5LMBA

Human spleen tyrosine kinase kinase domain in complex with azanaphthyridine inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
271
structure length
264
Chain Sequence
YLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Optimisation of a novel series of potent and orally bioavailable azanaphthyridine SYK inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 264
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5lmbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5lmbA01
2I7QA 3TDWA 5CZHA 3KC3A 4BKYA 1UWJA 4QMSA 4EK8A 5A4QA 3H9RA 3F69A 4YO6A 3FLNC 5A9UA 3ODYX 3E7OA 3TL8A 1H27A 3ULIA 3WARA 2OJJA 4F70A 4FYNA 3CJFA 4XNEA 1DAYA 5IA0A 3U8WA 2WPAA 3LFSA 4FVRA 4JQ8A 4F9WA 1F3MC 4RLLA 2PE1A 3ZSIA 4ZOGA 4O7LA 5F4NA 5HE1A 4CEGA 3WE8A 5J9ZA 2EXMA 2OWBA 3CE3A 2KTYA 3FI3A 4UWCA 2HZIA 4C36A 3HAVA 4OTPA 4NKSA 5KHXA 3HA8A 3VW6A 3AXWA 4CV9A 2XYNA 3FSKA 4X2NA 4YJOA 4CD0A 4AG8A 2XIZA 3FE3A 3VAPA 1Q62A 3FEGA 2CPKE 3ZFMA 2ERZE 2ITUA 4QMYA 3BQCA 3PXFA 4YNOA 1YDSE 2BTSA 2UZDA 3MSSA 4Y8DA 1W7HA 1TQIA 4X2KA 5KMJA 5HE2A 3RPSA 4WO5A 4F1TA 3F6XA 5IUHA 1M2QA 4BY9E 2BVAA 5K5XA 1OECA 2BRHA 3CTJA 1KWPA 3ENHA 4BGQA 4WNKA 3U9NA 5HLPA 1OPKA 2IN6A 2OJIA 3P9JA 5J5TA 1YOJA 4PDPA 1LUFA 1WZYA 4IB3A 2XS0A 4BCQA 3R1NA 4DEEA 3QTIA 3BU3A 4IACA 3O96A 3HMPA 4EUTA 4RWIA 4B9DA 4DGMA 2ZDTA 3PVGA 2JFMA 1SZMA 2FYSA 5JK3A 5ETCA 1H1RA 4YHFA 4AA4A 4BDJA 5CF8A 5C4KA 3LFEA 4AXAA 5C1QB 5A4CA 4QNAA 1OL7A 4YC8A 3SDJA 3ORZA 3ANQA 4YBJA 4GKIA 2QLQA 3ORKA 4FNZA 4XV1A 3MJ2A 5AV2A 5CAPA 2VO3A 3C9WA 3PA4A 4ZTSA 1GOLA 3K3JA 4PMPA 1PKGA 1YXUA 3UOHA 4UALA 5CEMA 1OL6A 3D4QA 4CFFA 1FOTA 5T68A 3QZGA 2JIUA 4EH9A 2LGCA 4F7NA 3FI8A 3TDVA 3ORLA 5CALA 2YN8A 2QOFA 2CNVA 2VU3A 3LMHA 3HMNA 4KKEA 4M15A 3AMYA 3FHRA 4RFYA 1Y8YA 2YIWA 5HBJA 3DBQA 5AADA 3QX2A 2UZWE 3DTWA 4ZP5A 3VHEA 2BZIB 2QOLA 2XJ0A 3EQCA 4BGHA 4FF8A 5J7HA 4HYIA 2V5QA 5DYJA 2G2FA 5ETAA 4PDOA 5TO8A 2PVMA 4AN3A 4RJ7A 4K8AA 2ESMA 5CSVA 5KCVA 3FC1X 4YZNA 1ZXEA 5LMKC 4BTJA 1Q4LA 2EVAA 3EWHA 3PVBA 1OPJA 3F3UA 1DS5A 2BCJA 4IQ6A 1SYKA 3RMFA 3WBLA 2IG7A 3WI6A 3OW3A 4LOQA 4JDKA 3T9TA 3O17A 4AN2A 2I6LA 3PA5A 2J4ZA 2V0DA 3Q3BA 1YWRA 4C4IA 2WMWA 3COKA 3P0MA 3VQHA 2QU5A 3R9HA 4FKOA 1DI9A 1B6CB 4W9WA 2PMIA 4FKRA 4EWHA 4X7QA 3CPCA 2RFEA 4ID7A 5IQDA 4FT3A 4KS7A 2FSOX 5LVOA 4YJQA 1WMKA 3BKBA 3RM7A 4TW9A 3BPRA 3BX5A 4GYGA 4TKSA 4PNIA 4X3FB 1Q5KA 4Z7GA 2YITA 4HGTA 4QYYA 3LPBA 4MXAA 1BUHA 4NM7A 3G15A 4WSYA 3PXZA 2GU8A 3GNIB 3EN9A 4Q9ZA 4EH6A 3D83A 2J0MB 3W2OA 3QKLA 3ZZEA 3BBTB 3MB6A 4E6DA 4IX3A 4CQEA 2VTPA 4O0XA 5CX9A 3O7LD 5DE2A 4KSPA 5DHJA 2YLFA 3CS9A 5A54A 4MWIA 3AG9A 2BFYA 2XNOA 4V01A 4E5BA 4FKLA 3BQRA 4JDIA 4CNHA 1XQZA 3KVXA 4FTOA 3OC1A 2C1BA 3FAAA 4FV4A 4PV0A 4S32A 3TNHA 1J1BA 4O84A 3MGYA 4YJPA 4YSJA 4B7TA 4L45A 5GIPE 2FH9A 1HCLA 5A14A 4JDJA 2X7FA 1ZYSA 1JKTA 5EI6A 2OIBA 5HHWA 4IWDA 4ALUA 5JFVA 4ZS0A 1S9IA 2O65A 2R7IA 3CD3A 4X3JA 5DR2A 4RG0A 4GT5A 3SQQA 4C4GA 5E92A 3HRFA 2OSCA 3FMEA 4JRNA 5C03A 5HORA 4ANMA 2OXDA 4MTAA 4E4XA 3M42A 4EHZA 4DBXA 4O7ZA 3E64A 4CFMA 3AC2A 5IQBA 5I5ZA 5KMKA 4QMVA 4F7JA 4HVHA 4V04A 2W5AA 4AZEA 2YM8A 4RFMA 4M13A 5AV3A 5CEQA 2VWBA 4CFUA 4O0RA 2OJGA 3ACKA 1Z57A 3L8SA 2YERA 4QMMA 4N4SA 5HG8A 5LVLA 1J7LA 4XYFA 3AGLA 4PDSA 2O63A 1R39A 5A4TA 2UW7A 3B8RA 2XNBA 2QI8A 4JI9A 5AA9A 3KA0A 3ZS5A 2O8YA 4TWCA 4AGWA 4HCUA 3KULA 3E8EA 4KRDA 5KZIA 1ZARA 2X0GA 5L2WA 2WMAA 2H9VA 1U4DA 3MIAA 2R3RA 2BHHA 2P33A 4G34A 4WT6A 2QG5A 3RK5A 3RM6A 3RZBA 4DAWA 2HW7A 4DYMA 1XH9A 2RG6A 5DH3A 2R3QA 4NKAA 3ZFXA 2VGOA 5EKNA 4YHJA 3QLFA 4PMMA 4IB1A 5CAQA 4AOIA 4NM5A 4C34A 5M4FA 4O91A 4E5WA 3O0GA 3UC4A 2Y9QA 2C3JA 4WRSA 3OUKA 1XH4A 4D4RA 3F2AA 4EHGA 2C69A 2NPQA 5C9CA 1WVYA 2FB8A 3LJ2A 3QRJA 1BL7A 2OG8A 1HOWA 3CTHA 4KINA 1FMOE 4MWHA 4DEHA 5AAGA 3FXXA 3GCPA 4QYFA 3KRWA 5IQFA 3HUBA 3Q4ZA 4C4FA 5EM7A 1JVPP 1YVJA 2OICA 1REJA 2PHKA 4MF0A 4QPSA 4BDEA 1RDQE 3FLZA 3R28A 2XNPA 2WQEA 4BTFA 4O82A 2B1PA 2HENA 3GQIA 2PULA 2VRXA 4D5HA 2C4GA 2WTCA 4YU2A 1XR1A 2H96A 1EH4A 4D2PA 2WKMA 4W4XA 2YIXA 3EOCA 3LFFA 1UNLA 2WEIA 3OEFX 5HG5A 3LXPA 4UYAA 2W4JA 4QTEA 2ITWA 2WQBA 5CT7A 3NVKI 5EK7A 2W4OA 2UV2A 2VV9A 3C4WA 3VC4A 3EN7A 3SXSA 5M4UA 3ZUTA 5CF5A 2QVSE 4EZ3A 3HYHA 4BI0A 4BICA 4CCUA 3QZHA 5CXHA 3AT3A 1G8AA 2LAVA 4YZDA 5CU0A 4QMZA 5EYCA 4CMTA 4WKQA 3ZFYA 4FIJA 4AWIA 2PVLA 4YURA 2IZSA 3PRFA 4FSZA 3WIKA 3Q2JA 3U6IA 5CVGA 1OIRA 2UVZA 2H8HA 2YIRA 3W1FA 4ZAUA 2OZAB 3GCVA 4DTAA 3EHAA 2WTKC 3CP9A 3GCUA 4IAZA 4X2JA 2OIQA 2HIWA 3LM0A 3QZIA 4MQ2A 4EOIA 3CPBA 3COMA 5I9VA 3ALOA 4JBVA 3R8VA 1CMKE 1BLXA 2QOCA 2XK4A 1M7QA 3BWJA 3Q96A 4M3QA 4CTCA 4AW5A 1KSWA 2G01A 3JY9A 4I20A 5FDXA 4NTSA 2O2UA 4CKRA 4UY9A 3LIJA 1OIQA 2WMSA 3ALNA 4JVGA 4RIXB 5D9HA 3EN5A 2YHVA 3RNIA 3PWDA 3WZUA 2WHBA 4ZLOA 1PMNA 2PUIA 4ZZMA 1DAWA 3GFEA 5AP2A 4FTAA 3OFMA 4TNDA 1OBDA 4LUEA 4FEWA 3R2BA 2XKEA 4E8AA 4F0FA 3D5UA 3LFBA 5M51A 4I5MA 3CTQA 3VUIA 3OW4A 4U80A 3RCDA 5CAOA 4QP1A 5DR9A 5C8NA 3KXNA 1J91A 1SMHA 2OF4A 2ONLC 3AC5A 2ERKA 1PYEA 1U5RA 4IAIA 5DT3A 5H3QA 2OBJA 2A2AA 1BMKA 3ELJA 3RHXA 3P1AA 2UZTA 4FZ6A 4V0GB 5FTOA 