4AACA

P38alpha map kinase bound to cmpd 29
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
355
structure length
350
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNILTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Discovery of N-Cyclopropyl-4-Methyl-3-[6--(4-Methylpiperazin-1-Yl-4-Oxoquinazolin-3(4H)-Yl]Benzamide (Azd6703), a Clinical P38Alpha Map Kinase Inhibitor for the Treatment of Inflammatory Diseases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
total genus 105
structure length 350
sequence length 355
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4aacA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aacA01
3FL4A 3V5TA 5CI6A 1SNXA 5GZAA 2WMQA 5CU6A 3CY2A 4GJ2A 3BYOA 4IB1A 5GJGA 3OT3A 3CKXA 3H3CA 4NW5A 4B99A 2C1AA 4L00A 3JVRA 4AFJA 4OTDA 1VYZA 2PVRA 1ZWSA 2Z60A 2X7FA 5CU4A 3D7TA 2XRUA 4I94A 4EH7A 4FA2A 1SVEA 1NVQA 4K0YA 3ERKA 3FZTA 3ORMA 5KMLA 5CVFA 3FLNC 3FMHA 5IEXA 4YJPA 3DV3A 3OWJA 3W2QA 1KV1A 2HXLA 5HTIA 4RVLA 4BL1A 4ZTRA 3SGCA 2IW8A 1TKIA 2JLDA 3O0GA 4ARKA 3I0OA 4FI1A 4I0TA 2PK9A 2IPXA 3HAVA 3CTHA 2BRBA 4UWYA 3DZOA 5HEZA 3D94A 4YJOA 4QYFA 3FEGA 3PXRA 2BUJA 2I0VA 2PZIA 2VZ6A 4BCKA 4EJ7A 4FTOA 5KMJA 3WF5A 4FK3A 2ITOA 2X81A 4YHJA 2Z02A 5DMZA 3LLAA 4YJNA 4PL5A 1DI8A 2F2CB 4GV1A 5HE1A 2R3OA 4XJ0A 3TV4A 3K3JA 4LOQA 3COHA 5CF8A 3QQHA 4XS2A 3GGFA 5E8VA 2VO3A 1MQ4A 3DNDA 3F3TA 3LMGA 4FTAA 3ODYX 5ANKA 3BHYA 4QYHA 2NNWB 1MP8A 3H30A 3EJ1A 4MBIA 4OTWA 3ZC6A 4IZYA 4QMVA 4KIKA 2F7ZE 4NL0A 2CCHA 3DT1A 4MXYA 2GNJA 1YHVA 4I5MA 3UOHA 1XBAA 1Z57A 2A0CX 4GL9A 4AZSA 4BDIA 4EQUA 1OMWA 3PIXA 5IKWA 4FYOA 4H1MA 2PUNA 3C13A 1F5QA 4CG9A 2GU8A 2WMTA 3EQPA 4EK4A 3OT8A 4BCNA 3UVPA 3PLSA 1SM2A 5L8JA 4RA5A 2WMVA 2CGXA 3NRMA 2QVSE 3UNJA 3UO4A 4G17A 4FT3A 2FUMA 2JAMA 3T3VA 2A27A 3COKA 2BAJA 3UC3A 5EQPA 4E5AX 4LQMA 2V55A 4OTQA 3OMVA 3GCUA 3FKOA 5HIDA 2XEYA 5BYYA 2UZEA 4NTSA 3SDJA 1H4LA 3WBLA 4X6RA 4FKQA 5A14A 2G2FA 3EMGA 3GT8A 4I22A 2I6LA 3V8SA 4YTCA 3R21A 1O6LA 3PXQA 4ITHA 5AUXA 2VTAA 1JKTA 5E7RA 1PKDA 2OJ9A 4L44A 4LV5A 2NRUA 2WTKC 3TDWA 3UZRA 1IA9A 5BMMA 3EL8A 3O17A 3O50A 3NIZA 2HAKA 3KXZA 1IRKA 5AUTA 5C4KA 3VBQA 5FWKK 3MW1A 3CD8A 3QQLA 3ZYAA 5I9YA 2VWUA 4C3PA 2VTQA 1VZOA 2FSTX 3DZQA 3ORXA 2Q0NA 5A4TA 4R3PA 3QKLA 4ZS0A 5IA0A 3I1AA 2XIKA 3ZTXA 5IG1A 1W83A 3QRJA 3F88A 4BWPA 3CGFA 5M56A 3KRRA 5LOHA 4ZJVA 4IH8A 1OKVA 3PJ3A 3PIZA 4U8ZA 2CKEA 4FNXA 5GJFA 4DTKA 3SOCA 2V62A 3RALA 3I6UA 4O6LA 4X3FC 2A1AB 3K5UA 1GIJA 5EG3A 4YP8A 4ERKA 4TT7A 1GAGA 3R7GA 3W1FA 3SHEA 5BUJA 3WE4A 4ZMFA 1OKZA 5BQ0A 3OVVA 1U54A 4EK5A 3R9RA 1KE8A 2QLQA 2BTRA 4G3EA 3IW5A 1B39A 1PXLA 4R6VA 3MVJA 1OL5A 3DJ6A 4F65A 4HYSA 3FLWA 4QQ5A 3ZDIA 5KKRB 3CC6A 2F7XE 1M14A 5AA9A 2ITXA 2RIOA 3B2WA 2J51A 3AD4A 4TZRA 4U41A 3ZONA 1GZ8A 3AXWA 3Q3BA 4TW9A 4CNHA 5CWZA 3EFWA 4HOKA 5LVMA 4CT1A 5T68A 4CTBA 3QQJA 4FG8A 4ZZOA 3O2MA 3QRUA 3FZPA 4DG2E 4RWJA 3L1SA 5KO1A 3BI6A 2GQRA 5F4NA 4TYHA 1B38A 4JAJA 3H0ZA 3PSDA 4BN1A 4BZNA 4W8DA 4Q2AA 3ZRKA 3I7BA 3VS4A 4V05A 2RFDA 2GNGA 3FHRA 4G6OA 3V5LA 4D0WA 4R5YA 4ZIMA 3D7TB 4GKHA 4P4CA 4C4EA 1Q5KA 3ORIA 4QMUA 2GS6A 4FT9A 1FGKA 4G2FA 4E5WA 1ND4A 3DFAA 1XHAA 2XNMA 5DI1A 4M69B 4P5QA 2WU7A 2OFUA 3FSKA 2NP8A 3G90X 4BDBA 1P4FA 1ERKA 2YIYA 4RX9A 3ZLXA 4W4WA 4NYEA 5HNGA 5IQGA 4O0SA 4JDHA 3BQRA 3L9PA 4S31A 2XJ1A 3ROYA 2XKDA 3TL8A 3ULZA 3ZLWA 1J7IA 4RVTA 5HO6A 5IQCA 5LXMA 4FSUA 4R3RA 4XG6A 2WO6A 5D7AA 5LMAA 2YIWA 5IDNA 4U40A 3HNGA 4NTTA 2PVMA 3PA3A 2QO7A 1XQZA 1T45A 1YXXA 3KCFA 2WGJA 3IONA 3F5UA 3H9FA 4HJOA 3MJ1A 3OWPA 3OOMA 5CAVA 3LFQA 3ACJA 4B6LA 4XCUA 4BCFA 3F3UA 4D2WA 1G5SA 5IA3A 3A7HA 1L8TA 2JDOA 5AP0A 3PFQA 1W84A 2DWBA 3LAUA 4QTAA 3DFCB 5CF6A 4ALVA 4FKUA 3HV3A 4IANA 4WOVA 3NUXA 5DRDA 2EUFB 4NZWB 4PDOA 4BYIA 3UC4A 3WARA 2E9PA 2UW0A 4FTQA 4M13A 3P08A 4IB3A 3E92A 4Q5EA 4WNKA 4ZJIA 3F2RA 1Y57A 5JSMA 2R3GA 4OTGA 3ZZEA 2J50A 3LZBA 1ZMUA 3ZFYA 4H36A 4ZSGA 3W2SA 5GZ8A 4XV9A 4F9CA 4UMQA 5DEYA 2LGCA 3GCQA 3FSFA 4BCOA 4GCJA 2X2MA 3PJ1A 4Z55A 2GNLA 1OBGA 4FKLA 5EOLA 1BX6A 3LKMA 3QX4A 1OL1A 1Q8TA 4D4SA 4EOIA 5KUPA 1PW2A 2BIKB 2WEIA 4KUJA 1URWA 2YWVA 2WEVA 4PTGA 1DAYA 5E8UA 3VS2A 2QOOA 4FKGA 3LOKA 1I09A 4NM5A 4QTEA 4D4RA 5CEOA 4FGRA 3BZ3A 2FSLX 4G3GA 3Q5IA 2YCQA 5HVJA 3JR1A 2RSVA 2VO0A 3CP9A 2WMUA 3ODZX 4XP2A 3HRBA 4ACHA 4B7TA 2BKZA 3UOJA 4FOCA 4DBNA 3PXKA 2XJ2A 4XG4A 3OWKA 4CVAA 1CMKE 3TIZA 4FVRA 3ACKA 4UALA 4QNYA 3VULA 5CF4A 3TWJA 4YZMA 3W55A 4E4LA 4RJ4A 3OBJA 2IVVA 2PVHA 1BL7A 5H9BA 2C4GA 3KXGA 4HNIA 4PMMA 2R3QA 4IQ6A 3VUHA 4AXAA 4CFMA 2ESMA 3QGWA 2WHBA 4M15A 2RKUA 4NT4A 2CGWA 2G01A 2VNYA 3HKOA 2PMOX 4FG9A 2B9HA 4HNFA 5CY3A 2OXYA 3ZM4A 3ZXZA 1UKHA 4F99A 4RWLA 2BDFA 3PY0A 3DBCA 3UE4A 4UEUA 4IAIA 3E3PA 3FQEA 3QC9A 5FTGA 3C4ZA 2KULA 3RTPA 5CEMA 4GS6A 2FO0A 2E2BA 2IVTA 1XBCA 3AC8A 4CKIA 2PVFA 5FM3A 3LPBA 4QPAA 2J7TA 2EB2A 3OCSA 5JT2A 4WIHA 3NNXA 5LARA 5E92A 3DTWA 2ZOQA 3MGYA 1JBPE 4N57A 2QNJA 3DAKA 4RJ7A 4BY9E 5GNKA 1IG1A 4C33A 2YDKA 4I92A 3NLBA 5L2TA 3TI1A 4MEDA 4FKPA 4NM7A 4LL5A 2GTMA 3FYJX 5KNJA 4K18A 2VTTA 4RQKA 2YIXA 2ZB0A 3L8PA 3MA6A 2W1CA 2R3JA 2OO8X 3KQ7A 