 1PRYA 3COMA 3LXNA 4AW1A 3PVWA 4FKUA 3VUIA 2IZTA 4DA5A 2PE1A 1ZAOA 4NFMA 4DG2E 5CU0A 4I6LA 5B2LA 4TT7A 3F5PA 2GFCA 4LQMA 5E8UA 1H0WA 3RPSA 3L9MA 5CAQA 5IQHA 3LXKA 1H00A 1A48A 1ERKA 2C68A 3R7IA 3FKOA 3DBFA 3E7OA 4RJ5A 4YJPA 3QKMA 2EUFB 4O38A 3DKOA 2ERZE 4PWNA 4NCTA 3DB6A 3OY3A 5AV3A 4ZTRA 4FK3A 3VUHA 5I3RA 2BZKB 5T6KA 5DI1A 4IANA 5ANGA 3BBWA 3KY2A 3DK7A 4KSPA 3LQ8A 2OGVA 4BTMA 4L46A 1U5QA 4G3CA 2Z7LA 1B39A 1Q24A 2BZIB 3UPXA 1PKDA 2CHLA 3DB8A 3FPQA 4C4GA 3NIZA 1KV1A 5HNGA 3CKXA 3WBLA 2C6EA 4QO9A 4R77A 3D4QA 3QQFA 2PTKA 3GI3A 4C3RA 5LMAA 4G31A 4P7EA 1WFCA 3SD0A 2PVYA 4YC6A 5JFXA 1GIJA 2VTRA 4PX6A 4BI0A 2GHGA 4FV5A 4C35A 3IOKA 4RC4A 3O0GA 2FUMA 2C0IA 4J71A 5BVNA 2BROA 3IW4A 3A4PA 4FX3A 4IE9A 3VW8A 4O7SA 2GU8A 3NLBA 1RJBA 5J1VA 4MNEB 2WNTA 4LV8A 4I6QA 4GKIA 2X8IA 4EC8A 4NT4A 2W9FB 3ZC6A 4N6ZA 4U44A 4BN1A 2JDRA 4APCA 3FAAA 3E7VA 3EYGA 5J95A 4OT5A 4ANBA 3DK3A 3LVPA 5HO6A 3RK9A 2YM5A 3S95A 4FTLA 5TT7A 1OL6A 2OU7A 4L7SA 4FTNA 4O7VA 4FVPA 5BVWA 3D83A 3S1HA 2W1FA 3KMMA 3E8NA 2VTMA 4L8MA 4BDBA 2BDWA 1GOLA 4D4SA 4EHVA 4GIIA 5DMZA 4GS6A 4P90A 1H1PA 1XH8A 1YW2A 4YLKA 4Q5EA 4XBUA 1E1VA 3GT8A 5EI2A 3LJ1A 2W99B 2X2KA 4XUFA 3SOCA 3F2AA 3SKCA 3AKKA 4O7NA 3JPVA 3TIYA 4KSQA 4FOCA 2P3GX 2B9FA 2OI4X 3DJ5A 3LE6A 5AX9A 4ACCA 2UZUE 3KC3A 5M4FA 4U79A 4FTUA 2XF0A 4KBAA 4FIJA 4RLLA 4FNXA 1VLRA 3DOGA 4I0TA 5IMEA 5M4CA 4UEUA 2VWVA 3HMMA 2J7TA 5JGDA 3TUBA 5CEOA 4DH1A 2F2CB 3H3CA 4HZSA 5GZAA 3TKHA 3SA0A 4DEAA 4ENXA 5A54A 2PMLX 4XX9A 4L01A 3MB6A 3UYSA 3WF5A 3QLFA 4DTBA 5M07A 5JGBA 3SXSA 3TTIA 4C38A 3ACKA 2O8YA 3O96A 3QUPA 3FQHA 5DGZA 4IZYA 4RVKA 5KZIA 5LXMA 4KRDA 4IAZA 1M2RA 2WMUA 4NCTC 5L2SA 1ZARA 3L8VA 2W05A 1UU7A 3AC2A 3UIMA 3PJ1A 4CFXA 4HVGA 4CZUA 1OL7A 4QRCA 2HWOA 3P4KA 5CSVA 3MTFA 4JBQA 4GH2A 3DPKA 5JRSA 4K6ZA 4EZ7A 3KK8A 3SRVB 4DHZA 