5LMBA

Human spleen tyrosine kinase kinase domain in complex with azanaphthyridine inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
271
structure length
264
Chain Sequence
YLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Optimisation of a novel series of potent and orally bioavailable azanaphthyridine SYK inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 264
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5lmbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5lmbA01
2IVSA 2F7XE 5IA2A 2B4SB 3ANRA 4I0SA 3UC4A 1FVVA 2GS6A 2HENA 3F5XA 5FRIA 5HHWA 1JWHA 5CSVA 2W1CA 4KRDA 5E7RA 5EYCA 4DEGA 2UZVA 4F9BA 3MFTA 4YJTA 2C47A 3Q9ZA 4FSRA 4H3BA 4I6FA 4X6RA 4YSMA 4EHVA 3E8EA 5AUTA 2PPQA 2C6MA 1ZOHA 3QQLA 2W0JA 5FEEA 2VO7A 1H00A 3U6JA 5J9YA 2RSVA 4AF3A 5M4CA 4EZ5A 4PY1A 2ACXA 2PHKA 4LUEA 4F6SA 5A54A 1H28A 3KXHA 3QQUA 4MK0A 3IDBA 3TCPA 3TG1A 3DNEA 1UU8A 4IADA 3BCEA 4TYHB 5CTPA 3BE2A 3RPVA 3GQIA 2GU8A 4PTCA 5A4LA 3QZFA 2IW6A 2R2PA 4AW0A 2WO6A 5HI2A 4ORKA 3MN3A 3C5UA 5CNOA 4GT3A 4C4GA 4NM7A 2ZVAA 4LRJA 5IQHA 4DFBA 4XRJA 3ODYX 4Q2AA 4QPSA 2O63A 2QC6A 4O2PA 2BAKA 5EQYA 3A7HA 4TYHA 4PMMA 1ZZ2A 4A4LA 3FHIA 2C69A 4JX7A 4UYAA 2VRXA 1PMVA 3MBLA 5AIRA 3BYSA 5L8KA 3COKA 5GZAA 1DI9A 3VN9A 1PY5A 2QVSE 4NYEA 3DBDA 3D0EA 5AJQA 3UJGA 4O7YA 3H0YA 1PKGA 2HXQA 1Q8TA 4ANOA 3ZDIA 3ZEWA 4LMNA 4OTIA 3IQ7A 2X2KA 2F7EE 3AC3A 5F94A 5H8BA 4L53A 4ANBA 3C50A 3JPVA 3WIGA 4CRLA 4NUSA 3O7LB 3A7GA 4CZUA 4FEUA 1BYGA 4XLIA 3QRTA 3EKKA 1OMWA 4UZHA 2CLXA 2YACA 2YFXA 4FTOA 1P14A 4UMQA 4XRLA 4HVIA 4TL0A 5IH4A 3PY3A 4L44A 5AIKA 3BHTA 3Q5IA 2PL0A 4DBNA 1WMKA 2OW3A 4ZMFA 4EOOA 5CALA 3GENA 3IECA 1CSNA 1OUKA 4B99A 4B8MA 5CU0A 1V0BA 3P4KA 4RJ7A 1M17A 3IKAA 3NYXA 4HCUA 2C6OA 3F2NA 4FKLA 4FZFB 3FQEA 2PTKA 4LM5A 4MBJA 3UOHA 1BMKA 1J91A 4XP0A 3MH1A 4O0VA 5EYMA 1NT2A 4ZJVA 2FA2A 4AA0A 3F2AA 4S31A 3LFAA 4ITIA 4NH1A 1KE5A 3OVVA 4BIDA 2HYYA 4GK3A 4KAOA 4R6VA 3UQFA 1PXIA 3P86A 3K3JA 3FY0A 2P4IA 2WMUA 4O1PA 3V8TA 4EYMA 4OTHA 2UVZA 3FLSA 3PJCA 4MNFA 4MXAA 4OGRA 4M97A 4EBWA 3NW6A 4FTNA 3ET7A 4MNEB 4M15A 2WQNA 5J5SA 3KL8A 2PZPA 4CD0A 3CEKA 5AP4A 2ZV8A 4DFXE 1PRYA 3CCNA 4EUUA 1O6KA 3KULB 3QD4A 1WBTA 4ITJA 4QMXA 4EH8A 5E8YA 3V5JA 3VULA 3C7QA 2XM8A 4IM0A 2B7AA 4W9XA 5DOSA 4AU8A 3BRBA 1DAYA 3IO7A 3PPJA 2GHGA 4O0SA 3KXZA 1JSTA 4NW6A 1OPJA 1E9HA 2JITA 2QHNA 2UUEA 4MNEA 5IF1A 3GU8A 2WTJA 3E7VA 4NK9A 4TYIA 4C4EA 2EB3A 2VTMA 3BGPA 4I4EA 5C26A 4G5JA 4GS6A 3KULA 4V05A 1UV5A 4KNBA 4PWNA 2W7XA 4X3JA 1ZXEA 1PKDA 3P9JA 3PZHA 3BI6A 2C6LA 3DLZA 4FTCA 2XBJA 2QCSA 3R00A 2IO6A 5ANJA 2G2HA 2X8IA 2R9SA 2R3NA 2WU6A 4FSZA 4RC2A 3UOJA 2YM6A 3R0TA 4OTWA 3ZRKA 3PXZA 2H6DA 4GJ3A 4RFYA 4DTKA 4USDA 3PDTA 2X9FA 3AQVA 1L3RE 4AAAA 2CKPA 1W82A 3KK8A 2WMWA 2H8HA 1JSVA 4PNIA 5L6OA 4AZWA 4NCTC 4EHZA 4RJ6A 3R7EA 4TRLA 2J5FA 1R78A 3QLFA 4ZJJA 4BI0A 2HY0A 4MX9A 4RIWA 3TWJA 5HO7A 1YDRE 4BL1A 1J1CA 3HAVA 3F5GA 3SC1A 1KOBA 3EQGA 4GK4A 2RFNA 2A2AA 2W1ZA 1F3MC 3NCZA 3OF0A 4XOZA 5JRSA 4DEEA 3C4FA 3VS3A 4OLIA 3ZLSA 2I0YA 3A8WA 1TQIA 4QD6A 5GIOE 2GFCA 3BBTB 4HYHA 2OICA 1PMEA 1WBSA 1S9IA 1YI3A 1XO2B 2EUFB 3EB0A 4QYEA 5AP1A 1QL6A 2FYSA 5AR2A 3WF6A 5BQ0A 4ZMEA 4MBIA 5C8KA 2VTHA 3O0GA 4TY1A 4PX6A 5KMOA 4LRKA 2PVJA 3UC3A 4BHNA 3KEXA 2W1DA 4HYIA 4XV1A 3H9OA 1P2AA 3ZO3A 1QMZA 3PE2A 3PG3A 4RWLA 1ZY5A 2VZ6A 4CCUA 2QO7A 4D58A 4OUCA 1Z57A 5HBHA 3NNWA 4IVCA 3OD6X 3FKOA 3VRZA 3ZSHA 2X7FA 5BPYA 2JLDA 1M2RA 3PVBA 4FNYA 2VUWA 5DPVA 3UG2A 1HCLA 3NIEA 3KMUA 2F2UA 5AX3A 3GU7A 3KXXA 3Q9YA 2G15A 2JDRA 2PVHA 3I4BA 3GI3A 5AV3A 4F9CA 5JFWA 4FZ6A 4CXAA 2QO9A 4HYSA 1MP8A 1LUFA 4IAFA 4YZBA 2QLQA 2QOKA 3P08A 2J51A 3FXZA 4AACA 5K5XA 3C4EA 2XJ2A 4IVDA 3V5LA 2PVYA 4Q5EA 3AXWA 2HZ4A 4Y5HA 4C2VA 5CXZA 3NUYA 4G3CA 5JGAA 1PJKA 2W5AA 4FBXA 2R3FA 2BUJA 2VTAA 4D5KA 3II5A 2UZBA 2CNQA 3VS4A 4ONAA 5FGKA 4ANSA 4C34A 4E20A 5J9LA 5TF9A 1PHKA 3EL8A 3D14A 4CFXA 5GJDA 1OI9A 3UZRA 3TT0A 3NEWA 4YR8A 3LMHA 3KKVA 4DF3A 4F63A 3KXNA 3KN5A 1H27A 5HTIA 4EZ3A 2PU8A 1OB3A 2XBAA 2WIPA 3EQCA 4G17A 4L3LA 4ZY6A 3OT8A 5AUXA 3UYSA 4NM0A 4AE9A 4ANNA 3NZ0A 4YJPA 3T8OA 4BZNA 3CBLA 3OCSA 3EN6A 3IW7A 3P79A 3QUPA 3OOMA 4JQEA 3HV7A 4QP8A 3LMGA 4ZOGA 1U59A 4DCAA 1RW8A 2WGJA 4W4XA 3F6XA 4C4FA 5A6NA 3SW4A 3BZ3A 2B1PA 3MA3A 4DG3E 3WOWA 4EL9A 3LM5A 2YIWA 2GFSA 4FICA 4WRSA 5HEZA 4BTMA 5AEPA 5JH6A 5IZFA 4KIOA 1CMKE 4S32A 3JS2A 5DG5A 2Q83A 4F99A 4HYUA 5JQ5A 4DITA 2ZB0A 3ZZEA 3DQWA 5J7HA 2BILB 4OW8A 1MRVA 2VTIA 2Z60A 4LG4A 2QU6A 4NCTA 3TNQB 4II5A 3ELJA 4FT5A 2IN6A 5AUZA 4G6OA 3EQIA 3EQRA 3QL8A 4FV1A 4M69B 3U8WA 3SAYA 4AZSA 4BZDA 3A99A 5KNJA 4UV0A 3PXQA 5JZNA 3UIUA 2XF0A 4QMQA 2GNGA 4IWOA 3DBFA 4JS8A 3V5PA 4IH8A 1M7NA 1YXTA 1PXKA 3MTFA 3HLLA 3L8XA 1O9UA 2VV9A 3ENHA 3TXOA 2QI8A 4AN2A 4B4LA 3E93A 4FX3A 4L3PA 4L6QA 4WUAA 4EZ7A 5BVOA 2BZJA 4JRVA 4B8LA 1P5EA 2PVMA 4M69A 5ETIA 3NR9A 4OTDA 3U6HA 4DTBA 3VS1A 4AGDA 2P33A 4LYNA 4LUDA 3SRVA 4AW1A 5AV4A 4EQCA 1P4OA 2F2CB 1Y57A 1H07A 3RVGA 4O6LA 1V1KA 1OM1A 4AXAA 4F7SA 2ZDUA 3IW6A 4DGGA 2CNVA 4L7FA 2UZDA 2F57A 3VAPA 2VTSA 3RNYA 4Z7GA 4DTAA 4MBLA 4QMMA 2BTSA 3FPMA 