4AACA

P38alpha map kinase bound to cmpd 29
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
355
structure length
350
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNILTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
publication title The Discovery of N-Cyclopropyl-4-Methyl-3-[6--(4-Methylpiperazin-1-Yl-4-Oxoquinazolin-3(4H)-Yl]Benzamide (Azd6703), a Clinical P38Alpha Map Kinase Inhibitor for the Treatment of Inflammatory Diseases
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 350
sequence length 355
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4aacA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aacA01
3FHRA 3VQHA 5H8GA 5C03A 2NO3A 2QR8A 4BCOA 2PUUA 3TG1A 3ZBXA 1F5QA 3W55A 4NJ3A 4AGDA 5KMIA 2UZWE 3TNPC 2YM7A 3NSZA 3I1AA 5BVKA 5HTBA 2DWBA 4MNEA 4I6FA 4PL3A 3LE6A 3VWAA 5JGAA 4FV8A 3JVRA 2VU3A 2CNQA 2JIIA 1DM2A 1Q62A 1BL7A 3AGMA 3LLTA 2UZEA 2V62A 3TIYA 1O6YA 3UPXA 5LMKA 4E6DA 2QD9A 3R9DA 2GTMA 3D7TA 5GZ8A 1EH4A 4W8DA 2X6EA 1MQBA 3QTIA 4DN5A 3BYUA 2WMBA 4FI1A 2C5VA 4WG4A 3ZUVA 4F70A 4IVCA 3QC9A 4WNMA 3LQ3A 3GU7A 3IDBA 1Q99A 4FTRA 2CKQA 2XK9A 3LMHA 3MY0A 4ACCA 4OTHA 4ZJIA 5CEQA 5H3QA 3HLLA 5LQFA 4ACHA 4EK4A 4ZTLA 5CSXA 5AUXA 1SVGA 3R8UA 3P23A 1K3AA 3E62A 2YM6A 4FSQA 2XS0A 4RJ7A 4HVDA 5EI8A 2W5AA 3L8SA 5AIRA 2CKEA 2OF4A 5IDPA 3QZIA 4H39A 2OJ9A 4L43A 4L8MA 4AGUA 4JRVA 4F7NA 2YCRA 3DXPA 3PXFA 4NEUA 4F6WA 2YZLA 3VIDA 5L4QA 3LVPA 2UZLA 3U9CA 1TVOA 4FEUA 1PXLA 4WG3A 4JAJA 3OZ6A 3WYYA 4U80A 4JDHA 4MKCA 5CY3A 5GJDA 4MD8E 4MXCA 2OU7A 4X2GA 2RFEA 3U8WA 4O7NA 2R3OA 4ZTHA 4CFMA 4I4FA 3ULIA 1OL5A 3HDMA 4MF1A 4WBBB 5DR6A 5HKMA 3N4VA 5HBEA 3E64A 5ETAA 4ANMA 5TKDA 1Z57A 2VX0A 3RPSA 4AT3A 5DIAA 5AR8A 4PL5A 2ZDUA 2JFLA 4FV2A 1YWRA 5DH3A 4TYHB 1YI3A 3FZ1A 4GVAA 3NPCA 2R4BA 3QQJA 4G2FA 2VTTA 4XUFA 5AIKA 4C61A 5A4QA 5HESA 4FIJA 3ZC5A 5JEBA 4X0MA 1WZYA 3AC1A 4FZAB 3D83A 3QX2A 4ID7A 2GSFA 3IS5A 3FEGA 3MTFA 4JDKA 4QTBA 3Q5IA 5L8KA 4XG4A 4FKTA 3TV6A 3O96A 3MB6A 3FMDA 4YJNA 3I6UA 2GS6A 3R83A 4BIDA 3ZS5A 4FF8A 3QYZA 4ZLOA 4JRNA 4FBXA 3PXYA 3BU5A 3TKHA 4WNPA 4XRJA 1SNXA 5AUWA 5LWNA 4ZTRA 5J8IA 5HQ0A 1WBVA 2ONLA 4YNOA 4XCUA 4Z9LA 5IQGA 2HYYA 2WB8A 1U4DA 3I79A 2XKFA 3R8PA 3ATSA 2ITUA 4AU8A 3QRJA 3A60A 4AOTA 4IVDA 3F3UA 5EH0A 3WE4A 1H8FA 4FV6A 4XV1A 3PSCA 5DNRA 3QQGA 5D41A 3CBLA 5IQEA 4J98A 4AOJA 4U3YA 2HY0A 3OOMA 4D9TA 1ERKA 2XKEA 3KQ7A 1BUHA 1H25A 5BVWA 3FJQE 4LL0A 5HEZA 5CZIA 2BIYA 3IW5A 3EQIA 3PVBA 3WF9A 3FMEA 2XCHA 3TNWA 4TWCA 5HBJA 5EHOA 4D1SA 1XKKA 2Y8OA 2GHLA 1IAHA 3BV3A 4AN9A 5KBQA 2BDJA 5DVRA 1PKGA 2C6KA 2R3HA 2BAJA 2PZ5A 2W4KA 2XM8A 3F5GA 2OJIA 3SDJA 4DH3A 4AACA 4HVIA 3R9HA 2KTYA 3NMUF 3E8EA 3QQHA 4NUSA 4TZRA 4FZDB 3U4WA 4MQ1A 3CY2A 5FDXA 5GZ9A 4BI0A 3QAME 1TQIA 2PPQA 4FNZA 5AR3A 3R9RA 3PIYA 5E1SA 3S0OA 4YZ9A 4YJRA 4DF3A 2YITA 1NY3A 3B8RA 4KBCA 4X3FA 4BKJA 2ZV8A 5FWKK 1IAJA 2PL0A 4FT9A 1H07A 3TUCA 4O2PA 5L3AA 3HA6A 4BCFA 4EI4A 4QMYA 5AP7A 4BIEA 2W7XA 3EQBA 3JPVA 4APCA 2HZIA 4JOAA 3FAAA 3NUPA 4O1PA 3L9PA 3PJ8A 2YDJA 3V8TA 1KE5A 4FV5A 1G3NA 5FBOA 3MPAA 5DPVA 5AWMA 4HVSA 4BB4A 4QMQA 2NRUA 1UNLA 2VZ6A 3P79A 1OITA 5KZIA 2I6LA 5AUYA 4C58A 4FTCA 4IACA 4IZYA 4IDVA 2A0CX 4QOXA 2QURA 2ITTA 2J0LA 3QZGA 4G9RA 3AT4A 2BPMA 3V5QA 1SNUA 1ZLTA 5EHLA 3E63A 1I09A 2CJMA 3ROCA 3H0YA 2VD5A 5AP1A 4A9TA 2UW7A 1XQZA 1O6KA 1FVTA 3PZEA 2A19B 3V5TA 4O91A 5E7RA 1NT2A 1ZYJA 4M97A 4DCAA 2UZOA 1GIHA 4NM7A 3V5JA 3VS4A 3DT1A 1AD5A 2VGPA 4UWYA 4RZVA 4DEDA 3ZSHA 2WTJA 4R77A 4XP2A 4KS8A 3UG1A 4K9YA 5KUPA 3OEFX 3I5NA 2OFUA 3MESA 4FG8A 3TI1A 4ZIMA 2IVTA 3AMBA 3MYGA 4ZTSA 5HLNA 2C3LA 4HNIA 4BR3A 4MXZA 4NSTA 3O7LB 4A07A 3CC6A 2H8HA 4DEBA 4FYNA 4O7WA 3FC2A 2CCIA 4RFZA 4TPTA 4ZLZA 2UW6A 3O8PA 3HV7A 2BRMA 2EXEA 4HPUE 3WZUA 4G3GA 3EZVA 2BCJA 5CTPA 4FL2A 1ZRZA 2YERA 3ORXA 2C5XA 4UALA 2B4SB 4LUEA 5KMKA 2GS2A 3U51A 3ZUUA 4FUYA 3IOKA 5AV2A 5KMNA 3OBGA 4FZFB 4U42A 4XBRA 4C0TA 2OK1A 3CCNA 2OXYA 3WBLA 5M57A 3KU2A 5CX9A 2BZKB 2R3NA 3TT0A 2QG7A 4BI1A 4MF0A 3SGCA 3BX5A 4IX6A 1KE7A 3ZRLA 5J5SA 5M4FA 5DI1A 1UVRA 1IA9A 3LPBA 4G5PA 4USDA 4R8QA 4BICA 4ONAA 5DYJA 3FI4A 5HE3A 3CXWA 3HMPA 4XYFA 4CZTA 5L6OA 2W05A 2ZOQA 2CLXA 3NW7A 4M3QA 2FSMX 1IRKA 1P5EA 3QKMA 2CGXA 2EVAA 4GKHA 2F7EE 1OB3A 4OBOA 2OJFE 4RLLA 5E8YA 3UOKA 2R7IA 3DAJA 3MY5A 5F9EA 5CAOA 1M14A 3SXFA 4YZMA 3MJ1A 5FTOA 3WF7A 5B7VA 5J79A 4XP0A 4WKQA 3RWPA 3QD4A 3R2YA 4XG2A 3WOWA 4BDKA 5IH6A 4BYIA 1VJYA 4WSYA 4FKVA 4AE9A 4BKYA 4BTMA 5IPJA 4S34A 2W1IA 3OCBA 4LRKA 5HTIA 3MV5A 4Q2AA 3ORKA 5L8JA 3FHIA 4JJRA 3S00A 2VV9A 4FTKA 3POOA 4O0WA 2XRWA 4CKRA 4QQTA 2ITYA 3IW6A 3NUUA 4DLJA 4O6EA 3PXQA 2BKKA 3N4TA 2YWVA 4O84A 2ERZE 3BU3A 4CFWA 3C4ZA 2UZBA 3GP0A 3BRBA 3G6HA 5I9VA 2Q83A 2XNNA 3GQLA 5LMAA 4FSUA 2R3JA 4XG8A 2EB2A 3CY3A 2XCKA 4IE9A 2BVAA 3Q9XA 1H27A 3EL8A 4HYIA 5HLWA 5CU3A 2UUEA 4AUAA 3MN3A 2XYNA 3K2LA 3PRFA 4LI5A 1UKIA 5LWMA 1Y8GA 5K0XA 4I21A 2E9NA 3PZHA 3BWFA 5CF8A 5B2KA 4AWIA 3ID6C 1BI8A 2HAKA 3BYVA 2FVDA 3HP2A 4E6CA 4R1VA 1IR3A 4O22A 2W1EA 4OT6A 1ZY4A 5EDQA 2IW8A 5HU9A 3IOPA 4NW6A 5DN3A 4IZAA 4OBPA 3ZXZA 1ZZ2A 2HZNA 3FLZA 4FV4A 2VTRA 