4UMTA

Structure of melk in complex with inhibitors
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
331
structure length
316
Chain Sequence
DYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDTAAALVAKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MATERNAL EMBRYONIC LEUCINE ZIPPER KINASE
publication title Structure-Based Design of Type II Inhibitors Applied to Maternal Embryonic Leucine Zipper Kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 316
sequence length 331
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4umtA00
1BX6A 3FXWA 2GHMA 1F0QA 3AT4A 2WXVA 2WTJA 4FOBA 3LM5A 1YHSA 4RFYA 2HYYA 4ZTNA 4IVCA 2CJMA 2PVHA 5T68A 4ZEGA 3C4FA 3KMUA 4IC7A 3VUDA 5ETIA 4TRLA 3KXMA 2QKRA 5LVNA 5HEZA 4P5QA 4KKGA 1BUHA 3H0ZA 3PSDA 3ZH8A 3NYVA 5FWKK 2P2HA 4IZ5A 4UMQA 5FEEA 4IANA 4UXLA 3THBA 2PY3A 4NK9A 3TTJA 4ZTQA 4IX5A 3EFJA 4F9AA 3KN5A 5CF8A 3RGFA 4UYAA 1PMUA 3TZ7A 4RX5A 3VQHA 3Q3BA 4F64A 3R9HA 5CZHA 2C0OA 3QGWA 3MA6A 1ZOEA 1A06A 1KE5A 2VTIA 3ORXA 4I24A 4O6LA 2W1IA 5AP1A 4CLIA 1STCE 4R5YA 2G1TA 4C02A 5LMKC 4AE6A 2I0VA 4I3ZA 4YHJA 3ZS5A 5CI6A 5AUVA 3LFFA 3OHTA 1JKTA 2GS6A 1ZMWA 5J7HA 2R7BA 3K2LA 4QMUA 4J1RA 5ANJA 3ROCA 2PZPA 3W33A 2VTHA 5HLWA 5AP5A 4ZZMA 1H25A 3KRWA 2OG8A 4YJVA 5B2KA 2IW8A 2JIUA 2ZM3A 1XH7A 3ZEWA 4Y5HA 2QURA 2FB8A 2E9UA 3H9OA 3QX2A 4NM3A 5CLPA 1Q41A 4FT0A 3RK7A 3DLZA 2F57A 2OK1A 5A4LA 2O5KA 4WKQA 3AC2A 4MQ1A 3AD6A 4YGAA 5CY3A 2W1DA 3D7ZA 4QP4A 4KKEA 3W2OA 3RWQA 2JFLA 5I9ZA 4YO4A 4RQVA 1FQ1B 1T46A 4QMSA 2WELA 4IZAA 3EWHA 3FLYA 2VTTA 4C37A 5J7BA 4EOJA 4IFGA 2V5QA 4RIXA 2WEVA 5DEWA 2VTAA 5AP3A 4L68A 5LVOA 3WIKA 3UE4A 1WVYA 4LMUA 5DT0A 4FL2A 4RC3A 1DAYA 2AC5A 4EK4A 3QTXA 4YURA 2OH4A 4GIHA 5H8EA 3FC2A 2YISA 4QP6A 5L2SA 1H1WA 2O64A 3R1YA 5CU0A 4R7IA 3QCSA 3FXZA 3DKCA 2XKDA 5HX6A 4FZ6A 4U5JA 4WNPA 1ZMUA 2VTRA 2ZV2A 4MBJA 2WTKB 4ONAA 1PXJA 4IJPA 4E4NA 4F9WA 1CDKA 2R3QA 4NM0A 2VWIA 2X6DA 4NFMA 1R0EA 2ZJWA 3TJDA 3QGYA 3CY3A 5L8LA 4ZSEA 3MPMA 3P78A 2YM5A 3O51A 3LCDA 3KC3A 5A6NA 3EN4A 4RIXB 1PXOA 2G2FA 1BL7A 4LGDA 3GEQA 5E8WA 2JEDA 3FE3A 4WUNA 2E9VA 4D58A 5BVOA 3QRJA 4CMUA 3BLRA 4G9RA 3RCJA 4QYGA 4AW0A 2JKMA 1VYWA 2GNGA 4FIJA 5JFWA 1LEWA 1PMNA 3VS3A 3ZXZA 4F7JA 1UNGA 2HCKA 5DMZA 2HW6A 3PVGA 5BYZA 1BI8A 2WTKC 4DEAA 5HBJA 2O8YA 2P2IA 4DFYA 2FSLX 4O0YA 4EC8A 4BCPA 1X8BA 4KS8A 4F99A 5DIAA 1J91A 3GU8A 3BE9A 2JIIA 4KB8A 2V55A 4R1VA 5FD2A 1O6KA 2VWYA 2J51A 4QMOA 4EOPA 1M52A 5AP2A 3AT3A 3VO3A 4CZTA 1OPJA 4PF4A 2AYPA 2EXMA 4KA3A 4KIQA 4OBPA 5AV1A 4AFEA 3EYHA 2X0GA 2YN8A 2X2MA 3CLYA 3LCOA 5EDQA 3OP5A 4CEGA 3FXXA 3ZU7A 5B7VA 3R04A 4GS6A 3C4EA 4FKIA 2IVSA 3I7CA 3DBEA 4PQNA 4DH1A 3DK3A 4G3GA 4UWCA 3U4WA 4BFMA 3PJCA 4FTMA 3DY7A 3SLSA 4QMZA 3IS5A 4ASDA 3LAUA 5FEDA 3PY1A 3F7ZA 3NW7A 4J97A 3U8WA 5CAUA 5FRIA 2ESMA 3E8NA 4CKJA 4F9BA 4U3YA 3KU2A 3UIBA 4UV0A 3AMBA 3FZTA 2WQNA 3BCEA 1PXMA 3FI4A 4CCBA 4XH6A 3JY9A 4RT7A 2QHMA 4U0IA 4ZZOA 5AMNA 1YHWA 3MVHA 5HCZA 1K2PA 3R7UA 4JS8A 2O0UA 2V7OA 2BIYA 3AG9A 3BU6A 4XOYA 2YWPA 4D0XA 1FMOE 1WBOA 3D4QA 5HLPA 4GU9A 2B7AA 3R83A 4Z7GA 2WFYA 4FZAB 5ACBC 5L2WA 5HO7A 3B8RA 4BDBA 5L2TA 3RM6A 5TOZA 1XQZA 2XJ0A 4G1WA 3LFAA 1B39A 3GCVA 4TT7A 2ITQA 4PMMA 4EOLA 3HV6A 3EQDA 3L8PA 5HU3A 4HYUA 2WKMA 1Y8YA 4TWOA 2EXEA 2HXLA 4X2JA 5EK7A 4AW2A 2YDIA 5FDXA 5JH6A 1Y6BA 5HTCA 3CQEA 5GJFA 4ZSGA 4DH5A 5KBQA 5CSVA 3PY0A 3GQLA 3O7LB 4CTCA 4D4VA 2FH9A 3DBFA 4CT1A 2ACXA 3W2PA 1M7NA 1VR2A 3ZCLA 3ZMMA 3WZEA 5LVMA 4FKWA 3NNUA 3OT3A 2ONLA 2H6DA 5AWMA 2CMWA 1R78A 3QRIA 2QOLA 1XBBA 1S9IA 3WF9A 4FSWA 3UZTA 3UNZA 4IJ9A 5DR9A 1UWJA 4BIBA 2CCHA 4E6AA 5GHVA 4HNFA 4I21A 4USDA 4AA0A 4EOKA 4EQUA 1FINA 4RVLA 4G5PA 4BWKA 3QA8A 4D2PA 1UA2A 2QKWB 3FMNA 5HVKA 3W1FA 4WUAA 4B99A 3Q4TA 4FR4A 5HNBA 4C4GA 2W1ZA 4I0TA 3D2IA 1KSWA 4MX9A 4GVAA 4IC8A 3AC3A 1CM8A 4JG6A 3HP5A 4TY1A 4KIKB 4L3LA 5HO6A 5T6KA 3VWAA 3DPKA 2SRCA 3DJ7A 3E93A 4KKHA 3AD4A 2GFCA 1GOLA 3NPCA 4GCJA 2ITPA 5CEIA 3ZO3A 3FJQE 3OUKA 4FSTA 2JD5A 3WZDA 4A06A 4LV5A 5IF1A 3UO5A 4DH3A 2C5NA 3P1AA 4BKYA 5EG3A 2QLQA 2XJ2A 2YCRA 2VTQA 4ZOGA 4AN2A 4CMOA 4DH7A 4Z3VA 3FMKA 4L01A 4EK3A 3NUSA 2ITOA 3KKVA 1H1RA 3UIMA 4O22A 3ZYAA 1U59A 4P5ZA 3TZ9A 4UXQA 1OL6A 2VWBA 3V6SA 3UTOA 5LWNA 5JFVA 4N4SA 3SOAA 1W8CA 1LUFA 5E8UA 1Q3DA 5CSPA 4GIIA 2DUVA 2IZSA 3S95A 2LGCA 4NUSA 2X9EA 4Z55A 3R00A 4AN3A 4RJ8A 1FVTA 3FBVA 4XS2A 1ZOHA 3A61A 3PIZA 2FUMA 3Q5IA 4D9UA 2JFMA 2Y4PA 3ROYA 3EHAA 3EQIA 2VO7A 3MSSA 4X0MA 1H26A 4RA4A 4RWKA 3RWPA 2HOGA 2XK8A 4RVKA 4YC8A 4BCOA 4UMRA 2ONLC 4A4XA 4XJ0A 3BEGA 4UY9A 2C6OA 4AE9A 3OEZA 4A4LA 2B54A 4FTKA 4ZTMA 4HZSA 4WSQA 5EI6A 2VNYA 3OS3A 5IA0A 5K4IA 5CU3A 4EHGA 2BROA 3KCFA 4MEDA 4E6DA 2Y0AA 4GSBA 4JOAA 3VBYA 5AP6A 1XH5A 4IM3A 4G34A 5DOSA 5C01A 4AOIA 2PZYA 3FWQA 4RX9A 5JN2A 3CCNA 2G01A 2R5TA 3MFUA 3TV7A 2VWVA 5C9CA 4FNXA 5IISA 2XF0A 4DN5A 4QQTA 4R3RA 4O1OA 3CBLA 3F2AA 3MVJA 5E8SA 2DYLA 4J99A 3NEWA 1ZYSA 5IUHA 4IB1A 3SDJA 4GL9A 5A6OA 1YVJA 1WCCA 5EKNA 4ZSLA 1XH6A 3QX4A 4PUZA 4LUDA 4XG7A 2R3IA 4DHFA 3BHHA 3G2FA 5JGBA 2C30A 3GUBA 4C3FA 4D4RA 3IO7A 4JL9A 2ITXA 3PVWA 2BAQA 5HD7A 5T3QA 3G6GA 