3H9RA

Crystal structure of the kinase domain of type i activin receptor (acvr1) in complex with fkbp12 and dorsomorphin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
328
structure length
312
Chain Sequence
TTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/protein kinase
molecule keywords Activin receptor type-1
publication title Structure of the Bone Morphogenetic Protein Receptor ALK2 and Implications for Fibrodysplasia Ossificans Progressiva.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 312
sequence length 328
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
A PF08515 TGF_beta_GS Transforming growth factor beta type I GS-motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3h9rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3h9rA01
1OBGA 1JLUE 3BHVA 4EUTA 2IVSA 5AP4A 3IW6A 5E8XA 4CFMA 5I9XA 4NUSA 5EI2A 1WCCA 1WFCA 3NUPA 3VUIA 3EQBA 2G01A 2B9FA 4BTMA 4EH7A 2A4LA 5K9IA 3K2LA 4IANA 4RG0A 5M4IA 2ZAZA 1W84A 2YDJA 5KMJA 4E6DA 4ACMA 1DAYA 1NA7A 3QRKA 2BILB 4DG3E 4MNEA 4J1RA 4O6EA 5EW9A 4BL1A 1SYKA 5AP3A 4BDFA 3VS4A 5FP6A 3BWFA 5DIAA 5AM6A 4IFGA 1M2PA 4HVGA 1J7LA 1GIHA 3G6GA 4V04A 1OL7A 4F9BA 3P5KA 4M14A 1UNLA 1AGWA 3S0OA 1DM2A 5CXZA 2BUJA 2QOQA 3BYVA 3FC2A 4L6QA 4ZSEA 5HU3A 5LMAA 5F95A 2QO2A 4XV2A 4QNAA 2JBOA 4MXYA 3VO3A 2XM8A 5K5XA 4F63A 4BFMA 3VJNA 3ERKA 3SHEA 2H6DA 4ZZMA 3KXGA 4FV8A 3TUCA 4LMNA 4YZ9A 5EM8A 4ZY5A 5D12A 4H1JA 5F9EA 4FI1A 4O7VA 3Q9ZA 1PMVA 3SW4A 2BMCA 3NDMA 2WQOA 4IZYA 2XKFA 2EVAA 4CQGA 3UVRA 2E9OA 4FIHA 1LPUA 3DK7A 2AC5A 2CGWA 2WD1A 3OUKA 3V3VA 4D28A 4WA9A 4W4WA 2WMUA 1NXKA 1YXUA 5JZNA 2IWIA 4O0YA 4NW6A 3TCPA 3QA8A 4YR8A 4OBOA 3ZMMA 2QO7A 2QD9A 4RC2A 3D7TB 4MX9A 2XYUA 4C8BA 4IB3A 2G9XA 4FSRA 3SXSA 5CAQA 3F82A 4O91A 4AN3A 4BDHA 4D5KA 2X2KA 2RFSA 3NYVA 3OP5A 4LM5A 4P5ZA 3MH3A 2XRWA 4XLVA 5JRSA 2YIQA 1A48A 3DZOA 3CTJA 4I4EA 5EK7A 4DCEA 3F2RA 2W1CA 3LXKA 4FGBA 4GT5A 5M51A 5IA2A 1IASA 1U46A 3FMDA 3FPMA 3WZEA 2XIXA 4IB0A 5CEIA 4F70A 2V7OA 3NVKI 1OECA 3A7HA 4IZ5A 4ZEGA 3RPOA 3BRBA 3TXOA 1GIIA 3LZBA 3TDVA 3FJQE 2NP8A 4ZZOA 5AIKA 3FI4A 3PIZA 4FV5A 4BY9E 4I1ZA 4CG9A 4E1ZA 2GU8A 2UW5A 2JDTA 4FT9A 2JFLA 4V0GB 4TTHB 2CPKE 2OLCA 2XMYA 4H58A 5F4NA 4ONAA 5HO6A 3BI6A 2QLQA 5GZAA 3TNPC 4AW1A 3FE3A 3ANRA 4FUYA 4O6LA 3OFMA 1O6YA 3WZUA 2R2PA 2X7OA 5JSMA 