1FQ1B 4RC2A 3FSFA 3A99A 4XMOA 4DFYA 3HMMA 4CTBA 4PPCA 4YPSA 3BLHA 3E7VA 3C5UA 5H8EA 2JGZA 5JSMA 3ZCLA 1U5QA 4KKEA 2RF9A 2VUWA 5JK3A 1YW2A 4G9CA 1BLXA 2ETRA 1FGKA 3PUPA 5CENA 4C62A 2PVYA 3RM6A 4FGBA 2J7TA 2WO6A 1APME 2IW6A 2J5EA 3F82A 3RK5A 3W16A 4FIIA 2GNFA 3VC4A 5CNOA 3MBLA 2HCKA 4AA4A 3G2FA 4LGGA 4IZ7A 4GFOA 4DC2A 5CS6A 3ORLA 4ZY4A 4E73A 2WQNA 1H1PA 1NXKA 3ZZEA 3F3ZA 3UQFA 3LW0A 5KMJA 5DT3A 3QL8A 3CPCA 3GCQA 4O21A 4CFUA 5AM7A 3CPBA 4JAIA 4W4VA 3CJFA 4S33A 2HZ0A 4C3PA 2OH4A 2WMSA 1MRYA 4CKIA 3BIZA 4RIXB 5CVHA 4FKIA 3OCGA 5T3QA 4YTFA 4MYGA 5HNGA 5GHVA 4YC6A 2OIQA 3R9OA 3TEIA 2JDTA 4R5SA 3TACA 1KE6A 2PHKA 1ZZLA 4JX3A 4PL4A 4XV3A 1Q8YA 3GFWA 4RIWA 3NNXA 4FNYA 2JEDA 3OC1A 4AW2A 3CJGA 3TJDA 2QOFA 3BE2A 3ODZX 5CXHA 4FGRA 3RAKA 4K2RA 3E3PA 1E1XA 4D2RA 2BAKA 1R3CA 2JITA 2F4JA 4J52A 4TWOA 2OGVA 3UE4A 3LXLA 4O7VA 4WIHA 2YZAA 4Y85A 4F0IA 3SW7A 1CMKE 2F57A 3D5UA 4HJOA 4BTKA 4YHJA 4O38A 4QPSA 1ZYSA 1OKZA 4GG7A 3D2IA 4RZWA 3AC4A 4FKPA 4FK6A 4MBLA 3GQIA 4BZOA 4H58A 2HXLA 4FT5A 4BVUA 4EWHA 2CNVA 3TDWA 2FO0A 3QWKA 3AMYA 5EYKA 2Y9QA 2W4OA 1JVPP 2XIRA 4IJPA 4EQMA 4U40A 4DEAA 3KMUA 4UMUA 3CGOA 1OVEA 5H9BA 3QU0A 4HPTE 5M06A 4EH2A 4XHKB 3FZRA 4QMNA 3C13A 5CF6A 4FT3A 4LYNA 3PA3A 5CAPA 5KKRB 4FIHA 2QR7A 2VWIA 3P5KA 4KSPA 5G1XA 4H36A 1YI6A 3W32A 3ZFYA 5AAFA 4DBNA 2XEZA 2W17A 2BMCA 3NW5A 1IASA 5EQPA 1KE9A 2BTRA 3NIZA 2Y4IB 4DGMA 3HAMA 2R0UA 3VUKA 4CFNA 5EI6A 4O7TA 1YDTE 4BDCA 2PVLA 5JH6A 3VS7A 5BVFA 4O0TA 4X6RA 4FYOA 3AMAA 2Z2WA 3MIYA 4K8AA 4AFJA 4U7ZA 3NDMA 3E88A 4B6LA 1FGIA 5IQCA 4MXXA 2XNMA 3HYHA 3UNKA 2WMWA 4BCKA 4LMNA 3F61A 1R39A 3DNEA 4JQ8A 4AZVA 3TWJA 4YUQA 2DQ7X 2OWBA 3LJ0A 3W18A 2YM4A 4CG8A 4F6UA 3UZPA 2QOBA 5LMBA 2VO0A 2ZM3A 3GU8A 3R63A 4BRXA 4RIYA 3NYNA 3ZMMA 3QCXA 1PHKA 2I0YA 3VBQA 3LIJA 1R1WA 2PVHA 3HMIA 4A9RA 1L8TA 2QO9A 5IKWA 3OMVA 3COHA 4G3EA 2W0JA 2XH5A 4JVGA 1LEZA 2XK7A 1XWSA 1I44A 2P2IA 4BDHA 3EHAA 4HYHA 3TUBA 2IZRA 4KIKA 5AUVA 3UP2A 1Q8WA 4QP1A 5AR7A 3QLGA 1O6LA 3JR1A 3ALNA 3C51A 4HVGA 4D5KA 3W10A 1J1BA 2IVVA 3B2WA 4QMSA 3RGFA 1YDSE 2ITNA 1SVHA 3IPHA 4FA2A 2I7QA 4M0ZA 2OKRA 3R04A 4AW1A 3DB8A 2IG7A 3PIXA 2P0CA 2F7XE 3R8VA 1J1CA 4ACMA 1R0EA 1X8BA 4I6HA 3VNTA 4QMUA 3ZEPA 4JDIA 4FX3A 4XH6A 5AP3A 2XM9A 3HV6A 3V51A 2B0QA 4AT5A 3KK9A 3O23A 3F9NA 2JKKA 3KA0A 2YJRA 3BELA 2KULA 4OBQA 4FNXA 5HG7A 3WZJA 4ALWA 3FXZA 3ACKA 3RP9A 3VUMA 4GFMA 5G6VA 4BCPA 4D1ZA 5JFSA 3GEQA 2QI8A 3FMHA 3G33A 3KVWA 2C6DA 3UVRA 4MCVA 4A06A 3GC8A 4EC8A 4FKJA 1K9AA 3VRYA 3LFEA 4RMZA 4IX4A 2EUFB 3DK3A 1KV2A 1JQHA 2CMWA 4IIRA 4QMVA 4F9CA 4AZTA 2XBJA 1U5RA 2I1MA 4AFEA 4CMTA 4KABA 4D55A 2PE0A 5AR2A 4EORA 3AQVA 3LCTA 3PLSA 5HD7A 5IU2A 2QCSA 4NKSA 3AD4A 4NH1A 2C47A 4O0SA 4NYEA 4LOPA 3W8QA 1REJA 3BYOA 1B6CB 1J3HA 3I60A 3VS5A 5FXQA 3G6GA 1Q3WA 1QMZA 2DS1A 3QTQA 4D4RA 3NNVA 3VF9A 2PWLA 2Z60A 3C4WA 3I6WA 5LCJA 1J7LA 2A27A 4IWDA 5EM7A 4XG9A 3CTHA 4ZTNA 3CGFA 2EXCX 3MFTA 4NM0A 3R8LA 4C3FA 2VO3A 2FA2A 4FSZA 5A4LA 2G9XA 2PVMA 3NW6A 3QWJA 4GU9A 4Q5EA 4O6LA 2VWUA 5GJFA 1Q8TA 4AS0A 4HW7A 1W84A 3OWKA 4O0YA 2BUJA 5C8NA 1LR4A 4GK2A 3W2SA 5CAUA 4NW5A 4TT7A 4ORKA 5AAEA 3AD5A 2H9VA 1QL6A 1H26A 3PP1A 4P4CA 3I7BA 2XBAA 3AC3A 1OL1A 5HO6A 4AZSA 1REKA 2YIXA 3HMNA 3N9XA 4IB0A 4O1OA 3MA3A 4UB7A 5C4LA 1BYGA 4IAYA 2QO7A 5AV4A 1YXSA 5AEPA 4G17A 3UDBA 2VWVA 4M13A 2X2KA 3Q4TA 1DS5A 2HXQA 3TCPA 1HOWA 4QYYA 4F6SA 1FPUA 3CS9A 2BAQA 1OKYA 3E7OA 4OUCA 5IA5A 2PMNX 4YC8A 5AMNA 4BL1A 4RWJA 4CRLA 3RPOA 1YOJA 4EONA 4I6QA 5J9LA 4NIFA 3VUGA 4ZMEA 3MVHA 2X8DA 2YAKA 3KMWA 1M2PA 2P4IA 2X0GA 4JS8A 5ANKA 5GNKA 4EOKA 4Z7HA 1KUTA 3QXPA 1LPUA 3P9JA 2WQOA 4L67A 3HEGA 3HRBA 2R3FA 5CQUA 5KE0A 3UC3A 4E4LA 3ZO3A 3DJ5A 4M7IA 2WEIA 4FKUA 2UZDA 4RLKA 2HK5A 3QTRA 1ZWSA 4GS6A 3D94A 4EZ5A 3S4QA 4G34A 3V01A 4C4IA 5HU3A 3A8WA 3SXRA 1PXOA 4IH8A 3B2TA 3RAWA 3SRVA 4PV0A 3CQWA 3WI6A 4FG7A 1YVJA 4E26A 4IMYA 3MFSA 4X2JA 4CZUA 5E8VA 4C2WA 4MEDA 1PMVA 3QA0A 4FSWA 4TYJA 2XNGA 2BFYA 2XKDA 3R7GA 3EFKA 4FUXA 3S2PA 4FIFA 5CU2A 4OTFA 1WVWA 3GENA 4ANQA 4R78A 4ASDA 1KSWA 5HBHA 3H4JA 5A54A 4OLIA 1CDKA 4QNAA 3VHEA 5CF5A 4ZSLA 4I5HA 3GC0A 4EBVA 3ERKA 5TF9A 3HUCA 4FSRA 2SRCA 2O63A 5CANA 3QZFA 4DT9A 4D4SA 4FVRA 2QOCA 5FG8A 2R7BA 1Q97A 3O8UA 5J87A 1OPJA 4OR5A 3WARA 5DEWA 5CXZA 4E20A 4IQ6A 3DKOA 4R5YA 2JIUA 4PDOA 4NJDA 2WMQA 4Y95A 2ETMA 3VBVA 4Z3VA 4YJPA 4L44A 4DITA 4YJQA 3UC4A 5CT0A 2G1TA 5KMLA 1FINA 5KNJA 4C4EA 4DINA 3GXLA 5B2MA 1U46A 2YACA 4BZNA 5DFPA 3I0QA 3CTQA 3KULA 3QRUA 4C3RA 4DYMA 4DLIA 4G3CA 4E6AA 5HE1A 3NRMA 4LQMA 3AGLA 4N70A 3IQ7A 4XLIA 1MQ4A 3DJ6A 4F64A 5FQDC 2PMLX 4UWCA 3DFAA 5I9UA 1KOBA 2ZB1A 3WZDA 2NNWB 4IWOA 4KD1A 5DWRA 3ZZWA 3JY9A 4CMOA 4C8BA 4KIPA 2WXVA 4BTJA 5A3XA 2WQMA 3R9NA 3ANRA 4YP8A 1Q5KA 3ZLSA 3C4XA 2X9FA 1K2PA 4M69A 4YZNA 5IA1A 5IG1A 3HZTA 1ZYDA 2REIA 3DTWA 5IUHA 4Y5HA 3RTPA 3AOXA 3OT8A 3ORMA 3KXZA 4J1RA 3NIEA 4I5MA 2A1AB 1ZOEA 2O0UA 3ZDUA 3Q2JA 2IN6A 4FV3A 3VS1A 4DFZE 2QOIA 3VUDA 3ZHPC 3VUTA 3KRRA 4XS2A 5JZNA 3DAKA 1M7QA 4O7YA 4EL9A 2FSLX 3AD6A 2VTNA 3Q9YA 2BFXA 2WNTA 3RI1A 2GHMA 4K33A 1FBNA 2YM3A 3GU4A 3FZPA 4WOVA 4IAFA 3FV8A 5I5ZA 3VN9A 