3SLSA 3KULA 1YDTE 4QQJA 4NUSA 1OM1A 4QMYA 3QZHA 4JBPA 3C4WA 3BGPA 5HORA 4OLIA 3KY2A 4MQ2A 4ZTLA 1OB3A 3ZXTA 4ANNA 5FDXA 5HVKA 3UJGA 2BRHA 2HXQA 5BMSA 1BI8A 3N4TA 1DI9A 3R9HA 1RDQE 2GSFA 3KF7A 4QQCA 1GZKA 2EXMA 4A06A 3V8WA 4X7QA 4XLVA 5ACBC 3NUAA 5JQ8A 2I0YA 5E1EA 4GT4A 4C4JA 3UOKA 3BU6A 5J1VA 5D10A 3UMXA 4MAOA 4O91A 2YZAA 4QMLA 5LMBA 2CMWA 1R0EA 2CKPA 2Y6MA 3UQGA 5GHVA 5C4LA 2PE0A 5TT7A 4BTMA 4YLLA 4IC7A 1JKLA 3BGZA 3JUHA 3GEQA 3DBDA 3PP1A 2WQEA 4EORA 3NUYA 2C6EA 4B9DA 2A19B 5BX0A 1X8BA 3SRVB 5CXZA 1NW1A 4KAOA 4AA0A 4DTBA 3O8TA 3MB7A 3FMDA 1IR3A 2Z8CA 4FSQA 4LUDA 5HG5A 1APME 4M12A 4MBJA 4PQNA 2QOHA 5CSXA 3RAHA 3RHXA 1OIRA 4ERWA 5FEEA 5BYLA 4ANBA 3IKAA 4CCBA 3K54A 4GVJA 3BBTB 3Q4UA 4E5BA 2XEZA 5LVNA 4AN3A 5IDPA 3E62A 3UVQA 5E91A 1M17A 3ANRA 2ETRA 4RJ8A 3NPCA 4I3ZA 4R1YA 5KKRC 4ZLZA 3Q2JA 2CCIA 2ZV2A 4MBLA 5TR6A 3RAWA 4C34A 3ETAA 2J0JA 4RWIA 1OPJA 4FEQA 1YHSA 3B8QA 2R4BA 3SXRA 3MFSA 4JBVA 4R77A 3L9MA 4P2KA 5LCJA 2JKOA 1RW8A 2G9XA 2XBAA 5CQWA 4FEUA 4FZAB 4FTRA 4L8MA 4FIJA 4IZ5A 4QP6A 3WF6A 3GOKA 3EZRA 2PVKA 3FXWA 3QCXA 4LRKA 1H28A 2IG7A 2P4IA 4Q9ZA 5BVWA 3G51A 3ENHA 3TN8A 3Q32A 5A4LA 2C5OA 3ZOSA 4OGRA 3OXTA 2YM8A 1JSTA 2YWPA 3LXNA 2GS7A 4EYMA 3EOCA 4IFGA 5AP5A 4PMTA 4A4LA 1K9AA 2XP2A 4HPUE 3JYAA 4CRLA 3A8WA 1OL7A 3TEIA 2VRXA 2G2HA 3QQUA 4H05A 2JIUA 2QOCA 2ZYBA 1YOJA 3KGAA 3RINA 5DR2A 1S9JA 2EXCX 4MXAA 3FLQA 3VUMA 4FOBA 4BCHA 3EH9A 4EOKA 5HU3A 3GU6A 3R30A 3ZUTA 5KHXA 4E8AA 3FLSA 3I5NA 3VF8A 4Z7GA 2XIYA 3C0GA 4FK6A 4FZ6A 1W82A 4C4GA 3D7ZA 5HCXA 1WCCA 5I3OA 3VBXA 3A7IA 3QXOA 3D2IA 4DEBA 1YWVA 5BVOA 5JFXA 3LFFA 4RJ3A 2C47A 2W1IA 2WPAA 1KV2A 4LL0A 3HEGA 3LCTA 3GXLA 4RBLA 3NX8A 3OWLA 4F64A 3AC2A 4RSSA 1STCE 3HUCA 2VTOA 2ITYA 2OIDA 3PPJA 4JG8A 1ZOGA 2FH9A 4F9WA 4IX3A 1WZYA 4O22A 1M7NA 2V7OA 1PXOA 4KB8A 2WQOA 4GFGA 4J96A 2ZDTA 3GP0A 1HOWA 2E9NA 1A06A 3DGKA 3KRLA 4E4MA 2PULA 3R6XA 3AMYA 3A60A 3Q9YA 3O96A 2X4FA 4G3FA 3ZMMA 2FYSA 3ZRMA 1WBPA 3R71A 2QODA 3DKFA 3ET7A 4FTKA 4WKQA 5AR4A 3T8OA 4E3CA 4ENYA 2X0GA 3RMFA 3U8WA 4EHGA 2X7OA 4LOPA 4F6SA 1KE6A 4RC2A 4HCTA 3SOAA 2VGOA 4CV9A 4N4SA 1ZOEA 5HLWA 3N4VA 3GCSA 3KULB 3T3UA 3QRIA 4TWOA 3QCQA 1HCLA 4QMQA 2UZOA 2ZB1A 2QR7A 3EB0A 3NZ0A 3RVGA 2FSOX 5DVRA 4BBFA 1YXTA 5BUEA 4UYAA 4U43A 3VS6A 2GHGA 4CFNA 4IMYA 1WVWA 4D5KA 4RGJA 2OJFE 2GMXA 1PYEA 3ZHPC 3FV8A 3LCSA 3VJOA 3IQ7A 3PIYA 5CVGA 5AV1A 3FUPA 3R7EA 3WILA 5HLNA 1PXJA 4KD1A 3UP7A 2YCSA 1CKIA 2XK6A 3R28A 4ITIA 5F95A 2WNTA 4FGBA 4YLJA 1ZYDA 3DLZA 4GFMA 2BZJA 5EM8A 5C03A 3OXZA 3Q4CA 3QKMA 2C6OA 3U51A 2YN8A 3ZUVA 4J99A 4ASEA 2BVAA 3UYSA 4O6EA 4IWDA 2HWOA 2ONLA 2YA9A 3R2YA 4BI0A 3HMIA 2W17A 4U0IA 3RK9A 3R22A 1YXVA 3QA0A 4C8BA 2RF9A 5HNIX 4OAVB 3VHKA 4YTHA 5EM5A 5LVLA 5JFSA 1ZYSA 3QF9A 4OBOA 4X0MA 4AW2A 3KKVA 3TM0A 4FEWA 2PVLA 4JIKA 4BCMA 4I5HA 5AUWA 2BFYA 4CZTA 4MXOA 4PWNA 3DAJA 3QHWA 4AZFA 5IQHA 3ZUUA 4N70A 4DG3E 4FODA 3BELA 5HBJA 5DRBA 3LFSA 4C3FA 3KK9A 4I0SA 4BI1A 3WZUA 3DB6A 4AN9A 4KS8A 2XK4A 3ITZA 1R1WA 2R3MA 4YZCA 4DT8A 3UP2A 3WOWA 4NFNA 4G1WA 5FTOA 2WU6A 4XP0A 2YABA 1YRPA 2REIA 1H26A 2H96A 3D15A 4K1BA 3TXOA 1ZZ2A 2VWZA 4XEYA 1XR1A 1ZY4A 2PYWA 2HENA 4W8EA 4IEBA 3QQGA 3R7VA 1P2AA 2YIQA 4RX7A 3ZSIA 5CI7A 4FTNA 4JS8A 1VR2A 1PXNA 3BLHA 2O63A 3R02A 2R0IA 3EQDA 3P7BA 2R0UA 5J87A 1BLXA 5HTBA 2PU8A 3RKBA 4C36A 4F08A 3FDNA 2H8HA 1Y8YA 3NYVA 3IK3A 4DFLA 3QD0A 2PVNA 1YXUA 5K5NA 2ZMCA 5K0XA 2ITVA 2Y6OA 5E8XA 4ZTNA 4OTPA 3G5DA 3M11A 3BV3A 5ANEA 4D2SA 3AMAA 5CX9A 3TKIA 2UW6A 4S34A 2C0IA 4CYIA 2CN8A 4QP1A 2JKKA 1MUOA 3PE2A 3ZLYA 4QPSA 5AV2A 2OIBA 5D12A 2Z2WA 3WF9A 3HV5A 3SVVA 2BRNA 5AM7A 1DAWA 3JY9A 3A4OX 4RZVA 4BGQA 5FGKA 3MH0A 4CFXA 4GUBA 4IWQA 4YJRA 5FUTA 3AG9A 3F5XA 3PZHA 4U80A 1REJA 3VW8A 3IDCA 3NSZA 5JKGA 5M08A 2QLUA 4MQ1A 3PRFA 3V5QA 2FVDA 5EQEA 2W5AA 4BCIA 1A48A 1ZXEA 4L45A 2FGIA 2QOIA 1Y91A 3CJGA 4FSZA 3NW7A 5LWNA 4HCVA 5AP6A 4YJVA 4ONAA 4NSTA 4PX6A 4HCUA 5DEWA 4QTDA 5DA3A 3C5IA 3V8TA 4NJ3A 5E4HA 4HVIA 2OH4A 3V6SA 5AUUA 3DXQA 4DBXA 3R9DA 3MIYA 1W98A 2VTSA 5DNRA 2W4JA 5EM7A 4ACDA 5FEDA 5I9XA 3F3WA 3GBZA 3HGKA 2ITZA 2YACA 4C59A 4CMUA 4FSRA 4FKJA 2JIVA 3E7OA 3FMMA 3R8MA 3KB7A 2WMAA 3LJ2A 4EBVA 4QD6A 1UU8A 2UZVA 5L8KA 4FE2A 4MKCA 1ZMVA 1W7HA 4O7TA 5CT7A 4BYJA 4F1OA 1Q8UA 4JDIA 1OPKA 4FTTA 3VS3A 3Q6WA 1URCA 1NY3A 2Y4IC 5IU2A 2WFYA 3UGCA 2QQ7A 5CSHA 2XCHA 4L42A 3RNYA 4A9UA 4AX8A 4BICA 4EQMA 2XKFA 5L2IA 5AR3A 4G31A 1U54B 2X8IA 4MTAA 4B8LA 3TZ9A 2VTIA 4CV8A 3QAME 2W96B 3LFAA 4J53A 2C0OA 2X2LA 2CNUA 4ZEGA 3ZFXA 2VTLA 4YSMA 3HECA 4IB0A 5TO8A 3DXPA 3HL7A 3A99A 3W16A 2VTPA 3VW6A 2XIXA 4FYNA 3Q9ZA 4MHAA 2GDOA 1LEWA 2EB3A 3O23A 4D2TA 2B9IA 4J8MA 3BYVA 3DXNA 3UVRA 4CZYB 4EOOA 1YXSA 1E9HA 3D14A 4JBQA 2XKCA 3ATSA 5DT3A 5A4QA 3OEFX 3VO3A 3AD5A 2E9VA 4HGTA 4X21A 4CSVA 1KUTA 1SVHA 4D9UA 2W1HA 4R3CA 4XX9A 1IAJA 3R9NA 2DUVA 4PNKA 2R3IA 3UQFA 1PJKA 3QLFA 1IA8A 2VX0A 3IW4A 4O0UA 1PXKA 3DPKA 5AAFA 5M57A 4GJ3A 3EHAA 4QP9A 2CGUA 1BUHA 2F7EE 4FNYA 4GG7A 4YHFA 5F20A 3ORZA 5I4NA 2UZNA 5ANDA 3N51A 4MD8E 4L52A 3V6RA 3V5JA 1RJBA 3PA5A 4NK9A 4RPVA 3Q96A 5ETFA 4ACCA 4O7SA 1UNHA 3LQ5A 2UUEA 4PPAA 3MPAA 