4UMTA 4L44A 4L43A 5C1QB 3S1HA 4YU2A 5AP6A 4AFJA 5IQGA 5FXQA 4FTUA 5CNNA 3EB0A 2J50A 3R83A 4F1OA 4FIJA 1XWSA 3KRRA 4NM0A 3TKIA 3ATSA 3QU0A 4ZP5A 2Y9QA 3OWLA 4MWIA 3PP0A 4XP0A 5FBNC 5FWKK 3OD6X 5DI1A 1KE8A 2I40A 3EL7A 3HEGA 3L9LA 5AADA 3PRFA 1OL1A 5AAGA 3QD2B 4RPVA 5TOZA 1PXMA 4I4FA 3UZTA 3HA8A 4HOKA 3QTSA 4HPTE 1OPJA 3QXPA 4BCHA 4TNBA 4DT8A 1M52A 1VYWA 2UZTA 3DBDA 5C9CA 3COMA 4JL9A 5EKOA 2YWPA 4DN5A 4W9WA 4BBEA 4GT4A 4C34A 3HAMA 3BYSA 1PKDA 3OXZA 2X2LA 3PVUA 3U51A 2J5EA 3E8CA 3W1FA 5I9WA 3VBTA 3IPHA 4FZ7A 4GVAA 1UNHA 1MRVA 2HW6A 4QMWA 4F64A 3A7JA 3D2KA 4NKSA 4O1PA 1H1PA 1PXKA 4EOKA 2R3JA 4AN2A 4IJPA 3A60A 2H34A 3I81A 4PV0A 4M0ZA 2EXEA 3TIZA 4L68A 4A9UA 3C4FA 1QCFA 3ZSIA 1YQJA 4P90A 3KRXA 2I0YA 4FOCA 4YBJA 4O7RA 3U54A 5K3YA 3RAHA 3MH0A 4F9CA 2HZ0A 4L00A 4O7ZA 5CEQA 3QF9A 2B54A 3V04A 2QOLA 2BDJA 2YM6A 2GFSA 3BIZA 4WG5A 3E62A 4JOAA 4Y95A 3WIKA 1B39A 2JKQA 4M68A 4D1XA 5I5ZA 3KXHA 3DNDA 1KUTA 5L2IA 3LQ5A 2O0UA 5FP5A 1HOWA 3AMBA 4C3PA 3KF4A 4CMOA 4H3QA 3BHYA 4J95A 4LRJA 5A4CA 3S95A 4WUNA 2BROA 4E4MA 4DFNA 4DAWA 1P5EA 3PG3A 4CFVA 1ZYJA 4DEHA 4FIIA 1RE8A 4C57A 2EXMA 4MCVA 5B2KA 4DC2A 2GS6A 4YJUA 3QC4A 3VS1A 5CF4A 3PVGA 4XG9A 2C1BA 3LFEA 3F2AA 2HY0A 3QKMA 2OZAA 4DA5A 4L53A 4BI0A 3W32A 4AX8A 2ETKA 4HCVA 4JQEA 5KHWA 4GIIA 4W4YA 4EL9A 1Q61A 2OI4X 4MBJA 3CGFA 3D5WA 3BU3A 3LXNA 4KS8A 4BIDA 1HCKA 5L8JA 4IX6A 2QU6A 4OT6A 3V6SA 4O81A 4WBBB 5FEEA 3ZM9A 3BELA 4F0FA 3MY0A 4BCNA 3FZRA 5KBRA 3MIYA 5ACBC 3ZRLA 2AYPA 5L8KA 1Z57A 3AOXA 5HBHA 1CM8A 3FMJA 3K54A 3I5NA 2WMAA 2OK1A 2XNGA 4S34A 1OI9A 3KK8A 1FVRA 3R1NA 3R7GA 4C4FA 4O1OA 4O2PA 3TWJA 3EHAA 4YZNA 4H36A 4W8EA 4D2SA 3CCNA 4EH5A 3GCPA 5A6OA 1LEWA 4QYYA 3NW7A 3R63A 2XRUA 2QQ7A 4H3PA 2J51A 2XK4A 4TT7A 3VHEA 3OBGA 1NVQA 4LGDA 4IDVA 4XV1A 5IDPA 4ITIA 3FXZA 3W2QA 3ZLYA 2I0HA 4QRCA 4C7TA 2YM3A 5C8KA 3F3TA 3O8TA 1JPAA 2ZDUA 3GC0A 3OWKA 5IF1A 2W05A 2YM7A 3GCUA 3MTLA 4ZSJA 4QOXA 3BQRA 5HD4A 4RX7A 1Y6BA 3FUPA 3PZEA 5DOSA 4FTKA 3CKXA 5M57A 4OTWA 3UNKA 5AP5A 1PXPA 2DS1A 2PL0A 4RFZA 4QMXA 4DEEA 4TWPA 4BCPA 2UUEA 3IGGA 2LAVA 5ANOA 5E1SA 3CS9A 3POOA 2QHMA 2C6KA 2RKUA 4W9XA 4C61A 2PZIA 3RK7A 4FTIA 3R7UA 2VO7A 3ZFXA 2V22A 2YCRA 3KVWA 2Z7RA 4QYFA 5AR7A 4E20A 5JFSA 1XH6A 3D14A 4OBQA 3ZS5A 2YLEA 5F20A 2UZLA 4FVRA 4G16A 2XK6A 3VC4A 4U44A 2DUVA 4DGNA 3QZIA 4YGAA 3UG1A 1WBOA 