5LMBA

Human spleen tyrosine kinase kinase domain in complex with azanaphthyridine inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
271
structure length
264
Chain Sequence
YLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tyrosine-protein kinase SYK
publication title Optimisation of a novel series of potent and orally bioavailable azanaphthyridine SYK inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 264
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5lmbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5lmbA01
2C47A 4Y72A 3I79A 2ITUA 1SM2A 3CS9A 5FUTA 1XO2B 4RIXB 5KMNA 2OZOA 3WZKA 4BGHA 2QO9A 1JLUE 4NIFA 2FH9A 4MF0A 3BI6A 4JRNA 2BAKA 2F57A 2QCSA 4DGMA 2C4GA 2GNLA 1YDTE 2FUMA 3ENMA 1KV1A 1FPUA 1U4DA 3FXXA 4KSPA 3R8ZA 4C62A 2CMWA 2VWVA 4DFBA 5IKWA 4J96A 3ORMA 4X2KA 3WF6A 5CSVA 4EH4A 4JBPA 2FSLX 5G1XA 3TNQB 4FNWA 2ITVA 4BC6A 4E26A 4CFMA 1SVGA 5H2UA 4C4JA 2RG5A 5LVPA 3R1QA 1OKZA 3KCKA 3DS6A 3KRJA 4S2ZA 5C4KA 4JS8A 5BVNA 2GTNA 3NUYA 4M84A 3C4CA 5EM5A 3VWAA 3WARA 4HPTE 4YUQA 2Z2WA 2WZJA 1E1VA 1PRYA 3IOKA 1CTPE 2GNIA 2VTHA 3AT2A 4JT3A 2RGPA 2I6LA 5J8IA 3RALA 1J1CA 3RTPA 2Z8CA 4FYNA 4BZDA 3C1XA 2B52A 4WA9A 2CKQA 5LARA 4IH8A 2Y4PA 1FGIA 1Q8WA 3ZLSA 4EYJA 3GI3A 3MVJA 4OTWA 2PYWA 4FV3A 4FEWA 1TQPA 2PTKA 3HV3A 3MY5A 5E8SA 5T68A 5F20A 3PRFA 4YO6A 3QALE 3QL8A 4GT5A 2YM3A 3EZRA 4M13A 4U5JA 4BDBA 3KREA 1P4OA 3POOA 4FV8A 4I5PA 2VTQA 3MYGA 1WBNA 4QYGA 4RX7A 4B8MA 4Z9LA 3R8MA 3NUXA 1WBWA 2XS0A 1OVEA 2WMAA 4HJOA 3W1FA 2H6DA 4TYHA 4I41A 1URCA 3UOJA 3ALOA 4IVAA 4PPAA 5IQAA 3RGFA 3R01A 2ZDTA 3MVLA 4ZY5A 5KMKA 3WIKA 5AJQA 3QD4A 3FQHA 3MB7A 4ZJVA 5KMLA 3R6XA 5CANA 3KN5A 3FLSA 4TKSA 2JEDA 2AC3A 4AZSA 2VTIA 2CN8A 4Y83A 4PDSA 4EK4A 4ZOGA 4GMYA 3RPSA 2XIKA 1PXKA 3HMPA 3GENA 4FT5A 5A4EA 2C0OA 4Y5HA 3PPJA 4G34A 1WVXA 2I0HA 3BHTA 3CY2A 5AM6A 5FXSA 5AV4A 5IQFA 4DCEA 5FG8A 5HG5A 5JFXA 4S32A 4NJDA 2NPQA 2QU6A 4RWLA 4G16A 4FG9A 2RF9A 3LXPA 4APCA 4BTJA 4EK8A 3O96A 4M14A 4KIOA 1FBNA 3TNPC 5AV1A 2YAAA 3WZJA 1U59A 5B7VA 4DG3E 1LPUA 5AEPA 2PWLA 4FEXA 5E7RA 5JRQA 4DC2A 2XMYA 4V01A 3N9XA 4I94A 2WOTA 4EOMA 2JIUA 3KGAA 4TY1A 3D7ZA 4W4YA 3R7EA 1W84A 2HZ0A 1PYXA 2RFEA 4G17A 1UNHA 3GXLA 4ASDA 4O7WA 5D12A 2VTLA 1IG1A 3MIAA 4AW2A 1H1WA 1ZMUA 2G15A 2XJ0A 4BBFA 4RLLA 5TOZA 3RPYA 3WZEA 5A46A 1Q8YA 4A4LA 4M69A 2FSOX 3ERKA 4G3DA 4JL9A 2CGWA 3F2RA 3TDVA 4W4VA 2B9HA 3V5PA 2PZIA 4U97A 2YCFA 4C57A 2ONLC 4YURA 3CGOA 3DK7A 3U6IA 4E6AA 3RAHA 4FKWA 4MH7A 3WBLA 2VO0A 2VUWA 3KC3A 2PVLA 3TZMA 4XCUA 4YC6A 2FGIA 2JAVA 4QPMA 2VTPA 3ORLA 4D55A 4N4SA 4JX3A 4IC8A 4LL0A 2Y4IB 2Y7JA 4BF2A 4IWDA 2IJMA 4OBPA 3MY1A 4YNOA 3BGZA 2XM9A 3DBCA 4BICA 1ATPE 4BCOA 4TL0A 3WF5A 3ZEPA 3FHIA 4MKCA 4EHGA 1WVWA 2UZLA 2WXVA 4MD7E 5CYIA 4FSTA 3PJ2A 4WNMA 5EFQA 4O82A 5E8WA 4CFNA 5AAGA 3C50A 4QT1A 4ZAUA 3UIMA 5KO1A 1H1QA 2X9FA 2F2UA 2VO6A 3VF9A 5FDXA 4AWIA 2GCDA 5CEMA 4AOIA 2QURA 1UU3A 3BYSA 3KMMA 2QNJA 1FGKA 4FTKA 4O1OA 3GP0A 1O6LA 1YDSE 3EQDA 4JAJA 4MNFA 5CY3A 1KE9A 5DN3A 3F69A 4YBJA 2WGJA 4KNBA 3QWKA 4A9UA 5M4FA 5HGIA 4IJPA 1DI8A 4FSWA 4A7CA 1VYWA 4NL0A 3BWFA 5IA5A 4MXAA 3VS2A 4TYEA 4MBLA 2J0KA 3HA8A 2FYSA 2QLQA 4IX3A 4RC2A 4NTSA 3MI9A 4O6LA 4XP2A 3VUDA 2R5TA 2PE2A 3MA3A 3MY0A 3O71A 4XX9A 4AQCA 4EH3A 3Q04A 5GJFA 3FZ1A 4CFWA 2YM5A 1PXOA 4N6YA 3VAPA 3ZTXA 2WTKB 3ZEWA 2IWIA 5IDNA 3NX8A 5JKGA 4V0GA 2Y6MA 4RT7A 3BEAA 1ZZLA 1WCCA 4XJ0A 2BRGA 3GT8A 3JS2A 4AN3A 1RQQA 4QYFA 4AGDA 4ZZNA 2EB2A 4PP7A 5JQ5A 3LOKA 5BQ0A 3BQCA 3EOCA 4LQMA 3QUPA 2C5NA 4JLCA 3LCDA 5FEQA 4AT4A 4FUYA 2OBJA 4FSZA 4UY9A 5M4CA 3PJCA 2DQ7X 4PL5A 3SX9A 4AN9A 4FC0A 4B7TA 3CEKA 4IXPA 5IA1A 4UYNA 4UMTA 3CQWA 2XRUA 1BL7A 3QTSA 4HW7A 5I0BA 4PDYA 4TWPA 4H05A 1WBPA 3UO6A 1Q97A 1OM1A 5EHOA 4V05A 4F4PA 4WNKA 4FZ6A 4BZOA 3PY0A 3OC1A 3UNZA 4L9IA 2XJ1A 4RIWB 2OJJA 2WTKC 3PG1A 3Q96A 4GL9A 2ZJWA 3KA0A 4IVDA 1J91A 3E8NA 4FNXA 5ACBC 2FB8A 3F7ZA 3HVCA 3ORXA 4PTCA 4B4LA 4BDFA 3BQRA 4NCTA 4C38A 1ZYSA 3QD2B 4XP3A 5AUUA 3V8TA 3VS0A 1OKWA 5CEOA 3UPZA 2X8DA 5JZJA 1QPJA 4OT5A 4BR3A 4EHZA 4ASEA 4NH1A 3VHEA 2BILB 5IMXA 4P7EA 4I3ZA 5EW8A 4G3CA 3PXQA 3QYWA 5EH0A 5C03A 2YCQA 3R63A 3FPQA 3RVGA 3UQFA 3P7BA 5ETAA 3BYOA 3BU5A 4MTAA 3FMEA 3C4EA 4W8EA 5H8GA 5BMMA 4ZTQA 4MK0A 4K18A 1R1WA 2OJFE 3ZM9A 2HYYA 4ZZMA 5D41A 4ANOA 1SMHA 1KV2A 2PZRA 2J9MA 4O0TA 4WBBB 4YZMA 2HZ4A 2WQNA 3T3UA 2QHNA 2VAGA 3CQEA 3QTUA 4TTHB 2OLCA 3ZO3A 3NLBA 4F7JA 2QR8A 1K2PA 3IKAA 4IM3A 4WT6A 4M7IA 4AZVA 3OWLA 3SG9A 2KTYA 3PLSA 2R7BA 3C4ZA 3W2SA 4A07A 2O3PA 2PVFA 2ZM1A 2EXMA 4GVAA 4F1OA 4ZEGA 5E8VA 2XK3A 3NDMA 4LRJA 4YPDA 4Z55A 5FXRA 4ZTRA 5AUXA 2I7QA 2O0UA 3DXNA 4C3PA 3IK3A 2ITPA 1U54B 3MH0A 4CXAA 1ZZ2A 2EUFB 1YWNA 2E9UA 2PVYA 4FTNA 2YACA 1ZRZA 3R1SA 1TQMA 4XMOA 4R5SA 5J95A 1DS5A 1W8CA 4IE9A 3T9TA 3TJCA 3MS9A 2V7OA 3FWQA 3PJ8A 2WEIA 2J5FA 5M07A 3GOKA 4OT6A 4MXZA 2QOHA 4JDJA 3Q4TA 3KF7A 4QTDA 3FHRA 1NY3A 4QMQA 5KMOA 3OBJA 4XS2A 3JVRA 3FYKX 2YEXA 3I0OA 5HLWA 2O65A 1KE8A 2GMXA 4ZS4A 4U42A 2PVHA 3FBVA 3Q32A 2UZTA 1TQIA 4FKGA 4RA4A 3HAMA 4PTEA 3Q60A 3NVKI 2WAJA 3HP5A 3CJFA 4F9BA 4GT3A 3OD6X 4D1SA 1HCLA 