5CTPA 3VS3A 3O17A 4AG8A 4F99A 2RF9A 3NYXA 4J97A 4RMZA 4E73A 3TNWA 5E8VA 1GZKA 3EWHA 2A98A 2VWXA 3D5WA 4TYHA 2ZYBA 3O8UA 4IAKA 4QTEA 3L8SA 5HX6A 4FEXA 4Z9LA 1ZZ2A 1H25A 4RFMA 4A06A 2BRHA 2PVHA 2BRBA 2WTWA 3SG8A 4FKJA 4FSWA 1Q8YA 5IUHA 3BZ3A 3VS4A 5T3QA 3OFMA 3JR1A 4M0ZA 2WEIA 4WNPA 3QZGA 5I9UA 4RLKA 4MBIA 4O21A 4MNFA 1YI6A 2W1ZA 4FIHA 4BGQA 3RGFA 1PXMA 4BIBA 4C2VA 2BHHA 2OWBA 4BCPA 2WMWA 2VWUA 1W84A 3OXTA 5L2TA 3T9TA 3OW4A 2BUJA 5ANOA 1NW1A 5CANA 2BAKA 1REJA 2YDKA 4A4LA 5HQ0A 1Q3DA 5DBXA 2O3PA 5DRBA 4F08A 3UG1A 4ONAA 1H08A 4GW8A 4YJQA 3WZEA 3VHEA 4IFGA 1QPCA 2XM8A 3E3BX 4WG5A 4PQNA 4G5JA 3RPYA 1Z57A 2QO9A 3ZLSA 3ZSHA 3ZRKA 1YXSA 4Q2AA 4ENYA 3H10A 2VX3A 3MPAA 3TXOA 4DINA 3U9CA 2VTIA 2VGOA 3RHKA 1XBCA 1CTPE 4PL3A 2ETRA 3RAWA 4F7SA 3QRIA 3CY3A 4NM5A 3U55A 3ANRA 4H3BA 3WE8A 4I0SA 2PVLA 5FBOA 2GNJA 2JIVA 4QTBA 3R9DA 3LKMA 1UU3A 3AC1A 3SW7A 2HELA 5J1WA 4XRJA 3BI6A 3NW6A 1MRYA 2XH5A 3AKJA 1CMKE 2ZB1A 2VTPA 3MSSA 3PA3A 4QMMA 5ACKA 3VW6A 4ANQA 4CGAA 3QA8A 2QNJA 2E9VA 5CT0A 3Q5ZA 5DEWA 3K3JA 2UW5A 3GC7A 2ZAZA 1IAJA 4CKIA 2ITVA 2QO7A 4BDHA 5J7BA 4ZP5A 1JKTA 5I4NA 3JYAA 5D1JA 1YDSE 4R78A 2XNPA 1R39A 2J4ZA 3BPRA 1M52A 2V55A 4FC0A 1PMUA 4FUXA 4Y5QA 3S2PA 2VTLA 4BZNA 3ID6C 3QU0A 3FZRA 5IQAA 4H1MA 4IVDA 4QP8A 4FTQA 1NVQA 4GRBA 3QC9A 4L43A 4PNIA 4GK2A 4P4CA 4X6RA 4BL1A 2HZ0A 5AR4A 4CXAA 5IUIA 5K5XA 3UIUA 3R02A 2VX1A 5JQ8A 3CR0A 3ZXZA 5IA1A 4DGLC 5FEEA 3MGYA 1AD5A 4Z16A 2XKCA 4RFZA 3FY0A 4O84A 3ALNA 2XMYA 4O7YA 3IDPA 3MFSA 4AUAA 4AW2A 4UYNA 3A8XA 4F78A 2QLQA 3UMXA 3O8PA 3DGKA 3PRFA 3K54A 2X0PA 5FEDA 5M51A 3MY5A 2I6LA 3BYOA 2BILB 3Q9ZA 3SXRA 4R1VA 4S33A 4AGUA 5FRIA 4FZAB 3NCZA 2BAQA 4FGBA 4FMQA 2AEGA 3TJCA 3KRXA 4HVSA 4B6LA 4YZDA 4JDHA 1KOAA 1PMVA 2PULA 4BWKA 3PRIA 2NO3A 2J9MA 4OTQA 4AT4A 5JFVA 3ZU7A 4F0IA 1F3MC 1QCFA 3POOA 4W4XA 