4AACA

P38alpha map kinase bound to cmpd 29
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
355
structure length
350
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNILTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Discovery of N-Cyclopropyl-4-Methyl-3-[6--(4-Methylpiperazin-1-Yl-4-Oxoquinazolin-3(4H)-Yl]Benzamide (Azd6703), a Clinical P38Alpha Map Kinase Inhibitor for the Treatment of Inflammatory Diseases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
total genus 105
structure length 350
sequence length 355
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4aacA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aacA01
3ORIA 1E1XA 2QKWB 3W2SA 2BFYA 4C0TA 3QWJA 3PZEA 2XKFA 1LP4A 4LOOA 5ETFA 4JDHA 5IU2A 2JDTA 3BGQA 3SOCA 4I5PA 5AIRA 5HGIA 2NO3A 3GBZA 3FZ1A 3ZUUA 3PVGA 4FIJA 2W1HA 4D2PA 1JSUA 3FLNC 3VUMA 4C3FA 5JGBA 4RWIA 5E8YA 1OPKA 4JBVA 3MI9A 1E9HA 1Y8GA 2R7BA 2QQ7A 4HCUA 4HYHA 5HG8A 3IONA 4O7WA 5LVPA 5IDNA 3W2RA 3FL4A 4CYIA 3RCJA 5F9EA 3O7LB 4NK9A 4XOYA 2C68A 3DK3A 1OKZA 4F70A 2BRMA 3U51A 4V04A 4A4XA 3UPXA 2BMCA 1W8CA 3CGOA 5CI7A 2C6LA 3RK5A 4GG7A 5FXRA 1WFCA 3UBDA 4DFYA 4ERKA 3DXNA 4DHFA 4YUQA 4IX5A 3R2BA 1MUOA 1JBPE 1PYEA 2IG7A 1P4OA 4PL5A 5JQ5A 3O51A 3JPVA 3RWPA 2OH4A 3ITZA 4G9RA 2HWPA 1Q8YA 3MY5A 4FZAB 4NUSA 4YTIA 4M12A 3T9TA 4J7BA 4AACA 5CAPA 4E8AA 4WRGA 4W4XA 4C4JA 4FTMA 4I1ZA 4K8AA 3E8NA 4CLJA 3UJGA 3K3IA 4G6LA 2PZRA 4O91A 3SC1A 3PJ8A 5BPYA 2CCHA 2VO6A 3QC4A 5TT7A 4CKRA 3R1QA 3ZBFA 2DS1A 5GJDA 4EK4A 1QL6A 3ALNA 3LCKA 2GPHA 5HCXA 3LXPA 4E7WA 4FV1A 5K9IA 2Z02A 3RTPA 3QA8A 5H9BA 2C6TA 3WYYA 4AGUA 4D2RA 4YJOA 1J1BA 3KREA 4GKIA 3EYHA 3E8DA 3Q6UA 4FG7A 3PLSA 4RC2A 3H9FA 3FC2A 3A62A 3VS1A 2W4JA 2Z7QA 4HGSA 2OU7A 4G3GA 4L52A 3O50A 3CP9A 5AP2A 5EFQA 1YOLA 4BCFA 5JEBA 3NLBA 3U6HA 5IQBA 4A07A 4B6LA 3QTUA 5EDQA 1M52A 3ORZA 4Y46A 5AP3A 3KMUA 5KMMA 5L4QA 4C34A 3ANRA 2BKKA 3ZSIA 3WYXA 2UZOA 5BVDA 3BWFA 4KIPA 3IW8A 3P9JA 4ZTHA 4QTEA 3FL5A 1OI9A 5JMSA 4GEOA 5ETCA 2HZIA 4KIQA 4RIWB 3PPZA 1ZYDA 3LXKA 3OD6X 4U80A 4GK3A 4KWPA 1WVYA 4NM5A 2LAVA 4FNZA 4F09A 1FQ1B 4XG7A 3VS3A 5EM5A 3VUDA 3GC7A 2PPQA 1WBOA 5EOBA 3CY2A 3WI6A 5LMKA 3EQPA 3BBWA 4WNKA 1W83A 2QODA 3PIZA 4XP2A 1KUTA 2RG6A 1UKHA 3H30A 1OL2A 1MQ4A 4YO6A 5LVOA 2PVFA 4J8MA 4EH6A 2R3HA 5HX6A 4RWJA 1Q41A 3GQIA 3MA6A 1PXPA 3EL7A 5DG5A 3L9NA 5HO8A 4C62A 3FZTA 5CVGA 3RKBA 4DH3A 3K54A 4CFVA 3RINA 4BCIA 3HMPA 3MTLA 3P86A 4G6NA 2VD5A 3EQHA 5CU4A 3NYNA 2QVSE 2WELA 2XRUA 5KCVA 5EHOA 4Q2AA 3TN8A 4BTJA 1RJBA 4PP7A 5LWNA 4ITHA 3Q4ZA 4AFEA 1I44A 4WRSA 5E9EA 3Q4UA 4D4RA 3R00A 3R7VA 5AR2A 2JBOA 3REPA 3MSSA 5FM2A 3I5NA 5DMZA 4AT4A 1Q61A 4XYFA 2RFEA 1OUKA 1Q3DA 2W06A 3QD4A 4ZTLA 5GJFA 3I4BA 4FEWA 2CJMA 5DT0A 3BEGA 3P23A 3T9IA 3VF9A 3QCSA 5DGZA 4M3QA 5AM7A 4AGCA 2YWPA 2FSTX 4O83A 4QTCA 3V5TA 4AW5A 5GINE 3HV4A 3BHHA 1R3CA 2UV2A 4BWPA 4LRJA 3FMMA 3P79A 5HHWA 4F6WA 3KL8A 2YIYA 4YSMA 1ZMVA 2W1EA 4CTBA 3F2AA 3CCNA 4M66A 4E1ZA 2J51A 4DEIA 4ZZOA 5AAEA 4X3FA 3KRJA 4FA2A 1WAKA 4RFMA 1UVRA 3ALOA 3O17A 4D5KA 3O71A 2WMWA 2YCQA 3FZRA 1FVRA 2C0TA 2VV9A 3DV3A 3OBJA 4FZDB 4QMPA 5E92A 1GAGA 4PPBA 4C38A 3FY0A 3PPJA 4DEGA 2C5OA 3QQKA 2ITYA 5HO7A 3VQHA 3OMVA 2PU8A 5KMLA 2X2MA 3CLYA 2G2HA 2R3OA 3F88A 3JY0A 3OT8A 4QMXA 5HICA 1O6LA 5DR2A 4ASEA 4Y95A 2CNVA 4EOIA 5HG9A 3DPKA 4GMYA 4IAYA 3ZOSA 4CVAA 3TT0A 5CAUA 2UZWE 4IACA 2PZ5A 3R8PA 3UG2A 3VW6A 4JDIA 3GT8A 4Q9ZA 5IUHA 2FSLX 4AS0A 4FZFB 4TTHB 2B9HA 4BYIA 5KHXA 3QRUA 4FSTA 2X7FA 4IAAA 4RX9A 4CFNA 4M69A 4BDDA 4DEDA 3IGGA 4ACCA 3ZDUA 1APME 2QOBA 3HRCA 4BCNA 3VHEA 3NUXA 2XBJA 2X0GA 4RIXB 4C4IA 3RAWA 3OXZA 4FTTA 4KIKA 3Q2JA 3MFSA 4HZRA 1SYKA 2BRHA 2UVXA 1WVWA 3BQRA 3OG7A 4JRVA 4O96A 2GDOA 4YLLA 3D7ZA 3C50A 5DEWA 1H01A 4IZYA 2YZLA 3TM0A 5HE1A 4ZLOA 4F0GA 5IQFA 2GHMA 5CNOA 4NH1A 4DCEA 3C4FA 4FTIA 3Q52A 2OZOA 4RIXA 5KMNA 2OXXA 2XP2A 2RGPA 3DFAA 3R7EA 1OBGA 2BZIB 2WMQA 3E7VA 4M97A 4P2KA 3HA6A 5L2IA 1PJKA 1H28A 3LLTA 2XK4A 2WTCA 3II5A 2A1AB 3B2WA 3NSZA 4HVSA 4QP3A 1NVRA 2F4JA 2XNGA 3QYWA 3POOA 3QQGA 5JZNA 2F49A 3THBA 4TPTA 5CX9A 4CV8A 4AUAA 3BZ3A 3A7HA 3G90X 5HE3A 4FNYA 4O0RA 4FIEA 4PQNA 3SG8A 3V8TA 4WHZA 4YJTA 3CTQA 4JG7A 4FKWA 1M2QA 5EQEA 3PXQA 4EUUA 4F9CA 1W84A 3D14A 2JC6A 1WBPA 3PJCA 1YHWA 4AU8A 4K77A 2IVSA 3Q5IA 1NY3A 5J79A 4FKOA 4BN1A 2ITXA 5CF4A 4HYUA 2J2IB 3F5XA 1TQPA 5KKRB 3UP2A 5CZIA 5BYLA 2VTPA 2WMBA 3W8QA 3L9MA 3LFSA 3KF4A 4M7IA 4ASXA 1GZOA 4EI4A 1CTPE 2FA2A 4DFXE 5IUGA 5L6OA 2NRYA 4MQ1A 3N51A 4DG2E 4PV0A 2A27A 2B9IA 3UTOA 4Q5HA 4I92A 4AXAA 3EZRA 4EWQA 2P2HA 2RF9A 4HOKA 5IQIA 2W1GA 5TE0A 3QFVA 3PA4A 4YZCA 1H00A 3UIMA 3ZFMA 5H8BA 4D55A 3ID6C 4IFGA 5L8KA 4LG4A 5IPJA 3ETAA 3E64A 5IA0A 3QGYA 4GRBA 4U7ZA 1OIQA 1ERKA 5C26A 1ND4A 2R3GA 3BV3A 4DGNA 4DH7A 5BVOA 3M2WA 4FVPA 4P4CA 4IW0A 2WEVA 2KULA 4LMNA 3W1FA 4NL0A 5FWKK 3K5VA 4YBKA 4F7JA 3CJFA 4RVKA 4XNEA 3F2RA 2C1BA 3KRWA 5CTPA 3L8VA 3PG3A 2J7TA 4FYOA 1X8BA 2W96B 3GU8A 4K2RA 4ZSGA 4QD6A 4HVDA 4CKJA 5IZFA 2ITZA 5DNRA 2R64A 4GYIA 1WBSA 2XNOA 4RQKA 3IKAA 4JI9A 5C01A 1PHKA 4I0TA 4BC6A 4U43A 2A19B 1H1PA 4BDFA 4AW1A 2WAJA 