4AACA

P38alpha map kinase bound to cmpd 29
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
355
structure length
350
Chain Sequence
b'RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNILTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
publication title The Discovery of N-Cyclopropyl-4-Methyl-3-[6--(4-Methylpiperazin-1-Yl-4-Oxoquinazolin-3(4H)-Yl]Benzamide (Azd6703), a Clinical P38Alpha Map Kinase Inhibitor for the Treatment of Inflammatory Diseases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 105
structure length 350
sequence length 355
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4aacA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aacA01
5TE0A 2QLQA 4XG9A 3QRIA 5GJFA 2YDKA 3NPCA 4WSYA 4RZWA 5D7AA 4YTFA 3HLLA 2YM3A 4EHGA 1GZOA 4RPVA 2YM8A 4KSPA 4AGWA 4E5BA 3SLSA 2ZM1A 4N70A 3ZXZA 3PYYA 4WO5A 3GOKA 1OVEA 3I7BA 4IB0A 2V22A 5AV1A 5M44A 1Y6BA 4TWPA 3T3VA 4EZ7A 3R8PA 2RFNA 3FQEA 3SKCA 4NUSA 3F3WA 5CXZA 4MXAA 2XIZA 5CU0A 2JFLA 2XA4A 3OTUA 4LMNA 1SNXA 5EQYA 1YVJA 4EK4A 4IC8A 5ANEA 3UP2A 3ACKA 3QTUA 5AAGA 4X3FA 4Z55A 2BCJA 3FYJX 5EHLA 3ET7A 2R4BA 1HCLA 1GIHA 4M69B 3HGKA 4S33A 5IA5A 4ACMA 4U5JA 2OIBA 3FI3A 5HBHA 1W0XC 3ANQA 4ACCA 2PK9A 3FLQA 4C4EA 4NKAA 4EOJA 3LHJA 5H8EA 4LYNA 5BYYA 4YNOA 3ZC5A 4QPAA 4CFWA 3QUDA 3DK3A 3OF0A 4U41A 5HEZA 3E87A 4AT3A 4UMUA 3O8PA 4MD7E 4YHFA 5I9UA 4K77A 1PXNA 5ETFA 4ACHA 2BZJA 3DNEA 3ZO2A 1NVRA 3H9RA 5I5ZA 5EOLA 2ZB0A 2QOQA 1H0WA 3D7TA 3IECA 3PZHA 4LG4A 2ETKA 2VTOA 3UG2A 3NVMB 4FEXA 4L42A 3UZRA 5C8KA 3PTGA 3F7WA 5H8BA 3ZZWA 3DGKA 4H3PA 3VF8A 3AMBA 5TT7A 4UMRA 5J5SA 3CQEA 4DTAA 1OKWA 4ZLOA 4L3PA 4IB5A 4LRKA 3P08A 4ZOGA 4OT6A 4BGHA 3WI6A 2JLDA 2OFVA 5JFWA 2OH4A 2QKRA 5CF4A 1T46A 3VHEA 3OP5A 2PY3A 3LQ5A 3ROCA 5IDNA 3EJ1A 4R3RA 1Q97A 3BLHA 3OXZA 4V0GB 4W9WA 5DNRA 5EFQA 5HE1A 4GKIA 2H8HA 4FZFB 4I5CA 5FP6A 4IAYA 1ZYSA 2R7IA 3ORMA 3RP9A 3W10A 3R9DA 2PMLX 2PE1A 1UU7A 1RJBA 3QYZA 2JDRA 1APME 4F0IA 3VS0A 3DTCA 2JIUA 4JR3A 4MWHA 2PPQA 3CIKA 4R1VA 2DS1A 3M2WA 3BYUA 2LAVA 3GVUA 4FIHA 1WBSA 1Y6AA 4PL5A 4C34A 5M4FA 2ITQA 3FSKA 2WAJA 2G2IA 5CS6A 2CCIA 3VUDA 4DH1A 4G3CA 4D1ZA 3TV7A 2YLFA 3KXHA 5CWZA 5EKOA 4BIEA 4CFXA 3PXKA 5FUTA 3EWHA 4KNBA 5BVFA 4MX9A 2O2UA 5HU3A 4TY1A 4AACA 4BCMA 4BVUA 1FOTA 5FTOA 5JGBA 4BDKA 1U46A 3N4UA 3EN6A 3UQGA 2WZJA 3E8CA 2NP8A 1ZZ2A 4FTKA 3S0OA 5IQEA 4AUAA 4W4VA 1SVHA 2YIRA 4IWOA 5CI6A 3POZA 2VTRA 3ZH8A 3UQFA 3E88A 4ANMA 4L3JA 3AD4A 3GQLA 2FSOX 3PY3A 5JZNA 2CGXA 1Q24A 4O0VA 5CLPA 1DS5A 1R0EA 4DFXE 4YMJA 5B2KA 3VRYA 3AXWA 3KL8A 4K2RA 2BIYA 2QKWB 4XCUA 4IVBA 5BMSA 2JDTA 1V0BA 5AV4A 4RMZA 1PMNA 1U4DA 4E4MA 2C1BA 4LGDA 1UU8A 3I6UA 2ZM3A 3KRRA 2I0HA 4RFMA 1Q8UA 4ALVA 3PLSA 4ANQA 1LPUA 3OOGA 2OJ9A 2ITTA 5DH3A 3MIYA 4M69A 4FZ6A 1YW2A 3SXFA 4GIIA 1U5RA 1G8AA 1OUYA 2OZOA 1CKIA 3UOJA 4FZAB 5AR7A 2VX1A 4PL4A 3FI8A 4QYGA 3RALA 4CTCA 2XBAA 4YHJA 2VWWA 3O7LD 4FYNA 4MWIA 5DR6A 4HYHA 4PQNA 3ENHA 3SX9A 2CNUA 3HAVA 4RFZA 4I6QA 4TT7A 1QPCA 2C6OA 2XYUA 5EW9A 5JRQA 2IW6A 2WQEA 5EM7A 5C01A 3TZ7A 4QRCA 4XP2A 4EYMA 4FZDB 4QP6A 2PE0A 3OEZA 4AW0A 3HV5A 4I92A 4YZDA 3UIXA 4F63A 2R3OA 1H8FA 3UNJA 4AFJA 4O86A 3O8UA 3R00A 5EI8A 4FKOA 2B7AA 4FT9A 3TT0A 4H3QA 3FJQE 3EIDA 3SOAA 3FLNC 2YEXA 2QVSE 4U44A 2J51A 4ZMEA 3UPZA 1M7NA 4ZSEA 2A2AA 4C3RA 3LFQA 1QPEA 3U8WA 2YCFA 3FI4A 2WEIA 4MNEA 3ATSA 3TUCA 4F0GA 4AA5A 5CF8A 3U4WA 3FMJA 1WBPA 4UY9A 3Q32A 5D7VA 4BCFA 4EOPA 4L3LA 4IMYA 3QZGA 3R71A 4GYIA 5EW8A 4G17A 3Q96A 3QTQA 3RJCA 3ZDIA 2FA2A 4NT4A 4L8MA 4HZRA 4KIQA 3EHAA 4LMUA 5HVJA 4RWKA 3DTWA 4ENXA 3RPVA 2ITZA 4ANOA 4FT0A 1IASA 3PIYA 3ZSHA 3GCSA 4Y95A 5DE2A 3KRXA 4XV9A 1LEZA 4FTUA 4FE2A 4KSQA 2PTKA 3L9LA 1J1CA 3DLZA 3ZLXA 3D14A 3UYTA 3I60A 4KS8A 3SRVA 2R3QA 2UW7A 4CRSA 5IH4A 3Q5IA 3U6IA 4U3YA 3NSZA 2GNHA 2XKDA 4XP3A 5LVLA 3LMGA 4D9UA 2VTJA 4I41A 4I5PA 5M07A 1X8BA 5L4QA 1ZWSA 3OCBA 4IJPA 1OL5A 3PJ2A 1KE7A 3DBQA 3M1SA 3ORIA 5C03A 1UV5A 4CFFA 2IPXA 3NAXA 3QUEA 2BHHA 3FV8A 3SHEA 4BIBA 3UG1A 3KC3A 3ZBXA 5B2MA 5A4QA 1REKA 4F08A 4HCTA 2QOOA 2XIXA 3Q53A 2AYPA 4BY9E 2KTYA 3G5DA 5KMNA 2C30A 1F0QA 2ONLA 4QP9A 3FQHA 5CI7A 4FSNA 2VTHA 4AOIA 3AD5A 2ZDTA 3AD6A 3LFNA 2QO2A 5ACKA 4N6YA 4J52A 3NYVA 4I21A 4BICA 3MVLA 2YJSA 2VGOA 1JVPP 3SC1A 2ITXA 3GC7A 3MH3A 3JR1A 1BLXA 2E2BA 2O65A 2O5KA 4B9DA 2PWLA 4GT4A 4RC2A 5AX9A 2BKZA 4MD9E 2WELA 3ODZX 1YXVA 2VO3A 4AOJA 5AWMA 4FTTA 3IQ7A 3H0YA 5LMBA 5HG9A 3DBDA 3ORKA 1ZARA 4F1MA 1P4FA 4K9YA 4BTKA 3G2FA 4YTIA 1PRYA 3DT1A 3N4TA 3KXGA 1O9UA 3VW8A 2VX0A 2YDIA 2XRWA 3KCKA 3RPYA 4FTIA 2WQBA 3ZFMA 2HXLA 3QC9A 4OTFA 3TNPC 3CP9A 4L7FA 3LCSA 3QCQA 3RK9A 2I0YA 5E92A 3OXTA 4CFUA 4KRCA 1CTPE 4HOKA 3ZRKA 3OROA 4IZ5A 3A60A 2PULA 1JKKA 4IBMA 4MCVA 3P86A 4M84A 2AUHA 4RJ4A 5CVHA 1ZY4A 3MFTA 4JRVA 4WNPA 4AU8A 4ZLYA 2QO7A 1K2PA 1JNKA 3L8SA 2WMTA 5LVOA 4JOAA 1GZNA 3ZDUA 1ND4A 4RLKA 1ZMUA 4TNDA 4FR4A 4OBQA 2UZTA 4WBBB 4G3GA 4PNIA 4RVLA 4E8AA 5HD7A 2IZUA 3DAEA 3MJ2A 2V0DA 4WOVA 1UWJA 4FNXA 4NEUA 4O1OA 4FG8A 4JG8A 5I4NA 1R3CA 5HE0A 4Y72A 2JKOA 3R28A 2GNFA 3P9JA 4RC4A 4TPTA 3VS7A 1PY5A 1R0PA 4JJRA 4ZZNA 3S00A 1FMKA 4PPAA 