4ZIMA 2UW5A 4FKQA 2CKEA 4EBWA 3VBYA 4FSQA 2X7OA 2ZAZA 5ETFA 4EZ7A 3BEGA 1B6CB 4FI1A 5IQHA 3EIDA 3MFTA 3FI3A 2BRMA 3VRZA 2JBPA 1GZOA 4X6QC 2XBAA 4BWPA 4X6RA 3AMAA 1JSVA 2C6IA 5K0XA 1PKGA 1ZOHA 3TV4A 3JYAA 3C0GA 1ZY4A 2VN9A 2BRNA 2JBOA 3OT3A 4ZZOA 5E8YA 5GJGA 2YISA 3VHKA 3D9VA 2WKMA 3OWKA 4PRJA 1H1PA 2UW8A 4AOJA 3TEIA 2GNGA 3BHYA 1H26A 5JEBA 4ANQA 1Q8ZA 3F3UA 5EQPA 4RIOA 3E88A 3QHRA 5C9CA 4YBKA 1REKA 2IZTA 3QRJA 3TM0A 3AD5A 4BCMA 3RMFA 5CF8A 4MBJA 1K3AA 3FPMA 1PXNA 2W4OA 3C0IA 2XNPA 3LMGA 3ULZA 3W2QA 4AAAA 3LMHA 3R9RA 5B2MA 4FUXA 2BPMA 2B9FA 2JIVA 3SAYA 3I7CA 3ZCLA 1XBAA 3BWJA 4XBUA 4HVSA 2XM8A 4FZAB 3W8QA 5AAEA 3C4FA 3VNTA 4FV5A 2BFXA 2PMOX 3Q52A 5ANGA 4IADA 5GHVA 3SXSA 5CAOA 5ETIA 2CGVA 5HVYA 2C6TA 1T46A 2OH4A 3HX4A 2QKRA 5FEEA 2ZOQA 4FOBA 4NU1A 4C2VA 5IH6A 4MNEB 4V04A 1OL6A 2OWBA 4DT9A 3QRTA 4FTJA 4ACGA 1Q41A 3EKKA 4DLJA 4HNFA 4AW5A 2W1EA 5AR2A 3OF0A 3DCVA 1SNXA 3GFWA 3JUHA 1WBTA 4NM3A 3KXNA 4FTLA 1F3MC 1YI6A 3O7LD 4DGGA 4FTCA 1Z57A 4RBLA 4AS0A 2IW8A 3K54A 3HGKA 4IFCA 2YFXA 3GC7A 3PA5A 2A2AA 2VTJA 2VTOA 2C6MA 2Q0NA 5ANIA 1FMOE 5AIRA 4NEUA 5CU6A 5IA3A 3EN4A 1KE7A 5GINE 2QOKA 2O5KA 5ETCA 4EK6A 3KXXA 5CNOA 4NM7A 4UXQA 3OCSA 5IA4A 2BHHA 3PVUA 4ACHA 2HXQA 1OUYA 3QAME 2WEVA 3HDNA 3F5XA 3KFAA 4GSBA 3QZFA 3HMMA 3NYXA 3PLAE 4AXAA 4FKTA 3ODYX 2QD9A 2H34A 4OTFA 3H0ZA 4IEBA 3PG3A 4RX9A 4YLLA 5IQGA 3G6GA 1WBOA 5L8KA 2R3FA 4I6QA 3OCBA 5AUYA 4J98A 1CKJA 2GSFA 1GNGA 3SRVA 5AUVA 2V7AA 1PMEA 3PJ1A 3D5WA 4GG7A 4TWCA 2H8HA 4EH5A 5AV3A 3HEGA 3MH3A 4IAAA 5T3QA 3VBWA 3WI6A 4QNAA 2C6DA 2DWBA 2E9PA 4EWQA 1KOBA 2Q83A 4XOZA 2ETRA 4ZJIA 1Y6BA 4FV2A 4JI9A 4A4XA 5IISA 4OR5A 5CQWA 5E91A 4E93A 2ETMA 2OIDA 2GHGA 3HRFA 3G15A 2HWPA 3THBA 3QC4A 3NVMB 3W55A 2ZV9A 3A8WA 2IVTA 4JG8A 1MP8A 4BKJA 5A54A 1OBDA 3C4XA 3EFLA 4NM5A 5ICPA 4JBQA 1H4LA 1M7NA 4R3PA 2R3GA 3A7JA 2Z60A 3O8PA 3QF9A 3N4VA 2A4LA 3FLQA 4M12A 1R3CA 3SD0A 3ZDIA 2WMXA 4IAIA 1PMVA 4CGAA 3OWJA 4RSSA 4HVHA 3FC2A 3DQWA 3QCXA 4RZVA 3FL5A 5TT7A 3FMNA 4WUAA 2R3KA 3RCDA 4D58A 1KSWA 2JC6A 3W2CA 1SVHA 3D94A 4CV8A 1IAJA 4YSJA 3A7FA 3O8UA 2B0QA 4FV1A 5KBRA 4YJPA 2GS6A 4ENYA 2BHEA 3ANQA 4CTCA 1UA2A 2NRUA 4GEOA 4WO5A 3PDTA 2ZVAA 5H9BA 4WD5A 5KE0A 2OXDA 2UUEA 3DKGA 4K2RA 3QU0A 3QD0A 3A2CA 4CCUA 2RG6A 3GCVA 5K0KA 2YWPA 4ALVA 5FGKA 2HIWA 3MJ2A 4U44A 4FE2A 3LQ3A 5K4IA 1XH5A 1YVJA 5KHWA 3V01A 4JQ7A 5JQ8A 4ALUA 4CCBA 3O17A 2JD5A 2ZV7A 4MYGA 5H3QA 4Z16A 5L2IA 4ANMA 1BL6A 3W10A 3P9JA 4HNIA 4C0TA 5BYLA 4K77A 4KIPA 3ET7A 4F9AA 4L8MA 3OXZA 3GOPA 4IANA 4GYIA 3EFWA 4X0MA 2PUUA 3LFFA 4C3FA 4D4VA 1I44A 1FINA 4BY9E 2XNNA 5FTGA 4N0SA 2IW6A 1YOMA 4ZMEA 5I9WA 3M42A 5LJJA 3D2IA 3DBFA 3UIXA 4PUZA 3SOAA 5KMJA 1YKRA 4I92A 3F7WA 3ZOSA 3ZUUA 5BX0A 3DZOA 1JOWB 4FTTA 4I0TA 5CQUA 4DH7A 5M4UA 5FRIA 3F66A 2C1AA 3RAWA 3PA3A 3AD6A 5HBEA 1OITA 2HZIA 5DE2A 2CJMA 2X8EA 4MHAA 4RQKA 4XRLA 4C34A 2WTJA 4USEA 5A4TA 3OEFX 3F3ZA 3RM6A 3FMLA 4FSYA 3EQRA 5AP4A 3UQCA 4BZNA 3FSFA 3TUDA 4PL4A 3RI1A 3VBQA 4QQ5A 2ZV8A 4FT9A 4HCVA 1IRKA 3ORPA 3PWYA 1IA9A 3QGWA 3WF9A 4D4RA 4IB3A 1S9IA 2C6EA 4LUDA 2YM4A 2JITA 1CSNA 3ETAA 3KRLA 4AA5A 2BZJA 1KWPA 4RVLA 4QYHA 3E5AA 3MTLA 1QL6A 2PUIA 5E8XA 5EW9A 3RNIA 4KD1A 4FGRA 3EN5A 3WYYA 3D14A 1U5QA 3TV7A 2GDOA 4J7BA 2G2FA 2OK1A 1VZOA 3OEZA 3R7YA 2R3NA 4F6WA 4QP3A 4C02A 2F7XE 2PPQA 2XEZA 4N70A 3GVUA 4EOLA 4CKRA 3R7OA 5HX6A 3MBLA 4ZP5A 3TG1A 4A9RA 4CKJA 2Z7LA 2XCKA 3FI4A 1UWHA 2X1NA 3OZ6A 3II5A 3V04A 2WTDA 4BI0A 3VRYA 1RJBA 1KOAA 2C3IB 5E90A 1JSTA 4FV0A 5GNKA 4UWYA 3BU3A 4HZSA 1XJDA 4QD6A 4EJ7A 5TF9A 2YM6A 1SZMA 2ERZE 1DI9A 3IQ7A 3HMNA 4JBVA 1P14A 5HI2A 4BCFA 5J79A 4DBNA 4A06A 5KKRC 4O0SA 3W2OA 4I23A 3KXHA 1LEWA 2J2IB 5I5ZA 2QOCA 2YWVA 3CPCA 3IOPA 1ZOGA 3T9IA 4DAWA 3NGAA 4GH2A 3UBDA 3R9DA 3HMIA 3FQEA 1WBVA 3HECA 4EUUA 3A4OX 4M3QA 4L45A 4BRXA 1DAYA 4TT7A 2B1PA 3CXWA 1ZYJA 4D28A 4RGJA 1OZ1A 4DHFA 3PE1A 2PVKA 4EOOA 3QQHA 5AX3A 4O0XA 3HRBA 4YMJA 3DPKA 1FQ1B 3KB7A 2DUVA 3HZTA 3R04A 4XOYA 1GZKA 3A99A 5IUHA 3NYNA 3PFQA 4XHKB 3RPOA 4P5QA 1A48A 1CKIA 2BIKB 2PHKA 4EONA 4FVRA 5CALA 3FMMA 1XH4A 4O83A 3DAKA 5IEXA 2OSCA 3QKMA 5FTOA 4C59A 2LGCA 3HNGA 2YDKA 3ZSHA 4R6VA 3B2TA 3GU5A 1LR4A 2IZRA 3NW6A 4LGDA 4GK2A 3OXTA 5DBXA 3NYVA 4JQ8A 1OUKA 3ZONA 4ACCA 2GNFA 3IDCA 4EWHA 5IQIA 2W1IA 4U6RA 4L43A 3Q4CA 3TT0A 4JOAA 4CLIA 5E8UA 5CF6A 3DLSA 4DCAA 1YI4A 1QPCA 2NP8A 2G9XA 2YJRA 4FIFA 3S4QA 4IACA 2X2MA 3K5VA 1U54A 2F7ZE 4GK3A 4K33A 4NJ3A 4RRVA 3S3IA 1U46A 4MX9A 1STCE 1V0OA 2F49A 3D7TB 3MVMA 4Q9ZA 4OBQA 3ROCA 2C5OA 2VO3A 2HW7A 3I5NA 5ANJA 3LCSA 3ZO4A 4F0FA 4HVIA 4KUJA 2FSMX 4F08A 3A7HA 3H30A 4I4EA 3F9NA 3SQQA 5DT0A 4IQ6A 4CYIA 4YJQA 1DAWA 3E63A 3DK6A 4JX7A 4C33A 2W05A 4M0ZA 4QMXA 5DRBA 2W0JA 5CSHA 2BZKB 3A62A 1ZWSA 2J4ZA 4I21A 4XH6A 3VUIA 3OROA 2X0GA 3HV6A 4HYIA 4NFNA 3GC0A 4XG8A 5IH5A 3NNXA 3RNYA 3H4JA 2OJIA 1Q62A 4OUCA 3G0EA 3TNWA 3CLYA 4BYJA 4BCNA 2W5AA 1ZOEA 2WQEA 2YM8A 2UVYA 2HOGA 4EOJA 2J0IA 3FKNA 3GBZA 3M11A 4I4FA 4QMOA 4E8AA 1IASA 3TZ7A 2QOIA 1QMZA 4YJRA 3KMWA 2XVDA 4FTAA 5ACKA 5KBQA 4O7YA 4UXLA 3QKKA 2GFSA 4XYFA 2X2KA 4NZWB 3IECA 2Z7RA 4FL3A 3AOXA 3DTWA 3S2PA 