3A2CA 3I1AA 2E9NA 4H39A 4HYIA 5EKOA 4AGWA 3AMAA 4CYJA 2XYUA 5D12A 2RKUA 3FLNC 3L9LA 1WBNA 5ETFA 5K0XA 3LJ2A 4D1SA 4DCEA 4EH8A 4B8LA 2QD9A 3BKBA 4APCA 1V0OA 3RAKA 4IACA 4KS7A 3KULA 3E92A 3RHXA 1OMWA 2XK6A 4HYSA 3C4ZA 3R8VA 4C62A 1CMKE 4XX9A 5LMAA 5C8MA 4U41A 5AAEA 5IMEA 1UNLA 4O91A 4BDDA 4QYFA 3EN6A 4EYMA 3G0FA 4PDPA 4BRXA 4TW9A 3CJFA 3GCSA 3UGCA 3GCUA 3F82A 3FSKA 3WBLA 3ZC5A 4RC4A 4BDJA 5DLSA 3UQGA 4BBMA 5L6WL 2DQ7X 1Q3WA 3D94A 4OTRA 3UZPA 4D28A 2OIQA 2XRWA 4RIYB 5IU2A 2PWLA 3HA6A 3R8UA 3O7LD 4RIWA 5ANEA 2ZDTA 4X3FA 1JKLA 4S2ZA 3E63A 3F5XA 2VX3A 3HV5A 4AA4A 4FSZA 5KBRA 1MP8A 4WD5A 3C4CA 4YPSA 4UX9A 3KN6A 3L9MA 5DA3A 2OIBA 3OOMA 3HA8A 4YBKA 3F3TA 5TO8A 5TT7A 3CQWA 2J5EA 5HD4A 4ITJA 5G1XA 1YOJA 4FICA 3DAEA 2X8IA 4MXXA 1YI6A 2OI4X 3WF5A 4DGNA 4MNFA 3F9NA 4JBOA 4Z9LA 3HNGA 4DGOA 2A0CX 4ZTHA 4GEOA 4LV8A 3CPCA 3UOJA 2CGVA 3ZDIA 5FEQA 2YCFA 3R63A 4RFMA 5AIRA 4XBRA 2W1GA 1SVEA 5FQDC 3Q6WA 4YR8A 3GNIB 2ITYA 4BWPA 4W8DA 2FSMX 2VGPA 5KZIA 2C0TA 1BI7A 5F20A 3P7CA 1G3NA 3DFCB 3BV3A 3IGOA 3OMVA 5EI8A 3LFNA 2YCQA 4Q9ZA 4RIWB 3R1SA 4PMPA 5AV3A 4MD7E 3TWJA 3UMXA 4CRLA 2Y8OA 1W7HA 5I9VA 4MKCA 4NU1A 3IW6A 5J1WA 3F61A 3R8MA 3VQUA 4F7SA 4X6RA 1YI4A 2IWIA 5L6PA 2JC6A 3TG1A 2VTPA 4MYGA 3BYSA 4JIKA 1ZYLA 4HNIA 4KINA 4U81A 5F4NA 3FHRA 3UQCA 3AC8A 2X7FA 4YZBA 1I09A 3HRCA 2CLQA 4Y46A 2YM4A 4N70A 5E91A 3RPYA 1GAGA 3GU5A 3R7VA 3RM7A 3R71A 4MXYA 2WZJA 1KV2A 3ODYX 4FMQA 1OKZA 4EH4A 4KIOA 4TWCA 5CI7A 5J8IA 2A4LA 5M4IA 5H2UA 3BZ3A 3F3VA 5D41A 1QPDA 3NNXA 5M57A 4BKJA 3RKBA 2QO7A 4JAIA 1PKGA 1Y91A 1FPUA 2JBOA 3HMPA 3ENMA 3MB7A 2J0MB 2VZ6A 2HWOA 4UBAA 4ACHA 4E4XA 3DNDA 4D2WA 2X2KA 1APME 4C4JA 4AP7A 3NUNA 5FTQA 5BNJA 4ZY4A 4CYIA 2W1FA 4B4LA 4Y95A 3VRZA 2QOCA 4BCIA 1XH8A 2PL0A 4C57A 3KXHA 3DAKA 1OIUA 4I6HA 3ORLA 2PMLX 2QU5A 2XNMA 3LE6A 5L2IA 3GP0A 5HG8A 3TCPA 3RAHA 2ITWA 2OXYA 2X1NA 1CSNA 2ZV7A 2PK9A 4AZVA 3PWYA 1GZ8A 4XG2A 1ZRZA 3VBTA 2XKEA 3DA6A 4AF3A 4DH8A 3HGKA 2PVMA 5EM7A 5HESA 4AZFA 3R0TA 4LOPA 3VUTA 4D5HA 4BDKA 3DQXA 3I5ZA 4XG6A 4BZOA 3ULIA 3QQJA 4E8AA 3PVUA 4J7BA 4QMPA 3LLTA 5CAOA 4QMTA 5KMNA 4CQEA 3C9WA 4JR3A 2C3IB 3GI3A 3CKWA 4FSYA 4EKKA 1DAWA 3R2BA 4NM5A 2REIA 5D11A 1FGIA 4IXPA 5G6VA 3FY2A 2FSTX 5IPJA 5ANOA 3QWKA 3UC3A 2YIXA 3MJ1A 4DG2E 3BBTB 2GS2A 4K8AA 4GRBA 3B8QA 5CEPA 3RK9A 2WOUA 4QMMA 3VN9A 4EHZA 4BCGA 4C2VA 3TV6A 5CASA 1YDRE 1MRUA 2CGUA 3PJ2A 3KXNA 4FKLA 4FKSA 2CKEA 4IDTA 3ZLYA 3JPVA 3CEKA 2W06A 4APPA 5CALA 3LJ0A 1Q4LA 2O3PA 2UVYA 3FMDA 5J87A 3FYKX 4FV9A 3VBQA 1U5RA 2B9HA 2WMXA 5HOAA 5IA2A 1H8FA 5E92A 4XG9A 4UN0C 1M2RA 4F0IA 5A4CA 3MIYA 4GFOA 2Z2WA 4QYYA 4U44A 4XMOA 3ANQA 4CCUA 3A7HA 5D7VA 5C8NA 1JVPP 4H1MA 1XH4A 4YLLA 4AACA 2XKCA 3UODA 2PVRA 1WBTA 4BDAA 5FG8A 1VZOA 2VD5A 5CEOA 4QMVA 2IO6A 4RC2A 4BCHA 3CR0A 4A9TA 1KOAA 2ITZA 3UYSA 5E8XA 3QCQA 4GYIA 4C4EA 4M3QA 1OUKA 1Q8YA 3II5A 3QC4A 3QD2B 4QPMA 4P2KA 5AAFA 1KV1A 2QODA 3KFAA 3KGAA 4YJNA 5AR2A 2C4GA 4ANMA 4F1TA 5LMBA 3KF4A 4OTDA 4WT6A 3QTRA 3NR9A 3C5UA 4FG9A 4RVTA 3FPQA 3W2RA 2PUUA 3O0GA 4FTTA 4JDJA 1R0PA 4JI9A 4NTTA 3R73A 3QTIA 4G6LA 1WBSA 3BLQA 3A62A 3C7QA 5K0KA 4TYHA 2WTVA 2NRYA 1GZOA 4L8MA 5ANDA 3IG7A 3OXTA 3ZUTA 4A7CA 1PYXA 1AD5A 2C1AA 3BYUA 4BIEA 3V8TA 2ZV9A 4L42A 3WIGA 2HW7A 4QP1A 4WBOA 2CSNA 4WRSA 2CPKE 4V05A 5HE3A 5HVJA 4BCFA 5JMSA 1JBPE 3A7IA 4HJOA 5M51A 3A60A 2BKZA 5DH3A 4ZY5A 5LCJA 2GTMA 4HZRA 2QOIA 2RG5A 3FV8A 3QUPA 4FNZA 4EQMA 4BB4A 1SVGA 5JRQA 2XK4A 4K77A 2KTYA 4PTGA 4B6LA 2BRGA 1FGKA 5KMKA 4NFNA 2WHBA 1H28A 2KULA 3R22A 5JT2A 4F9YA 4F70A 3FAAA 5M53A 2VTMA 2XVDA 3I4BA 4C3PA 5IA3A 3BYMA 2PZ5A 3LM0A 4D1ZA 4HCUA 2NP8A 4XNEA 3WZKA 2BTRA 4YNOA 3D15A 2BFXA 1RJBA 2J0KA 1JPAA 3CIKA 3QD3A 3R28A 3RHKA 3V8WA 2AC3A 1FOTA 3HZTA 5EM6A 1PMEA 1M2PA 5EM8A 3HUCA 5JGDA 1GNGA 3R8ZA 3Q96A 5E1EA 1BMKA 3TKUA 3C0HA 1E1VA 2OKRA 4O2PA 3JUHA 1JOWB 2PZRA 4FF8A 3VC4A 4Z7HA 2ZMDA 2XIXA 4QYEA 2W05A 5CAQA 2QI8A 4Y83A 2ZDUA 2IZUA 5AUYA 1OKYA 4U8ZA 4D0WA 3VULA 3V3VA 3DBCA 4JX7A 5A54A 2WB8A 4WNMA 4C0TA 2PVJA 4RJ5A 4FV4A 2UUEA 3EZRA 2R9SA 3EQFA 3MTFA 3VHEA 2CGWA 3SHEA 3IDCA 4QP7A 4EWHA 3IPHA 4R3CA 2IN6A 1JKSA 2P33A 3LJ1A 4YJTA 5AUWA 1W83A 3G0EA 1UWHA 3MFTA 3RPVA 4JG7A 2J5FA 2XCHA 2CHLA 3FYJX 1Q97A 2OFUA 3OD6X 4E1ZA 4M13A 5AEPA 3G33A 1ZARA 3IKAA 1YOMA 4AG8A 3ANRA 3MWUA 3BIZA 3BHUA 3HL7A 5KE0A 3TUDA 3VS5A 3PXZA 5GJGA 3K5VA 4LGHA 5L8JA 1SVHA 4F7NA 4WO5A 5K4JA 4BHZA 1QPJA 3MFSA 4MK0A 2RIOA 3QALE 3BEAA 3G5DA 5J95A 5AV4A 4FIEA 4B9DA 4Y5QA 2YM8A 3ORKA 5AIKA 3CQUA 5JKGA 4EOSA 3FUPA 3NAYA 3W8QA 4LYNA 4ANLA 1OL1A 4ZJJA 4AX8A 4HVDA 5A4QA 4E4LA 3LFCA 3KVWA 1WBPA 1QMZA 5EHYA 5HCYA 3R7OA 1M17A 1B6CB 4K0YA 3S1HA 1YWVA 3P7BA 4CKIA 4A9YA 4BTFA 5I0BA 2UZWE 3A7GA 2C3LA 4FKJA 1Q99A 2G2IA 1K9AA 4RLKA 5A3XA 5EHLA 2C6TA 1H00A 3RZBA 5J5TA 3GT8A 1IEPA 2IVUA 2P0CA 2PE0A 4MXAA 4ALVA 2P4IA 2UZOA 3PXKA 2RFSA 2W96B 4F6WA 4JX3A 4RJ6A 3UO4A 3ALOA 3RPRA 5JZJA 5E8TA 3VUMA 3UC4A 2BRHA 5EDPA 3SW7A 2OICA 3COHA 3JY0A 1OM1A 3NRMA 3OOGA 2Q0BA 3WZJA 4EUTA 3K3JA 3IONA 3DQWA 3KXZA 3P0MA 3NSZA 4FTNA 4S30A 5DHJA 3UYTA 1U54A 5KX8A 4EYJA 1UVRA 2WQEA 1YRPA 4ACMA 2R64A 