4X6QC 2R3LA 2R3HA 3BCEA 3ZO3A 4EOLA 1M2PA 3NR9A 5ETCA 3CKWA 3DTCA 3LFCA 3FMKA 4BWXA 2HWPA 3GFWA 3BHVA 4FIFA 4GT3A 3LE6A 5ANOA 5HVYA 5J5SA 3LJ0A 3QBNA 4TKSA 5E8SA 3FBVA 4MXXA 2ZVAA 5EI6A 4BWKA 5H8EA 5KMIA 1UNLA 3U6HA 4AT4A 2ITWA 3R73A 4WRGA 2ZMDA 1SVGA 5AIKA 1OPLA 3BYSA 1Q4LA 3RPSA 1YI3A 3VF9A 3CY3A 5B2MA 2W4KA 3P5KA 3HP2A 4D2VA 4I5PA 4DGGA 4DLJA 5K4JA 1IAHA 5HESA 2CSNA 3LFNA 1ZARA 1TVOA 4ZXTA 4RX8A 3NUUA 1OIUA 4CMTA 4WBOA 4FVPA 2X2KA 5KE0A 4W9XA 3UYTA 3DK3A 3UTOA 5DPVA 5ACKA 3KXXA 1WBNA 3MH1A 3PJ8A 3E63A 2Q0BA 1ZMWA 2VTHA 4WA9A 2GQSA 2W1FA 2V0DA 2QO9A 4O81A 3VVHA 3O8UA 3II5A 4O84A 3KRWA 3QTRA 4JXFA 3SXSA 2O64A 3DCVA 5EHOA 3BEAA 3A61A 3TACA 3K3IA 5EYMA 2JGZA 5JZJA 4QMTA 3UNKA 2Y8OA 2R7IA 3CIKA 2DS1A 4G5PA 4QMWA 4F7NA 1SZMA 5LQFA 2BALA 1NXKA 3EFLA 1UWJA 3NGAA 1DS5A 5CAQA 2I7QA 2J0MB 5AV3A 1JSVA 3OROA 4RT7A 3DLSA 4KNBA 4BB4A 3MPTA 3SKCA 5DYJA 3C0IA 2FA2A 3LVPA 4DEIA 4FV0A 5DFPA 5DT0A 2IZTA 3Q60A 4HYHA 3VBYA 2OU7A 4F4PA 3CLYA 1KE7A 4O0YA 3F9NA 4HYUA 4E4NA 3BKBA 3LXKA 2C30A 3FYKX 4IM2A 3G6HA 2I40A 3PXZA 4AZVA 3CEKA 1A9UA 4I20A 2QU6A 3PE1A 4M8TA 4Z3VA 1YI4A 2UW7A 2B52A 4AZEA 3RCDA 4D1XA 4OR5A 1BL6A 1JQHA 5D11A 3TIYA 4BKJA 4F0GA 4C02A 4D2RA 1LEZA 2QOLA 2IZUA 3RWQA 4AGDA 4QPMA 1JAMA 2Y0AA 2IVSA 3PZEA 3MB6A 1AGWA 1Y8GA 4D2PA 4DH1A 3QC4A 3F2NA 3OOGA 4XOZA 2W0JA 3NWWA 3I4BA 4QTBA 2RG5A 3RZFA 2C69A 3NNWA 1YWRA 4FR4A 4YZNA 3P79A 2AC3A 4KBKA 3JY0A 4ACMA 2XB7A 4QO9A 3WF7A 3WZKA 3DK6A 1Q8WA 4FV5A 1OL2A 4DFNA 4O7LA 2PMLX 3GVUA 2UZLA 4R8QA 3KEXA 3WZEA 3TNPC 4Z7HA 4TYGA 5I9ZA 2YM7A 2UW5A 2ZJWA 5EDQA 4WG5A 4YO6A 4AS0A 4CRSA 4YUQA 4ZZNA 5L6WL 4EUTA 5LMKC 3HA6A 3QZIA 4QMSA 3S1HA 2R3NA 2IW6A 3I5ZA 5BVEA 4LI5A 3GOPA 2XUUA 4BBEA 2ITNA 1VJYA 2R3KA 3B8RA 5DBXA 2F57A 3QL8A 2KTYA 5CU0A 5AADA 3PJCA 1XO2B 3U9NA 2OJGA 3AC4A 4BCGA 5J9YA 2W9FB 2OXDA 3OW3A 2R2PA 4U3YA 4O7ZA 2ONLC 5M09A 2VO6A 4K6ZA 4DCAA 4WHZA 3O71A 4KBAA 3TTJA 1LPUA 1Q3WA 4FZFB 4GT5A 4TRLA 2C6MA 2PMIA 4LGGA 2GNIA 4TY1A 4BKZA 3IW7A 4J71A 2B55A 5D1JA 3OCTA 4H1JA 3KXNA 1UU3A 5M55A 3QU0A 1P14A 4DN5A 5ITAA 4C3RA 4F9AA 5KMNA 5M4UA 4I1ZA 4JNWA 2PE2A 2CN5A 3LFEA 2YJSA 4MNEA 3ROCA 3SQQA 3SV0A 3WI6A 1M2QA 2XM8A 3ZC5A 1Q62A 1BMKA 2OG8A 3TUBA 4BDEA 3E88A 4EL9A 4RX5A 4IX5A 2P55A 3Q53A 2B9JA 3OP5A 2PZPA 5IISA 3VQUA 1UV5A 2PZ5A 2OICA 2OW3A 3C7QA 4B8MA 2I0EA 2X8DA 3TG1A 1JKSA 4QRCA 4YBJA 3TZ7A 4M7IA 3FL5A 4CKRA 4EOJA 4AF3A 2X9EA 1GY3A 3AC1A 4XH6A 3S95A 5L8LA 2CNVA 3GQIA 4S2ZA 5FLFA 3GC9A 3MJ2A 2VWYA 4DEAA 3DNEA 4ANOA 4USFA 5K5XA 1J7UA 4I4FA 5B2KA 5AUYA 4K77A 2VTRA 4UB7A 2X9FA 1H27A 4IAFA 4TTHB 4TWPA 2XCKA 3DQWA 4DEGA 4EKLA 5IMXA 3FZSA 4FMQA 4KSPA 4U9AA 4FTLA 5M06A 2VTNA 3KXHA 4GK3A 5HNBA 3SG8A 3PA4A 5HD7A 2WTJA 4G9RA 3S4QA 3BX5A 3TZ8A 3LJ1A 1JSUA 4O83A 2XK3A 5ETIA 4CZUA 4EWHA 2AUHA 3R83A 1TQMA 3FI4A 4P7EA 3NVMB 3RK5A 1VYWA 3I7CA 4ID7A 4X3JA 4ZTSA 1HCKA 4AW5A 5IA4A 4IM0A 4EHZA 3WYXA 3ZBFA 3UZPA 4UMRA 5IPJA 4FIHA 3DKCA 3E8DA 4NIFB 4P5ZA 4TXCA 3W33A 4EJNA 3EQFA 1OVEA 1JKKA 2C6IA 3KCKA 3MYGA 2IW9A 4KKGA 4RQVA 4W4YA 5CAOA 3PVGA 4FKSA 3E5AA 5M4FA 2UW9A 5HIEA 1XH9A 2H9VA 4K2RA 3KK8A 5LMKA 1ZAOA 4FBXA 4JL9A 4M84A 2SRCA 3EL7A 1U4DA 2PUUA 3OF0A 5IUHA 4UMTA 2ITUA 3R7OA 5HO7A 5I9WA 3CQWA 5JRSA 3H9RA 1Q61A 4PP7A 3BU3A 1JPAA 3W8QA 3QD4A 4CLJA 2GNHA 2CGVA 4I6HA 5DR9A 4FKWA 5FM2A 4B0GA 5IA1A 2RGPA 2W1EA 4FF8A 4OTIA 5K4IA 3LCKA 4TYEA 3W32A 5M53A 2PUIA 2JEDA 3Q52A 4GIIA 4PV0A 2Y4IB 4IJPA 3NDMA 4IDVA 1QPEA 1G8AA 4ANQA 4YPSA 4QP2A 5K0KA 3F7WA 3P23A 2HZIA 4QMNA 1KSWA 4E6DA 5AX9A 2VU3A 3COIA 1H25A 3GC0A 4NFMA 5EDRA 3W8LA 2VV9A 5AP1A 4EK8A 1OI9A 3HUBA 4MXZA 2CNQA 4U5JA 3HMOA 5EFQA 4EBWA 3CQUA 4J1RA 3A7GA 2VUWA 2R9SA 1Q8ZA 1H1WA 2BRGA 4RFYA 2YLFA 4Y95A 2JAVA 2YM4A 4GFOA 2E9UA 5GIOE 2BAQA 3RPOA 3TNIA 4HVSA 3GUBA 2PY3A 4GYIA 2WTWA 2VGPA 3DU8A 3FI3A 1TQIA 4IE9A 3S2PA 3R1YA 1WAKA 4ZSEA 4QOXA 3IOKA 1JWHA 3NS9A 5EI8A 2X8EA 3SW7A 3HVCA 5CQUA 5ANGA 2YM6A 4I5CA 4F6WA 1H8FA 4X2GA 4BTJA 3R2BA 3D9VA 4FC0A 1NVRA 2GHMA 2HELA 2IO6A 3POOA 2QKRA 4O0XA 5CVHA 5FBNC 5LCKA 3W2OA 4EOPA 4CQEA 1B6CB 2GPHA 1GOLA 3BWJA 1XH4A 3I6WA 4GK2A 4Y73A 4FSNA 5GJDA 3FY2A 4EEVA 4OBPA 2Y4PA 3CGOA 1Q41A 4Y83A 3U4UA 5CASA 4PTEA 1J91A 3ZU7A 4LMUA 3JS2A 4OT5A 3MVLA 1GZOA 4B4LA 3MTLA 5A4EA 4FL2A 3KRJA 3E93A 4APCA 4JLCA 5H2UA 3BU5A 1J7LA 4AFEA 3ATTA 4X2FA 2GNFA 2P0CA 3O7LD 3OY1A 2YISA 4NEUA 5CZHA 3HAMA 3CXWA 3QYZA 2HZ4A 4ALUA 2BRMA 2XMYA 3KRXA 5IMEA 1PRYA 5JRQA 4A7CA 1PKGA 3U87A 3MN3A 1OIQA 4YC6A 4PPCA 3SC1A 4BDCA 2C3LA 5KHWA 3VJNA 5DOSA 3FLYA 3DOGA 3QALE 3VRZA 5J7HA 4M67A 5KMOA 5C8MA 4UBAA 4YJUA 4QYEA 4WT6A 5CEIA 4DGOA 4YURA 4S33A 1J3HA 4G3DA 4FKRA 4IVCA 3OZ6A 3QXPA 2PSQA 4DGLC 2WQNA 4IAKA 5CAPA 2HIWA 3CS9A 4EONA 3LXPA 2W9ZB 4IZ7A 4WRSA 5CT0A 4O82A 4A4OA 4PF4A 4DEHA 1K2PA 4LM5A 4HGSA 3BYMA 2JDVA 4ITJA 4QTCA 3G15A 1H24A 4WBBB 4KIQA 4ZLYA 2OSCA 2Z7RA 5M4IA 4BCPA 3GCVA 3PUPA 3AOXA 2J6MA 4APPA 1GZNA 1PYXA 2JIIA 5E8ZA 3RPRA 4BVUA 2XNGA 5E8YA 4I23A 1MRUA 3EWHA 4K8AA 2V7AA 5IQDA 4JDJA 4OTRA 4IVBA 5CLPA 3PWDA 2JD5A 4KIOA 3BHTA 5B2LA 3NYOA 4R7IA 4XRLA 5CNNA 3RHKA 4DG0E 3MH3A 3MI9A 5AR8A 1FBNA 4AGCA 