4WD5A 1XH9A 5EQPA 2CSNA 4QPSA 3QF9A 3C9WA 4N0SA 5L8KA 3BRBA 3Q04A 2WTWA 4BBFA 4IIRA 3ALNA 3F82A 3H0ZA 3EKKA 2OI4X 3UOHA 3EL8A 5KMOA 1V0PA 4MKCA 3EQPA 4Y73A 4Z3VA 5HVKA 3NUXA 4AGCA 3UO6A 4FEQA 3RGFA 4PNKA 5IISA 2WQMA 5LVMA 3KREA 2OXYA 2WHBA 5EH0A 3V8TA 3PE2A 3ZC6A 3IW4A 2UVYA 2BRNA 5EI6A 4E7WA 3LW0A 3DFAA 5FLFA 5EHOA 5KCVA 4C7TA 3C0HA 3H10A 3HVCA 4KIPA 4O0XA 4DT8A 3DBEA 4DA5A 4FG7A 1Q8YA 4QOXA 5EI2A 4C8BA 4JT3A 3UVQA 2X4FA 4XEYA 4NU1A 4YLLA 4F9BA 4DBXA 1R39A 2YFXA 3P78A 2GTMA 5E90A 2XKEA 4NK9A 5EYKA 4BDGA 4OTIA 3WF9A 2RGPA 2X39A 5IQIA 3G6HA 4XHKB 5CF6A 2B9FA 4GS6A 5CEOA 1YOJA 4BDJA 3GGFA 4HPUE 1UKIA 4DE4A 4UN0C 2F4JA 3TJDA 2Y7JA 5L8JA 3NEWA 5A4CA 4YURA 1ZY5A 2QOBA 3CPBA 3OHTA 4C57A 2G2HA 4DG3E 2R3MA 2F2UA 4M7IA 4OTHA 5I9YA 3IPHA 3IOPA 1OZ1A 3QBNA 4YC3A 5FBNC 3VF9A 2ZVAA 4ANBA 1SYKA 4D0WA 1GNGA 5CXHA 2NO3A 5DYJA 3ROYA 3WF8A 3WOWA 4AG8A 4X2GA 4O83A 5B7VA 3R1NA 2VV9A 2BZKB 4CKRA 2OK1A 5HE2A 3QCXA 3R8LA 4F7NA 4FT5A 3ANRA 4J1RA 4C58A 3GC9A 3LFSA 4JG7A 3LVPA 4TZRA 4KD1A 3OCGA 2FO0A 1L3RE 3PJ8A 4QMTA 4L45A 4O6LA 4O0RA 4GV1A 3CKWA 1OM1A 4Z7GA 3IGOA 5AA8A 3N51A 4IB3A 4QQ5A 3OVVA 2NRYA 4PDOA 2CGVA 3QKKA 5M4CA 2QR8A 4QMXA 1K9AA 3AT3A 3QD2B 3C0GA 4FKVA 4IW0A 5ANKA 3NW5A 4RBLA 3OWPA 4NL0A 3GENA 4YC8A 3O51A 5KKRB 3CLYA 4DYMA 3U4UA 1OI9A 4U6RA 3PXFA 4QP4A 5AR4A 4EORA 4DH3A 5HLNA 2XP2A 4RJ6A 4IVDA 2XK4A 4O7YA 2QNJA 3NX8A 4RC3A 1P4OA 2A4LA 3BHVA 3RM6A 4TWOA 3FKNA 5GZAA 3LMHA 1CMKE 4R78A 2ACXA 4TYEA 5LMKC 4BL1A 5KMIA 3DK6A 4IHPA 1E1XA 3F9NA 3OG7A 2RG6A 2ZV2A 1YXTA 2RSVA 1QL6A 4W9XA 3EQBA 3G33A 4ZXTA 5BVKA 4OGRA 3QD3A 4EK6A 5A4TA 3K5UA 4FV0A 4I5MA 3LM0A 4R7HA 4N4SA 3F2NA 3SGCA 2J7TA 2JAMA 3ZM4A 4FYOA 4JBVA 4BCQA 1WVWA 4AN3A 4DN5A 4BDIA 3P5KA 3TIYA 4CMOA 4D58A 5DG5A 3MFSA 5AUZA 5AUTA 3FXZA 4E73A 5CEKA 2PL0A 4PP9A 4DHFA 5AJQA 2BRHA 3QGYA 4G3DA 3F5UA 5IKWA 2OG8A 4FIJA 4RIXB 4YO6A 4BI0A 3SQQA 2C3LA 3EOCA 4IFGA 2ITNA 2P33A 3BV2A 1V0OA 3Q6UA 4KBKA 4WBOA 3C5IA 4D9TA 5AUWA 2C5NA 4NM7A 4ZSLA 3ETAA 3PUPA 4M97A 4P5ZA 3UC3A 4AXAA 1H26A 5CY3A 2IVVA 4FV5A 2GU8A 3BE2A 2BROA 4HNFA 2PVKA 5IH6A 2WMBA 3PIZA 2W0JA 4FGRA 4DTKA 4RRVA 3U87A 4ITHA 4QTAA 4I20A 4IAIA 3NIEA 4MYGA 5T6KA 3RZFA 3GT8A 3SV0A 4DGGA 2BFYA 4R3PA 1FGKA 2R3PA 2RIOA 3IKAA 5M55A 2A27A 4JG6A 1NVQA 2YCRA 5E8ZA 3S3IA 3VUIA 3KEXA 4BDDA 3WBLA 3KRLA 2YAKA 4NW5A 2XIYA 1FVTA 4DGNA 5IU2A 2V62A 4WKQA 4V01A 2X4ZA 4BWPA 5AR3A 2B54A 2HZ0A 3FLSA 3NW7A 4D4SA 4HVHA 4YZCA 5BYLA 4EQMA 4K18A 2EVAA 4PTGA 3JPVA 2UZWE 5IA2A 3A2CA 3BYVA 3I6WA 4QT1A 2CGWA 3BYMA 1UNGA 3LCKA 3DXNA 4X3JA 4IFCA 1YQJA 2ITPA 2JGZA 2VD5A 2JD5A 5DA3A 3NRMA 3ACJA 4J71A 2A19B 3RCDA 2FSTX 4FODA 2X2KA 5IG1A 3A7HA 3KULB 4QP3A 2JAVA 2XH5A 4YSJA 5AP1A 3HP5A 4F64A 3KKVA 4FMQA 1OKVA 5C8MA 4TL0A 1GOLA 1BKXA 2QOCA 4IADA 5IEYA 2VTAA 4FV4A 3LLAA 4EJ7A 3VNTA 5CQWA 3VS6A 1JAMA 1FBNA 3SG9A 4R5SA 3IDBA 5C8NA 3VBYA 2XMYA 5FRIA 4IANA 1OMWA 4AWIA 4OUCA 2IJMA 5CTPA 3HUBA 4R8QA 3PXZA 2X2MA 4BCNA 4E3CA 4S34A 3O2MA 3RPRA 1KWPA 3QAME 4WRGA 5ETAA 4DH8A 3DBFA 4F7SA 3LLTA 2XKCA 4PMSA 2YACA 2XIKA 5HNGA 3EL7A 3VS2A 3ZO1A 5CF5A 2Y6OA 5J7HA 3GFWA 4I4FA 4IDVA 3FMMA 4C2WA 4IAZA 2UZLA 3LAUA 3RNIA 3L8XA 4G1WA 5JEBA 4FTNA 2ITWA 2WMSA 4IEBA 4TTHB 4X3FB 2PU8A 3I0OA 2QC6A 4LGHA 4TYHB 5CSVA 3A99A 5ACBC 2ZOQA 3MTLA 3H4JA 4FTOA 4I0RA 1YOLA 4O82A 3IW7A 2BTSA 4F9CA 4EH4A 2GQRA 3D4QA 3UODA 3PLAE 2OZAA 3O96A 4JIKA 2UW5A 3CBLA 1ZMWA 1OECA 1OL1A 1QCFA 2UW6A 4GT5A 5K4IA 4TN6A 3G6GA 4FOCA 2PUUA 3UDBA 4F4PA 4AA0A 5M4IA 5IUIA 3E93A 2OF2A 4EQUA 1BL7A 3DPKA 1ZMVA 3CCNA 3G15A 1YI3A 1QPDA 4B99A 3PSDA 4ZS0A 4AQCA 2PZ5A 5C1QB 4EK5A 4FKQA 4U3ZA 4ENYA 3Q2JA 3T9TA 2C5XA 3MN3A 2WMVA 3LPBA 5HO8A 4DFBA 2FB8A 3ZONA 4MTAA 2R9SA 4FSZA 4EK8A 4TRLA 3EYHA 4YU2A 3ENMA 1OL7A 2QHMA 3VS3A 4IM2A 2QODA 4RZVA 4ZSGA 2W4KA 3PXYA 2BALA 2C3JA 4APPA 3BI6A 1HCKA 4XJ0A 2ERKA 5AV0A 3HV3A 5CZHA 3PP0A 4EC8A 3AC1A 2XCHA 3GFEA 4J99A 4RX9A 4TXCA 3FHRA 5DEWA 3JS2A 4FUYA 3LXNA 4BDBA 4D5HA 1H1WA 3KN6A 4NIFA 1I44A 3KXNA 3H9OA 3REPA 5L2QA 3FKOA 3PA4A 3IG7A 3TZ8A 4XLIA 4PMPA 4EH6A 1BI7A 4O38A 4BN1A 3BV3A 4FKPA 4ZLZA 2JDSA 4E5WA 3ULZA 5E4HA 5LVNA 2A1AB 3DDPA 3R1YA 4XS2A 3EQFA 5BUEA 1H1SA 1YOMA 3EFWA 2XCKA 1JOWB 1URWA 3UIBA 4AW5A 3TNIA 3EQHA 4EUUA 4NFNA 3RTPA 1JQHA 5HVYA 3PE1A 1VEBA 2B0QA 4C02A 1QMZA 3Q9ZA 4QMWA 5I9XA 4AF3A 4A4LA 3AT2A 2VX3A 3I1AA 4I5HA 5EYMA 4M14A 4D2VA 2WNTA 2HCKA 4RVTA 4EOIA 1E9HA 3Q4CA 3ZSIA 4E6CA 5AP0A 2XNEA 3GC0A 3VBQA 3WZJA 2UZUE 3HKOA 3COKA 2ITUA 4EK3A 5LARA 3MESA 5KHXA 3UE4A 2HAKA 4IX5A 4HGLA 1OPJA 2C3KA 4J8NA 2CLXA 2Y4IC 4N6ZA 3QL8A 2YABA 5BYZA 2IZTA 5E7RA 3ZMMA 4TYHA 1BL6A 2YM4A 3VW6A 3NNWA 3WF5A 1Y8GA 5IQDA 5CU6A 3LQ3A 3QHRA 4DCAA 2J0MB 3B2TA 3NW6A 3OT3A 3P4KA 3R30A 2NRUA 3WYXA 4HW7A 2ZM4A 4E6QA 1TVOA 4O0TA 4FSQA 4I93A 4LV5A 4OBPA 5H9BA 4JDHA 3FBVA 4WNOA 2R3HA 3OBGA 4ANNA 4APCA 2GNGA 4O22A 4QMUA 4MXOA 2GS6A 4M12A 4C36A 1MUOA 5JGDA 4UMQA 3HX4A 4D2WA 3V5QA 5BVWA 2GMXA 5A3XA 3RNYA 5IA4A 3KMUA 4MVFA 3ZTXA 4C4IA 2VO7A 3FKLA 2EB2A 2R7BA 4H1JA 4PWNA 4R7BA 5L6OA 2ZJWA 4Q9SA 4BGQA 3OOMA 3VBVA 4ZMFA 2BRGA 3QWJA 2VTSA 3LIJA 2EU9A 5FXSA 4PL3A 2E9VA 