5AWMA 5JT2A 2VX1A 3GNIB 4PWNA 4RJ6A 3RINA 5FP5A 5KNJA 2XIXA 3MW1A 3PSCA 3ZBXA 4ZY4A 3SG8A 2JKKA 5M09A 1BMKA 2G2IA 2W1CA 3NUAA 2PZPA 4RIYB 4O27B 2YZAA 5AR5A 4HCTA 4RQVA 2ZDUA 4IMYA 5HIDA 3SXFA 3ZRMA 4HGTA 3QCYA 2XK7A 2ZMCA 4XEYA 5HE2A 2A19B 2F7EE 4WIHA 5IUIA 3UJGA 3NEWA 2J90A 4WRSA 4ZSLA 5CX9A 4X7QA 1MRVA 1H00A 1YDRE 2VRXA 4BN1A 1NVSA 1PMNA 4TRLA 1GIJA 2WELA 3RPVA 1V0PA 2BKKA 1E1XA 4RFZA 3OFMA 4XG9A 3DNEA 5KCVA 2R3PA 3POZA 2R4BA 3ULIA 3FZOA 4BTKA 2R3RA 3WILA 4BDAA 3EN7A 3IS5A 4C36A 4F6UA 5FTQA 4ACMA 2W7XA 2R3MA 4IIRA 3UOKA 5BYYA 1ZMWA 5CVGA 1OPKA 5M51A 1UKIA 4G9RA 3AC5A 3CKXA 3H0YA 2PE0A 2X7GA 3GGFA 4I5MA 4CFUA 2OF2A 5IG1A 3M2WA 4DEDA 1UKHA 2PMNX 1YOJA 1H25A 5DEWA 3MN3A 4IX4A 4TZRA 4QQJA 3ZZEA 5EG3A 1Q8TA 4QNYA 2ZM3A 3R30A 1W83A 3UIBA 5CEPA 3UVPA 3CR0A 4CZUA 5JZNA 4ZLYA 3FE3A 3TXOA 4AG8A 1OL7A 1J1BA 4E5WA 5IUGA 3H9FA 1XHAA 1REJA 4CLJA 2WTCA 3FZRA 4DG2E 2BZIB 3NIZA 5KZ0A 2XIZA 5HBJA 4Y5QA 5DYJA 2A1AB 2YERA 2YIRA 3BBTB 5F9EA 4XLVA 2W4KA 1UV5A 4DGOA 4ITJA 5HG7A 1NVQA 3L9LA 4BHNA 2C6KA 3VJNA 4AZTA 2CDZA 3F3VA 4FTRA 4OTQA 5HNGA 1GIHA 4O0RA 4R3RA 3D4QA 4PMSA 1XH6A 3L8VA 4PPCA 3GU7A 2WMVA 5HOAA 3PY3A 1FVTA 4LMNA 4GK4A 2UW6A 4EKKA 5I9ZA 2W1ZA 5ITAA 5EYDA 2OIQA 4C3RA 4RX5A 4H1JA 3Q5IA 3VUGA 4ITIA 2F4JA 2XZSA 4D2RA 5HIEA 2KULA 4YJOA 2IVVA 3DKOA 4FSMA 3ZLYA 4R8QA 4BHZA 4QQTA 3Q6UA 1H0VA 3P0MA 1OIYA 3CCNA 4BCIA 4E4NA 4BI2A 4QP2A 3LFNA 4AW0A 1QPEA 4BDCA 3CE3A 4KRDA 2Y4IC 4H58A 4IX5A 2B53A 3GEQA 3V5WA 2FO0A 4EOKA 3FMKA 4ID7A 5HESA 1GY3A 2VTTA 2ZMDA 2QOBA 4O0UA 4YU2A 3G6HA 5EKNA 3F5PA 4M66A 3FAAA 3PPKA 1H24A 2B54A 4C35A 2XNEA 3LFDA 4APPA 5AUWA 2WD1A 3P23A 5A4LA 1NT2A 4YGAA 1OECA 2QU5A 4XG3A 5HD4A 5HU9A 5JGDA 4O7NA 3PVBA 2R3HA 4UBAA 5FWKK 3DZQA 1KE5A 4M67A 3V5JA 3HP2A 1YOLA 4YTHA 4O86A 2UZNA 1Q3WA 5IQCA 4OAUC 3RAKA 4MD8E 3MTFA 1ZYCA 4DLIA 1YHWA 2ZB1A 4Y8DA 3F61A 1K9AA 3GU6A 2X8IA 3F6XA 4BDGA 3GCUA 2JKQA 5ANOA 3G9NA 5EYCA 4GKIA 3PVGA 3MVHA 3QBNA 5CWZA 1NA7A 4EEVA 2WMUA 3QTXA 3H10A 3I6UA 2XK6A 1YXVA 3LFAA 5AV2A 4ZTSA 3R0TA 2JDRA 3H9OA 3VIDA 2GPHA 3ZO1A 4CQEA 5DLSA 4F09A 3EFKA 2J50A 2R2PA 3VS1A 5M4IA 2QG7A 4JDKA 3RP9A 2E9VA 3KRXA 3NW7A 3EQPA 4IBMA 3IGOA 5FQDC 5EOBA 3UPXA 3UNKA 1OB3A 4QYYA 3KU2A 2OXYA 3ZFYA 3NPCA 3VW8A 5GIPE 4BCQA 2YM7A 3DDQA 4IB5A 5DR2A 2BAQA 4PL3A 4EL9A 4Z3VA 3QCSA 1R39A 5AIKA 4D2WA 5E8TA 2ZM4A 4ONAA 3KY2A 4NK9A 4JBOA 2CN5A 2XA4A 4M15A 4EQCA 3PSBA 2B4SB 4I6BA 4N6ZA 4I0SA 3UZPA 2XRWA 1OPLA 4S34A 3FMJA 3QYZA 5G6VA 2ITZA 2JGZA 3UODA 3V6SA 4D2TA 4RMZA 3FEGA 4LUEA 4DFXE 1W0XC 2DYLA 2UW0A 4BDIA 5C26A 3F3WA 2QODA 4QTCA 3TN8A 5F95A 5HE1A 1G8AA 3V8SA 1YWRA 4ANNA 4ANBA 2WFYA 4C58A 4EH9A 2OZAB 3FZTA 3LQ5A 3PA4A 4R7HA 5BMSA 2EVAA 3AG9A 3AQVA 1PXJA 4E73A 3P5KA 4FKVA 1MRUA 4K1BA 5BPYA 2OKRA 5LMBA 5A6OA 3BGPA 2EXCX 4FIEA 3LJ2A 3BHVA 3MPTA 4TYJA 5E8ZA 3TKIA 3P08A 3D15A 3L8XA 3TIZA 4KKHA 2WOUA 3ZXZA 3VUMA 5M44A 3GQLA 4HYHA 5B2LA 1W7HA 3ZU7A 2GQSA 4CMTA 3EHAA 4HGSA 5AUZA 4I20A 3DJ7A 2CNUA 4Q2AA 1M17A 1RDQE 4WNPA 1ZY5A 5TR6A 1GOLA 2IZSA 3SHEA 5C1QB 3EWHA 4CEGA 2YDJA 2XH5A 1FMKA 3ZHPC 3PVWA 4ANSA 5IDPA 4C37A 4ENXA 3E92A 4U81A 2XK9A 4KRCA 3RWQA 4X2GA 3LJ0A 3BYVA 2QVSE 2OIBA 2R7IA 2CLQA 4QMVA 3V51A 3DDPA 4I5CA 3KULB 3NUNA 4I0RA 4ACDA 5HNIX 4DA5A 2QI8A 2G2HA 2XP2A 2YABA 3RPRA 4EOQA 4E6CA 5L8LA 2CCHA 3PIYA 3QA8A 2VWXA 4X2FA 5E4HA 3K2LA 1JAMA 5KZIA 3OTUA 5IQEA 2RL5A 4O7RA 5LCKA 2OF4A 2WIHA 4USDA 4NW6A 2PU8A 3ZUTA 4R7BA 3CBLA 2QOQA 4XRJA 3QKLA 1URWA 5AAFA 4CTBA 4EK5A 4C4EA 4HPUE 3E7OA 3GC9A 4WKQA 4JJRA 2WU7A 3FMHA 2WTWA 2OGVA 3LFCA 4YO4A 1F0QA 1J7IA 1KUTA 4CNHA 2JDTA 5DH3A 4KAOA 2V55A 3ORKA 3QQKA 5AR7A 5C8MA 4ZTNA 2BZHB 2X7FA 3PIZA 2R3IA 4O2PA 5AR8A 3TCPA 3NZ0A 1Q5KA 3CPBA 4PNIA 3CGFA 1PW2A 5CI6A 5DGZA 2V0DA 5HCYA 4GT4A 4S33A 3VS3A 1G3NA 3AC1A 2RIOA 4JXFA 3Q5ZA 4JNWA 2Q0BA 4RVMA 1JNKA 3D0EA 2WQOA 4YZNA 2WMSA 5CT0A 4CRLA 4QOXA 4IAFA 1H27A 1B38A 4TYHB 2C5VA 4RIXA 4AZEA 3EL8A 1OL2A 4EUTA 2XKCA 4AFJA 5AP6A 1DM2A 3KF4A 1XKKA 4O38A 4D5HA 4LRKA 4K9YA 4E7WA 4O96A 2YDIA 4FVQA 4L53A 2R9SA 3GCPA 3R1NA 5C27A 4FNZA 1A06A 5L6WL 2CSNA 1LP4A 3VUHA 2X4FA 3A8XA 3SVVA 1JVPP 4AE6A 1YWVA 4CVAA 5J5TA 2FSTX 3H3CA 4AF3A 4O84A 3KCFA 5CF5A 4YJVA 2Z7SA 4YLKA 2F2CB 4C4GA 1XR1A 4G6OA 5FBNC 3R7VA 3MIYA 3R2YA 5JFSA 2BDWA 4EC9A 4Q9SA 2ACXA 2BUJA 4FKIA 4X21A 4CT2A 2HWOA 2UZVA 2GFCA 4S30A 3DXPA 1Y6AA 3FI8A 2RFNA 3P86A 3QZHA 1JKKA 3QXOA 4J1RA 4E1ZA 3NNUA 4G2FA 3D7TA 2X9EA 5C8KA 4IM2A 2PMLX 1ND4A 4FSUA 5CT7A 3EQFA 3ZM4A 4UN0C 5A4QA 5HO8A 4UMRA 4FA2A 5HQ0A 3AC4A 2VTNA 3LLAA 3PXYA 4MQ1A 4WG3A 2XIRA 4ALWA 2XB7A 4E20A 1H1SA 1Q8UA 2LAVA 1BI7A 3C9WA 5FEDA 2C68A 3MPAA 3O2MA 4O1PA 4R7IA 4P90A 3VJOA 2UVZA 5HTIA 4LG4A 3HUCA 4I24A 3SW7A 2C69A 3EMGA 3R8PA 3LM5A 4XP0A 2C1BA 3KXGA 3UYTA 5CU2A 3AMYA 5JK3A 3IW5A 4ERWA 4LI5A 4GRBA 4L52A 4D9UA 4FMQA 3ZMMA 4BL1A 3ATSA 1HOWA 3C5IA 1JKLA 3NCGA 4BTMA 3LFQA 3BHHA 4XUFA 2BCJA 1I09A 2C30A 3HDMA 4OTPA 2YN8A 3RAIA 5I4NA 4FZ7A 4QP8A 2ZV2A 4BWXA 3PWDA 1BYGA 2WO6A 1R0PA 4NTTA 4YJSA 1QCFA 4I22A 4UB7A 3V3VA 3VO3A 4FBXA 3NUSA 2I0VA 3EN9A 4TWOA 2VD5A 3DLZA 4BFMA 5TKDA 2H9VA 4II5A 