5HE0A 3R01A 3TNPC 3U6JA 2VO0A 3ZLWA 4ZTRA 3JYAA 3CTHA 4IZ7A 5GZ9A 1OL2A 1S9JA 3IW5A 5AUTA 3C13A 5HBHA 3C0GA 3CPBA 3NUPA 4M14A 4USFA 3F6XA 4AN9A 3ZBFA 1KE9A 2VX0A 4I5HA 5IG1A 2Y6OA 3TI1A 2HZIA 5EYCA 3HUBA 3KB7A 2QOBA 3PSCA 4DEGA 4EQCA 4EK6A 4G17A 4BGGA 3ZO4A 4FBXA 4JRVA 3DDPA 2CCIA 3D7TA 3SX9A 1H4LA 2YHVA 4G16A 4QP8A 3R9OA 2BDFA 2PZIA 2VWXA 4M0ZA 2FVDA 3CGFA 3M11A 4I1ZA 2C47A 4TWPA 1U54B 4FSUA 1UU3A 4RWLA 3ACJA 5HI2A 2OSCA 4YPDA 1ZLTA 3NUYA 4GG5A 3EMGA 1CKJA 1SZMA 2H34A 3QZFA 4USEA 4K11A 5LQFA 4PL3A 3TZMA 2CN5A 4LL5A 5AJQA 5CT0A 2Z7RA 3VS7A 4QNAA 2Z60A 3QUEA 2Z8CA 2W4KA 3GB2A 3R02A 5DPVA 2XRUA 4ZLOA 4YLJA 1URWA 3EZVA 1ZXEA 4FTIA 4PY1A 5CF5A 4FVQA 1YW2A 3W8LA 3E88A 3FKOA 4TYIA 3D7TB 3HMIA 3MVLA 1VEBA 1HCKA 2XCKA 3A4PA 5IA5A 3BWJA 3N9XA 3T9TA 4BBEA 2XH5A 5JQ8A 2PVLA 1TQPA 3QD4A 3K54A 2I0HA 2DS1A 2G2HA 2WU7A 2OF4A 2WD1A 3GC8A 2VN9A 1IRKA 4O6EA 1CKIA 2ITVA 5K3YA 4IVDA 5FBNC 5LARA 4DFZE 4O0SA 4O1PA 3ZSIA 4EH5A 4G3DA 5IA4A 2HWPA 2PE1A 3NYOA 3PPZA 3PRIA 5I3OA 2I40A 3HDMA 4NEUA 3M42A 3ZDUA 1REKA 4K1BA 3QC9A 3FQHA 3TXOA 3UP7A 2B9FA 3R6XA 1J1BA 4K2RA 4P7EA 4QNYA 1IR3A 4PX6A 3PSBA 4L6QA 4AS0A 4IM2A 2QO9A 4FKOA 3ZC6A 2C6IA 4R8QA 3LXLA 1A9UA 4CFVA 1TQIA 2OJIA 4I23A 3VUGA 4JG8A 4QMQA 3GCPA 4FI1A 2BHHA 3Q9WA 3ALNA 4TTHB 2FO0A 1ZYDA 4EC9A 3P79A 1ERKA 4BKZA 1DI9A 3TN8A 2UVXA 1YXTA 3OEFX 4ZSJA 1YQJA 2VWZA 4I5MA 4TZRA 3VS1A 1W98A 2IVTA 4EEVA 2W5AA 5HICA 1F5QA 3U9CA 2EWAA 4ANBA 2JDVA 4IB5A 2VV9A 3KRXA 4JLCA 2G9XA 2QR7A 5KNJA 2Y6MA 3VNTA 1O9UA 4AZWA 3SD0A 2V22A 3VHKA 4FTCA 4YU2A 1ZZ2A 4IVBA 2XP2A 3OXIA 3V8SA 3OVVA 1Q8WA 2QONA 5DG5A 1ZWSA 2J90A 2OZAA 4C8BA 5H9BA 3PIYA 5DR2A 4FKVA 3D2KA 4C58A 5EW8A 1OIRA 3B2WA 4O0XA 1P4OA 4XG4A 4TL0A 3T3UA 3LZBA 4GUBA 2X6EA 3L8SA 3QRUA 3AD5A 2WMRA 4WBBB 4XG8A 4JQEA 3FC1X 2ERZE 4GW8A 4IH8A 4KBCA 5LVLA 2C6EA 4QTCA 3R8PA 3WILA 1TKIA 3BV2A 4FG8A 4IE9A 2RF9A 2YJRA 4J71A 5IEYA 3PPKA 3Q4UA 2X9FA 5HCXA 4XG3A 3A7JA 4H3PA 5F95A 4QTAA 2BPMA 2GFSA 3RAWA 3KXGA 4XV3A 3NZ0A 4FK3A 3R21A 4QP3A 2I0EA 4ZK5A 3DDQA 1HCLA 3OW4A 4WRGA 4XOZA 3R1QA 3B2TA 5IDNA 3RAIA 4DFLA 4FTJA 1UU9A 4DC2A 4GJ2A 4FUXA 1W82A 3DKFA 4IB3A 4GU6A 5DRBA 3OUNB 4AZEA 3D9VA 2C69A 3MH1A 4NJDA 3GXLA 1WBVA 3WYYA 4FV2A 3PPJA 2BHEA 2C68A 4R6VA 4I41A 2W0JA 2YIWA 1U5QA 1SNUA 1U4DA 2O65A 3Q04A 4BGQA 5KHWA 2H8HA 4RVMA 3F3ZA 5BVNA 2UZLA 3FKLA 4XCUA 4D1XA 2BDJA 4YNEA 3VS6A 4CFNA 4F7LA 5EW9A 1LEZA 1SMHA 4P4CA 2R3RA 4HPTE 4CXAA 3DGKA 3QYWA 4ANOA 4YTCA 1WMKA 4YUQA 3VF9A 3QHRA 4R7HA 5JGAA 4O0TA 3PA3A 3CD8A 1Q8UA 3NNWA 4EKLA 5HIEA 2B52A 5FXSA 5KZ0A 1YOLA 2OZOA 1V0BA 1ZYCA 2WQMA 4F63A 1H01A 4EORA 4QD6A 3BYOA 3BELA 4F6UA 3EQHA 4UYNA 1QCFA 5AR3A 5J5SA 3D83A 1BKXA 3PJ8A 3DXNA 2NO3A 3GENA 3QTWA 3S3IA 3ZLSA 2OJFE 2YLFA 1H27A 1W84A 3U6IA 3PA5A 4L7FA 1GIHA 3UMWA 4YC3A 4D9TA 2JKKA 3Q9ZA 4O0VA 5BVWA 3GVUA 3C50A 4I92A 4HPUE 5A9UA 5CS6A 4K6ZA 3WYXA 4EZ5A 2X8DA 3PLSA 4FODA 2ITUA 1SNXA 3Q52A 2YAKA 3FPMA 1Q61A 5BUEA 2Z7QA 3UPXA 4DG0E 3D5WA 4E6CA 4UMTA 5DEYA 1OB3A 3M2WA 4Y72A 4B8MA 1OL5A 4RSSA 3UIXA 4R3PA 3IECA 2XBAA 4FYOA 4M7IA 4C4FA 2PMIA 3V5JA 4IX3A 3BGZA 4DG3E 4BZNA 5EH0A 4I4FA 1NA7A 2XEYA 4HOKA 2H9VA 2YFXA 5HBEA 1OIQA 1XH9A 4ITIA 3KRJA 3DV3A 3P4KA 2W1EA 3QTZA 1BLXA 4MF1A 1E9HA 2RL5A 5CAVA 3R2YA 3FMLA 3OXZA 4AWIA 4B7TA 2FYSA 2F9GA 4W4XA 4BN1A 1YKRA 3SV0A 3RI1A 3RPSA 4ASEA 3CC6A 3OZ6A 4GK2A 4G3FA 3DKOA 4IEBA 2HY81 2W4JA 2ETKA 2X39A 3VVHA 2EXCX 3ZFYA 4X2GA 2WMVA 3QTUA 4WG5A 4L00A 2GNJA 4GK3A 4WSYA 3HMNA 3PP0A 4YTFA 2RFDA 3UVQA 4QMYA 3EN5A 4O27B 3JVRA 1R3CA 3LCSA 5J9LA 2GNLA 4KSQA 3C4XA 4Q5HA 4AGDA 4MBLA 2VU3A 2XM8A 3AC1A 5AUUA 4ZY6A 3POZA 2CGXA 4CV9A 4LOOA 5CU6A 4GV1A 3CJGA 4FV0A 4L43A 1H08A 5EHOA 2IW9A 4BZDA 5DT3A 3PJ1A 4U7ZA 2PVNA 4RJ3A 3KRRA 4E3CA 5BPYA 5B2MA 3E8CA 4FSNA 4DEDA 4ERKA 5FP6A 3UQFA 5A46A 2YACA 5CSWA 4YHTA 5ANKA 3EH9A 4XRLA 4H58A 3MBLA 4DGMA 2VTOA 3MI9A 2QNJA 4AT3A 1PW2A 4W4WA 1G5SA 2PSQA 2YABA 4M66A 2OU7A 4FIIA 4NWMA 2XEZA 4RWIA 3GC7A 2DWBA 5CT7A 4CFUA 2WAJA 3G9LX 3V6RA 1NVRA 5HX8A 5HKMA 2A2AA 5HU9A 3TEIA 4MNEA 3BHTA 3A8WA 3KULB 5CVGA 5HTBA 4U9AA 4HGLA 4BDGA 2XNPA 3QCYA 5ICPA 2BUJA 5IDPA 3MY1A 3H0YA 2PVYA 4H36A 3VIDA 4C59A 2NPQA 4W9WA 4JBQA 1EH4A 2BAKA 4ZIMA 2VAGA 2YERA 2YM7A 3W2QA 4JQ8A 4JRNA 5HIDA 2V62A 1Q24A 4E7WA 3CXWA 5BYYA 3V04A 2HZNA 3CS9A 3ELJA 4OTGA 5GNKA 2PMOX 3NIEA 2FSOX 3Q60A 5CYIA 2BZHB 4EK8A 4WNKA 2UW9A 5FTOA 5L4QA 5CF4A 4AW1A 5B0XA 4IWQA 4FKPA 2WO6A 4U43A 4X3FB 5C26A 3F7WA 2WPAA 2UZNA 1OPLA 3MYGA 3JXWA 3UVRA 4AGUA 3DB6A 5DGZA 3CKXA 4EJNA 4IX4A 4XV9A 4MBIA 2Z7SA 5AP4A 1UNHA 3UJGA 3VW6A 3KL8A 3FI3A 2R3JA 2WIPA 5DVRA 1GIIA 3MY0A 3QL8A 4UB7A 3RK5A 4EONA 2XIRA 4AUAA 1FMKA 4V01A 1BYGA 4FT9A 4CFFA 4F1MA 4Y8DA 3KK8A 4IM0A 5IUIA 4CQGA 2HENA 4ENXA 4OAVB 2BZKB 3BU3A 5EFQA 2JDOA 5LVPA 1R1WA 3FZRA 4YHFA 3FLQA 5KUPA 3EKNA 3ZZWA 1JLUE 1YI3A 3EQCA 4LOQA 1H0WA 3KA0A 1XHAA 5KMOA 4X2NA 2WMWA 4FSMA 4X7QA 4ZP5A 4AT5A 3SA0A 2J50A 5HNGA 3PE1A 3S0OA 2HK5A 4X3FC 4EL9A 2CLXA 3V01A 3VRYA 4FT5A 3ETAA 3AGLA 4MHAA 3QZIA 4H3QA 4MD9E 3HEGA 2JAMA 3RPOA 3GOKA 5E90A 3QKLA 4EBWA 2QCSA 4O0RA 1OZ1A 3DTCA 