3GU8A 4BKJA 4FTNA 1VR2A 3FZTA 2Z60A 4XP2A 5E1EA 2OXYA 3BHVA 1W84A 3IW8A 1CKIA 4XX9A 5EOLA 3BIZA 4BCFA 1OL1A 5B2LA 2AC5A 2GPHA 4KIPA 2BHEA 2SRCA 1H1SA 5K3YA 3G51A 3VN9A 1BL6A 3OXIA 5HD7A 1OUKA 3AC1A 4DLJA 3FLQA 5KBRA 3S95A 2CKQA 2QOIA 5IU2A 3EFLA 3QD0A 3CEKA 5AJQA 4GK2A 4O81A 3DTCA 3EQHA 3F9NA 5FLFA 3BBWA 2PUPA 5KMOA 2Y7JA 4ACMA 2IWIA 4G6LA 4DTKA 5AAEA 3NAYA 4W8EA 3UVPA 4A9SA 3SOAA 2JDOA 3LXKA 5FXQA 3D7TB 3KRRA 4FIFA 4IXPA 2WO6A 4L53A 2O0UA 4UB7A 3DBEA 4EH4A 5A6OA 4BDAA 4I1ZA 3V8WA 3QF9A 5E8VA 5LWMA 3DZOA 4L01A 2CCHA 2XBAA 5DT0A 4ZSAA 5D11A 3HKOA 4Y73A 3E88A 1OKWA 3PG3A 4U7ZA 4ZLYA 4MXCA 2ITTA 3MN3A 2W05A 2I1MA 3R2YA 3Q9ZA 2X9EA 2XIRA 3C4XA 3MFUA 4AT5A 3HV5A 1PXLA 4QMOA 5HKMA 1PYXA 3NDMA 4LGDA 4AFJA 4D4YA 2REIA 4U5JA 3H0YA 2JDSA 3DDPA 2FUMA 3AC4A 3F3TA 3NW7A 4RBLA 1RJBA 5E91A 5AUXA 2YABA 4FV2A 3TKUA 2Q83A 4M8TA 3HA6A 4U42A 4R77A 4IADA 3K3IA 2C68A 4OTDA 4J97A 4R6VA 4ANLA 2YLEA 2VTJA 3R7YA 5IZFA 4EHVA 1WBPA 3WF6A 3FMNA 4O2ZA 3LCTA 4ZJJA 4DFNA 3W32A 3UIUA 3DKCA 5IEVA 4TZRA 1XH8A 4FZAB 3L9LA 4BI1A 4BTKA 4ENXA 3V8SA 2HOGA 1IG1A 4GS6A 3QQLA 5CU6A 3V5JA 2YCRA 4HVDA 5K4JA 5ANGA 5CEPA 3IO7A 5K4IA 5BVFA 3NS9A 2W1ZA 2X2LA 4ZLZA 4IB5A 4QRCA 3FZ1A 3F5PA 4QQJA 3T3VA 4CZYB 2R9SA 4QMNA 4DT8A 4ZSJA 1YDRE 4GT4A 2VD5A 5M08A 2C3IB 3O7LB 4OAVB 4I5PA 4MKCA 2F7XE 4F9BA 2PVRA 3A8XA 1YI3A 5CLPA 5IA3A 3S1HA 5DIAA 4D0WA 1FINA 3QX4A 3HAMA 2ETMA 3D14A 2HYYA 3O50A 4TYHB 5CY3A 4XJ0A 3U54A 3ODZX 4FTTA 4Z55A 4TYGA 2C30A 4AA5A 2EWAA 4J98A 3H3CA 3G6GA 4FX3A 4AF3A 3I81A 4JJRA 4YLLA 4GV1A 2XH5A 4BDIA 3EYGA 3G0EA 3GBZA 3P7BA 5FQDC 1YI6A 3IGGA 3RCJA 4A9RA 3VBXA 3R7VA 4YO4A 2I0EA 3DBDA 4BCNA 3NUYA 3R8MA 1STCE 5CU2A 1NVSA 1PW2A 4EZ5A 4DT9A 3VUGA 1XWSA 2G9XA 5ANKA 4O1OA 4RVTA 3PSDA 1OBGA 4NCTA 3JPVA 4K2RA 3OWJA 2R0UA 3VUMA 2VO0A 4WNOA 4FZDB 5T6KA 4W4VA 2CN8A 4IH8A 3I60A 5F95A 5CEKA 1SNXA 2OO8X 3UC3A 4FV0A 4RC3A 3FXWA 3NW5A 2C6LA 2YDJA 4DEDA 5M53A 5TT7A 4G6OA 3FMHA 2XKFA 4BDDA 4BI2A 4BDKA 3NUAA 4EJ7A 5AR2A 4UWYA 1J7IA 4PUZA 2WGJA 3EL8A 4E93A 4LOOA 4TL0A 3VUKA 1UKIA 4AZSA 4DG3E 3UJGA 5B2KA 2ZV2A 3TNQB 1RQQA 2WIPA 4JLCA 1XHAA 4O7VA 3R7GA 5EHOA 4C33A 2C3KA 3IOPA 4Y83A 2YJRA 2XCHA 5GZ9A 5CI7A 2JFLA 4DGLC 2KULA 3PP0A 2C1AA 4U8ZA 5JMSA 4QT1A 5C01A 1CSNA 1KE6A 5EW8A 3NYXA 3QHWA 3EQRA 4O27B 2C3LA 4KUJA 4CFXA 2QNJA 2F2UA 3Q9WA 4K77A 2NO3A 3EFJA 3PJ1A 4LM5A 4EONA 4DF3A 4H39A 4WA9A 4L44A 3HUCA 3G0FA 5FM2A 2QKWB 3KXXA 5BYZA 3A61A 4WD5A 4XBRA 3PG1A 4C37A 1XH5A 3QQFA 3QU0A 5IA4A 5KMLA 3SA0A 3BGQA 2OKRA 3QCXA 3PJCA 3QALE 4EI4A 2HY81 2XK8A 4O1PA 4WG5A 2AUHA 1TVOA 4BCIA 4IWOA 4OTQA 5C8KA 4G3EA 1KV2A 2P4IA 4KIQA 2X7GA 4MK0A 4C35A 1IRKA 2RSVA 2XKDA 3U87A 3W16A 3AC8A 4BDCA 4FG9A 2XF0A 1BYGA 5AV1A 1H1PA 3IW4A 4FKIA 2XEYA 5FP6A 5H8BA 4L46A 2X39A 3E3PA 5HZNA 4IM2A 2QR7A 5CS6A 3NUXA 3TTJA 4XG9A 4D58A 5HOAA 3SW7A 2XNEA 5EHLA 1AGWA 5EHYA 5L6OA 4GVJA 5BVWA 3UZPA 2FSLX 1PXJA 3QBNA 4F9CA 3DZQA 3RHKA 2XNNA 2WQOA 3I6UA 2VWXA 4PNKA 3FYJX 4LOPA 3ZHPC 3FMDA 3BYVA 4Y5HA 4QP3A 5EYDA 3ZCLA 2Z02A 3QFVA 3OHTA 3P4KA 4UMRA 2UZVA 3EQFA 4W4WA 1WBSA 3KRXA 4FIIA 1H07A 3LZBA 3UG2A 4BR3A 4FVPA 4DITA 4BWPA 2IVVA 2G2IA 4CRLA 2I0HA 3D5VA 5IQCA 1TKIA 2Y0AA 3C1XA 2XM9A 3FMKA 4AQCA 4O7SA 2CGUA 2XNGA 4ACCA 3DGKA 2VX0A 3KMWA 3TV6A 2VO7A 3UG1A 2C5XA 1PRYA 4YJVA 5JQ8A 3E93A 5HLWA 2YM6A 2R3KA 4NUSA 4HVIA 2C6IA 2XJ2A 3GCQA 3IOKA 3R01A 5EI2A 3VS7A 4U3YA 4ANSA 4AT4A 3QXOA 4DBNA 3ZUUA 3TI1A 5DEYA 1E1VA 4FTCA 4QD6A 3E63A 3PZEA 3T8OA 3FY2A 3OWPA 4RJ6A 4BCPA 2R3NA 4HYSA 4IX5A 1P4FA 4AGUA 2YEXA 2JEDA 2R3JA 2WQNA 5IKWA 1URCA 4FR4A 5HG9A 5LOHA 4JT3A 4IZYA 2OI4X 4M67A 3HLLA 4H3PA 5KX8A 4BIDA 4GSBA 4D28A 2JDTA 3C4FA 2C0IA 3Q5ZA 3JXWA 2Q0BA 4G5PA 3BWFA 4GJ2A 3WZDA 4RIWA 3QD4A 3TN8A 3A7GA 5CU4A 3BU6A 2PY3A 1PXPA 2WMTA 4GJ3A 3II5A 4YP8A 4E6QA 4EK3A 5HIEA 3UYTA 2BMCA 5L6WL 3RGFA 4USEA 4L8MA 3MFTA 1PXMA 4MNEA 3EQGA 3UYSA 3VVHA 3AQVA 4FTIA 5IQIA 4JQ7A 2X4ZA 2QKRA 2J0KA 4IVAA 5M44A 2GS6A 5L2IA 5J1VA 3QC4A 4I5HA 3JY0A 4FKGA 3NWWA 3FC2A 5ANJA 4F63A 3RWQA 2VO6A 3ET7A 4Y46A 4RZVA 4D2VA 3PTGA 3SHEA 3UZRA 3BHYA 4MD8E 1JSVA 3AD4A 4RVMA 4O0SA 4YJSA 3BGZA 3DK6A 2YM3A 2ITOA 4EK4A 2DUVA 3NYNA 5FEEA 2PPQA 4P7EA 5H2UA 5IQEA 3O23A 4RSSA 5JGBA 4AOTA 1OIYA 3LVPA 1ZY4A 4C02A 4UZHA 4D1SA 4G6NA 4CFVA 4HZRA 4LMUA 3ZOSA 2VWVA 1VEBA 3DKGA 4S31A 1OKZA 4MYGA 1XBCA 3MESA 4QYEA 1XKKA 5ANEA 1XH6A 4R1VA 4JX3A 1PXNA 2C6KA 1I44A 3KXMA 4FL2A 2BKKA 4PL3A 3G9NA 4XOZA 5EM8A 4BWKA 3DA6A 2J6MA 3DS6A 3HP2A 4J95A 5HCYA 4J7BA 1YXTA 4F6SA 5IH6A 4M97A 4D2TA 4D0XA 3R30A 2PZRA 5BVDA 1Q41A 4FGBA 4LV5A 4OTGA 3HVCA 1OGUA 4QYGA 4XG2A 4UMTA 1H4LA 4BDGA 3OWLA 2VAGA 3L8VA 3K54A 3QQGA 4CLIA 3BLQA 2P3GX 5I9UA 2ZAZA 5A4LA 5L2TA 3L9PA 3TIYA 4G5JA 4I3ZA 4ZJVA 3NIZA 2DQ7X 4KIKB 3QTSA 4IFGA 2IO6A 4WNPA 2B9HA 1URWA 3UIBA 1BI8A 3N51A 4AE6A 2G1TA 2EXEA 1L8TA 3VUTA 4DN5A 2X6EA 2CKPA 1Q8ZA 4I4FA 4X2GA 2XNMA 5LVMA 4RFZA 3BYOA 1W0XC 3PSBA 1OL2A 4LRMA 2A4LA 4M84A 3PVWA 1NVQA 4RC2A 2PU8A 2IZUA 3NYVA 3QLGA 4I6FA 4UX9A 4D5KA 4DC2A 2I0VA 3MJ1A 4FZ7A 2P55A 4BTMA 3DJ5A 3FWQA 3U6JA 5F20A 4A4LA 3R8PA 3OXTA 4B8LA 4IIRA 