4K6ZA 3O23A 4RJ7A 1XH7A 5FP6A 5F1ZA 4AZWA 3R02A 3TUBA 2UZWE 4BDHA 3EQHA 4DEEA 3Q6WA 4RIYA 5HTBA 2CLXA 1O6YA 4UX9A 4GFGA 4J95A 3LCTA 2C6LA 3KMUA 1PXPA 5E1EA 3FL4A 2UW3A 5EW3A 4HCUA 3PP0A 2QONA 1FOTA 3BLRA 4KS8A 4BB4A 3ELJA 5GZAA 3ZXTA 5HLPA 4FF8A 2X6DA 3GC8A 5CENA 3TJDA 4G31A 3LPBA 2C0IA 2ETKA 1XBCA 2YIQA 3L8SA 2OJ9A 3MPMA 4S31A 4RA5A 3Q9YA 3C7QA 4DEAA 4ZTLA 3EN6A 1PMUA 4PMTA 4OTRA 2R3JA 2JLDA 3IPHA 3NSZA 2VWWA 4YC3A 3I81A 3GU4A 2C3JA 3I0QA 2VZ6A 5BYZA 4CMUA 5BVFA 4BCKA 4CYJA 5KMIA 3TNHA 2P33A 1F5QA 3FC1X 3QUDA 3U8WA 4WSYA 4CT1A 5CXZA 4BCJA 2PL0A 1QPDA 2BROA 1RW8A 5J9YA 3LFSA 3MH1A 3QGYA 4EOSA 3KK8A 3PRIA 4TW9A 5IQDA 4EZ3A 4D4YA 5IZFA 3V8WA 4IDVA 4LOQA 2ITXA 5HO7A 3TZ8A 3W2PA 3ZZWA 4CRSA 4JR3A 5CEQA 2HW6A 3A7GA 3PY1A 3PXKA 1PXMA 3SC1A 3ZLWA 2I40A 5DG5A 5E92A 4BWKA 2P4IA 5HVJA 3D83A 3SKCA 3G33A 4X3JA 5DEYA 3TKUA 4V0GB 5M56A 3HV5A 5T6KA 2BKZA 3CKWA 2WNTA 5H8BA 4UALA 3FZSA 3HMOA 4FV9A 2WQMA 4W4XA 4GV1A 1GZ8A 4GU9A 3U4UA 5CVHA 5I9VA 5J5SA 4EHVA 2B9IA 4IZ7A 4FICA 5BUIA 3UZTA 4CZTA 5DWRA 3BLQA 2VNWA 4FTMA 2HCKA 4KIKB 4DH3A 2HELA 4BIBA 3QRUA 2YA9A 2QR7A 4XG4A 1AD5A 4Y73A 2QG5A 3JR1A 4IFGA 3ZBFA 5GZ8A 2QHMA 4D2SA 3MSSA 1OPJA 1WFCA 2WTIA 4PY1A 2BMCA 2QLUA 3AC2A 5J1WA 5CTPA 3E3BX 3IW4A 4FR4A 4L42A 2PUNA 4KBCA 3O50A 3OBGA 4W9XA 4NWMA 3RM7A 3C4WA 4EJNA 5LQFA 1YI3A 5JN2A 2R0IA 2WIPA 4IC7A 4GCJA 4BKYA 4HGLA 1YW2A 3VS5A 4ANLA 2BAJA 4KS7A 4Y85A 4PMMA 4R78A 3DFAA 4I93A 4FSNA 3ZS5A 4B9DA 4GVJA 4M0YA 3R00A 4H3QA 1AQ1A 4LL5A 2VX3A 3S1HA 3BPRA 1OI9A 1M2RA 2J5EA 3PTGA 3VBTA 4ZSJA 5AADA 2FVDA 5LVLA 1U5RA 3QA0A 3ZC5A 5LCJA 3Q9WA 4RWKA 3KQ7A 3L8PA 4FKJA 4JG6A 4B6LA 1LEZA 2BVAA 4PTGA 5CAPA 3CD3A 3ORNA 5BVEA 3AD4A 1SVEA 3OT8A 3DGKA 4PNKA 5AX9A 3G51A 2C3KA 5KUPA 2QO7A 4DT8A 1OIUA 4NM0A 4NKSA 3NNVA 1IA8A 3SV0A 4UMUA 1IR3A 1ZYLA 5JH6A 2XKEA 3ZDUA 5A6NA 5ANEA 4OBOA 3GB2A 2O64A 1A9UA 1SYKA 2YLFA 1XBBA 3IW7A 1L3RE 4NKAA 3RZFA 4E5BA 4CQGA 4L3LA 1UNGA 3GUBA 4MXXA 2VGOA 1W82A 3SXRA 4KWPA 3L9NA 5M55A 4ITHA 4OAVB 3UOHA 2J6MA 4RJ8A 5DT3A 5FM2A 3E3PA 2BIYA 2UZDA 2OU7A 1M2PA 3PYYA 5AP2A 2WMWA 5HEZA 4IB0A 3WE8A 5DFPA 2P3GX 3NAXA 4LM5A 3W8LA 3UQGA 5J9ZA 2ZB0A 1V1KA 3FKLA 2BALA 4MBIA 3QQGA 5DHJA 3E7VA 4RIWA 3WYXA 3BELA 2UW4A 4AX8A 3IDBA 5FBOA 3W16A 3D5XA 4R5YA 2W5HA 4DF3A 2BTSA 3LJ1A 3BGQA 3QHWA 3NCZA 2EWAA 3ALNA 4WUNA 5BNJA 4USFA 4IZAA 4IHPA 4QP4A 3GQIA 5D9HA 3LE6A 1ZLTA 3QQFA 2XKFA 1Q24A 4XG6A 5DOSA 2WU6A 4U41A 4O91A 3LFBA 1J7LA 4MXCA 3ENHA 4ZXTA 2W4JA 4G9CA 2PZ5A 3NYOA 3UGCA 2XF0A 1GZNA 5CASA 2VTMA 3OY3A 2OZAA 3DKCA 4DGLC 4FIGA 4DE4A 2EU9A 4JG7A 4F1TA 4AGCA 4HZRA 4G3GA 5AR4A 3QQJA 1OIRA 3V5QA 3QQLA 4FTIA 4J52A 2W5BA 3FMDA 4RC4A 4A9YA 3EQCA 3B8QA 1MRYA 5LVMA 4I5HA 3TI1A 3TNIA 4FG7A 1OBGA 3UMXA 5L3AA 3KRRA 4ZK5A 4LRMA 4QMNA 3DTCA 3RK9A 2H96A 5CZIA 5K9IA 2I0YA 3MA6A 4DTAA 3OW3A 4PV0A 4HOKA 4ZJJA 4IM0A 2P0CA 3CTHA 4F64A 3ORIA 4BYIA 1IEPA 1VEBA 2XBJA 5IPJA 3G2FA 3CC6A 2W99B 1LUFA 2RKUA 2HY81 4MWHA 4D1ZA 3LXKA 4F7SA 2CNQA 3QZGA 4J97A 4DFYA 3EH9A 3LCOA 4FT7A 3VUTA 1T45A 4BI1A 3KULA 3HV4A 4F7NA 1WZYA 4WG5A 2ITTA 4HGEA 5I9UA 5B0XA 1P5EA 5EI2A 5CVFA 3R8VA 5ANDA 3UG1A 3RK5A 5BVOA 3F3TA 3O0GA 2OO8X 4MCVA 3CQUA 4IWQA 3ITZA 5JMSA 5EK7A 3HL7A 2BRBA 2YIWA 4KKEA 1XH8A 2HENA 3DNDA 4TYIA 4RG0A 5AP0A 3UE4A 4TPTA 4DN5A 4OTHA 1WMKA 5B2KA 4C2WA 4YTFA 3S00A 2GNHA 3EJ1A 3Q53A 2J0MB 4G6LA 3L9MA 5LVOA 3HV7A 3OMVA 4FZFB 3LW0A 4E6DA 3OVVA 3F2AA 4ZSGA 2PVNA 1PXIA 5L4QA 2WPAA 2XJ2A 5ANKA 2V5QA 3COIA 3WE4A 2W96B 4O7ZA 4IWOA 2XNBA 3K5UA 1XH9A 3FXZA 4FK6A 4IAKA 3C0HA 3CTJA 1PY5A 4RX8A 2GQRA 5HD7A 2R64A 4H36A 4AA0A 2J7TA 4UZHA 4G6NA 4L7SA 5EKOA 5I9XA 4DYMA 2W1FA 4KSQA 1PF8A 5EM7A 3F5GA 5FLFA 2EB3A 5FXQA 2C5XA 2JFLA 1V0BA 4IW0A 3HYHA 3UNJA 3HKOA 2OW3A 4L44A 4JQEA 5TO8A 2IPXA 4EHEA 1BLXA 4WSQA 1Y8YA 5HG8A 3VS6A 4FEQA 3BHUA 3U55A 2VWIA 2VWZA 5EHLA 3UP2A 4AN2A 3R83A 3I1AA 4HYSA 4M97A 4RVKA 4WHZA 5AP5A 3TIYA 4O81A 3E8EA 3PSDA 3U4WA 3FY2A 4LYNA 1J3HA 1XWSA 4OTIA 2UZEA 2O2UA 3UTOA 4LGGA 4EQMA 3U51A 3B8RA 5LMKC 3D2KA 5L2TA 5CSPA 1BI8A 2VV9A 5DVRA 3LAUA 4XNEA 3V5LA 4YC8A 4C61A 3IONA 3CSVA 4QQCA 5C8NA 3SRVB 4OTGA 3G9LX 3KXZA 4NFMA 4YZBA 1WBSA 2E9NA 4UZDA 3TKHA 3ACKA 5A14A 1H07A 4P4CA 3FLNC 4DFNA 4D2PA 5EQYA 2X6EA 4O0WA 1UU9A 3BRBA 2W9ZB 4P2KA 2YCSA 5DA3A 2R3OA 4MNEA 3QQUA 4PF4A 4TNBA 4EK3A 5GIOE 4GJ3A 2JDVA 4FV7A 3BYUA 4XG7A 3C5UA 3LZBA 5EM8A 2UVXA 2X2LA 3R21A 2ITYA 2YITA 1OL5A 4U0IA 4E6QA 4EOPA 2NNWB 4BKZA 4ZMFA 2RSVA 4QMTA 3F5UA 4ZLZA 2V22A 4UV0A 3E8CA 2B7AA 4X3FB 1YXXA 3NS9A 5EHYA 3TTJA 4LMUA 4C4FA 4EH6A 5AP3A 4Q5HA 3EQGA 2JKMA 5HKMA 4FL2A 2VGPA 4DFZE 4EH8A 3DAJA 3P4KA 2SRCA 3QTZA 1FVRA 4R1YA 4AT3A 2CKPA 1ZAOA 3OTVA 2GNJA 3A4PA 2YHVA 3M1SA 1G5SA 3AT4A 4BBEA 4NYEA 1O9UA 4DG0E 1MQ4A 3CTQA 3R22A 1H08A 3PXRA 4A9SA 4RLKA 5K5XA 2OFUA 4D2VA 5LXMA 4EQUA 3O8TA 5EYMA 4I6FA 4TYGA 3E8DA 4GU6A 2W1DA 4QMYA 3KEXA 4TWNA 4UMPA 3V6RA 4JAIA 1VR2A 2GHLA 5CAUA 4Z7GA 2XNMA 4F6SA 3FY0A 4Q5EA 5CS6A 2ITNA 4M68A 4X2NA 2P2IA 4X3FC 5HHWA 3QX2A 4JVGA 1E9HA 3UIUA 5HG9A 3FV8A 3FLWA 3LXNA 2HK5A 4BDJA 2G01A 4GFOA 3U9CA 3JY9A 4DEBA 5IMEA 4ASZA 1W98A 