2HY81 4MKCA 2BIYA 4BICA 5J9LA 4FTRA 5CI6A 4ID7A 3NNXA 4G5PA 3H10A 4C59A 4V0GB 4R3PA 3KXZA 3PE1A 5AP7A 4G1WA 4CMUA 2J50A 3EFLA 3FZOA 3CQWA 3OCTA 3AC4A 4IVCA 4S33A 2WTIA 2I6LA 3PLAE 3QKKA 4NZWB 3PRIA 4OT5A 2JDRA 1M14A 4YHTA 4MD7E 4BR3A 3TJCA 4FEVA 1B6CB 1Z57A 4FL2A 1OGUA 3CIKA 1YOMA 4FG8A 5AV4A 3S00A 4ZSAA 3SW4A 4TYJA 3SKCA 3A7GA 2GHLA 2PHKA 2YIWA 4RLLA 4BZNA 4F9BA 2XJ1A 2C6KA 3LE6A 1ZY5A 3MDYA 3ZFYA 5CSPA 4GIHA 5A3XA 3RHKA 5HG5A 2WPAA 1Q5KA 5AEPA 3OWJA 3G51A 4IM3A 4J8NA 3TI1A 3KC3A 5EYCA 5LVLA 4TWCA 2W5AA 3QYZA 5BVKA 5HE0A 1K2PA 3GFWA 1MP8A 2W4OA 3MVMA 3LFEA 2JIUA 2V22A 1R39A 3RPOA 4DTAA 4NFNA 3O2MA 3NS9A 2JDOA 1A06A 2UW6A 2GFCA 4FIIA 4L9IA 3VVHA 3RVGA 2VTOA 1OIYA 4E5BA 2R3QA 4UMQA 4ZSLA 2RFNA 5GZ9A 5D9HA 2X8EA 3RALA 2BALA 4DLJA 5LMAA 2JIVA 4BWKA 4YHFA 4X2NA 5L2SA 1LEZA 2QOQA 2WMUA 3Q53A 4MQ2A 3WF5A 4KSQA 3ZTXA 1IRKA 4HJOA 2QKRA 1JKKA 3NCZA 3ELJA 4PX6A 1JLUE 1LPUA 2V7AA 3KXMA 1UNGA 4HZSA 1XKKA 2WOUA 5CU6A 1B39A 2ITNA 4X7QA 4DFLA 5HLPA 4DC2A 3EMGA 4O7ZA 4MXAA 2CKEA 4QTBA 3SG9A 3MJ1A 4YURA 4QMQA 4DITA 1O6YA 4EKLA 3WF7A 4DGOA 2IW8A 4YTHA 4A9YA 3JS2A 3KVWA 4PUZA 2GS2A 5HBHA 3LOKA 2OJJA 1NT2A 4IAFA 3RGFA 2HENA 3GC8A 3FWQA 4EONA 3VJOA 2ETMA 5J5TA 3BI6A 4MWIA 4YJNA 4BKZA 3Q9WA 4CMTA 5ITAA 1H08A 4NSTA 2R3KA 2JEDA 5ANKA 4YO4A 5GJGA 4CT2A 4CNHA 2PVLA 5GNKA 4D0XA 3VUGA 4DTKA 2XKDA 4DEEA 3U4UA 5EKNA 2VTNA 2XIYA 4LRMA 4I4FA 3ZEWA 2BRGA 2V55A 3HECA 3TNQB 4RLKA 3ULZA 1PRYA 3QZGA 1UU8A 3E8EA 2ZV2A 3FYKX 4NW6A 2HYYA 3CXWA 3F7WA 3LM5A 4RVLA 3P7BA 3DAKA 4U81A 5H3QA 4FBXA 3ZO1A 1Y6BA 4K6ZA 3H4JA 4B0GA 4E6DA 5KX8A 5AX9A 3ACJA 5AP5A 2F57A 2WGJA 2RKUA 4DYMA 1YXUA 5CAVA 3CPCA 3DBFA 4S2ZA 2YDJA 1CMKE 3G9LX 5CT0A 3L1SA 3TV6A 4DEAA 5BUIA 2VTLA 3EL8A 4EKKA 1J1CA 3SRVA 3WZKA 2OIBA 1NVSA 5LCKA 4MXYA 4FIFA 1WMKA 4ANBA 4P7EA 3POZA 3F9NA 4IH8A 4KSPA 3W33A 3O23A 4AZTA 4K18A 2C6OA 2VN9A 5AA8A 2YJRA 3DGKA 3QF9A 4ARKA 4QTDA 3FQHA 4J71A 2CNQA 2FSMX 4GV1A 4X2FA 4A4LA 1U54A 2C47A 3ODYX 1WBVA 3QZHA 3VBYA 3EH9A 4QMZA 5KUPA 1OECA 3A7IA 4ALVA 3TDWA 3U55A 4PDOA 1Z9XA 2PUUA 3QHWA 1GIHA 4L6QA 4DG0E 1TKIA 1XBCA 3KVXA 4N0SA 4RX7A 1QMZA 4JLCA 4S32A 5K4IA 2VTIA 3EFJA 3MY1A 3AMYA 4I0SA 4O86A 3I7BA 4WNOA 1PYXA 4WA9A 4AZEA 1YDSE 2BAKA 3LXLA 3BGZA 4BGGA 1UU7A 3VC4A 3AC1A 4B8MA 5C8NA 3LCOA 4GT4A 4GU9A 4J97A 3R9NA 4FGRA 3OOGA 4H3QA 4CRSA 2UUEA 3GCQA 4R7HA 5J1VA 4E93A 4YTCA 3ZRKA 4AWIA 4AE9A 4BI0A 2BZKB 2FYSA 2NRUA 4MNFA 2BDWA 2C69A 5B2MA 3D5UA 3LQ8A 5M08A 3Q5ZA 4FV6A 3H9RA 4BFMA 3ZUVA 5TKDA 2B52A 3DBQA 4PDPA 3PG1A 4QMYA 2P3GX 3C9WA 4J52A 5E8VA 2XYNA 4JBQA 4FV5A 4U40A 1OMWA 3PXKA 3SGCA 1YXSA 1SNXA 2ITWA 4YU2A 2QOOA 4EZ3A 3CPBA 3FE3A 3QTWA 1Q4LA 3IQ7A 4YBJA 3S4QA 1FVTA 3W8LA 4ITJA 1H27A 4XLVA 2B54A 3OP5A 3ZLSA 3CQEA 2PUNA 3BYVA 4CFFA 1ZOGA 2P0CA 3MIAA 4JQEA 5G1XA 2Q83A 3LQ3A 4K9YA 4JOAA 4WT6A 3W16A 2PUIA 2WMXA 3DBEA 2QG7A 3QQJA 5E8UA 3NYXA 3EQDA 2O5KA 4TY1A 4H1MA 1T46A 5EDPA 5F95A 2XB7A 4FGBA 5K0XA 3QZIA 2E9PA 2XKEA 5E7RA 5E90A 5M55A 2JKKA 3HUCA 4RJ3A 3SD0A 5M06A 4S30A 3FLQA 3DS6A 3RAHA 4BDHA 4WNMA 3FXWA 5CZHA 4ONAA 5DHJA 4BIBA 1ZWSA 4C4HA 3UZTA 5M4FA 1WVXA 4NEUA 3EHAA 4BKJA 3PUPA 4XG4A 5C9CA 3W2OA 4EHGA 4IDTA 3R7UA 4QP8A 5CQUA 4DINA 3V8WA 1KOBA 3Q3BA 2XK6A 4BCGA 4IZAA 4TYIA 3TIZA 1HCKA 4BKYA 4QP7A 3Q04A 1ZARA 3RM6A 3MFUA 2GMXA 3JY9A 4OR5A 4RIOA 4IVAA 4TNDA 2WMRA 3C4EA 3EIDA 2ITQA 4FOCA 2G2FA 2GFSA 4L7FA 3WF9A 3HL7A 4AZFA 2O63A 5DOSA 3GCSA 5AA9A 3H0ZA 3IGOA 4KKEA 1UNHA 3VHKA 5ANGA 4JVGA 4KBKA 1OIRA 3AGMA 3BYSA 1FMKA 3LAUA 4FX3A 3B2TA 4BRXA 4FUYA 3OTVA 4K33A 1J7LA 3GCPA 1NVQA 2O3PA 4FSYA 4FV2A 2ZMCA 4EYMA 5AR8A 4EK6A 4BHZA 4PNIA 2C0IA 4YMJA 4W9WA 3OC1A 3RMFA 3COMA 1YWRA 3RWQA 3KXNA 5I9WA 4OBPA 2CNUA 2C6EA 4YTFA 2WO6A 3QD3A 2VTTA 1XH7A 5EM7A 1NXKA 3TXOA 4C33A 3QUPA 2OLCA 3VS2A 5C8KA 2NNWB 5JRQA 3OS3A 4FZ7A 1ZYCA 1IAHA 5D41A 3RJCA 3VO3A 3KRLA 1PW2A 3F3UA 5CXHA 4IZ7A 3DZOA 4MXXA 1OIUA 4OTGA 5DT4A 4ZK5A 1J7IA 4CEGA 2W1DA 3ZLXA 4FKGA 4MX9A 4UEUA 5FXSA 3QZFA 2I0YA 4Q9SA 1XH9A 1UU3A 5CSWA 1PMUA 5IG1A 4IQ6A 3DLZA 4CFXA 3GEQA 4A7CA 5AAFA 4QQTA 4R3RA 3NUNA 3E88A 3A99A 4FOBA 3HX4A 3ORXA 2CMWA 4LL0A 3PSDA 2XVDA 2CGXA 4LMUA 2FUMA 3QHRA 3DKOA 3IOPA 3A60A 3V5LA 1IAJA 3NZ0A 4FR4A 3COHA 3HAVA 1FPUA 4QP4A 4DH5A 1XJDA 3Q60A 4ZEGA 1WCCA 3WZJA 2WMTA 4F9AA 2CN5A 2I7QA 1PXJA 3FHIA 1REJA 2VTSA 3P08A 3EFWA 2IVVA 2X81A 3NAYA 2JGZA 3CY3A 3SQQA 3ZLWA 3SW7A 4PTEA 3D0EA 1PXKA 4ANQA 4EC9A 4IZ5A 1JOWB 4I24A 3FEGA 4PDSA 2UZLA 3CTJA 2UZUE 4IJPA 3FDNA 4JJRA 5A6OA 3OWLA 2AC5A 3AXWA 3PP1A 5AWMA 3DKCA 5L8JA 4DEBA 3RI1A 4HVIA 3TKUA 4GK4A 1ZMWA 2HWOA 2WOTA 2WQEA 3OUKA 5LARA 3SRVB 4CZYB 5CEPA 3NYOA 3UP7A 5HIBA 3FMEA 4KAOA 1W0XC 4IX6A 4DGLC 4CFUA 1DI8A 3DNDA 3PY0A 2VO3A 3A61A 4G2FA 3CKXA 4GFOA 4U45A 3OW4A 1CSNA 2C0OA 3QRTA 4BVUA 2RIOA 4XG6A 3Q96A 5E8SA 4C61A 2F7EE 4PNKA 3DDQA 3MFRA 5HIEA 4ZMFA 3NVKI 4FNXA 4FKVA 1OB3A 4L01A 3IG7A 4L8MA 3W55A 2JITA 4PF4A 2R2PA 1QPDA 2CDZA 4ANOA 4WSQA 4ENYA 3U9NA 2OXDA 2WQMA 4X2JA 3CS9A 1YOJA 2LGCA 1IA9A 4YR8A 1V0PA 4FEQA 4FV0A 2XNEA 4RGJA 1U46A 3HP5A 4NTSA 2XEYA 2R3MA 3PE2A 4BGQA 4E5AX 5EI8A 1VZOA 1BMKA 1K3AA 