5E8ZA 1JNKA 2JLDA 4QTAA 3MFRA 3RAHA 5M4UA 3CKXA 4AT4A 3RNIA 3UOLA 1OIYA 5C8KA 3P7BA 4PRJA 5L8LA 2EB3A 4PTGA 1GOLA 4RGJA 5KZ0A 4J97A 1DAWA 4GT5A 2ITPA 3F2AA 4TWPA 3UG2A 3TZ8A 3DJ7A 1CTPE 4ZLYA 2CSNA 2XNEA 3GCSA 2X7FA 3PY0A 5AP6A 3PDTA 3CQUA 4FL3A 3DB6A 4L46A 2QHMA 5FBNC 4E4MA 4EQUA 4K11A 2C69A 4FSMA 4RFMA 4C38A 3VS2A 2YISA 3BQCA 2JKOA 1MP8A 5CVGA 4BBMA 4D2PA 3MDYA 3TTJA 3W2PA 4CGAA 4H3QA 5CQWA 1JKSA 4ZZOA 4KINA 3E8NA 4APPA 2QC6A 3R7VA 4EH4A 3TNQB 4EOIA 3LAUA 3NUNA 4F9YA 2QU5A 5AUTA 5BMSA 3G5DA 4O27B 3L8XA 1AGWA 1UWJA 3AT2A 4JG6A 4W8EA 3IK3A 5J7BA 3R0TA 3K3IA 4DGNA 2W1GA 5HNIX 4YBJA 3EZRA 3D2KA 4E8AA 2WMVA 5IQIA 4J95A 4IB3A 3GOKA 3VO3A 5BNJA 3TNHA 4WG5A 3O8TA 4MXYA 1PXPA 2JIVA 1OL7A 4I3ZA 5D12A 1PXKA 5L2TA 3DY7A 4YLJA 1WVYA 2XNBA 3A2CA 4RA4A 3I4BA 4BFMA 2OICA 2XK3A 3FLWA 4WUAA 4FTOA 3DLZA 4D4VA 3DV3A 5A6NA 3W2QA 4N4SA 2E9UA 3GFEA 3GGFA 1OBGA 3HKOA 1HCKA 2OG8A 4FKLA 4AA5A 2GQGA 4EK3A 4IJ9A 2QKRA 3T3UA 2VTOA 2RFNA 4O81A 3PLAE 4GK3A 4BGGA 3R30A 5HG8A 3V3VA 4YTCA 3EJ1A 5AR5A 3QCYA 2WAJA 4FTLA 3HL7A 3R28A 4U0IA 3TJCA 1ZYCA 2OZAB 2YHVA 3R01A 5D1JA 3WF6A 3RMFA 5GIPE 3N51A 3C50A 3PFQA 3MVJA 4Z7GA 4JBQA 4QO9A 4UZHA 4MWHA 4K0YA 4TN6A 3DBFA 4NFNA 4Y8DA 4I24A 4OAUC 1PW2A 3Q9WA 3E8CA 4PP7A 2ITOA 3DBDA 2IVSA 3GI3A 4CT2A 3ENMA 3UIXA 3GU6A 4PPAA 5E8UA 4EOJA 3WZKA 4G3FA 1TQPA 5K5XA 5F94A 4MWIA 1CSNA 4DH5A 3ITZA 2OF2A 3C0GA 2VAGA 4N57A 3TV7A 4DFLA 2H96A 1WFCA 2JFMA 4RC3A 4DCEA 5IQAA 1NVSA 3ZLXA 2YCFA 2W1DA 5ANOA 2CN5A 2G2FA 2XF0A 3FMMA 3WF5A 3LFNA 3V6SA 4V0GB 3FE3A 4KB8A 2RFDA 3FXWA 5CSVA 3PTGA 3UQGA 2OIBA 5ACBC 4RX5A 3PA4A 4X6QC 3Q9ZA 3QC4A 2Y0AA 2J0JA 5CI6A 1O9UA 4ZSGA 3WZEA 3QD3A 4M15A 4G31A 3JXWA 4AF3A 3CQEA 1OGUA 2CCHA 2YLEA 3BBWA 3KC3A 3FY2A 3QGWA 1U54B 4FTQA 3EQFA 3EIDA 4GVJA 4JBOA 4KNBA 4KRDA 4WT6A 3F2NA 4N0SA 4BCJA 4OTGA 2C68A 3FLNC 3Q60A 3Q5ZA 3QTXA 3MTLA 3NEWA 4X2KA 1XH7A 3PYYA 2JBOA 4GFGA 1H28A 4NM3A 5I0BA 3HUBA 2C4GA 4JBVA 3ZTXA 4ERKA 4KS7A 4FTUA 2WHBA 4PMPA 4YHFA 3W33A 4DTBA 2XJ1A 1NVQA 3TN8A 2O2UA 5JN2A 2IZUA 4FC0A 4L45A 2G01A 5CSHA 3PE1A 3HVCA 3UIUA 4M0YA 2BR1A 1P4FA 4GU6A 3LM0A 3EQDA 3UOHA 2WD1A 2FSTX 4RRVA 1ND4A 3OW3A 4FKGA 4I6BA 3I7CA 2WTDA 3QX4A 3U4UA 4R1YA 5K3YA 3ACJA 3OROA 3FQSA 5JGDA 3P1AA 4O86A 1H01A 1Q4LA 3COIA 3VS0A 4YBKA 2C6TA 4QD6A 4AQCA 4RVLA 4F0GA 3ORZA 1YXUA 5FEQA 4TNBA 4RPVA 3D4QA 1H1QA 4EHEA 3C9WA 4DEGA 4UMRA 4BYJA 3I81A 5KKRC 5EI2A 3RINA 1M2QA 3BYSA 3ORTA 4DFUA 3VQUA 3Q04A 3VF8A 4CV8A 1JSTA 4DG2E 4YURA 4RX8A 3RKBA 5C8MA 4U3ZA 3NLBA 2Y4IC 2QOOA 4QP7A 4BDFA 2Z7QA 4FK3A 3VBXA 4BF2A 3GCUA 5DG5A 1M7NA 3MGYA 2UVYA 1W7HA 3OUKA 3CEKA 2R2PA 4MNEB 1JPAA 2AC3A 2ITZA 2UZNA 2X9EA 3THBA 1OIUA 2QONA 2Z7SA 3PSDA 5HOAA 4RQKA 4EZ7A 4WSQA 3RBWA 2B52A 3F3TA 5EG3A 3RNYA 4V04A 5CU6A 4TYGA 5AP4A 3UO5A 2Z8CA 1PY5A 2J90A 3D7TB 4IVAA 4NM5A 3UBDA 3PJ1A 3OY1A 3JUHA 4FV1A 3CLYA 5J9YA 4C36A 2BRBA 4MXOA 2VTIA 4R3CA 4YC3A 5HO8A 2IWIA 4O0VA 4L00A 1ZYLA 2R64A 2UZTA 5I9WA 4F09A 4DFXE 3R7EA 3FI8A 3AT3A 5EKOA 4CCUA 3PPZA 3PVUA 4HYUA 3QHRA 4TW9A 4ZY5A 4CKJA 4DEHA 3EN5A 4YR8A 2YA9A 4QMOA 3A61A 4IB5A 4XOYA 4ANNA 5JGBA 3UZTA 3FKNA 3MI9A 4J7BA 2YM5A 3O50A 3Q4ZA 5CNNA 1W0XC 4X7QA 3NGAA 1OECA 3F7WA 4D5HA 2AYPA 3P4KA 4ACGA 2WELA 2ZV9A 2XP2A 3TV4A 1Y57A 3BKBA 4CQEA 4I23A 4I4EA 4DEEA 1XBCA 2CPKE 3FUPA 5CASA 2QQ7A 3A7JA 3UNJA 5EM8A 1R78A 4IHPA 5JRQA 4HYSA 3G15A 4ZS0A 3DPKA 3QHWA 3DCVA 3NYOA 5EW3A 3L1SA 1BI7A 4YSMA 4HGLA 4QPMA 4BC6A 4EK6A 5BUIA 3BZ3A 3BLQA 3NZ0A 4HCVA 3W8LA 5EW9A 4O2ZA 4YZDA 4MXAA 5AADA 1YQJA 3OF0A 4FTNA 3LMIA 5KHWA 2BHHA 5FRIA 1Q24A 1ZOGA 4IBMA 2BHEA 3ATTA 2QOLA 4FKRA 5FLFA 5HTCA 3ET7A 5BMMA 3OTVA 1ZXEA 3M11A 3RZBA 4QTDA 4AGWA 4FIGA 3Q6WA 3EYHA 2JDSA 3DLSA 4G3DA 2WOUA 5M55A 3VVHA 3VS6A 2OW3A 3FL4A 5TR6A 1PJKA 4IB1A 4IVBA 3OOGA 2C30A 3R7YA 3O7LD 5ANDA 4HCTA 4P5ZA 4A9SA 4QNYA 1WBSA 3QCSA 4U81A 2PVRA 3QD0A 3CR0A 1ZY5A 4NTSA 3FI2A 3K54A 3BLRA 4GUEA 3S1HA 4JQ7A 4E4NA 2HW7A 4LM5A 3LHJA 1UNGA 5B0XA 3RHXA 5FDPA 2P2HA 2LGCA 4FMQA 3TZ9A 4EH8A 5HCXA 1UU7A 4L3LA 4UYNA 3K5VA 4I41A 4EQCA 4F1MA 5HCYA 4WA9A 3MVLA 1NW1A 4B99A 4Q9SA 2OO8X 2R3KA 5IQBA 3BE9A 4OAVB 3EL7A 1XH5A 4BWPA 4O83A 3HDNA 4G5JA 2CGUA 4ZTQA 1H0WA 4OW8A 3ZRKA 5HX6A 5M4IA 3CD8A 3L8PA 4A9UA 1A48A 4ZZMA 1GZ8A 4E5AX 4EK8A 1QPEA 1OIRA 2J0KA 4F9BA 5C01A 3ZSGA 4RG0A 2V55A 3LCDA 4IAIA 5M53A 4M66A 4BWKA 1LP4A 4X2NA 2CLQA 1XH4A 2XUUA 4KBAA 3MPMA 5DT4A 5I3OA 2W1HA 3KXNA 1XR1A 3UVPA 4YJVA 4RJ4A 4EBWA 4QMMA 5JFXA 3NYXA 4HZRA 5IEXA 4EC9A 3QCQA 2XKCA 3QUPA 1G8AA 4CEGA 4B8LA 1FMOE 3GBZA 4F1TA 4J8MA 2V22A 4UMQA 3W2OA 5CEPA 3V5WA 5C1QB 3GB2A 4I5CA 3MVMA 1XH9A 4AP7A 3ENHA 5KO1A 4NFMA 4XV9A 4QP4A 3DKCA 2VTHA 4H3BA 4AA0A 5AJQA 2VNWA 3ALOA 4MBJA 4FL1A 3C7QA 4JT3A 3CP9A 1A06A 4ITHA 4YJUA 4RJ6A 5CEMA 4JLCA 4LRJA 3VRZA 3QTWA 4EH6A 4D9UA 4EH7A 5K4JA 4X3FB 4FT7A 4O96A 4K77A 3I0OA 3ZLYA 3ZFMA 4J96A 3G51A 4M12A 2IVUA 1M2RA 3LKMA 1BKXA 4II5A 4AGCA 5JQ5A 4TWNA 3MY1A 3GCPA 3RK9A 4ACDA 4R3PA 1DAYA 3KVXA 4JI9A 2ZB0A 2QVSE 3O17A 2XIKA 4NKAA 5EYDA 4QP3A 5FP5A 4BGHA 4FEXA 2RSVA 3EN7A 5J1VA 1F0QA 4UV0A 3N4UA 3DQXA 4RJ8A 1PF8A 2Y6OA 3FQHA 4ZOGA 