3MY0A 3QCQA 1YOLA 3OZ6A 3OTUA 1ZYDA 4MD9E 4DHFA 4PPAA 2C5YA 2PL0A 3HDMA 3VS6A 3H9OA 4XMOA 2GFCA 4GUEA 5HCXA 3VRYA 3HNGA 4ZTLA 5IG1A 4MXYA 3GEQA 3I0OA 3R8UA 1Q8YA 3LCOA 1BKXA 4ERKA 2XK7A 1UU9A 4EKLA 4HGLA 4YTFA 4JAJA 4AZTA 4CZUA 3VS2A 4LUDA 3IDBA 4KS8A 3NZ0A 4FT5A 1MQ4A 4NW5A 1IASA 3D7ZA 3R7EA 5IA1A 2C6MA 4CCBA 4M69B 3SRVB 3LM5A 2PUNA 3IECA 3TNIA 4FL1A 3NYOA 5CENA 3B8QA 3HMIA 4IVCA 3ORTA 3HMMA 2ZB1A 4WUAA 3EFKA 4YPSA 5LARA 5IH4A 4M0YA 3CY2A 5LWNA 4CZTA 4G3GA 5JSMA 3OT3A 4GL9A 1M7NA 3ZSGA 4D1ZA 3E5AA 2OXXA 3VBTA 2RL5A 1WBWA 2PZYA 2YAKA 3VRZA 4BCKA 2CSNA 3OBGA 5HGIA 1ZZLA 1PXOA 4RZWA 5ANOA 3OOMA 5EW3A 5J79A 3DAJA 5AMNA 3UMWA 3P78A 4KBCA 2QOOA 4MXZA 5HNBA 5IEXA 4EOMA 5BUJA 2IJMA 1JLUE 1P5EA 2CLQA 4BWXA 3N4VA 4PWNA 3LFAA 3IDPA 3C51A 5FDPA 1T45A 2ZM1A 5FP5A 2PSQA 4A9UA 2GNGA 5IH5A 1ZMVA 3PXYA 1A48A 2YIYA 3QRUA 4PP9A 5M09A 3JUHA 3PUPA 3L8PA 1YW2A 5J95A 1JQHA 5GJFA 3S2PA 3UQCA 5FEQA 1ZOHA 1NA7A 4G2FA 2XIXA 2WB8A 5HBEA 3DLSA 2J50A 3G9LX 3ETAA 4NT4A 3R9NA 3UOJA 2PMNX 5ANDA 5CAVA 2V55A 5JN2A 4G9CA 3QHRA 2HCKA 2ITXA 4K6ZA 4PDYA 1UV5A 4DCEA 1MQBA 4YUQA 4AW2A 5HE0A 1YI4A 3BU5A 1U54B 2NRUA 1OI9A 2R4BA 2GNLA 2XBJA 2BAQA 3ZC6A 4U45A 1GY3A 3DJ7A 4QO9A 4XV9A 5E8UA 3AGMA 4C2VA 4Q5HA 3MTFA 3W2RA 3E62A 2HZ0A 2XK9A 4KKHA 4UN0C 5AV4A 3R7OA 2C0TA 3ZLYA 4HCTA 5J9YA 3GU5A 1ZY5A 2UW5A 3MPTA 2R3LA 3RAKA 4YTCA 1A06A 3A99A 5EYMA 4XRLA 4JG7A 2Z7RA 1L3RE 5I9YA 5AUWA 3RJCA 5FXSA 4YBKA 2GS2A 4QMWA 5J8IA 4HVSA 2BKZA 3QQHA 4C2WA 3CD8A 3GOKA 2JITA 2UZEA 3UPZA 3FHIA 3GOPA 4WRGA 3NUPA 3QTQA 4C3PA 4IM3A 4AW1A 3IW5A 3OVVA 3EQPA 4XCUA 3ZO2A 3I1AA 1JNKA 1Q97A 1H00A 5DVRA 4JRVA 3LFQA 4GRBA 2BAJA 1LEWA 2B9IA 3CGOA 3KULB 2WU7A 5BVKA 1WBVA 4FKPA 4UXQA 2FGIA 5BNJA 4FSRA 4KAOA 3DPKA 3ZM9A 3FSFA 3U6HA 4EBVA 3LXLA 4KD1A 3E8NA 4QQ5A 3ACJA 3IDCA 4DH5A 2WMRA 4AX8A 2PZ5A 4A06A 5DBXA 4DH1A 2WTDA 2QHNA 4RWJA 2PVHA 1CKJA 4U9AA 1P14A 1UWHA 1GZ8A 4F1OA 3HDNA 3CQUA 2H6DA 2A19B 4KWPA 4AUAA 3PE2A 4Z3VA 4L7FA 4HYHA 3FPQA 4XV2A 2AYPA 4W4YA 4J52A 3D9VA 2PWLA 5C8MA 2F7EE 4LQMA 4MVFA 3IK3A 2BTRA 1NY3A 3MWUA 5I3RA 4JAIA 1ZMWA 4Q5EA 5D12A 5AR4A 2EB2A 3KRLA 2GDOA 3ID6C 1OM1A 4GIHA 4EEVA 2ACXA 3ENMA 3DXQA 3KCKA 3PY0A 3WYXA 2CGXA 3P5KA 1H0VA 2CMWA 2YM7A 4X0MA 2VGPA 3G2FA 3V8TA 5CF6A 4L42A 5CU3A 3ORPA 1H08A 3WZKA 4O6LA 2W1EA 5E8TA 4WUNA 1H26A 3GT8A 4OUCA 4F99A 2VNYA 4FL3A 3LLTA 4IJPA 2QU6A 2HWPA 4LL5A 5G6VA 4F6WA 2C0OA 3ZO3A 4ARKA 2NRYA 3BHHA 4FT9A 4H36A 4FV7A 2R64A 2UW4A 3UZTA 4G17A 2P2HA 5JEBA 1FMKA 1UA2A 2BZJA 3MVJA 5AFVA 3DK3A 3FZOA 3UGCA 1MRVA 1JPAA 4JS8A 3ORXA 2VTSA 2PMLX 2CJMA 4F9AA 4D2RA 5IEYA 1XH7A 2OF2A 1XBAA 3OCGA 5H8GA 4ZTNA 5LMKA 2V22A 4X21A 3MW1A 1JSTA 1Q3DA 3DKFA 3BLHA 5FBOA 3R8ZA 5IQHA 3GP0A 4RQVA 3OCSA 4PX6A 2QURA 2C6DA 4RJ8A 5D41A 4I4EA 3KK8A 3E8DA 3D0EA 3AD6A 3JVSA 3L1SA 3IQ7A 1GAGA 2FSTX 3F3VA 4UZDA 4IM0A 3LCDA 4EBWA 1QL6A 4K1BA 1W82A 4JXFA 3VO3A 4IAYA 3WF7A 5ANIA 5FXRA 5L2SA 4B8MA 3PSCA 3R22A 3QKKA 4CMOA 4B99A 2ITZA 4BBFA 3QA0A 4C4JA 1QMZA 3MPAA 4TWOA 4C58A 3F5XA 4E5AX 1KE5A 3FI4A 4USDA 4R5YA 3EZRA 1APME 2OZAA 3MH2A 2JAMA 3ZLWA 2WIHA 3ZEPA 3BRBA 1UKHA 1Y6BA 2OFUA 5LVNA 4R7HA 5AP3A 2Y4IC 1H8FA 2JBOA 2UZOA 2X1NA 3A7IA 4H58A 2OU7A 2IZRA 3PWYA 3GU4A 4EKKA 2ZYBA 2J9MA 1PMUA 3PYYA 4OTIA 5JZNA 4GH2A 4OLIA 2XM8A 3UNZA 3GB2A 4FEXA 3R9OA 4FEUA 4CMUA 4H3BA 2ZV8A 4O7RA 3R0TA 3TZ8A 3HV6A 5AUUA 3GVUA 4TYEA 5F94A 5L4QA 4HGSA 2UVXA 4H05A 3ZMMA 1QPCA 4F4PA 4DCAA 2PVKA 3KXHA 5CSPA 3FUPA 3NUNA 4PF4A 4AZVA 4BBMA 4KBKA 3KCFA 3C5IA 1XJDA 3U51A 4D4VA 4ZXTA 2FSMX 2W5BA 3GU6A 4C62A 2HWOA 3ROYA 5CNOA 3PXRA 4YJUA 4H3QA 2ZMDA 5DRBA 4FV3A 4TYJA 3NNUA 4MH7A 2BDJA 2R3GA 4ANQA 4F08A 3KREA 2VUWA 3C0GA 4FTMA 4P5ZA 4L3PA 2W4KA 3N9XA 4V0GA 4UBAA 3FZRA 4FTQA 3PE1A 1KE9A 3EL7A 4C4EA 3QYWA 4I41A 4O38A 1TQMA 1CTPE 2VTOA 3MPMA 4ACHA 3TM0A 4GMYA 3PJ3A 3PLSA 4IWQA 4EOSA 4FTLA 3OBJA 4FG8A 4JBOA 4O0TA 4AU8A 3BELA 2W0JA 5FBNC 4LYNA 2WMQA 5B2MA 3RPVA 2Z8CA 3K2LA 5HO8A 5HX8A 2X2KA 4YC3A 3B2TA 5EFQA 2P2IA 2I0YA 3WILA 5EW9A 3FKNA 4DFUA 3MYGA 2IVTA 4DEAA 3W8LA 4YJNA 4I93A 3OEZA 4ZTRA 2VTQA 2UW3A 3VW8A 4OTHA 5DGZA 4ONAA 1GNGA 4FODA 2RFDA 4U41A 3EJ1A 4J1RA 2E2BA 4WG3A 5JH6A 2XUUA 4FVQA 5ACBC 3TNWA 3TJCA 4PP7A 1MUOA 5HVYA 3EQBA 3ITZA 4OT6A 4TPTA 3E7VA 5AM6A 2GTMA 1MRUA 3Q2MA 2PVNA 4QOXA 3CQWA 1UU7A 4FMQA 1M2RA 3MH3A 3FL5A 3RWPA 4U6RA 2F4JA 1Q61A 1UVRA 1VJYA 3BYUA 3SAYA 4G16A 3WZJA 3JR1A 3CGFA 2ETKA 3P23A 5HEZA 3A4OX 4NU1A 2E9PA 3F5GA 4E20A 4HZSA 3CSVA 3PPJA 4J8NA 5HNGA 4YSMA 3UNKA 4C0TA 2J51A 5AUVA 4DEBA 1OITA 5AP1A 3GC9A 2CN5A 3NX8A 3D2IA 3ULZA 2AC3A 4RIYB 4FKUA 2R3FA 4FTKA 1IA8A 2YA9A 4ZY4A 4NH1A 2RFNA 5HU9A 1OKVA 4BKZA 5AP7A 3EB0A 2VWZA 3P86A 3PJ2A 1U5QA 3OG7A 3OD6X 4EYMA 3BEGA 3F82A 1WBTA 2GHGA 4GG7A 4U40A 3W33A 4EK6A 3P08A 5KO1A 4KBAA 3FYKX 4QTBA 3OWKA 4FT0A 2HXLA 3RPRA 3BE2A 3QL8A 4F9YA 4YMJA 2B53A 3LKMA 1O6LA 1WAKA 3H4JA 4ZMEA 5L6PA 4BHNA 3LE6A 1ZMUA 1ZRZA 1KOBA 2XK6A 3PPKA 3R21A 4FUXA 3LQ8A 4J53A 1KOAA 1SVEA 3RAWA 4JR7A 5HTCA 5HVKA 3V51A 5T3QA 5E8WA 2WTKB 5I9WA 1X8BA 3LAUA 5AUZA 3CBLA 5CAUA 4E7WA 3JS2A 4EL9A 5JFSA 2WTWA 4EOKA 