4ORKA 2VWVA 5AAGA 2QOFA 4PDYA 3O8UA 5D12A 3CJGA 4IIRA 2GQSA 2UW7A 3FPMA 3V51A 3GU6A 3NW5A 3VBVA 2QO2A 3O7LD 1JKTA 5HOAA 3FKNA 5KMKA 5KBRA 3QTSA 4IAKA 2BAQA 3D7TB 3MGYA 4MD9E 3R63A 5HI2A 4RJ4A 3HYHA 1LUFA 4APCA 4F9YA 4S34A 2F9GA 3AMAA 4GK2A 2J5FA 2C6IA 5EQYA 2H96A 3U8WA 4WUNA 2C3LA 5DRBA 4FL3A 3F3VA 5EYKA 4MTAA 3W18A 4L44A 3BU5A 5EKOA 4ZTSA 3ORPA 1PKGA 4I5HA 3ZZEA 4NYEA 1XH6A 1IG1A 3VULA 4C4GA 2WKMA 3OXTA 3VUHA 5M57A 3COKA 3QQHA 4UXQA 4FV8A 3W10A 4EK5A 2PVKA 2PVHA 4FKLA 4H3PA 2PMNX 2WTKC 5M56A 5T68A 5D7AA 2G2IA 4PY1A 2GTMA 4QNAA 1OVEA 5DFPA 3HDMA 3QLGA 3FAAA 4W4VA 5F4NA 2ZV8A 5DLSA 4FIHA 5BMMA 3ZM4A 4ZMEA 4OTFA 4UALA 4IC8A 5CVFA 5HKMA 1GIJA 4V0GA 3UOKA 1MRYA 4WNPA 1QCFA 3MVHA 3O0GA 3K5UA 1PF8A 4MWHA 5FTOA 3ZM9A 4BYJA 3PIXA 4FSMA 5FRIA 3V6RA 3G6HA 3ORLA 2PE2A 3PA3A 2XM8A 4FT3A 5M53A 3FUPA 4D4SA 1XH5A 4MF1A 3OCBA 3QBNA 4IFCA 5A4CA 5EHLA 5A4EA 4ANNA 2PK9A 5B2LA 4U6RA 3UE4A 3EFKA 4B99A 3AC2A 1WBTA 3UNKA 2YIRA 1OKWA 2VTHA 5ETIA 3QWKA 2R3LA 3UC4A 4GL9A 4MK0A 3C0HA 3PTGA 5LQFA 4F7SA 4PTGA 4UYAA 2WXVA 3A2CA 2WTVA 4QYEA 3ORMA 4C2WA 1YW2A 1GY3A 2W5BA 3E93A 2IZSA 5AJQA 2JKMA 2ONLC 3M1SA 4E73A 4PMPA 2E9VA 4Y5HA 3GCVA 2B53A 4HNFA 4OBOA 4ANSA 1UKIA 3F69A 2WNTA 3OFMA 4BZOA 4FKRA 3GU7A 4GCJA 5DIAA 4IX3A 2EXCX 3PPKA 1ZLTA 3KA0A 3ULIA 3PXZA 2FGIA 3JUHA 4R5YA 5DBXA 4AA5A 4PMTA 3I79A 4J1RA 5HORA 4DT9A 1JAMA 2R3NA 2BPMA 2X6EA 4NW5A 4DH1A 4QPSA 2RFSA 5HD7A 1WBNA 3T3UA 1ZZ2A 3NEWA 3V5PA 2Z8CA 3COIA 2IZRA 4EOKA 1KWPA 2XEZA 2YDKA 4D2VA 3ZXZA 4E6QA 2IVUA 2R3IA 3OTUA 5J7HA 4L42A 4C8BA 3F61A 2GS7A 2XH5A 3VRYA 4XX9A 2JBPA 1EH4A 4A9TA 5GZAA 4FTAA 4KBCA 4RSSA 5EI6A 3N4VA 5JFXA 3SXFA 3SVVA 3S2PA 3KB7A 3HMOA 3NW6A 3NNVA 3QCYA 3TZMA 4E6CA 3FQSA 4YHJA 3VS0A 3DDPA 5DWRA 4BBEA 1FINA 2EXMA 5AR7A 4FSWA 5E8ZA 3U4WA 5BNJA 1KSWA 3MFTA 2BTRA 1FGKA 3G0EA 3GNIB 3IECA 2XCHA 4GJ2A 4WSYA 4E4MA 5FD2A 1M7QA 4MBJA 5IEXA 2BVAA 3ZU7A 2QD9A 5HO6A 3KULB 3A7JA 4RA4A 2O0UA 2XNMA 4H36A 4XG9A 3R83A 4UXLA 4BY9E 3C51A 5EG3A 4CSVA 4XP3A 5BX0A 1YXVA 4FKJA 4IEBA 4U5JA 4TXCA 4CRLA 3KF7A 4MXZA 3NMUF 3HMMA 3VJNA 4DT8A 2WMVA 3ANQA 2IW9A 4XV1A 5M4CA 3EYGA 1ZAOA 5JKGA 3NUYA 3HV5A 4A9RA 4FSUA 4BWXA 5IMEA 4ZAUA 1GOLA 3N9XA 3MIYA 4ACGA 2R3FA 2CLXA 4O27B 3R21A 2PVJA 5IEYA 5CAOA 1BLXA 1H1WA 4PMSA 3UODA 1DS5A 2QLQA 4CMOA 5BVWA 2C30A 4GFMA 5CWZA 4ZY4A 2J0IA 3R73A 3KY2A 1M2PA 2EVAA 3DK6A 5HG7A 1ZYJA 4C02A 4WG5A 5M07A 4FKTA 4XS2A 5EOLA 2OI4X 2YFXA 3P7CA 4ANLA 2CKPA 4PWNA 3VW8A 5FP5A 5AUTA 3Q2MA 3MBLA 4FF8A 1M2RA 5EM8A 5HNBA 1GJOA 4C7TA 2JAVA 5ICPA 2YWVA 4XRLA 3R9HA 5E8WA 4RVTA 3A7FA 5CEOA 1CKIA 3TV4A 4JNWA 4I6BA 4TYHB 4CTCA 2DUVA 4LFIA 5I4NA 4I41A 1JKLA 4D4YA 2ZYBA 4O2PA 1OPJA 5JH6A 1P14A 2VWIA 4EWHA 2XCKA 4NM7A 4GH2A 3UQCA 2ZAZA 4NWMA 1FBNA 3GB2A 1YDRE 2W1FA 4G9CA 4UZHA 2XYUA 5BYYA 3ORNA 1DAYA 3T8OA 3QRJA 2BUJA 5FTGA 3CKWA 3D2IA 3DAEA 1BUHA 3C4XA 4HPTE 2BCJA 2HZ0A 3PA5A 3TL8A 4LV5A 3OCGA 3QD2B 1IR3A 2Y7JA 2BHHA 4G31A 2R3PA 3FLZA 3TG1A 1P2AA 3QQUA 2VNYA 3LCDA 4GS6A 3GCUA 5C8MA 2BR1A 4FYNA 1SVEA 3TNPC 3S0OA 3DFCB 4P5ZA 4O7LA 2J0JA 1H07A 4L68A 4QMWA 3VQUA 2YCSA 2GNGA 4KS7A 3RK7A 3W32A 1H26A 4J98A 3ERKA 3BQCA 3HRBA 5IQGA 3CD3A 3KN5A 2YCRA 3F3WA 4I94A 2RG5A 4ERWA 4D5HA 4DLIA 4O1OA 4USDA 2QONA 4AOTA 2ZB0A 1QPEA 1U5RA 3KN6A 4RC4A 4RVMA 3W2PA 4USEA 4F7NA 4TZRA 4BTKA 3BWJA 4O0UA 4NT4A 4R7BA 4IM0A 2XNNA 5CSVA 4BIEA 2PVYA 4GSBA 1U59A 4LV8A 2OIQA 3C7QA 2WTJA 1J3HA 4XBUA 5HIDA 1M17A 4IAZA 2V0DA 4AN2A 3JXWA 3LLAA 3RNYA 3FI4A 1YI6A 3PXFA 2YN8A 2Y4IC 2PTKA 3FLYA 5HNGA 3TZ8A 3TUDA 4QQJA 3PVWA 4QYGA 5HEZA 2H9VA 4EORA 1AQ1A 4TWPA 2REIA 3CGFA 5HBEA 1XH4A 1PXNA 2BDJA 1YWVA 2RFDA 5DA3A 4BHNA 2YCFA 3E92A 5LVNA 1BYGA 2X1NA 3GC9A 4QQ5A 5DN3A 3Q9ZA 5AP6A 5JFVA 2HXQA 4JT3A 4TT7A 4L67A 3R22A 5BYZA 3KQ7A 3NW7A 4G3EA 4BCHA 3OCSA 3GI3A 3TUCA 3AT4A 3UIXA 5C1QB 3ENMA 2BKZA 4II5A 5AUYA 2OBJA 3D15A 3VAPA 2HW7A 3D5VA 2HK5A 2PZPA 5CQWA 5FTQA 3VWAA 2QR7A 4I22A 4XCUA 4QYYA 3OEFX 4D2TA 5EQPA 5H8EA 4I5MA 4IWOA 1Y57A 2ZM4A 3OT3A 4F4PA 4ZLZA 1JSVA 4AQCA 1KV2A 5BQ0A 5IEVA 2ITOA 2YJSA 4KS8A 5L6PA 3ZONA 4U44A 3VIDA 1YRPA 3F5GA 3HVCA 4OTWA 5KZIA 2OXYA 5AUXA 5TF9A 5AFVA 5BVFA 3IK3A 4BBMA 4D2WA 2YM7A 2XK7A 5A4QA 1JWHA 4QMTA 2ZV9A 3U9CA 4OGRA 2R3RA 1UNLA 2WFYA 4QPAA 4Z16A 5T3QA 4TYHA 4NKSA 3NUUA 5L6WL 4A4OA 3TUBA 2WQOA 4DFUA 5HLNA 3DQXA 4FK6A 5D11A 3C0GA 2SRCA 4GG5A 4GT3A 3OBGA 1ZOHA 2WU7A 3UDBA 4EC8A 4HVHA 3G6GA 4O7RA 4R1VA 3MV5A 3CSVA 1IEPA 3BLQA 3BV2A 4O0SA 3FMDA 4OW8A 3QXPA 3R30A 3ATTA 3HNGA 3EZVA 5I3OA 4EQUA 2GQRA 3JVRA 3HRFA 4A06A 5JFSA 1S9JA 1V1KA 4RPVA 3AOXA 3MH1A 3TNHA 2PULA 2VGOA 4FEXA 4QP1A 3UYSA 2X9FA 3VS5A 1PMNA 3LMHA 3R7IA 4FV4A 2ITVA 2HY0A 5ETAA 2H8HA 5CLPA 3AG9A 2Z60A 3A8XA 4FV9A 1CM8A 2BFXA 2YAKA 5DI1A 3BEAA 5HVJA 5CEQA 5I0BA 3LCSA 3OY1A 4ENXA 1R0EA 4HGEA 5DPVA 2GNJA 1XH8A 4D0WA 3I6WA 4O7VA 2RSVA 2PUPA 4PL3A 4FTQA 4FKUA 3ZYAA 4D1XA 1OKYA 5IUIA 3DKFA 1PXLA 4NKAA 3FMLA 3I81A 5EYDA 4WO5A 5B0XA 3WZDA 5HESA 3Q4TA 3U87A 4EOSA 3HAMA 2XIKA 4D58A 4O7TA 3MWUA 4MD8E 5DR9A 3KULA 3C0IA 3NRMA 5AP4A 5EK7A 3RZFA 3JYAA 4RG0A 4EOJA 4C37A 2G15A 4F08A 2ZM3A 2I0EA 1OM1A 