3FL5A 1XH4A 3E7OA 3QQFA 4GUBA 4L46A 3NZ0A 4MD8E 4TWCA 3ZFYA 5T68A 2O0UA 4GU9A 4I23A 4MNEB 4XG3A 4BWXA 1YKRA 4NZWB 4YBKA 2XNPA 5LCKA 3G9LX 3RVGA 3ZEWA 3ZRMA 2NNWB 2XYNA 3QD4A 2BDWA 4DEGA 3EQRA 4EOSA 3AT4A 4TYGA 4LM5A 2WD1A 3HA8A 3R21A 4XLVA 3NUSA 3QQLA 4R7IA 1O6LA 4MAOA 3ZOSA 3DNDA 4B6LA 4DAWA 1Q8TA 5HI2A 3NUPA 5CX9A 2J5EA 2IWIA 3NR9A 3ZS5A 4WRSA 1YHSA 1ZZLA 3THBA 4CSVA 4C3FA 5IQCA 3HMMA 4D2SA 1DAYA 3QYWA 3O17A 4IACA 5AV3A 3PPZA 2C68A 4A9UA 4IWDA 4DEHA 3SRVB 4PDPA 3NYNA 5J5TA 3CSVA 3MVMA 3TG1A 4F1OA 4JIAA 4UMPA 3GCUA 3PWDA 5A9UA 4Y8DA 4D1SA 1FQ1B 3DKFA 3LZBA 4O7SA 4BCIA 4ONAA 4DG0E 4O91A 5E8YA 4GT3A 2W17A 3MYGA 4KABA 4XOYA 4CFNA 5LCJA 4A07A 5FXRA 1MRUA 4FSMA 3QU0A 3BHYA 3U6HA 5B2LA 5IQAA 3KXMA 4H1MA 3L9MA 4E5AX 2C6MA 4A9YA 4CEGA 4Z7HA 3FXWA 3V3VA 5M53A 2QOHA 3CC6A 4J97A 4AW2A 3ZO3A 1IA8A 2VWUA 3EN5A 3QRJA 2QG7A 5J95A 3EN9A 1IAHA 3CTQA 4C33A 2CJMA 4D1XA 2F49A 3IW6A 2RFEA 2WTKC 3GP0A 3H9FA 4D4RA 5D41A 5K0XA 3DXQA 4CNHA 3D0EA 4JLCA 1KUTA 4KB8A 5DRBA 1G8SA 4MXXA 3CD3A 2XK9A 4USEA 3QGWA 3FEGA 3G0EA 3E64A 4GVAA 2VO6A 3FLWA 3P7BA 3H3CA 1GIIA 4HCUA 4EWQA 1M7QA 4JL9A 4C59A 3RK5A 5DOSA 4AZTA 5KX8A 1YI6A 1Z57A 2XUUA 3D2KA 5FDXA 5C9CA 2W5AA 1KOBA 2RFDA 1FVVA 1OUKA 5IQFA 1U54A 2E9PA 4LUDA 3ZO4A 3FMLA 3ZUUA 2CDZA 4RX7A 2ZYBA 2PVFA 3D2IA 4Q9ZA 1M14A 3F5GA 3ORXA 1S9JA 4GRBA 4YSMA 4NW6A 3BU3A 3OXIA 5EQEA 3FUPA 3KF7A 2KULA 2J4ZA 4GU6A 4K1BA 2WQNA 4QMOA 3LKMA 1YWNA 2OJFE 2IVUA 2HK5A 1WBWA 1K3AA 3OW4A 4QP8A 5FP5A 1IG1A 3DZOA 2PVRA 5DLSA 3A61A 5IEVA 1WBTA 5HICA 3HRFA 3PRFA 1IEPA 3MWUA 2OJJA 5DIAA 1V1KA 4TYJA 5DR9A 4JQ8A 4AP7A 5AX3A 3GB2A 3G51A 5CSHA 3FE3A 4M0YA 3SDJA 3PG3A 4FNYA 1WBOA 4B8LA 2OO8X 3MW1A 4YJRA 3UIMA 3MA6A 3SW7A 4O2ZA 3HRBA 2CKPA 3IGGA 5AP6A 2P55A 4UALA 4AW1A 3ZLYA 4CLJA 4M8TA 5HX6A 4ZZMA 5JFSA 1CKJA 4HNIA 1GZ8A 1BMKA 1ZOEA 4Y5QA 3R7VA 4CD0A 4L7SA 2PVJA 3P7AA 3V8SA 1XH8A 4USDA 4NCTC 4WNMA 5BPYA 4FT3A 3UOLA 1H0VA 4E26A 2IW9A 5J7BA 4CCUA 4U97A 1NY3A 1DI8A 2WU6A 2BZIB 5DT3A 3QWKA 2BMCA 4GG7A 4WT6A 3RWQA 3UZPA 1XQZA 1UNLA 3MTFA 3A62A 3MH0A 4AGUA 2RL5A 5LXMA 3R8UA 5HO6A 3ERKA 2VTQA 2XJ2A 3QQGA 5H8GA 1XHAA 3LXKA 3LMIA 2GNJA 3NLBA 5KKRC 4EOOA 5CAVA 3NGAA 3PXRA 5DN3A 4FC0A 2CGUA 3VUGA 2QLUA 4IX4A 5M56A 3EQCA 4TWNA 2YIYA 4W4YA 2PZPA 2VWXA 1OITA 5GNKA 4NFMA 2PUIA 1OGUA 2QG5A 2Z2WA 1Z5MA 2ZV7A 3KK9A 1UU9A 4FT7A 4HGSA 1RQQA 4YNEA 1XKKA 2Q0NA 3IS5A 3P23A 4JBQA 5CT7A 3JVSA 4DT9A 4FV2A 3I79A 2LGCA 4IAFA 3FZTA 2UZDA 5HCZA 3DU8A 5A14A 2B4SB 4U40A 5L8LA 5C4KA 4G9CA 1STCE 5I9ZA 4EBVA 2EB3A 5J87A 2R0UA 3QA8A 4BWKA 3R9NA 3E8DA 3HZTA 3II5A 4NM3A 4RJ5A 4RGJA 2J6MA 4GK3A 4XG4A 5CQUA 1OB3A 5GHVA 5TKDA 4WUNA 3RI1A 1J7LA 4KIOA 2CMWA 4XG6A 5M09A 1L8TA 3NUAA 4WUAA 4MF1A 4QO9A 2OSCA 3TTJA 3MI9A 3UC4A 5KZ0A 3VUMA 3UZTA 1XBAA 4C37A 2G15A 5HCXA 1PXPA 4XOZA 1G5SA 2WMAA 3A4PA 2R3IA 3KQ7A 4QYHA 3TIZA 1YDSE 1OIQA 3LJ0A 4LFIA 1IR3A 5AR8A 3E63A 2I0EA 4WIHA 3ULIA 2C0OA 2ZMDA 3QTWA 3F5PA 2GNIA 2X0GA 2R5TA 4BGGA 3P79A 4DFYA 4BDEA 3AMAA 2Z7RA 2QOFA 3NCGA 1H27A 1MP8A 2XBJA 3V5WA 2XM8A 4FEVA 1W8CA 2DYLA 5GIPE 3LQ8A 2PZRA 3ATTA 3FYKX 4BKJA 1ZYJA 1Z9XA 2XK7A 5I3RA 3ZUVA 4B7TA 2VTNA 2BHEA 4I6BA 2QURA 5BX0A 1JSUA 1XH6A 1YXXA 3F3UA 3GBZA 2V55A 4P2KA 3UGCA 3QALE 3TCPA 3VHKA 4CVAA 5HNBA 1OKYA 2QOKA 2RG5A 3V5TA 2WTJA 1B38A 3G9NA 5TOZA 2XM9A 3DOGA 3SG8A 4HYSA 4NM0A 4FEUA 4QQTA 3R7OA 2F57A 3OFMA 2JDOA 4MEDA 2PE2A 4MBIA 4AAAA 5CU4A 2OJIA 4ACDA 5FQDC 4U8ZA 3UIUA 4AFEA 3OC1A 4PF4A 4G3FA 2C5YA 4RFYA 5T3QA 1NVSA 1RW8A 1CDKA 5TF9A 3O23A 4K11A 1JLUE 1B39A 2XS0A 3DZQA 4FKLA 2GHGA 4QMPA 5FDPA 3C4FA 3BEGA 2I6LA 4F09A 3WE4A 4DFZE 3W1FA 4UYNA 5D1JA 2UW0A 4FSYA 4BTFA 2XNNA 3R02A 5K5XA 2WOUA 4K8AA 4JAJA 1VR2A 4FKGA 3W8LA 2J0JA 1U59A 4YJPA 4E6DA 4RWJA 3DJ5A 4BCPA 2XB7A 4LRJA 4ALUA 3F7ZA 3VVHA 3R0TA 5HTIA 1R1WA 1OL6A 1KE8A 2GCDA 1PMVA 3MVHA 2OU7A 5AP3A 3PPJA 2FSLX 2VWBA 4CTBA 5KMLA 5AIKA 3E5AA 2J2IB 4JBPA 5AV2A 2HW7A 3BHUA 4EH2A 1FVRA 3BBWA 4Q5HA 4ZP5A 4CRLA 1E1VA 2OXDA 4G6LA 1GZKA 3GC8A 2FUMA 4X3FC 4C61A 2Y9QA 4BC6A 3Q5ZA 4O7RA 3EYGA 1F5QA 3D5XA 4G6NA 4YTCA 5HLWA 4YJOA 4G6OA 2Q83A 2J90A 4FV1A 3UVRA 2W06A 2IO6A 4G16A 1ZXEA 4QTCA 4XV1A 3UOKA 4BDAA 5M4UA 3OWLA 3QTIA 1W7HA 5G6VA 4CYJA 1M17A 4OTQA 4MH7A 3TV6A 4YUQA 2CN8A 4X0MA 4AGDA 4DGLC 2JBOA 5JFVA 4QP1A 4RA5A 2UZNA 5AEPA 3ZM9A 2JITA 1VZOA 4U0IA 2X81A 4PPCA 4FIFA 3DA6A 4R5YA 5JN2A 5EHYA 2WGJA 3BBTB 3RMFA 3VRZA 5D11A 2Q0BA 5F4NA 3AMYA 4IZ7A 4YJUA 3QUPA 3VUKA 4AN9A 5KHWA 3AC2A 3MH2A 3TM0A 3MBLA 2YWPA 4TW9A 4RIWB 2IZSA 5CSPA 3TTIA 4F0FA 3ZYAA 4FIGA 4LOPA 2HENA 3R6XA 5JH6A 5IMEA 2C4GA 4EH3A 2W4OA 3CTJA 3K3JA 4J95A 4D55A 4E4XA 3EQGA 5JQ8A 5EM8A 4G31A 2JEDA 3BQRA 5CENA 3HV4A 5HNIX 3TKIA 4M3QA 4GH2A 1GJOA 5E8XA 4KUJA 2RKUA 4E20A 3CTHA 4BCGA 3DJ6A 5EDPA 4FV3A 1WZYA 4K6ZA 4FK6A 4RLLA 4X21A 5HORA 3OWJA 3VQHA 3U55A 5C4LA 1EH4A 2YERA 4CZYB 1H25A 4BYIA 2BR1A 1KOAA 4FL3A 4EH8A 4FIIA 1HOWA 3FZPA 5I9WA 5KMMA 4ZZOA 3U9NA 3VIDA 4IQ6A 4OW8A 3VWAA 4CT2A 4XG7A 4RG0A 4UZHA 5HD4A 2HOGA 3WILA 4AT5A 3F3ZA 2YWVA 4ZTRA 2CCHA 2UV2A 3TKUA 5HU9A 3AGLA 2VWZA 3FMDA 4EH5A 4ZJIA 5I9VA 1JPAA 3F3VA 2BRBA 