1REKA 3AD4A 3PSCA 3UPXA 4X2KA 4GVJA 3VUIA 5AR5A 4BBEA 3O2MA 4QQCA 3DBCA 3WZDA 4EK8A 4FMQA 4DG0E 3CS9A 5HTCA 1J7UA 5GNKA 3Q4ZA 1UWJA 1NXKA 3VS5A 3QTIA 3HEGA 4ANLA 5K0XA 1W98A 2OZOA 1WBVA 4KBKA 4MWHA 4UMTA 3RAIA 3U87A 4I20A 2XK7A 3K5UA 3CY3A 1PYXA 3K2LA 5L4QA 3VBYA 4KIPA 5IDNA 4BTFA 4DHFA 1GZNA 4M13A 5BUEA 3R04A 3RK9A 5AAEA 5E8WA 2J0IA 4NZWB 2KULA 2WMSA 4FOBA 3I6WA 5K0KA 3MPAA 4M66A 2P2HA 3PE1A 5A46A 3WZJA 4D2TA 1TQMA 5H3QA 2WPAA 1S9JA 3MVLA 4FI1A 2P0CA 3PY1A 2WTWA 5TR6A 1H1SA 3PPKA 3Q32A 4QP4A 2JFLA 3R7YA 4RX8A 4YTFA 1OL7A 2R3QA 2R3KA 3GQLA 4C58A 4NTTA 2WAJA 3UMXA 3LFNA 4WSQA 4ZZMA 2QQ7A 2W5BA 3EIDA 4EH4A 3NNUA 5DT4A 3BKBA 4DLIA 4NKAA 3FLWA 1YKRA 4DGMA 1APME 4M12A 2XNGA 4N4SA 3D5XA 4R1VA 3NAYA 5LWMA 2CN8A 4IM3A 3DA6A 4MXCA 4UWBA 4HVHA 4RT7A 4BB4A 3RGFA 3ORLA 2R3GA 1OL2A 1BX6A 2JKQA 3JY9A 3NDMA 1JNKA 3WF7A 1URWA 3FMEA 3BV2A 3RPRA 4AZEA 4C7TA 2HWOA 3HKOA 1YHVA 2W4KA 3PRFA 3QRUA 4FKQA 4IACA 5HGIA 2JKKA 2UW3A 5CSWA 4DFZE 4BTKA 3QZIA 2VTPA 3RI1A 3FZPA 3S3IA 5C4LA 1IASA 2R0UA 3PJ1A 2ITVA 2O64A 2Y9QA 4ACMA 4E6QA 2X81A 2FVDA 3GVUA 2BRBA 2V55A 3DPKA 3OFMA 4QMLA 2VTTA 4XCUA 3CPBA 4JNWA 4XH6A 5K5NA 4O22A 3R9RA 4ZSEA 2G2IA 5IQIA 2BFXA 4YLJA 3QHRA 5AR7A 5IQAA 4CFMA 4U40A 1W8CA 3ZSIA 4GVAA 2WHBA 3FC1X 2CNUA 2R3HA 5CEIA 4XS2A 1Y8GA 3ZC6A 4FVPA 3HZTA 4IFCA 4U0IA 4BDAA 3ORNA 2IVVA 5LMBA 3TNPC 4CT2A 4QMSA 3BELA 4B0GA 4CTCA 4F7NA 3E7OA 3R8MA 4JR3A 5E9EA 4K18A 5EM8A 2JFMA 4I94A 3ZHPC 2YIRA 4OBPA 4GT4A 4DFUA 1JLUE 2PMLX 2UZUE 4FV4A 4YZ9A 3QC9A 4KRCA 4QQJA 4RIXB 3EYGA 4ZP5A 3BLRA 3G9LX 3DTCA 4JIKA 3VIDA 2WNTA 4FSMA 3UVQA 4BGGA 3TKHA 4BCQA 4EOSA 3FWQA 3UO5A 2C6EA 5CASA 4U42A 2Y6OA 3OWLA 3QD3A 4U81A 4DGLC 4FA2A 5EQPA 3KVXA 4FKSA 4JQ7A 5M06A 3HECA 4IE9A 5DR6A 4XEYA 3V6SA 5C8NA 3Q9WA 5FEQA 2BFYA 5HE2A 4IDVA 3B8QA 1STCE 4TYJA 4RIXA 4AFEA 3EMGA 5JKGA 4BCJA 4H39A 4XP2A 4AP7A 3MFUA 4EK5A 3DFAA 4S34A 3GCQA 1AQ1A 5HNGA 5IA1A 2PUUA 4IIRA 3QRKA 4FK3A 4X0MA 4CFUA 5KHXA 2E9OA 3VQHA 3EQPA 4AE6A 3ETAA 5JZJA 3V3VA 1NA7A 4X2FA 1Q97A 3AD6A 4L7SA 2XJ0A 2WMVA 4OAVB 2Q0BA 2Z7RA 4CZYB 3G6HA 4YTIA 4F9AA 2UW6A 4BKYA 1XQZA 3F5PA 4LV8A 5A4TA 5IQBA 4CT1A 5JQ8A 2WMAA 3RKBA 4ACGA 1ZLTA 5AADA 3D7TB 3OXTA 2QHMA 3NX8A 2OJJA 4TT7A 4IHPA 5AV0A 3P23A 4EQUA 4C33A 4JAIA 3M42A 3EZRA 4Y95A 5A14A 5IQGA 1FGKA 3RPYA 2CJMA 3PP1A 3UTOA 4GYIA 4L00A 1Q8YA 2UZEA 3OEFX 5HIEA 2Z8CA 4FV8A 5EHOA 2VD5A 3C4XA 4HGLA 4RIOA 3K3IA 2QNJA 4FKPA 4C3PA 4M68A 1Q3DA 5B2KA 2PZ5A 3RCDA 3VS6A 1YDTE 4GFMA 2R7BA 2OF2A 1Z5MA 5E91A 4BI1A 1ND4A 2R3OA 5C03A 1GZ8A 3TEIA 4FG7A 4IM2A 5M4UA 2F9GA 2QONA 3I5NA 1GOLA 4M0ZA 2CGXA 4XG8A 3CD3A 2DS1A 3MY5A 2BZHB 1SVHA 4OAUC 5BX0A 3NUAA 2YERA 1LPUA 3ACKA 4GG7A 4RA4A 4XHKB 1Q4LA 3QZGA 5J8IA 3NUUA 3QX4A 4JDIA 5IG1A 4HPUE 4IZ7A 4PMSA 4Y8DA 4C35A 3UBDA 4P5QA 3WF9A 2IVUA 1YXUA 5I9ZA 4FC0A 4LGHA 4PPCA 2VO6A 4HJOA 3VUMA 2EB2A 4C59A 3G51A 4E7WA 2OIDA 3LPBA 2XJ1A 4XBUA 1JQHA 3AMYA 5I9XA 3F3VA 5TOZA 4TWOA 3PJ8A 4QNYA 3I79A 3UVPA 5IH6A 2C30A 2UZOA 1MQ4A 5LARA 2QOIA 4DE4A 3E5AA 4D9TA 5AP7A 2PE2A 2XIKA 4O91A 2C6TA 2OH4A 5BYZA 5DNRA 5LXMA 4O7WA 4YZMA 4RA5A 5T6KA 3I6UA 3P7BA 2PULA 3W8LA 3FZSA 3WARA 1ERKA 2C0TA 3D5WA 2C5VA 4DFNA 3MB7A 5FTOA 4ZY5A 5CZIA 2C68A 4RZWA 3R02A 3GGFA 3QBNA 5GJFA 2OO8X 4BIEA 2W17A 3PP0A 5H2UA 2GPHA 4OT6A 2OJ9A 1ZYSA 5LMKA 4EOPA 4PQNA 1YXSA 3AGLA 2H96A 4RVLA 4DCEA 2BRMA 2QKRA 2VAGA 3MPTA 3QQHA 3CTHA 5KZIA 2YCFA 3EQFA 3LCDA 3S00A 2CLQA 2WQOA 1RJBA 4I22A 1OUYA 5EOBA 3FPQA 3PJ3A 5LVOA 3TKIA 3DJ6A 1P4FA 3F7ZA 4ANQA 3MH3A 2XKFA 3D4QA 5CYIA 2XNOA 1UU3A 1XH9A 1ZARA 4QMWA 3POZA 4RLKA 4IWQA 4O7RA 3ZEPA 3FC2A 5G6VA 2XEZA 3IGGA 4U5JA 4O0TA 3ZUUA 3AGMA 4FEQA 4MAOA 5HORA 4G6LA 4I5MA 3VRYA 4BWXA 2YN8A 3PVGA 2FB8A 5AP2A 2I40A 2C3IB 4QYHA 3PZEA 2WKMA 4JDHA 3UE4A 2YCSA 4R1YA 2NPQA 2IW9A 2PUNA 2CCHA 5DE2A 3C4CA 5DRBA 3VS2A 5IDPA 4E1ZA 3LCKA 4NKSA 4RC4A 4DC2A 4ENYA 5EM7A 5KMIA 2WMBA 1TKIA 2PUPA 2ZM3A 3CIKA 3A60A 5D1JA 3BYUA 4LGGA 5EM6A 4N57A 1U54B 4BI2A 2BDJA 2BZKB 3TL8A 3QD2B 3HGKA 3TJCA 2NO3A 5HKMA 1GIJA 3NPCA 3O96A 2XYNA 1XH5A 2RKUA 4QP6A 4GCJA 2YABA 4D2RA 4I0RA 3LCOA 3L8PA 3ORIA 3CLYA 1FQ1B 3KY2A 4DH5A 5IEVA 4RLLA 4MTAA 1OKWA 4QYFA 3QFVA 4PF4A 4EOIA 4A4OA 3FMJA 1H1PA 1RQQA 3LQ5A 3A8XA 4O86A 1XWSA 4BYJA 3PLSA 3FBVA 4HVGA 4XX9A 2W05A 4EH3A 5KCVA 4O7LA 3OWJA 3QLGA 1OGUA 2YIXA 1WFCA 5I9VA 5HE3A 2OK1A 5F95A 5TKDA 3IDCA 4I1ZA 2ITZA 3SOAA 3T9IA 1Q8WA 3UYTA 2VWBA 5AAGA 2V7AA 4GT5A 2YWPA 3D83A 3F61A 3GCVA 3T9TA 3DQXA 2XIZA 3FZOA 5IUHA 3RK5A 5EM5A 3MESA 2XYUA 3UNKA 4FSNA 5BUJA 1B6CB 3I5ZA 4BWPA 4O82A 4YJRA 4CYJA 2X4FA 4PTGA 3Q4TA 4BN1A 4N6ZA 3OCBA 3QTZA 4AZFA 1KWPA 3VW8A 5DR2A 3QF9A 3PA5A 3PA4A 5AV1A 1GZOA 1OKVA 4ZS0A 4D0XA 3LXPA 3LXNA 3LLAA 3OXIA 4WOVA 5KO1A 5DHJA 3PIZA 3AMBA 4QMNA 1K3AA 3GXLA 4EC8A 2E2BA 3QZHA 5LCKA 3VBVA 4CFFA 3PA3A 2AC5A 5HICA 3DJ7A 4JXFA 2J2IB 3BYVA 3NNVA 5EHYA 3R7IA 3ZONA 5J5TA 3SVVA 3SG9A 3FKNA 2OF4A 2RIOA 4PMTA 5M44A 4CKIA 4GYGA 2JAMA 4AFJA 3NYVA 2YITA 3PFQA 2VNWA 4ANMA 5DMZA 4X2JA 2QR8A 4P2KA 2DQ7X 4QTEA 4TZRA 4BDKA 3S0OA 4WG5A 3UIXA 1KSWA 4AZTA 3VUHA 3IG7A 4UN0C 4G1WA 3BGQA 