5ETCA 5IZFA 3RVGA 2ZMDA 3PG3A 4FKWA 1J7IA 2RG5A 4A7CA 5AM6A 3VW6A 3C4FA 4D4YA 1Z9XA 5IQFA 4B0GA 4BHZA 3FMKA 2FSOX 3Q4UA 1BMKA 5HVYA 2VTAA 3A4PA 4KKHA 1R0PA 4P2KA 2GNLA 2OBJA 3NAXA 4O0XA 5FXSA 1FVRA 4DGLC 3QTSA 2PUPA 4TXCA 3NCZA 1JSVA 3JYAA 3MJ2A 3H0ZA 1H24A 4KA3A 4W4XA 3V8WA 4XP3A 4HGSA 3ZH8A 2YWPA 1M17A 5AV1A 2QNJA 5EFQA 2YJSA 4FVPA 4PDPA 4EOQA 2BDWA 4TYHA 3Q52A 4BGQA 2C6EA 2F49A 3POZA 5DLSA 1WBNA 3DDQA 4FNWA 4GIHA 3NVMB 1PXNA 2E9VA 3AC2A 4ALUA 3OD6X 1QPCA 2XJ0A 2G2IA 5IQHA 1WBPA 4QYGA 2OXXA 4UMTA 4DH1A 1JBPE 2RGPA 3QLFA 4NZWB 3WIGA 5L2IA 3H9OA 4QYFA 1Y91A 4Q9ZA 3U54A 1CKPA 4W9XA 5JT2A 3MIAA 4RWLA 4V05A 4QRCA 2YIRA 4AG8A 3BEAA 3EQCA 4EWQA 4F9WA 1LUFA 2QG5A 4FTJA 2JKMA 3JS2A 4TRLA 1ATPE 4AZEA 3JY0A 2VO7A 4UY9A 3KCFA 2B1PA 4ZSEA 4BCGA 4DEIA 5IEYA 2CKOA 3FYKX 3R6XA 4BCIA 5IH5A 3E8DA 5IA2A 3ZC6A 2Y7JA 3UIMA 5HD4A 4MBIA 2B9FA 5JQ8A 5IQDA 3GCVA 2IPXA 2UW3A 5FD2A 5DOSA 1SMHA 2J51A 2JDOA 4FKOA 3EQHA 5K9IA 4EHGA 2A4LA 3B8QA 1CM8A 4JG8A 1URWA 4YTHA 3G0FA 3ZO2A 1E1VA 4FG9A 1GJOA 3KCKA 4L53A 1YDRE 3HGKA 3II5A 2C0OA 3TL8A 3DQWA 3UYTA 2A2AA 4AN3A 3OFMA 5E90A 2XZSA 5TO8A 4ZMFA 2XIYA 3NUSA 1SVEA 2GQSA 1YWNA 4YLLA 4GRBA 3IW8A 3QQUA 4KKGA 4RBLA 4BCMA 3A7IA 3P78A 2R9SA 4YSJA 1YWVA 5HIBA 5JZJA 5IA3A 1TKIA 4HOKA 4CFXA 3HMOA 3LXPA 4YJOA 2HENA 4S2ZA 3ZLWA 4F0FA 4OTRA 2O64A 3P08A 3F2RA 3QZHA 3SOAA 3BV2A 4F63A 3FBVA 4YLKA 2PE2A 3T9IA 1PMNA 4QQ5A 5T68A 4D28A 2F7ZE 1JKLA 4C34A 5CF4A 3ZM9A 4XBUA 3OWLA 5TE0A 3LLAA 5D11A 4BDBA 2X2MA 1ZMVA 2R5TA 1CKIA 4GCJA 5IDNA 5LCKA 4GJ3A 4M8TA 4C4JA 2FUMA 4PDYA 3ZBFA 3WE8A 1KE8A 2B7AA 3UGCA 4YO4A 2GNIA 1SM2A 5C9CA 3LJ2A 5C26A 1PXMA 3LJ1A 3OXIA 2GHGA 2ZM1A 1UNHA 4AN2A 4D58A 5JRSA 4CG9A 3QF9A 4PP9A 4NCTC 1ZMUA 3O0GA 3R73A 4IW0A 2IW9A 5CEOA 2ITVA 2WEVA 5CEKA 3MSSA 1VEBA 1H08A 2R3PA 3PWDA 4MVFA 4XG7A 3RJCA 3RWQA 4RVMA 2OLCA 2CN8A 4XV2A 5ANEA 2CNUA 1V0OA 1BX6A 3BGZA 3EWHA 5TT7A 5FUTA 3JVSA 1YI4A 3OHTA 1UU8A 4U9AA 4NL0A 3D15A 3Q6UA 4LV5A 3DOGA 3NAYA 5ANJA 3AC5A 2PZIA 2C5OA 5A4TA 5HVKA 4MK0A 5KMMA 4QMWA 4L6QA 4P90A 3OP5A 3A7FA 3T9TA 5HIDA 3BI6A 2VO6A 2OZOA 3COKA 4UXQA 4B7TA 2W96B 4LL5A 3ULZA 4LOOA 3EN6A 4OTDA 2XA4A 4P5QA 3IO7A 4KAOA 3ZRMA 3C5IA 3OBJA 3R7OA 5HZNA 3IGOA 5EQEA 3EMGA 4G6OA 4IXPA 5CAQA 4QYEA 2BZHB 3H9RA 1RQQA 3M42A 2WTKB 2W9FB 3R1NA 2QU6A 3E5AA 3Q32A 3HX4A 3HV4A 4I20A 3G9NA 4FEQA 2BKZA 3TZ7A 2QOHA 2G15A 4FVQA 2EU9A 2UZVA 4OGRA 5AP0A 4DH7A 5LVNA 4ZXTA 3TIZA 2VX1A 5BUJA 3ETAA 2J2IB 4V01A 2J4ZA 4WNKA 5TOZA 4YGAA 3LXKA 2YIQA 2X4FA 3OXZA 3R8ZA 1G5SA 3LFSA 4DT8A 4F7SA 4RSSA 5JMSA 5KHXA 3MFUA 2ERKA 3OEZA 3MS9A 4LMUA 2HELA 3PA5A 1V1KA 2CDZA 3BCEA 3LFDA 2VWZA 3E92A 5H2UA 4E3CA 3O71A 3G0EA 3RZFA 4M84A 3LFFA 2C5YA 3PRIA 4FIEA 4RFYA 2BALA 3A8XA 3KL8A 3RM7A 4U97A 4ARKA 2UV2A 3CE3A 2B55A 2GNJA 4NU1A 3F5XA 3REPA 5L2QA 3EN9A 4S30A 4IX5A 1OPLA 3PJCA 3BGQA 2GPHA 4FR4A 4RIWB 2PU8A 4IAAA 2QLUA 3VBYA 4HGTA 3AC8A 2WTCA 3D5VA 4JBPA 4EUUA 5DMZA 1T45A 2PVFA 3G90X 2O5KA 3LCSA 3R02A 4JG7A 4I5PA 4F65A 4ZSAA 1PYXA 2PUIA 4R6VA 4WBOA 3OG7A 3Q2MA 4IWQA 3UTOA 5DEYA 3QTUA 4GJ2A 3PY3A 3TM0A 3FPQA 1NA7A 4ANBA 3KXGA 4O7RA 2GFSA 3F88A 3E93A 3IDPA 5ACKA 4L52A 5IEVA 1SYKA 1NVRA 4ANSA 4YMJA 2B9IA 3U9NA 2Q0BA 4BCHA 4JR3A 4CTCA 5EOLA 2GFCA 4Y83A 3TNIA 1WBTA 4MAOA 2VWYA 4FTMA 4CCBA 1OM1A 3ZYAA 4QMTA 5BVNA 5EKNA 3DU8A 3OWJA 5BYYA 5E4HA 3Q53A 4G6NA 4D2VA 2UW0A 2QO2A 5DGZA 3U6HA 3EQRA 3DFCB 5HNBA 2ITXA 2C1AA 4YO6A 2OSCA 4XRLA 4FV9A 3R7UA 1WBOA 2OIDA 4QP8A 2PZRA 4RT7A 4QP6A 3U87A 2YCSA 1SZMA 5E9EA 3DTCA 3R2BA 3DK7A 4L9IA 4JR7A 4YU2A 2ESMA 5M4CA 1ZMWA 3BYMA 3KFAA 2VTSA 1VR2A 5CU0A 5LVMA 3QALE 4FE2A 1PXIA 2C1BA 3HP5A 4I0TA 4PX6A 3FZTA 3TKUA 4CLJA 1Z5MA 5GJGA 5J9ZA 3SG9A 3SXSA 2YN8A 2X7GA 4ZK5A 3NCGA 4RIOA 5AX3A 5F95A 4TTHB 2V7OA 3DBEA 2YEXA 4KBKA 4CSVA 3RK7A 3UODA 3BHVA 4EEVA 4K6ZA 3UNZA 1P4OA 2BZIB 2OI4X 3LFAA 4ENYA 2PVKA 3I5ZA 4CT1A 5IMEA 3NX8A 1UU9A 5LMKC 3F5PA 3HRFA 4KIOA 4M14A 4EOLA 4UZDA 2UZUE 1Y6AA 3EFJA 1IA8A 5D7AA 4AZFA 2VTMA 4RIYB 3O2MA 2UVXA 3GUBA 4OTIA 1PMUA 1YRPA 3UO6A 3FC1X 4B4LA 4C35A 4MQ2A 4ZTMA 5CZHA 2AUHA 5EYCA 3ZSIA 2ZDTA 3EYGA 3FYJX 3KN5A 1GNGA 2JAMA 3LQ8A 3P0MA 3D7ZA 4KIKB 5DRDA 3MH0A 3ROYA 4CMUA 2QODA 3R1YA 4PDSA 1OUKA 1F3MC 2R3MA 5DRBA 5E8TA 4QQJA 2WTIA 4ASXA 2WQBA 3NS9A 4PNIA 1J7UA 2W9ZB 3TUDA 2W99B 1Q61A 4BBEA 3KF7A 2JDVA 4MTAA 2WFYA 2I0VA 4F1OA 3KEXA 3MH3A 4U44A 3ORNA 1LEWA 5D9HA 3CSVA 4O0RA 1MUOA 4W4WA 4XNEA 4GYIA 4QYHA 2Y4PA 1S9JA 5HICA 3SG8A 1TQMA 1VYWA 2OXDA 3OW4A 5IISA 4GUBA 4L7SA 3LCOA 4DE4A 2J0IA 4JXFA 4BDGA 1HCLA 3DNDA 3OS3A 4WUNA 1WMKA 2YFXA 3TKIA 4RIXA 1JKTA 4ZJVA 3FMNA 3F6XA 4PTEA 5E92A 4EH9A 4E5WA 2BROA 4EHZA 3SX9A 2PY3A 3W2CA 2G2HA 1BL6A 2PTKA 2EWAA 1GZOA 4ASZA 2ZM4A 3FDNA 4JDJA 4JIAA 1DI8A 4DGOA 5BQ0A 3KB7A 3SV0A 3QRIA 1WCCA 2NRYA 3GT8A 3KRXA 3KMMA 4GYGA 4Y73A 3LFBA 2QHNA 5FM2A 2JD5A 2RIOA 5LVOA 1GAGA 4DG0E 3KK8A 4B9DA 4IANA 1RJBA 3KRLA 4QMLA 2XJ2A 5E91A 4A9YA 3RCDA 3DBQA 3Q3BA 4YJTA 5D10A 4EKLA 3IG7A 3QRKA 2P3GX 5ANIA 4BN1A 4D2TA 2PSQA 4AW5A 2R3LA 2QOQA 2C6MA 5HCZA 3DXNA 4BWXA 4FOCA 2OJJA 2GQRA 5GINE 4XX9A 4NTTA 2PULA 2WMRA 5A9UA 3OVVA 