4BGGA 5J7HA 3UO5A 3LXLA 4FIIA 4YZ9A 1SNUA 3P1AA 3VVHA 2RFDA 4CFXA 4OGRA 2JIIA 4O7LA 3GFEA 5IA0A 3QRIA 4JIAA 4KINA 3LLTA 4QPAA 3Q9ZA 2JAMA 2JFMA 5M08A 4EH7A 3W32A 5CZHA 3EB0A 4EBVA 2PSQA 4QRCA 3U87A 4DEHA 2BRHA 5FD2A 3UMWA 4G1WA 3BZ3A 5CI7A 3UC3A 3ZRKA 4FKPA 4YJUA 3VS7A 3B2WA 4CD0A 4DFUA 2C6OA 2PMIA 5BVDA 2IN6A 1HCKA 3H9RA 3AXWA 1H1RA 4GG5A 3W2RA 4PX6A 3R71A 5HZNA 3VC4A 4D1XA 1YXSA 5IEVA 5H8EA 2OXXA 2YJSA 4G5PA 4OW8A 3VS4A 3ZSGA 3IDPA 5EQEA 1RE8A 4L46A 4CMOA 3LKMA 1JKTA 1OGUA 3P78A 2FA2A 3OOMA 3QLGA 5AUTA 3BX5A 3FI2A 3GCSA 5JGAA 3L1SA 3NRMA 3F2NA 4DEGA 1H0WA 4RZWA 5HCXA 1B39A 4NW5A 2G1TA 2JDSA 3ZSIA 2VNYA 5L8JA 4J53A 3O51A 4JR7A 5K5NA 3OW4A 4YNEA 2ZYBA 3R28A 3FDNA 2OI4X 4ARKA 2AYPA 3LIJA 3FQSA 4H3PA 3E62A 4HVGA 4KIQA 3EYGA 2J0LA 3MFSA 4FGBA 4TNDA 5GJDA 5C01A 5HBHA 4E3CA 3Q2MA 4QMWA 5AA9A 5A4CA 4UEUA 4RJ4A 4F9WA 3PZEA 4ZTHA 3TV6A 3COHA 4KABA 1Z5MA 5HICA 4H3BA 3LHJA 1X8BA 4UWCA 3UP7A 1JBPE 1ZARA 2Y9QA 4EORA 3COKA 4K0YA 3CD8A 3PIXA 4U40A 4JRVA 5BVWA 4D9TA 3MV5A 4KIKA 1UWJA 4L6QA 4IVBA 3IO7A 1Q99A 5DR6A 2PE1A 4O7TA 4HVDA 3VBXA 1YHVA 3ANRA 3W33A 1BUHA 2VTRA 4AA4A 4UMQA 4I6HA 4RC3A 5HNBA 3UDBA 3LVPA 4BIDA 3VW6A 3OCTA 2IVSA 3BE9A 4FIJA 3RBWA 4Z7HA 1P2AA 3MJ1A 5DR9A 4F0IA 4YTCA 5FDPA 5EDPA 4YTIA 4RJ5A 1M2QA 1R0EA 2HZNA 3HLLA 2XYNA 2WMTA 5DIAA 2ERKA 4DTKA 2VWBA 4YR8A 2UZBA 4AFEA 4EOIA 4FKOA 4BDKA 5BUEA 5LOHA 4P5ZA 1UU8A 3O7LB 4IX6A 2BDFA 1S9JA 3T3VA 5EM6A 3PPZA 3WOWA 3RHXA 2UZOA 5E9EA 4PQNA 4XBRA 3PXZA 3W18A 5HIBA 4NUSA 4QTBA 4CFVA 4AP7A 4W4WA 4R77A 1Q61A 4AT5A 4KKGA 4GUBA 4AOTA 2OH0E 3SA0A 3ZFXA 1XQZA 3JXWA 3QUEA 3HUBA 4UYAA 3MWUA 4IVCA 4E5AX 4K11A 5CU3A 3SOCA 5J7BA 4NIFB 3LM0A 4IB1A 4MF1A 1AGWA 5GZ9A 3I5ZA 1WAKA 2GHMA 5EOLA 1FVVA 1Y57A 4C7TA 3OCGA 4F0GA 1L8TA 4QMZA 4O0YA 1YXUA 1ZYDA 2B55A 4TN6A 3VBVA 3FKOA 3DBDA 5DPVA 5AFVA 2IVUA 5CEKA 1JPAA 4KBAA 2CGUA 3R9NA 3ZC6A 4AUAA 5M53A 2AUHA 5LWNA 2PUPA 5L6PA 5EI6A 3AMBA 3HA6A 2XUUA 3WIGA 3QTIA 2OG8A 4FZDB 4MD9E 3TDWA 5FM3A 1OIQA 4J8MA 3TWJA 4YSMA 2J51A 2QO2A 3QCQA 4U8ZA 3DBQA 4U45A 4UWBA 4E4XA 4FEUA 4XV3A 4C4HA 5CXHA 3COMA 3FZPA 2VO7A 1Q3DA 3UYSA 5L2WA 1CM8A 1NXKA 3DJ5A 3MGYA 3I4BA 3R73A 1PXLA 1Y91A 1BKXA 2HAKA 3Q9XA 4MQ2A 2VWYA 3CJGA 3MFRA 4FTOA 5EI8A 5HCZA 4B99A 2P2HA 2YLEA 4QP6A 4BCPA 2REIA 1P4FA 3DFCB 3DY7A 5DMZA 4MAOA 4DINA 4M8TA 4O7VA 3E87A 2CGXA 2VTAA 1YHSA 1GAGA 3AC8A 3FYJX 3K3IA 4L01A 5DI1A 4WG4A 5EYKA 3OG7A 2XK4A 4KB8A 4RPVA 2VWUA 3FXWA 4YHTA 3CY3A 3E93A 4BTFA 4ZSAA 3ZO2A 3VUKA 4FX3A 3MH2A 5LMAA 2Z7QA 4L7FA 1UNLA 2GQGA 2XCHA 4IJ9A 3BV3A 2JKOA 2C3LA 3EYHA 3JVSA 4ZSEA 3EKNA 1M7QA 4ASXA 3KK9A 4A9TA 2XIYA 3IW8A 3FUPA 1OKVA 3D5VA 4D5KA 3REPA 4EH2A 2UW7A 4IDTA 2I0EA 5D11A 3KXMA 4CSVA 4E4MA 3R8LA 3E64A 1OKYA 4AZFA 3DKFA 3ORZA 3BV2A 2UW9A 1TVOA 4IAZA 4KBKA 3KL8A 4AGWA 4CV9A 4XLIA 3RCJA 4PDOA 4L3JA 3DK3A 4DBXA 3NWWA 3AGLA 4FTQA 4Y46A 4PMPA 1H01A 4TXCA 2OICA 3FSKA 3ACJA 3DAEA 4B0GA 2F9GA 4O6EA 3BIZA 5AM7A 4AU8A 3DU8A 2A0CX 4AE9A 2E2BA 4NSTA 2WMRA 5HU3A 3GU8A 4F9YA 2P55A 3V5TA 5HTCA 5IH4A 3SGCA 3OXIA 4FIHA 4QMUA 4C8BA 2B9JA 4O21A 3N4TA 4BVUA 4LFIA 1IAHA 2BDJA 1ZXEA 5JGBA 4L67A 2CKOA 3NAYA 3G90X 4MVFA 3L9PA 2BFYA 4ZTMA 4F7LA 4JDIA 4A4OA 2W06A 4EC8A 1G8SA 2QQ7A 3R9OA 3S0OA 4FEVA 3ODZX 1VYZA 3HAVA 5HE0A 3R7IA 4GFMA 4IZ5A 4RJ3A 4W9WA 1PJKA 3R9HA 5CAVA 1GJOA 4R1VA 4U80A 3TZ9A 5CAQA 4FKSA 3KRWA 4DEIA 3C13A 5EDQA 3TUCA 3Q4ZA 5LWMA 4D0XA 2YIXA 2WMBA 3U9NA 4U3ZA 4U43A 4G3EA 5AP7A 3F82A 3OWPA 2GS2A 1OMWA 4J71A 4M69B 5DRDA 4O0VA 3SDJA 4DH5A 2YIYA 5J1VA 4O7SA 5LMKA 2V62A 4XV9A 3GCQA 2EXEA 3I6WA 3MFUA 2I1MA 4U7ZA 1M14A 3P7CA 4L68A 3T8OA 4CFFA 4YJTA 3G0FA 4YPSA 1J7UA 4GKHA 2PVMA 4MEDA 5JFWA 3C51A 1JSUA 5CF4A 2R3QA 4QPSA 2YAKA 5DT4A 3ZUVA 2Y0AA 3QX4A 4FV6A 1JWHA 3DBEA 3NNWA 3QWJA 2IG7A 3AC3A 4RFYA 1YRPA 4DH1A 4QO9A 4BCGA 2PULA 3LFEA 3KN6A 1WVYA 2YCRA 3EZVA 3WF8A 4YHJA 2IO6A 4DGNA 5IEYA 3A60A 3CP9A 4FNYA 2OJGA 5EDRA 3RZBA 5CLPA 2WMQA 2GTMA 3RK7A 1JKSA 4XV1A 4DH8A 2WQBA 4NT4A 5F4NA 4CZYB 2X81A 3ROYA 1NVRA 4PPBA 4R3CA 5HO6A 5HE3A 5BVKA 4D4SA 1VJYA 4ZS0A 5IU2A 4YP8A 3FLZA 2Z02A 5D7VA 5AP1A 3VF8A 2HY0A 3DT1A 5J9LA 5L2SA 3U6JA 2WTVA 2UV2A 3RJCA 4BGQA 3RKBA 3FJQE 5IF1A 4OLIA 4RVTA 3BKBA 2XYUA 3BU6A 3ID6C 4G3FA 4IWPA 5K3YA 3R2BA 1CDKA 2O63A 4YJNA 5HLNA 1Y8GA 3KVWA 3ZFMA 2XEYA 3AGMA 4O2ZA 1PYEA 2Y6OA 3TTIA 3JY0A 4FL1A 3DOGA 4PP9A 2RFSA 4RWIA 3FLYA 2GU8A 5D10A 2ITOA 2ONLA 3PZHA 3WF7A 4WOVA 3UO4A 3OY1A 4FKUA 5L6OA 3D5UA 4FTUA 3DA6A 2VU3A 3BCEA 4X3FA 2Y8OA 3QTQA 3QD3A 1PHKA 4AACA 3QTWA 3ZYAA 3DB6A 3MB6A 2ITQA 4FV4A 5AMNA 4O22A 4QP1A 4U3YA 2AC5A 4BCHA 4YHFA 1UU7A 4CG8A 5I3OA 4CG9A 3U6HA 4DTBA 1EH4A 2E9OA 3AT3A 3G5DA 3UVQA 1ZMVA 3DJ6A 4CKIA 3A61A 2R3LA 1ERKA 4FKRA 5CSWA 3JPVA 3NMUF 5JFVA 5AR3A 3S95A 2JDOA 3QRKA 4OTDA 2NRYA 4BDEA 4MXYA 4FSRA 5A9UA 3Q4UA 5I3RA 4J8NA 4QMMA 5CNNA 4FYOA 5L2QA 2VX0A 5M57A 5TE0A 3WZUA 3MESA 3RWPA 3IG7A 1JQHA 1R78A 3MDYA 4LV5A 4MWIA 3QFVA 4IZYA 2W1GA 3BYMA 2BR1A 4BBMA 4F70A 5CU0A 3Q3BA 5HX8A 4AW1A 4BDDA 4XV2A 3BLHA 2C5YA 2YZLA 5BUJA 2PZYA 1M52A 5IA2A 3LCKA 4GW8A 5J87A 4FOCA 3DB8A 3OUKA 3R1YA 5JRSA 5E1SA 