2OZAB 3C13A 4X7QA 3UVPA 4KKGA 2HWPA 3IOKA 5A54A 1J7UA 4GIHA 3F6XA 3W33A 2X9EA 4FL2A 3OWKA 4R6VA 4W4XA 3V5PA 2VU3A 2OFUA 4BB4A 4BF2A 2BAJA 2XK6A 4ZAUA 5KBQA 3MY1A 4ZY5A 2PYWA 4J98A 4O1PA 3SA0A 4HYIA 2PZIA 1MRVA 3QLFA 4R3CA 3ID6C 4QNAA 5A6NA 2QO9A 5CEIA 5CAQA 1DI9A 2XK8A 4GJ2A 5GIOE 3B8QA 3MB6A 1XWSA 5IA3A 4IX6A 3PIXA 2OLCA 5FEQA 3HAMA 3CXWA 3DCVA 4DTBA 1OBDA 2OKRA 3W55A 2WO6A 2X7GA 1SM2A 3AOXA 3HUCA 1BI8A 2W05A 4CXAA 3VBWA 1FPUA 4ASXA 5IZFA 2C0TA 4UXQA 3LCTA 4FKUA 2OGVA 3MVJA 4WA9A 2W1FA 2Y6MA 4YP8A 2JIVA 4J53A 4OTGA 3OCSA 4C4JA 2XEYA 4MBJA 3MGYA 5CEPA 2C6LA 4XX9A 1RE8A 4YO4A 2B9IA 2DWBA 3AQVA 4BHNA 5KBRA 2VGPA 3KRJA 3BU5A 3DK7A 4U9AA 5C26A 2BKKA 4NIFB 3KVXA 4YJTA 2XEZA 5HIEA 4J8MA 4CG8A 4X6RA 1UNHA 3U54A 4I6FA 2ITYA 4E4NA 5EKNA 3ORLA 4KBCA 4BI2A 2XF0A 1FINA 4JS8A 4O0UA 1RDQE 1JKLA 3ORPA 5AUXA 4FV6A 4IZAA 4RIWA 3FWQA 4EONA 1VYZA 5KE0A 2HZIA 4KWPA 4EEVA 2XNGA 4NCTA 3QTSA 3BLRA 3MB7A 3RAWA 3GCVA 4CYIA 4HGEA 4IM0A 2H9VA 3UJGA 2CKOA 4RIOA 2PSQA 4UX9A 3TNWA 3MFRA 3ORZA 3QX4A 4KIKA 3ODYX 3OMVA 4FTCA 1F3MC 4ZSJA 3O8TA 5F20A 5JRSA 4HYUA 4HVDA 2GHLA 2W4JA 3ZZEA 4OTPA 5AUYA 3PG1A 4GG5A 1PJKA 1PXLA 3LE6A 4HVSA 5J1VA 5CANA 3MDYA 1YWVA 3BE9A 3BQCA 4P4CA 1AD5A 3C4CA 4NJ3A 3RAIA 1IA9A 5HX8A 1A9UA 1YXUA 2WTDA 3POOA 3UYSA 3HRCA 4UB7A 3BIZA 2VO0A 3E92A 4A7CA 4UYAA 2IVSA 5JSMA 2F7ZE 4DINA 3NYOA 4LUEA 4GL9A 1H24A 2P4IA 3MY0A 3R7YA 5AAFA 2REIA 3JY9A 1H1PA 4LV8A 3NYXA 4NTSA 2W1GA 5CSXA 4XG2A 4YGAA 3FQSA 4NJDA 4E4LA 3L9PA 3KA0A 3EFLA 3GCPA 5IQHA 4NTTA 5IA1A 2GSFA 4FSWA 5IUGA 4FTJA 4EOQA 1OIRA 2EWAA 4IM3A 3FPMA 4L00A 4FTMA 1M2PA 2DUVA 5AR2A 5EDQA 4EI4A 3LFCA 1PHKA 3NAYA 4O0YA 2W9FB 3GUBA 3K3IA 5AUVA 3IW8A 4EH9A 5LQFA 4ZTNA 3R83A 3BU6A 3GOPA 3OEFX 4EUTA 2P2IA 3U51A 2EXEA 3DQWA 2V5QA 3DLSA 4RQVA 2W99B 4D0XA 4NYEA 1ZAOA 2X8DA 2WMUA 3ELJA 3EZVA 4KS7A 1OIUA 2EXMA 3P7CA 4L67A 2ZAZA 4GYGA 5JFXA 1BUHA 3BKBA 4YPSA 3TUDA 3LM5A 5E1EA 3SD0A 4ITIA 2ITVA 2GNLA 4DLJA 2YHVA 1PYXA 3R73A 4OTRA 3QCSA 3R22A 4FGBA 5DGZA 5KMJA 5DHJA 3W2OA 2WTVA 4P7EA 4GUEA 4M68A 3CJGA 3F5XA 3QKLA 3W16A 2PUPA 1PMUA 4UMTA 3VUTA 4IXPA 4CV9A 1J91A 4MF0A 4ALWA 4CCBA 2VWYA 4BBEA 4OTWA 1Q3WA 3JVRA 3OT8A 5L2WA 5LWMA 3OS3A 4OLIA 3MPAA 2C0IA 4U79A 3NNVA 3LXPA 2I1MA 4KINA 4ZTHA 3BGPA 2UVZA 2HELA 3BX5A 4Y85A 4F65A 4G3EA 4FNZA 3CY3A 3MY5A 4UZDA 2XVDA 2VWVA 3RZBA 2ZMCA 4GVJA 3TI1A 5KUPA 1VJYA 4ZS4A 2WMXA 4CQGA 4ZY6A 2XNOA 3NIZA 4FBXA 4XP0A 3QZFA 4JI9A 4YLJA 4O84A 4XMOA 3UMWA 3VULA 5AIRA 4L6QA 5JT2A 2GHMA 2GDOA 3D15A 4KAOA 2IN6A 5AP2A 1M2QA 2EUFB 4DH5A 4AZVA 5BUJA 3A8WA 5BVOA 3N9XA 3KXXA 4FZ7A 3FMNA 1O6KA 4IE9A 3QRKA 4JDJA 5L2SA 4O7NA 3ZXTA 3OCTA 4W8DA 2J5FA 2BILB 3GU4A 4GSBA 4LOQA 4ZJVA 5DBXA 2YJRA 3S4QA 2WOTA 2E9OA 2X6DA 3I5NA 4QD6A 1OBGA 3HP2A 4O7LA 3VO3A 4O6EA 3O71A 5J8IA 4A9RA 5KNJA 2JKMA 4F9WA 2YAAA 3QD0A 5D12A 3BWFA 3A7JA 1PXJA 3Q9WA 2PUNA 2JDVA 4FOBA 5K5NA 2JKKA 3LFDA 1NXKA 3BLQA 4DITA 2YN8A 2W5BA 4H39A 5FM3A 3G90X 3TJCA 4OAUC 4LRMA 4HVGA 2C5VA 2VRXA 3CR0A 3I4BA 3LFBA 2CKEA 3IW5A 3QKMA 4ARKA 5ITAA 3TUBA 4BDCA 2FGIA 4GFGA 1GIJA 2JFMA 1Q4LA 4XBRA 4EOKA 3L8VA 3QZIA 2B53A 4L9IA 3IDCA 3PXQA 4ZY4A 5JK3A 1IRKA 2P3GX 2VN9A 3Q2MA 2CPKE 4J7BA 3W18A 4ANLA 4B8MA 4FEWA 1U54B 4H58A 2YLEA 4JNWA 3GU5A 3CGOA 4B0GA 2BTRA 2WIHA 4DFNA 2HYYA 4I24A 4WNKA 3G0FA 3FSFA 3OD6X 3DBCA 4FVQA 4IAKA 1UA2A 1Q5KA 5J9YA 3KMMA 4FVRA 2UW9A 4Q2AA 3TXOA 4DEBA 4M13A 5LVPA 4X2FA 2CHLA 4P90A 5EK7A 2VTIA 2J0IA 4B4LA 3M42A 1ATPE 5AFVA 3U6JA 5CASA 3VN9A 4OT5A 1OKZA 4FKJA 5FBOA 1TQPA 3PA3A 5EM5A 4PMMA 4L52A 5FWKK 4DEEA 3D94A 1OIYA 4ACGA 4QMNA 1M52A 1XR1A 3FZRA 4MXCA 5AM7A 5E8TA 5F1ZA 3RAHA 3VAPA 4ZSAA 3N4VA 4FTLA 4PX6A 4QYYA 3LCDA 4U43A 4E93A 2X9FA 3W2CA 4AN2A 4YC6A 4ASDA 1ZYCA 1NT2A 2WFYA 2O63A 4IX3A 2FH9A 3V51A 1LUFA 1ZRZA 4FK3A 5AM6A 4FKRA 2WTIA 2F2CB 2W5HA 4D28A 5AA9A 2Y4PA 1OL2A 3MFUA 5FGKA 3TZ9A 1PMEA 4JR7A 3W2QA 4HVIA 3EN7A 3Q4TA 5EW3A 3V6SA 4LGGA 3K5VA 3V5JA 3EQDA 3JY0A 1YWRA 5GJDA 2R3JA 2YISA 4FV8A 3S95A 3GU7A 5IF1A 3NS9A 3ZUTA 5JKGA 2ETRA 2YIXA 1PKDA 3PZEA 4FSUA 4EZ3A 5LMKA 4FI1A 3BHHA 4OTDA 4IVCA 4QMZA 2HY0A 3C51A 3R2YA 2GS2A 4AA4A 3NVKI 1ZYDA 2WB8A 4JXFA 4AOTA 3KY2A 4H3BA 3VQUA 1H08A 2VWIA 4A06A 4HGTA 2BFXA 5HTBA 2W1HA 5HLPA 5IQBA 3ITZA 5ANDA 4CKJA 2R3LA 4DLIA 3UBDA 5L6PA 2ZV9A 4TKSA 3RHKA 1PXIA 4PPBA 5E1SA 5CAOA 4XH6A 3ZU7A 3UPXA 4BTJA 2QR7A 5IPJA 5LOHA 4CGAA 5FEEA 2OIQA 3HV7A 2QONA 3C50A 3KN5A 5ETCA 2IG7A 3HDNA 4O81A 2VNWA 2I40A 1PXKA 3V6RA 4S31A 4BDFA 4JRNA 1J7IA 4G2FA 4DEIA 3DXPA 4II5A 4PTEA 2QQ7A 3FZSA 4L53A 2WMWA 4W8EA 1Q8WA 1SNUA 4C4HA 5M57A 3PJ1A 1UU3A 3R01A 2PVHA 4I0TA 3WIGA 3WZDA 3GQIA 4GCJA 3R1SA 5GZ8A 2OJGA 2QU6A 3MPMA 4D2PA 1YHVA 4PY1A 5D9HA 3LJ2A 2J0LA 2B55A 1KSWA 4AZFA 4CFVA 3D5UA 5FTQA 2XJ0A 1YRPA 4MQ2A 4RT7A 4FG9A 2PMNX 2YDJA 4QNYA 4OR5A 2AC3A 4IDTA 3Q3BA 4PDYA 4YR8A 2WXVA 2YIQA 3COMA 3P1AA 4X2KA 3QQUA 3T9IA 4AZEA 4JDKA 2O8YA 3MA3A 2BAKA 2VTMA 1XBCA 3GI3A 2Z7SA 5HCYA 5HOAA 3DJ7A 5K3YA 2WKMA 3TKHA 1XO2B 1H00A 2ZDUA 2X8EA 3JUHA 3PWYA 3R7GA 2GPHA 3COIA 4NSTA 4U80A 4V04A 4DGOA 4L68A 3RCJA 3FLYA 2F9GA 3OTVA 4FTQA 3QFVA 4RWIA 3MS9A 