3MBLA 4LGHA 2WIHA 5CI7A 3C5IA 1AQ1A 2C6MA 3IDBA 3L8VA 4ANNA 1JKSA 2P55A 4JG6A 2X39A 4E5WA 1L8TA 3MESA 3UVQA 4BWPA 4J53A 4FT7A 2C30A 5KMKA 4AU8A 3WILA 4RJ7A 1KE9A 3V5JA 2R3RA 3PY1A 2OZOA 1PMEA 2XEYA 3C4EA 3LCTA 4HPUE 5ETCA 2WO6A 3IW5A 3UTOA 3R9DA 4XUFA 2FO0A 3EFJA 3GCVA 5BVEA 3ZFMA 5TE0A 5TF9A 4RLKA 3JY9A 4L01A 4R6VA 2BFXA 3EOCA 3HV4A 4Q2AA 2C3KA 1ZOEA 4X7QA 3FMNA 3FMKA 5JQ8A 4Y8DA 5K4JA 2C5XA 2ZB1A 3PXYA 3ZUUA 4DGOA 4KINA 2R0UA 1F5QA 2BTSA 4L67A 5EOLA 3A4OX 4RJ6A 5AV2A 4J97A 2OF4A 3RAWA 3VWAA 2XM9A 5BPYA 4U43A 4BDIA 4IWOA 2YLFA 3OS3A 3A7IA 4C37A 4TYHB 2PUIA 4EKLA 1KOBA 3CQUA 2NPQA 2Y7JA 4W4VA 5AUXA 3VRYA 4YSJA 2CKQA 3FDNA 4IIRA 4FTCA 3V51A 4PDYA 1JAMA 4GW8A 3SD0A 3II5A 3KN6A 2V62A 3VULA 2HOGA 1XH4A 3B8QA 4NM3A 3WF9A 4U79A 3GU5A 2BRBA 4O7LA 5AV0A 2ITQA 4A07A 2PPQA 2BKKA 3L8XA 4N6ZA 4ENYA 2Z8CA 4C2VA 3MVMA 3QYZA 1XQZA 3FQEA 5DRDA 5J9LA 3KB7A 3U9NA 1LP4A 2GS7A 3ZO4A 5DR9A 1H1RA 2C68A 4U40A 3RNIA 4O0UA 3ZZEA 4CGAA 4PDPA 5HX8A 2O65A 2RG5A 3GEQA 3F3WA 5AP2A 4YTIA 2WEIA 1RW8A 3LM5A 3TN8A 2PY3A 3EZVA 3UQCA 3N4TA 4W8DA 3QRUA 4JAIA 5GINE 3A61A 2X9FA 4OBPA 4PP9A 5D7VA 5FTOA 4AN9A 4L46A 4N57A 4TYHA 4A9YA 3ZSGA 1P14A 4EQCA 3CXWA 3OWPA 2WQNA 3UIMA 3HV7A 4HYHA 3TDWA 2UW7A 4FODA 4M69B 3RI1A 5EM6A 4WIHA 5EM5A 2GNLA 2VWXA 3Q32A 2G15A 4FTMA 4NEUA 4FV7A 2WTCA 3MY5A 4YC8A 5FM2A 4EOIA 4D4RA 1ZRZA 4FNZA 4GYIA 5CT0A 4Z16A 3R8LA 3QQKA 4LGGA 3MFRA 2VD5A 3MS9A 1S9JA 1WVYA 5AJQA 3RCJA 5HTCA 3OY1A 1H07A 4FEXA 4TYIA 4PQNA 5KMLA 3VS3A 3CD3A 3OTUA 4X3JA 3I60A 4GSBA 3BV2A 1AD5A 3FI8A 4ZJIA 2W06A 5LWMA 4FC0A 2ZV8A 4ZMEA 3CBLA 4HNIA 3W10A 1WBWA 2PE0A 5HTIA 4E8AA 3GB2A 3IONA 4ITJA 4F65A 3GXLA 4MQ1A 1REJA 3VBVA 3NS9A 4KKEA 4C59A 4CTCA 5A14A 5BVDA 2XNMA 4HVIA 3ANQA 5AX9A 4M12A 1Q41A 2AC3A 2BRHA 2OG8A 4I6BA 4TKSA 4IVCA 3SKCA 4ALUA 5L4QA 3B2WA 2J7TA 4GS6A 5I3OA 2UZBA 3Q04A 4C4IA 3SOCA 1YOMA 4PDOA 3F9NA 4FYNA 1UWHA 3OZ6A 4FA2A 5HZNA 3PE2A 4EOOA 5F94A 4AA0A 2QOKA 3DPKA 3ZCLA 3F2NA 2CNQA 3SGCA 3MPAA 4QMNA 4O27B 2PE2A 5K0KA 3QWJA 4BIBA 2GNIA 4RX5A 1XBAA 2IZTA 4FNWA 3ORMA 3F61A 3SRVB 5HG8A 2HIWA 3CE3A 4FV3A 4O7TA 4B8MA 4KB8A 3LQ8A 1NVRA 1YWNA 3HMMA 4Y83A 2RFNA 3W2SA 4FTAA 4ZTRA 2ITVA 3M1SA 1CDKA 2HZ4A 4KWPA 2R3GA 1JSUA 1OKZA 3DFCB 4O2ZA 1PJKA 4ACCA 4ZLOA 5IPJA 5G1XA 2W1HA 3NZ0A 4EJ7A 3BCEA 4RIXA 4S2ZA 5DGZA 3WIGA 5KKRC 