4L3PA 2NO3A 5C4LA 4PDPA 2CHLA 3PUPA 4EYMA 4F9CA 1CKPA 3OP5A 1H8FA 4FK3A 3UVRA 3UG2A 5HORA 5K4JA 3DV3A 3ZRLA 2GS7A 4FVPA 2ESMA 3OUNB 4ZLOA 4YZDA 5DNRA 3EQIA 2OFVA 3IGGA 3ORTA 4LGHA 5CU4A 1OL1A 2XK8A 4GIIA 4QP7A 5KX8A 2PK9A 2VTSA 4ZY6A 3OOGA 4U79A 3R7GA 4FKLA 3QC9A 3VQHA 1BX6A 4FG8A 3VN9A 4K8AA 2O8YA 4WRGA 2X39A 5CEIA 3QXPA 4ERKA 4N57A 3VULA 2DS1A 4EI4A 3NUPA 2X4ZA 3PXFA 5D7AA 1UVRA 3QLFA 4NCTC 2HXLA 2PVRA 2XKDA 2C0TA 3VQUA 3F88A 3TACA 3KVXA 2PY3A 3SW4A 1MQBA 3ATTA 3A7IA 4JDHA 3HRCA 3NR9A 5D1JA 3RHKA 3OS3A 4QTEA 5A3XA 1APME 3QTRA 3DXQA 4C4IA 3P79A 2WHBA 5M06A 4GS6A 4EKLA 3R7UA 1O6KA 3NUUA 5KKRB 4AGUA 4GYGA 2QOFA 3IW6A 4GIHA 5CSXA 1H28A 2CCIA 2QC6A 2XNGA 3PJ3A 4LV8A 4YZCA 4EZ5A 3WZDA 3PP1A 4F99A 4HYUA 3R8UA 4E4LA 5AA8A 4KA3A 3BBWA 4W8DA 4I1ZA 3NIEA 1KE6A 3LQ8A 3Q2JA 4GUEA 3LMIA 4RWJA 5LVNA 3EFJA 1NW1A 3EQBA 3NW5A 2WB8A 4B8LA 4F65A 3N51A 3EL7A 5HVKA 4QYEA 2BTRA 2W17A 2UZUE 3P7AA 4LOOA 4X2JA 4JIKA 5AV0A 5IQBA 1PKDA 4XG2A 5KMMA 1MUOA 3QZIA 3UZRA 2W1HA 1TKIA 2PVJA 4F63A 3DQXA 3KKVA 1CMKE 2CPKE 3I7BA 4QMSA 3CIKA 3OHTA 4GJ2A 4DITA 2XNOA 2A27A 2ITWA 4G5JA 4IAYA 4J99A 1Q4LA 5F94A 3ZH8A 4F1MA 5JSMA 3BE2A 3SLSA 2QKWB 4RFMA 4YLJA 1Z9XA 4DFLA 4FT3A 2QOOA 3PE2A 4H39A 2W9FB 4L00A 4LOPA 1YXTA 4QP9A 2R0UA 4WBOA 3UC4A 1YQJA 2CNVA 4D0WA 2J0JA 3I60A 4ORKA 3ZLXA 3U54A 4QTAA 3UOLA 5KHXA 3K3JA 4MXOA 1GIIA 4FT0A 5I9YA 2QOLA 4H1MA 4QMLA 2IZUA 4QMPA 4WNOA 4FODA 3N4UA 4U9AA 4Y95A 4BIEA 2IW9A 3TL8A
chains in the Genus database with same CATH superfamily
2C47A 4Y72A 3I79A 2ITUA 1SM2A 3CS9A 5FUTA 1XO2B 4RIXB 5KMNA 2OZOA 3WZKA 4BGHA 2QO9A 1JLUE 4NIFA 2FH9A 4MF0A 3BI6A 4JRNA 2BAKA 2F57A 2QCSA 4DGMA 2C4GA 2GNLA 1YDTE 2FUMA 3ENMA 1KV1A 1FPUA 1U4DA 3FXXA 4KSPA 3R8ZA 4C62A 2CMWA 2VWVA 4DFBA 5IKWA 4J96A 3ORMA 4X2KA 3WF6A 5CSVA 4EH4A 4JBPA 2FSLX 5G1XA 3TNQB 4FNWA 2ITVA 4BC6A 4E26A 4CFMA 1SVGA 5H2UA 4C4JA 2RG5A 5LVPA 3R1QA 1OKZA 3KCKA 3DS6A 3KRJA 4S2ZA 5C4KA 4JS8A 5BVNA 2GTNA 3NUYA 4M84A 3C4CA 5EM5A 3VWAA 3WARA 4HPTE 4YUQA 2Z2WA 2WZJA 1E1VA 1PRYA 3IOKA 1CTPE 2GNIA 2VTHA 3AT2A 4JT3A 2RGPA 2I6LA 5J8IA 3RALA 1J1CA 3RTPA 2Z8CA 4FYNA 4BZDA 3C1XA 2B52A 4WA9A 2CKQA 5LARA 4IH8A 2Y4PA 1FGIA 1Q8WA 3ZLSA 4EYJA 3GI3A 3MVJA 4OTWA 2PYWA 4FV3A 4FEWA 1TQPA 2PTKA 3HV3A 3MY5A 5E8SA 5T68A 5F20A 3PRFA 4YO6A 3QALE 3QL8A 4GT5A 2YM3A 3EZRA 4M13A 4U5JA 4BDBA 3KREA 1P4OA 3POOA 4FV8A 4I5PA 3PUFC 2VTQA 3MYGA 1WBNA 4QYGA 4RX7A 4B8MA 4Z9LA 3R8MA 3NUXA 1WBWA 2XS0A 1OVEA 2WMAA 4HJOA 3W1FA 2H6DA 3AKKA 4TYHA 4I41A 1URCA 3UOJA 3ALOA 4IVAA 4PPAA 5IQAA 3RGFA 3R01A 2ZDTA 3MVLA 2A98A 4ZY5A 5KMKA 3WIKA 5AJQA 3QD4A 4LDTA 3FQHA 3MB7A 4ZJVA 5KMLA 3R6XA 5CANA 3KN5A 3AKLA 3FLSA 4TKSA 2JEDA 2AC3A 4AZSA 2VTIA 2CN8A 4Y83A 4PDSA 4EK4A 4ZOGA 4GMYA 3RPSA 2XIKA 1PXKA 3HMPA 3GENA 4FT5A 5A4EA 2C0OA 4Y5HA 3PPJA 4G34A 1WVXA 2I0HA 3BHTA 3CY2A 5AM6A 5FXSA 5AV4A 5IQFA 4DCEA 5FG8A 5HG5A 5JFXA 4S32A 4NJDA 2NPQA 2QU6A 4RWLA 4G16A 4FG9A 2RF9A 3LXPA 4APCA 4BTJA 4EK8A 3O96A 4M14A 4KIOA 1FBNA 3TNPC 5AV1A 2YAAA 3WZJA 1U59A 5B7VA 4DG3E 1LPUA 5AEPA 2PWLA 4FEXA 5E7RA 5JRQA 4DC2A 2XMYA 4V01A 3N9XA 4I94A 2WOTA 4EOMA 2JIUA 3KGAA 4TY1A 3D7ZA 4W4YA 3R7EA 1W84A 2HZ0A 1PYXA 2RFEA 4G17A 4QDEA 1UNHA 3GXLA 4ASDA 4O7WA 5D12A 2VTLA 1IG1A 3MIAA 4AW2A 1H1WA 1ZMUA 2G15A 2XJ0A 4BBFA 4DHZA 4RLLA 5TOZA 3RPYA 3WZEA 5A46A 1Q8YA 4A4LA 4M69A 2FSOX 3ERKA 4G3DA 4JL9A 2CGWA 3F2RA 3TDVA 4W4VA 2B9HA 3V5PA 2PZIA 4U97A 2YCFA 4C57A 2ONLC 4YURA 3CGOA 3DK7A 3U6IA 4E6AA 3RAHA 4FKWA 4MH7A 3WBLA 2VO0A 2VUWA 3KC3A 2PVLA 3TZMA 4XCUA 4YC6A 2FGIA 2JAVA 4QPMA 2VTPA 3ORLA 4D55A 4N4SA 4JX3A 4IC8A 4LL0A 2Y4IB 2Y7JA 4BF2A 4IWDA 2IJMA 4OBPA 3MY1A 4YNOA 3BGZA 2XM9A 3DBCA 4BICA 1ATPE 4BCOA 4TL0A 3WF5A 3ZEPA 3FHIA 4MKCA 4EHGA 1WVWA 2UZLA 2WXVA 4MD7E 5CYIA 4FSTA 3PJ2A 4WNMA 5EFQA 4O82A 5E8WA 4CFNA 5AAGA 3C50A 4QT1A 4ZAUA 3UIMA 5KO1A 1G8JA 1H1QA 2X9FA 2F2UA 2VO6A 3VF9A 5FDXA 4AWIA 2GCDA 5CEMA 4AOIA 2QURA 1UU3A 3BYSA 3KMMA 2QNJA 1FGKA 4FTKA 4O1OA 3GP0A 1O6LA 1YDSE 3EQDA 4JAJA 4MNFA 5CY3A 1KE9A 5DN3A 3F69A 4YBJA 2WGJA 4KNBA 3QWKA 4A9UA 5M4FA 5HGIA 4IJPA 1DI8A 4FSWA 4A7CA 1VYWA 4NL0A 3BWFA 5IA5A 4MXAA 3VS2A 4TYEA 4MBLA 2J0KA 3HA8A 2FYSA 2QLQA 4IX3A 4RC2A 4NTSA 3MI9A 4O6LA 4XP2A 3VUDA 2R5TA 2PE2A 3MA3A 3MY0A 3O71A 4XX9A 4AQCA 4EH3A 3Q04A 5GJFA 3FZ1A 4CFWA 2YM5A 1PXOA 4N6YA 3VAPA 3ZTXA 2WTKB 3ZEWA 2IWIA 5IDNA 3NX8A 5JKGA 4V0GA 2Y6MA 4RT7A 3BEAA 1ZZLA 1WCCA 4XJ0A 2BRGA 3GT8A 3JS2A 4AN3A 1RQQA 4QYFA 4AGDA 4ZZNA 4QEBA 2EB2A 4PP7A 5JQ5A 3LOKA 5BQ0A 3BQCA 3EOCA 4LQMA 3QUPA 2C5NA 4JLCA 3LCDA 5FEQA 4AT4A 4FUYA 2OBJA 4FSZA 4UY9A 5M4CA 3PJCA 2DQ7X 4PL5A 3SX9A 4AN9A 4FC0A 4B7TA 3CEKA 4IXPA 5IA1A 4UYNA 4UMTA 3CQWA 2XRUA 1BL7A 3QTSA 4HW7A 5I0BA 4PDYA 4TWPA 4H05A 1WBPA 3UO6A 1Q97A 1OM1A 5EHOA 4V05A 4F4PA 4WNKA 4FZ6A 4BZOA 3PY0A 3OC1A 3UNZA 4L9IA 2XJ1A 4RIWB 2OJJA 2WTKC 3PG1A 3Q96A 4GL9A 2ZJWA 3KA0A 4IVDA 1J91A 3E8NA 4FNXA 5ACBC 2FB8A 3F7ZA 3HVCA 3ORXA 4PTCA 4B4LA 4BDFA 3BQRA 4NCTA 4C38A 1ZYSA 3QD2B 4XP3A 5AUUA 3V8TA 3VS0A 1OKWA 5CEOA 3UPZA 2X8DA 5JZJA 1QPJA 4OT5A 4BR3A 4EHZA 4ASEA 4NH1A 3VHEA 2BILB 5IMXA 