4TWCA 1UA2A 3LQ8A 3DK7A 1FMKA 4E5BA 4P7EA 3CY2A 3U51A 4MVFA 4CFWA 1OL1A 2J0KA 3BE9A 1W7HA 3QXOA 4PL3A 3ACJA 4AGCA 2J90A 4FIFA 2WZJA 4NWMA 4XG9A 1B38A 1R39A 2JAVA 2F4JA 1X8BA 3EN4A 3LAUA 5D7VA 3CQEA 4RWKA 4FKIA 5HVKA 4TTHB 3BU5A 4LOQA 4KINA 4HPTE 3ZXZA 4FTMA 2GQGA 3QQFA 4Y85A 4IC7A 4BHZA 3HMIA 1NVQA 3QUDA 1WBOA 3QGWA 3ZMMA 5I9UA 4BCOA 5I0BA 2C6KA 4DT8A 1JPAA 3GFWA 4UZDA 1NY3A 3ZUTA 3DXPA 4ZTQA 1YI4A 2V0DA 4BY9E 5M51A 2XK8A 3OY3A 3R1NA 3NUNA 4YHJA 2BAQA 5BVWA 3F66A 4FTAA 4PDPA 1GY3A 1YWNA 4CMUA 5KX8A 3NLBA 2WOTA 5CQUA 2UW4A 3ZO4A 2PK9A 3QAME 4GK2A 3ZRMA 3OY1A 3SV0A 3VS0A 5KE0A 4QP7A 2WTDA 5JRQA 2BIKB 5EDQA 5AR8A 5EW8A 1JOWB 3BEGA 3ENMA 4XLVA 3AT3A 1VZOA 2UZNA 4FGBA 2IW8A 1GIHA 5LVMA 3S1HA 2JC6A 4IBMA 4EUTA 2GTNA 3Q4CA 4AW5A 3QKLA 2FO0A 1UNGA 5D11A 4D9UA 3E3PA 4ALUA 5C27A 3L8VA 1Y91A 4Z7HA 5HX6A 2UZWE 3U4UA 4ALVA 2W5HA 4BDHA 4EYJA 4XG3A 1F0QA 4YC3A 3OROA 2WQEA 1Q8UA 1GJOA 3FYJX 1R0PA 2WTKC 4AOTA 5JEBA 2NRUA 3BBWA 3GC0A 4FSWA 2W1GA 4KKGA 4BF2A 1PW2A 3EQDA 3OUNB 4C57A 1IEPA 1HCKA 2XP2A 3KU2A 3VF8A 2WEIA 3Q3BA 4AGUA 3WE4A 4R3RA 2CGUA 4MD9E 3P78A 2YM8A 3G0FA 4CVAA 3FMNA 3Q04A 4WNMA 3KRWA 2Z7QA 5E1EA 2YM7A 5HVJA 4EJNA 3HVCA 1UNLA 4IWPA 4NT4A 5BVEA 2QLUA 3LCTA 2BRNA 3GCPA 2PE1A 3QD0A 4IAIA 2W99B 1FVRA 3BHYA 2BPMA 4WNPA 5J79A 3VUDA 2ZB1A 2YA9A 3ZH8A 4JBQA 2I0VA 3DAEA 3AOXA 4J8NA 4ZLZA 4RIWB 5BVKA 1E1VA 3EQHA 4AS0A 4ZLYA 4BDFA 5DRDA 4MKCA 2ZV2A 2GNFA 3THBA 5KKRC 4P4CA 5HVYA 4BCIA 5CEPA 3G6GA 5IEYA 4C4IA 4F9WA 1LP4A 2QO2A 3PXRA 3RAKA 1WBWA 4F0FA 4M84A 4DN5A 3ORZA 4RBLA 3W16A 2SRCA 2WOUA 4RFMA 1K9AA 2G2FA 5IA4A 5M09A 3DXQA 1WBPA 3TIZA 5IH5A 1KE9A 3L9LA 2P2IA 3OW3A 5CSXA 3W2SA 4E3CA 2XB7A 5HCZA 3ZTXA 5E4HA 4R5SA 3NSZA 4FSTA 3MW1A 4KIKA 5HX8A 2WU7A 4O38A 5IKWA 4ASDA 4FV9A 5CLPA 5BVFA 5A9UA 2PVRA 4WHZA 4FE2A 5KBRA 2GDOA 4C37A 3H30A 4GG5A 3BX5A 4E26A 5D9HA 3DZOA 4F9YA 4HW7A 2QR7A 1BI7A 3LFDA 3O23A 1DS5A 4U9AA 3QCQA 4NJDA 1VEBA 5CQWA 4NEUA 4YP8A 2IWIA 2P3GX 3V5TA 5L6PA 3U4WA 4TNDA 5DYJA 2GHMA 4MD7E 3EKNA 1FVTA 2NNWB 1OL6A 2GHLA 3CE3A 5AR4A 4N6YA 4U8ZA 1H1WA 2VX0A 3KXMA 2JDTA 4CKJA 1H1QA 2HY81 5DEYA 3BU3A 4G9CA 2YIYA 3KF7A 3UOKA 2YCRA 2CCIA 3LHJA 4M67A 1W83A 3K54A 4YHTA 5T68A 4O21A 4S2ZA 1WVXA 5HU9A 5HO8A 3H10A 4EKLA 3ZO2A 5HD7A 5KZ0A 3VBXA 4XG2A 4LL5A 3WYYA 3MA6A 1OBDA 2QOBA 5I3RA 4EH9A 2HW6A 3ATTA 4U7ZA 4DLJA 4F6WA 2A27A 2JIVA 2CGWA 4R7HA 4O0XA 4K9YA 5L2IA 5CAUA 2GTMA 4M14A 4CLJA 2HZIA 3TACA 4GIIA 3N4VA 3TZ7A 4FG8A 3O51A 4QMVA 2W9FB 3ZLWA 4B7TA 4HGTA 5IMXA 5HG8A 3GCUA 3O7LD 4U6RA 5AUVA 5DWRA 2HOGA 2W9ZB 3MDYA 3M11A 4ZK5A 4X21A 1F5QA 4FZ7A 4TXCA 2Y7JA 3GU5A 1O6LA 4EJ7A 1YHWA 3KMMA 1L8TA 3H9FA 5CVHA 2W1HA 5CU6A 5IEXA 3PVWA 5F4NA 3ZFXA 3SD0A 5JSMA 4UB7A 2C0IA 2G01A 2J6MA 5IA3A 4EI4A 2ZDTA 5FBNC 3LFFA 3VO3A 3K5VA 2REIA 4E5AX 5TE0A 4YTHA 5GZ8A 2Q0NA 2B54A 4J95A 4BCFA 4GFGA 4EWHA 1CTPE 4JJRA 2ERZE 2OU7A 3R22A 3HMMA 3FL4A 3KC3A 3BHVA 3DB6A 4MD8E 3DS6A 4TNBA 4ZSAA 4DYMA 4FZAB 1H0WA 4FYNA 3FMDA 1OZ1A 2H9VA 2VX1A 4KKEA 4PV0A 4G5PA 3FY2A 4QPMA 5EHLA 2ITXA 3DU8A 5GJGA 5LMAA 4E6AA 5IPJA 1T45A 4NFMA 4HNFA 3PRIA 4E8AA 4EOJA 5JFXA 5M07A 3AC4A 3CXWA 3V5WA 3VWAA 2X1NA 4L68A 1J1BA 4GKIA 1M7QA 1OIUA 2ONLC 3WZEA 4ASZA 3U55A 1Q5KA 3SRVB 5M08A 3LJ1A 1W84A 4C2WA 5C9CA 4FTUA 2YLFA 4FKGA 4FUXA 4KBCA 4AA5A 2WMRA 4R8QA 4V04A 2HZNA 1ZYDA 3AC2A 3FZRA 5AUYA 1R0EA 4YBJA 4R7IA 3MJ2A 3ORKA 4I3ZA 5AMNA 4ZZOA 3SA0A 5CENA 2BAJA 4YJOA 2W96B 5HNBA 4JBOA 3RP9A 3SDJA 4U97A 4A9YA 3R2BA 3KRXA 3RZBA 4L9IA 4I21A 4XV2A 3TNIA 2BKKA 5I5ZA 1IA8A 3Q6WA 2VNYA 5BVDA 3NMUF 4KBAA 4NM5A 4CFVA 4FODA 3AT4A 4WRGA 4R5YA 4O7SA 3EN5A 2FSTX 4IX4A 4RIYB 3O50A 3FMMA 3ORMA 4OR5A 4MH7A 3KRLA 5FBOA 3NWWA 5KMJA 4OTRA 4ZAUA 4V01A 2J0JA 4QYYA 2W1FA 3BHHA 5AA9A 1KV1A 3A2CA 4F4PA 1JBPE 3LQ3A 2C1AA 3A4PA 2WFYA 1JKTA 3EQBA 4E4NA 4Q5HA 3W2RA 4Q9ZA 4EOMA 5CSPA 4RIYA 3HYHA 3TUBA 3G9NA 2J4ZA 3LJ0A 5HLWA 1PMNA 2B52A 1U5RA 3NS9A 4BDGA 2PMNX 2HELA 3T3UA 1IAJA 4FYOA 5GHVA 3QTRA 2CPKE 5L2TA 3PXYA 5D12A 2VTRA 4FKUA 5IUGA 4IB3A 1BLXA 4FV2A 4MHAA 3EN7A 4F70A 3TNWA 2P55A 3E87A 4DEDA 4IB5A 4FTLA 2PVNA 4WBBB 4UWYA 5J87A 4YJQA 2E9UA 2VTLA 5B0XA 3I7CA 4TKSA 3W2PA 2OJIA 5E8SA 4PTEA 2QU5A 3NYNA 4EK3A 4L67A 2BDFA 3RWQA 4YUQA 2GNHA 4A7CA 2I1MA 4O7NA 2XMYA 3EJ1A 4FTTA 5KMKA 4CV9A 1SVEA 1QPCA 2J9MA 5HD4A 4E4XA 1OPKA 3OG7A 3V01A 4GEOA 2G9XA 5AWMA 3DBQA 4ZS4A 2B9IA 2RFDA 4O6EA 1SNXA 5E90A 3A7FA 3GT8A 4GL9A 3ZOSA 1AD5A 4DH3A 4XV9A 1CM8A 2B9HA 2XZSA 3Q96A 2YM4A 4IZ5A 4OTPA 2O2UA 3H3CA 1H08A 1YI6A 3RALA 4U44A 4AWIA 2PWLA 3UPZA 4TWPA 5BYLA 2GQRA 4AOIA 3A61A 3LXLA 2OXYA 5DEWA 3H0ZA 3OW4A 1UU7A 1TVOA 4F1OA 5CAPA 3OBGA 3QX2A 4X2GA 3MI9A 5HE1A 2W1IA 3E63A 1EH4A 4G9RA 3R9OA 4GJ2A 3O8UA 3ALNA 3TIYA 4EK4A 4O7TA 3F3UA 2ONLA 4EC9A 5L2WA 3Q2JA 3R7VA 4RX7A 4C02A 3LFBA 2C3KA 3LCSA 1XBCA 3WE8A 2XCHA 2VTJA 4YPSA 2YAAA 3LKMA 2OJGA 2GNJA 2C5YA 3QQGA 1Z9XA 2E9NA 4HGSA 4TYGA 3WZUA 2OFUA 1PXNA 1YWVA 5DIAA 4CYIA 1YXXA 4RFZA 1LEWA 1ZWSA 4FL3A 4OBOA 5FTQA 4C0TA 3LFSA 4PPBA 4RMZA 1QPJA 4H1MA 4WD5A 5CX9A 4QMOA 4BKZA 3TKUA 4GFOA 1ATPE 3CTQA 3MFRA 2IZRA 5HLNA 5I4NA 4RJ5A 