4ZTSA 3UOLA 2OJFE 3PXZA 3NSZA 4A7CA 3WE8A 5LMKC 2ITPA 1SVGA 1G8AA 4AT3A 4B99A 3VJOA 4RMZA 1APME 3IECA 3LMIA 3DB8A 3ORIA 4TNDA 3DKOA 4FSWA 4ANMA 3H3CA 4PMSA 4IQ6A 4GJ3A 1JWHA 5TO8A 3A8WA 3L8PA 5AV4A 5JGBA 3NUSA 3O2MA 2OFUA 3H9FA 4S30A 5GIOE 5CLPA 3VS6A 1M7QA 1OZ1A 2FUMA 2UZUE 3N4VA 1YXVA 5A4QA 3KXNA 5FGKA 4UMPA 2PWLA 5FEQA 1GOLA 4IBMA 1XH9A 2XZSA 3ZRMA 2F57A 5HLPA 5CSWA 3VUGA 4HVSA 4U5JA 3BYUA 4FGRA 4ZS0A 2JDVA 2YIWA 3ENHA 3OCTA 5IQCA 4LFIA 3ZEPA 4M13A 4IM2A 4AA4A 1IAJA 3R7YA 4QTDA 5AP0A 4HNFA 4IEBA 4ZTQA 2BRNA 4XBRA 2Q0NA 5BYLA 4GG7A 4BKYA 4XLIA 4GIHA 2QNJA 2PZ5A 4MNFA 5CI6A 4BGHA 3BZ3A 2BZIB 1E9HA 3MGYA 4EK4A 1Y8YA 4YBKA 4I6FA 3VUDA 3EQCA 4WNOA 3MA6A 4B9DA 1FQ1B 4IWPA 2ONLA 5DFPA 4B7TA 2J6MA 4FTQA 4R5YA 5HBEA 5E8SA 2R3KA 5I9YA 3B2TA 5I9ZA 3F7WA 4RWIA 1TVOA 1YDSE 3F7ZA 1SNXA 3DK6A 3PA4A 4RC4A 1R0PA 5AUWA 3E93A 4HVHA 3P9JA 5L2QA 1IG1A 4WT6A 1JKLA 3AC5A 4I0RA 4QMTA 3LCOA 5ACKA 5FUTA 3QD3A 4U0IA 3MVLA 4A9TA 2ETMA 3UPZA 3QKLA 3LOKA 4UWCA 1QPJA 4CV9A 3MY1A 4YZCA 4YHTA 3UPXA 3ZC6A 4TPTA 2BZJA 2WTKB 3OEFX 5EYKA 5IQFA 3FPQA 2F2UA 1IA8A 5ETAA 2XA4A 4FT0A 5DT4A 4ZTNA 4FKOA 5LQFA 5IH5A 2XK3A 4V05A 3W8LA 3LAUA 3DBEA 2VAGA 1Z9XA 4PDSA 3WYYA 4BCGA 1KOAA 2J0JA 4NM7A 3PUPA 1W83A 3FLSA 4BWKA 4AT4A 4AQCA 2WU7A 4FBXA 3L9MA 5IDNA 5CVGA 2W1GA 1GZNA 3VS5A 5IA0A 1OL6A 1Q3WA 2VX0A 3FLZA 4FIFA 4I5HA 4K6ZA 5DYJA 3GGFA 4KBKA 4L3PA 1K2PA 2WMSA 4RQKA 4EK3A 2R3IA 5EQEA 1NW1A 3MPTA 4FK6A 4ASXA 2YA9A 5A46A 3UMWA 5C4KA 4GK2A 2ZVAA 3JVSA 5EW3A 3O17A 5CF6A 3PDTA 2VU3A 2XNPA 3CEKA 3PVBA 5AR4A 4DITA 1WBSA 2ZMCA 3TKHA 1TQIA 2IZRA 3MVHA 1DAWA 3CY3A 2E9UA 4D55A 4JDHA 4EHVA 4I22A 4G6NA 1ZMVA 3LFAA 5EYCA 3U87A 4AUAA 5J1VA 3FZPA 3EN4A 5J9YA 4YJPA 3ID6C 5EDQA 1BX6A 4D4YA 4TY1A 1ZYDA 2X6DA 3WZJA 4W4XA 1H1WA 3F3UA 2WTIA 1B6CB 3DT1A 5DA3A 5B2MA 2VO3A 4GFOA 4RIWA 5C8MA 1GAGA 3ZDIA 2C5NA 2CGXA 3HUBA 4G3GA 2YN8A 5DRBA 3VW6A 3U4UA 4AGUA 1IEPA 3QCYA 5KMMA 1MRYA 4NJ3A 3R7OA 1V0OA 2GNJA 3OCGA 2UW9A 3QLGA 3QTXA 3PJCA 3OF0A 4UN0C 4MNEB 1VJYA 3JPVA 3RINA 4F6UA 3RCDA 1VR2A 3NYOA 1OIUA 4BB4A 2FSLX 3T9TA 3RAIA 4LL5A 3ZSHA 3OC1A 4FSMA 5EDRA 1ZMUA 2JITA 4JG8A 4UXLA 2R3HA 4KIPA 3ALOA 2R3MA 3IDCA 2C6OA 4RJ8A 2C5VA 4EOJA 4F7NA 4HYSA 4U3ZA 1RJBA 4ACHA 3TV6A 4JRNA 4KIKA 4QP2A 5H2UA 3KL8A 2ESMA 2J2IB 1JKTA 1KV2A 4H1MA 2EXCX 5H8EA 3R8ZA 5B2LA 3K3IA 