4UWBA 2X2LA 1B39A 1GIJA 3SHEA 4USFA 4MHAA 4IM3A 3NUAA 4QTCA 1RDQE 2HIWA 2UW9A 2H34A 4P7EA 3KREA 5AUZA 4O82A 2ONLC 4MH7A 4TNDA 2VX3A 4J53A 5KX8A 3OUNB 4EJ7A 2XK8A 4PF4A 2UVZA 3FZSA 3UQCA 1JLUE 1GIIA 1U59A 3HNGA 3HA8A 4GW8A 5AR4A 3LM5A 3QKKA 4PTCA 5BVOA 2PZPA 5CT7A 3D14A 4HVHA 2ITQA 2XIXA 4QP2A 3S3IA 4I22A 3OCTA 2GCDA 3SLSA 1JWHA 2IZTA 3ZDIA 3PPKA 4JX7A 3H9FA 3IGGA 5IUIA 2BDFA 3HRCA 1CKJA 4A4LA 3QQLA 1VYZA 4FTIA 4LGDA 3KF4A 1OL2A 4FTTA 2X8IA 3V8SA 2ITWA 3DZQA 2C6IA 4X2FA 2WMUA 3FZOA 3DK6A 4D0XA 3R00A 2GU8A 2ZV2A 5AA8A 4Y5QA 4EHVA 5ITAA 3HAVA 1UWHA 5C27A 4UYAA 3VJOA 2FYSA 4NIFB 2VN9A 5EDRA 3ZOSA 2YDKA 5M51A 1JSUA 1UU3A 4K18A 1XHAA 3RALA 3C4EA 5J7HA 3DZOA 3FLQA 3LFQA 4IAZA 5FEEA 3O51A 4R7BA 3BHUA 5L6PA 1PKDA 3RAIA 4O7ZA 2QKWB 2ZJWA 1XBBA 2HWPA 3NNUA 4RA5A 3F5UA 1OPKA 2CGWA 3ORPA 2YM8A 2XNOA 1Y8YA 5EK7A 3F3VA 3CTJA 1ZAOA 2HY81 2O65A 5CI7A 3MH2A 5DBXA 4IAKA 4ZEGA 1W82A 3LMGA 3SRVB 4R7HA 4GV1A 4U8ZA 4FOBA 5L6WL 4CD0A 3OY3A 4GG5A 3UJGA 4BTFA 5LVPA 3PVWA 4X3FC 4D2SA 2W5HA 3RPRA 5FTQA 4RWKA 4C57A 4EYMA 1Q8UA 1ZOHA 5BX0A 4F9AA 2BRNA 2XK6A 2Y6MA 3L9NA 4J8NA 4IM2A 4KRCA 4WD5A 4CLIA 4Z55A 2H6DA 4KUJA 3QFVA 5M08A 4ITIA 4H1JA 4K1BA 2I0EA 2XK4A 3W2RA 4C4GA 4QTEA 2VWWA 4L01A 2VTJA 4UEUA 2C0IA 5EDPA 5CVFA 5I4NA 1E9HA 1PYEA 2RG6A 2RKUA 2VTQA 4FSYA 5T6KA 4F99A 3D5XA 4I1ZA 4JIKA 1G8SA 1KV1A 3TXOA 3CIKA 3OWPA 5CYIA 5I3RA 2FB8A 4WO5A 2W1CA 3RHKA 3TTIA 3C1XA 3E87A 4RC4A 4CQGA 3L9MA 4AXAA 3DXQA 4XLVA 2XRUA 2BZJA 2XIZA 3C0HA 3P86A 2VTLA 3PSBA 4M68A 4NT4A 3P7CA 5ETIA 4ZJJA 3QQFA 4AZWA 5AV0A 3EKKA 1JAMA 5DHJA 1YOLA 5FXRA 1JOWB 3C0IA 3OTUA 4QT1A 2UW4A 3M1SA 4CFFA 2WZJA 2YAAA 5E8XA 4W4YA 4XJ0A 3KULB 4XEYA 5FTGA 4J71A 3OT3A 5EM5A 3FLYA 5EW8A 4CRSA 1OZ1A 5CSPA 5ICPA 4EOPA 1QPJA 1OUYA 3ELJA 2C5NA 4C37A 2B9JA 4LUDA 4D1XA 2GS7A 3VBWA 3A7GA 5DR9A 4FKSA 4GKIA 4QMZA 4H05A 3KXMA 2XEYA 2BTSA 4RVTA 4X3JA 2WIHA 5D7VA 4HZSA 3OCSA 3IW4A 4YPDA 4AX8A 3TZMA 1WAKA 3UIBA 3QBNA 5IA0A 5H8BA 3H30A 4U6RA 4EOSA 4UBAA 4UX9A 4GSBA 4BKZA 1MRVA 3EOCA 4M69B 3PIZA 5IA4A 5M44A 3HV5A 3U6JA 3VW8A 3EKNA 3UO4A 3AG9A 3L9LA 2C0TA 1PRYA 1OL6A 1OKVA 3F66A 4HGEA 4IADA 3V6RA 4L3JA 3HECA 2XB7A 4D0WA 1J91A 2VTPA 3GNIB 3KN6A 2JDRA 4O0UA 3FXXA 3S95A 2J6MA 2PE1A 3PJ2A 5F1ZA 4FV0A 2W1FA 2WGJA 4EZ3A 1MRUA 2BRGA 4A4OA 2ACXA 2E2BA 4L42A 1V0PA 5AV3A 4L68A 1Q41A 4B8MA 1KOAA 4OTWA 3SW4A 2HOGA 3Q4CA 4DFNA 3PVGA 5K4IA 4DBXA 2BRHA 4RVKA 4I0RA 3VUIA 2W4JA 4F08A 2GDOA 3T8OA 1H0VA 2R3GA 3SVVA 2Z7LA 3SKCA 3EH9A 4E93A 5LJJA 3WF8A 1FOTA 3GU5A 1FMKA 3K5UA 3DDPA 4GIIA 4TY1A 5JKGA 4F7JA 5M07A 4J99A 1WBWA 4KIQA 4Q5HA 4RX7A 5HHWA 5IF1A 3WYXA 3QXOA 2W1ZA 3FLSA 1GY3A 3DKGA 2IJMA 4I94A 5LXMA 4Y46A 1PXJA 3VAPA 3NR9A 4C4FA 3Q96A 4FEWA 4PMTA 5E8WA 3ZEWA 4E7WA 1H1SA 4KWPA 4ANLA 2E9OA 1H00A 3UVQA 3ODYX 3LCKA 4DFBA 2J9MA 3ZO1A 4A4XA 4C7TA 4TL0A 2ZV7A 5A4CA 2WPAA 3QGYA 5I9ZA 2V5QA 4FZ7A 3R8MA 5GIOE 4DTKA 2R3IA 2ZYBA 1Y6BA 4QQCA 4GT4A 3UOJA 3DAEA 4G1WA 4QMXA 1AQ1A 2EXMA 2F9GA 2OH0E 3DA6A 4I93A 5HE2A 3QKLA 3RPYA 4DGGA 1RW8A 4N6ZA 5J5TA 2UW5A 4JL9A 3W1FA 5AX9A 3FMLA 2YIYA 4GT3A 3R1QA 4OTQA 4BY9E 2QOKA 4L3PA 2JBPA 5CAVA 5HX8A 2F2CB 4GEOA 1OI9A 2RFSA 4ZSJA 4M67A 3ZONA 1QCFA 3CD3A 3A4OX 3BHYA 3IDCA 3LQ5A 4PWNA 4Z16A 4FSNA 4UN0C 2CGVA 3BPRA 5M09A 3DBCA 3WIKA 1YXVA 2JC6A 2WMXA 2B53A 2P55A 3P7AA 3TDVA 1YHSA 5HG5A 2WMTA 2X81A 1P14A 4FTAA 5BPYA 4IWPA 5HE0A 2X6DA 5CALA 5BYZA 5L2SA 3BQRA 4XG6A 2UW8A 4MD9E 1W8CA 2YCQA 3PXKA 1H1WA 1YOMA 4EOOA 2C3JA 2VWBA 5FEDA 3LXNA 2V7AA 4C33A 3SQQA 4USEA 4TKSA 4EYJA 3SA0A 3A62A 2P33A 1OIQA 4ITJA 4ZAUA 2GMXA 2WOTA 3VBTA 5DA3A 4BIBA 4DA5A 3KKVA 3F7ZA 4YZBA 4C02A 1GZNA 2C3IB 3ZUTA 3FSKA 3BWJA 2GTNA 4H1MA 4UXLA 4ZP5A 1JKKA 2FGIA 5HI2A 3KRWA 3FI3A 3KGAA 4IX3A 5AP5A 2PYWA 4ZZNA 1IG1A 1H1RA 2WTKC 4N6YA 4E5BA 2ZAZA 4AAAA 5A14A 3UPZA 4U41A 3FMJA 1YHWA 4DAWA 2CHLA 3R21A 4TYEA 5HLPA 3NWWA 4MNFA 4WNOA 5HORA 4XG3A 3EB0A 2VRXA 3MW1A 5K5NA 1YHVA 3PP0A 4NK9A 3PXRA 2YIWA 3RPVA 1OBDA 3NUYA 2B54A 3QQKA 4ZY6A 3OXTA 2Z02A 3D9VA 3NNWA 2BILB 3QRTA 4F7LA 4DHFA 4GL9A 5CEIA 4QPAA 2V0DA 3NVKI 4JNWA 3A7HA 1P2AA 2PUNA 1A9UA 1T46A 1XO2B 2XMYA 4WRSA 5BVDA 1YKRA 4U79A 4PNKA 3LOKA 5AP2A 2C6LA 2PZYA 2FH9A 4BCNA 5J1WA 2ETKA 3G9LX 3QYWA 5L2WA 2GNGA 4CYIA 4DG3E 2IO6A 2VWXA 2X7OA 3K3JA 2PMOX 3ZO4A 4C59A 3ZU7A 2W5BA 1W83A 4NWMA 3KXXA 2R0IA 3EFLA 3MPTA 3QUDA 3VHKA 4HNFA 4PUZA 3VUHA 1DI9A 4G16A 5K0KA 2J50A 2X8EA 2XYUA 1XJDA 5I9XA 2F2UA 1B38A 2NP8A 1XBAA 4ANOA 2WTVA 4TYIA 1ZARA 2B9HA 4FZ6A 4ENXA 2YLFA 3KRJA 3R1SA 4IZ5A 3UP7A 5JFWA 5A46A 4G6LA 4U43A 4E4XA 4U5JA 2YDIA 3R22A 2YABA 5DT0A 2Z7RA 4GK4A 4BDEA 1URCA 4S32A 4YJSA 1L3RE 3AXWA 3VULA 4XOZA 4JQEA 5F4NA 2HZ4A 2O3PA 2WU6A 3VJNA 2DYLA 2WMAA 5CSWA 2I40A 4IC7A 3FQEA 4UMPA 3UZRA 2NPQA 1UV5A 3PXZA 4BCQA 1UKHA 3E3BX 3PE2A 3BU6A 1H4LA 5BVEA 3ZFXA 4BBFA 2O8YA 5AUUA 1Q3DA 3DKFA 1PMEA 4KSQA 5FGKA 5FP6A 3EN4A 2OJGA 1KWPA 4Y72A 5CWZA 3UYSA 3HV3A 3QD2B 5EYMA 4NCTA 4IM0A 2QLQA 4MX9A 3NYVA 4PMSA 2IZSA 1S9IA 5E8SA 5HO7A 4IDTA 4E1ZA 4IFCA 3V04A 4FKQA 5C4KA 2C3KA 4FSTA 3RCJA 4MD7E 5IMXA 2X1NA 4LV8A 3C4CA 4O7SA 4IC8A 4C2VA 3U6IA 