2HZ4A 5C4LA 2C1AA 4U41A 1K9AA 2X2KA 5CF6A 4XBRA 2QU6A 4U3YA 4C3PA 4EK3A 2J9MA 4H3BA 4X0MA 3R9OA 4N70A 3LZBA 2QO7A 3A4PA 4O0YA 5L8LA 5M44A 5CF8A 4X3FB 4TNBA 3F5PA 5J9ZA 3LIJA 4ZXTA 4MF0A 4TYGA 1U5QA 4K0YA 3GVUA 1A48A 4F63A 2DYLA 3CE3A 3EQFA 2X9EA 3QX2A 3UPZA 2ZDUA 3RAIA 3MVJA 4OTRA 1Y8YA 4WG4A 4EH2A 4A9SA 1W7HA 4LGHA 4XLIA 3KK8A 4ZTRA 3PWDA 2GNIA 5LVMA 5LMBA 4F6SA 4CLIA 2JKOA 1ATPE 1Q8TA 4BB4A 2O65A 1OL6A 1BX6A 3QXOA 4JX3A 3FZSA 2I0HA 5JQ8A 4UX9A 3FLSA 4IVBA 5HD4A 4CT1A 1Z5MA 4QYFA 3UMWA 3DB6A 3VRZA 4IVDA 2I0VA 3FMKA 4ZLYA 4O7YA 3TEIA 1Q97A 2W99B 3N4TA 4UMPA 2WQNA 4YJVA 5B7VA 1JSTA 2YM5A 2X7OA 5L2TA 4G6OA 3U6JA 2AYPA 4IB5A 4RFYA 4U0IA 4FKQA 2XIRA 1ZOEA 4R7IA 4FTUA 1O9UA 4D9TA 1MQBA 2CSNA 2W1ZA 4I6FA 4YNOA 1PMEA 4V05A 3FKLA 5ANEA 4ZSJA 2VWUA 3HMNA 3O8PA 3PFQA 2HW6A 4LYNA 3SXSA 3V5WA 4FT9A 3ZSHA 4AW0A 3R01A 4JAJA 3RNIA 4EUTA 4EH8A 1SVHA 4CZTA 4BF2A 3WIGA 2QHNA 3UO6A 4W8DA 4IC7A 4F65A 1XR1A 4NJ3A 4QO9A 4BDEA 3OXIA 4F7LA 4Z7HA 2VWWA 3AD5A 3CQUA 3UG1A 1DAWA 1KV1A 2NPQA 2XKCA 3FSFA 1L3RE 2VGPA 3LFBA 4JL9A 2C3KA 4KNBA 4EOOA 1SNUA 4YZMA 3V6SA 2YISA 1OL5A 4ALUA 4ZIMA 3LMGA 4CCBA 3DXQA 3DZQA 4QRCA 4TYEA 2I40A 2UZEA 3SDJA 1SM2A 2WEIA 2C6DA 2J6MA 3TDVA 2R5TA 3NNWA 4YZBA 3Q9YA 5I5ZA 3WIKA 1WZYA 4N4SA 4AP7A 3ZDIA 5J7BA 3MPAA 3ZCLA 4JX7A 5IQEA 2V5QA 4PTCA 3P5KA 4B4LA 1LEWA 3FBVA 3QGWA 5AMNA 3EWHA 3O8TA 4JRNA 3KCKA 2OH0E 4AZWA 2O64A 3CEKA 4I23A 4ZTQA 1FOTA 2G9XA 2V62A 4GIIA 3LFFA 4WUAA 3QTRA 2B9JA 3BHTA 3E87A 4EZ7A 5E91A 1URCA 3D94A 5CY3A 5F1ZA 2QOIA 3PJ3A 2YM8A 5IISA 4GT5A 3ATSA 3UOLA 2Z7SA 4PP9A 1GZNA 1KE5A 5AV3A 3ZO4A 2QLUA 2Y4PA 3DQWA 3RP9A 2OWBA 5D7VA 2QOKA 4MHAA 4GYGA 5HQ0A 1JNKA 2UVZA 3D7TA 1G5SA 4TWNA 4RJ8A 2ZB1A 1H1QA 2E9NA 3GENA 4LUEA 4I93A 1WBWA 3ZRMA 1UWJA 5FG8A 1H1SA 3DLSA 1OITA 4M69B 3LCTA 1YI4A 1TQIA 2PZIA 4EH3A 5AUWA 4FKSA 2OICA 2ERKA 2OG8A 3TV7A 3DA6A 2E9UA 3Q4CA 2WD1A 3VBTA 3LJ1A 4AT5A 3SV0A 3UVQA 3NGAA 4ITIA 1PXMA 4YJQA 1IASA 2W05A 5FGKA 5BVNA 2YM6A 5DRDA 4FNWA 3QUEA 4NJDA 4OBQA 4CQGA 3BRBA 4ANMA 4UWYA 4YJPA 4EH9A 4ZJJA 5HTIA 4GVJA 4CV9A 3FMJA 4LOPA 3TWJA 3ACKA 1H25A 2JIIA 3GFEA 3P4KA 4YJUA 4GKHA 4M13A 2XRWA 3MTFA 4JDJA 3EQRA 4L53A 5JGAA 3V5QA 3SAYA 4QQCA 4BCQA 4KA3A 2Y8OA 3PRFA 4R1YA 5HNIX 4GW8A 3MPMA 4DTBA 3WF6A 3F66A 3FLWA 4QMSA 5L3AA 5IQAA 5E4HA 3TIYA 4U42A 3UQGA 4Y5QA 4IXPA 5I9YA 4L46A 2VX1A 5J9YA 5J87A 3ODZX 4H1JA 4AF3A 3DJ5A 4AA4A 3CTHA 3R04A 4W8EA 5ANOA 4IWPA 3QTQA 4CQEA 4NTTA 4ZP5A 3R8LA 4M67A 3WILA 3FJQE 4CG9A 2X2LA 4Z3VA 5KNJA 3DXPA 4UZDA 4ZS4A 2XK9A 5ACKA 1RQQA 4FKIA 4LGDA 2UZBA 2BHEA 3FPQA 5JK3A 5FUTA 2KTYA 2WZJA 2Q0NA 3V5JA 2HELA 2DWBA 5AUZA 1H0VA 5ANIA 1F5QA 5K0KA 2YIQA 5CU0A 2ZDTA 4XG2A 3NR9A 3R02A 2PSQA 5EM6A 2B0QA 2PE1A 3R1NA 2JFMA 2P33A 3TZ9A 4BDCA 3KKVA 5M09A 4N6YA 2JD5A 3BIZA 2QR8A 2ETRA 4FTLA 5AP0A 3RPSA 1AGWA 2O8YA 5TOZA 4CZUA 3DB8A 4WBBB 5GIPE 2Z7RA 3KXXA 4FC0A 4R8QA 5CXZA 4FT0A 5IF1A 5I9ZA 3GC0A 4O0TA 5ANDA 3OOMA 2GCDA 5IQDA 3I5ZA 3HGKA 4KB8A 4RBLA 4MNEA 3PZHA 5EW8A 4BCJA 5IH4A 4IMYA 4EBWA 2OJGA 2IJMA 4KIKB 4D1ZA 3UZRA 4O38A 4L45A 1E1VA 5CT7A 4GU6A 4JIAA 4WBOA 4NIFB 3ZEPA 3IPHA 1STCE 5CEKA 3FMHA 4O81A 1BKXA 2EB2A 2WHBA 3D2KA 3GGFA 3DK7A 3C1XA 2OK1A 4EK8A 3D4QA 4AN3A 3EJ1A 5JT2A 1ZY4A 2EUFB 3NPCA 4FEUA 5FBNC 1OKVA 2C5YA 3QQLA 4C2VA 2JAMA 3AD4A 5E8XA 2P55A 2ACXA 1V0BA 4RC3A 3C5IA 2ITUA 2C3IB 4F1OA 5CYIA 3DY7A 2XF0A 2YABA 4M84A 2YACA 4X2GA 5CVHA 4IHPA 4O6LA 1KE9A 2Z7LA 1H8FA 4M14A 4YZ9A 4RRVA 5HTBA 3I0QA 4GUBA 4FT5A 3RAKA 3NIEA 2CGUA 5FQDC 3UGCA 5FLFA 2VX0A 3OZ6A 3BELA 3L8SA 5AIKA 2OIDA 5CU3A 3ET7A 4YNEA 1UV5A 4L43A 1CDKA 4IADA 2IO6A 3F3TA 4M0ZA 4C3RA 1J7UA 4FK3A 3NUAA 4XV2A 3SLSA 3SA0A 3G33A 3AMBA 2VNWA 2WTWA 5A14A 4O84A 3KMMA 4E4LA 3S3IA 3EN4A 3E8CA 3FC1X 4G5JA 4DBNA 4YC3A 4AZVA 3R7OA 1G3NA 2EB3A 2R3JA 2XS0A 3EKNA 4U9AA 5CASA 5L2WA 4L00A 4WIHA 5F94A 3D5WA 2ITPA 4R6VA 2YM4A 3DJ6A 4FUXA 4WD5A 3FY2A 1VEBA 4RJ6A 3LMIA 2BDFA 4XMOA 3SX9A 4JXFA 5IA3A 4MYGA 3FKOA 3JVSA 5IA5A 3RK9A 3QU0A 5FP6A 4AOJA 4C36A 4HGTA 2B4SB 5ACBC 5KE0A 3VS6A 3KK9A 3LKMA 2QOLA 4Z55A 3MH0A 5AP1A 4DAWA 3SXRA 3JR1A 2QNJA 3R1SA 4ASZA 4C35A 4F0IA 4OUCA 4Z7GA 5DVRA 5DT3A 3RBWA 4D9UA 5K5XA 4FTKA 5KMOA 2X7GA 2B55A 5AX3A 4EHVA 1R0PA 2HOGA 4BTFA 2Y0AA 3AQVA 2JLDA 4I0RA 1YDTE 4U8ZA 4E5WA 5I9VA 2CGVA 4FSZA 4XUFA 2B7AA 4JG6A 5J8IA 2G01A 3M42A 2C5XA 4MEDA 4AW2A 5AV2A 4MXCA 2OF4A 3CC6A 3L8XA 4HYIA 4FODA 1KOAA 4R5SA 2ZV7A 3LJ2A 4Y8DA 4AG8A 3DTCA 5CNNA 2GSFA 2XNPA 3AD6A 5AM6A 2GS6A 2VRXA 5LJJA 2YZAA 4AA0A 1RW8A 3LM0A 3NDMA 2W5HA 5FDXA 1Q8UA 2VX3A 4HNIA 1F0QA 2XIXA 4BBFA 5AADA 5J5SA 2IZUA 4PMMA 4XP0A 2BRNA 1YXTA 2JDSA 4XRJA 4Y73A 4RMZA 5C03A 3RHXA 3P7AA 4HVGA 5JN2A 4I20A 4KKGA 4FSQA 2XBAA 5FXQA 2J0KA 3D5XA 3QL8A 2CPKE 2FO0A 4KRCA 4OAUC 3KGAA 5AUUA 3DAJA 2UW3A 4E3CA 1PXOA 2YHVA 2HXLA 2XK8A 3C5UA 3MS9A 4MNEB 3T3VA 4IBMA 4JAIA 4IWDA 3IW6A 4BI2A 2CGWA 2PY3A 3QTZA 4GFGA 4B7TA 2QG5A 2BILB 2Z2WA 3F7ZA 2CN8A 4I4EA 3HV3A 5EI2A 5DE2A 3RPRA 4C4EA 2VUWA 2BZJA 3R8UA 4ZOGA 2PYWA 4QMNA 4F0FA 2CKOA 2PWLA 1ZZLA 5H8GA 1ZYLA 2ERZE 1DM2A 2GNFA 4D1SA 3L8PA 3TNWA 4JDKA 5HCZA 3BHVA 2B1PA 