2WD1A 4EQMA 5EYDA 4DFLA 5J1WA 5CI7A 3EFWA 4IB0A 4CTBA 4GRBA 1UNHA 2ITPA 1JSUA 2JD5A 4CG8A 2YLEA 4CFNA 3TV4A 2G1TA 2XK3A 1WCCA 3KMWA 4DINA 3IGOA 3W1FA 2HWPA 4BDBA 4FEWA 5FTGA 3RAWA 3R6XA 3AC1A 4P90A 1I44A 2VWYA 3R9DA 4ACCA 3COHA 3PY0A 4EK6A 3R7GA 4G3DA 2PVKA 2VN9A 4FR4A 3LZBA 3NUXA 4QQTA 4PPAA 4TPTA 3RZFA 4ZLOA 5EYKA 3BQCA 1IA9A 2OBJA 4FKVA 3BLQA 1H1RA 4J52A 3RJCA 2ZV9A 2XH5A 5CU4A 3QCSA 3LFQA 1PF8A 4AGWA 5AV2A 5DGZA 2O5KA 2BR1A 4I5CA 3LE6A 5EKOA 3CJGA 4K11A 3NUPA 4KSQA 3QC4A 5CEQA 5AP5A 3ULZA 4F64A 2JGZA 2OGVA 5L3AA 3U9CA 3W55A 3QHWA 2PSQA 2J7TA 3F69A 4AZVA 3CPCA 3OOGA 4YZCA 2EXMA 4DEBA 2ZM1A 2H34A 1BKXA 3WZKA 1OIYA 1O6YA 3N51A 5DA3A 4A9RA 5BUIA 2FSOX 2WB8A 2XA4A 1DAWA 5CF8A 4YTCA 3VJOA 2BROA 4YJVA 1BL6A 4BGQA 3VS7A 3BEAA 3R8ZA 3COIA 5CAQA 3UOLA 4P5ZA 3PIXA 4EBVA 3KQ7A 3D9VA 4H05A 4L52A 4CRSA 1MRUA 5CF5A 1LEZA 1W0XC 4USFA 4FV3A 1ZMUA 2VWWA 3MIAA 4FNZA 3ZZWA 5CT7A 1YQJA 3QTQA 4QP3A 4TW9A 3GUBA 5H8GA 3HAMA 2UW0A 3QTSA 2E9VA 4I4FA 3RM7A 2GS2A 5DT0A 5M56A 4JRNA 3UO6A 4KIQA 2XIYA 1FOTA 3D2KA 2YDIA 4QTDA 2VTNA 5CU3A 4BDEA 4MEDA 3P0MA 4APCA 3QALE 3LIJA 1YDSE 4G3EA 3UIBA 2B53A 4YZDA 4R3CA 3TNHA 3RHXA 5LOHA 3NVKI 2R3LA 4JIAA 1YOMA 4DH8A 3FEGA 4EH2A 3OTUA 3ZM9A 3Q53A 2V62A 4NTSA 3W33A 3PTGA 2XK6A 4D4RA 4RWIA 3E62A 2RFEA 3F5UA 5GINE 2CMWA 4QP2A 5IMEA 2O8YA 1AGWA 4E5WA 3HA8A 2W4JA 3SW7A 4L01A 4FEXA 3UP7A 2VO3A 3COMA 2GCDA 4JG8A 5DFPA 4J71A 1YHSA 3UNJA 3AT2A 4IX3A 4HVDA 3VVHA 2PMOX 3BIZA 3EWHA 3P1AA 3B8RA 3C9WA 4I93A 4O0RA 3RHKA 4Y73A 2VO0A 3ID6C 3QUEA 4FTJA 4XG4A 3MY0A 4W8EA 4YJUA 1R3CA 3OHTA 3LMIA 3C4WA 2C5NA 2OFVA 1RDQE 3MVJA 4QMUA 2WEVA 2BIYA 4R3PA 5HG9A 3SXRA 4I41A 3UZTA 4YSJA 1GZKA 4RQVA 3LVPA 4BCKA 2V22A 3L9PA 4YJNA 3BYMA 4CMOA 4JQ8A 5CZHA 3FE3A 1GNGA 3QXPA 3D15A 2YISA 3SXSA 4GIHA 5ACKA 3SGCA 4ZSGA 1H24A 3A62A 4X3FC 5A4EA 1JKSA 3S2PA 4R78A 3DFCB 4CNHA 2C3JA 3OWKA 5F20A 3EZVA 3GB2A 5K9IA 2A4LA 5IQDA 3B2TA 4JX3A 3C1XA 4XBRA 3QQJA 3UZPA 3OC1A 3VF9A 1H0VA 4IB1A 3DDPA 4FSQA 4MF0A 4D2PA 4IW0A 4RVTA 5CY3A 3ZFYA 3I60A 4C4JA 5EW9A 2CGVA 5DR9A 3E8NA 4CMTA 3FI8A 3R73A 2QG5A 3G2FA 3UNZA 4ASXA 4J1RA 3OS3A 1Q61A 1WVWA 1SNUA 4YLLA 3GC8A 4FF8A 5D7AA 3G5DA 4D4VA 4UX9A 4W9WA 3G90X 5EI2A 2QOOA 2BHEA 4Y46A 1YXVA 3GC7A 2YDJA 2BCJA 3HUBA 1YVJA 2I7QA 1CKPA 5HLPA 2JKOA 4JVGA 4I5PA 3TZ9A 2A19B 2O65A 2ZAZA 5AA8A 5HQ0A 1H01A 4XJ0A 3O8TA 4AT4A 2RGPA 3MS9A 4C8BA 1SVGA 4F0IA 3PWYA 4IZAA 4ERWA 2R3MA 5HG7A 2PVLA 5ANGA 4NIFB 4F65A 2R3IA 3OBJA 3BGZA 4TN6A 1SM2A 4BIBA 3QWJA 2NRYA 5BMSA 4L45A 3M1SA 5CAOA 3SQQA 4XV3A 1PXLA 1YOJA 2PZIA 4WT6A 5B2LA 1KE7A 3IOPA 5LCJA 5CXHA 1ZRZA 3MYGA 4WNOA 2EVAA 3WBLA 4MXZA 4BKJA 5HG5A 4NIFA 3CP9A 4G31A 4PP7A 4PP9A 3ZM4A 4PDYA 2UV2A 5CU2A 2QOCA 3OTVA 1NW1A 3OUKA 1NVSA 2R5TA 3TUDA 3FQSA 1BL7A 3F3ZA 3UMWA 4HNIA 3E88A 4BZOA 5CNNA 4QQ5A 3R8UA 4FKRA 4X7QA 3GU4A 3I0OA 3UODA 4FSUA 3LXKA 3MTLA 1ZYLA 4L42A 4AW2A 5J1VA 2QD9A 4O83A 3KVWA 5AP6A 3PPZA 4RC3A 2YCQA 4AOJA 4BDDA 1JVPP 3VHEA 4X2NA 3TV7A 1M2PA 2ZV7A 4YZNA 3VC4A 5BVNA 3TI1A 2GNLA 3RK7A 3F2RA 3R71A 3OMVA 4Y72A 3RWPA 4M8TA 4X3FB 3V04A 5D41A 1Q3WA 4A07A 5HU3A 4EONA 1FMOE 2YHVA 3CD8A 2WQMA 3OCGA 2ITNA 3E8DA 2X2MA 3FMKA 2CSNA 4Z9LA 2ITUA 4BFMA 3F3WA 3G15A 2Z02A 3GBZA 3PLAE 1DI8A 1XBBA 5CVGA 3QRIA 3WF8A 5K4JA 3RAHA 4GH2A 4LOOA 5T3QA 3E64A 4A06A 4X3FA 2WTCA 4D4SA 3VUTA 1UVRA 5CVFA 3FXXA 3EN9A 3UP2A 3V5QA 2X9EA 2OXDA 4HCVA 3W2QA 3BQRA 2QKWB 3FKLA 1FINA 4FKWA 4N0SA 3LFCA 5DVRA 5HTBA 3TZMA 4O7ZA 4ERKA 1PXJA 3PWDA 3HL7A 3PSDA 3PSBA 2BTRA 5AP3A 3RNIA 2JBOA 3EFLA 4K2RA 4USEA 4DG2E 3DLSA 4U80A 1YW2A 1KE6A 1QPDA 2BRGA 1YRPA 2ETRA 3DKCA 4BBMA 4KSPA 2CKEA 2VU3A 4H58A 5KMMA 3TN8A 2I0EA 3VQUA 4D4YA 4DEAA 5FXSA 4HOKA 3A7IA 5E8ZA 4QYGA 4ZY4A 2OKRA 2BKZA 4JBVA 3R1QA 2FUMA 3DAJA 3IOKA 4J7BA 4TWNA 4G6NA 2YIQA 2ZYBA 1CDKA 4CV8A 2JBPA 4QTAA 2XCKA 4YNEA 4BR3A 5BMMA 4JG7A 2XNEA 5LJJA 4FL2A 2A1AB 4IAKA 2YEXA 3PUPA 5EI6A 4C4HA 1Q8ZA 4F7JA 5DN3A 5HOAA 3VBWA 3GCSA 3R63A 1OECA 3TM0A 2XNPA 3NAXA 5CEMA 4O81A 2UW9A 4K8AA 4ZZNA 3H9RA 3QA8A 3QYZA 5DI1A 4S33A 3BLHA 5E8VA 4IAAA 4UYNA 3HV6A 4RZVA 3ODZX 2OG8A 4FNWA 3DGKA 5AR3A 4ZTMA 5C1QB 3MJ1A 4ALWA 1ZMWA 1V0PA 3A7JA 3FZ1A 3RINA 3UVRA 4UMPA 3RPSA 1T46A 3ANQA 4QP9A 4ZJIA 2BHHA 2W1EA 1HOWA 2B55A 5E1SA 1IAHA 5LVPA 4YLKA 3ZFMA 4EHEA 3HMNA 3OXZA 3WI6A 3SHEA 5EQEA 4U3YA 3DAKA 2OXXA 3HMOA 3FLZA 4HZRA 3O71A 5ANKA 4BBFA 2YDKA 2UVYA 4XUFA 3NNXA 4F09A 5HZNA 5JFSA 1KV2A 4CSVA 4ACDA 3MPMA 2X4ZA 3TTIA 4HZSA 2X8EA 2Y4IC 3IW4A 4NM3A 3C0HA 4AN3A 3IW5A 3CC6A 4CGAA 4UALA 4CQGA 3VNTA 3KCFA 1H8FA 2Y6MA 4FKTA 2VTOA 4KA3A 2OWBA 4APPA 4FKJA 4MQ2A 3UQCA 4GUBA 2JIIA 3QKKA 4PUZA 3KK9A 2XRWA 2BVAA 4KWPA 4EOQA 1PXMA 5K3YA 2VTQA 4YJSA 4BYIA 4BWKA 5CWZA 4E6DA 3TUCA 2B0QA 2F49A 4YC6A 5JT2A 3FLNC 2VWVA 3IDPA 4FV6A 2XNMA 4KIKB 3BU6A 3LLTA 4D0WA 4DFYA 4H3PA 2QOLA 4GU9A 2IPXA 5ANOA 3SOCA 3V8WA 5A6OA 2EWAA 3C51A 4XYFA 2FH9A 3I81A 3R01A 4FIHA 3NCGA 4RJ3A 4EKKA 5IA0A 2CKOA 1Q99A 4DA5A 1PYEA 3AMAA 4C3RA 1JAMA 1OVEA 2R3PA 2VWUA 4M7IA 1BI8A 4W4YA 2W4OA 1ZZLA 4WG4A 3JVSA 5EW3A 5HCYA 5AUWA 4QMPA 2XIXA 4IDTA 5AM6A 3MH0A 5CANA 