4JX3A 3GNIB 4DCEA 4EQCA 3OW3A 4Y46A 4K33A 4DFLA 1PYEA 1YI4A 2VNYA 3C7QA 3QQKA 4FKIA 1KE6A 4CV8A 1WMKA 3PY0A 1MQ4A 4O96A 3F2RA 4ITJA 5E8VA 4XRJA 5A4LA 3COHA 3ZFXA 5FD2A 2W96B 4C4FA 4EL9A 4QP7A 4ZK5A 5DFPA 5GZ9A 4UWCA 4UEUA 4EBWA 3FL4A 3VC4A 4EKLA 2W9ZB 2X2LA 4PTCA 4BYJA 2WMQA 3EN4A 4ZJJA 3SOCA 2I0VA 4AS0A 4YZMA 5EM6A 3WF7A 1I09A 2R3KA 3QRUA 4KBAA 5ANGA 3QTZA 2CNVA 4CG9A 2GQSA 3T3UA 4V0GA 5DEYA 3KVWA 3Q4UA 4DFUA 4DF3A 4GK4A 2R0IA 4OBOA 4XG8A 1T45A 3B2WA 3R7IA 3I81A 3RK7A 4R77A 3RWPA 5CU3A 3A7FA 4YLKA 5IDPA 4IJ9A 4QMLA 2V7AA 3ORNA 4QMSA 4UBAA 4YBJA 3VBTA 4BCHA 5K4JA 5LJJA 2HWOA 5EDRA 2QD9A 4O7WA 5CVFA 1XH5A 3R7EA 3FDNA 3OUNB 2X7FA 3PRIA 3RKBA 5HBJA 3R2BA 1SZMA 2Y4IB 4ZTQA 4DH7A 4I1ZA 3QQJA 4WG4A 2G2FA 3I5ZA 3LCOA 1PXOA 3EH9A 3TN8A 1PXMA 1A48A 5CNNA 3TACA 4P5QA 2G1TA 3UP7A 2SRCA 4F9AA 2UVXA 3ALOA 2OW3A 3TEIA 3CY2A 3VS5A 4JDIA 4BCOA 3RPOA 4MHAA 2X6EA 3D5WA 4MXZA 3QLGA 1P5EA 5FM2A 5DPVA 4QMMA 5J1WA 3NUNA 3R8ZA 3BYSA 4IB1A 3BZ3A 4F6WA 4M66A 1TQIA 4UWYA 2VTTA 4DBNA 3A4OX 4QYFA 3QZHA 3DFCB 4IVAA 4QQJA 4BR3A 2RF9A 5BNJA 4MNFA 1KE5A 1UWHA 1Q62A 4BKZA 4I6HA 1LR4A 1WAKA 2BVAA 3A7GA 3L1SA 3PVGA 3RM7A 4FVPA 4C4GA 4QQCA 3TDVA 1SVGA 4F9YA 2IVTA 5BVEA 4EWHA 3Q9YA 3RAKA 5AUUA 1H07A 3PSBA 4NKSA 2HXQA 5G1XA 5HE3A 5JZJA 3C4XA 1DAWA 4K0YA 4XNEA 4CFMA 4IWPA 5AAEA 1OPLA 4G5JA 3UNZA 4EHVA 1JKTA 3R9OA 2E9NA 5AP4A 2EXCX 5H2UA 2QCSA 4EOLA 3R04A 4YZNA 4XUFA 3VBXA 3CS9A 4ASZA 3S1HA 1YHWA 5F95A 3W8QA 4IAAA 5TR6A 1PW2A 5A6OA 2UZBA 1Q3DA 3TL8A 2O64A 3F61A 1WBVA 1FGIA 4ZTSA 3VS1A 3TZMA 4RJ7A 3WZEA 2R3RA 5E9EA 4BCJA 2FSMX 3PVWA 3PY1A 4G5PA 5E8WA 4D4VA 1ZOHA 3TNHA 2Y0AA 5JGAA 5L6WL 4NH1A 1YXSA 4CZTA 5DI1A 1YDRE 2XRUA 4IH8A 3GU8A 1FMOE 4LL0A 5CYIA 4O0WA 3EFKA 4IZYA 2UW4A 3ZLWA 5M51A 3EZRA 3KF4A 2C5OA 2XJ1A 4XBUA 5HO7A 1ZLTA 4JVGA 3HMNA 5HZNA 1H1QA 3VUHA 2BIKB 3IDPA 3MV5A 4ERWA 2YM7A 4GEOA 5CNOA 4CQEA 3DAKA 1XBBA 3BGZA 2WMRA 3QQHA 2AC5A 3SAYA 3W2PA 5L2IA 2I7QA 3HECA 4F7JA 2Y8OA 4FKTA 3Q52A 5EYDA 3PJCA 5CSWA 4YHTA 2B1PA 1CM8A 1Y91A 1H28A 5GJGA 1GAGA 3RBWA 3NCZA 4QMQA 2B52A 2C6KA 4GK2A 3C0IA 3I7CA 4O0SA 1QPJA 2HW6A 3F66A 4PV0A 5H3QA 4BZOA 4RX5A 2BAQA 4BHZA 5GINE 5IH5A 2WTKB 2XZSA 2QOIA 4C2VA 3V01A 3PDTA 1SVEA 3D9VA 5IQGA 3NMUF 2VTLA 1ERKA 2YM5A 5DT0A 5HG5A 5HBEA 4M0ZA 3P0MA 4UXLA 1H4LA 4DC2A 4ZIMA 1O6YA 2W7XA 3OBJA 1W84A 2YM6A 3DKGA 3LFAA 4O27B 4BZNA 4F6UA 1R78A 4O7ZA 4FSTA 3EB0A 5FTGA 2P0CA 4QPMA 3AC3A 3UO5A 2PMIA 3R8MA 5ICPA 1W98A 3OUKA 3WF6A 3CEKA 2UUEA 5IEXA 4QP2A 3FAAA 4EKKA 2GQGA 5ANJA 3OZ6A 1JWHA 1TQMA 2F7EE 3OY3A 3L8PA 3CD8A 5DR2A 4BI1A 3LOKA 3JYAA 3LJ1A 1Q61A 3C5UA 3VS4A 2GTNA 4G9RA 4QYEA 3O0GA 3A8XA 4JQ7A 5CAPA 3BWJA 3QTXA 3LFFA 2BRMA 4C0TA 4GW8A 2YA9A 3C1XA 3DV3A 4DG2E 5FG8A 1LEWA 3SXSA 3UQCA 2JKQA 3V8WA 4HCVA 5L2TA 2R3GA 5KO1A 1WFCA 2XK3A 4TNBA 3TWJA 3ZLSA 5HG8A 4QTEA 2UZEA 1Y8YA 5D10A 4MBLA 2FVDA 4EHEA 4S32A 3EMGA 3QXPA 4Y5HA 3SW4A 3VJOA 2IW8A 2QOLA 3C4ZA 2H96A 4PDSA 3UTOA 4BIDA 2P2HA 4R1YA 2W1ZA 3CJFA 3ORTA 4RJ8A 2HY81 3CQWA 4D4YA 2VUWA 2JC6A 3GCQA 4LOOA 2R3FA 5CT0A 2HIWA 4NWMA 4MK0A 2OXXA 4WG5A 5DRDA 5HQ0A 2ITOA 4KA3A 4LQMA 5CU2A 3R63A 4A4XA 5TO8A 4CZUA 2R64A 5L3AA 4TYIA 2YCSA 4F1TA 4BRXA 1UKHA 3QXOA 4O2PA 3L9NA 2Z02A 2WEVA 3E3PA 4CLIA 1ZYLA 3GXLA 3WZUA 5M08A 3VJNA 4KKEA 1XJDA 4YZBA 2UZVA 5DVRA 5F94A 2ZV8A 3K2LA 5HGIA 4FA2A 3BPRA 5IA0A 4KIKB 2BUJA 4WSQA 1BYGA 1Q41A 3FZ1A 3F69A 3KRWA 4XV3A 2ESMA 2C6EA 3BGQA 4X2JA 1AGWA 3HMPA 2OH0E 4I22A 3KGAA 1KE9A 1P2AA 3MPTA 5K9IA 4RVKA 4FKSA 3ZRLA 4YJQA 2CN5A 4O7VA 4JQEA 4ZTLA 3PJ3A 1VYWA 4WHZA 4XRLA 3EFJA 2DQ7X 2B9HA 3CPCA 3WZKA 2JBPA 2J50A 3O50A 3R9HA 5CEMA 4QTBA 5E8UA 5F9EA 1KV1A 2PVLA 5BVDA 1BX6A 5KMKA 4E6AA 2OWBA 4PMTA 3UNKA 3C4EA 3QRTA 4G34A 4Q5EA 5I3OA 4D2TA 3HV6A 5HIDA 2W1EA 3Q6WA 3MJ1A 4F70A 2ETMA 5BUIA 2OIDA 4FUXA 2XNMA 3RINA 5DT4A 4MQ1A 2NPQA 1Q8ZA 4GKHA 3M11A 4U81A 3RPSA 2PHKA 2W1IA 2VZ6A 4U7ZA 3FPQA 4KKHA 2YCQA 3WYYA 4L01A 3NUUA 4JX7A 1PF8A 4BKYA 3HA6A 5JQ5A 3PVBA 4J96A 3FY2A 1WVYA 4UWBA 3IONA 2VAGA 4EHZA 2HZ4A 3CKXA 2O3PA 3MH1A 3ZBFA 4YJNA 2OF4A 4HJOA 4PUZA 4ZTMA 4YZ9A 4S2ZA 4AZWA 3FHIA 5AR5A 4E1ZA 3PP1A 1M2RA 3BYOA 3LFEA 3HMIA 2ERZE 5AP5A 2QI8A 5ANOA 4A4OA 1IAJA 1DM2A 3DQXA 4U42A 2WU7A 1TKIA 3HNGA 4W4WA 5AMNA 3DAJA 3FY0A 4PRJA 1JSVA 4I4EA 3DY7A 5CVGA 5HG7A 4BFMA 2R3NA 3FZOA 1H1RA 3PVUA 3QHWA 3MIAA 4YTHA 3RHXA 4FF8A 3WE8A 4C3PA 3PA5A 2E9UA 4Z16A 4H05A 2Z60A 4D5KA 2C6IA 2PMOX 4NM5A 3EQIA 1P14A 1W83A 2RFSA 3KB7A 4FL1A 1SMHA 2R2PA 1Q99A 3OY1A 2CKQA 3B8RA 4LI5A 5EOBA 3IK3A 4ASEA 4RIYB 1NA7A 3IO7A 3KCFA 4GMYA 4RJ3A 3H30A 3QA0A 4ANSA 3CGFA 5E8SA 3UO4A 3DB6A 2X7OA 4BDHA 2HZNA 2OICA 2GS7A 4Y83A 5BQ0A 2W1CA 2X8IA 3LXLA 4RVMA 2OBJA 4IC7A 4FICA 3EKNA 3D83A 4U45A 3CE3A 4JBOA 2PZYA 4CT1A 3KXZA 1JBPE 3FMKA 3Q4ZA 3ZCLA 4F7LA 3W2RA 4FKWA 3AG9A 5HESA 3R1QA 3NUYA 1JSTA 2PVYA 1B6CB 1MQBA 4FX3A 4M15A 4CMTA 2J9MA 2VTPA 4MXYA 5LWNA 5C27A 3HMOA 3U9CA 3AC4A 2YZAA 3KFAA 4F99A 5LMAA 3NNUA 1A06A 1J1BA 3I0QA 2ZB1A 3CQUA 4EH7A 2C47A 1W82A 3DS6A 3D7ZA 4OAVB 4BBMA 2XIRA 3KU2A 2V7OA 3HYHA 3W2SA 5DMZA 4I94A 2B9JA 4FSRA 4DGMA 3DKOA 4AE6A 4AE9A 1WBNA 2C6TA 