4FV6A 4KBKA 4F0FA 5LWMA 3DJ6A 4RFZA 5BVEA 1QPCA 3IW8A 4OT5A 3TZ8A 2Y9QA 5LOHA 4A07A 4PMTA 2JLDA 2WMAA 2ERKA 3W55A 4IAZA 4ZSAA 3PUPA 4G6OA 4YZMA 4M84A 5JK3A 4JDHA 1HOWA 2HZ0A 3A99A 5AX3A 3E3BX 4Z16A 3WOWA 2F7XE 4FVRA 4PP7A 3FZOA 4OTIA 3RZFA 2R3KA 4QMWA 4IB0A 1YXUA 2J7TA 2QOHA 2BMCA 2X8EA 4K18A 4I22A 4FEQA 2OBJA 2EVAA 1ZYJA 3H9FA 4DEBA 5E8YA 4L53A 4D2TA 3VJNA 3AT2A 3OCGA 5AP7A 2OJJA 3G90X 2GHGA 2OWBA 2QOKA 5AR8A 3NWWA 1ZAOA 3MH2A 3TL8A 3V5TA 2PMNX 1XWSA 1MRYA 3Q4ZA 4XV2A 3R7YA 1GZKA 2B9JA 1FVVA 2ZVAA 3R8LA 5J9YA 3PTGA 3SXSA 2RFEA 5GZ8A 3LCTA 3G6HA 2QOOA 3IW4A 4L3JA 4U40A 4DEHA 4ZJVA 4A9SA 3L9PA 2F2CB 4BDCA 4EHEA 4DINA 1O6LA 3EQPA 5C03A 5C8KA 4PDSA 3IGGA 2IVVA 3GU7A 3C0IA 3A8XA 4MWHA 1Q62A 4QTBA 4KD1A 3ORNA 4S31A 5LXMA 3PFQA 3PYYA 5CXHA 3I7BA 5FBOA 3R9DA 3TKIA 3OWKA 4G6NA 4YZDA 4EZ7A 1I44A 2HELA 3CY2A 4I20A 4NW6A 3DZQA 2XNEA 1UV5A 4PWNA 4J96A 1H1QA 3QCXA 3UG1A 3GOPA 3FLWA 3FZPA 4DBNA 3HMOA 1XBAA 2WTCA 3ZSHA 4C7TA 2UZTA 3KEXA 3MDYA 3QQFA 1Q5KA 2UZUE 4TYGA 2X81A 3FLSA 4HVIA 4OTPA 5ANGA 3HKOA 2RSVA 3COKA 3NCZA 4PPBA 3PXRA 4I6FA 3QUDA 2I6LA 4JXFA 2UW7A 3DK7A 3JS2A 5DN3A 3CTQA 4Q9SA 3VW8A 2JKQA 4YJPA 4YSJA 3QQHA 2W7XA 2J0IA 3DBDA 3FQSA 3SQQA 3OT8A 3RINA 2YDKA 4W9XA 2ZV8A 3KVXA 2WQOA 5AAGA 2A27A 3HVCA 2J6MA 4QT1A 3RBWA 3QQKA 4F6SA 5I9XA 4QYHA 4GK4A 3FL5A 1TQMA 3BRBA 5C1QB 4NCTA 4QPAA 2R4BA 4E93A 2BTSA 2C5OA 4FIGA 3D5UA 4XP0A 3Q32A 2VRXA 3OCTA 2BRNA 4ARKA 4FUYA 3UOLA 4Y85A 4FL1A 3IDBA 4W4VA 4E5AX 2UZBA 5HO8A 3W2CA 3EQRA 4CSVA 1AGWA 4YZCA 2EB2A 3NLBA 4JBVA 3SAYA 4P90A 2BCJA 3RNYA 4BCQA 4RG0A 4TNBA 3W18A 2FGIA 3UNJA 3R1NA 4EUUA 5M56A 3HV7A 4DLJA 3WARA 3TNWA 1NVSA 3AC4A 4FT3A 3QQLA 4TYHB 3MH0A 2QG5A 4JQ7A 5CX9A 3I6UA 3QQGA 3ZFMA 3ZRKA 4BI0A 3NNVA 5IH6A 1SYKA 3EKKA 4BCJA 3EL7A 3OBJA 3OWPA 4QP9A 4BDIA 1WZYA 3SKCA 5M44A 3OWJA 3OFMA 3QRTA 3U51A 3OTUA 2UVZA 5HE1A 4BVUA 1H07A 3VJOA 2R0IA 3BQRA 4J53A 4N6YA 5HHWA 3V51A 4UMPA 3ZRLA 4I0SA 4YMJA 5CSXA 5GJDA 4FSQA 2F49A 4YC6A 4YO6A 4FV1A 3BHVA 3C51A 5HG7A 3F88A 2JBPA 3H4JA 1MQ4A 4IFCA 4OTWA 3QA0A 3E5AA 4JR7A 4S33A 2BRMA 4I94A 4D5KA 4I6BA 4OTQA 5FP5A 4M69A 4IWOA 3BWFA 2QC6A 2ZAZA 1M2QA 3UVPA 2XA4A 4TNDA 1IG1A 4F1OA 3PE2A 1V1KA 2B4SB 2C5VA 4EOOA 2P55A 5CXZA 1M7QA 2C1BA 5I4NA 3O8UA 4QRCA 3PG3A 4HCVA 3I5NA 4X3JA 2UW0A 4CNHA 3NUUA 1YDSE 4BTKA 5F9EA 3CGOA 1KOBA 4R5SA 4NCTC 4NIFA 3IOKA 3KCKA 4JDIA 2AUHA 1PXNA 4J95A 4RZVA 4QOXA 3IQ7A 2XB7A 3F5GA 3Q53A 2PE2A 5I9WA 2R3MA 3T9IA 3VF8A 3TJCA 2VTNA 3COIA 3AGMA 4ZXTA 3DAJA 2XNNA 3F3UA 5D9HA 4TPTA 3RTPA 3WZUA 3ITZA 3F69A 5BVKA 4M69B 4C34A 3EQBA 3IOPA 4TN6A 3NYNA 3UG2A 3W32A 4FTUA 4DGLC 3ZFXA 2HY0A 2UW5A 2WTWA 3O8TA 4I5PA 1CTPE 5HG9A 2JKOA 5CWZA 2ZB1A 1Q8ZA 2BFYA 5ETCA 3VS2A 3OROA 5EI2A 3V5LA 5IH5A 4O96A 4GH2A 2BILB 4IHPA 4OLIA 1TVOA 4GT3A 2IZTA 1XO2B 3P9JA 4IVAA 4NIFB 4PL5A 3UBDA 5FXQA 4M97A 2WEIA 4WIHA 3S4QA 2QQ7A 3F5PA 4FGBA 5EDRA 3DLSA 5F94A 1Y6AA 3OBGA 4O21A 3VUHA 2GDOA 4KRDA 4G3CA 4ALUA 2ZB0A 4M15A 3SOCA 4AXAA 5E1SA 3EYGA 4FL3A 5HTIA 3QLFA 4J8MA 4E5WA 4AFJA 4NSTA 5IUGA 4GT4A 4BI1A 4AQCA 4A9UA 5HZNA 5ETAA 3K5UA 1URCA 3DU8A 4QTEA 3MB6A 4ACDA 4ANSA 1Z57A 4D4SA 2UW3A 3O71A 2F7EE 3OF0A 5IMXA 4IBMA 4Q5EA 3QU0A 3FHIA 2W9ZB 2R7IA 3R7EA 4CT2A 1J3HA 3ZO2A 5AR5A 5AUXA 1BL6A 3LXKA 4QO9A 5EYKA 1WAKA 3WE4A 4FKQA 4YJQA 5A14A 2XIKA 4LMNA 5CVFA 3O8PA 4G9CA 5E7RA 4MF0A 4F65A 1UKIA 3DOGA 4MH7A 4RX8A 4V04A 4F9CA 1PY5A 2HZ4A 3FQEA 5M4UA 2YJSA 3TNHA 5AM7A 3F5UA 3NUXA 2X4FA 4X2KA 5HE2A 3RJCA 2W4OA 2UW6A 2ZMCA 4L45A 3R7IA 3ZXTA 2J0LA 3CE3A 3LMGA 4DFNA 4IWDA 3PXYA 3ZBXA 3VS0A 4FKTA 2BZJA 4O38A 2VO6A 2WMSA 2YCSA 3LPBA 4LRMA 4O0WA 4DYMA 2VWUA 5L8KA 3NS9A 4HCTA 3O50A 1PXLA 3OCBA 3LVPA 4MVFA 4M8TA 5IEVA 2W1HA 1Y57A 4XLVA 4TXCA 1E1XA 2BR1A 2GNIA 2VO3A 3ERKA 4EH9A 4ITHA 3GFEA 3M1SA 4FTOA 4AU8A 1KE7A 3OC1A 2OFVA 2VX1A 4FKUA 2GQGA 2HIWA 3PXFA 4ZZNA 1OGUA 2BALA 4BF2A 4FC0A 3BLHA 5JQ5A 3BGQA 1Q8TA 1YXSA 1QPEA 3F3WA 4RBLA 4XBUA 3PRFA 2HXQA 4RRVA 4QMNA 4WA9A 3UPZA 4MCVA 3E62A 4ENYA 4DITA 1DI8A 2J0JA 5ACKA 1QL6A 4E73A 5KMMA 4GVJA 3HECA 2B55A 4YLKA 4RA5A 3EQGA 1MRVA 4MXOA 4LL0A 3PP1A 3MY5A 4II5A 1IA8A 3C1XA 4RQKA 3ACKA 5AM6A 4FV7A 2XBJA 2NRUA 3ZEPA 2R3LA 3ZZEA 1M14A 1NVQA 2PVKA 4HGEA 4LUEA 2X7OA 4BTJA 4X2FA 5BVDA 5JSMA 3C4WA 3TACA 2YLEA 3O96A 4NTSA 3AXWA 3MN3A 4FTQA 4ID7A 4BDHA 4GFGA 3BPRA 5FDPA 4NM7A 4LFIA 4CMTA 5FGKA 4UZHA 4AA5A 2JAVA 1OITA 4YJRA 4C33A 4PTCA 2V0DA 3D5XA 1RDQE 4AGCA 5CQWA 3ZM4A 2IJMA 1J1CA 3G51A 4YBJA 4FA2A 1Z9XA 3GC0A 2YEXA 2JITA 2B53A 3FZSA 3EOCA 3UIUA 4D2SA 5FLFA 2C5XA 4LM5A 3QWJA 4IMYA 1YXVA 4RPVA 4ALWA 4ZLZA 5I9YA 3FKNA 4S34A 1DM2A 3ORIA 3NW5A 3BGPA 4JDKA 1B38A 3O17A 3PJ3A 4ACGA 4AZTA 4RX7A 5H8GA 3PY3A 4EOIA 3KF7A 3AC5A 1WBWA 3DBQA 3Q2MA 2BAJA 3P08A 4DEEA 1MQBA 4DGGA 2YIYA 1MUOA 3T8OA 4V0GA 3JVSA 1UKHA 4FV5A 2VTSA 3E7OA 3BYVA 3TV4A 5CAPA 4OT6A 4PV0A 2C6DA 2G15A 4U42A 3SXFA 5M55A 3RP9A 4YSMA 1XR1A 3D0EA 3QZGA 4ASZA 4D2VA 2XNOA 3E3PA 4H3BA 3WF7A 5KO1A 2WMUA 2YAAA 3LFDA 2UZEA 2J9MA 1NXKA 3P86A 4E4MA 3R30A 2OZAB 2YM6A 3KXXA 3QFVA 5DR6A 3F2NA 3MW1A 4QMXA 3LFQA 4MXCA 4E6QA 2X4ZA 4KIKA 2QOFA 