2BILB 4I21A 5IH5A 4UWBA 1W8CA 4A9TA 5CS6A 3RJCA 4QMOA 1CKJA 4K9YA 5DLSA 3VS1A 1OZ1A 3F3ZA 4M66A 4RMZA 4E6AA 3N9XA 4YJQA 3F82A 4DGNA 1WMKA 5IH6A 3HLLA 3QHRA 1REKA 3MFTA 5CSWA 4F7JA 3ZO1A 2XK8A 4ZSAA 1UU7A 2WOUA 3UPZA 1TQPA 2BPMA 3L8SA 4L01A 1PXMA 3PWYA 5CXHA 4BIEA 4BZDA 4YHTA 3PG3A 4WNMA 2OF2A 2PL0A 3EKKA 4FV6A 4D28A 3F2AA 2BHEA 3A7FA 3EFKA 2C5VA 4Q5HA 1FINA 3ALNA 4GK4A 4LGHA 4DH3A 4E26A 5L6PA 5EW9A 2FSMX 4XUFA 4LRJA 4L53A 3UO5A 3IO7A 4PDSA 3LMHA 4RWKA 4RIYB 2XNBA 4RG0A 5DH3A 2IN6A 5H3QA 2UW8A 3VWAA 5C26A 5JGDA 4YZBA 1ZYCA 2O3PA 5CYIA 3TNQB 3R01A 5CF5A 5EQYA 2W06A 4TNBA 4V0GA 4R78A 2QOKA 4DLIA 3HRCA 4QP3A 4AUAA 4DE4A 5EOBA 5IZFA 2BZKB 2C6DA 2HYYA 4K33A 4NKAA 4O0WA 3VUKA 4F63A 2RFEA 2HK5A 4QMZA 4AG8A 3AMBA 4CYJA 4BDFA 4L7FA 4N6ZA 2WAJA 4L3LA 1JNKA 4WO5A 2CHLA 3W2CA 5HG8A 4KSQA 1YHWA 3BQCA 5LJJA 2RFSA 4ALWA 3MSSA 2ZAZA 4BHZA 1P4OA 5DG5A 4AZWA 3VBWA 4JQ7A 2WXVA 1H1SA 3LCOA 3IDBA 1XJDA 3PSBA 3QLGA 3E7VA 1E1VA 3RP9A 3ZO2A 3MY0A 1H01A 4XRJA 4WSQA 4EH2A 4PL4A 3C5UA 3MS9A 4MWHA 3BBWA 3DJ7A 2C6KA 4AAAA 4WG3A 5ANJA 3AC5A 5JEBA 1V1KA 2IWIA 2JDRA 4AACA 3OCGA 3A2CA 3HA8A 3QTSA 3RAKA 4U79A 2JFLA 4DCEA 3V5PA 2VNWA 5AUVA 4HGLA 2VWIA 3VAPA 3R8PA 3CTJA 3ORNA 2HW7A 3SD0A 3CD3A 3FJQE 3C51A 4X2NA 1XH8A 3P1AA 2B4SB 3QRTA 4M0ZA 4FKTA 5CEKA 4RLLA 5EHLA 4DFXE 4V01A 2VAGA 4ZY5A 2XZSA 2J0LA 2Z7QA 3V3VA 5EKNA 2QI8A 1G8SA 4JR7A 2UV2A 1XWSA 1CM8A 4GG5A 4DYMA 1K3AA 4JIAA 4RVKA 2XVDA 2Z7SA 5IQIA 4YC3A 3HDMA 1W0XC 4JAIA 3MIAA 1GIHA 3MBLA 3F3VA 4XG9A 4KIKB 3ZO4A 4TNDA 3NCGA 5GZ9A 2F49A 2J9MA 2GS2A 3C4CA 5EYKA 3OTUA 2J90A 4PPBA 3QTUA 4XP3A 4AZTA 1H07A 4UY9A 1IASA 3MY5A 2YZLA 3WE8A 5HX8A 3TCPA 2JBOA 2HY0A 1PXIA 1UKIA 2WIPA 4YGAA 4AW1A 4EHEA 5A6NA 4O7NA 4O7WA 4RJ5A 4EOSA 4K11A 2X6EA 4DEDA 1YOLA 2UZDA 3LHJA 4M0YA 5CALA 5I0BA 3CQEA 3JPVA 3QFVA 4XYFA 4M97A 3IECA 4F6UA 1Z9XA 4LGDA 5HCYA 3FZRA 4Y5HA 4UWCA 3VS5A 4ZZMA 3SA0A 4CT2A 1BKXA 2R3PA 3OUKA 2R7BA 1F3MC 4FL1A 4FT5A 2QHNA 4XNEA 3UDBA 4AP7A 4KIPA 4EK6A 4RRVA 3BGQA 4C35A 5C27A 4HZSA 3VQHA 4NWMA 5L6OA 3H9OA 4EH8A 2R5TA 2UW3A 5HO8A 2PWLA 2QO2A 3BV2A 3LFDA 5FD2A 5G6VA 5DHJA 4QP7A 5IF1A 4DH7A 2V5QA 1IEPA 1QPCA 2X7GA 1NT2A 5AP4A 4O38A 4JDKA 2OI4X 4NCTA 3QZGA 5FDPA 2F9GA 2O2UA 3A4PA 5J79A 4IJ9A 4JRNA 2WD1A 3D5UA 3P0MA 3QCYA 3QGYA 4JQEA 4UXQA 4XG3A 3ZEWA 5HQ0A 2XS0A 4BBMA 5BVNA 5BYZA 3PJ2A 3MTFA 1H1RA 4BDJA 4XV2A 4X3FB 4BC6A 4BDGA 5HI2A 4ZJJA 3KVXA 3L8XA 4AA5A 4CD0A 1PMVA 3LLTA 3NUNA 3I81A 3IW8A 1V0PA 5DT4A 5BVDA 3LFBA 2C6TA 4W9WA 5AP2A 3V04A 4OAUC 2F4JA 3HX4A 4JBOA 2XK9A 1WVYA 4J7BA 4RC4A 4V0GB 4BDAA 4Y85A 4H3PA 4QQTA 4KKEA 5IQFA 4D9TA 2YJRA 2XF0A 2WTDA 3W2PA 3QKKA 1I44A 4YC8A 3QUDA 3QWKA 5K9IA 4XOYA 2W99B 4IVDA 1PMUA 4E6QA 3AGLA 2QG5A 3JXWA 2OH0E 4FIEA 4Z16A 5IQEA 4EH3A 4ZMEA 4TL0A 4X2KA 5CSPA 5IEYA 3H4JA 3OW4A 4BKYA 3NVKI 4TPTA 1WVXA 2C6LA 1YOMA 2VTJA 2BCJA 5IA5A 3QTQA 3C1XA 3ZRLA 4D1ZA 4ENXA 5IEVA 4FIIA 1JVPP 4MH7A 1WBWA 4W4XA 1O6KA 4FV7A 1M52A 2A2AA 2HOGA 4N0SA 5DWRA 4RC3A 3RPVA 3THBA 3K2LA 4ZTMA 5KCVA 3N4UA 3DKGA 3F7ZA 3WZDA 4A9YA 3DK7A 4L68A 3VS7A 4TWNA 1YDRE 4O7YA 4LMNA 2ZV8A 2PE1A 4FZDB 1OKWA 1Q8YA 2BIYA 2IVUA 3LCDA 4TYJA 3RAIA 5BNJA 3QYWA 2JDTA 4ASDA 4GU6A 4FEXA 3MPMA 3D5XA 2PMNX 2YCRA 3P4KA 1OKYA 3IW6A 1XBBA 2BROA 2ZM1A 4AQCA 4Q9SA 4E6CA 5M07A 4EZ5A 2GTNA 3UIBA 5KZIA 4H3QA 3TTIA 3I60A 4IVAA 5CSVA 4MNFA 4FV9A 5HICA 4MYGA 1H08A 3E8CA 4D0XA 2BDJA 2QR8A 5D7VA 4GSBA 3PVUA 3TT0A 3VBVA 5JFWA 1H0WA 4PUZA 2C5YA 2BKKA 4C61A 3HMMA 3FI2A 2UZBA 3CPCA 5CU2A 5BPYA 1OUKA 1UWHA 3PYYA 4AA4A 4L7SA 4GMYA 4BHNA 1U5QA 4RIYA 4J52A 2OZAB 4JG7A 5KX8A 4M3QA 4U45A 4IX4A 2J0KA 1R78A 3G2FA 3QA8A 4HW7A 2UZUE 3OCBA 3R1QA 1G3NA 3NW6A 3MFUA 5HE3A 4DHFA 2YAAA 3LQ8A 3RI1A 4PL3A 4F0FA 4AT3A 5LWMA 4I6FA 3IGOA 1ZYLA 3TV7A 2WTCA 5M51A 3ZLSA 4I93A 3BHHA 2WTIA 4WUNA 3TUCA 2GQGA 3BPRA 4PMPA 4IADA 3QQKA 3FZ1A 3NNUA 3A7JA 2HZ0A 4OT6A 4S32A 5CNOA 3TZMA 3UZTA 4IW0A 5IQAA 3KA0A 3MFRA 4JI9A 3REPA 3NUSA 4C4HA 4YZDA 2YHVA 4F70A 3R00A 3GC7A 1L3RE 1MRYA 2B0QA 1FGIA 3PXFA 2VO7A 1XH6A 4PTCA 4XBRA 3UG1A 1PHKA 4HZRA 2ERKA 3P9JA 3LM0A 2QOFA 3E8EA 4ZP5A 5JGAA 5F1ZA 2BZIB 4UXLA 4U97A 4QNAA 4DH5A 4E73A 1OIYA 4O86A 4EHVA 2YITA 3D2KA 4OTHA 4EH6A 5M44A 3PY3A 1PF8A 4A9RA 4EH4A 3UMWA 4QMMA 2QG7A 4U3ZA 5EW8A 5HX6A 3OS3A 3BIZA 4ANLA 3EZVA 4MD7E 3PLAE 2ITQA 5HHWA 2O65A 5FQDC 4MF0A 4E20A 3ZCLA 2XK7A 3BE2A 4GRBA 4JQ8A 5A4CA 4O0RA 1Q3DA 2CLQA 4IFCA 4BIDA 3NYXA 2O5KA 3G33A 3MDYA 5ETAA 4YMJA 5JMSA 4DT9A 3NMUF 2QHMA 3GQLA 5KMKA 3D83A 4XG7A 4RA4A 4LUEA 4O0TA 2PPQA 2YFXA 4KRCA 3R9OA 3DAEA 4WSYA 4F1TA 1R0PA 2C68A 3OFMA 2UVZA 5T3QA 2F2UA 2G2IA 3Q4TA 4EYJA 3EQCA 1CDKA 4UZHA 4OTFA 5J5TA 4RIXB 1Y6AA 4GUEA 1SNUA 5AFVA 3OD6X 4EC9A 3FKNA 1U5RA 3EN4A 3SW4A 4FTIA 3QUPA 3AC3A 4QP4A 3WIGA 1WFCA 4C37A 4G9CA 2B54A 4FSWA 3DBEA 4L3PA 5L2QA 3UBDA 3ZS5A 3B2TA 4NH1A 5AM6A 1RE8A 2HY81 2VX3A 4U81A 2QD9A 3TDVA 3EN7A 3Q9WA 3ZSHA 2HZNA 4FV4A 4CFVA 5J8IA 2I0HA 4G6NA 3VHEA 3PVWA 5KBQA 3QTXA 2G15A 3TJDA 4ACGA 3OY3A 4GEOA 3ELJA 3MA3A 2UZTA 2C3KA 1FVTA 3OXIA 5C8KA 1Y6BA 4I0RA 2VTMA 4IWPA 4OUCA 3VBTA 4EOMA 3R63A 2QKWB 3JVSA 5E8TA 