4P7EA 4I3ZA 5EW8A 4G3CA 3PXQA 3QYWA 5EH0A 5C03A 2YCQA 3R63A 3FPQA 3RVGA 3UQFA 3P7BA 5ETAA 3BYOA 3BU5A 4MTAA 3FMEA 3C4EA 4W8EA 5H8GA 5BMMA 4ZTQA 4MK0A 4K18A 1R1WA 2OJFE 3ZM9A 2HYYA 4ZZMA 5D41A 4ANOA 1SMHA 1KV2A 2PZRA 2J9MA 4O0TA 4WBBB 4YZMA 2HZ4A 2IEWA 2WQNA 2QHNA 3T3UA 3ML1A 4MUQA 3TMOA 2VAGA 3CQEA 3QTUA 4O4FA 4TTHB 3ZO3A 2OLCA 3NLBA 2AQXA 2QR8A 1K2PA 3IKAA 4IM3A 4F7JA 4WT6A 4M7IA 4AZVA 3OWLA 3SG9A 2KTYA 3PLSA 2R7BA 3C4ZA 3W2SA 4A07A 2O3PA 2PVFA 2ZM1A 2EXMA 4GVAA 4F1OA 4ZEGA 5E8VA 2XK3A 3NDMA 4LRJA 4YPDA 4Z55A 5FXRA 4ZTRA 5AUXA 2I7QA 2XARA 2O0UA 3DXNA 4C3PA 3IK3A 2ITPA 1U54B 3MH0A 4CXAA 1ZZ2A 2EUFB 1YWNA 2E9UA 2PVYA 4FTNA 2YACA 1ZRZA 3R1SA 1TQMA 4XMOA 4R5SA 5J95A 1DS5A 1W8CA 4IE9A 3T9TA 3TJCA 3MS9A 2V7OA 4DHIB 3FWQA 3PJ8A 2WEIA 2J5FA 5M07A 3GOKA 4OT6A 4MXZA 2QOHA 4JDJA 3Q4TA 3KF7A 4QTDA 3FHRA 1NY3A 4QMQA 5KMOA 3OBJA 4XS2A 3JVRA 4AXFA 3FYKX 2YEXA 3I0OA 5HLWA 2O65A 1KE8A 2GMXA 4ZS4A 4U42A 2PVHA 3FBVA 3Q32A 2UZTA 1TQIA 4FKGA 4RA4A 3HAMA 4PTEA 3Q60A 3NVKI 2WAJA 3HP5A 3CJFA 4F9BA 4GT3A 3OD6X 4D1SA 1HCLA 4ZIMA 2UW5A 4FKQA 2CKEA 4EBWA 3VBYA 4FSQA 2X7OA 2ZAZA 5ETFA 4EZ7A 3BEGA 1B6CB 4FI1A 5IQHA 3EIDA 3MFTA 3FI3A 2BRMA 3VRZA 2JBPA 1GZOA 4X6QC 2XBAA 4BWPA 4X6RA 3AMAA 1JSVA 2C6IA 5K0XA 1PKGA 1ZOHA 3TV4A 3JYAA 3C0GA 1ZY4A 2VN9A 2BRNA 2JBOA 3OT3A 4ZZOA 5E8YA 5GJGA 2YISA 3VHKA 3D9VA 2WKMA 3OWKA 4PRJA 1H1PA 2UW8A 4AOJA 3TEIA 2GNGA 3BHYA 4AAYA 1H26A 5JEBA 4ANQA 1Q8ZA 3F3UA 5EQPA 2NYAA 4RIOA 3E88A 3QHRA 5C9CA 4YBKA 1REKA 2IZTA 3QRJA 3TM0A 3AD5A 4BCMA 3RMFA 5CF8A 4MBJA 1K3AA 3FPMA 1PXNA 2W4OA 3C0IA 2XNPA 1W2FA 3LMGA 3ULZA 3W2QA 4AAAA 3LMHA 5B2MA 3R9RA 4FUXA 2BPMA 2B9FA 2JIVA 3SAYA 3I7CA 3ZCLA 1XBAA 3BWJA 4XBUA 4HVSA 2XM8A 4FZAB 3W8QA 5AAEA 3C4FA 3VNTA 4FV5A 2BFXA 2PMOX 3Q52A 5ANGA 4IADA 5GHVA 3SXSA 5CAOA 5ETIA 2CGVA 3KIOC 5HVYA 2C6TA 1T46A 2OH4A 3HX4A 2QKRA 5FEEA 2ZOQA 4FOBA 4NU1A 4C2VA 5IH6A 4MNEB 4V04A 1OL6A 2OWBA 4DT9A 3QRTA 4FTJA 4ACGA 1Q41A 3EKKA 4DLJA 4HNFA 4AW5A 2W1EA 5AR2A 3OF0A 3DCVA 1SNXA 3BLAA 2X0PA 3GFWA 3JUHA 1WBTA 4NM3A 3KXNA 4FTLA 1F3MC 1YI6A 3O7LD 4DGGA 4FTCA 1Z57A 4RBLA 4AS0A 2IW8A 3K54A 3HGKA 4IFCA 2YFXA 3GC7A 3PA5A 2A2AA 2VTJA 2VTOA 2C6MA 2Q0NA 5ANIA 1FMOE 5AIRA 4NEUA 5CU6A 5IA3A 3EN4A 1KE7A 5GINE 2QOKA 2O5KA 5ETCA 4EK6A 3KXXA 5CNOA 4NM7A 4UXQA 3OCSA 5IA4A 2BHHA 3PVUA 4ACHA 2HXQA 1OUYA 3QAME 2WEVA 3HDNA 3F5XA 3KFAA 4GSBA 3QZFA 3HMMA 3NYXA 3PLAE 4AXAA 4FKTA 3ODYX 4DDIA 2QD9A 2H34A 4OTFA 3H0ZA 4IEBA 3PG3A 4RX9A 4YLLA 5IQGA 3G6GA 1WBOA 5L8KA 2R3FA 4I6QA 3OCBA 5AUYA 4J98A 1CKJA 2GSFA 1GNGA 3SRVA 5AUVA 2V7AA 1PMEA 3PJ1A 3D5WA 4GG7A 4TWCA 2H8HA 4EH5A 5AV3A 3HEGA 3MH3A 4IAAA 5T3QA 3VBWA 3WI6A 4QNAA 2C6DA 2DWBA 2E9PA 4EWQA 1KOBA 2Q83A 4XOZA 2ETRA 4ZJIA 1Y6BA 4FV2A 4JI9A 4A4XA 5IISA 4OR5A 5CQWA 5E91A 4E93A 2ETMA 2OIDA 2GHGA 3HRFA 3G15A 2HWPA 3THBA 3QC4A 3NVMB 3W55A 2ZV9A 3A8WA 2IVTA 4JG8A 1MP8A 4BKJA 5A54A 1OBDA 3C4XA 3EFLA 4NM5A 5ICPA 4JBQA 1H4LA 1M7NA 4R3PA 2R3GA 3A7JA 2Z60A 3O8PA 3QF9A 3N4VA 2A4LA 3FLQA 4M12A 1R3CA 3SD0A 3ZDIA 2WMXA 4IAIA 1PMVA 4CGAA 3OWJA 4RSSA 4HVHA 3FC2A 3DQWA 3QCXA 4RZVA 3FL5A 5TT7A 3FMNA 4WUAA 2R3KA 3RCDA 4D58A 1KSWA 2JC6A 3W2CA 1TZDA 1SVHA 3D94A 4CV8A 1IAJA 4YSJA 3A7FA 3O8UA 2B0QA 4FV1A 5KBRA 4YJPA 2GS6A 4ENYA 2BHEA 3ANQA 4CTCA 1UA2A 2NRUA 3UDTA 4GEOA 4WO5A 3PDTA 2ZVAA 5H9BA 4WD5A 5KE0A 2OXDA 2UUEA 3DKGA 4K2RA 3QU0A 3QD0A 3A2CA 4CCUA 2RG6A 3GCVA 5K0KA 2YWPA 4ALVA 5FGKA 2HIWA 3MJ2A 4U44A 4FE2A 3LQ3A 5K4IA 1XH5A 1YVJA 5KHWA 3V01A 4JQ7A 5JQ8A 4ALUA 4CCBA 3O17A 2JD5A 2ZV7A 4MYGA 5H3QA 4Z16A 5L2IA 4ANMA 1BL6A 3W10A 3P9JA 4HNIA 4C0TA 5BYLA 4K77A 4KIPA 3ET7A 4F9AA 4L8MA 3OXZA 3GOPA 4IANA 4GYIA 3EFWA 4X0MA 2PUUA 3LFFA 4C3FA 4D4VA 1I44A 2X0QA 1FINA 4BY9E 2XNNA 5FTGA 4N0SA 2IW6A 1YOMA 4ZMEA 5I9WA 3M42A 5LJJA 3D2IA 3DBFA 3UIXA 4PUZA 3SOAA 5KMJA 1YKRA 4I92A 3F7WA 3ZOSA 3ZUUA 5BX0A 3DZOA 1JOWB 4FTTA 4I0TA 5CQUA 4DH7A 5M4UA 5FRIA 3F66A 2C1AA 3RAWA 3PA3A 3AD6A 5HBEA 1OITA 2HZIA 5DE2A 2CJMA 2X8EA 4MHAA 4RQKA 4XRLA 4C34A 2WTJA 4USEA 5A4TA 3OEFX 3F3ZA 3RM6A 3FMLA 4FSYA 3EQRA 5AP4A 3UQCA 1VLRA 4BZNA 3FSFA 3TUDA 4PL4A 3RI1A 3VBQA 4QQ5A 2ZV8A 4FT9A 4HCVA 1IRKA 3ORPA 3PWYA 1IA9A 3QGWA 3WF9A 4D4RA 4IB3A 1S9IA 2C6EA 4LUDA 2YM4A 2JITA 1CSNA 3ETAA 3KRLA 4AA5A 2BZJA 1KWPA 4RVLA 4QYHA 3E5AA 3MTLA 1QL6A 2PUIA 5E8XA 5EW9A 3RNIA 4KD1A 4FGRA 3EN5A 3WYYA 3D14A 1U5QA 3TV7A 2GDOA 4J7BA 2G2FA 2OK1A 1VZOA 3OEZA 3R7YA 2R3NA 4F6WA 4QP3A 4C02A 2F7XE 2PPQA 2XEZA 4N70A 3GVUA 4EOLA 4CKRA 3R7OA 5HX6A 3MBLA 4ZP5A 3TG1A 4A9RA 4CKJA 2Z7LA 2XCKA 3FI4A 1UWHA 2X1NA 3OZ6A 3II5A 3V04A 2WTDA 4BI0A 3VRYA 1RJBA 1KOAA 2C3IB 5E90A 1JSTA 4FV0A 5GNKA 4UWYA 3BU3A 4HZSA 1XJDA 4QD6A 4EJ7A 5TF9A 2YM6A 4JMQA 1SZMA 2ERZE 1DI9A 3IQ7A 3HMNA 4JBVA 1P14A 5HI2A 4BCFA 5J79A 4DBNA 4A06A 5KKRC 4O0SA 3W2OA 4I23A 3KXHA 1LEWA 2J2IB 5I5ZA 2QOCA 2YWVA 3CPCA 3IOPA 1ZOGA 3T9IA 4DAWA 3NGAA 4GH2A 3UBDA 3R9DA 3HMIA 3FQEA 1WBVA 3HECA 4EUUA 3A4OX 4M3QA 4L45A 4BRXA 1DAYA 4TT7A 2B1PA 3CXWA 1ZYJA 4D28A 4RGJA 1OZ1A 4DHFA 2XAOA 4DDGA 3PE1A 2PVKA 4EOOA 3QQHA 5AX3A 4O0XA 3HRBA 4YMJA 3DPKA 1FQ1B 3KB7A 2DUVA 