5LCJA 2W1CA 1J91A 4H58A 3PJ2A 4X6QC 4U3ZA 3UIUA 4EOMA 2QHMA 4IM2A 3TACA 1OUYA 3GXLA 4J99A 5CU2A 3IS5A 5L2QA 4XEYA 5HX8A 3QTXA 5EH0A 3ZXTA 3MN3A 4AT3A 1GZ8A 2F2CB 4HCTA 4UV0A 3TJDA 4QYHA 3B8RA 4E6AA 2OW3A 2WTDA 1OL7A 4PL4A 3EN7A 4DG3E 1Y91A 4AFJA 4XOZA 2W0JA 2X8IA 5CSXA 3UNJA 3WOWA 5A46A 3ZMMA 2PVRA 3S1HA 3ENHA 3IW7A 4QMVA 2ZJWA 4OTIA 2UZVA 4RIYB 4FTNA 4QT1A 4YJRA 4DGMA 5A54A 3S95A 5DYJA 4XG8A 4O0VA 2OZAA 2GTNA 4Y85A 2CLQA 4FTOA 2XIZA 2O2UA 3LPBA 1KE8A 3GQLA 3TNIA 3ZRLA 2ETKA 2J4ZA 4RA5A 2QC6A 2W4KA 3OF0A 3Q6WA 3DT1A 3W2CA 3AC3A 4WG3A 2UW0A 5C4KA 3R6XA 4DA5A 3BE9A 3OWKA 4FTJA 5CAQA 4EL9A 4P90A 2GHGA 3B8QA 3OHTA 3QA0A 2PMIA 4RQVA 3OVVA 2OJFE 4NU1A 4KBAA 1GZKA 3BKBA 3QC9A 4EQCA 2UW5A 2QOHA 3QD0A 4FSRA 4L3JA 1TQMA 5HU3A 4GVAA 1BI7A 4CYJA 4EJ7A 5GHVA 3MW1A 3WF8A 2F7ZE 4Y72A 2Y6OA 1P4FA 4FV3A 2WIHA 4V01A 5JGDA 1HOWA 3PVUA 4EHEA 2E2BA 5EW3A 4JQ7A 4OTDA 4CFWA 4EZ5A 3E7OA 1PY5A 5AV1A 5E1SA 4DN5A 2DQ7X 3ZLYA 1QPJA 1OPLA 4FTCA 4BGHA 3BBTB 4I5CA 2ITTA 3H0YA 3LFNA 4QMUA 3TZ7A 3PIYA 3PSCA 4ALWA 3EN9A 4BL1A 3BHYA 1P5EA 2J0MB 2OF2A 2YLEA 2OZAB 4ZJIA 3UYTA 5M4UA 4EBVA 4N57A 2XM9A 3FHRA 2OGVA 1U4DA 2P2IA 2VTAA 3PYYA 4FVRA 3R8VA 2J5EA 2OJ9A 4KIOA 3TTJA 2UZNA 2Y4IB 1S9IA 2QO9A 2PL0A 2YDIA 3UVRA 4AOIA 4DF3A 2UZTA 3NVMB 4F6UA 1W82A 3OY3A 5A9UA 5HVKA 3A8WA 3AC5A 4EOQA 4JQ8A 3E3BX 3WARA 3LFAA 4RIWA 2ZVAA 5EYMA 3PY3A 3BPRA 3FV8A 2YAAA 4LUDA 2QI8A 2C4GA 3ZS5A 3HKOA 4FI1A 2YA9A 3KRRA 4O0XA 4IAIA 2PE0A 2VTJA 3DBCA 3IW4A 3TCPA 4OAVB 3F6XA 3P1AA 1OL1A 3V3VA 4GUEA 5A4LA 3OUNB 3BGPA 3PSBA 4C58A 4D2SA 1G8SA 3BX5A 4O82A 4U97A 5H2UA 3BU6A 4CXAA 2B9FA 3U54A 4EQMA 1YHVA 1ZRZA 4HW7A 2EU9A 4TW9A 4X6RA 3ZZWA 2FH9A 4M68A 4YZDA 3KXGA 4FIGA 5FEDA 4BTMA 1REKA 2C6MA 3CD8A 4NFMA 2OSCA 4HPUE 3MH3A 3C4CA 3UNZA 4ZSEA 4F64A 4QP2A 2Y9QA 4BDIA 2HAKA 3W2QA 4UWCA 3NX8A 1JVPP 4L3PA 5E8TA 3VUTA 5HZNA 2J0LA 4YGAA 4RWLA 1H24A 3TKHA 2F2UA 3FZPA 1NA7A 2JKQA 2IZTA 3MPTA 2XNBA 2VWYA 3EOCA 1Q99A 4AGWA 3NAXA 2EWAA 2PVNA 2GU8A 5HU9A 3BHUA 2X8DA 4CG8A 5I9UA 2C5VA 3ZC6A 5IQHA 4AN9A 1OBDA 3E62A 4LRKA 2WMSA 1ZYSA 2YEXA 4IB1A 4I21A 3CBLA 3MB6A 3QKLA 2UW9A 3R1YA 2X39A 4I6QA 4IDVA 2W17A 4F99A 5FM3A 4AX8A 4UMUA 3ZH8A 4MAOA 5FEQA 2BAJA 3TKIA 4EH7A 4X2KA 3IOKA 4KABA 3VBQA 4D4VA 3UOHA 5KBQA 3LFCA 4B9DA 2JFLA 4XH6A 3IDPA 3P0MA 4DE4A 3PDTA 2J90A 5F20A 4RJ5A 3HP2A 3EQGA 4R78A 3M11A 2G1TA 3R7GA 4I6HA 4O21A 5IDPA 4NM0A 2XA4A 3KU2A 4UWBA 4M15A 1YKRA 4RIYA 5CALA 2WB8A 4F1TA 2YLFA 3D9VA 5HTCA 1B38A 3NYVA 4G3CA 5BVEA 2QU5A 1FMOE 2C5NA 3DBDA 5K3YA 2IN6A 3FMNA 3NCGA 3EQBA 2VWXA 2CCIA 2WIPA 4IX4A 3R28A 4ZZMA 5KMJA 4UMRA 4IWQA 3L9LA 3SHEA 2AUHA 1JPAA 4H05A 3GU4A 3NWWA 5CF5A 4U79A 4FKPA 4LQMA 3TTIA 1RDQE 4FG9A 4BCPA 1YWNA 3QCQA 4FE2A 2IVTA 3IO7A 4IE9A 3MYGA 1KE7A 4D28A 5IA2A 1F3MC 4W4WA 1DI9A 4G17A 4ACMA 4FICA 3G0FA 1R1WA 2W7XA 3PJ1A 3EQCA 4C4FA 4I3ZA 1PXIA 4RX5A 3IW5A 5M4IA 1XQZA 1GNGA 4TKSA 1NW1A 2R9SA 4G34A 2W9ZB 5TO8A 3V8SA 1PMVA 3KRXA 5IQCA 1H4LA 2CHLA 2VO7A 4E4NA 4DCAA 2XJ2A 3C4ZA 5K4JA 5EHYA 4ACHA 3QKMA 3LW0A 4JR3A 4X21A 5CENA 4UN0C 5J95A 2PZYA 3PY1A 3ZSGA 4YSJA 4Y83A 4RJ7A 3I0OA 4ZTNA 4RZWA 4BCOA 3R71A 3PXRA 4S31A 3HEGA 3BLRA 5IA1A 4G3FA 1I09A 2E9OA 1UWHA 2GNLA 1HCLA 3G2FA 5EW9A 1BL6A 5AV0A 5HBJA 3ORKA 3NUSA 5BMSA 4WKQA 4JS8A 2X4FA 4DH8A 1TVOA 2BROA 1Q24A 2OJIA 3GUBA 3R2YA 4KKHA 4MVFA 2BTSA 4NCTA 3WE4A 3GOPA 1GIIA 4O6EA 2C3JA 3LQ5A 2UZDA 2WTKB 5DR6A 2XMYA 2UVYA 4C57A 4O22A 4BCKA 4OTQA 3F3ZA 4IANA 3KXHA 3HDNA 4PPCA 3RPVA 5CEMA 2XUUA 4K11A 4E4XA 1ZMUA 2QURA 3G9NA 4LGGA 1MRVA 3R7YA 4QNYA 3LHJA 3VS7A 2ESMA 2EXEA 3ZO3A 5CANA 4R77A 3DOGA 4Q5EA 3QCXA 3ROCA 3QX4A 3FXZA 3UC3A 4KD1A 4IJ9A 1OZ1A 5TR6A 4CCUA 2CKQA 4HCVA 4OT6A 3BU3A 3E63A 3HZTA 2YM3A 3FYJX 2A2AA 5LOHA 4B8LA 2BIKB 2OKRA 3EN5A 4TWOA 1URWA 4NM3A 4X3JA 4YC6A 4X3FC 3BYUA 4BIDA 4EJNA 4BDKA 4GJ3A 3I7CA 4G3DA 4UB7A 5KHWA 4UBAA 5A6NA 3ZFXA 5KKRC 4IB0A 4BCMA 1LR4A 1VR2A 1Q8ZA 4J96A 4BDAA 4PPAA 4MBLA 3R9RA 2W9FB 4FSNA 4N6ZA 5ANJA 3UZPA 5LWMA 4CGAA 4KUJA 4G16A 3MY0A 3QAME 3WBLA 3LVPA 3RCDA 3BLHA 3EN6A 2UW4A 3FSKA 3QALE 3HV7A 3PXYA 3UIBA 5BUJA 3FI8A 2VU3A 1A9UA 4EH4A 2AC3A 3F5UA 3FXXA 3WZUA 4F9WA 4EEVA 5IH5A 2BRBA 3H3CA 3PVBA 4QPMA 3EKKA 2F7XE 4YLKA 2PMLX 4FL1A 1W98A 1VYZA 1L8TA 4KRDA 5D10A 3G15A 4O7SA 4K1BA 2VAGA 3KEXA 3HLLA 1IA8A 4YZNA 2Q0BA 3R9DA 2R7IA 4LI5A 3V01A 4ACDA 4IB3A 4ZY5A 4E20A 1AD5A 3OWPA 5FEEA 1YXXA 4PRJA 5FBOA 4USFA 3OW3A 3QTIA 5E1EA 3ROYA 4BI1A 2YERA 4O7NA 1XO2B 4RWKA 2VZ6A 4W4YA 4JR7A 5HE2A 4WOVA 2A0CX 4BDJA 2R0IA 3QRKA 3UVPA 3V04A 3VBWA 3P78A 3C13A 1PKDA 3R8ZA 2X4ZA 5CS6A 3PWYA 5KZ0A 5LXMA 4O0WA 4ZS0A 3MESA 4O2ZA 1BL7A 3RZBA 3N4UA 1V0OA 4TRLA 2GQGA 3MH2A 1G8AA 3O96A 4ASDA 4CFMA 2FB8A 3RM7A 1MRUA 3KMWA 5JRSA 4QMOA 3VUIA 1ZXEA 2VTMA 3QRIA 2XZSA 4FZ6A 5C27A 1VYWA 4YPSA 3ZBXA 4DFZE 4OTHA 4R3CA 3FQEA 5GIOE 5I3RA 4EOLA 1SZMA 2I1MA 4W9XA 5AR4A 1FGIA 4ZZNA 3R0TA 1SMHA 3LFQA 3DKGA 1UA2A 3FI3A 2H6DA 3UQFA 4FV7A 3MA3A 5A4TA 2WU6A 3NNUA 2VO0A 4HGLA 4XV9A 3ZC5A 3E5AA 2ZOQA 4CKIA 4EH5A 5KO1A 4APPA 5K5NA 3G5DA 3I60A 1CKJA 3RPYA 3VBXA 5CSHA 4BDBA 4QP9A 4OTPA 2VWBA 2Y6MA 5IKWA 