3NX8A 5K5XA 3ZOSA 3AOXA 5TR6A 4UEUA 3GCQA 5BUJA 2VWWA 3BBWA 1RW8A 4OBOA 3V5QA 1U46A 4ASXA 4CVAA 1XBCA 3U87A 4BI2A 2O2UA 2WMQA 5EOBA 3S2PA 4OTFA 5L6OA 4YJSA 3DCVA 4YP8A 3OG7A 2GU8A 4AOTA 5HLNA 4V0GB 3LFBA 3T3VA 2PVFA 4O2ZA 4CRSA 1P5EA 3H3CA 3IK3A 1R39A 2GSFA 3LQ8A 3HV4A 4KSPA 4FNYA 4HYHA 1UU8A 4PP9A 4U80A 4LRKA 3F66A 4RLLA 2IW6A 5CANA 3PG1A 3FMHA 1JKKA 4IX6A 4JAJA 5BMSA 2OXDA 2XIZA 1F3MC 2BDWA 2VUWA 3KQ7A 4LG4A 2YDJA 3QYZA 5CNOA 3SW4A 4C3RA 2VTJA 4J98A 4O0UA 4AT4A 2B9IA 2QOQA 2J2IB 3HRBA 4I5CA 4C35A 3MGYA 3ORPA 4FZDB 4BDEA 4EH2A 2VNWA 3AMYA 4CZUA 4HGSA 2OGVA 3DK6A 4FIFA 5I3RA 5M4CA 3VBWA 2ZYBA 3ZTXA 3ENHA 2WOTA 3DZOA 5EYMA 3QKKA 3I0OA 5DT4A 4B0GA 4HGTA 5D7AA 2QO2A 4D55A 5AADA 2IZRA 4IAKA 2Y7JA 5HGIA 5HNIX 4PNIA 4S32A 4KABA 3L1SA 3RMFA 2C6LA 2LAVA 3LQ5A 1Z5MA 3EL8A 3KRLA 3GQIA 3KY2A 4G5JA 4EI4A 5CEKA 3EFWA 4DTKA 2B1PA 3LW0A 4ANNA 2WQBA 3EN9A 4QP2A 2UV2A 4UWBA 1H24A 4IAYA 4FTLA 2XYNA 1RQQA 5TKDA 2QR8A 3D14A 3LHJA 4NH1A 4EH6A 3MPTA 4IW0A 2JDSA 3FI2A 5LCKA 3Q5ZA 1DS5A 4MXZA 4ERWA 2YZAA 1OUYA 3FY0A 2RFNA 4YTHA 4JVGA 4PTEA 5JRSA 1OI9A 1GJOA 3E7VA 4ZS0A 4I4EA 3QHWA 1LPUA 4UZDA 3FSFA 3MIAA 4WOVA 3NW6A 2VGOA 4L46A 4PPAA 4ZAUA 5KMLA 3GU6A 4XHKB 4Y73A 3W2SA 2R3GA 4FTRA 1JAMA 2GNHA 2EUFB 2YIRA 2CDZA 2I0YA 4IAFA 4IADA 1GZNA 5EOLA 2R3PA 3IW7A 4PRJA 4I93A 3VUKA 3ZRMA 5L3AA 3ZUUA 3MFRA 5HG5A 3ORMA 1T45A 4YZNA 3QAME 3BU5A 1VJYA 2XKFA 4XEYA 1YDTE 5IH4A 2Q0NA 2ZOQA 3ET7A 4MD8E 5BMMA 5AA9A 2C3JA 4BIDA 5BUIA 4K9YA 3TIZA 2X2LA 4GYGA 4BICA 4CFMA 3RNIA 4BHNA 4EWQA 3H9RA 4CV8A 4I6QA 3ZUVA 3MV5A 1WFCA 2P3GX 4ZJIA 4BCNA 3TUCA 5FM2A 2OW3A 4J52A 3QQUA 1P4FA 5HORA 4IDVA 3SVVA 3SC1A 2XK7A 5ITAA 3U9NA 5JFXA 4GG7A 1JQHA 4WG4A 5HIBA 5K5NA 2X7GA 5E8ZA 2C6MA 2R0UA 4TYEA 4RIYA 3EN7A 3FMEA 5CQUA 2R3HA 4C38A 2GHLA 2XIYA 5CVHA 4GT5A 4YJUA 1ZY5A 3DKGA 3DB8A 4U45A 4KRCA 5CF6A 4FKGA 3NYXA 3LFSA 4J8NA 1AQ1A 3COMA 4QQ5A 4X6QC 4RZWA 5AX9A 1JSTA 3AQVA 3I60A 4PPCA 4L3PA 1V0PA 4ZLYA 4AZSA 4MWIA 3VBXA 5TE0A 2GS7A 2CN8A 2W5HA 4JIAA 5CEQA 3QD0A 2XK9A 2JDTA 3EIDA 2C0IA 3FDNA 4PL4A 4GFMA 5CZIA 4IWPA 2UW8A 4RIOA 4CD0A 5IZFA 2RG6A 3DFAA 1GIJA 3W10A 3HLLA 3PVBA 1K3AA 4FX3A 4R1YA 3ZO1A 2W17A 4XLIA 4QMLA 3ZONA 3QKMA 3QLGA 2GTNA 4C4IA 5EYDA 2ETRA 4FNWA 3HX4A 3E8DA 4OTHA 3RCDA 5DNRA 5FXRA 1ZZLA 4QQJA 2W99B 4BTMA 3TKHA 4F0GA 5EM5A 4HVSA 4MQ2A 2Y4IB 2XMYA 3HV3A 1YWRA 4M68A 4JT3A 4W8EA 3MS9A 1XKKA 4F08A 3REPA 4HW7A 5KMIA 3EJ1A 1PXKA 1PJKA 3OY3A 3E87A 3UP2A 4D4YA 1PF8A 2GPHA 4CLJA 5M4FA 2QVSE 3VS4A 4BL1A 4N6ZA 2W9FB 1JSVA 5CNNA 2RGPA 4MNEB 3RALA 4F4PA 5L2QA 2R2PA 3R9NA 3UOKA 4CFXA 2XJ1A 2JIVA 5C27A 4FSRA 3PIXA 3MH3A 3QZHA 4ACCA 2UZVA 2VTLA 4C2WA 2ETMA 3DJ5A 3UO6A 2OF2A 4LI5A 4OBQA 5DBXA 4LRJA 4FZ7A 4H1JA 3WF6A 3Q9YA 1OPKA 3BE2A 3OY1A 1JWHA 5AP0A 3ZLXA 1H1PA 1Y8GA 4LQMA 5GZAA 2Y4IC 4N0SA 2ZM1A 4MAOA 5CU2A 5CTPA 2EU9A 3TNQB 1OKVA 3GBZA 2XZSA 4FG7A 4JBPA 2QLUA 2HAKA 3VUIA 2ZM4A 2XNGA 3BI6A 5ANIA 4XP3A 2XS0A 4DEIA 2GNFA 3O23A 4L52A 3TTIA 4XV1A 2F2UA 4BYIA 1LR4A 4X21A 1XJDA 5LJJA 3KK9A 4UWYA 4G3EA 1P14A 1YXXA 3PZHA 4OR5A 4WHZA 2ITTA 3V5WA 2E9OA 3GU4A 3W16A 4KAOA 4IIRA 4E20A 2WIHA 4U3ZA 2OXXA 4HVGA 3ORTA 4EOMA 2JDRA 3LFEA 4TYJA 5IKWA 4RJ7A 3A7FA 1UU7A 4L7SA 3P5KA 3PZEA 3QXPA 4AAAA 3WE8A 3FLZA 3HP2A 1KE6A 2BZIB 3QTQA 3TT0A 3ZHPC 4FVPA 5CU4A 4A4OA 4Q2AA 4XUFA 1H1SA 3EB0A 4OUCA 4KIPA 2H96A 1RE8A 3HYHA 4PMSA 5DWRA 2WNTA 2YITA 3EFKA 4DAWA 4KBAA 4L67A 2WTIA 1JSUA 4BGHA 3NIZA 4IAIA 2OH0E 4ZTLA 1OIYA 4PNKA 1W0XC 4BWXA 5DE2A 2WGJA 4EZ3A 4W4YA 2W5BA 4TWNA 2XM9A 1SM2A 4FKRA 4C4HA 1PXIA 4U97A 4F09A 2C3KA 4A9RA 2GCDA 3NAXA 4DLIA 5K9IA 2OJGA 3LIJA 5A4EA 3LOKA 3O2MA 1REJA 3Q4CA 3S00A 3MJ2A 4RWJA 1PMVA 3RVGA 3FMMA 3HRFA 4FIHA 2J4ZA 5AV0A 5KCVA 1JNKA 2R3FA 3ORZA 2Z7LA 4I0RA 3E64A 4RJ4A 2F4JA 2UW4A 4EH7A 1OL7A 2A1AB 3TUBA 4ANQA 2EB3A 1O6YA 2R3OA 2WU6A 3I0QA 3PA4A 3N51A 3CD3A 4FV3A 2PTKA 4FK6A 4GJ3A 5I9UA 2UZDA 3OWLA 4FZFB 5AV2A 4NZWB 1WVWA 4KWPA 4BCMA 5KMJA 2QU6A 3A4OX 2XUUA 1KE8A 4BBFA 3U6HA 2FA2A 3OW3A 4EH3A 3DS6A 2F7ZE 2I1MA 3R7GA 4FTAA 4U6RA 2E9PA 5B2LA 5I5ZA 2BVAA 3LCKA 3SRVA 3CP9A 3VAPA 3VBVA 4AW5A 5AA8A 3PWDA 4EK5A 3KMMA 3K3IA 3I79A 5EW3A 4XYFA 3QF9A 2OJ9A 2W1CA 4FYNA 3TIYA 3TNIA 2WMTA 3IDPA 3QXOA 3FZ1A 4D2RA 3ZSGA 4EHVA 3V5PA 3LXNA 2QHNA 4WNOA 3FL4A 5IA1A 4GUEA 4YZ9A 3H10A 1P2AA 3U4UA 5A4TA 5KHXA 1VYZA 2R3NA 3G9NA 1KWPA 1CKPA 4BDFA 5H8BA 1IASA 4FOCA 4BC6A 4KNBA 4FT7A 4MTAA 4XRJA 5BX0A 3NCGA 3MA3A 3QTSA 4LGGA 5H3QA 2XK3A 4QQCA 3POOA 4IQ6A 3SRVB 4DFXE 3GC9A 5J9ZA 3CTJA 5AR4A 3EFLA 4WG3A 2JGZA 5DRDA 1OVEA 5KKRB 4CKRA 2PHKA 5AR7A 3L9NA 3LXPA 4TKSA 5IEXA 5F1ZA 5JZNA 1PYEA 4AOJA 4M67A 3FMJA 2ITNA 4EBVA 2WTDA 4OGRA 1FVRA 4L9IA 3MTLA 4YJOA 2OIDA 3DTWA 4HVHA 3SXRA 3NDMA 4QTDA 4M12A 3I6WA 4U79A 5E8VA 1ZMVA 4OAUC 2YA9A 3DT1A 3BHYA 4PDOA 2GMXA 3ULZA 4XP2A 1GY3A 1PKDA 4ZTSA 4CTBA 4RGJA 3ODZX 5J1VA 1H0VA 4EOQA 2V7AA 3I81A 2O63A 4K33A 5CSHA 5FM3A 1LP4A 4NJ3A 5CENA 3L8XA 4C36A 5LMKA 3KMWA 1YHVA 3BQCA 3QRKA 5DI1A 3L8VA 4NT4A 1PHKA 3QBNA 3WI6A 4C61A 3PXQA 1ATPE 4FV8A 4L44A 5HQ0A 3H30A 3MPAA 3MVMA 4G2FA 4G31A 4NW5A 3GFWA 4JJRA 4CFWA 5D1JA 4M0YA 3D5VA 5CEMA 3UNKA 2E2BA 5JFSA 4IAAA 2C6KA 5BQ0A 5KKRC 2WMBA 3DNEA 4BCKA 5JEBA 3P7AA 1PXPA 5BVFA 1OKWA 3P23A 5J79A 2XNBA 4GMYA 2BRBA 3OCSA 4RMZA 5DFPA 1WVXA 1OECA 4UALA 5D10A 3BX5A 4YTIA 4JNWA 3OTVA 1ZOGA 2OO8X 1NY3A 2C5YA 1YWNA 3E8EA 4NKSA 5HVYA 4CZYB 2YIQA 3HDNA 4QPSA 4IZYA 4BYJA 2YM3A 3UOHA 1ZY4A 5AUZA 4OW8A 3Q9XA 3HMMA 3Q6UA 4E5BA 2A19B 5TF9A 3NGAA 3WF8A 3UDBA 1L3RE 2BIKB 4UMUA 4E26A 3GGFA 4NKAA