4QP1A 2QOOA 1SMHA 2GHMA 1E1VA 3AD4A 3H9OA 4RVKA 2X4ZA 1ATPE 5HX6A 3BU5A 5TKDA 2AUHA 4GV1A 4S31A 1YDTE 5AA9A 4PNKA 4YLJA 2HXLA 4UX9A 1Q8WA 2CN8A 2ERZE 3I7BA 3FHRA 4UB7A 4LRKA 2VWWA 3DBQA 5EI8A 4PNIA 5HGIA 3NIEA 5AAEA 3U55A 4DGMA 5KO1A 1O6KA 4FKRA 5CU3A 5LXMA 2O64A 3RPSA 3DS6A 3MIAA 3ZHPC 5CENA 3TM0A 2OFVA 2PMLX 5DR6A 2W0JA 3QTIA 4E6QA 3P7CA 5T68A 4FV1A 3GOPA 2W9ZB 2PVLA 5FG8A 2WFYA 2QOIA 4FIEA 3HV3A 3DKFA 2HK5A 4EH6A 3BX5A 1M14A 3BPRA 3MYGA 4HCTA 1FVVA 3TIYA 3Q4ZA 3DK3A 3P0MA 3BBTB 3NRMA 4FNXA 5ANGA 2E9PA 1IR3A 4IW0A 4APPA 1STCE 1J7UA 2BAQA 2C4GA 3ODYX 4PMTA 3U6JA 4APCA 4GUBA 4K1BA 4MXXA 2JIVA 3Q5ZA 3LFBA 4K2RA 4M3QA 4F7LA 3FSKA 4IAIA 4YNOA 3UO4A 5HTBA 4OTPA 4OTDA 5EHYA 2PE1A 3ZYAA 3W2RA 4GK3A 5EQYA 3OT8A 4EH9A 2ZM1A 3QQUA 3UJGA 1ZZLA 2ITWA 5HG9A 3MA3A 5L6PA 3B8RA 2VGPA 4RJ4A 4YLLA 3TNIA 3WZDA 3QCSA 4O7WA 4N6YA 1LUFA 4Q5HA 4X6QC 2PUNA 4YTHA 3SOAA 4YURA 4FKIA 3E8NA 5AIRA 3QC9A 4G6LA 3U4WA 1DS5A 3ALNA 4QMZA 3VBWA 4ANSA 4MHAA 4ERWA 4KUJA 1PXJA 2J0MB 4KIOA 1U54A 2C6DA 2KULA 5JK3A 4JDIA 4QMLA 1QPCA 1QPDA 2ITTA 3ZC5A 4EORA 3NUAA 2Y6OA 2Z7LA 4C3RA 3IOKA 3UC4A 1WVWA 2OJIA 2VWIA 3SXFA 5BVNA 2F4JA 3FZ1A 4TWOA 5IA4A 4L42A 3F5XA 4IX5A 1WAKA 5BYZA 3MPMA 2QVSE 4GK4A 4JXFA 4UV0A 1ZXEA 5E8ZA 4DYMA 4DEIA 5K5NA 3G33A 4KSPA 3P23A 1PY5A 2QKWB 4ALWA 5BUJA 4EH2A 3HMIA 4CLIA 3HAVA 4PPAA 4CLJA 4G5PA 3QZFA 1SNUA 3IDPA 4NKAA 4EOMA 4J99A 4FKJA 4OTIA 5JMSA 4RJ5A 4PL4A 4FVQA 4J8MA 2UW3A 1OKYA 4MD8E 3N9XA 4LUEA 2VO0A 3CPBA 4PY1A 1BMKA 3BHTA 3PFQA 3WE4A 3NNVA 5HLNA 4WD5A 4EK8A 4KRCA 3CPCA 3R8VA 2VTMA 5E91A 3OMVA 5DR2A 3Q2JA 1M2RA 3ACJA 3MH2A 4MBLA 4QMYA 1V0BA 2VTPA 4G34A 4N70A 5DBXA 5DWRA 3C0HA 3OUNB 3R9OA 2A1AB 4DBNA 4F09A 3BHUA 4X3FA 4FKTA 3KULA 5CZHA 2W4KA 3F5GA 3NX8A 2UVXA 3V8SA 4QP3A 2XNBA 4DF3A 1QPEA 3DQXA 1P4FA 3DDQA 4WHZA 3QX4A 2W96B 4BCIA 4IVDA 5FXSA 2QI8A 2WU6A 4TYEA 3LE6A 4X6RA 2BCJA 3NW6A 3IS5A 3BHHA 1O6LA 2IG7A 2WQBA 4PL3A 1PHKA 3ET7A 3GENA 5GNKA 4QP4A 4TN6A 2OJ9A 4CFWA 4QYGA 4NTSA 4WG4A 5HQ0A 3WOWA 2C0IA 1G5SA 3BQCA 4AW0A 2GMXA 2QOCA 3BBWA 5DE2A 4HW7A 3G15A 4EK5A 4FTNA 2VGOA 1GNGA 1I44A 1FMKA 5A6NA 4MTAA 1W82A 2BRMA 5D9HA 3I6UA 5CEMA 3E87A 2YISA 3KVXA 1JOWB 3QTUA 4IJ9A 3R01A 4U9AA 5CQWA 4NL0A 3FMLA 2R3LA 2OH4A 3AC2A 4UMRA 5DHJA 5J7BA 2OZAB 4FG7A 1ND4A 2BKZA 2VTQA 1OUKA 1M17A 2C6LA 3O7LD 5C03A 4BYJA 