3FKOA 5B2LA 2VNYA 5FM3A 2X39A 4CV9A 3D5WA 5E1EA 2JAVA 4LG4A 3BHTA 5HG9A 2OFVA 1M52A 3WILA 1V0BA 2WQEA 2XNPA 3PWYA 4EK5A 2DUVA 3NUXA 1STCE 4RWIA 4ALVA 1W98A 4YZCA 5IUGA 3BBTB 3R7IA 2WU7A 4FICA 1IEPA 3EQGA 3QA8A 5GZAA 5AAGA 4R7IA 4RJ5A 3F69A 2CKPA 3GOPA 2AC5A 2R3RA 4BI2A 2PVJA 4CFVA 1GZKA 1WVXA 5A6OA 3U55A 5DR2A 4EH5A 4F4PA 4WHZA 3V5LA 4CYJA 4WRGA 2W06A 3D0EA 5EM6A 1OMWA 2WTWA 2OZAA 1YXXA 3BGPA 2LAVA 3SC1A 4CZYB 4I92A 5LARA 3UMXA 4EOMA 5CU4A 3BEGA 4QP9A 4PMMA 4LOQA 1UA2A 2RL5A 2XVDA 3FL5A 3ORIA 1Q8ZA 4BZDA 2Q0NA 3H3CA 4CVAA 5LVLA 3R71A 3EFWA 3FKLA 4RQVA 3UMWA 4O7LA 2C6OA 2ZVAA 3MH1A 4FT0A 2X4ZA 4HCUA 5HVJA 3CKWA 1XH6A 5J95A 4LGHA 5EQYA 5BUEA 5AFVA 2VGOA 3GC7A 4RJ3A 4I0SA 5LOHA 3PY1A 3IKAA 4ERWA 1OKWA 4X21A 2PMIA 3FPMA 1VZOA 3EQPA 4AE6A 5ETFA 5KMOA 2WIPA 4YNEA 5DE2A 5AA9A 4ZS4A 3COMA 4FODA 4H3PA 4V0GA 3SAYA 3ANQA 4FEVA 3F3WA 2HW6A 5EHYA 3KXHA 4BDIA 4PQNA 4BDJA 2JKQA 4CNHA 5IH4A 1U54A 2E9PA 4GH2A 4AOIA 2I0HA 3BHHA 3LZBA 5KCVA 2HWOA 5CLPA 4BHNA 5A4EA 4S31A 2BIKB 3M2WA 4EH3A 3MWUA 5BYLA 4YHTA 3SOCA 4PPBA 3L8VA 4LFIA 3FWQA 1QPDA 4IFGA 4GMYA 5EOBA 3IONA 1RE8A 4PY1A 4ASEA 2R3QA 5KBRA 5I9YA 3PG1A 1FVVA 3QUEA 3DGKA 3FY0A 3LFCA 3ZXTA 4YTIA 3IW7A 2J5FA 5ANGA 5HIEA 4R3RA 3V5PA 4BDDA 2ZMCA 3QTZA 4IEBA 4EJNA 5JFVA 4U45A 1YXTA 3IECA 4BDAA 4EKKA 4FV7A 5HGIA 3DS6A 2WKMA 4C4HA 3GC9A 1XH8A 4CXAA 4W9WA 3H10A 2J0MB 4E6QA 4LRMA 4DTAA 3PPJA 2PVNA 3MA6A 4OTPA 5F20A 3SD0A 4RX9A 5M56A 3VS3A 3MB7A 3GVUA 3PJ3A 4QMPA 4D2WA 4DH8A 3T3VA 4EUTA 4L7FA 4AW0A 3ZM4A 3KY2A 4OT5A 2GNHA 2PK9A
chains in the Genus database with same CATH superfamily
3FHRA 3VQHA 5H8GA 5C03A 2NO3A 2QR8A 4BCOA 2PUUA 3TG1A 3ZBXA 1F5QA 3W55A 4NJ3A 4AGDA 5KMIA 2UZWE 3TNPC 2YM7A 3NSZA 3I1AA 5BVKA 5HTBA 2DWBA 4MNEA 4I6FA 4PL3A 3LE6A 3VWAA 5JGAA 4FV8A 3JVRA 2VU3A 2CNQA 2JIIA 1DM2A 1Q62A 1BL7A 3AGMA 3LLTA 2UZEA 2V62A 3TIYA 1O6YA 3UPXA 5LMKA 4E6DA 2QD9A 3R9DA 2GTMA 3D7TA 5GZ8A 1EH4A 4W8DA 2X6EA 1MQBA 3QTIA 4DN5A 3BYUA 2WMBA 4FI1A 2C5VA 4WG4A 3ZUVA 4F70A 4IVCA 3QC9A 4WNMA 3LQ3A 3GU7A 3IDBA 1Q99A 4FTRA 2CKQA 2XK9A 3LMHA 3MY0A 4ACCA 4OTHA 4ZJIA 2XALA 5CEQA 5H3QA 3HLLA 5LQFA 4ACHA 4EK4A 4ZTLA 5CSXA 5AUXA 1SVGA 3R8UA 3P23A 1K3AA 3E62A 2YM6A 4FSQA 2XS0A 4RJ7A 4HVDA 5EI8A 2W5AA 3L8SA 5AIRA 2CKEA 2OF4A 4AQKA 5IDPA 4DHZA 3QZIA 4H39A 2OJ9A 4L43A 4L8MA 4AGUA 4JRVA 4F7NA 2YCRA 3DXPA 3PXFA 4NEUA 4F6WA 2YZLA 3VIDA 5L4QA 3LVPA 2UZLA 3U9CA 1TVOA 4FEUA 1PXLA 4WG3A 4JAJA 3OZ6A 3WYYA 4U80A 4JDHA 4MKCA 5CY3A 5GJDA 4MD8E 4MXCA 2OU7A 4X2GA 3P5JC 2RFEA 3U8WA 4O7NA 2R3OA 4ZTHA 4CFMA 4I4FA 3ULIA 1OL5A 3HDMA 4MF1A 4WBBB 5DR6A 5HKMA 3N4VA 5HBEA 3E64A 5ETAA 4ANMA 5TKDA 1Z57A 2VX0A 3RPSA 1W2FA 4AT3A 5DIAA 5AR8A 4PL5A 2ZDUA 2JFLA 4FV2A 1YWRA 5DH3A 4TYHB 1YI3A 3FZ1A 4GVAA 3NPCA 2R4BA 3QQJA 4G2FA 2VTTA 4XUFA 5AIKA 4C61A 5A4QA 5HESA 4FIJA 3ZC5A 5JEBA 4X0MA 1WZYA 3AC1A 4FZAB 3D83A 3QX2A 4ID7A 2GSFA 3IS5A 3FEGA 3MTFA 4JDKA 4QTBA 3Q5IA 5L8KA 4XG4A 4FKTA 3TV6A 3O96A 3MB6A 3FMDA 4YJNA 3I6UA 2GS6A 3R83A 4BIDA 3ZS5A 4FF8A 3QYZA 4ZLOA 4JRNA 4FBXA 3PXYA 3BU5A 3TKHA 4WNPA 4XRJA 1SNXA 5AUWA 5LWNA 4ZTRA 5J8IA 5HQ0A 2NYAA 1WBVA 2ONLA 4YNOA 4XCUA 4Z9LA 5IQGA 2HYYA 2WB8A 1U4DA 3I79A 2XKFA 3R8PA 3ATSA 2ITUA 4AU8A 3QRJA 3A60A 4AOTA 4IVDA 3F3UA 5EH0A 3WE4A 1H8FA 4FV6A 4XV1A 3PSCA 5DNRA 3QQGA 5D41A 3CBLA 5IQEA 4J98A 4AOJA 3PUFC 4U3YA 2HY0A 3OOMA 4D9TA 1ERKA 2XKEA 3KQ7A 1BUHA 1H25A 5BVWA 3FJQE 4LL0A 5HEZA 5CZIA 2BIYA 3IW5A 3EQIA 3PVBA 3WF9A 1W2DA 3FMEA 2XCHA 3TNWA 4TWCA 5HBJA 5EHOA 4D1SA 1XKKA 2Y8OA 2GHLA 1IAHA 3BV3A 4AN9A 5KBQA 2BDJA 5DVRA 1PKGA 2C6KA 2R3HA 2BAJA 2PZ5A 2W4KA 2XM8A 3F5GA 2OJIA 3SDJA 4DH3A 4AACA 4HVIA 3R9HA 2KTYA 3NMUF 3E8EA 3QQHA 4NUSA 4TZRA 4FZDB 3U4WA 2AQXA 4MQ1A 3CY2A 5FDXA 5GZ9A 4BI0A 3QAME 1TQIA 2PPQA 4FNZA 5AR3A 3R9RA 3PIYA 5E1SA 3S0OA 4YZ9A 4YJRA 4DF3A 2YITA 1NY3A 3B8RA 4KBCA 4X3FA 4BKJA 2ZV8A 5FWKK 1IAJA 2PL0A 4FT9A 1H07A 3TUCA 4O2PA 5L3AA 3HA6A 4BCFA 4EI4A 4QMYA 5AP7A 4BIEA 2W7XA 3EQBA 3JPVA 4APCA 2HZIA 4JOAA 3FAAA 3NUPA 4O1PA 3L9PA 3PJ8A 2YDJA 3V8TA 1KE5A 4FV5A 1G3NA 5FBOA 3MPAA 5DPVA 5AWMA 4HVSA 4BB4A 4QMQA 2NRUA 1UNLA 2VZ6A 3P79A 1OITA 5KZIA 2I6LA 5AUYA 4C58A 4FTCA 4IACA 4IZYA 4IDVA 2A0CX 4QOXA 2QURA 2ITTA 2J0LA 3QZGA 4G9RA 3AT4A 2BPMA 3V5QA 1SNUA 1ZLTA 5EHLA 2ZFYA 3E63A 1I09A 2CJMA 3ROCA 3W0NA 3H0YA 2VD5A 5AP1A 4A9TA 2UW7A 1XQZA 1O6KA 1FVTA 3PZEA 2A19B 3V5TA 4O91A 5E7RA 1NT2A 1ZYJA 4M97A 4DCAA 2UZOA 1GIHA 4NM7A 3V5JA 3VS4A 3DT1A 1AD5A 3PFYA 2VGPA 4UWYA 4RZVA 4DEDA 3ZSHA 2WTJA 4R77A 4XP2A 4KS8A 3UG1A 4K9YA 5KUPA 3OEFX 1TZDA 3I5NA 2OFUA 3MESA 4FG8A 3TI1A 4ZIMA 2IVTA 3AMBA 3MYGA 4ZTSA 5HLNA 2C3LA 4HNIA 4BR3A 4MXZA 4NSTA 3O7LB 4A07A 3CC6A 2H8HA 4DEBA 4FYNA 4O7WA 3FC2A 2CCIA 4RFZA 4TPTA 4ZLZA 2UW6A 3O8PA 3HV7A 2BRMA 2EXEA 4HPUE 3WZUA 4G3GA 3EZVA 4BJJB 2BCJA 4AXEA 5CTPA 4FL2A 1ZRZA 2YERA 3ORXA 2C5XA 4UALA 2B4SB 4LUEA 5KMKA 2GS2A 3U51A 3ZUUA 4FUYA 3IOKA 5AV2A 5KMNA 3OBGA 4FZFB 4U42A 4XBRA 4C0TA 2OK1A 3CCNA 2OXYA 3WBLA 5M57A 3KU2A 5CX9A 2BZKB 2R3NA 3TT0A 2QG7A 4BI1A 4MF0A 3SGCA 3BX5A 4IX6A 1KE7A 3ZRLA 5J5SA 5M4FA 5DI1A 1UVRA 1IA9A 3LPBA 4G5PA 