3RALA 4BY9E 4ALUA 1CDKA 5HCXA 3TZ7A 2BDJA 4EOPA 4XG9A 2PU8A 2OFVA 4FKPA 2QG7A 4I21A 4I93A 3VS5A 4D1SA 3E8EA 2UZTA 4ZSEA 2UW4A 4J7BA 1V0OA 4NIFA 4YMJA 2XUUA 4LOQA 3NNWA 5ACBC 3SAYA 1YDTE 4RIXA 4IFCA 2FB8A 4L67A 1YVJA 1OECA 2XRUA 3DDQA 4LL5A 2R3RA 1H27A 2GDOA 3EFKA 4S2ZA 1KE8A 5CVHA 3FXZA 4DFBA 5DWRA 2PZ5A 4O0XA 3QRJA 3S00A 2PZRA 5AP2A 3V6RA 4EOOA 3LFDA 5AMNA 3TACA 3R6XA 3GUBA 4MHAA 4MH7A 1OIRA 2HY0A 2XJ1A 3HRCA 3LFAA 1LEWA 3PP1A 5JKGA 1H1RA 3POZA 4BCMA 2WD1A 3DY7A 4NU1A 2GFSA 2RFSA 4UMTA 2WMXA 4JX7A 2PVJA 4GYIA 4K9YA 2C5VA 3H30A 3OROA 2BZJA 4I0RA 3ZFXA 3F5UA 3RZFA 2JIIA 3OG7A 4EQMA 4BC6A 1YOLA 1STCE 3CD8A 4U41A 3TJDA 4BDGA 2VTQA 4LM5A 3A2CA 5FM2A 4M66A 2YIQA 1JVPP 5FXSA 3L9PA 5HO8A 2X7FA 3DLZA 5M09A 1VZOA 5H2UA 4KIOA 4AW5A 5K0KA 5FXRA 5AP5A 4DTAA 3A4OX 4BCHA 1FMOE 1LUFA 2BTRA 5G1XA 4BDCA 4KRCA 5AV1A 4CG9A 2YERA 2YWPA 3R63A 2WQOA 4LDTA 4E1ZA 2XCHA 1MUOA 1OUYA 2XKFA 3E8DA 4OBOA 4FVQA 1CKIA 1URCA 3KKVA 3KRLA 3QWKA 1ZLTA 4OUCA 3OW3A 5D12A 5GJDA 3RWQA 2A27A 4EOIA 2G1TA 3QYWA 3PWDA 3VQHA 3MA6A 5DVRA 5J5TA 5FP6A 2J0IA 4V04A 2XNBA 4O4BB 2F49A 4H36A 4YPDA 2YIYA 2YN8A 4PL4A 4XBRA 4XHKB 5C01A 5DFPA 4AXEA 3AC3A 3CGOA 1W83A 2RKUA 3QD2B 4MEDA 2JKOA 5DEYA 4ZTSA 2WMVA 3TDVA 5ETAA 3R30A 4QQ5A 3WZDA 3HP2A 4NW5A 1ZMUA 4FSNA 4W8EA 3HV6A 4GU9A 3R04A 4M15A 3LW0A 5AP3A 4D2WA 5HIEA 3W0PA 5E1EA 3EMGA 4OAVB 2B1PA 3AT4A 2E9UA 3M11A 4F7LA 4DGOA 4CRSA 2ACXA 4IAIA 4C0TA 4UY9A 3FQSA 4EOMA 1REKA 2QG5A 2QO2A 2FSOX 3GENA 2BRMA 2ERKA 2W1GA 3U4UA 2HK5A 3Q9YA 1PF8A 3HL7A 5EDRA 3ZMMA 2PUUA 2OFUA 2YFXA 2JFLA 1Q41A 3QUEA 4ZS4A 3UQGA 4HNFA 3UE4A 3NIEA 4FL3A 5HU3A 5I9WA 2R64A 3T3VA 2BAJA 4E8AA 4JXFA 4FIGA 4YTHA 4ZTNA 4I5PA 2F7XE 3FYJX 4OR5A 4L52A 3A7FA 4CLJA 3F6XA 3PG1A 3PVBA 5IDPA 3QBNA 5L8KA 2UZEA 5GHVA 4JL9A 5J9YA 3C4XA 2JDTA 3VJOA 3D5VA 3EL8A 3DBCA 