chains in the Genus database with same CATH superfamily
1BX6A 3FXWA 2GHMA 1F0QA 3AT4A 2WXVA 2WTJA 4FOBA 3LM5A 1YHSA 4RFYA 2HYYA 4ZTNA 4IVCA 2CJMA 2PVHA 5T68A 4ZEGA 3C4FA 3KMUA 4IC7A 3VUDA 5ETIA 4TRLA 3KXMA 2QKRA 5LVNA 5HEZA 4P5QA 4KKGA 1BUHA 3H0ZA 3PSDA 3ZH8A 3NYVA 5FWKK 2P2HA 4IZ5A 4UMQA 5FEEA 4IANA 4UXLA 3THBA 2PY3A 4NK9A 3TTJA 4ZTQA 4IX5A 3EFJA 4F9AA 3KN5A 5CF8A 3RGFA 4UYAA 1PMUA 3TZ7A 4RX5A 3VQHA 3Q3BA 4F64A 3R9HA 5CZHA 2C0OA 3QGWA 3MA6A 1ZOEA 1A06A 1KE5A 2VTIA 3ORXA 4I24A 4O6LA 2W1IA 5AP1A 4CLIA 1STCE 4R5YA 2G1TA 4C02A 5LMKC 4AE6A 2I0VA 4I3ZA 4YHJA 3ZS5A 5CI6A 5AUVA 3LFFA 3OHTA 1JKTA 2GS6A 1ZMWA 5J7HA 2R7BA 3K2LA 4QMUA 4J1RA 5ANJA 3ROCA 2PZPA 3W33A 2VTHA 5HLWA 5AP5A 4ZZMA 1H25A 3KRWA 2OG8A 4YJVA 5B2KA 2IW8A 2JIUA 2ZM3A 1XH7A 3ZEWA 4Y5HA 2QURA 2FB8A 2E9UA 3H9OA 3QX2A 4NM3A 5CLPA 1Q41A 4FT0A 3RK7A 3DLZA 2F57A 2OK1A 5A4LA 2O5KA 4WKQA 3AC2A 4MQ1A 3AD6A 2X0PA 4YGAA 5CY3A 2W1DA 3D7ZA 4QP4A 4KKEA 3W2OA 3RWQA 2JFLA 5I9ZA 4YO4A 4RQVA 1FQ1B 1T46A 4QMSA 2WELA 4IZAA 3EWHA 3FLYA 2VTTA 4C37A 5J7BA 4EOJA 4IFGA 2V5QA 4RIXA 2WEVA 5DEWA 2VTAA 5AP3A 4L68A 5LVOA 3WIKA 3UE4A 1WVYA 4LMUA 5DT0A 4FL2A 4RC3A 1DAYA 2AC5A 4EK4A 3QTXA 4YURA 2OH4A 4GIHA 5H8EA 3FC2A 2YISA 4QP6A 5L2SA 1H1WA 2O64A 3R1YA 5CU0A 4R7IA 3QCSA 4O4BB 3FXZA 3DKCA 2XKDA 5HX6A 4FZ6A 4U5JA 4WNPA 1ZMUA 2VTRA 2ZV2A 4MBJA 2WTKB 4ONAA 1PXJA 4IJPA 4E4NA 4F9WA 1CDKA 2R3QA 4NM0A 2VWIA 2X6DA 4NFMA 1R0EA 2ZJWA 3TJDA 3QGYA 3CY3A 5L8LA 4ZSEA 3MPMA 3P78A 2YM5A 3O51A 3LCDA 3KC3A 5A6NA 3EN4A 4RIXB 1PXOA 2G2FA 1BL7A 4LGDA 3GEQA 5E8WA 2JEDA 3FE3A 4WUNA 2E9VA 4D58A 5BVOA 3QRJA 1W2CA 4CMUA 3BLRA 4G9RA 3RCJA 4QYGA 4AW0A 2JKMA 1VYWA 2GNGA 4FIJA 5JFWA 1LEWA 1PMNA 3VS3A 3ZXZA 4F7JA 1UNGA 2HCKA 5DMZA 2HW6A 3PVGA 5BYZA 1BI8A 2WTKC 4DEAA 5HBJA 2O8YA 2P2IA 4DFYA 2FSLX 4O0YA 4EC8A 4BCPA 1X8BA 4KS8A 4F99A 5DIAA 1J91A 3GU8A 3BE9A 2JIIA 4KB8A 2V55A 4R1VA 5FD2A 1O6KA 2VWYA 2J51A 4QMOA 4EOPA 1M52A 5AP2A 3AT3A 3VO3A 4CZTA 1OPJA 4PF4A 2AYPA 2EXMA 4KA3A 4KIQA 4OBPA 5AV1A 4AFEA 3EYHA 2X0GA 2YN8A 2X2MA 3CLYA 3LCOA 5EDQA 3OP5A 4CEGA 3FXXA 3ZU7A 5B7VA 3R04A 4GS6A 3C4EA 4FKIA 2IVSA 3I7CA 3DBEA 4PQNA 4DH1A 3DK3A 4G3GA 4UWCA 3U4WA 4BFMA 3PJCA 4FTMA 3DY7A 3SLSA 4QMZA 3IS5A 4ASDA 3LAUA 5FEDA 3PY1A 3F7ZA 3NW7A 4J97A 3U8WA 5CAUA 5FRIA 2ESMA 3E8NA 4CKJA 4F9BA 4U3YA 3KU2A 3UIBA 4UV0A 3AMBA 3FZTA 2WQNA 3BCEA 1PXMA 3FI4A 4CCBA 4XH6A 3JY9A 4RT7A 2QHMA 4U0IA 4ZZOA 5AMNA 1YHWA 3MVHA 5HCZA 1K2PA 3R7UA 4JS8A 2O0UA 2V7OA 2BIYA 3AG9A 3BU6A 4XOYA 2YWPA 4D0XA 1FMOE 1WBOA 3D4QA 5HLPA 4GU9A 2B7AA 3R83A 4Z7GA 2WFYA 4FZAB 5ACBC 5L2WA 5HO7A 3B8RA 4BDBA 5L2TA 3RM6A 5TOZA 1XQZA 2XJ0A 4G1WA 3LFAA 1B39A 3GCVA 4TT7A 2ITQA 4PMMA 4EOLA 3HV6A 3EQDA 3L8PA 5HU3A 4HYUA 2WKMA 1Y8YA 4TWOA 2EXEA 2HXLA 4X2JA 5EK7A 4AW2A 2YDIA 5FDXA 5JH6A 1Y6BA 5HTCA 3CQEA 5GJFA 4ZSGA 4DH5A 5KBQA 5CSVA 3PY0A 3GQLA 3O7LB 4CTCA 4D4VA 2FH9A 3DBFA 4CT1A 2ACXA 3W2PA 1M7NA 1VR2A 3ZCLA 3ZMMA 3WZEA 5LVMA 4FKWA 3NNUA 3OT3A 2ONLA 2H6DA 5AWMA 2CMWA 1R78A 3QRIA 2QOLA 1XBBA 1S9IA 3WF9A 4FSWA 3UZTA 3UNZA 4IJ9A 5DR9A 1UWJA 4BIBA 2CCHA 4E6AA 5GHVA 4HNFA 4I21A 4USDA 4AA0A 4EOKA 4EQUA 1FINA 4RVLA 4G5PA 4BWKA 3QA8A 4D2PA 1UA2A 2QKWB 3FMNA 5HVKA 3W1FA 4WUAA 4B99A 3Q4TA 4FR4A 5HNBA 4C4GA 2W1ZA 4I0TA 3D2IA 1KSWA 4MX9A 4GVAA 4IC8A 3AC3A 1CM8A 4JG6A 3HP5A 4TY1A 4KIKB 4L3LA 5HO6A 5T6KA 3VWAA 3DPKA 2SRCA 3DJ7A 3E93A 4KKHA 3AD4A 2GFCA 1GOLA 3NPCA 4GCJA 2ITPA 5CEIA 3ZO3A 3FJQE 3OUKA 4FSTA 2JD5A 3WZDA 4A06A 4LV5A 5IF1A 3UO5A 4DH3A 2C5NA 3P1AA 4BKYA 5EG3A 2QLQA 2XJ2A 2YCRA 2VTQA 4ZOGA 4AN2A 4CMOA 4DH7A 4Z3VA 3FMKA 4L01A 4EK3A 3NUSA 2ITOA 3KKVA 1H1RA 3UIMA 4O22A 3ZYAA 1U59A 4P5ZA 3TZ9A 4UXQA 1OL6A 2VWBA 3V6SA 3UTOA 5LWNA 5JFVA 4N4SA 3SOAA 1W8CA 1LUFA 5E8UA 1Q3DA 5CSPA 4GIIA 2DUVA 2IZSA 3S95A 2LGCA 4NUSA 2X9EA 4Z55A 3R00A 4AN3A 4RJ8A 1FVTA 3FBVA 4XS2A 1ZOHA 3A61A 3PIZA 2FUMA 3Q5IA 4D9UA 2JFMA 2Y4PA 3ROYA 3EHAA 3EQIA 2VO7A 3MSSA 4X0MA 1H26A 4RA4A 4RWKA 3RWPA 2HOGA 2XK8A 4RVKA 4YC8A 4BCOA 4UMRA 2ONLC 4A4XA 4XJ0A 3BEGA 4UY9A 2C6OA 4AE9A 3OEZA 4A4LA 2B54A 4FTKA 4ZTMA 4HZSA 4WSQA 5EI6A 2VNYA 3OS3A 5IA0A 5K4IA 5CU3A 4EHGA 2BROA 3KCFA 4MEDA 4E6DA 2Y0AA 4GSBA 4JOAA 3VBYA 5AP6A 1XH5A 4IM3A 4G34A 5DOSA 5C01A 4AOIA 2PZYA 3FWQA 4RX9A 5JN2A 3CCNA 2G01A 2R5TA 3MFUA 3TV7A 2VWVA 5C9CA 4FNXA 5IISA 2XF0A 4DN5A 4QQTA 4R3RA 4O1OA 3CBLA 3F2AA 3MVJA 5E8SA 2DYLA 4J99A 3NEWA 1ZYSA 5IUHA 4IB1A 3SDJA 4GL9A 5A6OA 1YVJA 1WCCA 5EKNA 4ZSLA 1XH6A 3QX4A 4PUZA 4LUDA 4XG7A 2R3IA 4DHFA 3BHHA 3G2FA 5JGBA 2C30A 3GUBA 4C3FA 4D4RA 3IO7A 4JL9A 2ITXA 3PVWA 2BAQA 5HD7A 5T3QA 3G6GA 3A2CA 3I1AA 2E9NA 4H39A 4HYIA 5EKOA 4AGWA 3AMAA 4CYJA 2XYUA 