3HZTA 3R04A 4XOYA 1GZKA 3A99A 5IUHA 3NYNA 3PFQA 4XHKB 3RPOA 4P5QA 1A48A 1CKIA 3W0OA 2BIKB 2PHKA 4EONA 4FVRA 5CALA 3FMMA 1XH4A 4O83A 3DAKA 5IEXA 2OSCA 3W0RA 3QKMA 5FTOA 4C59A 2LGCA 2XAMA 3HNGA 2YDKA 3ZSHA 4R6VA 3B2TA 3GU5A 1LR4A 2IZRA 3NW6A 4LGDA 2AEGA 4FRFA 4GK2A 3OXTA 5DBXA 3NYVA 4JQ8A 1OUKA 3ZONA 4ACCA 2GNFA 3IDCA 4EWHA 5IQIA 4O4EA 2W1IA 4U6RA 4L43A 3Q4CA 3TT0A 4JOAA 4CLIA 5E8UA 5CF6A 3W0MA 3DLSA 4DCAA 1YI4A 1QPCA 2NP8A 2G9XA 2YJRA 4FIFA 3S4QA 4IACA 2X2MA 3K5VA 1U54A 2F7ZE 4GK3A 4K33A 4NJ3A 4RRVA 3S3IA 1U46A 4MX9A 1STCE 1V0OA 2F49A 3D7TB 3MVMA 4Q9ZA 4OBQA 3ROCA 2C5OA 2VO3A 2HW7A 3I5NA 5ANJA 3LCSA 3ZO4A 4F0FA 4HVIA 4FJVA 4KUJA 2FSMX 4F08A 3A7HA 3H30A 4I4EA 3F9NA 3SQQA 5DT0A 4IQ6A 4CYIA 4YJQA 1DAWA 3E63A 3DK6A 4JX7A 4C33A 2W05A 4M0ZA 4QMXA 5DRBA 2W0JA 5CSHA 2BZKB 3A62A 1ZWSA 2J4ZA 4I21A 4XH6A 3VUIA 3OROA 2X0GA 3HV6A 4HYIA 4NFNA 3GC0A 4XG8A 5IH5A 3NNXA 3RNYA 3H4JA 2OJIA 1Q62A 4OUCA 3G0EA 3TNWA 3CLYA 4BYJA 4BCNA 2W5AA 1ZOEA 2WQEA 2YM8A 2UVYA 2HOGA 4EOJA 2J0IA 3FKNA 3GBZA 3M11A 4I4FA 4QMOA 4E8AA 1IASA 3TZ7A 2QOIA 1QMZA 4YJRA 3KMWA 2XVDA 4FTAA 5ACKA 5KBQA 4O7YA 4UXLA 1W2DA 3QKKA 2GFSA 4XYFA 2X2KA 4NZWB 3IECA 2Z7RA 4FL3A 3AOXA 3DTWA 3S2PA 5AWMA 5JT2A 2VX1A 3GNIB 4PWNA 4RJ6A 3RINA 5FP5A 5KNJA 2XIXA 3MW1A 3PSCA 3ZBXA 4ZY4A 3SG8A 2JKKA 5M09A 1BMKA 2G2IA 2W1CA 3NUAA 2PZPA 4RIYB 4O27B 2YZAA 5AR5A 4HCTA 4RQVA 2ZDUA 4IMYA 5HIDA 3SXFA 3ZRMA 4HGTA 3QCYA 2XK7A 2ZMCA 4XEYA 5HE2A 2A19B 2F7EE 4WIHA 5IUIA 3UJGA 3NEWA 2J90A 4WRSA 4ZSLA 5CX9A 4X7QA 1MRVA 1H00A 1YDRE 2VRXA 4BN1A 1NVSA 1PMNA 4TRLA 1GIJA 2WELA 3RPVA 1V0PA 2BKKA 1E1XA 4RFZA 3OFMA 4XG9A 3DNEA 5KCVA 2R3PA 3POZA 2R4BA 3ULIA 3FZOA 4BTKA 2R3RA 3WILA 4BDAA 3EN7A 3IS5A 4C36A 4F6UA 5FTQA 4ACMA 2W7XA 2R3MA 4IIRA 3UOKA 5BYYA 1ZMWA 5CVGA 1OPKA 5M51A 1UKIA 4G9RA 3AC5A 3CKXA 3H0YA 2PE0A 2X7GA 3GGFA 4I5MA 4CFUA 2OF2A 5IG1A 3M2WA 4DEDA 1UKHA 2PMNX 1YOJA 1H25A 5DEWA 3MN3A 4IX4A 4TZRA 3TYKA 4QQJA 3ZZEA 5EG3A 1Q8TA 4QNYA 2ZM3A 3R30A 1W83A 3UIBA 5CEPA 3UVPA 3CR0A 4CZUA 5JZNA 4ZLYA 3FE3A 3TXOA 4AG8A 1OL7A 1J1BA 4E5WA 5IUGA 3H9FA 1XHAA 1REJA 4CLJA 2WTCA 3FZRA 4DG2E 2BZIB 3NIZA 5KZ0A 2XIZA 5HBJA 4Y5QA 5DYJA 2A1AB 2YERA 2YIRA 3BBTB 5F9EA 4XLVA 2W4KA 1UV5A 4DGOA 4ITJA 5HG7A 1NVQA 3L9LA 4BHNA 2C6KA 3VJNA 4AZTA 2CDZA 3F3VA 4FTRA 4OTQA 5HNGA 1GIHA 4O0RA 4R3RA 3D4QA 4PMSA 1XH6A 3L8VA 4PPCA 3GU7A 2WMVA 5HOAA 3PY3A 1FVTA 4LMNA 4GK4A 2UW6A 4EKKA 5I9ZA 2W1ZA 5ITAA 5EYDA 2OIQA 4C3RA 4RX5A 4H1JA 3Q5IA 3VUGA 4ITIA 2F4JA 2XZSA 4D2RA 5HIEA 2KULA 4YJOA 2IVVA 3DKOA 4FSMA 3ZLYA 4R8QA 4BHZA 4QQTA 3Q6UA 1H0VA 3P0MA 1OIYA 3CCNA 4BCIA 4E4NA 4BI2A 4QP2A 3LFNA 4AW0A 1QPEA 4BDCA 3CE3A 4KRDA 2Y4IC 4H58A 4IX5A 2B53A 3GEQA 3V5WA 2FO0A 4EOKA 3FMKA 4ID7A 5HESA 1GY3A 2VTTA 2ZMDA 2QOBA 4O0UA 4YU2A 3G6HA 5EKNA 3F5PA 4M66A 3FAAA 3PPKA 1XMMA 1H24A 2B54A 4C35A 2XNEA 3LFDA 4APPA 5AUWA 2WD1A 3P23A 5A4LA 1NT2A 4YGAA 4AXCA 1OECA 2QU5A 4XG3A 5HD4A 5HU9A 5JGDA 4O7NA 3PVBA 2R3HA 4UBAA 5FWKK 3DZQA 1KE5A 4M67A 3V5JA 3HP2A 1YOLA 4YTHA 4O86A 2UZNA 1Q3WA 5IQCA 4OAUC 3RAKA 4MD8E 3MTFA 1ZYCA 4DLIA 1YHWA 2ZB1A 4Y8DA 3F61A 1K9AA 3GU6A 2X8IA 3F6XA 4BDGA 3GCUA 2JKQA 5ANOA 3G9NA 5EYCA 4GKIA 3PVGA 3MVHA 3QBNA 5CWZA 1NA7A 4EEVA 2WMUA 3QTXA 3H10A 3I6UA 2XK6A 1YXVA 3LFAA 5AV2A 4ZTSA 3R0TA 2JDRA 3H9OA 3VIDA 2GPHA 3ZO1A 4CQEA 5DLSA 4F09A 3EFKA 2J50A 2R2PA 3VS1A 5M4IA 2QG7A 4JDKA 3RP9A 2E9VA 3KRXA 3NW7A 3EQPA 4IBMA 3IGOA 5FQDC 5EOBA 3UPXA 3UNKA 1OB3A 4QYYA 3KU2A 2OXYA 3ZFYA 3NPCA 3VW8A 5GIPE 4BCQA 2YM7A 3DDQA 4IB5A 5DR2A 2BAQA 4PL3A 4EL9A 4Z3VA 3QCSA 1R39A 5AIKA 4D2WA 5E8TA 2ZM4A 4ONAA 3KY2A 4NK9A 4JBOA 2CN5A 2XA4A 4M15A 4EQCA 3PSBA 2B4SB 4I6BA 4N6ZA 4I0SA 3UZPA 2XRWA 1OPLA 4S34A 3FMJA 3QYZA 5G6VA 2ITZA 2JGZA 3UODA 3V6SA 4D2TA 4RMZA 3FEGA 4LUEA 4DFXE 1W0XC 2DYLA 2UW0A 4BDIA 5C26A 3F3WA 2QODA 4QTCA 3TN8A 5F95A 5HE1A 3NFFB 1OGYA 1G8AA 3V8SA 1YWRA 4ANNA 4ANBA 2WFYA 4C58A 4EH9A 2OZAB 3FZTA 3LQ5A 3PA4A 4R7HA 5BMSA 2EVAA 3AG9A 3AQVA 1PXJA 4E73A 3P5KA 4FKVA 1MRUA 4K1BA 5BPYA 2OKRA 5LMBA 5A6OA 3BGPA 2EXCX 4FIEA 3LJ2A 3BHVA 3MPTA 4TYJA 5E8ZA 3TKIA 4BJJB 3P08A 3D15A 3L8XA 3TIZA 4KKHA 2WOUA 3ZXZA 3VUMA 5M44A 3GQLA 4HYHA 5B2LA 1W7HA 3ZU7A 2GQSA 4CMTA 3EHAA 4HGSA 5AUZA 4I20A 3DJ7A 2CNUA 4Q2AA 1M17A 1RDQE 4WNPA 1ZY5A 5TR6A 1GOLA 2IZSA 3SHEA 5C1QB 2ZFYA 3EWHA 4CEGA 2YDJA 2XH5A 1FMKA 3ZHPC 3PVWA 4ANSA 5IDPA 4C37A 4ENXA 3E92A 4U81A 2XK9A 4KRCA 3RWQA 4X2GA 3LJ0A 3BYVA 2QVSE 2OIBA 2R7IA 2CLQA 4QMVA 3V51A 3DDPA 4I5CA 3KULB 3NUNA 4I0RA 4ACDA 5HNIX 4DA5A 2QI8A 2G2HA 2XP2A 2YABA 3RPRA 4EOQA 4E6CA 5L8LA 2CCHA 3PIYA 3QA8A 2VWXA 4X2FA 5E4HA 3K2LA 1JAMA 5KZIA 3OTUA 5IQEA 2RL5A 4O7RA 5LCKA 2OF4A 2WIHA 4USDA 4NW6A 2PU8A 3ZUTA 4R7BA 3CBLA 2QOQA 4XRJA 3QKLA 1URWA 5AAFA 4CTBA 4EK5A 4C4EA 4HPUE 3E7OA 3GC9A 4WKQA 4JJRA 2WU7A 3FMHA 2WTWA 2OGVA 3LFCA 4YO4A 1F0QA 1J7IA 1KUTA 4CNHA 2JDTA 5DH3A 4KAOA 2V55A 3ORKA 3QQKA 5AR7A 5C8MA 4ZTNA 2BZHB 2X7FA 3PIZA 2R3IA 4O2PA 5AR8A 3TCPA 3NZ0A 1Q5KA 3CPBA 4PNIA 3CGFA 1PW2A 5CI6A 5DGZA 2V0DA 5HCYA 4GT4A 4S33A 3VS3A 4I6LA 1G3NA 3AC1A 2RIOA 4JXFA 3Q5ZA 4JNWA 2Q0BA 4RVMA 1JNKA