3VF8A 1U59A 4UV0A 3BHTA 3ZUTA 3F82A 3IONA 2OJFE 5CF4A 2YEXA 1DS5A 4MAOA 4CNHA 3RP9A 1IA8A 4EYMA 3DNDA 5KUPA 3Q2JA 2GSFA 4FTTA 2QKRA 5EHOA 1G8SA 3IW8A 3MH1A 4JDJA 3ULZA 3PXFA 5CI7A 2RFNA 4QP6A 3TZMA 2CGXA 2V22A 5ANIA 2CLQA 3RWPA 3QKLA 3UODA 3EQHA 3ZTXA 4B8LA 5H9BA 4AZEA 4BI2A 4TYGA 4QPAA 3ORKA 1J1CA 3IW5A 2EB2A 3QLGA 3T9IA 2ZOQA 1J7UA 3BL7A 2YCRA 3Q04A 2RGPA 2YLEA 3CY2A 3GFWA 3QL8A 4OTFA 3ZSIA 2Y4PA 4BKJA 4RJ4A 5JMSA 2IG7A 2YZAA 3LFBA 4FKLA 2HENA 4O96A 1SZMA 3R83A 2OLCA 3EN7A 5E92A 5M44A 4KUJA 1F0QA 4P5QA 4PF4A 3VBTA 5HU9A 4IWOA 5HGIA 3NWWA 2PK9A 3H0ZA 3Q32A 3AGMA 2I0VA 4O0VA 4NSTA 3PVGA 3E64A 3QTIA 5HNIX 3NZ0A 4RIWA 2XIRA 4FTJA 4YGAA 3V5QA 3OTVA 4IB3A 5EDQA 3C0IA 1QPDA 3C4WA 3FZPA 2VZ6A 4XG2A 3DXPA 3UZRA 3C4ZA 1I44A 1OUKA 3P9JA 3RBWA 1B38A 3PSBA 2OZAA 3OVVA 2Y6MA 5CYIA 4YP8A 4JG7A 5HTCA 2AQXA 4FBXA 4E5WA 2GNLA 3WZJA 4WUNA 2ITWA 3AT2A 3FDNA 4AS0A 5E9EA 1OIQA 4GYGA 3R21A 2PMIA 4FKGA 4MCVA 4YC8A 5CU6A 4ZZOA 2OJIA 4EZ3A 4O83A 3FZOA 5KHXA 5DN3A 4C02A 2XKDA 4M14A 5ETCA 4FSRA 4BZDA 2FVDA 2WMSA 4GJ2A 5EI8A 3HRFA 3MS9A 3VUGA 1SVGA 3MN3A 4LI5A 4NM7A 4APPA 4BCFA 3ORNA 4QOXA 4O2ZA 5C9CA 3W0NA 2E9PA 2GPHA 1YRPA 1J1BA 2WZJA 4FT5A 4ZMFA 3MWUA 5E8WA 4UALA 3U4WA 3LLAA 4G9CA 1APME 1BKXA 1K3AA 4ZLZA 2UVXA 2YCSA 4PNKA 2B55A 3GU8A 1DAWA 4A9TA 2VTHA 4LV7A 4FT0A 2CPKE 2XYNA 5AA9A 5K4JA 4CQGA 2ITYA 1UNHA 3ML1A 2B54A 3LFQA 3HKOA 4BCOA 3PIZA 4GMYA 2XZSA 3ZONA 4X3JA 5GZ9A 3I6UA 4G17A 1PXLA 4DH8A 4Y83A 3GCPA 5LARA 2Q0NA 2ZV2A 4IM0A 3K3IA 4RZVA 2FGIA 4FR4A 1YWRA 2IZRA 1WBNA 2W7XA 5EKNA 2ZM4A 4TYJA 2Y6OA 5FG8A 4PTCA 3F7ZA 3R1QA 2IJMA 3FI8A 4O82A 4U45A 4D4VA 2BCJA 5FUTA 3KXGA 1P4OA 2R3HA 5AR3A 1RQQA 3W1FA 3SHEA 5IMXA 4DN5A 4BGHA 3GGFA 4A9YA 3JVRA 2CMWA 4EH5A 5KMOA 4LMUA 3EQPA 4NK9A 1H01A 4Y46A 3NVMB 2SRCA 3B8RA 3A7HA 5DOSA 5KBRA 1H8FA 