3L8SA 3E8CA 4RJ4A 2R3JA 5ETAA 5TT7A 3WF5A 4O7VA 2OIQA 3DK6A 4XOYA 1OIRA 3I7BA 1QCFA 2HXLA 3JY0A 3R28A 4D2SA 2C5OA 3ORPA 4LI5A 3DKOA 2XK4A 2QOFA 3WIKA 4WKQA 3D5UA 4A9UA 2J5EA 5EI8A 1OBGA 3GOKA 5C4KA 4FIGA 5FDPA 4NU1A 3NRMA 3UQGA 4D28A 1ZOGA 1UWHA 2UW5A 1UKIA 2IZSA 3AG9A 3BHUA 2YZAA 3IK3A 3RMFA 2PYWA 4DAWA 3KCKA 4U43A 3FSFA 3GOPA 4Z3VA 4JL9A 3VJNA 4J53A 3CKXA 4W4WA 4PMPA 4U79A 3JVRA 2DYLA 4FG9A 3VBTA 1REJA 2Z7LA 4ZTHA 1G8SA 5CS6A 5AAFA 4IC8A 2WTKB 3BYOA 3DK3A 2ZOQA 3QTUA 2X2LA 4GUEA 4DGOA 3DZQA 3FDNA 2J0MB 4FIIA 4H3QA 4O2ZA 5EK7A 4UWCA 4F08A 1ZYJA 3HDMA 2QURA 4IQ6A 4D1ZA 4FVQA 2ZM4A 3FAAA 3FJQE 3DTWA 3O17A 2LAVA 3DOGA 5CF6A 4DH1A 3FQHA 1A9UA 2CKQA 3W2OA 3DNDA 2F7ZE 5FM2A 2Y4IB 4FT7A 4JLCA 2VWIA 1FBNA 3F9NA 5FG8A 2RF9A 5HBEA 3R7OA 3GNIB 2RL5A 2BDWA 2PZRA 3FUPA 3S95A 4X6QC 3KREA 3D94A 4LGDA 4HVSA 2QG7A 5KKRB 2YM5A 4KS8A 4Z16A 5HBJA 2HK5A 4FV7A 2QODA 3HDNA 4LRMA 4MF1A 2OJFE 2XEYA 5L2QA 1R1WA 3ZC5A 3G0EA 3GU6A 4FT0A 3JYAA 4XG7A 3UG1A 4AN9A 5JMSA 5M57A 4WBOA 4R7BA 3TDVA 4DT9A 1OKYA 2RG6A 3AC5A 5ETFA 2YJRA 5KMLA 3R1YA 4O0WA 3BWJA 3Q9XA 4NJ3A 4UXLA 2UZTA 3F7WA 5EDRA 4RPVA 3PXFA 1PXPA 1PMUA 2R3RA 4E4MA 3SG8A 1U4DA 2C5XA 3R2YA 2FSLX 1XKKA 3ZUVA 3ZXTA 3ITZA 3UIMA 4AT5A 3ROCA 4C61A 4U3ZA 1VYZA 3HP2A 4FL1A 3CR0A 3HX4A 3FI4A 2UVXA 4G34A 5BYYA 3KA0A 4EWQA 3P7AA 4K0YA 4LFIA 5A3XA 3MFSA 4I6BA 3FYKX 1IR3A 4U45A 2JKMA 4IWDA 3U9NA 2CHLA 3UDBA 4AG8A 3R8VA 5JK3A 4IAYA 4J97A 1JKLA 4OTGA 5M4IA 4IMYA 3AC8A 4FV0A 2C0OA 3NIZA 4DEHA 1YOLA 2ETMA 2Y0AA 3HP5A 1J7IA 4MYGA 1VJYA 2RFSA 3AD5A 5IQCA 4YNOA 1FPUA 2X6DA 3OEZA 3Q60A 4HCTA 1OIQA 4QMTA 4GSBA 4ZTRA 5JN2A 1E1XA 3D5VA 3RCJA 4BDIA 2IG7A 3W32A 2B9JA 2I6LA 3BWFA 3FLQA 2C3LA 4AA4A 4CG9A 1URCA 3EFJA 4G16A 2V7OA 4GU6A 4WSYA 1XJDA 4GV1A 2OH0E 2PMIA 1J3HA 1QPEA 3IW8A 3R8PA 2YM3A 3OCTA 4PL4A 2HIWA 4F6UA 3C5IA 4GMYA 4A9TA 4BVUA 1NVRA 4EOLA 4EORA 4PNKA 4UMRA 4EH7A 4MWIA 4RVMA 4AUAA 5AFVA 3FL5A 4BCNA 2WXVA 3O8PA 3HRFA 4RRVA 4FOCA 3GC9A 3HRBA 5HIBA 2ITQA 4ARKA 1FGIA 5CI6A 3ZS5A 4YU2A 5I9YA 5M4FA 1KE8A 5ACBC 2YZLA 5EKNA 4K33A 2QOHA 4H36A 4NL0A 3A4OX 4XMOA 5L6WL 3JXWA 3OWPA 3Q2MA 3C0IA 1V0OA 4IX5A 4K77A 4MXYA 3TV6A 2C1BA 4MXOA 1OL5A 4OBQA 4YPDA 4B9DA 3NGAA 4R77A 3NYOA 4UY9A 2WTVA 5AM7A 2O0UA 2XVDA 5CAVA 5AUUA 2QOQA 3DXNA 4GKHA 4KD1A 1ZY4A 3SKCA 3QCYA 5E8XA 5HO6A 3VUKA 2OZAB 3POOA 4ASEA 3QQKA 4E4LA 1ZOEA 3MY1A 4RG0A 4RX5A 4G3FA 2GQSA 4CLIA 3R83A 2Z2WA 2BMCA 2X0GA 2O3PA 3CQUA 3WILA 3NW7A 1ZAOA 2Y4PA 3FHRA 4KKHA 2GNIA 1CKIA 3M2WA 3EH9A 5HIDA 4ZTSA 3DDQA 4CEGA 5J9ZA 3GFEA 2UW7A 4O0UA 3MV5A 5KMNA 2VX3A 2OZAA 2V5QA 3W8QA 3R9NA 4E93A 1Y8YA 3MIYA 4XP3A 4C62A 1YWRA 4CZTA 3S4QA 3JR1A 5LVNA 3EHAA 5ANIA 5HE0A 1J7LA 4ZIMA 3G33A 5B2MA 3DT1A 4BRXA 4FUYA 5M53A 4HGEA 4JG6A 2IZTA 3TJDA 4YHFA 2BRHA 3IS5A 4OTFA 3I0QA 3ALOA 4S30A 3SLSA 4LOPA 3C0GA 4PRJA 4YC8A 2ZMDA 5IA5A 2AYPA 4PDOA 3KN6A 4NW5A 5JGBA 5JGDA 4FT3A 5KBQA 1XH8A 4I6HA 5E92A 3ZBFA 4RQKA 2C4GA 3OT3A 3H4JA 5LQFA 2Z7SA 4D5HA 2PUIA 2X6EA 3QA0A 5D10A 3VW6A 4AQCA 4LQMA 4IJ9A 3RPOA 3IPHA 2XK9A 2XKDA 3DJ5A 4IANA 3KF4A 4YURA 4IJPA 4A9SA 5AX9A 3QYWA 3KFAA 2FGIA 4G2FA 1U46A 2VGOA 1WZYA 2FSMX 3QGYA 2UW8A 1PXOA 4TYEA 4L46A 1DM2A 4Q9SA 1VYWA 3NVMB 4I92A 2ETKA 2OI4X 1VR2A 4QO9A 3KRRA 5CEOA 5F9EA 4I5HA 4ZEGA 4IVAA 2ESMA 3W18A 2C6DA 3CSVA 4FTIA 3RTPA 4Z55A 1H26A 4UBAA 3T3VA 5FXQA 2EXCX 3GP0A 3HMPA 4F1MA 5FEDA 2X8DA 2VWXA 1U5QA 2W06A 2I0HA 3KRJA 3QKMA 4FGRA 3N9XA 5FWKK 1WAKA 1WVYA 4ZSLA 5FUTA 1SZMA 2XUUA 1OPLA 5ANEA 3UGCA 4FIEA 3Q5ZA 4V0GB 5JFVA 3DKFA 4WNKA 3DKGA 4G3GA 4MQ1A 2GS7A 4QTCA 5HNIX 3ZCLA 3VUGA 3TZ8A 3FSKA 4WA9A 2LGCA 4L3JA 3CGFA 2JEDA 3MVMA 2XKCA 4MCVA 4UXQA 4IEBA 4UMUA 2HZ0A 3Q6UA 4FK6A 4DGNA 4A4XA 3R30A 4BCMA 5LMKC 2ZJWA 5M55A 2YWVA 4V0GA 1KUTA 1H25A 2CDZA 4WUNA 4KS7A 5FP6A 3F82A 3R21A 5CT0A 2XRUA 4D1SA 5LVLA 4FV5A 3V8SA 3HUCA 5DBXA 1XH7A 5G1XA 5HESA 4IXPA 3ZO1A 3EFKA 3FI2A 4BGHA 2XM9A 3GEQA 4CQEA 3L1SA 5A4CA 4J96A 2R7IA 4FEVA 4MXXA 1Y6BA 4QRCA 3EL7A 1OKZA 4FTQA 3QRJA 4C36A 5EDPA 4BDJA 3KB7A 5GIPE 4IFGA 2VWZA 3QTWA 3MVHA 5TO8A 4O84A 3REPA 3FZTA 1LR4A 2GMXA 3DV3A 3ZBXA 3UO4A 2PY3A 3ERKA 4LMUA 1CKJA 3PXKA 4RWJA 4ZXTA 4OTQA 2PZYA 5DT3A 2X39A 3W10A 4RX9A 4RVKA 2WTIA 1Q24A 2PE0A 2R64A 4ITHA 4RJ8A 2JIUA 4DH7A 5L8LA 3OP5A 4IZYA 4RGJA 1K2PA 3HV5A 3LOKA 4CKRA 4WO5A 3TDWA 3MWUA 1XHAA 3NW5A 4NFNA 4D2WA 2WMQA 4F1TA 2JDSA 2E9PA 4FTKA 4ID7A 3N4TA 1MRYA 3FV8A 2J50A 2YAKA 2YJSA 3P7CA 4IX6A 4Y83A 5C8MA 2A0CX 2XS0A 3ULIA 3SX9A 5IU2A 4EHGA 5CEKA 1ZYCA 3Q52A 1Q62A 2NP8A 3HA6A 4QMYA 1M52A 2B9FA 3QCXA 4ENXA 4EH5A 4F7LA 2WMTA 3ZRLA 1UKHA 3D7TA 3VHKA 5DLSA 3ZSGA 4BTJA 3QTXA 5AP0A 3C13A 5ANDA 5FDXA 5H8EA 1G5SA 4FT9A 4Y5QA 3WYXA 4BCGA 4L43A 3HV3A 3CQWA 4NSTA 4QPAA 3ZLXA 3D7ZA 5I9WA 3U6IA 3CJFA 2WELA 3MSSA 4E6CA 1XH6A 4OT5A 4XG6A 3ROYA 5EOLA 1XBAA 5LWNA 1RE8A 5C01A 4O1OA 3TTJA 3P5KA 3DCVA 3ZU7A 2OIBA 2XNNA 1Y6AA 3LW0A 4C38A 5FD2A 5E8TA 4E73A 4H1JA 5KUPA 2ITOA 3EYHA 4D55A 4I6QA 2RG5A 4KABA 4O27B 4W8DA 4YO6A 2OLCA 5EG3A 5KHWA 2EU9A 4IVBA 4PL5A 2R0IA 2X7GA 2KTYA 3R1SA 3V51A 5IISA 4W4VA 5IQEA 4BICA 3L9NA 2IJMA 