2YIWA 3R8VA 4RWLA 3FC1X 5M06A 4D2RA 3V5LA 3R9RA 4QMVA 4YJVA 5BVNA 3V04A 2Z8CA 3WARA 4YPDA 4BCKA 1Y57A 4CMUA 5J9LA 3KMWA 3NWWA 4EOMA 3E8EA 4QMYA 3Q9XA 4EZ5A 5J9ZA 4I3ZA 3MSSA 2A0CX 4LL5A 4AX8A 4C62A 4DEAA 3DB8A 1YDTE 4RX8A 3AC5A 3DDQA 2G01A 4I0SA 4UV0A 2PVMA 5AP7A 2PVNA 2QU5A 4GJ3A 1REJA 5FEDA 4N57A 3E3BX 4XV2A 4RQKA 3HL7A 5AADA 4USFA 2WPAA 3HDMA 1UVRA 1WVXA 4BTMA 4DEDA 4EYJA 2Z7QA 3A7IA 2ONLC 4O21A 5ANIA 1OPKA 4Z9LA 3DKCA 4F6SA 1MRYA 5ETIA 5HIBA 2WIPA 1PKGA 5IMXA 4WG3A 5HTCA 2FYSA 1JKSA 4RSSA 5CZIA 1H01A 2GFCA 3E62A 2H34A 4IWQA 5DWRA 3T8OA 3FMEA 4ZEGA 2BDJA 3AGMA 3C4WA 4RIXA 3F2AA 2GFSA 1GY3A 4FTRA 4HPTE 4EC9A 3PFQA 5A46A 2WQOA 3WIKA 4X6QC 4ID7A 2BZHB 5KZIA 2JIIA 1LP4A 4JAIA 4YJSA 3UMXA 3PSCA 5E91A 3Q60A 4QTDA 4FV9A 3QTRA 3GU6A 2XNBA 3ZSGA 4FNWA 3BEAA 3D7TB 1U5QA 2C69A 4RA4A 1AQ1A 2W1DA 4GFOA 4L43A 3KK8A 3TV4A 4FTAA 4ORKA 4RIYA 5CAUA 2UZOA 4X2NA 3FXXA 2YZLA 3AC8A 5BMMA 3BELA 2G9XA 1NW1A 5A4EA 2C6DA 4A9SA 2XKFA 2X1NA 3BCEA 4O7TA 4C35A 2UW8A 2H6DA 3BHTA 3FMHA 4S30A 4FIEA 5FXQA 3ZEPA 4AT4A 4H36A 3QC4A 4KRDA 3SVVA 2C1AA 2F7XE 3JXWA 4A9TA 3D5VA 5EG3A 2BPMA 2QHNA 1WCCA 3O7LB 3F88A 1ZOGA 4M67A 5HKMA 2CNQA 4EJNA 1XH7A 4L44A 4ERKA 4C38A 3QCYA 3NDMA 1CKPA 3GEQA 1CSNA 2Z7LA 3QX2A 4CKIA 2BDFA 3HEGA 5EYCA 1KV2A 2J0KA 4AZSA 3TNQB 5HHWA 4BZDA 5IUHA 3K54A 4XYFA 3FC2A 3ZHPC 4PP7A 3W32A 5K0KA 5I0BA 1J3HA 3E7VA 5J79A 2WTCA 3S2PA 5CALA 5JMSA 3NNXA 1S9IA 4FV7A 1G3NA 4GFMA 5B0XA 3KULA 4V05A 5CEQA 3R7UA 1URCA 2UW3A 3TDWA 2YITA 3F3TA 3FI2A 2C3IB 2CLQA 3E8NA 3PPKA 3FLZA 3SXRA 4HZSA 2IZRA
chains in the Genus database with same CATH superfamily
5TE0A 2QLQA 4XG9A 3QRIA 5GJFA 2YDKA 3NPCA 4WSYA 4RZWA 5D7AA 4YTFA 3HLLA 2YM3A 4EHGA 1GZOA 4RPVA 2YM8A 4KSPA 4AGWA 4E5BA 3SLSA 2ZM1A 4N70A 3ZXZA 3PYYA 4WO5A 3GOKA 1OVEA 3I7BA 4IB0A 2V22A 5AV1A 5M44A 1Y6BA 4TWPA 3T3VA 4EZ7A 3R8PA 2RFNA 3FQEA 3SKCA 4NUSA 3F3WA 5CXZA 4MXAA 2XIZA 5CU0A 2JFLA 2XA4A 3OTUA 4LMNA 1SNXA 5EQYA 1YVJA 3ML1A 4EK4A 4IC8A 5ANEA 3UP2A 3ACKA 3QTUA 5AAGA 4X3FA 4Z55A 2BCJA 3FYJX 5EHLA 3ET7A 2R4BA 1HCLA 1GIHA 4M69B 3HGKA 4S33A 5IA5A 4ACMA 4U5JA 2OIBA 3FI3A 5HBHA 1W0XC 3ANQA 4ACCA 2PK9A 3FLQA 4C4EA 4NKAA 4EOJA 3LHJA 5H8EA 4LYNA 5BYYA 4YNOA 3ZC5A 4QPAA 4CFWA 3QUDA 3DK3A 3OF0A 4U41A 5HEZA 3E87A 4AT3A 4UMUA 3O8PA 4MD7E 4YHFA 5I9UA 4K77A 1PXNA 5ETFA 4ACHA 2BZJA 3DNEA 3ZO2A 1NVRA 3H9RA 5I5ZA 5EOLA 2ZB0A 4FJVA 2QOQA 1H0WA 3D7TA 3IECA 3PZHA 4LG4A 2ETKA 2VTOA 3UG2A 3NVMB 4FEXA 4L42A 3UZRA 5C8KA 3PTGA 3F7WA 5H8BA 3ZZWA 1ST4A 3DGKA 4H3PA 3VF8A 3AMBA 5TT7A 4UMRA 5J5SA 3CQEA 4DTAA 1OKWA 4ZLOA 4L3PA 4IB5A 4LRKA 3P08A 4ZOGA 4OT6A 4BGHA 3WI6A 2JLDA 2OFVA 5JFWA 2OH4A 2QKRA 5CF4A 1T46A 3VHEA 3OP5A 2PY3A 3LQ5A 3ROCA 5IDNA 3EJ1A 4R3RA 1Q97A 3BLHA 3OXZA 4V0GB 4W9WA 5DNRA 5EFQA 5HE1A 4GKIA 2H8HA 4FZFB 4I5CA 5FP6A 4IAYA 1ZYSA 2R7IA 3ORMA 3RP9A 3W10A 3R9DA 2PMLX 2PE1A 1UU7A 1RJBA 3QYZA 2JDRA 1APME 4F0IA 3VS0A 5BV3A 3DTCA 2JIUA 4JR3A 4MWHA 2PPQA 3CIKA 4R1VA 2DS1A 3M2WA 3BYUA 2LAVA 3GVUA 4FIHA 1WBSA 1Y6AA 4PL5A 4C34A 5M4FA 2ITQA 3FSKA 2WAJA 2G2IA 5CS6A 2CCIA 3VUDA 4DH1A 4G3CA 4D1ZA 3TV7A 2YLFA 3KXHA 5CWZA 5EKOA 4BIEA 4CFXA 3PXKA 5FUTA 3EWHA 4KNBA 5BVFA 4MX9A 2O2UA 5HU3A 4TY1A 4AACA 4BCMA 4BVUA 1FOTA 5FTOA 5JGBA 4BDKA 1U46A 3N4UA 3EN6A 3UQGA 2WZJA 3E8CA 2NP8A 1ZZ2A 4FTKA 3S0OA 5IQEA 4AUAA 4W4VA 1SVHA 2YIRA 4IWOA 5CI6A 3POZA 2VTRA 3ZH8A 3UQFA 3E88A 4ANMA 4L3JA 3AD4A 3GQLA 2FSOX 3PY3A 5JZNA 2CGXA 1Q24A 4O0VA 5CLPA 1DS5A 1R0EA 4DFXE 4YMJA 5B2KA 3VRYA 3AXWA 3KL8A 4K2RA 2BIYA 2QKWB 4XCUA 4IVBA 5BMSA 2JDTA 1V0BA 5AV4A 4RMZA 1PMNA 1U4DA 4E4MA 2C1BA 4LGDA 1UU8A 3I6UA 2ZM3A 3KRRA 2I0HA 4RFMA 1Q8UA 4ALVA 3PLSA 4ANQA 4QDEA 1LPUA 3OOGA 2OJ9A 2ITTA 5DH3A 2NYAA 3MIYA 4M69A 4FZ6A 1YW2A 3SXFA 4GIIA 1U5RA 1G8AA 1OUYA 2OZOA 1CKIA 3UOJA 4FZAB 5AR7A 2VX1A 4PL4A 3FI8A 4QYGA 3RALA 4CTCA 2XBAA 4YHJA 2VWWA 3O7LD 4FYNA 4MWIA 5DR6A 4HYHA 4PQNA 3ENHA 3SX9A 2CNUA 3HAVA 4RFZA 4I6QA 4TT7A 1QPCA 2C6OA 2XYUA 5EW9A 5JRQA 2IW6A 2WQEA 5EM7A 5C01A 3TZ7A 4QRCA 4XP2A 4EYMA 4FZDB 4QP6A 2PE0A 3OEZA 4AW0A 3HV5A 4I92A 4YZDA 3UIXA 4F63A 2R3OA 1H8FA 3UNJA 4AFJA 2IF8A 3O8UA 3R00A 5EI8A 4O86A 4FKOA 2B7AA 4FT9A 3TT0A 4H3QA 3FJQE 3EIDA 3SOAA 3FLNC 2YEXA 2QVSE 4U44A 2J51A 4ZMEA 3UPZA 1M7NA 4ZSEA 2A2AA 4C3RA 3LFQA 1QPEA 3U8WA 2YCFA 3FI4A 2WEIA 4MNEA 3ATSA 3TUCA 4F0GA 4AA5A 5CF8A 3U4WA 3FMJA 1WBPA 4UY9A 3Q32A 5D7VA 4BCFA 4EOPA 4L3LA 4IMYA 3QZGA 3R71A 4GYIA 5EW8A 4G17A 3Q96A 3QTQA 3RJCA 3ZDIA 2FA2A 4NT4A 4L8MA 4HZRA 4KIQA 3EHAA 4LMUA 5HVJA 4RWKA 3DTWA 4ENXA 3RPVA 2ITZA 4ANOA 4FT0A 1IASA 3PIYA 3ZSHA 3GCSA 4Y95A 5DE2A 3KRXA 4XV9A 1LEZA 4FTUA 4FE2A 4KSQA 2PTKA 3L9LA 1J1CA 3DLZA 3ZLXA 3D14A 3UYTA 3I60A 4KS8A 3SRVA 2R3QA 2UW7A 4CRSA 5IH4A 3Q5IA 3U6IA 4U3YA 3NSZA 2GNHA 2XKDA 4XP3A 5LVLA 3LMGA 4D9UA 2VTJA 4I41A 4I5PA 5M07A 1X8BA 5L4QA 1ZWSA 3OCBA 4IJPA 1OL5A 3PJ2A 1KE7A 3DBQA 3M1SA 3ORIA 5C03A 1UV5A 4CFFA 2IPXA 3NAXA 3QUEA 2BHHA 3FV8A 3SHEA 4BIBA 3UG1A 3KC3A 3ZBXA 5B2MA 5A4QA 1REKA 4F08A 4HCTA 2QOOA 2XIXA 3Q53A 2AYPA 4BY9E 2KTYA 3G5DA 5KMNA 2C30A 1F0QA 2ONLA 4QP9A 3FQHA 5CI7A 4FSNA 2VTHA 4AOIA 3AD5A 