5D12A 2RKUA 3FLNC 3L9LA 1WBNA 5ETFA 5K0XA 3LJ2A 4D1SA 4DCEA 4EH8A 4B8LA 2QD9A 3BKBA 4APCA 1V0OA 3RAKA 4IACA 4KS7A 3KULA 3E92A 3RHXA 1OMWA 2XK6A 4HYSA 3C4ZA 3R8VA 4C62A 1CMKE 4XX9A 5LMAA 5C8MA 4U41A 5AAEA 5IMEA 1UNLA 4O91A 4BDDA 4QYFA 3EN6A 4EYMA 3G0FA 4PDPA 4BRXA 4TW9A 3CJFA 3GCSA 3UGCA 3GCUA 3F82A 3FSKA 3WBLA 3ZC5A 4RC4A 4BDJA 2A98A 5DLSA 3UQGA 4BBMA 5L6WL 2DQ7X 1Q3WA 3D94A 4OTRA 3UZPA 4D28A 2OIQA 2XRWA 4RIYB 5IU2A 2PWLA 3HA6A 3R8UA 3O7LD 4RIWA 5ANEA 2ZDTA 4X3FA 1JKLA 4S2ZA 3E63A 3F5XA 2VX3A 3HV5A 4AA4A 4FSZA 5KBRA 1MP8A 4WD5A 3C4CA 4YPSA 4UX9A 3KN6A 3L9MA 5DA3A 2OIBA 3OOMA 3HA8A 4YBKA 3F3TA 5TO8A 5TT7A 3CQWA 2J5EA 5HD4A 4ITJA 5G1XA 1YOJA 4FICA 3DAEA 2X8IA 4MXXA 1YI6A 2OI4X 3WF5A 4DGNA 4MNFA 3F9NA 4JBOA 4Z9LA 3HNGA 4DGOA 2A0CX 4ZTHA 4GEOA 4LV8A 3CPCA 3UOJA 2CGVA 3ZDIA 5FEQA 2YCFA 3R63A 4RFMA 5AIRA 4XBRA 2W1GA 1SVEA 5FQDC 1W2FA 3Q6WA 4YR8A 3GNIB 2ITYA 4BWPA 4W8DA 2FSMX 2VGPA 5KZIA 2C0TA 1BI7A 5F20A 3P7CA 1G3NA 3DFCB 3BV3A 3IGOA 3OMVA 5EI8A 3LFNA 2YCQA 4Q9ZA 4RIWB 3R1SA 4PMPA 5AV3A 4MD7E 3TWJA 3UMXA 4CRLA 2Y8OA 1W7HA 5I9VA 2AQXA 4MKCA 4NU1A 3IW6A 5J1WA 3F61A 3R8MA 3VQUA 4F7SA 4X6RA 1YI4A 2IWIA 5L6PA 2JC6A 3TG1A 2VTPA 4MYGA 3BYSA 4JIKA 1ZYLA 4HNIA 4KINA 4U81A 5F4NA 3FHRA 3UQCA 3AC8A 2X7FA 4YZBA 1I09A 3HRCA 2CLQA 4Y46A 2YM4A 4N70A 5E91A 3RPYA 1GAGA 3GU5A 3R7VA 3RM7A 3R71A 4MXYA 2WZJA 1KV2A 3ODYX 4FMQA 1OKZA 4EH4A 4KIOA 4TWCA 5CI7A 5J8IA 2A4LA 5M4IA 5H2UA 3BZ3A 3F3VA 5D41A 1QPDA 3NNXA 5M57A 4BKJA 3RKBA 2QO7A 4JAIA 1PKGA 1Y91A 1FPUA 2JBOA 3HMPA 3ENMA 3MB7A 2J0MB 2VZ6A 2HWOA 4UBAA 4ACHA 4E4XA 3DNDA 4D2WA 2X2KA 1APME 4C4JA 4AP7A 3NUNA 5FTQA 5BNJA 4ZY4A 4CYIA 2W1FA 4B4LA 4Y95A 3VRZA 2QOCA 4BCIA 1XH8A 2PL0A 4C57A 3KXHA 3DAKA 1OIUA 4I6HA 3ORLA 2PMLX 2QU5A 2XNMA 3LE6A 5L2IA 3GP0A 5HG8A 3TCPA 3RAHA 2ITWA 2OXYA 2X1NA 1CSNA 2ZV7A 2PK9A 4AZVA 3PWYA 1GZ8A 4XG2A 1ZRZA 3VBTA 2XKEA 3DA6A 4AF3A 4DH8A 3HGKA 2PVMA 5EM7A 5HESA 4AZFA 3R0TA 4LOPA 3VUTA 4D5HA 4BDKA 3DQXA 3I5ZA 4XG6A 4BZOA 3ULIA 3QQJA 4E8AA 3PVUA 4J7BA 4QMPA 3LLTA 5CAOA 4QMTA 5KMNA 4CQEA 3C9WA 4JR3A 2C3IB 3GI3A 3CKWA 4FSYA 4EKKA 1DAWA 3R2BA 4NM5A 2REIA 5D11A 1FGIA 4IXPA 5G6VA 3FY2A 2FSTX 5IPJA 5ANOA 3QWKA 3UC3A 2YIXA 3MJ1A 4DG2E 3BBTB 2GS2A 4K8AA 4GRBA 3B8QA 5CEPA 3RK9A 2WOUA 4QMMA 3VN9A 4EHZA 4BCGA 4C2VA 3TV6A 5CASA 1YDRE 1MRUA 2CGUA 3PJ2A 3KXNA 4FKLA 4FKSA 2CKEA 4IDTA 3ZLYA 3JPVA 3CEKA 2W06A 4APPA 5CALA 3LJ0A 1Q4LA 2O3PA 2UVYA 3FMDA 5J87A 3FYKX 4FV9A 3VBQA 1U5RA 2B9HA 2WMXA 5HOAA 5IA2A 1H8FA 5E92A 4XG9A 4UN0C 1M2RA 4F0IA 5A4CA 3MIYA 4GFOA 2Z2WA 4QYYA 4U44A 4XMOA 3ANQA 4CCUA 3A7HA 5D7VA 5C8NA 1JVPP 4H1MA 1XH4A 4YLLA 4AACA 2XKCA 3UODA 2PVRA 1WBTA 4BDAA 5FG8A 1VZOA 2VD5A 5CEOA 4QMVA 2IO6A 4RC2A 4BCHA 3CR0A 4A9TA 1KOAA 2ITZA 3UYSA 5E8XA 3QCQA 4GYIA 4C4EA 4M3QA 1OUKA 1Q8YA 3II5A 3QC4A 3QD2B 4QPMA 4P2KA 5AAFA 1KV1A 2QODA 3KFAA 3KGAA 4YJNA 5AR2A 2C4GA 4ANMA 4F1TA 5LMBA 3KF4A 4OTDA 4WT6A 3QTRA 3NR9A 3C5UA 4FG9A 4RVTA 3FPQA 3W2RA 2PUUA 3O0GA 4FTTA 4JDJA 1R0PA 4JI9A 4NTTA 3R73A 3QTIA 4G6LA 1WBSA 3BLQA 3A62A 3C7QA 5K0KA 4TYHA 2WTVA 2NRYA 1GZOA 4L8MA 5ANDA 3IG7A 3OXTA 3ZUTA 4A7CA 1PYXA 1AD5A 2C1AA 3BYUA 4BIEA 3V8TA 2ZV9A 4L42A 3WIGA 2HW7A 4QP1A 4WBOA 2CSNA 4WRSA 2CPKE 4V05A 5HE3A 5HVJA 4BCFA 5JMSA 1JBPE 3A7IA 4HJOA 5M51A 3A60A 2BKZA 5DH3A 4ZY5A 5LCJA 2GTMA 4HZRA 2QOIA 2RG5A 3FV8A 3QUPA 4FNZA 4EQMA 4BB4A 1SVGA 5JRQA 2XK4A 4K77A 2KTYA 4PTGA 4B6LA 2BRGA 1FGKA 5KMKA 4NFNA 2WHBA 1H28A 2KULA 3R22A 5JT2A 4F9YA 4F70A 3FAAA 5M53A 2VTMA 2XVDA 3I4BA 4C3PA 5IA3A 3BYMA 2PZ5A 3LM0A 4D1ZA 4HCUA 2NP8A 4XNEA 3WZKA 2BTRA 4YNOA 3D15A 2BFXA 1RJBA 2J0KA 1JPAA 3CIKA 3QD3A 3R28A 3RHKA 3V8WA 2AC3A 1FOTA 3HZTA 5EM6A 1PMEA 1M2PA 5EM8A 3HUCA 5JGDA 1GNGA 3R8ZA 3Q96A 5E1EA 1BMKA 3TKUA 3C0HA 1E1VA 2OKRA 4O2PA 3JUHA 1JOWB 2PZRA 4FF8A 3VC4A 4Z7HA 2ZMDA 2XIXA 4QYEA 2W05A 5CAQA 2QI8A 4Y83A 2ZDUA 2IZUA 5AUYA 1OKYA 4U8ZA 4D0WA 3VULA 3V3VA 3DBCA 4JX7A 5A54A 2WB8A 4WNMA 4C0TA 2PVJA 4RJ5A 4FV4A 2UUEA 3EZRA 2R9SA 3EQFA 3MTFA 3VHEA 2CGWA 3SHEA 3IDCA 4QP7A 4EWHA 3IPHA 4R3CA 2IN6A 1JKSA 2P33A 3LJ1A 4YJTA 5AUWA 1W83A 3G0EA 1UWHA 3MFTA 3RPVA 4JG7A 2J5FA 2XCHA 2CHLA 3FYJX 1Q97A 2OFUA 3OD6X 4E1ZA 4M13A 5AEPA 3G33A 1ZARA 3IKAA 1YOMA 4AG8A 3ANRA 3MWUA 3BIZA 3BHUA 3HL7A 5KE0A 3TUDA 3VS5A 3PXZA 5GJGA 3K5VA 4LGHA 5L8JA 1SVHA 4F7NA 4WO5A 5K4JA 4BHZA 1QPJA 3MFSA 4MK0A 2RIOA 3QALE 3BEAA 3G5DA 5J95A 5AV4A 4FIEA 4B9DA 4Y5QA 2YM8A 3ORKA 5AIKA 3CQUA 5JKGA 4EOSA 3FUPA 3NAYA 3W8QA 4LYNA 4ANLA 1OL1A 4ZJJA 4AX8A 4HVDA 5A4QA 4E4LA 3LFCA 3KVWA 1WBPA 1QMZA 5EHYA 5HCYA 3R7OA 1M17A 1B6CB 4K0YA 3S1HA 1YWVA 3P7BA 4CKIA 4A9YA 4BTFA 5I0BA 2UZWE 3A7GA 2C3LA 4FKJA 1Q99A 2G2IA 1K9AA 4RLKA 5A3XA 5EHLA 2C6TA 1H00A 3RZBA 5J5TA 3GT8A 1IEPA 2IVUA 2P0CA 2PE0A 4MXAA 4ALVA 2P4IA 2UZOA 3PXKA 2RFSA 2W96B 4F6WA 4JX3A 4RJ6A 3UO4A 3ALOA 3RPRA 5JZJA 5E8TA 3VUMA 3UC4A 2BRHA 5EDPA 3SW7A 2OICA 3COHA 3JY0A 1OM1A 3NRMA 3OOGA 2Q0BA 3WZJA 4EUTA 3K3JA 3IONA 3DQWA 3KXZA 3P0MA 3NSZA 4FTNA 4S30A 5DHJA 3UYTA 1U54A 5KX8A 4EYJA 1UVRA 2WQEA 1YRPA 4ACMA 2R64A 5HE0A 3R01A 3TNPC 3U6JA 2VO0A 3ZLWA 4ZTRA 