3PJ2A 2ITYA 1IRKA 4FVRA 5FXRA 2ITTA 4QNAA 2XNBA 2ITWA 3IONA 4QT1A 1A06A 4ZSJA 4DEIA 3PIYA 4U41A 3RM6A 5ICPA 2VGPA 4O96A 5L8JA 5L2SA 4YGAA 3CGOA 4AX8A 2HAKA 3SXFA 5BNJA 1M2QA 2BZIB 2X7OA 5ITAA 3C4ZA 4FKOA 3R7UA 4BC6A 3EOCA 3FI3A 2AC3A 1XH4A 2J0LA 4M0YA 4DBXA 3LFEA 1OITA 3PG1A 4JI9A 4BDCA 4D1XA 2ERKA 4LV5A 4WG3A 3V6RA 4RSSA 4QP1A 5FP5A 4I24A 5HCXA 3W2CA 3FXWA 3MGYA 2IZUA 3HNGA 3RBWA 2UZLA 4JDJA 2C6IA 2HCKA 5DH3A 4UEUA 2WIHA 1M14A 1KOAA 2WQBA 5A4QA 1UU9A 2CN5A 3U54A 1XR1A 4JAJA 3JUHA 4YBKA 3ORXA 3Q4UA 1MQBA 3MH2A 2XIRA 3DY7A 4I23A 3ZDUA 1ZMVA 3F88A 2BALA 4CCBA 2ZMCA 4FZDB 2WMXA 2AUHA 5F1ZA 5CSHA 3ZLYA 4JBPA 1GIIA 4LL0A 4KB8A 4B6LA 4J8MA 1WBNA 3KXGA 5FQDC 1G8AA 3B2WA 4FNXA 4K1BA 4JR7A 3FLYA 1Q41A 1TQPA 4JOAA 4ZTLA 3ATSA 5CF4A 4FIJA 5K4IA 1G3NA 1SYKA 4ACHA 4BCHA 3MB6A 4ZTNA 4BCPA 2DUVA 2EXEA 5E8UA 2Y8OA 5EFQA 4D2VA 4F0GA 4KUJA 3ORTA 3FMHA 5EH0A 2PVFA 3BV3A 4FTRA 4O0YA 4PDSA 3BPRA 3PYYA 4N70A 4FSYA 3R8LA 4QMZA 4XNEA 1BUHA 2R4BA 4YO4A 1SMHA 3L9MA 4GW8A 5IUIA 3KGAA 2OSCA 4I0TA 5B7VA 3E92A 4YMJA 3VBQA 3HRCA 3PVUA 2XKEA 5GZ9A 2HW7A 1H4LA 1IG1A 3QWKA 5ETCA 4C3FA 5J7BA 1MUOA 2IVTA 4QTBA 2GSFA 3QU0A 4EOKA 4AT3A 3D2IA 3DBEA 1I09A 5I3OA 1A48A 3ZYAA 1U54A 3HV4A 1GAGA 3LM0A 4IAZA 4WIHA 5H9BA 4EEVA 2JDOA 3R9HA 5FLFA 5IQFA 3NUSA 4L8MA 3CTJA 2JDVA 1JKKA 3LJ2A 4JDKA 4JT3A 3N4UA 3I1AA 2DWBA 3DB8A 4J98A 4M3QA 4J99A 1B39A 3F3TA 5FM3A 3FMLA 4QOXA 4K6ZA 3E3BX 5J95A 3CKWA 4EH6A 3OZ6A
chains in the Genus database with same CATH superfamily
2IVSA 2F7XE 5IA2A 2B4SB 3ANRA 4I0SA 3UC4A 1FVVA 2GS6A 2HENA 3F5XA 5FRIA 5HHWA 1JWHA 5CSVA 2W1CA 4KRDA 5E7RA 5EYCA 4DEGA 2UZVA 4F9BA 3MFTA 4YJTA 3W0SA 2C47A 3Q9ZA 4FSRA 4H3BA 4I6FA 4X6RA 4YSMA 4EHVA 3E8EA 5AUTA 2PPQA 2C6MA 1ZOHA 3QQLA 2W0JA 5FEEA 2VO7A 1H00A 3U6JA 5J9YA 2RSVA 4AF3A 5M4CA 4EZ5A 4PY1A 2ACXA 2PHKA 4LUEA 4F6SA 5A54A 1H28A 3KXHA 3QQUA 4MK0A 3IDBA 3TCPA 3TG1A 3DNEA 1UU8A 4IADA 3BCEA 4AQKA 4TYHB 5CTPA 3BE2A 3RPVA 3GQIA 2GU8A 4PTCA 5A4LA 3QZFA 2IW6A 2R2PA 4AW0A 2WO6A 5HI2A 4ORKA 3MN3A 3C5UA 5CNOA 4GT3A 4DHIB 4C4GA 4NM7A 2ZVAA 4LRJA 5IQHA 4DFBA 4XRJA 3ODYX 4Q2AA 4QPSA 2O63A 2QC6A 4O2PA 2BAKA 5EQYA 3A7HA 4TYHA 4PMMA 1ZZ2A 4A4LA 3FHIA 2C69A 4JX7A 2XALA 4UYAA 2VRXA 1PMVA 3MBLA 5AIRA 3BYSA 5L8KA 3COKA 5GZAA 1DI9A 3VN9A 1PY5A 2QVSE 4NYEA 3DBDA 3D0EA 5AJQA 3UJGA 4O7YA 3W0PA 3H0YA 1PKGA 2HXQA 1Q8TA 3W0QA 4ANOA 3ZDIA 3ZEWA 4LMNA 4OTIA 3IQ7A 2X2KA 2F7EE 3AC3A 5F94A 5H8BA 4QEBA 4L53A 4ANBA 3C50A 3JPVA 3WIGA 4CRLA 4NUSA 3O7LB 3A7GA 4CZUA 4FEUA 1BYGA 4XLIA 3QRTA 3EKKA 1OMWA 4UZHA 2CLXA 2YACA 2YFXA 4FTOA 1P14A 4UMQA 4XRLA 4HVIA 4TL0A 5IH4A 3PY3A 4L44A 5AIKA 3BHTA 3Q5IA 2PL0A 4DBNA 1WMKA 2OW3A 4ZMFA 4EOOA 5CALA 3GENA 3IECA 1CSNA 1OUKA 4B99A 4B8MA 5CU0A 1V0BA 3P4KA 4RJ7A 1M17A 3IKAA 3NYXA 4HCUA 2C6OA 3F2NA 4FKLA 4FZFB 3FQEA 2PTKA 4LM5A 4MBJA 3UOHA 1BMKA 1J91A 4XP0A 3MH1A 4O0VA 5EYMA 1NT2A 4ZJVA 2FA2A 4AA0A 3F2AA 4S31A 3LFAA 4ITIA 4NH1A 1KE5A 3OVVA 4BIDA 2HYYA 4GK3A 4KAOA 4R6VA 3UQFA 1PXIA 3P86A 3K3JA 3FY0A 3UDTA 2P4IA 2WMUA 4O1PA 3V8TA 4EYMA 4OTHA 2UVZA 3FLSA 3PJCA 4MNFA 4MXAA 4OGRA 4M97A 4EBWA 3NW6A 4FTNA 3ET7A 4MNEB 1G8JA 4M15A 2WQNA 5J5SA 3KL8A 2PZPA 4CD0A 3CEKA 5AP4A 2ZV8A 4DFXE 1PRYA 3CCNA 4EUUA 1O6KA 3KULB 3QD4A 1WBTA 4ITJA 4QMXA 4EH8A 5E8YA 3V5JA 3VULA 3C7QA 2XM8A 4IM0A 2B7AA 4W9XA 5DOSA 4AU8A 3BRBA 1DAYA 3IO7A 3PPJA 2GHGA 4O0SA 3KXZA 1JSTA 4NW6A 1OPJA 1E9HA 2JITA 2QHNA 2UUEA 4MNEA 5IF1A 3GU8A 2WTJA 3E7VA 4NK9A 4TYIA 4C4EA 2EB3A 2VTMA 3BGPA 4I4EA 5C26A 4G5JA 4GS6A 3KULA 4V05A 1UV5A 4KNBA 4PWNA 2W7XA 4X3JA 1ZXEA 4F78A 1PKDA 3P9JA 3PZHA 3BI6A 2C6LA 3DLZA 4FTCA 2XBJA 2QCSA 3R00A 2IO6A 5ANJA 2G2HA 2X8IA 2R9SA 2R3NA 2WU6A 4FSZA 4RC2A 3UOJA 2YM6A 3R0TA 4OTWA 3ZRKA 3PXZA 4FRFA 2H6DA 4GJ3A 4RFYA 4DTKA 4USDA 3PDTA 2X9FA 3AQVA 1L3RE 4AAAA 2CKPA 1W82A 3KK8A 2WMWA 2H8HA 1JSVA 4PNIA 5L6OA 4AZWA 4NCTC 4EHZA 4RJ6A 3R7EA 4TRLA 2J5FA 1R78A 3QLFA 4ZJJA 4BI0A 2HY0A 4MX9A 4RIWA 3TWJA 5HO7A 1YDRE 4BL1A 1J1CA 3HAVA 3F5GA 3SC1A 1KOBA 3EQGA 4GK4A 2XANA 2RFNA 2A2AA 2W1ZA 1F3MC 3NCZA 3OF0A 4XOZA 5JRSA 4DEEA 4DHJA 3C4FA 3VS3A 4OLIA 3ZLSA 2I0YA 3A8WA 1TQIA 4QD6A 5GIOE 2GFCA 3BBTB 4HYHA 2OICA 1PMEA 1WBSA 1S9IA 1YI3A 1XO2B 2EUFB 3EB0A 4QYEA 5AP1A 1QL6A 2FYSA 5AR2A 3WF6A 5BQ0A 4ZMEA 4MBIA 5C8KA 2VTHA 3O0GA 4TY1A 2XAMA 4PX6A 5KMOA 4LRKA 2PVJA 3UC3A 4BHNA 3KEXA 2W1DA 4HYIA 4XV1A 3H9OA 1P2AA 3ZO3A 1QMZA 3PE2A 3PG3A 4RWLA 4DDIA 1ZY5A 2VZ6A 4CCUA 2QO7A 4D58A 4OUCA 1Z57A 5HBHA 3NNWA 4IVCA 3OD6X 3FKOA 3VRZA 3ZSHA 2X7FA 5BPYA 2JLDA 1M2RA 3PVBA 4FNYA 2VUWA 5DPVA 3UG2A 1HCLA 3NIEA 3KMUA 4I6LA 2F2UA 5AX3A 3GU7A 3KXXA 3Q9YA 2G15A 2JDRA 2PVHA 3I4BA 3GI3A 5AV3A 4F9CA 5JFWA 4FZ6A 4CXAA 2QO9A 4HYSA 1MP8A 1LUFA 4IAFA 4YZBA 2QLQA 2QOKA 3P08A 2J51A 3FXZA 4AACA 5K5XA 3C4EA 2XJ2A 4IVDA 3V5LA 2PVYA 4Q5EA 3AXWA 2HZ4A 4Y5HA 4C2VA 5CXZA 3NUYA 4G3CA 5JGAA 1PJKA 2W5AA 4FBXA 2R3FA 2BUJA 2VTAA 4D5KA 3II5A 2UZBA 2CNQA 3VS4A 4ONAA 5FGKA 4ANSA 4C34A 4E20A 5J9LA 5TF9A 1PHKA 3EL8A 3D14A 4CFXA 5GJDA 1OI9A 3UZRA 3TT0A 3NEWA 4YR8A 3LMHA 3KKVA 4DF3A 4F63A 3KXNA 3KN5A 1H27A 5HTIA 4EZ3A 2PU8A 