2ZDTA 3AD6A 3LFNA 2QO2A 5ACKA 4N6YA 4J52A 3NYVA 4I21A 4BICA 3MVLA 2YJSA 2VGOA 1JVPP 3SC1A 2ITXA 3GC7A 3MH3A 3JR1A 1BLXA 2E2BA 2O65A 2O5KA 4B9DA 2PWLA 4GT4A 4RC2A 5AX9A 2BKZA 4MD9E 2WELA 3ODZX 1YXVA 2VO3A 4AOJA 5AWMA 4FTTA 3IQ7A 3H0YA 5LMBA 3W0RA 5HG9A 3DBDA 3ORKA 1ZARA 4F1MA 1P4FA 4K9YA 4BTKA 3G2FA 4YTIA 1PRYA 3DT1A 3N4TA 3KXGA 1O9UA 3VW8A 2VX0A 2YDIA 2XRWA 3KCKA 3RPYA 4FTIA 2WQBA 3ZFMA 2HXLA 3QC9A 4OTFA 3TNPC 3CP9A 4L7FA 3LCSA 3QCQA 3RK9A 2I0YA 5E92A 3OXTA 4CFUA 4KRCA 1CTPE 4HOKA 3ZRKA 3OROA 4IZ5A 3A60A 2PULA 1JKKA 4IBMA 4MCVA 3P86A 4M84A 2AUHA 4RJ4A 5CVHA 1ZY4A 3MFTA 4JRVA 4WNPA 4AU8A 4ZLYA 2QO7A 1K2PA 1JNKA 3L8SA 2WMTA 5LVOA 4JOAA 1GZNA 3ZDUA 1ND4A 4RLKA 1ZMUA 4TNDA 4FR4A 4OBQA 2UZTA 4WBBB 4G3GA 4PNIA 4RVLA 4E8AA 5HD7A 2IZUA 3DAEA 3MJ2A 2V0DA 4WOVA 1UWJA 4FNXA 4NEUA 4O1OA 4FG8A 4JG8A 5I4NA 1R3CA 5HE0A 4Y72A 2JKOA 3R28A 2GNFA 3P9JA 4RC4A 4TPTA 3VS7A 1PY5A 1R0PA 4JJRA 4ZZNA 3S00A 1FMKA 4PPAA 4WD5A 1XH9A 5EQPA 2CSNA 4QPSA 3QF9A 3C9WA 4N0SA 5L8KA 3BRBA 3Q04A 2WTWA 4BBFA 4IIRA 3ALNA 3F82A 3H0ZA 3EKKA 2OI4X 3UOHA 3EL8A 5KMOA 1V0PA 4MKCA 3EQPA 4Y73A 4Z3VA 5HVKA 3NUXA 4AGCA 3UO6A 4FEQA 3RGFA 4PNKA 5IISA 2WQMA 5LVMA 3KREA 2OXYA 2WHBA 5EH0A 3V8TA 3PE2A 3ZC6A 3IW4A 1OGYA 2UVYA 2BRNA 5EI6A 4E7WA 3LW0A 3DFAA 5FLFA 5EHOA 5KCVA 4C7TA 3C0HA 3H10A 3HVCA 4KIPA 4O0XA 4DT8A 3DBEA 4DA5A 4FG7A 1Q8YA 4QOXA 5EI2A 4C8BA 4JT3A 3UVQA 2X4FA 4XEYA 4NU1A 4YLLA 4F9BA 4DBXA 1R39A 2YFXA 3P78A 2GTMA 5E90A 2XKEA 4NK9A 5EYKA 4BDGA 4OTIA 3WF9A 2RGPA 2X39A 5IQIA 3G6HA 4XHKB 5CF6A 2B9FA 4GS6A 5CEOA 1YOJA 4BDJA 3GGFA 4HPUE 1UKIA 2ZFYA 4DE4A 4UN0C 2F4JA 3TJDA 2Y7JA 5L8JA 3NEWA 5A4CA 4YURA 1ZY5A 2QOBA 3CPBA 3OHTA 4C57A 2G2HA 4DG3E 2R3MA 2F2UA 4M7IA 4OTHA 5I9YA 3IPHA 3IOPA 1OZ1A 3QBNA 4YC3A 5FBNC 3VF9A 2ZVAA 4ANBA 1SYKA 4D0WA 1GNGA 5CXHA 2NO3A 5DYJA 3ROYA 3WF8A 3WOWA 4AG8A 4X2GA 4O83A 5B7VA 3R1NA 2VV9A 2BZKB 4CKRA 2OK1A 5HE2A 3QCXA 3R8LA 4F7NA 4FT5A 3PFYA 3ANRA 4J1RA 4C58A 3GC9A 3LFSA 4JG7A 3LVPA 4TZRA 4KD1A 3OCGA 2FO0A 1L3RE 3PJ8A 4QMTA 4L45A 4O6LA 4O0RA 4GV1A 3CKWA 1OM1A 4Z7GA 3IGOA 5AA8A 3N51A 4IB3A 4QQ5A 3OVVA 2NRYA 4PDOA 2CGVA 3QKKA 5M4CA 2QR8A 4QMXA 1K9AA 3AT3A 3QD2B 3C0GA 4FKVA 4IW0A 5ANKA 3NW5A 4RBLA 3OWPA 4NL0A 3GENA 4YC8A 3O51A 5KKRB 3CLYA 4DYMA 3U4UA 1OI9A 4U6RA 3PXFA 4QP4A 5AR4A 4EORA 4DH3A 5HLNA 2XP2A 4RJ6A 4IVDA 2XK4A 4O7YA 2QNJA 3NX8A 4RC3A 1P4OA 2A4LA 3BHVA 3RM6A 4TWOA 3FKNA 5GZAA 3LMHA 1CMKE 4R78A 2ACXA 4TYEA 5LMKC 4BL1A 3W0QA 5KMIA 3DK6A 4IHPA 3BL9A 1E1XA 3F9NA 3OG7A 2RG6A 2ZV2A 1YXTA 2RSVA 1QL6A 4W9XA 3EQBA 3G33A 4ZXTA 5BVKA 4OGRA 3QD3A 4EK6A 5A4TA 3K5UA 4FV0A 4I5MA 3LM0A 4R7HA 4N4SA 3F2NA 3SGCA 2J7TA 2JAMA 3ZM4A 4FYOA 4JBVA 4BCQA 1WVWA 4AN3A 4DN5A 4JMQA 4BDIA 3P5KA 3TIYA 4CMOA 4D58A 5DG5A 3MFSA 5AUZA 5AUTA 3FXZA 4E73A 5CEKA 2PL0A 4PP9A 4DHFA 5AJQA 2BRHA 3QGYA 4G3DA 3F5UA 5IKWA 2OG8A 4FIJA 4RIXB 4YO6A 4BI0A 3SQQA 2C3LA 3EOCA 4IFGA 2ITNA 2P33A 3BV2A 1V0OA 3Q6UA 4KBKA 4WBOA 3C5IA 4D9TA 5AUWA 2C5NA 4NM7A 4ZSLA 3ETAA 3PUPA 4M97A 4P5ZA 3UC3A 4AXAA 1H26A 3AKJA 5CY3A 2IVVA 4FV5A 2GU8A 3BE2A 2BROA 4HNFA 2PVKA 5IH6A 2WMBA 3PIZA 2W0JA 4FGRA 4DTKA 4RRVA 3U87A 4ITHA 4QTAA 4I20A 4IAIA 3NIEA 4MYGA 5T6KA 3RZFA 3GT8A 3SV0A 4DGGA 2BFYA 4R3PA 1FGKA 2R3PA 2RIOA 3IKAA 5M55A 2A27A 4JG6A 1NVQA 2YCRA 5E8ZA 3S3IA 3VUIA 3KEXA 4BDDA 3WBLA 3KRLA 2YAKA 4NW5A 2XIYA 1FVTA 4DGNA 5IU2A 2V62A 4WKQA 4V01A 2X4ZA 4BWPA 5AR3A 2B54A 2HZ0A 3FLSA 3NW7A 4D4SA 4HVHA 4YZCA 5BYLA 4EQMA 4K18A 2EVAA 4PTGA 3JPVA 2UZWE 5IA2A 3A2CA 3BYVA 3I6WA 4QT1A 2CGWA 3BYMA 1UNGA 3LCKA 3DXNA 4X3JA 4IFCA 1YQJA 2ITPA 2JGZA 2VD5A 2JD5A 5DA3A 3NRMA 3ACJA 4J71A 2A19B 3RCDA 2FSTX 4FODA 2X2KA 5IG1A 3A7HA 3KULB 4QP3A 2JAVA 2XH5A 4YSJA 5AP1A 3HP5A 4F64A 3KKVA 4FMQA 1OKVA 5C8MA 4TL0A 1GOLA 1BKXA 2QOCA 4IADA 5IEYA 2VTAA 4FV4A 3LLAA 4EJ7A 3VNTA 5CQWA 3VS6A 1JAMA 1FBNA 3SG9A 4R5SA 3IDBA 5C8NA 3VBYA 2XMYA 5FRIA 4IANA 1OMWA 4AWIA 4OUCA 2IJMA 5CTPA 3HUBA 4R8QA 3PXZA 2X2MA 4BCNA 4E3CA 4S34A 3O2MA 3RPRA 1KWPA 3QAME 4WRGA 5ETAA 4DH8A 3DBFA 4F7SA 3LLTA 2XKCA 4PMSA 2YACA 2XIKA 5HNGA 3EL7A 3VS2A 3ZO1A 2A98A 5CF5A 2Y6OA 5J7HA 3GFWA 4I4FA 4IDVA 3FMMA 4C2WA 4IAZA 2UZLA 3LAUA 3RNIA 3L8XA 4G1WA 5JEBA 3TYKA 4FTNA 2ITWA 2WMSA 4IEBA 4TTHB 4X3FB 4DHZA 2PU8A 3I0OA 2QC6A 4LGHA 4TYHB 5CSVA 3A99A 5ACBC 2ZOQA 3MTLA 3H4JA 4FTOA 4I0RA 1YOLA 4O82A 3IW7A 2BTSA 2IEWA 4F9CA 4EH4A 2GQRA 3D4QA 3UODA 3PLAE 2OZAA 3O96A 4JIKA 2UW5A 3CBLA 1ZMWA 1OECA 1OL1A 1QCFA 2UW6A 4GT5A 5K4IA 4TN6A 3G6GA 4FOCA 2PUUA 3UDBA 4F4PA 4AA0A 5M4IA 5IUIA 3E93A 2OF2A 4EQUA 1BL7A 3DPKA 1ZMVA 3CCNA 3G15A 1YI3A 1QPDA 4B99A 3PSDA 4ZS0A 4AQCA 2PZ5A 5C1QB 4EK5A 4FKQA 4U3ZA 4ENYA 1TFFA 3Q2JA 3T9TA 2C5XA 3MN3A 2WMVA 3LPBA 5HO8A 4DFBA 2FB8A 3ZONA 4MTAA 2R9SA 4FSZA 4EK8A 4TRLA 3EYHA 4YU2A 3ENMA 1OL7A 2QHMA 3VS3A 4IM2A 2QODA 4RZVA 4ZSGA 2W4KA 3PXYA 2BALA 2C3JA 4APPA 3BI6A 1HCKA 4XJ0A 2ERKA 5AV0A 3HV3A 5CZHA 3PP0A 4EC8A 3AC1A 2XCHA 3GFEA 4J99A 4RX9A 4TXCA 3FHRA 5DEWA 3JS2A 4FUYA 3LXNA 4BDBA 4D5HA 1H1WA 3KN6A 4NIFA 1I44A 3KXNA 3H9OA 3REPA 5L2QA 3FKOA 3PA4A 3IG7A 3TZ8A 4XLIA 4PMPA 4EH6A 1BI7A 4O38A 4BN1A 