3CE3A 1JLUE 3D4QA 4MD9E 3DDQA 4YJTA 4AN2A 4IAZA 1FPUA 1R39A 3L9LA 4F0IA 2P2IA 4C57A 5HU9A 2B7AA 4KBCA 5H8GA 4C2WA 2WTKB 3ORPA 5A46A 4M68A 3A62A 3R1NA 4Y8DA 4CEGA 2JKQA 5IA2A 3M42A 4BTFA 1LR4A 1SYKA 3FXZA 3CTQA 1QL6A 5JFVA 1GIIA 1KE5A 3NEWA 4I24A 4JX7A 3D0EA 2P33A 3IDPA 4IAYA 2XBJA 1WBTA 2O0UA 4H3BA 4L46A 3RM6A 4D5HA 3U54A 3RGFA 1H1QA 3CCNA 3FHIA 2W5HA 2WOTA 3HZTA 3FPMA 2QOQA 5AIRA 3UG2A 4UN0C 3GFEA 2OZAA 4J95A 5AP3A 4IBMA 3ANQA 3MESA 4FKVA 2C5NA 3GI3A 1QMZA 4W4VA 3ZH8A 1Z5MA 4XG2A 4IM3A 3KMUA 3IPHA 4GVAA 3VUDA 5TOZA 3EN9A 3BLRA 3EN6A 3Q04A 2ERZE 5AJQA 5C01A 3TNWA 3V51A 5A6OA 5J9LA 4OBQA 2PUPA 3OTVA 2R3FA 2HCKA 2WKMA 2WMBA 5K3YA 4HVDA 3PY1A 3U6JA 3GU5A 2J4ZA 4E7WA 4YR8A 2CJMA 3E87A 5ANIA 5I9VA 3COMA 4ZY4A 2WMWA 3HYHA 2Z7LA 5CU3A 2XH5A 4EQCA 4EC8A 4AGUA 4GH2A 5J9ZA 2OXXA 2IZRA 1RQQA 3PSCA 4HPTE 4J97A 3BRBA 5FP5A 2PVJA 2R64A 3BLQA 5CAUA 4NJDA 2P3GX 4I6QA 4A9SA 5BUIA 4O2PA 5ICPA 2CKQA 1U46A 4YLKA 5A9UA 4CFWA 4NCTC 1BI7A 3GNIB 3EN5A 3NCZA 4Z9LA 5I5ZA 5DR6A 1FQ1B 5HZNA 2C3IB 2X6DA 5J95A 5E8WA 4F7LA 3ORKA 4L6QA 4XHKB 1OGUA 2GFSA 4ZS4A 3PXYA 5AUZA 2B53A 3O51A 3KC3A 3DJ5A 4FL3A 4FTUA 3KF4A 2OJJA 4IB5A 4TN6A 4DF3A 3ZM9A 5IUIA 3VUTA 4X2JA 4G34A 1Q99A 3F61A 3G9LX 1PY5A 4NM0A 4MF1A 5EI2A 1BYGA 4G5JA 4KS7A 3BHUA 5DIAA 4BDKA 4YU2A 2XNNA 4L67A 2WQMA 5B0XA 5HIBA 4YO4A 3SXFA 5A54A 1ZZLA 4FUXA 2UZWE 5TE0A 5AR7A 5AWMA 4DC2A 3R04A 1T46A 1ZLTA 1ZY5A 4BRXA 2JC6A 3G9NA 3KREA 3F69A 3V5WA 1FVRA 5AR2A 4V04A 5FTQA 1AQ1A 5AMNA 2A4LA 4ZTQA 3Q6UA 1XH7A 4IIRA 4Y5QA 5KZ0A 4PY1A 3TV6A 3OUNB 2H6DA 3UIUA 3G6GA 4IX6A 4M14A 4BDDA 1PMNA 2UVYA 2HW6A 1V0OA 2EU9A 2YCFA 3NAXA 4O1OA 4FV8A 5I9UA 3VS0A 3SRVA 2QURA 2W5BA 5EYCA 1EH4A 3RM7A 2XKEA 2OK1A 4XLIA 2WIHA 2P2HA 1XH5A 3T9IA 5GIPE 4NU1A 3R7IA 1YQJA 4O21A 2W05A 4FZ7A 5EM6A 2W1DA 3EQHA 4QMXA 3BEGA 4Y72A 4NM3A 5LVPA 1PMEA 3AT4A 2XYUA 4KKHA 1NA7A 3DS6A 5AEPA 4GU9A 4ZSJA 2QONA 4ZTHA 3C50A 2IJMA 3K5VA 3MH2A 4YTFA 4R7HA 4WNPA 2WB8A 3RNIA 4TYHB 2PTKA 3TNHA 2VWBA 4IC8A 4BR3A 4ZOGA 3RBWA 4ORKA 3MWUA 2OIQA 2XNEA 3P78A 1WBSA 3HMPA 3A8XA 1OUYA 4ZSLA 5IH4A 3DKOA 4JG6A 1H1PA 3RCJA 3IS5A 5CANA 2YAKA 4RIWB 4WD5A 2BZHB 3M1SA 2C0TA 3QZFA 4XV3A 5L3AA 2XJ0A 4FV3A 4CCUA 4WNOA 3MVHA 4DGMA 4PMSA 2XRWA 5EDPA 5HTCA 1UU9A 4G6LA 4EZ7A 4UX9A 4C2VA 3FPQA 3MV5A 3C4XA 4R7BA 3FZOA 3VIDA 1OL6A 3SAYA 4QYYA 1QPDA 3FQSA 4EWQA 1OBDA 3KL8A 5L2SA 3E3BX 3HDNA 4J98A 2X1NA 1FVVA 2UW4A 4II5A 3EQIA 4P90A 1KOBA 4RFZA 2NO3A 3U4WA 4AT5A 3GU7A 2W4OA 5JGBA 3P7CA 1FMOE 5BVKA 3DQXA 4O1PA 3C0HA 4UMPA 5D41A 2VWWA 5EKOA 3ID6C 2J0IA 2X4ZA 4ZAUA 2OJIA 4RIXA 1ZYJA 1UNGA 4G3CA 5HGIA 3L8VA 3R8VA 4E1ZA 4HVGA 2JFMA 3OEZA 5DN3A 1V0BA 5J7BA 4L43A 4C4FA 2ITTA 4DAWA 1U59A 3GB2A 2JITA 3Q9XA 3QRKA 2G1TA 3Q4ZA 2FB8A 4XBUA 3DB8A 4JJRA 4PP9A 4BGHA 4CKJA 3KXMA 3BYUA 3LMIA 4FIGA 5KMMA 3OHTA 2PHKA 4IZAA 4RLKA 3WYYA 3NYNA 2XNOA 4IAAA 1PXPA 3C4EA 3F66A 3CSVA 4FV1A 3FC1X 2R3RA 3RPYA 5L4QA 4DTAA 3NAYA 5HE0A 2O8YA 2J2IB 1ZOHA 2ZM4A 1KWPA 3GC8A 4CFFA 2ZM3A 4GIHA 3QUEA 4FVQA 3PRIA 3S00A 4TWCA 3KVWA 4IHPA 2VD5A 3AGMA 2AC5A 3KMMA 3QCSA 4U6RA 3ZDUA 3HRFA 3W18A 2RFNA 3FMLA 4ASZA 4CFUA 1S9IA 4F1MA 4M69A 4XG8A 2CLXA 3FY0A 5EH0A 1DM2A 5FP6A 5HCZA 3WIKA 4MNEB 4EOQA 2YDIA 5CTPA 4IACA 4RJ6A 3CBLA 4D55A 3Q5ZA 4AWIA 2W7XA 3AT2A 2BFXA 4BF2A 3KN6A 5E90A 2GCDA 3O7LB 4FTMA 4QYGA 4BCQA 4BFMA 4YTIA 3TJCA 3F5GA 4S30A 4U7ZA 5L2WA 2X39A 3C9WA 3FMEA 3GCPA 2E9OA 4N6YA 1CKPA 4DA5A 2AYPA 3QX2A 3R7YA 3UQCA 4CGAA 3H10A 1M7QA 3C4FA 1P5EA 2OWBA 4X3FA 5JZNA 4FV2A 4MVFA 3DDPA 4YZ9A 4EH9A 1CSNA 1OECA 1LUFA 5AAGA 3IGGA 2YEXA 2ZDUA 4FG7A 2YIRA 4MX9A 1Q97A 2ITPA 3GU8A 4CXAA 4D4YA 5C1QB 2Q83A 3M2WA 4O96A 4OW8A 1YKRA 2BMCA 4FSYA 4LG4A 1VEBA 3W2RA 4AE9A 2DQ7X 3BE9A 5HOAA 4A4XA 4KWPA 4IWOA 3VNTA 4C4IA 4FT0A 2QOBA 5IUGA 3UIMA 5EK7A 5A3XA 5JQ5A 3PPZA 2GHLA 1YI6A 1H0VA 3UO6A 3KMWA 3NIEA 3TKHA 2QCSA 4G16A 4ASXA 3IOPA 3OBGA 2CPKE 2YERA 3EQBA 3FE3A 3HV4A 4H58A 3NW5A 4MWIA 4PNIA 4BI2A 4ANSA 4BDHA 5E9EA 3CPBA 2OKRA 1ATPE 5C8NA 4JT3A 2CKOA 5JN2A 2EWAA 3QTWA 3POZA 4FICA 4FX3A 3ZBXA 3EQRA 2W1GA 2WELA 4BZOA 1GJOA 1XKKA 2XYNA 5CENA 2J5EA 4FEVA 3ULIA 3AT3A 4CLIA 4L9IA 4NIFA 2I1MA 3D5WA 4QT1A 4CQGA 2V22A 4E4XA 5LVOA 2YM5A 2BR1A 3FC2A 3ZEPA 3DBQA 3FMJA 5DE2A 3U6IA 3D5VA 2YM3A 4DFUA 3KFAA 4FKIA 4D4VA 4E93A 3FI8A 5DGZA 3ZFMA 4UMUA 3GENA 4IXPA 4DITA 2ZV7A 4C62A 5I3RA 2BTSA 3HMNA 3DA6A 3LW0A 5TF9A 5AR5A 4A07A 3AQVA 2WTVA 3OG7A 4KA3A 5EW3A 3G0FA 4QMPA 3VUGA 2QC6A 5F94A 3O8PA 3ORLA 4D1SA 1J1BA 2YDJA 4EK3A 5J1WA 2EXEA 4IDTA 4JX3A 3VN9A 3QD3A 2BAKA 4MCVA 2GFCA 3PG1A 1YDSE 2C1BA 5FXQA 4RFMA 3MY1A 4USEA 4YNOA 2ETMA 2ETKA 2QU5A 1YVJA 5IQBA 4XV1A 2JDSA 3EFJA 1YW2A 3QWJA 3LXLA 5AP7A 5GINE 2NPQA 3CR0A 3EIDA 2JBPA 3ALOA 4NW6A 4EH5A 5HD4A 1MQBA 2IZSA 4EKKA 3FAAA 2B9FA 3E64A 5FXSA 3V01A 5HBEA 3DY7A 3TKUA 4JRVA 4C0TA 4C38A 4U44A 5F9EA 2YLEA 4GW8A 5TKDA 3Q2MA 2XA4A 1LP4A 3R7UA 2C5XA 5FRIA 5M4CA 3F6XA 5CEPA 3ZZWA 3P86A 4PRJA 2B1PA 5AV0A 5FG8A 4DFYA 2DYLA 4CMOA 3F5PA 5JH6A 3LM5A 3QQFA 3PTGA 4LV8A 2Y7JA 2C3JA 5AAEA 3DBFA 1FOTA 4FNZA 3FKLA 4RIWA 4Y46A 4YNEA 1H00A 3QTIA 4HYIA 3EYGA 3WZJA 