2VWZA 3H4JA 2R3KA 4ZIMA 2BTSA 4NFNA 5CAOA 4WBOA 5CEKA 1XR1A 1SVEA 3FLZA 3NW5A 5EYCA 5GINE 1OZ1A 4UXQA 4HCVA 2OG8A 5BYZA 4F9BA 3PFQA 4ITJA 3F3UA 2GNHA 1W2FA 3VBYA 3TV6A 4N70A 1U54A 2HIWA 5CAVA 3ZHPC 3O51A 3TG1A 2HCKA 2UW3A 2BKZA 3WZKA 4X3FB 1OL5A 4AACA 3NUNA 2VNWA 4TKSA 4IX5A 4FRFA 3AQVA 3R28A 5HI2A 4DFNA 4ASXA 4MD7E 3UGCA 1K9AA 5CQWA 1H1WA 4C4EA 5KO1A 3UDBA 3HA6A 3QCYA 4WA9A 3UOKA 3MW1A 4D2TA 1R3CA 2JDSA 3KMWA 3UOLA 4BDAA 4PY1A 4TRLA 4ASZA 1FPUA 2XALA 2XA4A 1Q62A 3MA3A 3RK5A 1RE8A 3PJ8A 2UZVA 3GBZA 3EOCA 1FVTA 5TR6A 2B9IA 4HZRA 2QOBA 3GC9A 4D4YA 2XB7A 4FJVA 4F1OA 4OTHA 3SXFA 2FA2A 3PY3A 4DF3A 5K0XA 3AKLA 3DJ6A 4DT9A 3GU7A 3G33A 3ODYX 4FEUA 5HCYA 5BUIA 4IVBA 5EQYA 4AOIA 2UV2A 3ENHA 5CI6A 5TF9A 2QOLA 3MFRA 3JS2A 3OWJA 3HDNA 1XJDA 2PHKA 2R0UA 4G3FA 4O0UA 4K8AA 1KE6A 3FLNC 4NTTA 3IK3A 4BKZA 4RX7A 4KKHA 4RIYA 2VO7A 2HYYA 3PPJA 4QMXA 1YXUA 2I0EA 4AT3A 4IM2A 5JGAA 1SNXA 2WO6A 2C1BA 4RA4A 5HG7A 5CY3A 4AZTA 2J0LA 3ORIA 2I1MA 3AT3A 4FKWA 5DIAA 4DHFA 3RAIA 3RNYA 3AC4A 3BWJA 3BE9A 3C1XA 3ZXTA 4Q5HA 2Z2WA 3LM0A 2EXMA 2JDOA 3MJ1A 5CASA 5I9YA 2P4IA 4F0GA 1OB3A 3ZRLA 3PLSA 4C33A 1YOMA 4EHEA 3F5XA 4YJOA 5BVKA 3NDMA 1PXNA 2RG6A 3TNQB 4D9UA 4X2FA 3I81A 4U40A 2PPQA 1O6LA 5DT0A 2WB8A 3FL5A 3R22A 4BIEA 1XH7A 1L8TA 4O7WA 3Q6UA 4GU6A 1OPKA 2AUHA 4BKYA 3TMOA 2QURA 4GV1A 4QMLA 4Z3VA 1O6YA 3M1SA 4DH7A 5GNKA 5AV0A 4JG6A 3QTUA 3FL4A 4NL0A 3DBEA 4MD9E 4JJRA 5C8NA 1A06A 2X9EA 3TDWA 3BGQA 4ERWA 3NUAA 5AR5A 3LZBA 3R1NA 4RX9A 3KIOC 4Y8DA 3CPCA 3CGFA 3SX9A 2VTJA 1W7HA 4OTWA 4BHNA 1GZNA 4X2KA 4FKVA 3U87A 3A7JA 1E9HA 4O4FA 2CGVA 3F5GA 3HP5A 5EKOA 2YM8A 1UWJA 3RPOA 3TZ8A 1ZYDA 2WU7A 2UVZA 4LGGA 4ZZNA 1GIHA 4AA4A 2C1AA 3NAXA 2QOQA 3UC3A 3VIDA 1FMKA 1OIUA 1Q8UA 1ZRZA 3SQQA 3UIXA 3BLRA 3FKNA 3LCKA 1S9IA 1ATPE 3MVHA 4I1ZA 1H0VA 3GEQA 5CNOA 5CENA 5D7AA 