3I1AA 1YVJA 2V7OA 3C4WA 2UW8A 1JKSA 2NP8A 3KFAA 3E3PA 3LJ0A 4JG8A 4TN6A 5KMIA 3AC8A 4NIFA 1H0WA 3F82A 5BUEA 4YLJA 4AE6A 3VF8A 2PVMA 3HV6A 2ZMDA 4H39A 5T6KA 3MJ2A 2XK3A 4RZVA 3GOKA 2WMAA 3ORTA 4XJ0A 4YC8A 5DEYA 4MH7A 2XJ0A 3OROA 4EHZA 4AGDA 1Q8WA 3NIZA 2IW6A 3GU5A 2VTRA 3DTWA 3NUPA 1H1RA 5I9XA 3HUBA 3FI2A 1T45A 4MBIA 1Q62A 2YITA 4QMMA 4Z9LA 4A9UA 4E26A 3UMXA 2ZM1A 2QCSA 5FDPA 2OFVA 1M7NA 2VWZA 4CD0A 4DEHA 5EDRA 2HIWA 1UU9A 4YPDA 5LMKC 3IDBA 3UOJA 2W1IA 3MVLA 3K3JA 5AUVA 4OLIA 1XBAA 3GP0A 3OEZA 3QUDA 4QP6A 5D1JA 4ZJVA 3VN9A 3DU8A 4QMLA 1CKPA 5DH3A 3ZO2A 4LOQA 3VNTA 2PMOX 1Y6AA 4P5QA 4UYNA 4AZSA 4FMQA 3IDCA 3AT3A 3H9OA 4AAAA 3EQIA 5HVYA 4DBXA 1XHAA 3SOAA 3LFDA 3HMIA 4XG3A 3BYOA 4RT7A 3WZEA 4JBPA 4L7SA 3DJ7A 2RL5A 1Q3WA 3DNEA 2FSOX 5G6VA 3D83A 3ZUTA 4BZDA 1FVVA 1YHSA 4L3LA 5IA4A 3F2NA 2QOCA 2BZHB 4HYSA 4RFZA 4RX8A 5HLWA 2VTQA 5IH6A 3A4OX 3MB7A 1XBBA 4UY9A 4DFBA 1KE6A 4QTAA 4EOPA 3ZHPC 2OFUA 4YP8A 5J1WA 4J95A 5CEIA 2H34A 2R0UA 4ZY6A 3HA8A 5JSMA 1O6KA 4KINA 4NCTC 3Q9XA 4FVQA 4J53A 2X6DA 3WE8A 3R8MA 4QOXA 3CR0A 4M0YA 3BYMA 1YI3A 5AR5A 2YIXA 3QQFA 2R4BA 3BE2A 3K2LA 3EB0A 4ZTMA 3VS4A 3BCEA 3UO4A 1RE8A 4YJSA 2A4LA 2GNHA 1XWSA 3U6IA 4DFNA 1BI8A 2WQBA 3QLFA 4O1PA 1U54B 5M51A 2OO8X 4XHKB 4BDGA 4TL0A 2IPXA 1VJYA 2IWIA 4UMTA 3I6UA 4DGGA 2HZNA 4LM5A 1QPCA 1YQJA 5AR3A 4LL5A 4M8TA 5B2KA 2FVDA 2ONLA 5HCYA 5GZ8A 4MXOA 3L9PA 1JQHA 3Q32A 4FT7A 3VUKA 4EYJA 5JFWA 5JZJA 3UO5A 4JIKA 2HCKA 3LXNA 4MCVA 3KCFA 3DCVA 5IMXA 2JDVA 1SVGA 4JBOA 2P4IA 3AGLA 3PP0A 4F1MA 4XV3A 3AT2A 1R78A
chains in the Genus database with same CATH superfamily
3ORIA 1E1XA 2QKWB 3W2SA 2BFYA 4C0TA 3QWJA 3PZEA 4DHIB 2XKFA 1LP4A 4LOOA 5ETFA 4JDHA 5IU2A 2JDTA 3BGQA 3SOCA 4I5PA 5AIRA 5HGIA 2NO3A 3GBZA 3FZ1A 3ZUUA 3PVGA 4FIJA 2W1HA 4D2PA 1JSUA 3FLNC 3VUMA 4C3FA 5JGBA 4RWIA 5E8YA 1OPKA 4JBVA 3MI9A 1E9HA 1Y8GA 2R7BA 2QQ7A 4HCUA 4HYHA 5HG8A 3IONA 4O7WA 5LVPA 5IDNA 3W2RA 3FL4A 4CYIA 3RCJA 5F9EA 3O7LB 4NK9A 4XOYA 2C68A 3DK3A 1OKZA 4F70A 2BRMA 3U51A 4V04A 4A4XA 3UPXA 3W0NA 2BMCA 1W8CA 3CGOA 5CI7A 2C6LA 3RK5A 4GG7A 5FXRA 1WFCA 3UBDA 4DFYA 4ERKA 3DXNA 4DHFA 4YUQA 4IX5A 3R2BA 1MUOA 1JBPE 1PYEA 4LDTA 2IG7A 1P4OA 4PL5A 5JQ5A 3O51A 3JPVA 3RWPA 2OH4A 3ITZA 4G9RA 2HWPA 1Q8YA 3MY5A 4FZAB 4NUSA 4YTIA 4M12A 3T9TA 4J7BA 4AACA 5CAPA 4E8AA 4WRGA 4W4XA 4C4JA 4FTMA 4I1ZA 4K8AA 3E8NA 4CLJA 3UJGA 3K3IA 4G6LA 2PZRA 4O91A 3SC1A 3PJ8A 5BPYA 2CCHA 2VO6A 3QC4A 5TT7A 4CKRA 3R1QA 3ZBFA 2DS1A 5GJDA 4EK4A 1QL6A 3ALNA 3LCKA 2GPHA 5HCXA 3LXPA 4E7WA 4FV1A 5K9IA 2Z02A 3RTPA 3QA8A 5H9BA 2C6TA 3WYYA 4AGUA 4D2RA 4YJOA 1J1BA 3KREA 4GKIA 3EYHA 3E8DA 3Q6UA 4FG7A 3PLSA 4RC2A 3H9FA 3FC2A 3A62A 3VS1A 2W4JA 2Z7QA 4HGSA 2OU7A 4G3GA 4L52A 3O50A 3CP9A 5AP2A 5EFQA 1YOLA 4BCFA 5JEBA 3NLBA 3U6HA 5IQBA 4A07A 4B6LA 3QTUA 5EDQA 1M52A 3ORZA 4Y46A 5AP3A 3KMUA 5KMMA 5L4QA 4C34A 3ANRA 2BKKA 3ZSIA 3WYXA 2UZOA 5BVDA 3BWFA 4KIPA 3IW8A 3P9JA 4ZTHA 4QTEA 3FL5A 1OI9A 5JMSA 4GEOA 5ETCA 2HZIA 4KIQA 4RIWB 3PPZA 1ZYDA 3LXKA 3OD6X 4U80A 4GK3A 4KWPA 1WVYA 4NM5A 2LAVA 4FNZA 4F09A 1FQ1B 4XG7A 3VS3A 5EM5A 3VUDA 3GC7A 2PPQA 1WBOA 5EOBA 3CY2A 3WI6A 5LMKA 3EQPA 3BBWA 4WNKA 1W83A 2QODA 3PIZA 4XP2A 1KUTA 2RG6A 1UKHA 3H30A 1OL2A 1MQ4A 4YO6A 5LVOA 2PVFA 4J8MA 4EH6A 2R3HA 5HX6A 4RWJA 1Q41A 3GQIA 3MA6A 1PXPA 3EL7A 5DG5A 3L9NA 4I6LA 5HO8A 4C62A 3FZTA 5CVGA 3RKBA 4DH3A 3K54A 4CFVA 3RINA 4BCIA 3HMPA 3MTLA 3P86A 4G6NA 2VD5A 3EQHA 5CU4A 3NYNA 2QVSE 2WELA 2XRUA 5KCVA 5EHOA 4Q2AA 3TN8A 4BTJA 1RJBA 4PP7A 5LWNA 4ITHA 3Q4ZA 4AFEA 1I44A 4WRSA 5E9EA 3Q4UA 4D4RA 3R00A 3R7VA 5AR2A 2JBOA 3REPA 3MSSA 5FM2A 3I5NA 5DMZA 4AT4A 1Q61A 4O4BB 4XYFA 2RFEA 1OUKA 1Q3DA 2W06A 3QD4A 4ZTLA 5GJFA 3I4BA 4FEWA 2CJMA 5DT0A 3BEGA 3P23A 4O4CA 3T9IA 3VF9A 3QCSA 5DGZA 4M3QA 5AM7A 4AGCA 2YWPA 2FSTX 4O83A 4QTCA 3V5TA 4AW5A 5GINE 3HV4A 3BHHA 1R3CA 2UV2A 4BWPA 4LRJA 3FMMA 3P79A 5HHWA 4F6WA 3KL8A 2YIYA 4YSMA 1ZMVA 2W1EA 4CTBA 3F2AA 3CCNA 4M66A 4E1ZA 2J51A 4DEIA 4ZZOA 5AAEA 4X3FA 3KRJA 4FA2A 1WAKA 4RFMA 1UVRA 3ALOA 3O17A 4D5KA 3O71A 2WMWA 2YCQA 3FZRA 1FVRA 2C0TA 2VV9A 3DV3A 3OBJA 4FZDB 4QMPA 5E92A 1GAGA 4PPBA 4C38A 3FY0A 3PPJA 4DEGA 2C5OA 3QQKA 2ITYA 5HO7A 3VQHA 3OMVA 2PU8A 5KMLA 2X2MA 3CLYA 2G2HA 2R3OA 3F88A 3JY0A 3OT8A 4QMXA 5HICA 1O6LA 5DR2A 4ASEA 4Y95A 2CNVA 4EOIA 5HG9A 3DPKA 4GMYA 4IAYA 3ZOSA 4CVAA 4DDIA 3TT0A 5CAUA 2UZWE 4IACA 2PZ5A 3R8PA 3UG2A 3VW6A 4JDIA 3GT8A 4Q9ZA 5IUHA 2FSLX 4AS0A 4FZFB 4TTHB 2B9HA 4BYIA 5KHXA 3QRUA 4FSTA 2X7FA 4IAAA 4RX9A 4CFNA 4M69A 4BDDA 4DEDA 3IGGA 4AXCA 4ACCA 3ZDUA 1APME 2QOBA 3HRCA 4BCNA 3VHEA 3NUXA 2XBJA 2X0GA 4RIXB 4C4IA 3RAWA 3OXZA 4FTTA 4KIKA 3Q2JA 3MFSA 4HZRA 1SYKA 2BRHA 2UVXA 1WVWA 3BQRA 3OG7A 4JRVA 4O96A 2GDOA 4YLLA 3D7ZA 3C50A 5DEWA 1H01A 4IZYA 2YZLA 3NFFB 5HE1A 3TM0A 4ZLOA 4F0GA 5IQFA 3TYKA 2GHMA 5CNOA 4NH1A 4DCEA 3C4FA 4FTIA 3Q52A 2OZOA 4RIXA 5KMNA 2OXXA 2XP2A 2RGPA 3DFAA 3R7EA 1OBGA 2BZIB 2WMQA 3E7VA 4M97A 4P2KA 3HA6A 5L2IA 1PJKA 1H28A 3LLTA 2XK4A 2WTCA 3II5A 2A1AB 1W2FA 3B2WA 3NSZA 4HVSA 4QP3A 1NVRA 2F4JA 2XNGA 3QYWA 3POOA 3QQGA 5JZNA 5BV3A 2F49A 3THBA 4TPTA 5CX9A 4CV8A 4AUAA 