3L9NA 3VUIA 3HP5A 4I6BA 4O2ZA 4FT7A 3FLZA 5EHYA 4J8NA 2VN9A 3EQGA 1M2RA 1WBVA 4BIBA 2OZOA 4L3JA 5FBOA 4RZWA 4F9YA 1GNGA 2W1ZA 4XMOA 1MRVA 1QCFA 1R3CA 2NRYA 4PDPA 2LAVA 4AW0A 3S0OA 5G1XA 2PVYA 5HLPA 3QTZA 4C58A 4FNWA 3FMNA 4U42A 5E1SA 5HE2A 3RK7A 4ZK5A 3KU2A 2J5FA 4RVMA 3G0EA 4I4EA 1CTPE 1KOAA 3P7AA 3T9TA 3R1SA 4EUUA 3ENMA 5H8BA 5KBRA 3QD2B 4DEEA 3FXXA 2JKMA 3KN5A 5B7VA 5CEQA 3UNZA 2VWXA 4BGGA 2Y9QA 2ACXA 4C7TA 1F0QA 2XIRA 5EYDA 2OF4A 3NUPA 4DINA 2OLCA 4O7VA 4FTJA 4RIOA 4YPDA 5AV4A 5HG9A 4H39A 4AGWA 3R8LA 2BDWA 2EVAA 3I0QA 4I41A 4LYNA 4AE6A 4YSJA 1FMKA 4NKSA 5HG7A 5T6KA 3SX9A 2WMRA 2WMXA 3PVBA 2WZJA 5CZIA 4QP8A 4F9BA 3H0YA 2UVXA 4JR3A 4FKOA 4KRDA 4R1VA 1WBOA 2OGVA 4UZDA 2VWVA 3UODA 4AOTA 4CTCA 3WF8A 4DFZE 2XIZA 3PPKA 3ORTA 4WG4A 5JK3A 3U55A 4LOOA 3OC1A 5BVFA 1ZRZA 2VX1A 3W10A 4USDA 1QPJA 4AU8A 4DH8A 4HVHA 1UVRA 5HKMA 3E8NA 2PZYA 4O27B 1J1CA 3NNVA 4CG8A 4ZLOA 3R8UA 3GU4A 3UIXA 1UA2A 3HV7A 4LRMA 1O6YA 5AX3A 1YWNA 4BCJA 4HGEA 3I79A 4FSTA 2RL5A 5AA8A 4MXCA 4ZY6A 4F7SA 4O0VA 2H34A 1OITA 4AOJA 2PZRA 2XNPA 4R5SA 3LQ3A 4WUAA 3AD6A 2ZV9A 4AOIA 3FQHA 3FWQA 2OBJA 4PDYA 4TYIA 4FTCA 4UV0A 3S3IA 2XM9A 3R8ZA 4EI4A 4JVGA 3EYHA 3SG9A 4DFBA 3UOLA 4D58A 3PP0A 2WMSA 3LIJA 3TUDA 4F09A 3U9CA 5D9HA 4ANMA 5FEQA 4BTKA 3PDTA 3RZBA 1E1XA 1AD5A 5HBHA 3IG7A 4LFIA 1SMHA 5C9CA 2BHHA 3EKNA 4GYGA 4EZ3A 1JOWB 3HV6A 2RG6A 4YJSA 4KINA 5FXRA 3BWFA 4FSMA 2WQBA 3ZSGA 2OFVA 4FUYA 4GKIA 3R0TA 3CJFA 1KE9A 3VRYA 4MK0A 4UYNA 1NVSA 4JOAA 2CDZA 3MVMA 3VC4A 1O9UA 1Q24A 4KABA 3RWPA 4YBKA 4O7RA 3UPXA
chains in the Genus database with same CATH superfamily
3FL4A 3V5TA 5CI6A 1SNXA 5GZAA 2WMQA 5CU6A 3CY2A 4GJ2A 3BYOA 4IB1A 5GJGA 3OT3A 3CKXA 3H3CA 4NW5A 4B99A 2C1AA 4AXEA 4L00A 3JVRA 4AFJA 4OTDA 1VYZA 2PVRA 1ZWSA 2Z60A 2X7FA 5CU4A 3D7TA 2XRUA 4I94A 4EH7A 4FA2A 1SVEA 1NVQA 4K0YA 3ERKA 3FZTA 3ORMA 5KMLA 5CVFA 3FLNC 3FMHA 5IEXA 4YJPA 3DV3A 3OWJA 3W2QA 1KV1A 2HXLA 5HTIA 4RVLA 4BL1A 4ZTRA 3SGCA 2IW8A 1TKIA 2JLDA 3O0GA 4ARKA 3I0OA 4FI1A 4I0TA 2PK9A 2IPXA 3HAVA 3CTHA 2BRBA 4UWYA 3DZOA 5HEZA 3D94A 4YJOA 2XAMA 4QYFA 3FEGA 3PXRA 2BUJA 2I0VA 2PZIA 2VZ6A 4BCKA 4EJ7A 4FTOA 5KMJA 3WF5A 4FK3A 2ITOA 2X81A 4YHJA 2Z02A 5DMZA 3LLAA 4YJNA 4PL5A 1DI8A 2F2CB 4GV1A 5HE1A 2R3OA 4XJ0A 3TV4A 3K3JA 4LOQA 3COHA 5CF8A 3QQHA 4XS2A 3GGFA 5E8VA 2VO3A 1MQ4A 3DNDA 3F3TA 3LMGA 4FTAA 3ODYX 5ANKA 3BHYA 4QYHA 2NNWB 1MP8A 4DHJA 3H30A 3EJ1A 4MBIA 4OTWA 3ZC6A 4IZYA 4QMVA 4KIKA 2F7ZE 4NL0A 2CCHA 3DT1A 4MXYA 2GNJA 1YHVA 4I5MA 3UOHA 1XBAA 1Z57A 2A0CX 4GL9A 4AZSA 4BDIA 4EQUA 1OMWA 3PIXA 5IKWA 4FYOA 4H1MA 2PUNA 3C13A 1F5QA 4CG9A 2GU8A 2WMTA 3EQPA 4EK4A 3OT8A 4BCNA 3UVPA 3PLSA 1SM2A 5L8JA 4RA5A 2WMVA 2CGXA 3NRMA 2QVSE 3UNJA 3UO4A 4G17A 2IEWA 4FT3A 2FUMA 2JAMA 3T3VA 2A27A 3COKA 2BAJA 3UC3A 5EQPA 4E5AX 4LQMA 2V55A 4OTQA 3OMVA 3GCUA 3FKOA 5HIDA 2XEYA 5BYYA 2UZEA 4NTSA 3SDJA 1H4LA 3WBLA 4X6RA 4FKQA 5A14A 2G2FA 3EMGA 3GT8A 4I22A 2I6LA 3V8SA 4YTCA 3R21A 1O6LA 3PXQA 4ITHA 5AUXA 2VTAA 1JKTA 5E7RA 1PKDA 2OJ9A 4L44A 4LV5A 2NRUA 2WTKC 3TDWA 3UZRA 1IA9A 5BMMA 3EL8A 3O17A 3O50A 3NIZA 2HAKA 3KXZA 1IRKA 5AUTA 5C4KA 3VBQA 5FWKK 3MW1A 3CD8A 3QQLA 3ZYAA 5I9YA 2VWUA 4C3PA 2VTQA 1VZOA 2FSTX 3DZQA 3ORXA 2Q0NA 5A4TA 4R3PA 3QKLA 4ZS0A 5IA0A 3I1AA 2XIKA 3ZTXA 5IG1A 1W83A 3QRJA 3F88A 4BWPA 3CGFA 5M56A 3KRRA 5LOHA 4ZJVA 4IH8A 1ST0A 2XALA 1OKVA 3PJ3A 3PIZA 4U8ZA 2CKEA 4FNXA 5GJFA 4DTKA 3SOCA 2V62A 3RALA 3I6UA 4O6LA 4X3FC 2A1AB 3K5UA 1GIJA 5EG3A 4YP8A 4ERKA 4TT7A 1GAGA 3R7GA 3W1FA 3SHEA 5BUJA 3WE4A 4ZMFA 1OKZA 5BQ0A 3OVVA 1U54A 4EK5A 3R9RA 1KE8A 2QLQA 2BTRA 4G3EA 3IW5A 1B39A 1PXLA 4R6VA 4FRFA 3MVJA 1OL5A 4O4FA 3DJ6A 4F65A 4HYSA 3FLWA 4QQ5A 3ZDIA 5KKRB 3CC6A 2F7XE 1M14A 5AA9A 2ITXA 2RIOA 3B2WA 4AXDA 2J51A 3AD4A 4TZRA 4U41A 3ZONA 1GZ8A 3AXWA 3Q3BA 4TW9A 4CNHA 5CWZA 3EFWA 4HOKA 5LVMA 4CT1A 5T68A 4CTBA 3QQJA 4FG8A 4ZZOA 3O2MA 3QRUA 3FZPA 4DG2E 4RWJA 3L1SA 5KO1A 3BI6A 2GQRA 5F4NA 4TYHA 1B38A 4JAJA 3H0ZA 3PSDA 4BN1A 4BZNA 4W8DA 4Q2AA 3ZRKA 3I7BA 3VS4A 4V05A 2RFDA 2GNGA 3FHRA 4G6OA 3V5LA 4D0WA 4O4EA 4R5YA 4ZIMA 3D7TB 4GKHA 4P4CA 4C4EA 1Q5KA 3ORIA 4QMUA 2GS6A 4FT9A 1FGKA 4G2FA 3ML1A 4E5WA 1ND4A 3DFAA 1XHAA 2XNMA 5DI1A 4M69B 4P5QA 2WU7A 2OFUA 3FSKA 2NP8A 3G90X 4BDBA 1P4FA 1ERKA 2YIYA 4RX9A 3ZLXA 4W4WA 4NYEA 5HNGA 5IQGA 4O0SA 4JDHA 3BQRA 3L9PA 4S31A 2XJ1A 3ROYA 2XKDA 3TL8A 3ULZA 3ZLWA 1J7IA 4RVTA 5HO6A 5IQCA 5LXMA 1VLRA 4FSUA 4R3RA 4XG6A 2WO6A 5D7AA 5LMAA 2YIWA 5IDNA 4U40A 3HNGA 4NTTA 2PVMA 3PA3A 2QO7A 1XQZA 1T45A 1YXXA 3KCFA 2WGJA 3IONA 3F5UA 3H9FA 4HJOA 3MJ1A 3OWPA 3OOMA 5CAVA 3LFQA 3ACJA 1TFFA 4B6LA 4XCUA 4BCFA 3F3UA 4D2WA 1G5SA 5IA3A 3A7HA 1L8TA 2JDOA 5AP0A 3PFQA 1W84A 2DWBA 3LAUA 4QTAA 3DFCB 5CF6A 4ALVA 4FKUA 3HV3A 4IANA 4WOVA 3NUXA 5DRDA 2EUFB 4NZWB 4PDOA 4BYIA 3UC4A 3WARA 2E9PA 2UW0A 2A98A 4FTQA 4M13A 3P08A 4IB3A 3E92A 4Q5EA 4WNKA 4ZJIA 3F2RA 1Y57A 5JSMA 2R3GA 4OTGA 3ZZEA 2J50A 3LZBA 1ZMUA 3ZFYA 4H36A 4ZSGA 3W2SA 5GZ8A 4XV9A 4F9CA 4UMQA 5DEYA 2LGCA 3GCQA 3FSFA 4BCOA 4GCJA 2X2MA 3PJ1A 4Z55A 2GNLA 1OBGA 4FKLA 4I6LA 5EOLA 1BX6A 3LKMA 3QX4A 1OL1A 1Q8TA 4D4SA 4EOIA 5KUPA 