4DBNA 5L6PA 3IPHA 3FQEA 4FIIA 4WSQA 2R3JA 4I4EA 4E4MA 3ZM9A 2ITQA 2Z60A 1FVVA 4G1WA 1KOBA 2WTDA 1B6CB 2Z02A 2B9JA 2GNGA 3GU6A 3FLQA 4FICA 4QMPA 3BHUA 2UUEA 1PHKA 4NKAA 2JBPA 3WARA 1Q99A 4UMPA 5L2IA 3ULIA 4O7LA 3G6HA 5LMKA 2R7BA 3M42A 2J6MA 2WTKC 3G9LX 3I7CA 3LFCA 3MTLA 1MQ4A 3QTXA 4E4XA 5AFVA 4JNWA 3F69A 5L8JA 4DFLA 3BYSA 3F88A 5LJJA 5C4LA 1NXKA 5A4QA 4FT7A 2C3KA 1UVRA 3LFNA 3Q9WA 1BMKA 3WF7A 3E3PA 3S3IA 3UMWA 5L6OA 3ZFYA 5CEQA 2J2IB 2C6MA 1ZOEA 3I5NA 1OKYA 2NRYA 3GCQA 2A2AA 4JLCA 4A07A 3AG9A 3BEGA 1ZXEA 3EL7A 3TNIA 4WRGA 3VWAA 5AA8A 4FV0A 5FQDC 1TQIA 2BIYA 3W2CA 4JQ8A 3Q9XA 3ZBXA 3V51A 3NRMA 4AXAA 1JOWB 1NVSA 2YISA 2PVRA 3CD3A 3OCTA 2BIKB 4CCBA 4M13A 3E87A 3LXPA 2IVVA 1W98A 2C0OA 5FDXA 4MTAA 3UQFA 4XP2A 4BR3A 1VJYA 3D7TA 1Y57A 1QMZA 3C4CA 1CM8A 3V5TA 4EK4A 4FV8A 2O64A 1BYGA 5K3YA 4TNDA 1JSVA 5IG1A 2WKMA 5H3QA 1V0BA 4L3LA 4D28A 3IOPA 5IQEA 3OXZA 3BE2A 3G2FA 4QEBA 1Y6AA 3BLHA 5J7HA 2YAAA 4R5YA 3PP0A 3KXZA 2VTOA 2E2BA 2ZVAA 4U5JA 3SLSA 3VS7A 3BL9A 3RPRA 3O50A 5BYYA 5AAFA 4XCUA 1QPEA 4AWIA 4GIHA 4H3QA 4QP4A 4CKRA 4C4IA 4RZWA 2W0JA 2XEZA 3UDZA 3R8LA 3FV8A 3UC4A 3IW7A 4H58A 5A14A 3ANQA 3KULA 3GOPA 4YPSA 2PUIA 4DDGA 5CVGA 3R8UA 4M12A 3FI2A 5KCVA 4YZBA 3EZRA 4NJDA 4JQ7A 2OICA 4RVTA 4TYIA 5KBQA 2GQRA 3E92A 1U4DA 4QP3A 4E7WA 2CN5A 2RFDA 3DKGA 3QD0A 3N51A 5BVOA 5FDPA 4DCAA 2OZOA 5KKRC 3V5JA 3BQCA 2QHMA 4K2RA 5CEPA 3QGYA 1URWA 1Q97A 4BWXA 5EQPA 2XK8A 2C30A 2XJ2A 3MPTA 1RW8A 4YHTA 4ACGA 2OJ9A 4CMUA 4F9WA 4F09A 2RG5A 3PLAE 2JD5A 2J5EA 5IA5A 2WTIA 4XNEA 4Z7HA 3G6GA 3PSCA 5CS6A 5A9UA 1F5QA 4G3DA 3WF9A 4L44A 5I9VA 4C37A 4CFUA 2NYAA 3GU4A 3BIZA 4CFFA 3ATTA 4A9UA 5LMKC 2VTSA 2YIWA 3UQCA 5J79A 4PTEA 3L1SA 4EOKA 1ZWSA 5IISA 2XAOA 1CSNA 4AA0A 4FUYA 5AM7A 3VBWA 4EHGA 3AMAA 5CVFA 4DGMA 5A4TA 4CKJA 3R9HA 3UZTA 1Q8TA 5LVLA 2CNQA 