3HV4A 3F2RA 2CGWA 2BROA 3UTOA 4OGRA 4TYHA 4F6UA 2Z7SA 5CEIA 3FQHA 5BX0A 3QD3A 2WELA 2GMXA 2OJFE 5DT4A 3DAEA 4DGNA 4E26A 4G1WA 4CG9A 1NW1A 4S2ZA 5M55A 3UVQA 3SVVA 5FRIA 4XS2A 3AMBA 3QYZA 1W83A 1YDTE 1V0BA 3ROCA 4AAAA 2GNHA 4YZCA 2Y4IB 2FO0A 5AX3A 2Y6MA 3U9CA 5DNRA 5E7RA 1NT2A 2C6TA 3RINA 2W1IA 2VWUA 3ZDUA 2XEZA 4JL9A 4WOVA 1B38A 4N70A 4RWKA 3SW4A 3POZA 3NPCA 4ASZA 3L8XA 4U0IA 4NYEA 3UE4A 3BCEA 4O83A 3VULA 2Z7QA 3VBYA 4CV8A 4BZNA 4M68A 1R3CA 4ERWA 5A46A 5GZ8A 4DG2E 5J1WA 2HW6A 4J71A 4D55A 2ITQA 3OXZA 3RZFA 3ZLXA 4FKJA 5CSWA 4CVAA 1KV1A 3FLWA 5JRSA 4YTIA 2OH0E 3AMAA 2IW9A 3COIA 3EIDA 4ITJA 3TZMA 2EB3A 3A7HA 2EUFB 2J5EA 3ANRA 4TRLA 4C3RA 3HV7A 2XVDA 5HIDA 1PKDA 2UZUE 3ORIA 4FKSA 4BCHA 2ZV7A 3B2WA 5KKRC 3FKLA 5DA3A 3G6HA 5I9XA 5FG8A 4O7YA 3HEGA 3M2WA 3EN6A 4F65A 4II5A 4WG4A 3UO6A 3QWKA 4HCVA 3BV3A 2YM4A 3DV3A 3QUDA 1PMVA 1Z9XA 3P7CA 5FEDA 2ZDUA 2DWBA 3IW7A 5E8YA 3JYAA 5JZJA 3TCPA 2R2PA 5JQ5A 1OKYA 1YWVA 5JFXA 4HPUE 2YFXA 4C61A 2ITPA 4BIEA 1Z5MA 3G33A 3GCSA 4X6RA 5IMEA 3OMVA 4FK6A 3QAME 5C4LA 4RVKA 5C27A 2B9FA 4UMUA 4JQEA 3RK7A 2A27A 2XJ1A 4EH2A 3CKWA 3NIEA 5TE0A 4IE9A 1OPLA 1FVTA 5TF9A 3FMMA 3WOWA 5HTIA 3KU2A 4C7TA 5IDPA 4UXLA 4CQGA 4BIBA 1G5SA 2JDRA 4I6HA 5ETFA 5HE3A 3R7IA 3LLAA 5HU3A 3Q6WA 4CFWA 4YPDA 4NL0A 4E6AA 3DNEA 4LL0A 3EKKA 4FYOA 4GG5A 4XH6A 3HL7A 3CC6A 3TV7A 3FXZA 1IA9A 2R3PA 3MIYA 4MBIA 4QP6A 5IA5A 4V05A 3RBWA 2QO2A 3R1YA 4K18A 4EJNA 5JGDA 5KHWA 4O86A 1PXKA 3MVLA 3AC3A 5CNNA 3OROA 4MXOA 3DOGA 4JG8A 4HJOA 4JBPA 5DI1A 3RPYA 5HVJA 3MH0A 4ALWA 2CGVA 1R1WA 3TG1A 3NVMB 5FD2A 1YOMA 2W1CA 3ZBXA 5IA2A 5CZIA 3NGAA 2J90A 3F88A 3W2PA 3Q6UA 4BB4A 5BQ0A 4TWPA 4A9YA 2C6OA 4I5CA 5AP4A 1ZYLA 3DQXA 3DQWA 4PPBA 4DH8A 5BMMA 1WVXA 4W9XA 3QD2B 3A2CA 4IZ5A 5AP6A 3C4ZA 1QPJA 1ND4A 4FSQA 4FK3A 5IDNA 4OT5A 3ATSA 4OR5A 2CCIA 4A4XA 3I7BA 3PZHA 3NNVA 5CVHA 2HZ4A 5BMSA 4F0IA 3R00A 4WBOA 5DR6A 4RJ5A 2BRBA 2XIKA 4QYHA 5CEOA 3VS4A 5F1ZA 2ZV9A 3UVRA 3DT1A 1H1QA 4R8QA 4GFOA 1ZOEA 3LXNA 4AS0A 3AT4A 5C26A 4M66A 5DOSA 3SKCA 4G3FA 4GCJA 4IAFA 2XP2A 4IWPA 5GINE 4XV3A 4FICA 4I6QA 3RAIA 4JDHA 1UNGA 3O51A 3Q04A 4UEUA 2G2HA 3VJNA 4FKTA 4FSTA 5F9EA 4HNIA 3D5XA 1K3AA 4GYIA 4QTAA 5IF1A 3WF8A 2QR8A 5IMXA 1P4OA 2GHMA 1GIJA 5M4CA 5EM6A 3CY3A 4EH7A 2CNQA 3RNYA 4AGDA 4BL1A 2BZHB 4GU9A 2ITVA 3SX9A 4A7CA 5CTPA 2ZM4A 2QCSA 3MFSA 4LV8A 4PY1A 4U3ZA 5FWKK 3POOA 2E9UA 4Y95A 3EH9A 4NIFB 2QLUA 2GCDA 4QMTA 3ZO1A 1FGKA 4O0VA 3RVGA 1GZOA 4QP2A 4E3CA 2OLCA 1DM2A 3FPMA 4MX9A 3MS9A 1Q99A 5EH0A 3NW6A 1YXSA 4QP4A 4UV0A 4U79A 1HCKA 1ERKA 3LCKA 4DFBA 1J3HA 1FGIA 1E1XA 3UODA 3ZO4A 2F2CB 4YLKA 4ALVA 2YCQA 4O6EA 4TN6A 5IUGA 3IG7A 5E8XA 4J8MA 4DH3A 3U55A 4AACA 2VNWA 3A7JA 3VBWA 5AA8A 5DPVA 5FTQA 3BGPA 4EUUA 3R9RA 2EXCX 3ZRKA 1ATPE 3MV5A 4LMNA 5HO6A 2R3IA 1JOWB 4I6BA 2R7BA 3KEXA 4G9RA 2YJSA 3LFDA 4I23A 4XLIA 5E8SA 1H0WA 2XRWA 4WSQA 3KN6A 4EOLA 4RJ4A 5AX9A 4D9UA 5KKRB 4FSWA 4D4SA 4EOOA 3LMIA 1F5QA 3H9FA 4R7IA 2PUUA 1RE8A 1Q24A 2WNTA 3ZTXA 1R0PA 4EQMA 2W5HA 2HY0A 2R3MA 2BZKB 3NEWA 4HOKA 5A3XA 3KMUA 3R1QA 3ZEWA 3ZBFA 4QTCA 4KABA 3F5UA 5LXMA 3UMXA 5CANA 3KF7A 3KL8A 5HG7A 3QXPA 5BYLA 1IAHA 5JGAA 2ZJWA 4FIEA 3FL4A 3KN5A 3QQJA 2DYLA 3NNXA 4FC0A 3ERKA 3QUPA 4FGRA 4FV8A 3CIKA 1YQJA 1PY5A 2HELA 4NJDA 4HNFA 3GQLA 4BCOA 4E6CA 3SGCA 3FMJA 5LMAA 3M1SA 4N6YA 4G3CA 4DGGA 4HVGA 5HI2A 3KKVA 4WHZA 4BGGA 1FVRA 4GU6A 4R78A 4EQCA 4PMSA 2UUEA 1H1WA 3EYHA 4KIKA 3ZC5A 3FLYA 1FQ1B 4GEOA 3ZONA 3UO5A 5KZ0A 2GQSA 4EZ7A 3EZVA 1UNHA 3QTWA 3BLRA 4NM3A 1YHSA 5AEPA 1JBPE 4GFGA 3KXGA 4HGEA 4UMQA 1KE7A 3KB7A 5D10A 4GW8A 3VS3A 4C4HA 2OH4A 4IAKA 5DWRA 4ZSGA 3LQ5A 4QMUA 1JKSA 4IC8A 4N6ZA 4FSYA 4NEUA 3DNDA 3FMLA 3VBVA 4KIOA 3ZLSA 3VUHA 3BYSA 4C59A 3D15A 5J7BA 4APCA 5GNKA 3UIMA 3CXWA 4JR3A 4MEDA 3OS3A 4X2FA 4ZZNA 3AT2A 1O6KA 4FTJA 3F3ZA 3IGOA 4M7IA 3F2NA 3DCVA 4DEIA 5JRQA 5LMBA 5K0KA 3GU7A 3QTUA 4YLJA 5LQFA 3V5PA 4K33A 3PVUA 1R0EA 4EWQA 5BVOA 2QONA 3NLBA 5J5SA 2X8DA 2VX3A 4BDFA 3LJ0A 3Q53A 4E4NA 4A9TA 2WXVA 5EI8A 4CSVA 4BVUA 1GJOA 3A8WA 3I6WA 4RC4A 1Q8TA 4J99A 4OBPA 3R04A 2VTLA 1XBBA 4BDBA 4LGGA 5CASA 4Y5QA 4TY1A 4ZEGA 4BCMA 3CR0A 4L68A 1NVRA 5EDRA 4M69A 3BI6A 3SRVA 3F7ZA 3TV4A 1Y57A 1IEPA 2IZTA 2Z7LA 3Q9YA 1G3NA 3HV3A 5BPYA 2PYWA 3N4UA 5BVEA 2VTMA 5E90A 3FV8A 4EQUA 4DH7A 2XIYA 5L8LA 4YZBA 3DU8A 5E1SA 4KKGA 4GT3A 2XZSA 2YDIA 4DFXE 5KBQA 4O7NA 4HPTE 5FGKA 2IW6A 5HQ0A 3TUCA 4NFNA 2XKCA 3L9NA 3NAXA 4X3FA 3V04A 4E73A 1FVVA 1TQPA 1W98A 4F0GA 4NW6A 4CYIA 3ZUVA 5BYYA 4XLVA 2YACA 4I21A 4IX4A 2BFXA 3V5WA 3KRJA 5EQPA 2X4FA 3SG8A 4PMTA 4M12A 4ANOA 2WU6A 3VF9A 2YZLA 3NUUA 5FUTA 1VYZA 2CHLA 4MQ1A 2B0QA 2C5VA 3C13A 4B4LA 3C7QA 3O8PA 4FTRA 4XBUA 4P2KA 4ZMFA 4LI5A 1P2AA 2GHLA 3NRMA 3PIYA 4EOPA 1ZWSA 4XHKB 3NCZA 3G5DA 3W55A 4FV6A 5LCJA 3TKHA 1H01A 3TACA 1BI7A 3Q32A 5J9LA 3DFCB 3ZZWA 4FNYA 3T9IA 2PVJA 3VF8A 4QMPA 3CKXA 5CXZA 4XG4A 4CGAA 1CDKA 4BZOA 3V5TA 4R3CA 4S34A 3TUDA 1M17A 1CM8A 2G15A 3QWJA 4MD7E 3A4PA 4PTGA 1OIUA 5HD4A 2QHMA 1ZOGA 2JKKA 3MH1A 2WMUA 3F3WA 2GQRA 5I0BA 1U54A 2V7OA 5I4NA 4WNMA 4IB0A 4CKJA 1YHWA 3FZSA 1G8SA 3MFRA 2HXQA 4AE9A 5LVPA 1AD5A 