1OB3A 2XBAA 2WIPA 3EQCA 4G17A 4L3LA 4ZY6A 3OT8A 5AUXA 3UYSA 4NM0A 4AE9A 4ANNA 3NZ0A 4YJPA 3T8OA 4BZNA 3CBLA 3OCSA 3EN6A 3IW7A 3P79A 3QUPA 3OOMA 4JQEA 3HV7A 4QP8A 3LMGA 4ZOGA 1U59A 4DCAA 1RW8A 2WGJA 4W4XA 3F6XA 4C4FA 5A6NA 3SW4A 3BZ3A 2B1PA 3MA3A 4DG3E 3WOWA 4EL9A 3LM5A 2YIWA 2GFSA 4FICA 4WRSA 5HEZA 4BTMA 5AEPA 5JH6A 5IZFA 4KIOA 1CMKE 4S32A 3JS2A 5DG5A 2Q83A 4F99A 4HYUA 5JQ5A 4DITA 2ZB0A 3ZZEA 3DQWA 5J7HA 2BILB 4OW8A 1MRVA 2VTIA 2Z60A 4LG4A 2QU6A 4NCTA 3TNQB 4II5A 3ELJA 4FT5A 2IN6A 5AUZA 4G6OA 3EQIA 3EQRA 3QL8A 4FV1A 4M69B 3U8WA 3SAYA 4AZSA 4BZDA 3A99A 5KNJA 4UV0A 3PXQA 5JZNA 3UIUA 2XF0A 4QMQA 2GNGA 4IWOA 3DBFA 4JS8A 3V5PA 4IH8A 1M7NA 1YXTA 1PXKA 3MTFA 3HLLA 3L8XA 1O9UA 2VV9A 3ENHA 3TXOA 2QI8A 4AN2A 4B4LA 3E93A 4FX3A 4L3PA 4L6QA 4WUAA 4EZ7A 5BVOA 2BZJA 4JRVA 4B8LA 1P5EA 2PVMA 4M69A 5ETIA 3NR9A 4OTDA 3U6HA 4DTBA 3VS1A 4AGDA 2P33A 4LYNA 4LUDA 3SRVA 4AW1A 5AV4A 4EQCA 1P4OA 2F2CB 1Y57A 1H07A 3RVGA 4O6LA 1V1KA 1OM1A 4AXAA 4F7SA 2ZDUA 3IW6A 4DGGA 2CNVA 4L7FA 2UZDA 2F57A 3VAPA 2VTSA 3RNYA 4Z7GA 4JMQA 4DTAA 4MBLA 4QMMA 2BTSA 3FPMA 1REKA 3AD4A 3PSCA 3UPXA 4X2KA 4GVJA 3VUIA 5AR5A 4BBEA 3O2MA 4QQCA 3DBCA 3WZDA 4EK8A 4FMQA 4DG0E 3CS9A 5HTCA 1J7UA 5GNKA 3Q4ZA 1UWJA 1NXKA 3VS5A 3QTIA 3HEGA 4ANLA 5K0XA 1W98A 2OZOA 1WBVA 4KBKA 4MWHA 4UMTA 3RAIA 3U87A 4I20A 2XK7A 3K5UA 3CY3A 1PYXA 3K2LA 5L4QA 3VBYA 4KIPA 5IDNA 4BTFA 4DHFA 1GZNA 4M13A 5BUEA 3R04A 3RK9A 5AAEA 5E8WA 2J0IA 4NZWB 2KULA 2WMSA 4FOBA 3I6WA 5K0KA 3MPAA 4M66A 2P2HA 3PE1A 5A46A 3WZJA 4D2TA 1TQMA 5H3QA 2WPAA 1S9JA 3MVLA 4FI1A 2P0CA 3PY1A 2WTWA 5TR6A 1H1SA 3PPKA 3Q32A 4QP4A 1TFFA 2JFLA 3R7YA 4RX8A 4YTFA 1OL7A 2R3QA 2R3KA 3GQLA 4C58A 4NTTA 2WAJA 3UMXA 3LFNA 4WSQA 4ZZMA 2QQ7A 2W5BA 3EIDA 4EH4A 3NNUA 5DT4A 3BKBA 4DLIA 4NKAA 3FLWA 1YKRA 4DGMA 1APME 4M12A 2XNGA 4N4SA 3D5XA 4R1VA 3NAYA 5LWMA 4FJVA 2CN8A 4IM3A 3DA6A 4MXCA 4UWBA 4HVHA 4RT7A 4BB4A 3RGFA 3ORLA 2R3GA 1OL2A 1BX6A 2JKQA 3JY9A 3NDMA 1JNKA 3WF7A 1URWA 3FMEA 3BV2A 3RPRA 4AZEA 4C7TA 2HWOA 2X0QA 3HKOA 1YHVA 2W4KA 3PRFA 3QRUA 4FKQA 4IACA 5HGIA 2JKKA 2UW3A 5CSWA 4DFZE 4BTKA 3QZIA 2VTPA 3RI1A 3FZPA 3S3IA 5C4LA 1IASA 2R0UA 3PJ1A 2ITVA 2O64A 2Y9QA 4ACMA 4E6QA 2X81A 2FVDA 3GVUA 2BRBA 2V55A 3DPKA 3OFMA 4QMLA 2VTTA 4XCUA 3CPBA 4JNWA 4XH6A 5K5NA 4O22A 3R9RA 4ZSEA 2G2IA 5IQIA 2BFXA 4YLJA 3QHRA 5AR7A 5IQAA 4CFMA 4U40A 1W8CA 3ZSIA 4GVAA 2WHBA 3FC1X 2CNUA 2R3HA 5CEIA 4XS2A 1Y8GA 3ZC6A 4FVPA 3HZTA 4IFCA 4U0IA 4BDAA 3NFFB 3ORNA 2IVVA 5LMBA 3TNPC 4CT2A 4QMSA 3BELA 4O4FA 4B0GA 4CTCA 4F7NA 3E7OA 3R8MA 4JR3A 5E9EA 4K18A 5EM8A 2JFMA 4I94A 3ZHPC 2YIRA 4OBPA 4GT4A 4DFUA 1JLUE 2PMLX 2UZUE 4FV4A 4YZ9A 3QC9A 4KRCA 4QQJA 4RIXB 3EYGA 4ZP5A 3BLRA 3G9LX 3DTCA 4JIKA 3VIDA 2WNTA 4FSMA 3UVQA 4BGGA 3TKHA 4BCQA 4EOSA 3FWQA 3UO5A 2C6EA 5CASA 4U42A 2Y6OA 3OWLA 3QD3A 4U81A 4DGLC 4FA2A 5EQPA 3KVXA 4FKSA 4JQ7A 5M06A 3HECA 4IE9A 5DR6A 4XEYA 3V6SA 5C8NA 3Q9WA 5FEQA 2BFYA 5HE2A 4IDVA 3B8QA 1STCE 4TYJA 4RIXA 4AFEA 3EMGA 5JKGA 4BCJA 4H39A 4XP2A 4AP7A 3MFUA 4EK5A 3DFAA 4S34A 3GCQA 1AQ1A 5HNGA 5IA1A 2PUUA 4IIRA 3QRKA 4FK3A 4X0MA 4CFUA 5KHXA 2E9OA 3VQHA 3EQPA 4AE6A 3ETAA 5JZJA 3V3VA 1NA7A 4X2FA 1Q97A 3AD6A 4L7SA 2XJ0A 2WMVA 4OAVB 2Q0BA 2Z7RA 4CZYB 3G6HA 4YTIA 4F9AA 2UW6A 4BKYA 1XQZA 3F5PA 4LV8A 5A4TA 5IQBA 4CT1A 5JQ8A 2WMAA 3RKBA 4ACGA 1ZLTA 5AADA 3D7TB 3OXTA 2QHMA 3NX8A 2OJJA 4TT7A 4IHPA 5AV0A 3P23A 4EQUA 4C33A 4JAIA 3M42A 3EZRA 4Y95A 5A14A 5IQGA 1FGKA 3RPYA 2CJMA 3PP1A 3UTOA 4GYIA 4L00A 1Q8YA 2UZEA 3OEFX 5HIEA 2Z8CA 4FV8A 5EHOA 2VD5A 3C4XA 3AKJA 4HGLA 4RIOA 3K3IA 2QNJA 4FKPA 4C3PA 4M68A 1Q3DA 5B2KA 2PZ5A 3RCDA 3VS6A 1YDTE 4GFMA 2R7BA 2OF2A 1Z5MA 5E91A 4BI1A 1ND4A 3C5IA 2R3OA 5C03A 1GZ8A 3TEIA 4FG7A 4IM2A 5M4UA 2F9GA 2QONA 3I5NA 1GOLA 4M0ZA 2CGXA 4XG8A 3CD3A 2DS1A 4QDVA 3MY5A 2BZHB 1SVHA 4OAUC 5BX0A 3NUAA 2YERA 1LPUA 2AQXA 3ACKA 4GG7A 4RA4A 4XHKB 1Q4LA 3QZGA 5J8IA 3NUUA 3QX4A 4JDIA 5IG1A 4HPUE 4IZ7A 4PMSA 4Y8DA 4C35A 3UBDA 4P5QA 3WF9A 2IVUA 1YXUA 5I9ZA 4FC0A 4LGHA 4PPCA 2VO6A 4HJOA 3VUMA 2EB2A 4C59A 3G51A 4E7WA 2OIDA 3LPBA 2XJ1A 4XBUA 1JQHA 3AMYA 5I9XA 3F3VA 5TOZA 4TWOA 3PJ8A 4QNYA 3I79A 3UVPA 5IH6A 2C30A 2UZOA 1MQ4A 5LARA 2QOIA 4DE4A 3E5AA 4D9TA 5AP7A 2PE2A 2XIKA 4O91A 2C6TA 2OH4A 5BYZA 5DNRA 5LXMA 4O7WA 4YZMA 4RA5A 5T6KA 3I6UA 3P7BA 2PULA 3W8LA 3FZSA 3WARA 1ERKA 2C0TA 3D5WA 2C5VA 4DFNA 3MB7A 5FTOA 4ZY5A 5CZIA 2C68A 4RZWA 3R02A 4LV7A 3GGFA 3QBNA 5GJFA 3AKKA 2OO8X 4BIEA 2W17A 3PP0A 5H2UA 2GPHA 4OT6A 2OJ9A 1ZYSA 5LMKA 4EOPA 4PQNA 1YXSA 3AGLA 2H96A 4RVLA 4DCEA 1ST4A 2BRMA 2QKRA 2VAGA 3MPTA 3QQHA 3CTHA 5KZIA 2YCFA 3EQFA 3LCDA 3S00A 2CLQA 2WQOA 1RJBA 4I22A 1OUYA 5EOBA 3FPQA 3PJ3A 5LVOA 3TKIA 3DJ6A 1P4FA 3F7ZA 4ANQA 3MH3A 2XKFA 3D4QA 5CYIA 2XNOA 1UU3A 1XH9A 1ZARA 4QMWA 3POZA 4RLKA 4IWQA 4O7RA 3ZEPA 3FC2A 5G6VA 2XEZA 3IGGA 4U5JA 4O0TA 3ZUUA 3AGMA 4FEQA 4MAOA 5HORA 4G6LA 4I5MA 3VRYA 4BWXA 2YN8A 3PVGA 2FB8A 5AP2A 2I40A 2C3IB 4QYHA 3PZEA 2WKMA 4JDHA 3UE4A 2YCSA 4R1YA 2NPQA 2IW9A 2PUNA 3UDSA 2CCHA 5DE2A 3C4CA 5DRBA 3VS2A 5IDPA 4E1ZA 3LCKA 4NKSA 4RC4A 4DC2A 4ENYA 5EM7A 5KMIA 2WMBA 1TKIA 2PUPA 2ZM3A 