4IB1A 1KE6A 2CLXA 3TV4A 1UKIA 4D9UA 5IH6A 2PTKA 1R1WA 2BZHB 3OHTA 4JAJA 4PMPA 3ELJA 1W98A 3PIXA 3RALA 5AP1A 3RVGA 1NY3A 2YM8A 4S32A 4H39A 4RIOA 5JKGA 4EOLA 5AUUA 5M4FA 5CALA 2RSVA 3VNTA 4CYIA 3FZTA 5HG7A 1KSWA 4MD7E 3NMUF 4A4LA 2EWAA 3QQGA 3KKVA 4I3ZA 4FV2A 3N51A 4R5SA 3UOHA 4PUZA 2PVFA 3PJ8A 5FDXA 2QHNA 5GJGA 4D1ZA 4KBAA 4XG6A 4XV3A 1Y91A 1IAHA 3UMXA 4J7BA 2Y4IB 1ZYLA 3FMEA 3F5UA 4BDGA 5LVLA 5T3QA 2NRUA 2FYSA 5ETIA 3PXRA 3QQJA 2OU7A 2SRCA 4NIFA 3OWJA 4GFMA 3RAKA 2BAKA 1URCA 3I79A 4DFYA 4F9YA 4CVAA 4CFUA 4E26A 3DXPA 2REIA 3COKA 4ZTMA 5IUGA 2WQEA 3DB6A 2IO6A 3ORZA 2GPHA 2ZDTA 4HGEA 3RK9A 4JQ7A 4JBPA 4QO9A 4XHKB 4TYJA 4CT1A 4MEDA 2IN6A 4AZEA 4D2TA 3CD8A 5E1EA 5CANA 3PPZA 3G2FA 3R8PA 1PXNA 2PVRA 3FY0A 4O7SA 3A4PA 3TTJA 4FEWA 4R7BA 5IQAA 3QRJA 3WF6A 1PXLA 4O7NA 3WYXA 3VAPA 3KRLA 3V8WA 4CTBA 3W18A 1J1BA 3OY3A 4BDKA 4ZJVA 4FSTA 2UZNA 4QMUA 2JKKA 4BTKA 4NW5A 2NO3A 3NNXA 5ANIA 3UGCA 3VUTA 4CCUA 5KCVA 3FYKX 2F7ZE 4KABA 3T3VA 1T46A 3DBFA 3ZDUA 3PA5A 4EZ5A 1MP8A 3ENMA 4NCTA 3W2PA 3E8DA 4L7SA 5CU0A 3HV6A 2CN5A 2CNUA 5A54A 3BLQA 3T3UA 5D41A 3TACA 4OT5A 3OTVA 4DTKA 4I20A 5CX9A 2WTVA 2R7BA 4BBFA 4HYIA 3V5WA 5EYMA 3LFQA 1XO2B 1U5QA 1H27A 2Y4IC 4DFUA 3NUUA 2BHEA 2WMTA 4JR3A 3EZRA 4USDA 4OTRA 4GFGA 3C50A 3RWQA 2W1IA 3RWPA 1X8BA 1YXTA 1UNGA 3LCDA 3W8QA 4Z9LA 4D4SA 2YITA 3M2WA 4QP6A 3FZOA 1PF8A 2OSCA 5AUTA 4FG8A 4QQCA 3OT3A 4FTTA 5EDPA 4ZSAA 3UO6A 1PYXA 2OIBA 5HO7A 4L52A 3OW4A 2XP2A 2NNWB 4BCMA 4QMMA 4UMUA 4JX7A 3QQLA 1WZYA 4X2GA 1R3CA 4FTOA 3UNZA 2FA2A 5CEOA 1L3RE 3TZ8A 3HMOA 2X8DA 4CMTA 2VTOA 4ZY6A 2JDOA 5E92A 5LCKA 5CS6A 5LCJA 4JQ8A 1OIYA 2OICA 3DKGA 3FAAA 3DLSA 4IM0A 4RSSA 3DTWA 4HZRA 2V0DA 1Q4LA 3FWQA 4YC6A 5HE3A 5BMMA 3MTFA 2V7AA 4NTTA 3V5QA 3PY3A 1U4DA 3Q52A 5ANKA 5EI6A 2B9HA 5GZ9A 2XK7A 5EHOA 3H4JA 4RFYA 3KA0A 2IW8A 2IPXA 5AR3A 2PHKA 4JX3A 3DLZA 5BMSA 4RZWA 2R3OA 4XV9A 4ZLYA 1E1XA 5LARA 1J7IA 4HGSA 2X4FA 1A9UA 4G5JA 3RZBA 4CT2A 4D0WA 4GJ2A 2YM5A 4MQ2A 2BDWA 4LUDA 4NYEA 3LHJA 2C3IB 2IW6A 1NVSA 2RF9A 2VWBA 4XX9A 5HBJA 3QA0A 3P4KA 1H8FA 2ZJWA 4PTGA 4YJVA 3PXKA 4GCJA 2HWPA 4EQMA 3E7OA 2VWYA 3A2CA 2EB3A 4FICA 2C6EA 2X81A 3K3JA 3JXWA 3TNWA 2G1TA 2IVTA 3RNYA 4C33A 5LJJA 4R7HA 2HZIA 4QP7A 5IA5A 2YDKA 4MAOA 2Y6MA 4O0RA 5AP7A 1H01A 4IWDA 4ASEA 1YXXA 3UZRA 4R1VA 5DT0A 2OKRA 4M84A 4JR7A 3AMYA 3BEGA 4FYOA 