2BR1A 2YWPA 3C4EA 4LFIA 4PRJA 3W18A 3UDBA 3ZRMA 3KQ7A 5D7AA 3IONA 4OTRA 4AP7A 3W8QA 3LJ1A 2PZIA 1YXXA 4JX7A 3R7UA 3C0IA 5TKDA 4AGCA 4L7SA 4RGJA 2Z2WA 3R6XA 1PHKA 2O3PA 3PXKA 4XG6A 5H8EA 1B39A 2OK1A 1LEZA 2X81A 3KF4A 4MXXA 2HZNA 2JAVA 4KSQA 2X9FA 3HX4A 3GC8A 1BX6A 4APPA 1W8CA 1YHVA 4OTFA 1M2PA 1MRYA 2J2IB 4ASXA 5L8JA 4OW8A 2E9NA 4FIGA 3TZ7A 3DK7A 5I3OA 5KE0A 2WMXA 2FVDA 5D7VA 3UP7A 3GENA 1O6YA 1U59A 4FE2A 1V0PA 2WFYA 2GFSA 3I0QA 3QGWA 2EU9A 2PE0A 3V5QA 3SD0A 4FTUA 4FIHA 4UYNA 3DXPA 3IW6A 1SVGA 2O5KA 3ZXTA 4UMPA 4AA0A 3VS5A 2ITYA 4IVDA 2YCFA 4EH3A 2HK5A 2F49A 4IVBA 3HRBA 2Y8OA 2PVYA 4ITHA 2RIOA 3KVWA 4L6QA 4R3RA 4HW7A 2WTVA 4DGOA 1LR4A 2W7XA 2QC6A 4KRCA 4OBOA 4QQCA 3DKOA 3UP2A 4CT1A 2QOQA 4AFEA 2WZJA 5CQWA 5CSXA 4ZK5A 4RWLA 3W2QA 3ZU7A 3TNPC 3ORMA 4Z16A 4NZWB 4GVAA 4J96A 5HO7A 1Y8GA 2C47A 2QOKA 2WEVA 3OY3A 3MTLA 3C50A 3VBQA 2R0IA 4A07A 3Q4UA 4OAUC 3ZH8A 4XP0A 1QCFA 4O0UA 2P0CA 3WIGA 4C57A 5DN3A 4E1ZA 2XYUA 4AZWA 5KMMA 5B7VA 5GJDA 3RALA 4N0SA 4RX7A 4QMQA 3TJDA 5GJGA 2PMOX 3P79A 3CLYA 4ANNA 4GK3A 4I22A 5HX6A 4L52A 3TT0A 2XB7A 3D94A 4M0ZA 2VTAA 4EC8A 4ZZOA 4NK9A 2C5OA 4PPCA 1GIIA 1Y91A 4YZMA 3O8UA 4O7WA 2R5TA 2YISA 5AUYA 5GZAA 1M14A 2OW3A 4FV5A 2GNFA 1S9JA 4NWMA 5LJJA 2BPMA 4OBQA 5M57A 3LQ3A 1R78A 4BZDA 4CYJA 3HP5A 4FNWA 4O7TA 4E4LA 2R3HA 1AQ1A 4YC6A 3BV2A 1PXIA 2QOHA 5D1JA 3RP9A 2ZVAA 4NTTA 3R1SA 5CF4A 4LRKA 2RFSA 4O96A 4RQKA 4FZFB 2WMVA 3QTZA 3K5UA 4IBMA 3EQDA 4O22A 4BC6A 1OL5A 4R1YA 5CVFA 4FV1A 4Y72A 3KFAA 5KMNA 3Q4CA 3VNTA 1QPEA 1I09A 4EOJA 3ZYAA 3HGKA 2VTRA 4GIIA 3COHA 4NCTC 3OOGA 5E9EA 3I5ZA 2WMBA 4FSNA 4O2PA 4XEYA 3PLAE 4I94A 4K11A 2BRNA 2VWIA 5ETIA 5AV0A 3SV0A 2QO7A 2VZ6A 3QRKA 4FG7A 2B52A 4CLJA 5BUEA 2BILB 2WAJA 1SNUA 5AR3A 1JKKA 2VTTA 4DFZE 4Q2AA 3VHKA 2F9GA 3UQFA 4IMYA 3OCBA 4I92A 4TYIA 3DFAA 4U44A 3R73A 3QTRA 1WFCA 3UOLA 5M4IA 4FSMA 1ZYCA 2VWWA 4RIXA 1YWNA 2RG5A 2XRUA 5HTBA 3MDYA 1OZ1A 3EMGA 3QQUA 2XCKA 2YAAA 3EQIA 4FOCA 2WOTA 1UU3A 5CT0A 3UO4A 4D9TA 4CRSA 3P7AA 3FKOA 3UNJA 5I9ZA 2W06A 2UZLA 5AP0A 3LHJA 1GZNA 2JKOA 4U81A 3FI2A 5DRDA 5K5NA 3Q9XA 2H34A 4DA5A 3V5LA 4EHEA 2B55A 2DS1A 4MF1A 4NFMA 4FBXA 4ZTQA 5FM3A 4I24A 3V01A 2YIQA 3QZFA 4QTDA 3FJQE 2WTJA 3O71A 2ZM3A 4BYIA 5CYIA 4L3JA 3FZPA 2Q0NA 3VJOA 3VWAA 5M07A 1WBOA 3HMOA 4TNBA 4PTEA 2UZBA 3K5VA 4IAAA 4BFMA 4MNFA 3GFWA 2QG7A 4M14A 4QMLA 2PVFA 4QPAA 5HESA 4NM0A 4ANBA 4B6LA 2JIIA 3NCGA 3QRIA 3EKNA 3PXQA 1OUYA 3ZRLA 5AAFA 5AR7A 2W9FB 5B0XA 4ACDA 3PP1A 5HIBA 1ZLTA 2ETRA 2ZOQA 3O2MA 3QRTA 5E8ZA 3A60A 3F66A 1FBNA 3W10A 5K0XA 3EN4A 4QMXA 3DDQA 1JSUA 3GGFA 2BDFA 3THBA 3NR9A 4IDTA 3PY1A 3QTXA 3G90X 4FI1A 2RGPA 1Q3WA 5FTGA 3PIZA 5TR6A 4JNWA 2F7ZE 4R5SA 4RX9A 3AOXA 3RKBA 4XRJA 2VTNA 1KE8A 3D7TA 3OP5A 2GS7A 4YGAA 5EDQA 4DFLA 2J0LA 3LFCA 3M11A 4FUYA 2BALA 3DBCA 3DJ6A 4LGHA 3QKMA 4EH8A 2NNWB 4F7LA 4ACGA 4BYJA 4U43A 5IISA 1OB3A 1REKA 3QC9A 3WYYA 3TWJA 2XK3A 3HRCA 4XUFA 2YM5A 4RJ3A 4P90A 3OTVA 5EYKA 3GUBA 4ASDA 4D2WA 3AD5A 2PZPA 3W2CA 4RPVA 3KMMA 3C0HA 4L3LA 3MA6A 2X8EA 3TTIA 3DAKA 5AP5A 2UZNA 3VUDA 4C3FA 4RIOA 5HNIX 5HICA 5HLNA 3SG9A 5IQGA 2BRMA 4ASEA 3FBVA 1K2PA 4FOBA 4YJTA 3DXNA 4YNEA 3R02A 4ZJIA 1Q8WA 2J0JA 2XA4A 1Y6AA 1XO2B 4AT3A 4BCJA 4ZY5A 3R9DA 2ITNA 4EK5A 5KUPA 2HAKA 4ZSEA 3PDTA 4L43A 3H30A 3UIXA 2A1AB 2W96B 3QCYA 3I5NA 3PPZA 4USFA 4EH5A 2GQGA 3R71A 4L67A 4RRVA 2BIYA 3I4BA 5BVNA 5EQEA 4U97A 2JKQA 4KNBA 2R3OA 5AUTA 2BUJA 1JAMA 3C4CA 3FY0A 5AIRA 4BN1A 3LW0A 1QPDA 4MHAA 4PTCA 2QD9A 2ZB0A 4TTHB 2UW0A 4JIKA 4RIYA 5HCZA 4ITIA 5EDPA 3QUEA 4CTBA 4Z7HA 2E9VA 2JGZA 3DB6A 4TXCA 5IUIA 2YCSA 3I79A 3JVRA 4RX8A 5A4EA 3BHTA 4DFYA 2A0CX 4YHTA 4BBEA 4ENYA 2W1GA 3MVMA 3GI3A 3VS0A 3S0OA 3TKIA 2V7AA 3BEAA 3WE4A 1E9HA 2YZAA 3ATTA 4AOJA 3T3UA 3S4QA 2B54A 1WVWA 2NP8A 2WTIA 1IR3A 1PJKA 3D5WA 4XG8A 5DFPA 2B4SB 3Q60A 5BUIA 2CKOA 5KMIA 1ZZ2A 4C38A 2W1HA 2Y6OA 4IZ7A 4L9IA 2GTNA 4IW0A 4YTHA 5GIOE 2BAKA 1WCCA 4H1JA 4P4CA 4TWNA 5EKOA 2BDWA 2VWYA 1M52A 4IFCA 2IPXA 3HZTA 1RW8A 3KXZA 3E3BX 4XOYA 4BCGA 3ZSHA 4DINA 4QP7A 1OMWA 2PTKA 4DG0E 2C6EA 2UW6A 3QA8A 4JBQA 2RF9A 2RKUA 3SC1A 2JKMA 1J1CA 3ZXZA 4EORA 3LFNA 2QQ7A 2UW8A 3LMGA 2JBPA 3OT8A 5DMZA 4F1MA 4G31A 3CCNA 2XMYA 4LG4A 3MI9A 4K9YA 3CQEA 3DBFA 5G1XA 3U4WA 2VN9A 5A6NA 5EOBA 2YWVA 3TZ9A 1VYWA 2I40A 4IX6A 5CQUA 4A4OA 4MBJA 3H10A 4W8DA 3S00A 2J0IA 3NUSA 3BHUA 4DE4A 5K9IA 2C5NA 2BRGA 5EQYA 4TT7A 2W99B 4FKQA 5AR5A 2GSFA 4WBBB 4CKIA 4Y85A 2J7TA 3WF9A 2ONLA 4BDHA 3OF0A 1JWHA 1MP8A 5KNJA 3UPXA 3V6SA 4FEQA 3KK9A 3MB7A 1GZKA 3O8TA 4I0SA 3GC0A 5DG5A 5H9BA 5IPJA 4YJRA 4HYUA 2WD1A 4FKVA 4O0WA 4CFNA 3F61A 4QP9A 5EM5A 4PL4A 3A62A 4R7BA 3R8LA 3TEIA 3TXOA 4FEVA 2OIDA 4E4MA 2IVSA 4LRJA 2OFVA 1F0QA 5JT2A 3NNWA 5CI6A 3VIDA 3FQSA 3OUNB 2IW8A 3SLSA 4BRXA 4D2SA 1SM2A 3MBLA 4FV9A 2PK9A 4OTWA 4YR8A 3Q5IA 3PJ8A 4D1XA 2X2MA 4ZTHA 2FA2A 4EC9A 4C8BA 2UVYA 4FKWA 4NJ3A 3U4UA 3E92A 2F57A 3LOKA 5DLSA 4RLKA 3LCSA 4MBLA 5L2QA 3MVHA 3DLZA 3R83A 1O9UA 3TUBA 2X8IA 4ZS4A 4DEGA 5ACKA 4DTBA 3DB8A 4AN9A 4I0TA 2CDZA 4FT7A 2OGVA 3C5UA 2ZMCA 2CKEA 3PIXA 4IJ9A 1H28A 3RTPA 3QQKA 4ORKA 4ZSLA 4BF2A 3E87A 