3JYAA 3CTHA 4IZ7A 5GZ9A 1OL2A 1S9JA 3IW5A 5AUTA 3C13A 5HBHA 3C0GA 3CPBA 3NUPA 4M14A 4USFA 3F6XA 4AN9A 3ZBFA 1KE9A 2VX0A 4I5HA 5IG1A 2Y6OA 3TI1A 2HZIA 5EYCA 3HUBA 3KB7A 2QOBA 3PSCA 4DEGA 4EQCA 4EK6A 4G17A 4BGGA 3ZO4A 4FBXA 4JRVA 3DDPA 2CCIA 3D7TA 3SX9A 1H4LA 2YHVA 4G16A 4QP8A 3R9OA 2BDFA 2PZIA 2VWXA 4M0ZA 2FVDA 3CGFA 3M11A 4I1ZA 2C47A 4TWPA 1U54B 4FSUA 1UU3A 4RWLA 3ACJA 5HI2A 2OSCA 4YPDA 1ZLTA 3NUYA 4GG5A 3EMGA 1CKJA 1SZMA 2H34A 3QZFA 4USEA 4K11A 5LQFA 4PL3A 3TZMA 2CN5A 4LL5A 5AJQA 5CT0A 2Z7RA 3VS7A 4QNAA 2Z60A 3QUEA 2Z8CA 2W4KA 3GB2A 3R02A 5DPVA 2XRUA 4ZLOA 4YLJA 1URWA 3EZVA 1ZXEA 4FTIA 4PY1A 5CF5A 4FVQA 1YW2A 3W8LA 3E88A 3FKOA 4TYIA 3D7TB 3HMIA 3MVLA 1VEBA 1HCKA 2XCKA 3A4PA 5IA5A 3BWJA 3N9XA 3T9TA 4BBEA 2XH5A 5JQ8A 2PVLA 1TQPA 3QD4A 3K54A 2I0HA 2DS1A 2G2HA 2WU7A 2OF4A 2WD1A 3GC8A 2VN9A 1IRKA 4O6EA 1CKIA 2ITVA 5K3YA 4IVDA 5FBNC 5LARA 4DFZE 4O0SA 4O1PA 3ZSIA 4EH5A 4G3DA 5IA4A 2HWPA 2PE1A 3NYOA 3PPZA 3PRIA 5I3OA 2I40A 3HDMA 4NEUA 3M42A 3ZDUA 1REKA 4K1BA 3QC9A 3FQHA 3TXOA 3UP7A 2B9FA 3R6XA 1J1BA 4K2RA 4P7EA 4QNYA 1IR3A 4PX6A 3PSBA 4L6QA 4AS0A 4IM2A 2QO9A 4FKOA 3ZC6A 2C6IA 4R8QA 3LXLA 1A9UA 4CFVA 1TQIA 2OJIA 4I23A 3VUGA 4JG8A 4QMQA 3GCPA 4FI1A 2BHHA 3Q9WA 3ALNA 4TTHB 2FO0A 1ZYDA 4EC9A 3P79A 1ERKA 4BKZA 1DI9A 3TN8A 2UVXA 1YXTA 3OEFX 4ZSJA 1YQJA 2VWZA 4I5MA 4TZRA 3VS1A 1W98A 2IVTA 4EEVA 2W5AA 5HICA 1F5QA 3U9CA 2EWAA 4ANBA 2JDVA 4IB5A 2VV9A 3KRXA 4JLCA 2G9XA 2QR7A 5KNJA 2Y6MA 3VNTA 1O9UA 4AZWA 3SD0A 2V22A 3VHKA 4FTCA 4YU2A 1ZZ2A 4IVBA 2XP2A 3OXIA 3V8SA 3OVVA 1Q8WA 2QONA 5DG5A 1ZWSA 2J90A 2OZAA 4C8BA 5H9BA 3PIYA 5DR2A 4FKVA 3D2KA 4C58A 5EW8A 1OIRA 3B2WA 4O0XA 1P4OA 4XG4A 4TL0A 3T3UA 3LZBA 4GUBA 2X6EA 3L8SA 3QRUA 3AD5A 2WMRA 4O4EA 4WBBB 4XG8A 4JQEA 3FC1X 2ERZE 4GW8A 4IH8A 4KBCA 5LVLA 2C6EA 4QTCA 3R8PA 3WILA 1TKIA 3BV2A 4FG8A 4IE9A 2RF9A 2YJRA 4J71A 5IEYA 3PPKA 3Q4UA 2X9FA 5HCXA 4XG3A 3A7JA 4H3PA 5F95A 4QTAA 2BPMA 2GFSA 3RAWA 3KXGA 4XV3A 3NZ0A 4FK3A 3R21A 4QP3A 2I0EA 4ZK5A 3DDQA 1HCLA 3OW4A 4WRGA 4XOZA 3R1QA 3B2TA 5IDNA 3RAIA 4DFLA 4FTJA 1UU9A 4DC2A 4GJ2A 4FUXA 1W82A 3DKFA 4IB3A 4GU6A 5DRBA 3OUNB 4AZEA 3D9VA 2C69A 3MH1A 4NJDA 2IF8A 3GXLA 1WBVA 3WYYA 4FV2A 3PPJA 2BHEA 2C68A 4R6VA 4I41A 2W0JA 2YIWA 1U5QA 1SNUA 1U4DA 2O65A 3Q04A 4BGQA 5KHWA 2H8HA 4RVMA 3F3ZA 5BVNA 2UZLA 3FKLA 4XCUA 4D1XA 2BDJA 4YNEA 3VS6A 4CFNA 4F7LA 5EW9A 1LEZA 1SMHA 4P4CA 2R3RA 4HPTE 4CXAA 3DGKA 3QYWA 4ANOA 4YTCA 1WMKA 4YUQA 3VF9A 3QHRA 4R7HA 5JGAA 4O0TA 3PA3A 3CD8A 1Q8UA 3NNWA 4EKLA 5HIEA 2B52A 5FXSA 5KZ0A 1YOLA 2OZOA 1V0BA 1ZYCA 2WQMA 4F63A 1H01A 4EORA 4QD6A 3BYOA 3BELA 4F6UA 3EQHA 4UYNA 1QCFA 5AR3A 5J5SA 3D83A 1BKXA 3PJ8A 3DXNA 2NO3A 3GENA 3QTWA 3S3IA 3ZLSA 2OJFE 2YLFA 1H27A 1W84A 3U6IA 3PA5A 4L7FA 1GIHA 3UMWA 4YC3A 4D9TA 2JKKA 3Q9ZA 4O0VA 5BVWA 3GVUA 3C50A 4I92A 4HPUE 5A9UA 5CS6A 4K6ZA 3WYXA 4EZ5A 2X8DA 3PLSA 4FODA 2ITUA 1SNXA 3Q52A 2YAKA 3FPMA 1Q61A 5BUEA 2Z7QA 3UPXA 4DG0E 3D5WA 4E6CA 4UMTA 5DEYA 1OB3A 3M2WA 4Y72A 4B8MA 1OL5A 4RSSA 3UIXA 4R3PA 3IECA 2XBAA 4FYOA 4M7IA 4C4FA 2PMIA 3V5JA 4IX3A 3BGZA 4DG3E 4BZNA 5EH0A 4I4FA 1NA7A 2XEYA 4HOKA 2H9VA 2YFXA 4O4CA 5HBEA 1OIQA 1XH9A 4ITIA 3KRJA 3DV3A 3P4KA 2W1EA 3QTZA 1BLXA 4MF1A 1E9HA 2RL5A 5CAVA 3R2YA 3FMLA 3OXZA 4AWIA 4B7TA 2FYSA 2F9GA 4W4XA 4BN1A 1YKRA 3SV0A 3RI1A 3RPSA 4ASEA 3CC6A 3OZ6A 4GK2A 4G3FA 3DKOA 4IEBA 2HY81 2W4JA 2ETKA 2X39A 3VVHA 2EXCX 3ZFYA 4X2GA 2WMVA 3QTUA 4WG5A 4L00A 2GNJA 4GK3A 4WSYA 3HMNA 3PP0A 4YTFA 2RFDA 3UVQA 4QMYA 3EN5A 4O27B 3JVRA 1R3CA 3LCSA 5J9LA 2GNLA 4KSQA 3C4XA 4Q5HA 4AGDA 4MBLA 2VU3A 2XM8A 3AC1A 5AUUA 4ZY6A 3POZA 2CGXA 4CV9A 4LOOA 5CU6A 4GV1A 3CJGA 4FV0A 4L43A 1H08A 5EHOA 2IW9A 4BZDA 5DT3A 3PJ1A 4U7ZA 2PVNA 4RJ3A 3KRRA 4E3CA 5BPYA 5B2MA 3E8CA 4FSNA 4DEDA 4ERKA 5FP6A 3UQFA 5A46A 2YACA 5CSWA 4YHTA 5ANKA 3EH9A 4XRLA 4H58A 3MBLA 4DGMA 2VTOA 3MI9A 2QNJA 4AT3A 1PW2A 4W4WA 1G5SA 2PSQA 2YABA 4M66A 2OU7A 4FIIA 4NWMA 2XEZA 4RWIA 3GC7A 2DWBA 5CT7A 4CFUA 2WAJA 3G9LX 3V6RA 1NVRA 5HX8A 5HKMA 2A2AA 5HU9A 3TEIA 4MNEA 3BHTA 3A8WA 3KULB 5CVGA 5HTBA 4U9AA 4HGLA 4BDGA 2XNPA 3QCYA 5ICPA 2BUJA 5IDPA 3MY1A 3H0YA 2PVYA 4H36A 3VIDA 4C59A 2NPQA 4W9WA 4JBQA 1EH4A 2BAKA 4ZIMA 2VAGA 2YERA 2YM7A 3W2QA 4JQ8A 4JRNA 5HIDA 2V62A 1Q24A 4E7WA 3CXWA 5BYYA 3V04A 2HZNA 3CS9A 3ELJA 4OTGA 5GNKA 2PMOX 3NIEA 2FSOX 3Q60A 5CYIA 2BZHB 4EK8A 4WNKA 2UW9A 5FTOA 5L4QA 5CF4A 4AW1A 5B0XA 4IWQA 4FKPA 2WO6A 4U43A 4X3FB 5C26A 3F7WA 2WPAA 2UZNA 1OPLA 3MYGA 3JXWA 3UVRA 4AGUA 3DB6A 5DGZA 3CKXA 4EJNA 4IX4A 4XV9A 4MBIA 2Z7SA 5AP4A 1UNHA 3UJGA 3VW6A 3KL8A 3FI3A 2R3JA 2WIPA 5DVRA 1GIIA 3MY0A 3QL8A 4UB7A 3RK5A 4EONA 2XIRA 4AUAA 1FMKA 4V01A 1BYGA 4FT9A 4CFFA 4F1MA 4Y8DA 3KK8A 4IM0A 5IUIA 4CQGA 2HENA 4ENXA 4OAVB 2BZKB 3BU3A 5EFQA 2JDOA 5LVPA 1R1WA 3FZRA 4YHFA 3FLQA 5KUPA 3EKNA 3ZZWA 1JLUE 1YI3A 3EQCA 4LOQA 1H0WA 3KA0A 1XHAA 5KMOA 4X2NA 2WMWA 4FSMA 4X7QA 4ZP5A 4AT5A 3SA0A 2J50A 5HNGA 3PE1A 3S0OA 2HK5A 4X3FC 4EL9A 2CLXA 3V01A 3VRYA 4FT5A 3ETAA 3AGLA 4MHAA 3QZIA 4H3QA 4MD9E 3HEGA 2JAMA 3RPOA 3GOKA 5E90A 3QKLA 4EBWA 2QCSA 4O0RA 1OZ1A 3DTCA 4FV6A 4KBKA 4F0FA 5LWMA