3CIKA 3A60A 5D1JA 3BYUA 4LGGA 5EM6A 4N57A 1U54B 4BI2A 4O4CA 2BDJA 2BZKB 3TL8A 3QD2B 3HGKA 3TJCA 2NO3A 5HKMA 1GIJA 3NPCA 3O96A 2XYNA 1XH5A 2RKUA 4QP6A 3UDZA 4GCJA 2YABA 4D2RA 4I0RA 3LCOA 3L8PA 3ORIA 3CLYA 1FQ1B 2IEWA 3KY2A 4DH5A 5IEVA 4RLLA 4MTAA 1OKWA 4QYFA 3QFVA 4PF4A 4EOIA 4A4OA 3FMJA 1H1PA 1RQQA 3LQ5A 3A8XA 4O86A 1XWSA 4BYJA 3PLSA 3FBVA 4HVGA 4XX9A 2W05A 4EH3A 5KCVA 4O7LA 3OWJA 3QLGA 1OGUA 2YIXA 1WFCA 5I9VA 5HE3A 2OK1A 5F95A 5TKDA 3IDCA 4I1ZA 2ITZA 3SOAA 3T9IA 1Q8WA 3UYTA 2VWBA 5AAGA 2V7AA 4GT5A 2YWPA 3D83A 3F61A 3GCVA 3T9TA 3DQXA 2XIZA 3FZOA 3KIOC 5IUHA 3RK5A 5EM5A 3MESA 2XYUA 3UNKA 4FSNA 5BUJA 1B6CB 3W0OA 3I5ZA 4BWPA 4O82A 4YJRA 4CYJA 2X4FA 4PTGA 3Q4TA 4BN1A 4N6ZA 3OCBA 3QTZA 4AZFA 1KWPA 3VW8A 5DR2A 3QF9A 3PA5A 3PA4A 5AV1A 1GZOA 1OKVA 4ZS0A 4D0XA 3LXPA 3LXNA 3LLAA 3OXIA 4WOVA 5KO1A 5DHJA 3PIZA 3AMBA 4QMNA 1K3AA 3GXLA 4EC8A 2E2BA 3QZHA 5LCKA 3VBVA 4CFFA 3PA3A 3TMOA 2AC5A 5HICA 3DJ7A 4JXFA 2J2IB 3BYVA 3NNVA 5EHYA 3R7IA 3ZONA 5J5TA 3SVVA 3SG9A 3FKNA 2OF4A 2RIOA 4PMTA 5M44A 4CKIA 4GYGA 2JAMA 4AFJA 3NYVA 2YITA 3PFQA 2VNWA 4ANMA 5DMZA 4X2JA 2QR8A 4P2KA 2DQ7X 4QTEA 4TZRA 4BDKA 3S0OA 4WG5A 3UIXA 1KSWA 4AZTA 3VUHA 3IG7A 4UN0C 4G1WA 3BGQA 4TWCA 1UA2A 3LQ8A 3DK7A 1FMKA 4E5BA 4P7EA 3CY2A 3U51A 4MVFA 4CFWA 1OL1A 2J0KA 3BE9A 1W7HA 3QXOA 4PL3A 3ACJA 4AGCA 2J90A 4FIFA 2WZJA 4NWMA 4XG9A 1B38A 1R39A 2JAVA 2F4JA 1X8BA 3EN4A 3LAUA 5D7VA 3CQEA 4RWKA 4FKIA 5HVKA 4TTHB 3BU5A 4LOQA 4KINA 4HPTE 3ZXZA 4FTMA 2GQGA 3QQFA 4Y85A 4IC7A 4BHZA 3HMIA 1NVQA 3QUDA 1WBOA 3QGWA 3ZMMA 5I9UA 4BCOA 5I0BA 2C6KA 4DT8A 1JPAA 3GFWA 4UZDA 1NY3A 3ZUTA 3DXPA 4ZTQA 1YI4A 2V0DA 4BY9E 5M51A 2XK8A 3OY3A 3R1NA 3NUNA 4YHJA 2BAQA 5BVWA 3F66A 4FTAA 4PDPA 1GY3A 1YWNA 4CMUA 5KX8A 3NLBA 2WOTA 5CQUA 2UW4A 3ZO4A 2PK9A 3QAME 4GK2A 3ZRMA 3OY1A 3SV0A 3VS0A 5KE0A 4QP7A 2WTDA 5JRQA 2BIKB 5EDQA 5AR8A 5EW8A 3BL7A 1JOWB 3BEGA 3ENMA 4XLVA 3AT3A 1VZOA 2UZNA 4FGBA 2IW8A 1GIHA 5LVMA 3S1HA 2JC6A 4IBMA 4EUTA 2GTNA 3Q4CA 4AW5A 3QKLA 2FO0A 1UNGA 5D11A 4D9UA 3E3PA 4ALUA 5C27A 3L8VA 1Y91A 4Z7HA 5HX6A 2UZWE 3U4UA 4ALVA 2W5HA 4BDHA 4EYJA 4XG3A 1F0QA 4YC3A 3OROA 2WQEA 1Q8UA 1GJOA 3FYJX 1R0PA 2WTKC 4AOTA 5JEBA 2NRUA 3BBWA 3GC0A 4FSWA 2W1GA 4KKGA 4BF2A 1PW2A 3EQDA 3OUNB 4C57A 1IEPA 1HCKA 2XP2A 3KU2A 3VF8A 2WEIA 3Q3BA 4AGUA 3WE4A 4R3RA 2CGUA 4MD9E 3P78A 2YM8A 3G0FA 4CVAA 3FMNA 3Q04A 4WNMA 3KRWA 2Z7QA 5E1EA 2YM7A 5HVJA 4EJNA 3HVCA 1UNLA 4IWPA 4NT4A 5BVEA 2QLUA 3LCTA 2BRNA 3GCPA 2PE1A 3QD0A 4IAIA 2W99B 1FVRA 3BHYA 2BPMA 4WNPA 5J79A 1W2FA 3VUDA 2ZB1A 2YA9A 3ZH8A 4JBQA 2I0VA 3DAEA 3AOXA 4J8NA 4ZLZA 4RIWB 3NFGB 5BVKA 1E1VA 3EQHA 4AS0A 4ZLYA 4BDFA 5DRDA 4MKCA 2ZV2A 2GNFA 3THBA 5KKRC 4P4CA 5HVYA 4BCIA 5CEPA 3G6GA 5IEYA 4C4IA 4F9WA 1LP4A 2QO2A 3PXRA 3RAKA 1WBWA 4F0FA 4M84A 4DN5A 3ORZA 4RBLA 3W16A 2SRCA 2WOUA 4RFMA 1K9AA 2G2FA 5IA4A 5M09A 3DXQA 1WBPA 3P5JC 3TIZA 5IH5A 1KE9A 3L9LA 2P2IA 3OW3A 5CSXA 3W2SA 4E3CA 2XB7A 5HCZA 3ZTXA 5E4HA 4R5SA 3NSZA 4FSTA 3MW1A 4KIKA 5HX8A 2WU7A 4O38A 5IKWA 4ASDA 4FV9A 5CLPA 5BVFA 5A9UA 2PVRA 4WHZA 4FE2A 5KBRA 2GDOA 4C37A 3H30A 4GG5A 3BX5A 4E26A 5D9HA 3DZOA 4F9YA 4HW7A 2QR7A 1BI7A 3LFDA 3O23A 1DS5A 4U9AA 3QCQA 4NJDA 1VEBA 5CQWA 4NEUA 4YP8A 2IWIA 2P3GX 3V5TA 5L6PA 3U4WA 4TNDA 5DYJA 2GHMA 4MD7E 3EKNA 1FVTA 2NNWB 1OL6A 2GHLA 3CE3A 5AR4A 4N6YA 4U8ZA 1H1WA 2VX0A 3KXMA 2JDTA 4CKJA 1H1QA 2HY81 5DEYA 3BU3A 4G9CA 2YIYA 3KF7A 3UOKA 2YCRA 2CCIA 3LHJA 4M67A 1W83A 3K54A 4YHTA 5T68A 4O21A 4S2ZA 1WVXA 5HU9A 5HO8A 3H10A 4EKLA 3ZO2A 5HD7A 5KZ0A 3VBXA 4XG2A 4LL5A 3WYYA 3MA6A 1OBDA 2QOBA 5I3RA 4EH9A 2HW6A 3ATTA 4U7ZA 4DLJA 4F6WA 2A27A 2JIVA 2CGWA 4R7HA 4O0XA 4K9YA 5L2IA 5CAUA 2GTMA 4M14A 4CLJA 2HZIA 3TACA 4GIIA 3N4VA 3TZ7A 4FG8A 3O51A 4QMVA 2W9FB 3ZLWA 4B7TA 4HGTA 5IMXA 5HG8A 3GCUA 3O7LD 4U6RA 5AUVA 5DWRA 2HOGA 2W9ZB 3MDYA 3M11A 4ZK5A 4X21A 1F5QA 4FZ7A 4TXCA 2Y7JA 3GU5A 1O6LA 4EJ7A 1YHWA 3KMMA 1L8TA 3H9FA 5CVHA 2W1HA 5CU6A 5IEXA 3PVWA 5F4NA 3ZFXA 3SD0A 5JSMA 4UB7A 2C0IA 2G01A 2J6MA 5IA3A 4EI4A 2ZDTA 5FBNC 3LFFA 3VO3A 3K5VA 2REIA 4E5AX 5TE0A 4YTHA 5GZ8A 2Q0NA 2B54A 4J95A 4BCFA 4GFGA 4EWHA 1CTPE 3TYKA 4JJRA 2ERZE 2OU7A 3W0MA 1XMLA 3R22A 3HMMA 3FL4A 3KC3A 3BHVA 3DB6A 4MD8E 3DS6A 4TNBA 4ZSAA 4DYMA 4FZAB 1H0WA 4FYNA 3FMDA 1OZ1A 2H9VA 2VX1A 4KKEA 4PV0A 4G5PA 3FY2A 4QPMA 5EHLA 2ITXA 3DU8A 5GJGA 5LMAA 4E6AA 5IPJA 1T45A 4NFMA 4HNFA 3PRIA 4E8AA 4EOJA 5JFXA 5M07A 3AC4A 3CXWA 3V5WA 3VWAA 2X1NA 4L68A 1J1BA 4GKIA 1M7QA 1OIUA 2ONLC 3WZEA 4ASZA 3U55A 1Q5KA 3SRVB 5M08A 3LJ1A 1W84A 4C2WA 5C9CA 4FTUA 2YLFA 4FKGA 4FUXA 4KBCA 4AA5A 2WMRA 4R8QA 4V04A 2HZNA 1ZYDA 3AC2A 3FZRA 5AUYA 1R0EA 4YBJA 4R7IA 3MJ2A 3ORKA 4I3ZA 5AMNA 4ZZOA 3SA0A 5CENA 2BAJA 4YJOA 2W96B 5HNBA 4JBOA 3RP9A 3SDJA 4U97A 4A9YA 3R2BA 3KRXA 3RZBA 4L9IA 3BL9A 4I21A 4XV2A 3TNIA 2BKKA 5I5ZA 1IA8A 3Q6WA 2VNYA 5BVDA 3NMUF 4KBAA 4NM5A 4CFVA 4FODA 3AT4A 4WRGA 4R5YA 4O7SA 3EN5A 2FSTX 4IX4A 4RIYB 3O50A 3FMMA 3ORMA 4OR5A 4MH7A 3KRLA 5FBOA 3NWWA 5KMJA 4OTRA 4ZAUA 4V01A 2J0JA 4QYYA 2W1FA 3BHHA 5AA9A 1KV1A 3A2CA 4F4PA 1JBPE 3LQ3A 2C1AA 3A4PA 2WFYA 1JKTA 3EQBA 4E4NA 4Q5HA 3W2RA