4IDVA 4CG8A 1LP4A 5DEWA 4QPMA 1WBNA 1PF8A 3UOKA 1CKPA 1VZOA 1ZAOA 3IS5A 3V6RA 3ZM4A 4RT7A 4FA2A 3FQEA 4DLIA 4O21A 5M56A 3I7CA 3NMUF 3OY1A 3OCTA 1YRPA 4NSTA 4XG3A 4N57A 1PMEA 5ICPA 3HECA 4IZAA 3REPA 5L8KA 2W1FA 4IANA 5AWMA 4X6QC 1A9UA 4B0GA 4GUBA 4G3DA 2JIVA 3N4TA 3FLSA 4P5QA 3D2KA 2WOUA 3PRIA 5TOZA 3PA3A 5EG3A 1T46A 4JOAA 2WQMA 4ZY6A 1V1KA 5LCKA 5ITAA 4BHZA 3QCSA 4PQNA 2W17A 3MA3A 5GHVA 3S3IA 3V3VA 2X7OA 3TIZA 4QP8A 1SVHA 2PE2A 3Q52A 1KUTA 2UW9A 5HBHA 2O64A 3KGAA 2VTHA 3GXLA 3SXRA 3PY3A 2OJ9A 2X6DA 3RPOA 4EYJA 2QOBA 4CT2A 1NXKA 1J7UA 3IKAA 2VTIA 1LPUA 2Y4PA 4RA5A 4KA3A 3BE9A 1K9AA 5JFWA 4RX5A 3UQGA 4RMZA 4AZFA 1DI8A 2E9OA 4ZTMA 1H24A 3WZEA 1FPUA 4RIWB 3DY7A 4KB8A 3WF5A 1Q8UA 4JG6A 3ZDIA 3SOCA 4ZIMA 1V0OA 2JDVA 4IEBA 3Q4TA 4R3PA 3RK9A 5CSHA 5AR8A 2B9JA 3PFQA 4EOQA 3VQUA 4GKHA 3RI1A 4Z9LA 1IAJA 5AIKA 4O0YA 3UBDA 5M06A 2BIKB 3BYMA 3FDNA 3GC7A 2JD5A 3KY2A 4RVLA 3RAHA 4RA4A 4IHPA 4MNEB 3L9MA 1GIHA 1UU8A 3CJGA 3E8CA 4S30A 4JIAA 5CWZA 2GNIA 4YZ9A 2W1DA 4F09A 4FSUA 4S33A 4L00A 4AW0A 4QNYA 4F7SA 4X3FC 2J5FA 1YXVA 1H25A 4GFMA 2IVUA 1U46A 1ZYJA 2VX1A 4XP3A 3IPHA 2YDKA 4F64A 5E4HA 4K0YA 3NSZA 3F7WA 4Q9SA 2JLDA 3H0ZA 3R63A 2OZOA 5L3AA 5IQAA 4H1MA 4WIHA 4UWBA 3W2SA 4QQTA 4MAOA 2W9ZB 2GNJA 2QO9A 3MY1A 4I0RA 5JKGA 4CXAA 3A7FA 4FNXA 3BZ3A 2V62A 4MCVA 2QODA 2CNUA 3EFWA 4XG7A 1OVEA 4PL5A 2JC6A 4GK4A 5J87A 3ORNA 5AM7A 3VS1A 4NIFA 2CLXA 2B7AA 3MY5A 3SXFA 1YKRA 3QGYA 1JKLA 4IC7A
chains in the Genus database with same CATH superfamily
2I7QA 3TDWA 5CZHA 3KC3A 4BKYA 1UWJA 4QMSA 4EK8A 5A4QA 3H9RA 3F69A 4YO6A 3FLNC 5A9UA 3ODYX 3E7OA 3TL8A 1H27A 3ULIA 3WARA 2OJJA 4F70A 4FYNA 3CJFA 4XNEA 1DAYA 5IA0A 3U8WA 2WPAA 3LFSA 4FVRA 4JQ8A 4F9WA 1F3MC 4RLLA 2PE1A 3ZSIA 4ZOGA 4O7LA 4AXCA 5F4NA 5HE1A 4CEGA 3WE8A 5J9ZA 2EXMA 2OWBA 3CE3A 2KTYA 3FI3A 4UWCA 2HZIA 4C36A 3HAVA 4OTPA 4NKSA 5KHXA 3HA8A 3VW6A 3AXWA 4CV9A 2XYNA 3FSKA 4X2NA 4YJOA 4CD0A 4AG8A 2XIZA 3FE3A 3VAPA 1Q62A 3FEGA 2CPKE 3ZFMA 2ERZE 2ITUA 4QMYA 3BQCA 3PXFA 4YNOA 1YDSE 2BTSA 2UZDA 3MSSA 4Y8DA 1W7HA 1TQIA 4X2KA 5KMJA 5HE2A 3RPSA 4WO5A 4F1TA 3F6XA 5IUHA 1M2QA 4BY9E 2BVAA 5K5XA 1OECA 2BRHA 3CTJA 1KWPA 3ENHA 4BGQA 4WNKA 3U9NA 5HLPA 1OPKA 2IN6A 2OJIA 3P9JA 5J5TA 1YOJA 4PDPA 1LUFA 2X0QA 1WZYA 4IB3A 2XS0A 4BCQA 3R1NA 2XARA 4DEEA 3QTIA 3BU3A 4IACA 3O96A 3HMPA 4EUTA 4RWIA 4B9DA 4DGMA 2ZDTA 3PVGA 2JFMA 1SZMA 2FYSA 5JK3A 5ETCA 1H1RA 4YHFA 4AA4A 4BDJA 5CF8A 5C4KA 3LFEA 4AXAA 5C1QB 5A4CA 4QNAA 1OL7A 4YC8A 3SDJA 3ORZA 3ANQA 4YBJA 4GKIA 2QLQA 3ORKA 4FNZA 4XV1A 4FRFA 3MJ2A 5AV2A 5CAPA 2VO3A 3C9WA 3PA4A 4ZTSA 1GOLA 3K3JA 4PMPA 1PKGA 1YXUA 3UOHA 4UALA 5CEMA 1OL6A 3D4QA 4CFFA 1FOTA 5T68A 3QZGA 2JIUA 4EH9A 2LGCA 4F7NA 3FI8A 3TDVA 3ORLA 5CALA 2YN8A 2QOFA 2CNVA 2VU3A 3LMHA 3HMNA 4KKEA 4M15A 3AMYA 3FHRA 4RFYA 1Y8YA 2YIWA 5HBJA 3DBQA 5AADA 3QX2A 2UZWE 3DTWA 4ZP5A 3VHEA 2BZIB 2QOLA 2XJ0A 3EQCA 4BGHA 4FF8A 5J7HA 4HYIA 2V5QA 5DYJA 2G2FA 5ETAA 4PDOA 5TO8A 2PVMA 4AN3A 4RJ7A 4K8AA 2ESMA 5CSVA 5KCVA 3FC1X 4YZNA 1ZXEA 5LMKC 4BTJA 1Q4LA 2EVAA 3EWHA 3PVBA 1OPJA 3F3UA 1DS5A 2BCJA 4IQ6A 1SYKA 3RMFA 3WBLA 2IG7A 4F78A 3WI6A 3OW3A 4LOQA 4JDKA 3T9TA 3O17A 4AN2A 2I6LA 3PA5A 2J4ZA 2V0DA 3Q3BA 1YWRA 4C4IA 2WMWA 3COKA 3P0MA 3VQHA 2QU5A 3R9HA 4FKOA 1DI9A 1B6CB 4W9WA 2PMIA 4FKRA 4EWHA 4X7QA 3CPCA 2RFEA 4ID7A 5IQDA 4FT3A 4KS7A 2FSOX 5LVOA 4YJQA 1WMKA 3BKBA 3RM7A 4TW9A 3BPRA 3BX5A 4GYGA 4TKSA 4PNIA 4X3FB 1Q5KA 4Z7GA 2YITA 4HGTA 4QYYA 3LPBA 4MXAA 1BUHA 4NM7A 3G15A 4WSYA 3PXZA 2GU8A 3GNIB 3EN9A 4Q9ZA 4EH6A 3D83A 2J0MB 3W2OA 3QKLA 3ZZEA 3BBTB 3MB6A 4E6DA 4IX3A 4CQEA 2VTPA 4O0XA 5CX9A 3O7LD 5DE2A 4KSPA 5DHJA 2YLFA 3CS9A 5A54A 4MWIA 3AG9A 2BFYA 2XNOA 4V01A 4E5BA 4FKLA 3BQRA 4JDIA 4CNHA 1XQZA 3KVXA 4FTOA 3OC1A 2C1BA 3FAAA 4FV4A 4PV0A 4S32A 3TNHA 1J1BA 4O84A 3MGYA 4YJPA 4YSJA 4B7TA 4L45A 5GIPE 2FH9A 1HCLA 3NFGB 5A14A 4JDJA 2X7FA 1ZYSA 1JKTA 5EI6A 2OIBA 5HHWA 4IWDA 4ALUA 5JFVA 4ZS0A 1S9IA 2O65A 2R7IA 3CD3A 4X3JA 5DR2A 4RG0A 1OGYA 4GT5A 3SQQA 4C4GA 5E92A 3HRFA 2OSCA 3FMEA 4JRNA 5C03A 5HORA 4ANMA 2OXDA 4MTAA 4E4XA 3M42A 4EHZA 4DBXA 4O7ZA 3E64A 4CFMA 3AC2A 5IQBA 5I5ZA 5KMKA 4QMVA 4F7JA 4HVHA 4V04A 2W5AA 4AZEA 2YM8A 4RFMA 4M13A 5AV3A 5CEQA 2VWBA 4CFUA 4O0RA 2OJGA 3ACKA 1Z57A 3L8SA 2YERA 4QMMA 4N4SA 5HG8A 5LVLA 1J7LA 4XYFA 3AGLA 4PDSA 2O63A 1R39A 5A4TA 2UW7A 3B8RA 2XNBA 2QI8A 4JI9A 5AA9A 3KA0A 1XMMA 3ZS5A 2O8YA 4TWCA 4AGWA 4HCUA 3KULA 3E8EA 4KRDA 5KZIA 1ZARA 2X0GA 5L2WA 2WMAA 2H9VA 1U4DA 3MIAA 2R3RA 2BHHA 2P33A 4G34A 4WT6A 2QG5A 3RK5A 3RM6A 3RZBA 4DAWA 2HW7A 4DYMA 1XH9A 2RG6A 5DH3A 2R3QA 4NKAA 3ZFXA 2VGOA 5EKNA 4YHJA 3QLFA 4PMMA 4IB1A 5CAQA 4AOIA 4NM5A 4C34A 5M4FA 4O91A 4E5WA 5BV3A 3O0GA 3UC4A 2Y9QA 2C3JA 4WRSA 3OUKA 1XH4A 4D4RA 3F2AA 4EHGA 2C69A 2NPQA 5C9CA 1WVYA 2FB8A 3LJ2A 3QRJA 1BL7A 2OG8A 1HOWA 3CTHA 4KINA 1FMOE 4MWHA 4DEHA 5AAGA 3FXXA 3GCPA 4QYFA 3KRWA 5IQFA 3HUBA 3Q4ZA 4C4FA 5EM7A 1JVPP 1YVJA 2OICA 1REJA 2PHKA 4MF0A 4QPSA 4BDEA 1RDQE 3FLZA 3R28A 2XNPA 2WQEA 4BTFA 4O82A 2B1PA 2HENA 3GQIA 2PULA 2VRXA 4D5HA 2C4GA 2WTCA 4YU2A 1XR1A 2H96A 1EH4A 4D2PA 2WKMA 4W4XA 2YIXA 