4USDA 4R8QA 4BICA 4ONAA 5DYJA 3FI4A 5HE3A 3CXWA 3HMPA 4XYFA 4CZTA 5L6OA 2W05A 2ZOQA 2CLXA 3NW7A 4M3QA 2FSMX 1IRKA 1P5EA 3QKMA 2CGXA 2EVAA 4GKHA 2F7EE 1OB3A 4OBOA 2OJFE 4RLLA 5E8YA 3UOKA 2R7IA 3DAJA 3MY5A 5F9EA 5CAOA 1M14A 3SXFA 4YZMA 3MJ1A 5FTOA 3WF7A 5B7VA 5J79A 4XP0A 4WKQA 3RWPA 3QD4A 3R2YA 4XG2A 3WOWA 4BDKA 5IH6A 4BYIA 1VJYA 4WSYA 4FKVA 4AE9A 4BKYA 4BTMA 5IPJA 4S34A 2W1IA 3OCBA 4LRKA 5HTIA 3MV5A 4Q2AA 3ORKA 5L8JA 3FHIA 4JJRA 3S00A 2VV9A 4FTKA 3POOA 4O0WA 2XRWA 4CKRA 4QQTA 2ITYA 3IW6A 3NUUA 4DLJA 4O6EA 3PXQA 2BKKA 3N4TA 2YWVA 4O84A 2ERZE 3BU3A 4CFWA 3C4ZA 2UZBA 3GP0A 3BRBA 3G6HA 5I9VA 2Q83A 2XNNA 3GQLA 5LMAA 4FSUA 2R3JA 4XG8A 2EB2A 3CY3A 2XCKA 4IE9A 2BVAA 3Q9XA 1H27A 3EL8A 4HYIA 5HLWA 5CU3A 2UUEA 4AUAA 3MN3A 2XYNA 3K2LA 3PRFA 4LI5A 1UKIA 5LWMA 1Y8GA 5K0XA 4I21A 2E9NA 3PZHA 3BWFA 5CF8A 5B2KA 4AWIA 3ID6C 1BI8A 2HAKA 3BYVA 2FVDA 3HP2A 4E6CA 4R1VA 1IR3A 4O22A 2W1EA 3W0QA 4OT6A 1ZY4A 5EDQA 2IW8A 5HU9A 3IOPA 4NW6A 5DN3A 4IZAA 4OBPA 3ZXZA 1ZZ2A 2HZNA 3FLZA 4FV4A 2VTRA 1FQ1B 4RC2A 3FSFA 3A99A 4XMOA 4DFYA 3HMMA 4CTBA 4PPCA 4YPSA 3BLHA 3E7VA 3C5UA 5H8EA 2JGZA 5JSMA 3ZCLA 1U5QA 4KKEA 2RF9A 2VUWA 5JK3A 1YW2A 4G9CA 1BLXA 2ETRA 1FGKA 3PUPA 5CENA 4C62A 2PVYA 3RM6A 4FGBA 2J7TA 2WO6A 1APME 3W0PA 2IW6A 2J5EA 3F82A 3RK5A 3W16A 4FIIA 2GNFA 3VC4A 5CNOA 3MBLA 2HCKA 4AA4A 3G2FA 4LGGA 4IZ7A 4O4DA 4GFOA 4DC2A 5CS6A 3ORLA 4ZY4A 4E73A 2WQNA 1H1PA 1NXKA 3ZZEA 3F3ZA 3UQFA 3LW0A 5KMJA 5DT3A 3QL8A 3CPCA 3GCQA 4O21A 4CFUA 5AM7A 3CPBA 4JAIA 4W4VA 3CJFA 4S33A 2HZ0A 4C3PA 2OH4A 2WMSA 1MRYA 4CKIA 3BIZA 4RIXB 5CVHA 4FKIA 2AEGA 3OCGA 5T3QA 4YTFA 4MYGA 5HNGA 5GHVA 4YC6A 2OIQA 3R9OA 3TEIA 2JDTA 4R5SA 3TACA 1KE6A 2PHKA 1ZZLA 4JX3A 4PL4A 4XV3A 1Q8YA 3GFWA 4RIWA 3NNXA 4FNYA 2JEDA 3OC1A 4AW2A 3CJGA 3TJDA 2QOFA 3BE2A 3ODZX 5CXHA 4FGRA 3RAKA 4K2RA 3E3PA 1E1XA 4D2RA 2BAKA 1R3CA 2JITA 2F4JA 4J52A 4TWOA 2OGVA 3UE4A 3LXLA 1VLRA 4WIHA 2YZAA 4Y85A 4F0IA 3SW7A 1CMKE 2F57A 3D5UA 4HJOA 4BTKA 4YHJA 4O38A 4QPSA 1ZYSA 1OKZA 4GG7A 3BL7A 3D2IA 4RZWA 3AC4A 4FKPA 4FK6A 4MBLA 3GQIA 4BZOA 4H58A 2HXLA 4FT5A 4BVUA 4EWHA 2CNVA 3TDWA 2FO0A 3QWKA 3AMYA 5EYKA 2Y9QA 2W4OA 1JVPP 2XIRA 4IJPA 4EQMA 4U40A 4DEAA 3KMUA 4UMUA 1TFFA 3CGOA 1OVEA 5H9BA 3QU0A 4HPTE 5M06A 4EH2A 4XHKB 3FZRA 4QMNA 3C13A 5CF6A 4FT3A 4LYNA 3PA3A 5CAPA 5KKRB 4FIHA 2QR7A 4O7VA 2VWIA 3P5KA 4KSPA 5G1XA 4H36A 1YI6A 3W32A 3ZFYA 5AAFA 4DBNA 2XEZA 2W17A 3VONA 2BMCA 3NW5A 1IASA 5EQPA 1KE9A 2BTRA 3NIZA 2Y4IB 4DGMA 3HAMA 2R0UA 3VUKA 4CFNA 5EI6A 4O7TA 1YDTE 4BDCA 2PVLA 5JH6A 3VS7A 5BVFA 4O0TA 4X6RA 4FYOA 4DHIB 3AMAA 2Z2WA 3MIYA 4K8AA 4AFJA 4U7ZA 3NDMA 3E88A 4B6LA 1FGIA 5IQCA 4MXXA 2XNMA 3HYHA 3UNKA 2WMWA 4BCKA 4LMNA 3F61A 1R39A 3DNEA 4JQ8A 4AZVA 3TWJA 4YUQA 2DQ7X 2OWBA 3LJ0A 3W18A 2YM4A 4CG8A 4F6UA 3UZPA 2QOBA 5LMBA 2VO0A 2ZM3A 3GU8A 3R63A 4BRXA 4RIYA 3NYNA 3ZMMA 3QCXA 1PHKA 2I0YA 3VBQA 3LIJA 1R1WA 2PVHA 3HMIA 4A9RA 1L8TA 2QO9A 5IKWA 3OMVA 3COHA 4G3EA 3TMOA 2W0JA 2XH5A 4JVGA 1LEZA 1G8KA 2XK7A 1XWSA 1I44A 2P2IA 4BDHA 4QDVA 3EHAA 4HYHA 2XARA 3TUBA 2IZRA 4KIKA 5AUVA 3UP2A 1Q8WA 4QP1A 5AR7A 3QLGA 1O6LA 3JR1A 3ALNA 3C51A 4HVGA 4D5KA 3W10A 1J1BA 2IVVA 3B2WA 4QMSA 3RGFA 1YDSE 2ITNA 1SVHA 3IPHA 4FA2A 2I7QA 4M0ZA 2OKRA 3R04A 4AW1A 3DB8A 2IG7A 3PIXA 2P0CA 2F7XE 3R8VA 1J1CA 4ACMA 1R0EA 1X8BA 4I6HA 3VNTA 4QMUA 3ZEPA 4JDIA 4FX3A 4XH6A 5AP3A 2XM9A 3HV6A 3V51A 2B0QA 4AT5A 3KK9A 3O23A 3F9NA 2JKKA 3KA0A 2YJRA 3BELA 2KULA 4OBQA 4FNXA 5HG7A 3WZJA 4ALWA 3FXZA 3ACKA 3RP9A 3VUMA 4GFMA 5G6VA 4BCPA 4D1ZA 5JFSA 3GEQA 2QI8A 3FMHA 3G33A 3KVWA 2C6DA 3UVRA 4MCVA 4A06A 3GC8A 4EC8A 4FKJA 1K9AA 3VRYA 3LFEA 4RMZA 4IX4A 2EUFB 3DK3A 1KV2A 1JQHA 2CMWA 4IIRA 4QMVA 4F9CA 4AZTA 2XBJA 1U5RA 2I1MA 4AFEA 4CMTA 4KABA 4D55A 2PE0A 5AR2A 4EORA 3AQVA 3LCTA 3PLSA 5HD7A 1ST0A 5IU2A 2QCSA 4NKSA 3AD4A 4NH1A 2C47A 4O0SA 4NYEA 4LOPA 3W8QA 1REJA 3BYOA 1B6CB 1J3HA 3I60A 3VS5A 5FXQA 3G6GA 1Q3WA 1QMZA 2DS1A 3QTQA 4D4RA 3NNVA 3VF9A 2PWLA 2Z60A 3C4WA 3I6WA 5LCJA 1J7LA 2A27A 4IWDA 5EM7A 4XG9A 5BV3A 3CTHA 4ZTNA 3CGFA 2EXCX 3MFTA 4NM0A 3R8LA 4C3FA 2VO3A 2FA2A 4FSZA 5A4LA 2G9XA 2PVMA 3NW6A 3QWJA 4GU9A 4Q5EA 4O6LA 2VWUA 5GJFA 1Q8TA 4AS0A 4HW7A 1W84A 3OWKA 4O0YA 3W0RA 2BUJA 5C8NA 1LR4A 4GK2A 3W2SA 5CAUA 4NW5A 4TT7A 4ORKA 5AAEA 3AD5A 2H9VA 1QL6A 1H26A 3PP1A 4P4CA 3I7BA 2XBAA 3AC3A 1OL1A 5HO6A 4AZSA 1REKA 2YIXA 3HMNA 3N9XA 4IB0A 4O1OA 2X0QA 3MA3A 4UB7A 5C4LA 1BYGA 4IAYA 2QO7A 5AV4A 1YXSA 5AEPA 4G17A 3UDBA 2VWVA 4M13A 2X2KA 3Q4TA 1DS5A 2HXQA 3TCPA 1HOWA 4QYYA 4F6SA 1FPUA 3CS9A 2BAQA 1OKYA 3E7OA 4OUCA 5IA5A 2PMNX 4YC8A 5AMNA 4BL1A 4RWJA 4CRLA 3RPOA 1YOJA 4EONA 4I6QA 5J9LA 4NIFA 3VUGA 4ZMEA 3MVHA 2X8DA 2YAKA 3KMWA 1M2PA 2P4IA 2X0GA 4JS8A 5ANKA 5GNKA 4EOKA 4Z7HA 1KUTA 3QXPA 1LPUA 3P9JA 2WQOA 4L67A 3HEGA 3HRBA 2R3FA 5CQUA 5KE0A 3UC3A 4E4LA 3ZO3A 3DJ5A 4M7IA 2WEIA 4FKUA 2UZDA 4RLKA 2HK5A 3QTRA 1ZWSA 4GS6A 3D94A 4EZ5A 3S4QA 4G34A 3V01A 2IF8A 4C4IA 5HU3A 3A8WA 3SXRA 1PXOA 4IH8A 3B2TA 3RAWA 3SRVA 4PV0A 3CQWA 3WI6A 4FG7A 1YVJA 4FRFA 4IMYA 4E26A 3MFSA 4X2JA 4CZUA 5E8VA 4C2WA 4MEDA 1PMVA 3QA0A 4FSWA 4TYJA 2XNGA 2BFYA 2XKDA 