4NJDA 3W2CA 5CAOA 3DCVA 1J3HA 2CMWA 1SVEA 3QFVA 3SX9A 4E4LA 3E3BX 2VRXA 4PTCA 4O0VA 2WELA 2GHLA 2ITYA 3MSSA 4AA5A 4CZUA 3KF7A 4RVLA 5L3AA 2BIKB 3UIUA 4X0MA 5M07A 4GVJA 1BKXA 5CAVA 3LJ0A 3OBJA 2J0IA 4DH5A 4EH3A 5HICA 1H1QA 3UIBA 4G31A 3TV7A 2JIUA 1BUHA 2WHBA 4JT3A 4D2WA 5I4NA 2WMVA 1CSNA 3MVJA 3EKNA 2Q0BA 3V01A 3LJ1A 4TRLA 1ZY4A 1JKKA 2B4SB 4V01A 5M08A 3QD4A 4FR4A 5FLFA 4AW2A 4M66A 2CGVA 3AG9A 3OG7A 5KKRB 2ZV7A 3KGAA 3KRWA 3ZOSA 2QONA 4F1MA 4OAVB 3BV3A 3DV3A 2UZVA 3F66A 5JT2A 5IQBA 5HORA 4Y73A 4EHGA 4RZVA 1R78A 3GQLA 3C7QA 4K18A 1Z5MA 2LGCA 2GQRA 4FE2A 1YHVA 4BTJA 3TI1A 2W5BA 3OCSA 5FRIA 3DA6A 4CNHA 3NNWA 2BAJA 4AOIA 3BEAA 3PG1A 2W1FA 3MWUA 4FTLA 4BC6A 4O0WA 3GOKA 5HIDA 1O9UA 2FVDA 2VV9A 5HNGA 1ZMWA 2P0CA 2BDFA 2JBPA 2BALA 3IOPA 4RIXB 4NSTA 3BLHA 4Y85A 1H1SA 3EQFA 3ACKA 2JLDA 2C0TA 5IUHA 3NAXA 2C69A 2W7XA 1V0PA 4FG9A 3L1SA 3P78A 3R7VA 5DVRA 4FKQA 3LCSA 4LG4A 3DTCA 3LJ2A 4BI1A 4FSQA 1XH5A 3PTGA 3Q4CA 4RVTA 3VIDA 3HP5A 4P4CA 3WF8A 1W8CA 3O23A 3PYYA 4E6AA 2PK9A 4FKVA 3G90X 2DQ7X 1JSTA 3GI3A 1ZYCA 3BKBA 1ZOHA 4FK3A 3NUNA 1W7HA 3UE4A 3PLAE 5AR5A 3E7VA 4FKGA 4J71A 4P2KA 3AT4A 1UU3A 3MFUA 4EJNA 3RJCA 3UO5A 4ANQA 1WBVA 2ITZA 3F5PA 3AD6A 4FV6A 5K4IA 5LVPA 3SLSA 5HEZA 3T9IA 3LVPA 3GU8A 5M4CA 4QQTA 4G6OA 4AWIA 3R8MA 3TT0A 3H30A 3UYSA 3QGWA 2XEZA 3AC8A 4FSNA 4F4PA 3KCKA 4YHFA 2YCSA 4HVDA 4G3FA 2R64A 4BCKA 1ZY5A 4UMQA 3LXPA 3A62A 3G0EA 3FZSA 3KMWA 4IX4A 3DJ7A 3HUCA 4DGGA 2QG7A 3BGPA 3R02A 1P4OA 3QALE 1PMNA 3QHWA 1Q8TA 4C36A 5M56A 2UW4A 3C13A 2E9VA 4BRXA 1CTPE 5CT7A 5CF8A 3UBDA 3ZLXA 4EH8A 3R1QA 4DTAA 3ATTA 2B9JA 3Q5IA 4I94A 4C0TA 5CTPA 5E8UA 4AS0A 3HP2A 4RRVA 3SXRA 1Q97A 2XJ2A 3OOGA 3HVCA 5AMNA 3D15A 2UZEA 4NM5A 5K0XA 2NRYA 2IW9A 2R0IA 4ZJJA 3WF5A 1ZZ2A 4FKWA 4G2FA 4BICA 5FTQA 4D2RA 4FIGA 3GC8A 4IZ7A 4ZMFA 3L9NA 3Q6WA 2C3LA 2I0EA 4MVFA 4AZSA 4JIKA 5B7VA 2X1NA 5LMBA 2GTNA 4EI4A 3SG8A 3I5ZA 1H00A 4E4NA 3CY2A 3C9WA 4L45A 3PXQA 3QTZA 2JFMA 1KE5A 4TWCA 3V5LA 5CU6A 2X2MA 3KQ7A 1BYGA 2FGIA 4RBLA 3ZO2A 2OO8X 3R2BA 3PXFA 2UZOA 4IDTA 4EOSA 3HDNA 1ERKA 2YAAA 3I7CA 3DQWA 4PMMA 3RHKA 2J4ZA 5BUEA 5DLSA 1GZOA 2XS0A 2VTTA 4TW9A 4DTBA 1SVHA 4CFXA 2JDSA 3MB7A 3EN9A 4GL9A 1U5RA 3DAJA 5M53A 4ERKA 1SM2A 3G9NA 3PIYA 3C4ZA 3EN6A 2C5YA 3HRCA 3LXLA 5J8IA 1H28A 1YWVA 2QR7A 4ZK5A 4ZY4A 4IM3A 3RTPA 1PRYA 2C1AA 1PXOA 1ZYSA 