3EOCA 3LFFA 1UNLA 2WEIA 3OEFX 5HG5A 3LXPA 4UYAA 2W4JA 4QTEA 2ITWA 2WQBA 5CT7A 3NVKI 5EK7A 2W4OA 2UV2A 2VV9A 3C4WA 3VC4A 3EN7A 3SXSA 5M4UA 3ZUTA 5CF5A 2QVSE 4EZ3A 3HYHA 4BI0A 4BICA 4CCUA 3QZHA 5CXHA 3AT3A 1G8AA 2LAVA 4YZDA 5CU0A 4QMZA 5EYCA 4CMTA 4WKQA 3ZFYA 4FIJA 4AWIA 2PVLA 4YURA 2IZSA 3PRFA 4FSZA 3WIKA 3Q2JA 3U6IA 5CVGA 1OIRA 2UVZA 2H8HA 2YIRA 3W1FA 4ZAUA 2OZAB 3GCVA 4MUQA 3EHAA 4DTAA 2WTKC 3CP9A 3GCUA 4IAZA 4X2JA 2OIQA 2HIWA 3LM0A 3QZIA 4MQ2A 4EOIA 3CPBA 3COMA 5I9VA 3ALOA 4JBVA 3R8VA 1CMKE 1BLXA 2QOCA 2XK4A 1M7QA 3BWJA 3Q96A 1G8KA 4M3QA 4CTCA 4AW5A 1KSWA 2G01A 3JY9A 4I20A 5FDXA 4NTSA 2O2UA 4CKRA 3NFFB 4UY9A 3LIJA 1OIQA 2WMSA 3ALNA 4JVGA 4RIXB 5D9HA 3EN5A 2YHVA 3RNIA 3PWDA 3WZUA 2WHBA 4ZLOA 1PMNA 2PUIA 4ZZMA 1DAWA 3GFEA 5AP2A 4FTAA 3OFMA 4TNDA 1OBDA 4LUEA 4FEWA 3R2BA 2XKEA 4E8AA 4F0FA 3D5UA 3LFBA 5M51A 4I5MA 3CTQA 3VUIA 3OW4A 4U80A 3RCDA 5CAOA 4QP1A 5DR9A 5C8NA 3KXNA 1J91A 1SMHA 2OF4A 2ONLC 3AC5A 2ERKA 1PYEA 1U5RA 4IAIA 5DT3A 5H3QA 2OBJA 2A2AA 1BMKA 3ELJA 3RHXA 3P1AA 2UZTA 4FZ6A 4V0GB 5FTOA 3GU8A 4BKJA 3TYKA 4FTNA 1VR2A 3FZTA 2Z60A 4XP2A 5E1EA 2OXYA 3BHVA 1W84A 3IW8A 1CKIA 4XX9A 5EOLA 3BIZA 4BCFA 1OL1A 5B2LA 2AC5A 2GPHA 4KIPA 2BHEA 2SRCA 1H1SA 5K3YA 3G51A 3VN9A 1BL6A 3OXIA 5HD7A 1OUKA 3AC1A 4DLJA 3FLQA 5KBRA 3S95A 2CKQA 2QOIA 5IU2A 3EFLA 3QD0A 3CEKA 5AJQA 4GK2A 4O81A 3DTCA 3EQHA 3F9NA 5FLFA 3BBWA 2PUPA 5KMOA 2Y7JA 4ACMA 2IWIA 4G6LA 4DTKA 5AAEA 3NAYA 4W8EA 3UVPA 4A9SA 3SOAA 2JDOA 3LXKA 5FXQA 3D7TB 3KRRA 4FIFA 4IXPA 2WO6A 4L53A 2XALA 2O0UA 4UB7A 3DBEA 4EH4A 5A6OA 3AKKA 4BDAA 4I1ZA 3V8WA 3QF9A 5E8VA 5LWMA 3DZOA 4L01A 2CCHA 2XBAA 5DT0A 4ZSAA 5D11A 3HKOA 4Y73A 3E88A 1OKWA 3PG3A 4U7ZA 4ZLYA 4MXCA 2ITTA 3MN3A 2W05A 2I1MA 3R2YA 3Q9ZA 2X9EA 2XIRA 3C4XA 3MFUA 4AT5A 3HV5A 1PXLA 4QMOA 4O4EA 1PYXA 3NDMA 5HKMA 4LGDA 4AFJA 4D4YA 2REIA 4U5JA 3H0YA 3P5JC 2JDSA 3DDPA 2FUMA 3AC4A 3F3TA 3NW7A 4RBLA 1RJBA 5E91A 5AUXA 2YABA 4FV2A 3TKUA 2Q83A 4M8TA 3HA6A 4U42A 4R77A 4IADA 3K3IA 2C68A 4OTDA 4J97A 4R6VA 4ANLA 2YLEA 2VTJA 3R7YA 5IZFA 4EHVA 1WBPA 3WF6A 3FMNA 4O2ZA 3LCTA 4ZJJA 4DFNA 3W32A 3UIUA 3DKCA 5IEVA 4TZRA 1XH8A 4FZAB 3L9LA 4BI1A 4BTKA 4ENXA 3V8SA 2HOGA 1IG1A 4GS6A 3QQLA 5CU6A 3V5JA 2YCRA 4HVDA 5K4JA 5ANGA 5CEPA 3IO7A 5K4IA 5BVFA 3NS9A 2W1ZA 2X2LA 4ZLZA 4IB5A 4QRCA 3FZ1A 3F5PA 4QQJA 3T3VA 4CZYB 2R9SA 4QMNA 4DT8A 4ZSJA 1YDRE 4GT4A 2VD5A 5M08A 2C3IB 3O7LB 4OAVB 4I5PA 4MKCA 2F7XE 1ST4A 4F9BA 2PVRA 3A8XA 1YI3A 5CLPA 5IA3A 3S1HA 5DIAA 4D0WA 1FINA 3QX4A 3HAMA 2ETMA 3D14A 2HYYA 3O50A 4TYHB 5CY3A 4XJ0A 3U54A 3ODZX 4FTTA 4Z55A 4TYGA 2C30A 4AA5A 2EWAA 3UDTA 4J98A 3H3CA 3G6GA 4FX3A 4AF3A 3I81A 4JJRA 4YLLA 1G8JA 4GV1A 2XH5A 4BDIA 3EYGA 3G0EA 3GBZA 3P7BA 5FQDC 1YI6A 3IGGA 3RCJA 4A9RA 3VBXA 3R7VA 4YO4A 2I0EA 3DBDA 4BCNA 3NUYA 3R8MA 1STCE 5CU2A 1NVSA 1PW2A 4EZ5A 4DT9A 3VUGA 1XWSA 2G9XA 5ANKA 4O1OA 4RVTA 3PSDA 1OBGA 4NCTA 3JPVA 4K2RA 3OWJA 2R0UA 3VUMA 2VO0A 4WNOA 4FZDB 5T6KA 4W4VA 2CN8A 4IH8A 3I60A 5F95A 5CEKA 1SNXA 2OO8X 3UC3A 4FV0A 4RC3A 3FXWA 3NW5A 4BJJA 2C6LA 2YDJA 4DEDA 4DHZA 5M53A 5TT7A 4G6OA 3FMHA 2XKFA 4BDDA 4BI2A 4BDKA 3NUAA 4EJ7A 5AR2A 4UWYA 1J7IA 4PUZA 2WGJA 3EL8A 4E93A 4LOOA 4TL0A 3VUKA 1UKIA 4AZSA 4DG3E 3UJGA 5B2KA 2ZV2A 3TNQB 1RQQA 2WIPA 4JLCA 1XHAA 4O7VA 3R7GA 5EHOA 4C33A 2C3KA 3IOPA 4Y83A 2YJRA 2XCHA 5GZ9A 5CI7A 2JFLA 4DGLC 2KULA 3PP0A 2C1AA 4U8ZA 5JMSA 4QT1A 5C01A 1CSNA 1KE6A 5EW8A 3NYXA 3QHWA 3EQRA 4O27B 2C3LA 4KUJA 4CFXA 2QNJA 2F2UA 3Q9WA 4K77A 2NO3A 3EFJA 3PJ1A 4LM5A 4EONA 4DF3A 4H39A 4WA9A 4L44A 3HUCA 3G0FA 5FM2A 2QKWB 4FJVA 3KXXA 5BYZA 3A61A 4WD5A 4XBRA 3PG1A 4C37A 1XH5A 3QQFA 3QU0A 5IA4A 5KMLA 3SA0A 3BGQA 2OKRA 3QCXA 3PJCA 3QALE 4EI4A 2HY81 2XK8A 4O1PA 4WG5A 2AUHA 1TVOA 4BCIA 4IWOA 4OTQA 5C8KA 4G3EA 1KV2A 2P4IA 4KIQA 2X7GA 4MK0A 4C35A 1IRKA 2RSVA 2XKDA 3U87A 3W16A 3AC8A 4BDCA 4JMQA 4FG9A 2XF0A 1BYGA 5AV1A 1H1PA 3IW4A 4FKIA 2XEYA 5FP6A 5H8BA 4L46A 2X39A 3E3PA 5HZNA 4IM2A 2QR7A 5CS6A 3NUXA 3TTJA 4XG9A 4D58A 5HOAA 3SW7A 2XNEA 5EHLA 1AGWA 5EHYA 5L6OA 4GVJA 5BVWA 3UZPA 2FSLX 1PXJA 3QBNA 4F9CA 3DZQA 3RHKA 2XNNA 2WQOA 3I6UA 2VWXA 4PNKA 3FYJX 4LOPA 3ZHPC 3FMDA 3BYVA 4Y5HA 4QP3A 5EYDA 3ZCLA 2Z02A 3QFVA 3OHTA 3P4KA 4UMRA 2UZVA 3EQFA 4W4WA 1WBSA 3KRXA 4FIIA 1H07A 3LZBA 3UG2A 4BR3A 4FVPA 4DITA 4BWPA 2IVVA 2G2IA 4CRLA 2I0HA 3D5VA 5IQCA 1TKIA 2Y0AA 3C1XA 2XM9A 3FMKA 4AQCA 4O7SA 2CGUA 2XNGA 4ACCA 3DGKA 2VX0A 3KMWA 3TV6A 2VO7A 3UG1A 2C5XA 1PRYA 4YJVA 5JQ8A 3E93A 5HLWA 2YM6A 2R3KA 4NUSA 4HVIA 2C6IA 2XJ2A 3GCQA 3IOKA 3R01A 5EI2A 3VS7A 4U3YA 4ANSA 4AT4A 3QXOA 4DBNA 3ZUUA 3TI1A 5DEYA 1E1VA 4FTCA 4QD6A 3E63A 3PZEA 3T8OA 3FY2A 3OWPA 4RJ6A 4BCPA 2R3NA 4HYSA 4IX5A 1P4FA 4AGUA 2YEXA 2JEDA 2R3JA 2WQNA 5IKWA 1URCA 4FR4A 5HG9A 5LOHA 4JT3A 4IZYA 2OI4X 4M67A 3HLLA 4H3PA 5KX8A 4BIDA 4GSBA 4D28A 2JDTA 3C4FA 2C0IA 3Q5ZA 3JXWA 2Q0BA 4G5PA 3BWFA 4GJ2A 3WZDA 4RIWA 3QD4A 3TN8A 3A7GA 1TFFA 5CU4A 3BU6A 2PY3A 1PXPA 2WMTA 4GJ3A 3II5A 4YP8A 4E6QA 4EK3A 5HIEA 3UYTA 2BMCA 5L6WL 3RGFA 4USEA 4L8MA 3MFTA 1PXMA 4MNEA 3EQGA 3UYSA 3VVHA 3AQVA 4FTIA 5IQIA 4JQ7A 2X4ZA 2QKRA 2J0KA 4IVAA 5M44A 