1PW2A 2BIKB 2WEIA 4KUJA 1URWA 2YWVA 2WEVA 4PTGA 1DAYA 5E8UA 3VS2A 2QOOA 4FKGA 3LOKA 1I09A 4NM5A 4AAYA 4QTEA 4D4RA 5CEOA 4FGRA 3BZ3A 2FSLX 4G3GA 3Q5IA 2YCQA 5HVJA 3JR1A 2RSVA 2VO0A 3CP9A 2WMUA 3ODZX 4XP2A 3HRBA 4ACHA 4B7TA 2BKZA 3UOJA 4FOCA 4DBNA 3PXKA 2XJ2A 3NFFB 4XG4A 3OWKA 4CVAA 1CMKE 3TIZA 4FVRA 3ACKA 4UALA 4QNYA 3VULA 5CF4A 3TWJA 4YZMA 3W55A 4E4LA 4RJ4A 3OBJA 2IVVA 2PVHA 1BL7A 5H9BA 2C4GA 3KXGA 4HNIA 4PMMA 2R3QA 4IQ6A 3VUHA 4AXAA 4CFMA 2ESMA 3QGWA 2WHBA 4M15A 4DDIA 2RKUA 4NT4A 2CGWA 2G01A 2VNYA 3HKOA 2PMOX 4FG9A 2B9HA 4HNFA 5CY3A 2OXYA 3ZM4A 3ZXZA 1UKHA 4F99A 4RWLA 2BDFA 3PY0A 3DBCA 3UE4A 4UEUA 4IAIA 3E3PA 3FQEA 3QC9A 5FTGA 3C4ZA 2KULA 3RTPA 5CEMA 4GS6A 2FO0A 2E2BA 2IVTA 1XBCA 3AC8A 4CKIA 4BJJB 2PVFA 5FM3A 3LPBA 4QPAA 2J7TA 2NYAA 2EB2A 3OCSA 5JT2A 4WIHA 3NNXA 5LARA 5E92A 3DTWA 2ZOQA 3MGYA 1JBPE 4N57A 2QNJA 3DAKA 4RJ7A 4BY9E 5GNKA 1IG1A 4C33A 2YDKA 4I92A 3NLBA 5L2TA 3TI1A 4MEDA 4FKPA 4NM7A 4LL5A 2GTMA 3FYJX 5KNJA 4K18A 2VTTA 4RQKA 2YIXA 2ZB0A 3L8PA 3MA6A 2W1CA 2R3JA 2OO8X 3KQ7A 3SLSA 3KULA 1YDTE 4QQJA 4NUSA 1OM1A 4QMYA 3QZHA 4JBPA 3C4WA 3BGPA 5HORA 4OLIA 3KY2A 4MQ2A 4ZTLA 1OB3A 3ZXTA 4ANNA 5FDXA 5HVKA 3UJGA 2BRHA 2HXQA 4O4CA 5BMSA 1BI8A 3N4TA 1DI9A 3R9HA 1RDQE 2GSFA 3KF7A 4QQCA 1GZKA 2EXMA 4A06A 3V8WA 4X7QA 4XLVA 5ACBC 3NUAA 5JQ8A 2I0YA 5E1EA 4GT4A 4C4JA 3UOKA 3BU6A 5J1VA 5D10A 3UMXA 4MAOA 4O91A 2YZAA 4QMLA 5LMBA 2CMWA 1R0EA 2CKPA 2Y6MA 3UQGA 5GHVA 5C4LA 2PE0A 5TT7A 4BTMA 4YLLA 4IC7A 1JKLA 3BGZA 3JUHA 3GEQA 3DBDA 3PP1A 2WQEA 4EORA 3NUYA 2C6EA 4B9DA 2A19B 5BX0A 1X8BA 3SRVB 5CXZA 1NW1A 4KAOA 4AA0A 4DTBA 3O8TA 3MB7A 3FMDA 1IR3A 2Z8CA 4FSQA 4LUDA 5HG5A 1APME 4M12A 4MBJA 4FJVA 4PQNA 2QOHA 5CSXA 3RAHA 3RHXA 1OIRA 4ERWA 5FEEA 5BYLA 4ANBA 3IKAA 4CCBA 3K54A 4GVJA 3BBTB 3Q4UA 4E5BA 2XEZA 5LVNA 4AN3A 5IDPA 3E62A 3UVQA 5E91A 1M17A 3ANRA 2ETRA 4RJ8A 3NPCA 4I3ZA 4R1YA 5KKRC 4ZLZA 3Q2JA 2CCIA 2ZV2A 4MBLA 5TR6A 3RAWA 4C34A 3ETAA 2J0JA 4RWIA 1OPJA 4FEQA 1YHSA 3B8QA 2R4BA 3SXRA 3MFSA 4JBVA 4R77A 3L9MA 4P2KA 5LCJA 2JKOA 1RW8A 2G9XA 2XBAA 5CQWA 4FEUA 4FZAB 4FTRA 4L8MA 4FIJA 4IZ5A 4QP6A 3WF6A 3GOKA 3EZRA 2PVKA 3FXWA 3QCXA 4LRKA 1H28A 2IG7A 2P4IA 4Q9ZA 5BVWA 3G51A 3TYKA 3ENHA 3TN8A 3Q32A 5A4LA 2C5OA 3ZOSA 4OGRA 3OXTA 2YM8A 1JSTA 2YWPA 3LXNA 2GS7A 4EYMA 4QDEA 3EOCA 4IFGA 5AP5A 4PMTA 4A4LA 1K9AA 2XP2A 4HPUE 3JYAA 4CRLA 3A8WA 1OL7A 3TEIA 2VRXA 2G2HA 3QQUA 4H05A 2JIUA 2QOCA 2ZYBA 1YOJA 3KGAA 3RINA 5DR2A 1S9JA 2EXCX 4MXAA 3FLQA 3VUMA 4FOBA 5C03A 4BCHA 3EH9A 4EOKA 5HU3A 3GU6A 3R30A 3ZUTA 3AKJA 5KHXA 4E8AA 3FLSA 3I5NA 3VF8A 4Z7GA 2XIYA 3C0GA 4FK6A 4FZ6A 1W82A 4C4GA 3D7ZA 5HCXA 1WCCA 5I3OA 3VBXA 3A7IA 3QXOA 3D2IA 4DEBA 1YWVA 5BVOA 5JFXA 3LFFA 4RJ3A 2C47A 2W1IA 2WPAA 1KV2A 4LL0A 3HEGA 3LCTA 3GXLA 4RBLA 3NX8A 3OWLA 4F64A 3AC2A 4RSSA 1STCE 1W2CA 3HUCA 2VTOA 2ITYA 2OIDA 3PPJA 4JG8A 1ZOGA 2FH9A 4F9WA 4IX3A 1WZYA 4O22A 1M7NA 2V7OA 1PXOA 4KB8A 2WQOA 4GFGA 4J96A 2ZDTA 3GP0A 1HOWA 2E9NA 1A06A 3DGKA 3KRLA 4E4MA 2PULA 3R6XA 3AMYA 3A60A 3Q9YA 3O96A 2X4FA 4G3FA 3ZMMA 2FYSA 3ZRMA 1WBPA 3R71A 2QODA 3DKFA 3ET7A 4FTKA 4WKQA 5AR4A 3T8OA 4E3CA 4ENYA 2X0GA 3RMFA 3U8WA 4EHGA 2X7OA 4LOPA 4F6SA 1KE6A 4RC2A 4HCTA 3SOAA 2VGOA 4CV9A 4N4SA 1ZOEA 5HLWA 3N4VA 3GCSA 3KULB 3T3UA 3QRIA 4TWOA 3QCQA 1HCLA 4QMQA 2UZOA 2ZB1A 2QR7A 3EB0A 3NZ0A 3RVGA 2FSOX 5DVRA 4BBFA 1YXTA 5BUEA 4UYAA 4U43A 3VS6A 2GHGA 4CFNA 4IMYA 1WVWA 4D5KA 4RGJA 2OJFE 2GMXA 1PYEA 3ZHPC 3FV8A 3LCSA 3VJOA 3IQ7A 3PIYA 5CVGA 5AV1A 3FUPA 3R7EA 3WILA 5HLNA 1PXJA 4KD1A 3UP7A 2YCSA 1CKIA 3AKKA 2XK6A 3R28A 4ITIA 5F95A 2WNTA 4FGBA 4YLJA 1ZYDA 3DLZA 2X0QA 2BZJA 4GFMA 5EM8A 3OXZA 3Q4CA 3QKMA 2C6OA 3U51A 2YN8A 3ZUVA 4J99A 4ASEA 4MUQA 2BVAA 3UYSA 4O6EA 2XAOA 4IWDA 2HWOA 2ONLA 2YA9A 3R2YA 4BI0A 3HMIA 2W17A 4U0IA 3RK9A 3R22A 1YXVA 3QA0A 4C8BA 2RF9A 5HNIX 4OAVB 3VHKA 4YTHA 5EM5A 5LVLA 5JFSA 1ZYSA 3QF9A 4OBOA 4X0MA 4AW2A 3KKVA 3TM0A 4FEWA 2PVLA 4JIKA 4BCMA 4I5HA 5AUWA 2BFYA 4CZTA 4MXOA 4PWNA 3DAJA 3QHWA 4AZFA 5IQHA 3ZUUA 4N70A 4DG3E 4FODA 3BELA 5HBJA 5DRBA 3LFSA 4C3FA 3KK9A 4I0SA 4BI1A 3WZUA 3DB6A 4AN9A 4KS8A 2XK4A 3ITZA 1R1WA 2R3MA 4YZCA 4DT8A 3UP2A 3WOWA 4NFNA 4G1WA 5FTOA 2WU6A 4XP0A 2YABA 1YRPA 2REIA 1H26A 2H96A 3D15A 4K1BA 3TXOA 3UDSA 1ZZ2A 2VWZA 4XEYA 1XR1A 1ZY4A 2PYWA 2HENA 4W8EA 4IEBA 3QQGA 3R7VA 1P2AA 2YIQA 4RX7A 3ZSIA 5CI7A 4FTNA 4JS8A 1VR2A 1PXNA 3BLHA 2O63A 3R02A 2R0IA 3EQDA 3P7BA 2R0UA 5J87A 1BLXA 5HTBA 2PU8A 3RKBA 4C36A 4F08A 3FDNA 2H8HA 1Y8YA 3NYVA 3IK3A 4DFLA 3QD0A 2PVNA 1YXUA 5K5NA 2ZMCA 5K0XA 2ITVA 2Y6OA 5E8XA 4ZTNA 4OTPA 3G5DA 3M11A 3BV3A 5ANEA 4D2SA 3AMAA 5CX9A 3TKIA 2UW6A 4S34A 2C0IA 4CYIA 2CN8A 4QP1A 2JKKA 1MUOA 3PE2A 3ZLYA 4QPSA 5AV2A 2OIBA 5D12A 2Z2WA 3WF9A 3HV5A 3SVVA 2BRNA 5AM7A 1DAWA 3JY9A 3A4OX 4RZVA 4BGQA 5FGKA 3MH0A 4CFXA 4GUBA 4IWQA 4YJRA 5FUTA 3AG9A 3F5XA 3PZHA 4U80A 1REJA 3VW8A 3IDCA 3NSZA 5JKGA 5M08A 2QLUA 4MQ1A 3PRFA 3V5QA 2FVDA 5EQEA 2W5AA 4BCIA 1A48A 2AEGA 1ZXEA 4L45A 2FGIA 2QOIA 1Y91A 3CJGA 4FSZA 3NW7A 5LWNA 4HCVA 5AP6A 4YJVA 4ONAA 3P5JC 4NSTA 4PX6A 4HCUA 5DEWA 4QTDA 5DA3A 3C5IA 3V8TA 4NJ3A 5E4HA 4HVIA 2OH4A 3V6SA 