3BZ3A 3A7HA 3G90X 5HE3A 4FNYA 4O0RA 4FIEA 4PQNA 3SG8A 3V8TA 4WHZA 4YJTA 3CTQA 4JG7A 4FKWA 1M2QA 5EQEA 3PXQA 4EUUA 4F9CA 1W84A 3D14A 2JC6A 1WBPA 3PJCA 1YHWA 4AU8A 4K77A 2IVSA 3Q5IA 1NY3A 5J79A 4FKOA 4BN1A 2ITXA 5CF4A 4HYUA 2J2IB 3F5XA 1TQPA 5KKRB 3UP2A 5CZIA 5BYLA 2VTPA 2WMBA 3W8QA 3L9MA 3LFSA 3KF4A 4M7IA 4ASXA 1GZOA 4EI4A 1CTPE 2FA2A 4DFXE 5IUGA 5L6OA 2NRYA 4MQ1A 3N51A 4DG2E 4PV0A 2A27A 2B9IA 3UTOA 4Q5HA 4I92A 4AXAA 3EZRA 4EWQA 2P2HA 2RF9A 4HOKA 5IQIA 2W1GA 5TE0A 3QFVA 3PA4A 4YZCA 1H00A 3UIMA 3ZFMA 5H8BA 4D55A 3ID6C 4DDGA 4IFGA 5L8KA 4LG4A 5IPJA 3ETAA 3E64A 5IA0A 3QGYA 4GRBA 4U7ZA 1OIQA 1ERKA 5C26A 1ND4A 2R3GA 3BV3A 4DGNA 4DH7A 5BVOA 3M2WA 4FVPA 4P4CA 4IW0A 2WEVA 2KULA 4LMNA 3W1FA 4NL0A 5FWKK 3K5VA 4YBKA 2AQXA 3CJFA 4F7JA 4RVKA 4XNEA 3F2RA 2C1BA 3KRWA 5CTPA 3L8VA 3PG3A 2J7TA 4FYOA 1X8BA 2W96B 3GU8A 4K2RA 4ZSGA 4QD6A 4HVDA 4CKJA 5IZFA 2ITZA 5DNRA 2R64A 4GYIA 1WBSA 2XNOA 4RQKA 3IKAA 4JI9A 5C01A 1PHKA 4I0TA 4BC6A 2ZFYA 4U43A 2A19B 1H1PA 4BDFA 4AW1A 2WAJA 2HY81 4MKCA 2BIYA 4BICA 5J9LA 4FTRA 5CI6A 4ID7A 3NNXA 4G5PA 3H10A 4C59A 4V0GB 4R3PA 3KXZA 3PE1A 5AP7A 4G1WA 4CMUA 2J50A 3EFLA 3FZOA 3CQWA 3OCTA 3AC4A 4IVCA 4S33A 2WTIA 2I6LA 3PLAE 3QKKA 4NZWB 3PRIA 4OT5A 2JDRA 1M14A 4YHTA 4MD7E 4BR3A 3TJCA 4FEVA 1B6CB 1Z57A 4FL2A 1OGUA 3CIKA 1YOMA 4FG8A 5AV4A 4O4EA 3S00A 4ZSAA 3SW4A 4TYJA 3SKCA 3A7GA 2GHLA 2PHKA 2YIWA 4RLLA 4BZNA 4F9BA 2XJ1A 2C6KA 3LE6A 1ZY5A 3MDYA 3ZFYA 5CSPA 4GIHA 5A3XA 3RHKA 5HG5A 2WPAA 1TFFA 1Q5KA 5AEPA 3OWJA 3G51A 4IM3A 4J8NA 3TI1A 3PUFC 3KC3A 5EYCA 5LVLA 4TWCA 2W5AA 3QYZA 5BVKA 5HE0A 1K2PA 3GFWA 1MP8A 2W4OA 3MVMA 3LFEA 2JIUA 2V22A 1R39A 3RPOA 4DTAA 4NFNA 3O2MA 3NS9A 2JDOA 1A06A 2UW6A 2GFCA 4FIIA 4L9IA 3VVHA 3RVGA 2VTOA 1OIYA 4E5BA 2R3QA 4UMQA 4ZSLA 2RFNA 5GZ9A 5D9HA 2X8EA 3RALA 2BALA 4DLJA 5LMAA 2JIVA 4BWKA 4YHFA 4X2NA 5L2SA 1LEZA 2QOQA 2WMUA 3Q53A 4MQ2A 3WF5A 4KSQA 3ZTXA 1IRKA 4HJOA 2QKRA 1JKKA 3W0QA 3NCZA 3ELJA 4PX6A 1JLUE 1LPUA 2V7AA 3KXMA 1UNGA 4HZSA 1XKKA 2WOUA 5CU6A 1B39A 2ITNA 4X7QA 4DFLA 5HLPA 4DC2A 3EMGA 4O7ZA 4MXAA 2CKEA 4QTBA 3SG9A 3MJ1A 4YURA 4QMQA 4AAYA 4DITA 1O6YA 4EKLA 3WF7A 4DGOA 2IW8A 4YTHA 4A9YA 3JS2A 3KVWA 4PUZA 2GS2A 5HBHA 3LOKA 2OJJA 1NT2A 4IAFA 3RGFA 2HENA 3GC8A 3FWQA 4EONA 3VJOA 2ETMA 5J5TA 3BI6A 4MWIA 4YJNA 4BKZA 3Q9WA 4CMTA 5ITAA 1H08A 4NSTA 2R3KA 2JEDA 5ANKA 4YO4A 5GJGA 4CT2A 4CNHA 2PVLA 5GNKA 4D0XA 2XARA 3VUGA 4DTKA 2XKDA 4DEEA 3U4UA 5EKNA 2VTNA 2XIYA 4LRMA 4I4FA 3ZEWA 2BRGA 2V55A 3HECA 3TNQB 4RLKA 3ULZA 1PRYA 3QZGA 1UU8A 3E8EA 2ZV2A 3FYKX 4NW6A 2HYYA 3CXWA 3F7WA 3LM5A 4RVLA 3P7BA 3DAKA 4U81A 5H3QA 4FBXA 3ZO1A 1Y6BA 4K6ZA 3H4JA 4B0GA 4E6DA 5KX8A 5AX9A 3ACJA 5AP5A 2F57A 2WGJA 2RKUA 4DYMA 1YXUA 5CAVA 3CPCA 3DBFA 4S2ZA 2YDJA 1CMKE 3G9LX 5CT0A 3L1SA 3TV6A 4DEAA 5BUIA 2VTLA 3EL8A 4EKKA 1J1CA 3SRVA 3WZKA 2OIBA 1NVSA 5LCKA 4MXYA 4FIFA 1WMKA 4ANBA 4P7EA 3POZA 3F9NA 4IH8A 4KSPA 3W33A 3O23A 4AZTA 4K18A 2C6OA 2VN9A 5AA8A 2YJRA 3DGKA 3QF9A 4ARKA 4QTDA 3FQHA 1G8JA 4J71A 2CNQA 2FSMX 4GV1A 4X2FA 4A4LA 1U54A 2C47A 3ODYX 1WBVA 3QZHA 3VBYA 3EH9A 4QMZA 5KUPA 1OECA 3A7IA 4ALVA 3TDWA 3U55A 4PDOA 1Z9XA 2PUUA 3QHWA 1GIHA 4L6QA 4DG0E 1TKIA 1XBCA 3KVXA 4N0SA 4RX7A 1QMZA 1TZDA 1ST4A 4JLCA 4S32A 5K4IA 2VTIA 3EFJA 3MY1A 3AMYA 4I0SA 4O86A 3I7BA 4WNOA 1PYXA 4WA9A 4AZEA 1YDSE 2BAKA 3LXLA 3BGZA 4BGGA 1UU7A 3VC4A 3AC1A 4B8MA 5C8NA 3LCOA 4GT4A 4GU9A 4J97A 3R9NA 4FGRA 3OOGA 4H3QA 4CRSA 2UUEA 3GCQA 4R7HA 5J1VA 4E93A 4YTCA 3ZRKA 4AWIA 4AE9A 4BI0A 2BZKB 2FYSA 2NRUA 4MNFA 2BDWA 4O4FA 2C69A 5B2MA 3D5UA 3LQ8A 5M08A 3Q5ZA 4FV6A 3H9RA 4BFMA 3ZUVA 5TKDA 2B52A 3DBQA 4PDPA 3PG1A 4QMYA 2P3GX 3C9WA 4J52A 5E8VA 2XYNA 4JBQA 4FV5A 4U40A 1OMWA 3PXKA 3SGCA 1YXSA 1SNXA 2ITWA 4QDEA 4YU2A 2QOOA 4EZ3A 3CPBA 3FE3A 3QTWA 1Q4LA 3IQ7A 4YBJA 3S4QA 1FVTA 3W8LA 4ITJA 1H27A 4XLVA 2B54A 3OP5A 3ZLSA 3CQEA 2PUNA 3BYVA 4CFFA 1ZOGA 2P0CA 3MIAA 4JQEA 5G1XA 2Q83A 3LQ3A 4K9YA 4JOAA 4WT6A 3W16A 2PUIA 2WMXA 3DBEA 2QG7A 3QQJA 5E8UA 3NYXA 3EQDA 2O5KA 4TY1A 4H1MA 1T46A 5EDPA 5F95A 2XB7A 4FGBA 5K0XA 3QZIA 2E9PA 2XKEA 5E7RA 5E90A 5M55A 2JKKA 3HUCA 4RJ3A 3SD0A 5M06A 4S30A 3FLQA 3DS6A 3RAHA 4BDHA 4WNMA 3FXWA 5CZHA 4ONAA 5DHJA 4BIBA 1ZWSA 4C4HA 3UZTA 5M4FA 1WVXA 4NEUA 3EHAA 4BKJA 3PUPA 4XG4A 5C9CA 3W2OA 4EHGA 4IDTA 3R7UA 4QP8A 5CQUA 4DINA 3V8WA 1KOBA 3Q3BA 2XK6A 4BCGA 4IZAA 4TYIA 3TIZA 1HCKA 4BKYA 4QP7A 3Q04A 1ZARA 3RM6A 3MFUA 2GMXA 3JY9A 4OR5A 4RIOA 4IVAA 4TNDA 2WMRA 3C4EA 3EIDA 2ITQA 4FOCA 2G2FA 2GFSA 4L7FA 3WF9A 3HL7A 4AZFA 2O63A 5DOSA 3GCSA 5AA9A 3H0ZA 3IGOA 4KKEA 1UNHA 3VHKA 5ANGA 4JVGA 4KBKA 1OIRA 3AGMA 3BYSA 1FMKA 3LAUA 4FX3A 3B2TA 4BRXA 4FUYA 3OTVA 4K33A 1J7LA 3GCPA 1NVQA 2O3PA 4FSYA 2A98A 2ZMCA 4FV2A 4EYMA 5AR8A 4EK6A 4BHZA 4PNIA 2C0IA 4YMJA 4W9WA 3OC1A 3RMFA 3COMA 1YWRA 3RWQA 3KXNA 5I9WA 4OBPA 2CNUA 2C6EA 4YTFA 2AEGA 2WO6A 3QD3A 2VTTA 1XH7A 5EM7A 1NXKA 3TXOA 4C33A 3QUPA 2OLCA 3VS2A 5C8KA 2NNWB 5JRQA 3OS3A 4FZ7A 1W2DA 1ZYCA 1IAHA 4AQKA 5D41A 3RJCA 3VO3A 3KRLA 1PW2A 3F3UA 5CXHA 4IZ7A 3DZOA 4MXXA 1OIUA 4OTGA 5DT4A 4ZK5A 1J7IA 4CEGA 2W1DA 3ZLXA 4FKGA 4MX9A 4UEUA 5FXSA 3QZFA 2I0YA 4Q9SA 