3BV3A 4FKPA 4ZLZA 2JDSA 4E5WA 1TZDA 3ULZA 5E4HA 5LVNA 2A1AB 3DDPA 3R1YA 4XS2A 3EQFA 5BUEA 1H1SA 1YOMA 3EFWA 2XCKA 1JOWB 1URWA 3UIBA 4AW5A 3TNIA 3AKLA 3EQHA 4EUUA 3AKKA 4NFNA 3RTPA 1JQHA 5HVYA 3PE1A 1VEBA 2B0QA 4C02A 1QMZA 3Q9ZA 4QMWA 5I9XA 4AF3A 4A4LA 3AT2A 2VX3A 3I1AA 4I5HA 5EYMA 3W0PA 4M14A 4D2VA 2WNTA 2HCKA 4RVTA 4EOIA 1E9HA 3Q4CA 3ZSIA 4E6CA 5AP0A 2XNEA 3GC0A 3VBQA 3WZJA 2UZUE 3HKOA 3COKA 2ITUA 4EK3A 5LARA 3MESA 5KHXA 3UE4A 2HAKA 4IX5A 4HGLA 1OPJA 2C3KA 4J8NA 2CLXA 2Y4IC 4N6ZA 3QL8A 2YABA 5BYZA 2IZTA 5E7RA 3ZMMA 4TYHA 1BL6A 2YM4A 3VW6A 3NNWA 3WF5A 1Y8GA 5IQDA 5CU6A 3LQ3A 3QHRA 4DCAA 2J0MB 3B2TA 3NW6A 3OT3A 3P4KA 3R30A 2NRUA 3WYXA 4HW7A 2ZM4A 4E6QA 1TVOA 4O0TA 4FSQA 4I93A 4LV5A 4OBPA 5H9BA 4JDHA 3FBVA 4WNOA 2R3HA 3OBGA 4ANNA 4APCA 2GNGA 2XAMA 4O22A 4QMUA 4MXOA 2GS6A 4M12A 4C36A 1MUOA 5JGDA 4UMQA 3HX4A 4D2WA 3V5QA 5BVWA 2GMXA 5A3XA 3RNYA 5IA4A 3KMUA 4MVFA 3ZTXA 4C4IA 2VO7A 3FKLA 2XALA 2EB2A 2R7BA 4H1JA 4PWNA 4R7BA 5L6OA 2ZJWA 4Q9SA 4BGQA 1W2CA 3OOMA 3VBVA 4ZMFA 2BRGA 3QWJA 2VTSA 3LIJA 2EU9A 5FXSA 4PL3A 2E9VA 3FL5A 1XH4A 3E7OA 3QQFA 4GUBA 4L46A 3NZ0A 4MD8E 4TWCA 3ZFYA 5T68A 2O0UA 4GU9A 4I23A 4MNEB 4XG3A 4BWXA 1YKRA 4NZWB 4YBKA 2XNPA 5LCKA 3G9LX 3RVGA 3ZEWA 3ZRMA 2NNWB 2XYNA 3QD4A 2BDWA 4DEGA 3EQRA 4EOSA 3AT4A 4TYGA 4LM5A 2WD1A 3HA8A 3R21A 4XLVA 3NUSA 3QQLA 4R7IA 1O6LA 4MAOA 3ZOSA 3DNDA 4B6LA 4DAWA 1Q8TA 5HI2A 3NUPA 5CX9A 2J5EA 2IWIA 3NR9A 3ZS5A 4WRSA 1YHSA 1ZZLA 3THBA 4CSVA 4C3FA 5IQCA 3HMMA 4D2SA 1DAYA 3QYWA 3O17A 4IACA 5AV3A 3PPZA 2C68A 4A9UA 4IWDA 4DEHA 3SRVB 4PDPA 3NYNA 5J5TA 3CSVA 3MVMA 3TG1A 4F1OA 4JIAA 4UMPA 3GCUA 3PWDA 5A9UA 4Y8DA 4D1SA 1FQ1B 3DKFA 3LZBA 4O7SA 4BCIA 4ONAA 4DG0E 4O91A 5E8YA 4GT3A 2W17A 3MYGA 4KABA 4XOYA 4CFNA 5LCJA 4A07A 5FXRA 1MRUA 4FSMA 3QU0A 3BHYA 3U6HA 5B2LA 5IQAA 3KXMA 4H1MA 3L9MA 4E5AX 2C6MA 4A9YA 4CEGA 4Z7HA 3FXWA 3V3VA 5M53A 2QOHA 3CC6A 4J97A 4AW2A 3ZO3A 1IA8A 2VWUA 3EN5A 3QRJA 2QG7A 5J95A 3EN9A 1IAHA 4AXEA 3CTQA 4C33A 2CJMA 4D1XA 2F49A 3IW6A 2RFEA 2WTKC 3GP0A 3H9FA 4D4RA 5D41A 5K0XA 3DXQA 4CNHA 3D0EA 4JLCA 1KUTA 4KB8A 5DRBA 1G8SA 4MXXA 3CD3A 2XK9A 4USEA 3QGWA 3FEGA 3G0EA 3E64A 4GVAA 2VO6A 3FLWA 3P7BA 3H3CA 1GIIA 4HCUA 4EWQA 1M7QA 4JL9A 3UDSA 4C59A 3RK5A 5DOSA 4AZTA 5KX8A 1YI6A 1Z57A 2XUUA 3D2KA 5FDXA 5C9CA 2W5AA 1KOBA 2RFDA 1FVVA 1OUKA 5IQFA 1U54A 2E9PA 4LUDA 3ZO4A 3FMLA 3ZUUA 2CDZA 4RX7A 2ZYBA 2PVFA 3D2IA 4Q9ZA 1M14A 3F5GA 3ORXA 1S9JA 4GRBA 4YSMA 4NW6A 3BU3A 3OXIA 5EQEA 3FUPA 3KF7A 2KULA 2J4ZA 4GU6A 4K1BA 2WQNA 4QMOA 3LKMA 1YWNA 2OJFE 2IVUA 2HK5A 1WBWA 1K3AA 3OW4A 4QP8A 5FP5A 1IG1A 3DZOA 2PVRA 5DLSA 3A61A 5IEVA 1WBTA 5HICA 3HRFA 3PRFA 1IEPA 3MWUA 2OJJA 5DIAA 1V1KA 4TYJA 5DR9A 4JQ8A 4AP7A 4O4EA 5AX3A 3GB2A 3G51A 5CSHA 3FE3A 4M0YA 3SDJA 3PG3A 4FNYA 1WBOA 4B8LA 1VLRA 2OO8X 3MW1A 4YJRA 3UIMA 3MA6A 3SW7A 4O2ZA 3HRBA 2CKPA 3IGGA 5AP6A 2P55A 4UALA 4AW1A 3ZLYA 4CLJA 4M8TA 5HX6A 4ZZMA 5JFSA 1CKJA 4HNIA 1GZ8A 1BMKA 1ZOEA 4Y5QA 3R7VA 4CD0A 2XARA 4L7SA 2PVJA 3P7AA 3V8SA 1XH8A 4USDA 4NCTC 4WNMA 5BPYA 4FT3A 3UOLA 1H0VA 4E26A 2IW9A 5J7BA 4CCUA 4U97A 1NY3A 1DI8A 2WU6A 2BZIB 5DT3A 3QWKA 2BMCA 4GG7A 4WT6A 3RWQA 3UZPA 1XQZA 1UNLA 3MTFA 3A62A 3MH0A 4AGUA 2RL5A 5LXMA 3R8UA 5HO6A 3ERKA 2VTQA 2XJ2A 3QQGA 5H8GA 1XHAA 3LXKA 3LMIA 2GNJA 3NLBA 5KKRC 4DDGA 4EOOA 5CAVA 3NGAA 3PXRA 5DN3A 4FC0A 3NFGB 2CGUA 3VUGA 2QLUA 4IX4A 5M56A 3EQCA 4TWNA 2YIYA 4W4YA 2PZPA 2VWXA 1OITA 5GNKA 1W2FA 4F78A 4NFMA 2PUIA 1OGUA 2QG5A 2Z2WA 1Z5MA 2ZV7A 3KK9A 1UU9A 4FT7A 4HGSA 1RQQA 4YNEA 1XKKA 2Q0NA 3IS5A 3P23A 4JBQA 5CT7A 3JVSA 4DT9A 4FV2A 3I79A 2LGCA 4IAFA 3FZTA 2UZDA 5HCZA 3DU8A 5A14A 2B4SB 4U40A 5L8LA 5C4KA 4G9CA 1STCE 2X0PA 4EBVA 5I9ZA 2EB3A 5J87A 2R0UA 3QA8A 4BWKA 3R9NA 3E8DA 3HZTA 3II5A 4NM3A 4RJ5A 4RGJA 2J6MA 4GK3A 4XG4A 5CQUA 1OB3A 5GHVA 5TKDA 4WUNA 3RI1A 1J7LA 4KIOA 3NFFB 2CMWA 4XG6A 5M09A 1L8TA 3NUAA 4WUAA 4MF1A 4QO9A 2OSCA 3TTJA 3MI9A 3UC4A 5KZ0A 3VUMA 3UZTA 1XBAA 1G8JA 4C37A 2G15A 5HCXA 1PXPA 4XOZA 1G5SA 2WMAA 3A4PA 2R3IA 3KQ7A 4QYHA 3TIZA 1YDSE 1OIQA 3LJ0A 4LFIA 1IR3A 5AR8A 3E63A 2I0EA 4WIHA 3ULIA 2C0OA 2ZMDA 3QTWA 3F5PA 2GNIA 2X0GA 2R5TA 4BGGA 3P79A 4DFYA 4BDEA 3AMAA 2Z7RA 2QOFA 3NCGA 1H27A 1MP8A 2XBJA 3V5WA 2XM8A 4FEVA 1W8CA 2DYLA 5GIPE 3LQ8A 2PZRA 1XMMA 3ATTA 3FYKX 4BKJA 1ZYJA 1Z9XA 2XK7A 5I3RA 3ZUVA 4B7TA 2VTNA 2BHEA 4I6BA 2QURA 5BX0A 1JSUA 1XH6A 1YXXA 3F3UA 3GBZA 2V55A 4P2KA 3UGCA 3QALE 3TCPA 3VHKA 4CVAA 5HNBA 1OKYA 2QOKA 2RG5A 3V5TA 2WTJA 1B38A 3G9NA 5TOZA 2XM9A 3DOGA 3SG8A 4HYSA 4NM0A 4FEUA 4QQTA 3R7OA 2F57A 3OFMA 2JDOA 4MEDA 2PE2A 4MBIA 4AAAA 5CU4A 2OJIA 4ACDA 5FQDC 4U8ZA 3UIUA 4AFEA 3OC1A 4PF4A 4G3FA 2C5YA 4RFYA 5T3QA 1NVSA 1RW8A 1CDKA 5TF9A 3O23A 4K11A 1JLUE 1B39A 2XS0A 3DZQA 4FKLA 2GHGA 4QMPA 3PUFC 5FDPA 3C4FA 3BEGA 2I6LA 4F09A 3WE4A 4DFZE 3W1FA 4UYNA 5D1JA 2UW0A 4FSYA 4BTFA 2XNNA 3R02A 5K5XA 2WOUA 4K8AA 4JAJA 1VR2A 4FKGA 3W8LA 2J0JA 1U59A 4YJPA 4E6DA 4RWJA 3DJ5A 4BCPA 2XB7A 4LRJA 4ALUA 3F7ZA 3VVHA 3R0TA 5HTIA 1R1WA 1OL6A 1KE8A 2GCDA 1PMVA 3MVHA 2OU7A 5AP3A 3PPJA 2FSLX 2VWBA 4CTBA 5KMLA 5AIKA 3E5AA 2J2IB 4JBPA 5AV2A 2HW7A 3BHUA 4EH2A 1FVRA