5AUUA 3DXQA 4DBXA 3R9DA 3MIYA 1W98A 2VTSA 5DNRA 2W4JA 5EM7A 4ACDA 5FEDA 5I9XA 3F3WA 3GBZA 3HGKA 2ITZA 2YACA 4C59A 4CMUA 4FSRA 4FKJA 2JIVA 3E7OA 3FMMA 3R8MA 3KB7A 2WMAA 3LJ2A 4EBVA 4QD6A 1UU8A 2UZVA 5L8KA 4FE2A 4MKCA 1ZMVA 1W7HA 4O7TA 5CT7A 4BYJA 4F1OA 1Q8UA 4JDIA 1OPKA 4FTTA 3VS3A 3Q6WA 1URCA 1NY3A 2Y4IC 5IU2A 2WFYA 3UGCA 2QQ7A 5CSHA 2XCHA 4L42A 3RNYA 4A9UA 4AX8A 4BICA 4EQMA 2XKFA 5L2IA 5AR3A 4G31A 1U54B 2X8IA 4MTAA 4B8LA 3TZ9A 2VTIA 4CV8A 3QAME 2W96B 3LFAA 4J53A 2C0OA 2X2LA 2CNUA 4ZEGA 3ZFXA 2VTLA 4YSMA 3HECA 4IB0A 5TO8A 3DXPA 3HL7A 3A99A 3W16A 2VTPA 3VW6A 2XIXA 4FYNA 3Q9ZA 4MHAA 2GDOA 1LEWA 2EB3A 3O23A 4D2TA 2B9IA 4J8MA 3BYVA 3DXNA 3UVRA 4CZYB 4EOOA 1YXSA 1E9HA 3D14A 4JBQA 2XKCA 3ATSA 5DT3A 5A4QA 3OEFX 3VO3A 3AD5A 2E9VA 4HGTA 4X21A 4CSVA 1KUTA 1SVHA 4D9UA 2W1HA 4R3CA 4XX9A 1IAJA 3R9NA 2DUVA 4PNKA 2R3IA 3UQFA 1PJKA 1G8JA 3QLFA 1IA8A 2VX0A 3IW4A 4O0UA 1PXKA 3DPKA 5AAFA 5M57A 4GJ3A 3EHAA 4QP9A 2CGUA 1BUHA 2F7EE 4FNYA 4GG7A 4YHFA 5F20A 3ORZA 5I4NA 2UZNA 5ANDA 3N51A 4MD8E 4L52A 3V6RA 3V5JA 1RJBA 3PA5A 4NK9A 4RPVA 3Q96A 5ETFA 4ACCA 4O7SA 1UNHA 3LQ5A 2UUEA 4PPAA 3MPAA 4X6QC 2R3LA 2R3HA 3BCEA 3ZO3A 4EOLA 1M2PA 3NR9A 5ETCA 3CKWA 3DTCA 3LFCA 3FMKA 4BWXA 2HWPA 3GFWA 3BHVA 4FIFA 4GT3A 3LE6A 5ANOA 5HVYA 5J5SA 3LJ0A 3QBNA 4TKSA 5E8SA 3FBVA 4MXXA 2ZVAA 5EI6A 4BWKA 5H8EA 5KMIA 1UNLA 3U6HA 4AT4A 2ITWA 3R73A 4WRGA 2ZMDA 1SVGA 5AIKA 1OPLA 3BYSA 1Q4LA 3RPSA 1YI3A 3VF9A 3CY3A 5B2MA 2W4KA 3P5KA 3HP2A 4D2VA 4I5PA 4DGGA 4DLJA 5K4JA 1IAHA 5HESA 2CSNA 3LFNA 1ZARA 1TVOA 4ZXTA 4RX8A 3NUUA 1OIUA 4CMTA 4WBOA 4FVPA 2X2KA 5KE0A 4W9XA 3UYTA 3DK3A 3UTOA 5DPVA 5ACKA 3KXXA 1WBNA 3MH1A 3PJ8A 3E63A 2Q0BA 1ZMWA 2VTHA 4WA9A 2GQSA 2W1FA 2V0DA 2QO9A 4O81A 3VVHA 3O8UA 3II5A 4O84A 3KRWA 3QTRA 4JXFA 3SXSA 2O64A 3DCVA 5EHOA 3BEAA 3A61A 3TACA 3K3IA 5EYMA 2JGZA 5JZJA 4QMTA 3UNKA 2Y8OA 2R7IA 3CIKA 2DS1A 4G5PA 4QMWA 4F7NA 1SZMA 5LQFA 2BALA 1NXKA 3EFLA 1UWJA 3NGAA 1DS5A 5CAQA 2I7QA 2J0MB 5AV3A 1JSVA 3OROA 4RT7A 3DLSA 4KNBA 4BB4A 3MPTA 3SKCA 5DYJA 3C0IA 2FA2A 3LVPA 4DEIA 4FV0A 5DFPA 5DT0A 2IZTA 3Q60A 4HYHA 3VBYA 2OU7A 4F4PA 3CLYA 1KE7A 4O0YA 3F9NA 4HYUA 4E4NA 3BKBA 3LXKA 2C30A 3FYKX 4IM2A 3G6HA 2I40A 3PXZA 4AZVA 3CEKA 1A9UA 4I20A 2QU6A 3PE1A 4M8TA 4Z3VA 3BL7A 1YI4A 2UW7A 2B52A 4AZEA 3RCDA 4D1XA 4OR5A 1BL6A 1JQHA 5D11A 3TIYA 4BKJA 4F0GA 4C02A 4D2RA 1LEZA 2QOLA 2IZUA 3RWQA 4AGDA 4QPMA 1JAMA 2Y0AA 2IVSA 3PZEA 3MB6A 1AGWA 1Y8GA 4D2PA 4DH1A 3QC4A 3F2NA 3OOGA 4XOZA 2W0JA 3NWWA 3I4BA 4QTBA 2RG5A 3RZFA 2C69A 3NNWA 1YWRA 4FR4A 4YZNA 3P79A 2AC3A 4KBKA 3JY0A 4ACMA 2XB7A 4QO9A 3WF7A 3WZKA 3DK6A 1Q8WA 4FV5A 1OL2A 4DFNA 4O7LA 2PMLX 3GVUA 2UZLA 4R8QA 3KEXA 3WZEA 3TNPC 4Z7HA 2XANA 4TYGA 5I9ZA 2YM7A 2UW5A 2ZJWA 5EDQA 4WG5A 4YO6A 4AS0A 4CRSA 4YUQA 4ZZNA 5L6WL 4EUTA 5LMKC 3HA6A 3QZIA 4QMSA 3S1HA 2R3NA 2IW6A 3I5ZA 5BVEA 4LI5A 3GOPA 2XUUA 4BBEA 2ITNA 1VJYA 2R3KA 3B8RA 5DBXA 2F57A 3QL8A 2KTYA 5CU0A 5AADA 3PJCA 1XO2B 3U9NA 2OJGA 3AC4A 4BCGA 5J9YA 2W9FB 2OXDA 3OW3A 2R2PA 4U3YA 4O7ZA 2ONLC 5M09A 2VO6A 4K6ZA 4DCAA 4WHZA 3O71A 4KBAA 3TTJA 1LPUA 1Q3WA 4FZFB 4GT5A 4TRLA 2C6MA 2PMIA 4LGGA 2GNIA 4TY1A 4BKZA 3W0NA 3IW7A 4J71A 2B55A 5D1JA 3OCTA 4H1JA 1W2FA 1UU3A 3KXNA 3QU0A 1P14A 5M55A 4DN5A 5ITAA 4C3RA 4F9AA 5KMNA 5M4UA 4I1ZA 2IF8A 4JNWA 2PE2A 2CN5A 3LFEA 2YJSA 4MNEA 3ROCA 3SQQA 3SV0A 3WI6A 1M2QA 2XM8A 3ZC5A 1Q62A 1BMKA 2OG8A 3TUBA 4BDEA 3E88A 4EL9A 4RX5A 4IX5A 2P55A 3Q53A 2B9JA 3OP5A 2PZPA 5IISA 3VQUA 3PUFC 3O5AA 1UV5A 2PZ5A 2OICA 2OW3A 3C7QA 4B8MA 2I0EA 2X8DA 3TG1A 1JKSA 4QRCA 4YBJA 3TZ7A 4M7IA 3FL5A 4CKRA 4EOJA 4AF3A 2X9EA 1GY3A 3AC1A 4XH6A 3S95A 5L8LA 2CNVA 3GQIA 4S2ZA 5FLFA 3GC9A 3MJ2A 2VWYA 4DEAA 3DNEA 4ANOA 4USFA 5K5XA 1J7UA 4I4FA 5B2KA 5AUYA 4K77A 2VTRA 4UB7A 2X9FA 1H27A 4IAFA 4TTHB 4TWPA 2XCKA 3DQWA 4DEGA 4EKLA 5IMXA 3FZSA 4FMQA 4KSPA 4U9AA 4FTLA 5M06A 2VTNA 3KXHA 4GK3A 5HNBA 3SG8A 3PA4A 5HD7A 2WTJA 4G9RA 3S4QA 3BX5A 3TZ8A 3LJ1A 1JSUA 4O83A 2XK3A 5ETIA 4CZUA 4EWHA 2AUHA 3R83A 1TQMA 3FI4A 4P7EA 3NVMB 3RK5A 1VYWA 3I7CA 4ID7A 4X3JA 4ZTSA 1HCKA 4AW5A 5IA4A 4IM0A 4EHZA 3WYXA 3ZBFA 3UZPA 4UMRA 5IPJA 4FIHA 3DKCA 3E8DA 4NIFB 4P5ZA 4TXCA 3W33A 4EJNA 3EQFA 1OVEA 1JKKA 2C6IA 3KCKA 3MYGA 2IW9A 4KKGA 4RQVA 4W4YA 5CAOA 3PVGA 4FKSA 3E5AA 5M4FA 2UW9A 5HIEA 1XH9A 2H9VA 4K2RA 3KK8A 5LMKA 1ZAOA 4FBXA 4JL9A 4M84A 2SRCA 3EL7A 1U4DA 2PUUA 3OF0A 5IUHA 4UMTA 2ITUA 3R7OA 5HO7A 5I9WA 3CQWA 5JRSA 3H9RA 1Q61A 4PP7A 3BU3A 1JPAA 3W8QA 3QD4A 4CLJA 2GNHA 2CGVA 4I6HA 5DR9A 4FKWA 5FM2A 4B0GA 5IA1A 2RGPA 2W1EA 4FF8A 4OTIA 5K4IA 3LCKA 4TYEA 3W32A 5M53A 2PUIA 2JEDA 3Q52A 4GIIA 4PV0A 2Y4IB 4IJPA 3NDMA 4IDVA 1QPEA 1G8AA 4ANQA 4YPSA 4QP2A 5K0KA 3F7WA 3P23A 2HZIA 4QMNA 1KSWA 4E6DA 5AX9A 2VU3A 3COIA 1H25A 3GC0A 4NFMA 5EDRA 3W8LA 2VV9A 5AP1A 4EK8A 1OI9A 3HUBA 4MXZA 2CNQA 4U5JA 3HMOA 5EFQA 4EBWA 3CQUA 4J1RA 3A7GA 2VUWA 2R9SA 1Q8ZA 1H1WA 2BRGA 4RFYA 2YLFA 4Y95A 2JAVA 2YM4A 4GFOA 2E9UA 5GIOE 2BAQA 3RPOA 3TNIA 4HVSA 4QEBA 3GUBA 2PY3A 4GYIA 2WTWA 2VGPA 3DU8A 3FI3A 1TQIA 4IE9A 3S2PA 3R1YA 1WAKA 4ZSEA 4QOXA 3IOKA 1JWHA 3NS9A 5EI8A 2X8EA 3SW7A 3HVCA 5CQUA 5ANGA