3R7GA 3EFKA 4FUXA 3S2PA 4FIFA 5CU2A 4OTFA 1WVWA 3GENA 4ANQA 4AAYA 4R78A 4ASDA 1KSWA 5HBHA 3H4JA 5A54A 4OLIA 1CDKA 4QNAA 3VHEA 5CF5A 4ZSLA 4I5HA 3GC0A 4EBVA 3ERKA 5TF9A 3HUCA 4FSRA 2SRCA 2O63A 5CANA 3QZFA 4DT9A 4D4SA 4FVRA 2QOCA 5FG8A 2R7BA 1Q97A 3O8UA 5J87A 1OPJA 4OR5A 3WARA 5DEWA 5CXZA 4E20A 4IQ6A 3DKOA 4R5YA 2JIUA 4PDOA 4NJDA 2WMQA 4Y95A 2ETMA 3VBVA 4Z3VA 4LDTA 4YJPA 4L44A 4DITA 4YJQA 3UC4A 5CT0A 2G1TA 5KMLA 1FINA 5KNJA 4C4EA 4DINA 3GXLA 5B2MA 1U46A 2YACA 4BZNA 5DFPA 3I0QA 3CTQA 3KULA 3QRUA 4C3RA 4DYMA 4DLIA 4G3CA 4E6AA 5HE1A 3NRMA 4LQMA 3AGLA 4N70A 3IQ7A 3TYKA 4XLIA 1MQ4A 3DJ6A 4F64A 5FQDC 2PMLX 4UWCA 3DFAA 5I9UA 1KOBA 2ZB1A 3WZDA 2NNWB 4IWOA 4KD1A 5DWRA 3ZZWA 3JY9A 4CMOA 4C8BA 4KIPA 2WXVA 4BTJA 5A3XA 2WQMA 3R9NA 3ANRA 4YP8A 1Q5KA 3ZLSA 3C4XA 2X9FA 1K2PA 4M69A 4YZNA 5IA1A 5IG1A 3HZTA 1ZYDA 2REIA 3DTWA 5IUHA 4Y5HA 3RTPA 3AOXA 3OT8A 3ORMA 3KXZA 4J1RA 3NIEA 4I5MA 2A1AB 1ZOEA 2O0UA 3ZDUA 1G8JA 3Q2JA 2IN6A 4FV3A 3VS1A 4DFZE 2QOIA 3VUDA 3ZHPC 3VUTA 3KRRA 4XS2A 5JZNA 3DAKA 1M7QA 4O7YA 4EL9A 2FSLX 3W0SA 3AD6A 2VTNA 3Q9YA 2BFXA 2WNTA 3RI1A 2GHMA 4K33A 1FBNA 2YM3A 3GU4A 3FZPA 4WOVA 4IAFA 3FV8A 5I5ZA 3VN9A 5E8ZA 1JNKA 2JLDA 4QTAA 3MFRA 3RAHA 5M4UA 3CKXA 4AT4A 3RNIA 3UOLA 1OIYA 5C8KA 3P7BA 4PRJA 5L8LA 2EB3A 4PTGA 1GOLA 4RGJA 5KZ0A 1XMMA 4J97A 1DAWA 4GT5A 2ITPA 3F2AA 4TWPA 3UG2A 3TZ8A 3DJ7A 1CTPE 4ZLYA 2CSNA 2XNEA 3GCSA 2X7FA 3PY0A 4O4CA 5AP6A 3PDTA 3CQUA 4FL3A 3DB6A 4L46A 2QHMA 5FBNC 4E4MA 4EQUA 4K11A 2C69A 4FSMA 4RFMA 4C38A 3VS2A 2YISA 3BQCA 2JKOA 1MP8A 5CVGA 4BBMA 4D2PA 3MDYA 3TTJA 3W2PA 4CGAA 4H3QA 5CQWA 1JKSA 4ZZOA 4KINA 3E8NA 4APPA 2QC6A 3R7VA 4EH4A 3TNQB 4EOIA 3LAUA 3NUNA 4F9YA 2QU5A 5AUTA 5BMSA 3G5DA 4O27B 3L8XA 1AGWA 1UWJA 3AT2A 4JG6A 4W8EA 3IK3A 5J7BA 3R0TA 3K3IA 4DGNA 2W1GA 5HNIX 4YBJA 3EZRA 3D2KA 4E8AA 3UDZA 2WMVA 5IQIA 4J95A 4IB3A 3GOKA 3VO3A 5BNJA 4QDEA 3TNHA 4WG5A 3O8TA 4MXYA 1PXPA 2JIVA 1OL7A 4I3ZA 5D12A 1PXKA 5L2TA 3DY7A 4YLJA 1WVYA 2XNBA 3A2CA 4RA4A 3I4BA 4BFMA 2OICA 2XK3A 3FLWA 4WUAA 4FTOA 3DLZA 4D4VA 3DV3A 5A6NA 3W2QA 4N4SA 2E9UA 3GFEA 3GGFA 1OBGA 3HKOA 1HCKA 2OG8A 4FKLA 4AA5A 2GQGA 4EK3A 4IJ9A 2QKRA 3T3UA 2VTOA 2RFNA 4O81A 3PLAE 4GK3A 4BGGA 3R30A 5HG8A 3V3VA 4YTCA 3EJ1A 5AR5A 3QCYA 2WAJA 4FTLA 3HL7A 3R28A 4U0IA 3TJCA 1ZYCA 2OZAB 2YHVA 3R01A 5D1JA 3WF6A 3RMFA 5GIPE 3N51A 3C50A 3PFQA 3MVJA 4Z7GA 4JBQA 4QO9A 4UZHA 4MWHA 4K0YA 4TN6A 3DBFA 4NFNA 4Y8DA 4I24A 4OAUC 1PW2A 3Q9WA 3E8CA 4PP7A 2ITOA 3DBDA 2IVSA 3W0OA 3GI3A 4CT2A 3ENMA 3UIXA 3GU6A 4PPAA 5E8UA 4EOJA 3WZKA 4G3FA 1TQPA 5K5XA 5F94A 4MWIA 1CSNA 4DH5A 3ITZA 2OF2A 3C0GA 3NFGB 2VAGA 4N57A 3TV7A 4DFLA 2H96A 1WFCA 2JFMA 4RC3A 4DCEA 5IQAA 1NVSA 3ZLXA 2YCFA 2W1DA 5ANOA 2CN5A 2G2FA 2XF0A 3FMMA 3WF5A 3LFNA 3V6SA 4V0GB 3FE3A 4KB8A 2RFDA 3FXWA 5CSVA 3PTGA 3UQGA 2OIBA 5ACBC 4RX5A 3PA4A 4X6QC 3Q9ZA 3QC4A 2Y0AA 2J0JA 5CI6A 1O9UA 4ZSGA 3WZEA 3QD3A 4M15A 4G31A 3JXWA 4AF3A 3CQEA 1OGUA 2CCHA 2YLEA 3BBWA 3KC3A 3FY2A 3QGWA 1U54B 4FTQA 3EQFA 3EIDA 4GVJA 4JBOA 4KNBA 4KRDA 4WT6A 3F2NA 4N0SA 4BCJA 4OTGA 2C68A 3FLNC 3Q60A 3Q5ZA 3QTXA 3MTLA 3NEWA 4X2KA 1XH7A 3PYYA 2JBOA 4GFGA 1H28A 4NM3A 5I0BA 3HUBA 2C4GA 4JBVA 3ZTXA 4ERKA 4KS7A 4FTUA 2WHBA 4PMPA 4YHFA 3W33A 2XANA 4DTBA 2XJ1A 1NVQA 3TN8A 2O2UA 5JN2A 2IZUA 4FC0A 4L45A 2G01A 5CSHA 3PE1A 3HVCA 3UIUA 4M0YA 2BR1A 1P4FA 4GU6A 3LM0A 3EQDA 3UOHA 2WD1A 2FSTX 4RRVA 1ND4A 3OW3A 4FKGA 4I6BA 3I7CA 2WTDA 3QX4A 3U4UA 4R1YA 5K3YA 3ACJA 3OROA 3FQSA 5JGDA 3P1AA 4O86A 1H01A 1Q4LA 3COIA 3VS0A 3BLAA 4YBKA 2C6TA 4QD6A 4AQCA 4RVLA 4F0GA 3ORZA 1YXUA 5FEQA 4TNBA 4RPVA 3D4QA 1H1QA 4EHEA 3C9WA 4DEGA 4UMRA 4BYJA 3I81A 5KKRC 5EI2A 3RINA 1M2QA 3BYSA 3ORTA 4DFUA 3VQUA 3Q04A 3VF8A 4CV8A 1JSTA 4DG2E 4YURA 4RX8A 3RKBA 5C8MA 4U3ZA 3NLBA 2Y4IC 2QOOA 4QP7A 4BDFA 2Z7QA 4FK3A 3VBXA 4BF2A 3GCUA 5DG5A 1M7NA 3MGYA 2UVYA 4I6LA 1W7HA 3OUKA 3CEKA 2R2PA 4MNEB 1JPAA 2AC3A 2ITZA 2UZNA 2X9EA 3THBA 1OIUA 2QONA 2Z7SA 3PSDA 5HOAA 4RQKA 4EZ7A 4WSQA 3RBWA 2B52A 3F3TA 5EG3A 3RNYA 4V04A 5CU6A 4TYGA 5AP4A 3UO5A 2Z8CA 1PY5A 2J90A 3D7TB 4IVAA 4NM5A 3UBDA 3PJ1A 3OY1A 3JUHA 3AKKA 4FV1A 3CLYA 5J9YA 4C36A 2BRBA 4MXOA 2VTIA 4R3CA 4YC3A 5HO8A 2IWIA 1ST4A 4O0VA 4L00A 1ZYLA 2R64A 2UZTA 5I9WA 4F09A 4DFXE 3R7EA 3FI8A 3AT3A 5EKOA 4CCUA 3PPZA 3PVUA 4HYUA 3QHRA 4TW9A 4ZY5A 4CKJA 4DEHA 3EN5A 4YR8A 2YA9A 4QMOA 3A61A 4IB5A 4XOYA 4ANNA 5JGBA 3UZTA 3FKNA 3MI9A 4J7BA 2YM5A 3O50A 3Q4ZA 5CNNA 1W0XC 4X7QA 3NGAA 1OECA 3F7WA 4D5HA 2AYPA 3P4KA 4ACGA 2WELA 2ZV9A 2XP2A 3TV4A 1Y57A 3BKBA 4CQEA 4I23A 4I4EA 4DEEA 1XBCA 2CPKE 3FUPA 5CASA 2QQ7A 3A7JA 3UNJA 5EM8A 1R78A 4IHPA 5JRQA 4HYSA 3G15A 4ZS0A 3DPKA 3QHWA 3DCVA 3NYOA 5EW3A 3L1SA 1BI7A 4YSMA 4HGLA 4QPMA 4BC6A 4EK6A 5BUIA 3BZ3A 3BLQA 3NZ0A 4HCVA 3W8LA 5EW9A 4O2ZA 4YZDA 4MXAA 5AADA 3BL9A 1YQJA 3OF0A 4FTNA 3LMIA 5KHWA 2BHHA 5FRIA 1Q24A 1ZOGA 4IBMA 2BHEA 3ATTA 2QOLA 4FKRA 5FLFA 5HTCA 3ET7A 5BMMA 3OTVA 1ZXEA 3M11A 3RZBA 4QTDA 4AGWA 4FIGA 3Q6WA 3EYHA 2JDSA 3DLSA 4G3DA 2WOUA 5M55A 3VVHA 3VS6A 2OW3A 3FL4A 5TR6A 1PJKA 4IB1A 4IVBA 3OOGA 2C30A 3R7YA 3O7LD 5ANDA 4HCTA 4P5ZA 4A9SA 4QNYA 1WBSA 3QCSA 4U81A