3H9FA 3R7YA 2PWLA 4XYFA 1XH4A 5DH3A 2VNYA 3DQWA 4IM3A 4KD1A 4MVFA 3RKBA 4TYHB 4BBEA 3FZSA 1ZZLA 3FKLA 3MYGA 1WBPA 4GEOA 2F7ZE 2EU9A 4ZTLA 4EH6A 2HXQA 5JRQA 2IVUA 3G90X 4AGWA 2W96B 4GK3A 2YCFA 4F7NA 4NJ3A 1AGWA 4S31A 4O81A 4ZMEA 5HLWA 4PDSA 4L9IA 1H1QA 3IQ7A 4O0SA 4NUSA 2X6DA 3RM7A 3ZYAA 3P5JC 4A7CA 3EQIA 4QDVA 2X2MA 4PTGA 3DS6A 3PXKA 4U43A 2X7OA 3JVSA 2ZB0A 4FTKA 5AM6A 3WF8A 5CF8A 4WG3A 5AP7A 1ZYCA 3CTJA 3OT3A 5HG5A 4AZFA 1M7QA 3DNEA 2UW7A 1P4FA 4EKKA 4RWIA 4AZWA 3FEGA 4EZ5A 5DPVA 4L3JA 3BGPA 3RK7A 5GIOE 4O6LA 3E88A 4JMQA 3RINA 4AZVA 2IEWA 4HVDA 5D7VA 3PZEA 4E6DA 3MY0A 4KIPA 3HDMA 3EQGA 4KB8A 4JOAA 2XIYA 5TOZA 5CEIA 3DCVA 3DDPA 1PJKA 4LGHA 4QQCA 2A1AB 2R3FA 4HGSA 2VU3A 4FEVA 5HIDA 3CS9A 3DV3A 2QQ7A 1GZOA 3R7GA 1GY3A 1OGYA 5GJFA 3CSVA 3E93A 1GNGA 2VN9A 4DGNA 3W55A 4JQEA 3I7BA 3DAKA 2VTNA 1JSTA 4RWLA 4QMYA 5BYLA 2O0UA 3AC8A 1KUTA 3OWLA 2ITNA 4H3PA 1XBAA 3FI4A 2YHVA 1BL6A 1JSUA 3MVMA 4FL2A 4IVCA 4UMQA 2JFMA 1QL6A 5AUZA 1WCCA 2YM6A 4BTJA 1WAKA 4JDIA 4N0SA 5JSMA 3R7VA 1OL1A 5M55A 1NY3A 4WG4A 3KXHA 4EH3A 4R6VA 3U51A 2AYPA 3NUYA 4IB5A 2WEVA 2XYUA 3ZLXA 2YITA 3AOXA 4LRMA 3VO3A 3II5A 2VGPA 3GOKA 4O1PA 4PMTA 2ITXA 3BLAA 5KNJA 1OVEA 5DYJA 3QTWA 4G2FA 3EFJA 3NR9A 3BELA 2CKQA 3VC4A 4G9RA 3QTSA 3QRTA 5KMKA 1YXTA 3PSDA 1YXVA 3NAYA 2XCKA 4I22A 5DG5A 4XOYA 3TKIA 4CRLA 4CV9A 4EH7A 5HX8A 2GTNA 5GJGA 4N57A 4M3QA 5DLSA 3E63A 3RI1A 3VBQA 5T68A 3NPCA 3V01A 3D0EA 4FTRA 5DT4A 1MP8A 2J0MB 4EOLA 4FTAA 4KS8A 2DYLA 2NP8A 4GFGA 2LAVA 4DG0E 3NNXA 1H26A 2EXCX 2QONA 3ZUVA 3OT8A 2WHBA 4M84A 4I6FA 3AD4A 2R3QA 4OBPA 2R3OA 3EQDA 3PUPA 3COKA 4ANMA 4ZOGA 4NIFB 3ZZEA 3MVLA 4TWOA 3D9VA 3FC1X 4QP2A 3PXYA 4A9SA 5ANJA 1Q61A 3OCGA 2G01A 5E8YA 3GVUA 4C36A 3V8TA 4D1XA 3PWYA 2BRNA 4I3ZA 4XOZA 3BV3A 5DR9A 2W5BA 3UTOA 5J5SA 4DEDA 3KGAA 3BU3A 4C34A 3G9NA 1H1SA