1XH9A 1UU3A 5CSWA 3UDTA 1PMUA 5IG1A 4IQ6A 3DLZA 4CFXA 3GEQA 4A7CA 5AAFA 4QQTA 4R3RA 3NUNA 3E88A 3A99A 4FOBA 3HX4A 3ORXA 2CMWA 4LL0A 3PSDA 2XVDA 2CGXA 4LMUA 2FUMA 3QHRA 3DKOA 3IOPA 3A60A 3V5LA 1IAJA 3NZ0A 4FR4A 3COHA 4BJJA 3HAVA 1FPUA 4QP4A 4DH5A 1XJDA 3Q60A 4ZEGA 1WCCA 3WZJA 2WMTA 4F9AA 2CN5A 2I7QA 1PXJA 3FHIA 1REJA 2VTSA 3P08A 3EFWA 2IVVA 2X81A 3NAYA 2JGZA 3CY3A 3SQQA 3ZLWA 3SW7A 4PTEA 3D0EA 1PXKA 4ANQA 4EC9A 4IZ5A 1JOWB 4I24A 3FEGA 4PDSA 2UZLA 3CTJA 2UZUE 4IJPA 3FDNA 4JJRA 5A6OA 3W0RA 3OWLA 2AC5A 3AXWA 3PP1A 5AWMA 3DKCA 5L8JA 4DEBA 3RI1A 4HVIA 3TKUA 4GK4A 1ZMWA 2HWOA 2WOTA 2WQEA 3OUKA 5LARA 3SRVB 4CZYB 5CEPA 3NYOA 3UP7A 5HIBA 3FMEA 4KAOA 1W0XC 4IX6A 4DGLC 4CFUA 1DI8A 3DNDA 3PY0A 2VO3A 3A61A 4G2FA 3CKXA 4GFOA 4U45A 3OW4A 1CSNA 2C0OA 3QRTA 4BVUA 2RIOA 4XG6A 3Q96A 5E8SA 4C61A 2F7EE 4PNKA 3DDQA 3MFRA 5HIEA 4ZMFA 3NVKI 4FNXA 4FKVA 1OB3A 4L01A 3IG7A 4L8MA 3W55A 2JITA 4PF4A 2R2PA 1QPDA 2CDZA 4ANOA 4WSQA 4ENYA 3U9NA 2OXDA 2WQMA 4X2JA 3CS9A 1YOJA 2LGCA 1IA9A 4YR8A 1V0PA 4FEQA 4FV0A 2XNEA 4RGJA 1U46A 3HP5A 4NTSA 2XEYA 2R3MA 3PE2A 4BGQA 4E5AX 5EI8A 1VZOA 1BMKA 1K3AA 4ORKA 2VWVA 5AAGA 2QOFA 4PDYA 3O8UA 5D12A 3CJGA 4IIRA 2GQSA 3BL9A 2UW7A 3FPMA 3V51A 3GU6A 3NW5A 3VBVA 2QO2A 3O7LD 1JKTA 5HOAA 3FKNA 5KMKA 5KBRA 3QTSA 4IAKA 2BAQA 3D7TB 3MGYA 4MD9E 3R63A 5HI2A 4RJ4A 3HYHA 1LUFA 4APCA 4F9YA 4S34A 2F9GA 3AMAA 4GK2A 2J5FA 2C6IA 5EQYA 2H96A 3U8WA 4WUNA 2C3LA 5DRBA 4FL3A 3F3VA 5EYKA 4MTAA 3W18A 4L44A 3BU5A 5EKOA 4ZTSA 3ORPA 1PKGA 4I5HA 3ZZEA 4NYEA 4BJJB 1XH6A 1IG1A 3VULA 4C4GA 2WKMA 3OXTA 3VUHA 5M57A 3COKA 3QQHA 4UXQA 4FV8A 3W10A 4EK5A 2PVKA 2PVHA 4FKLA 4H3PA 2PMNX 2WTKC 5M56A 5T68A 5D7AA 3BLAA 2G2IA 4PY1A 2GTMA 4QNAA 1OVEA 5DFPA 3HDMA 3QLGA 3FAAA 4AXFA 4W4VA 5F4NA 2ZV8A 5DLSA 4FIHA 5BMMA 3ZM4A 4ZMEA 4OTFA 4F78A 4UALA 4IC8A 5CVFA 5HKMA 1GIJA 4V0GA 3UOKA 1MRYA 4WNPA 1QCFA 3MVHA 3O0GA 3K5UA 1PF8A 4MWHA 5FTOA 3ZM9A 4BYJA 3PIXA 4FSMA 5FRIA 3V6RA 3G6HA 3ORLA 2PE2A 3PA3A 2XM8A 4FT3A 5M53A 3FUPA 4D4SA 1XH5A 4MF1A 3OCBA 3QBNA 4IFCA 5A4CA 5EHLA 5A4EA 4ANNA 2PK9A 5B2LA 4U6RA 3UE4A 3EFKA 4B99A 3AC2A 1WBTA 3UNKA 2YIRA 1OKWA 2VTHA 5ETIA 3QWKA 2R3LA 3UC4A 4GL9A 4MK0A 3C0HA 3PTGA 5LQFA 4F7SA 4PTGA 4UYAA 2WXVA 3A2CA 2WTVA 4QYEA 3ORMA 4C2WA 1YW2A 1GY3A 2W5BA 3E93A 2IZSA 5AJQA 2JKMA 2ONLC 3M1SA 4E73A 4PMPA 2E9VA 4Y5HA 3GCVA 2B53A 4HNFA 4OBOA 4ANSA 1UKIA 3F69A 2WNTA 3OFMA 4BZOA 4FKRA 3GU7A 4GCJA 5DIAA 4IX3A 2EXCX 3PPKA 1ZLTA 3KA0A 3ULIA 3PXZA 2FGIA 3JUHA 4R5YA 5DBXA 4AA5A 4PMTA 3I79A 4J1RA 5HORA 4DT9A 1JAMA 2R3NA 2BPMA 2X6EA 4NW5A 4DH1A 4QPSA 2RFSA 5HD7A 1WBNA 3T3UA 1ZZ2A 3NEWA 3V5PA 2Z8CA 3COIA 2IZRA 4EOKA 1KWPA 2XEZA 2YDKA 4D2VA 3ZXZA 4E6QA 2IVUA 2R3IA 3OTUA 5J7HA 4L42A 4C8BA 3F61A 2GS7A 2XH5A 3VRYA 4XX9A 2JBPA 1EH4A 4A9TA 5GZAA 4FTAA 4KBCA 4RSSA 5EI6A 3N4VA 5JFXA 3SXFA 3SVVA 3S2PA 3KB7A 3HMOA 3NW6A 3NNVA 3QCYA 3TZMA 4E6CA 3FQSA 2NYAA 4YHJA 3VS0A 3DDPA 3AKJA 5DWRA 4BBEA 1FINA 2EXMA 5AR7A 4FSWA 5E8ZA 3U4WA 5BNJA 1KSWA 3MFTA 2BTRA 1FGKA 3G0EA 3GNIB 3IECA 2XCHA 4GJ2A 4WSYA 4E4MA 5FD2A 1M7QA 4MBJA 5IEXA 2BVAA 3ZU7A 2QD9A 2XANA 5HO6A 3KULB 3A7JA 4RA4A 2O0UA 2XNMA 4H36A 4XG9A 3R83A 4UXLA 4BY9E 3C51A 5EG3A 4CSVA 4XP3A 5BX0A 1YXVA 4FKJA 4IEBA 4U5JA 4TXCA 4CRLA 3KF7A 4MXZA 3NMUF 3HMMA 3VJNA 4DT8A 2WMVA 3ANQA 2IW9A 4XV1A 5M4CA 3EYGA 1ZAOA 5JKGA 3NUYA 3HV5A 4A9RA 4FSUA 4BWXA 5IMEA 4ZAUA 1GOLA 3N9XA 3MIYA 4ACGA 2R3FA 2CLXA 4O27B 3R21A 2PVJA 5IEYA 5CAOA 1BLXA 1H1WA 4PMSA 3UODA 1DS5A 2QLQA 4CMOA 5BVWA 2C30A 4GFMA 5CWZA 4ZY4A 2J0IA 3R73A 3KY2A 1M2PA 2EVAA 3DK6A 5HG7A 1ZYJA 4C02A 4WG5A 5M07A 4FKTA 4XS2A 5EOLA 2OI4X 2YFXA 3P7CA 4ANLA 2CKPA 4PWNA 3VW8A 5FP5A 5AUTA 3Q2MA 3MBLA 4FF8A 1M2RA 5EM8A 5HNBA 1GJOA 4C7TA 3BL7A 2JAVA 5ICPA 2YWVA 4XRLA 3R9HA 5E8WA 4RVTA 3A7FA 5CEOA 1CKIA 3TV4A 4JNWA 4I6BA 4TYHB 4CTCA 2DUVA 4LFIA 5I4NA 4I41A 1JKLA 4D4YA 2ZYBA 4O2PA 1OPJA 5JH6A 1P14A 2VWIA 4EWHA 2XCKA 4NM7A 4GH2A 3UQCA 2ZAZA 4NWMA 1W2CA 1FBNA 3GB2A 1YDRE 2W1FA 4G9CA 4UZHA 2XYUA 5BYYA 3ORNA 1DAYA 3T8OA 3QRJA 2BUJA 5FTGA 3CKWA 3D2IA 3DAEA 1BUHA 3C4XA 4HPTE 2BCJA 2HZ0A 3PA5A 3TL8A 4LV5A 3OCGA 3QD2B 1IR3A 2Y7JA 2BHHA 4G31A 2R3PA 3FLZA 3TG1A 1P2AA 3QQUA 2VNYA 3LCDA 4GS6A 3GCUA 5C8MA 2BR1A 4FYNA 1SVEA 3TNPC 3S0OA 3DFCB 4P5ZA 4O7LA 2J0JA 1H07A 4L68A 4QMWA 3VQUA 1ST0A 2YCSA 2GNGA 4KS7A 3RK7A 3W32A 1H26A 4J98A 3ERKA 3BQCA 3HRBA 5IQGA 3CD3A 3KN5A 2YCRA 3F3WA 4I94A 2RG5A 4ERWA 4D5HA 4DLIA 4O1OA 4USDA 2QONA 4AOTA 2ZB0A 1QPEA 1U5RA 3KN6A 4RC4A 4RVMA 3W2PA 4USEA 4F7NA 4TZRA 4BTKA 3BWJA 4O0UA 4NT4A 4R7BA 4IM0A 2XNNA 5CSVA 4BIEA 2PVYA 4GSBA 1U59A 4LV8A 2OIQA 3C7QA 2WTJA 1J3HA 4XBUA 5HIDA 1M17A 4IAZA 4O4DA 2V0DA 4AN2A 3JXWA 3LLAA 3RNYA 3KIOC 3FI4A 1YI6A 3PXFA 2YN8A 2Y4IC 2PTKA 3FLYA 5HNGA 3TZ8A 3TUDA 4QQJA 3PVWA 4QYGA 5HEZA 2H9VA 4EORA 1AQ1A 4TWPA 2REIA 3CGFA 5HBEA 1XH4A 1PXNA 2BDJA 1YWVA 2RFDA 5DA3A 4BHNA 2YCFA 3E92A 1VLRA 5LVNA 1BYGA 2X1NA 3GC9A 4QQ5A 5DN3A 3Q9ZA 5AP6A 5JFVA 2HXQA 4JT3A 4TT7A 4L67A 3R22A 5BYZA 3KQ7A 3O5AA 3NW7A 4G3EA 4BCHA 3OCSA 3GI3A 3TUCA 3AT4A 3UIXA 5C1QB 3ENMA 2BKZA 4II5A 5AUYA 2OBJA 3D15A 3VAPA 2HW7A