2GS6A 5L2IA 1ST0A 5J1VA 3QC4A 4I5HA 3JY0A 4FKGA 3NWWA 3FC2A 5ANJA 4F63A 3RWQA 2VO6A 3ET7A 4Y46A 4RZVA 4D2VA 3PTGA 3SHEA 3UZRA 3BHYA 4MD8E 1JSVA 3AD4A 4RVMA 4O0SA 4YJSA 3BGZA 3DK6A 2YM3A 2ITOA 4EK4A 2DUVA 3NYNA 5FEEA 2PPQA 4P7EA 5H2UA 5IQEA 3O23A 4RSSA 5JGBA 4AOTA 1OIYA 3LVPA 1ZY4A 4C02A 4UZHA 4D1SA 4G6NA 4QEBA 4CFVA 4HZRA 4LMUA 3ZOSA 4DDGA 2VWVA 1VEBA 3DKGA 4S31A 1OKZA 4MYGA 1XBCA 3MESA 4QYEA 1XKKA 5ANEA 1XH6A 3PFYA 4R1VA 4JX3A 1PXNA 2C6KA 1I44A 3KXMA 4FL2A 2BKKA 4PL3A 3G9NA 4XOZA 5EM8A 4BWKA 3DA6A 2J6MA 3DS6A 3HP2A 4J95A 5HCYA 4J7BA 1YXTA 4F6SA 2NYAA 5IH6A 4M97A 4D2TA 4D0XA 3R30A 2PZRA 5BVDA 1Q41A 4FGBA 4LV5A 4OTGA 3HVCA 1OGUA 4QYGA 4XG2A 4UMTA 1H4LA 4BDGA 3OWLA 2VAGA 3L8VA 3K54A 3QQGA 4CLIA 3BLQA 2P3GX 5I9UA 2ZAZA 5A4LA 5L2TA 4AXEA 3L9PA 3TIYA 4G5JA 4I3ZA 4ZJVA 3NIZA 2DQ7X 4KIKB 3QTSA 4IFGA 2IO6A 4WNPA 2B9HA 1URWA 2X0PA 1BI8A 3UIBA 3N51A 4AE6A 2G1TA 2EXEA 1L8TA 3VUTA 4DN5A 2X6EA 2CKPA 1Q8ZA 4I4FA 4X2GA 2XNMA 5LVMA 4RFZA 3BYOA 1W0XC 3PSBA 1OL2A 4LRMA 2A4LA 4M84A 3PVWA 1NVQA 4RC2A 2PU8A 2IZUA 3NYVA 3QLGA 4I6FA 4UX9A 4D5KA 4DC2A 2I0VA 3MJ1A 4FZ7A 2P55A 4BTMA 3DJ5A 3FWQA 3U6JA 5F20A 4O4FA 4A4LA 3R8PA 3OXTA 4B8LA 4IIRA 3MY0A 3QCQA 1YOLA 3OZ6A 3OTUA 1ZYDA 4MD9E 4DHFA 4PPAA 2C5YA 2PL0A 3HDMA 3VS6A 3H9OA 4XMOA 2GFCA 4GUEA 5HCXA 3VRYA 3HNGA 4ZTLA 5IG1A 4MXYA 3GEQA 3I0OA 3R8UA 1Q8YA 3LCOA 1BKXA 4ERKA 2XK7A 1UU9A 4EKLA 4HGLA 4YTFA 4JAJA 4AZTA 4CZUA 3VS2A 4LUDA 2XAMA 3IDBA 4KS8A 3NZ0A 4FT5A 1MQ4A 4NW5A 1IASA 3D7ZA 4O4BB 3R7EA 5IA1A 2C6MA 4CCBA 4M69B 3ML1A 3SRVB 3LM5A 2PUNA 3IECA 3TNIA 4FL1A 3NYOA 5CENA 3B8QA 3HMIA 4IVCA 3ORTA 3HMMA 2ZB1A 4WUAA 3EFKA 4YPSA 5LARA 5IH4A 4M0YA 3CY2A 5LWNA 4CZTA 4G3GA 5JSMA 3OT3A 4GL9A 1M7NA 3ZSGA 4D1ZA 3E5AA 2OXXA 3VBTA 2RL5A 1WBWA 2PZYA 2YAKA 3VRZA 4BCKA 2CSNA 3OBGA 5HGIA 1ZZLA 1PXOA 4RZWA 5ANOA 3OOMA 5EW3A 5J79A 3DAJA 5AMNA 3UMWA 3P78A 4KBCA 2QOOA 4MXZA 5HNBA 5IEXA 4EOMA 5BUJA 2IJMA 1JLUE 1P5EA 2CLQA 4BWXA 3N4VA 4PWNA 3LFAA 3IDPA 3C51A 5FDPA 1T45A 2ZM1A 5FP5A 2PSQA 4A9UA 2GNGA 5IH5A 4AAYA 1ZMVA 3PXYA 1A48A 2YIYA 3QRUA 4PP9A 5M09A 3JUHA 3PUPA 3L8PA 1YW2A 5J95A 1JQHA 5GJFA 3S2PA 3UQCA 5FEQA 1ZOHA 1NA7A 4G2FA 2XIXA 2WB8A 5HBEA 3DLSA 2J50A 3G9LX 3ETAA 4NT4A 3R9NA 3UOJA 2PMNX 5ANDA 5CAVA 2V55A 5JN2A 4G9CA 3QHRA 3O5AA 2HCKA 2ITXA 4K6ZA 4PDYA 1UV5A 4DCEA 1MQBA 4YUQA 4AW2A 5HE0A 1YI4A 3BU5A 1U54B 2NRUA 1OI9A 2R4BA 2GNLA 2XBJA 2BAQA 3ZC6A 4U45A 1GY3A 3DJ7A 4QO9A 4XV9A 5E8UA 3AGMA 4C2VA 4Q5HA 3MTFA 3W2RA 3E62A 2HZ0A 2XK9A 4KKHA 4UN0C 5AV4A 3R7OA 2C0TA 3ZLYA 4HCTA 5J9YA 3GU5A 1ZY5A 2UW5A 3MPTA 2R3LA 3RAKA 4YTCA 1A06A 3A99A 5EYMA 4XRLA 4JG7A 2Z7RA 1L3RE 5I9YA 5AUWA 3RJCA 5FXSA 4YBKA 2GS2A 4QMWA 5J8IA 4HVSA 2BKZA 3QQHA 4C2WA 3CD8A 3GOKA 2JITA 2UZEA 3UPZA 3FHIA 3GOPA 4WRGA 3NUPA 1W2CA 3QTQA 4C3PA 4IM3A 4AW1A 3IW5A 3OVVA 3EQPA 4XCUA 3ZO2A 3I1AA 1JNKA 1Q97A 1H00A 5DVRA 4JRVA 3LFQA 4GRBA 2BAJA 1LEWA 2B9IA 3CGOA 3KULB 2WU7A 5BVKA 1WBVA 4FKPA 4UXQA 2FGIA 5BNJA 4FSRA 4KAOA 3DPKA 3ZM9A 3FSFA 3U6HA 4EBVA 3LXLA 4KD1A 3E8NA 4QQ5A 3ACJA 3IDCA 4DH5A 2WMRA 4AX8A 2PZ5A 4A06A 5DBXA 4DH1A 2WTDA 2QHNA 4RWJA 2PVHA 1CKJA 4U9AA 1P14A 1UWHA 1GZ8A 4F1OA 3HDNA 3CQUA 2H6DA 2A19B 4KWPA 4AUAA 3PE2A 4Z3VA 4L7FA 4HYHA 3FPQA 4XV2A 2AYPA 4W4YA 4J52A 3D9VA 2PWLA 5C8MA 2F7EE 4LQMA 4MVFA 3IK3A 2AQXA 2BTRA 1NY3A 3MWUA 5I3RA 4JAIA 1ZMWA 4Q5EA 5D12A 5AR4A 2EB2A 3KRLA 2GDOA 3ID6C 1OM1A 4GIHA 4EEVA 2ACXA 3ENMA 3DXQA 3KCKA 3PY0A 3WYXA 2CGXA 3P5KA 1H0VA 2CMWA 2YM7A 4X0MA 2VGPA 3G2FA 3V8TA 5CF6A 4L42A 5CU3A 3ORPA 1H08A 3WZKA 4O6LA 2W1EA 5E8TA 4WUNA 1H26A 3GT8A 4OUCA 4F99A 2VNYA 4FL3A 3LLTA 4IJPA 2QU6A 2HWPA 4LL5A 5G6VA 4F6WA 2C0OA 3ZO3A 4ARKA 2NRYA 3BHHA 4FT9A 4H36A 4FV7A 2R64A 2UW4A 3UZTA 4G17A 2P2HA 5JEBA 1FMKA 1UA2A 2BZJA 3MVJA 5AFVA 3DK3A 3FZOA 3UGCA 1MRVA 1JPAA 4JS8A 3ORXA 2VTSA 2PMLX 2CJMA 4F9AA 4D2RA 5IEYA 1XH7A 2OF2A 1XBAA 3OCGA 5H8GA 4ZTNA 5LMKA 2V22A 4X21A 3MW1A 1JSTA 1Q3DA 3DKFA 3BLHA 5FBOA 3R8ZA 5IQHA 3GP0A 4RQVA 3OCSA 4PX6A 2QURA 2C6DA 4RJ8A 5D41A 4I4EA 3KK8A 3E8DA 3D0EA 3AD6A 3JVSA 3L1SA 3IQ7A 1GAGA 2FSTX 3F3VA 4UZDA 4IM0A 3LCDA 4EBWA 1QL6A 4K1BA 1W82A 4JXFA 3VO3A 4IAYA 3WF7A 5ANIA 3AKLA 5FXRA 5L2SA 4B8MA 3PSCA 3R22A 3QKKA 4CMOA 4B99A 2ITZA 4BBFA 3QA0A 4C4JA 1QMZA 3MPAA 4TWOA 4C58A 3F5XA 4E5AX 1KE5A 3FI4A 4USDA 4R5YA 3EZRA 1APME 2OZAA 3MH2A 2JAMA 3ZLWA 2WIHA 3ZEPA 3BRBA 1UKHA 1Y6BA 2OFUA 5LVNA 4R7HA 5AP3A 2Y4IC 1H8FA 2JBOA 2UZOA 2X1NA 3A7IA 4H58A 2OU7A 2IZRA 3PWYA 3GU4A 4EKKA 2ZYBA 2J9MA 1PMUA 3PYYA 4OTIA 5JZNA 4GH2A 4OLIA 2XM8A 3UNZA 3GB2A 4FEXA 3R9OA 4FEUA 4CMUA 4H3BA 4LV7A 2ZV8A 4O7RA 3R0TA 3TZ8A 3HV6A 5AUUA 3GVUA 4TYEA 5F94A 5L4QA 4HGSA 2UVXA 3W0MA 4H05A 3ZMMA 1QPCA 4F4PA 4DCAA 2PVKA 3KXHA 5CSPA 3FUPA 3NUNA 4PF4A 4AZVA 4BBMA 4KBKA 3KCFA 3C5IA 1XJDA 3U51A 4D4VA 4ZXTA 2FSMX 2W5BA 3GU6A 4C62A 4AXDA 2HWOA 3ROYA 5CNOA 3PXRA 4YJUA 4H3QA 2ZMDA 5DRBA 4FV3A 4TYJA 3NNUA 4MH7A 2BDJA 2R3GA 4ANQA 4F08A 3KREA 2VUWA 3C0GA 4FTMA 4P5ZA 4L3PA 2W4KA 3N9XA 4V0GA 4UBAA 3FZRA 4FTQA 3PE1A 1KE9A 3EL7A 4C4EA 3QYWA 4I41A 4O38A 1TQMA 1CTPE 2VTOA 3MPMA 4ACHA 3TM0A 4GMYA