3PSDA 2BRGA 1CKPA 4M7IA 3PP1A 3QWKA 5JRQA 2VZ6A 4D9TA 1UU9A 2GQSA 4JNWA 2YIYA 3PE1A 4QTBA 2VTAA 3R21A 3Q2MA 4EC8A 2WTWA 2XYNA 4RWJA 3ORLA 4LQMA 3W33A 2YZLA 3IW7A 3LKMA 3POZA 4BDAA 2ONLC 2YFXA 4U45A 5AUZA 1PMUA 3SAYA 1H25A 5E90A 3RPYA 3FXXA 2BVAA 3W16A 4DH3A 4FEUA 4IMYA 2CHLA 5AV3A 3TZ9A 4CCBA 3COIA 5D1JA 5IEVA 4B4LA 4G1WA 2WOUA 3COHA 5D11A 4H3BA 4ANOA 2Z02A 5IQIA 2VTLA 5CVHA 4FSUA 4D0XA 5FD2A 2UVZA 4AF3A 5L2WA 2Z2WA 5H8BA 2C5OA 1XHAA 3QTRA 4RIWB 4E7WA 2Q83A 3SA0A 3DAEA 3LMGA 5F1ZA 3PLSA 4II5A 3FMMA 1J1CA 4XBUA 4D2VA 5BX0A 2ZMDA 2CKEA 3ZLSA 5EHLA 5HG5A 4U42A 1P2AA 2UV2A 2XF0A 4M15A 3R7EA 5B0XA 5HE2A 2HXQA 4G9RA 3I6WA 3ZBXA 4C02A 3PJ1A 3RZFA 1XJDA 2XCHA 1Q8YA 3K5VA 4BZOA 3QUPA 3ITZA 4DFZE 4EHEA 1BLXA 2HAKA 2XJ1A 5DNRA 3HX4A 3R9NA 3OXIA 2X7GA 4JIAA 5KZ0A 5J87A 3HMPA 4ACDA 5IU2A 4AACA 5BQ0A 3H0ZA 4Y5HA 4ZSLA 2WIPA 4BZNA 4BZDA 3IGOA 4ACGA 4MXZA 2JIIA 4M8TA 5CAPA 4KIKB 1H0WA 5AAFA 5JFXA 2BFYA 4KKGA 3ZO3A 3JY0A 4Y72A 2A27A 1ZWSA 1FVTA 3NWWA 4X2JA 5FXRA 4DEBA 3UP7A 1OL2A 2GDOA 3Q4TA 3R30A 4IAKA 4IACA 4WKQA 2B0QA 3ZO1A 3DGKA 2CDZA 4L3LA 3EQIA 5KNJA 1YWRA 3EIDA 2QOFA 4D2PA 3FYJX 2X8EA 5AWMA 4G9CA 3O0GA 5D7AA 3CLYA 1PYEA 5JQ5A 4UZDA 4K8AA 2GNFA 4RIYA 4YMJA 4A9SA 3JVRA 2QOBA 3R9RA 4FEVA 3MV5A 3QCXA 5ANJA 5IA3A 2ERKA 2VNYA 3AXWA 3ZFYA 4BBMA 3LFFA 4NH1A 4MXAA 4D5HA 3VF8A 5IQHA 4GU6A 2H8HA 4BKJA 4ASDA 4I92A 3AQVA 4JVGA 4BHNA 5ANEA 3A7FA 3ZRKA 5IMEA 3ZTXA 4I5MA 5I9VA 4FMQA 2HENA 5IQDA 4KSQA 4LYNA 1KE7A 3ROYA 4EOPA 4L9IA 2YZAA 4FZ6A 4JJRA 4D58A 3D5XA 2CNVA 3UQGA 3R00A 4RLLA 3V8TA 2WAJA 4YPDA 3BE9A 1XH7A 2WQMA 5DEWA 3D5UA 4WNKA 4AOTA 4OAUC 2P4IA 2PVHA 2JC6A 5C01A 3SQQA 3LLTA 4FKSA 2F49A 4M67A 1Y8GA 3KCFA 3LFDA 5HCZA 2A0CX 4AFEA 4Q9ZA 3C0GA 2C3JA 3I4BA 3MJ1A 4RJ3A 1JVPP 4WRSA 5TT7A 5HLWA 4RX8A 4C62A 2BHHA 4H05A 4XRJA 3QL8A 5FQDC 4A4XA 4BR3A 2WOTA 3M11A 4EWHA 4YZDA 4C4GA 4FT3A 3EWHA 4QYHA 1OPLA 1U54B 1FPUA 2GFCA 2XCKA 2QC6A 2YJSA 3BLRA 4DBXA 4DH1A 4U3YA 4Z3VA 4FZDB 3D4QA 2CGUA 3WF7A 2WPAA 3AGLA 3NYXA 3TKUA 2CKPA 3CJFA 4XS2A 2CCIA 2VTSA 3GQIA 2P2HA 3QZGA 3RKBA 4JBVA 2ZB0A 3E5AA 4E93A 2XKDA 2PMOX 4R3PA 4OTGA 3UDBA 4QMSA 3KMMA 3PJ2A 3IG7A 3P79A 2W1DA 3KN5A 4NFNA 3EQRA 5EW8A 5HO8A 4N0SA 1UVRA 3G9LX 1DI8A 3QHRA 4ORKA 5I9UA 4FL3A 5KMNA 2GNGA 3U9CA 3NCGA 3RHXA 3GP0A 4R7IA 2P33A 1XKKA 2XBJA 2QODA 2I0VA 3LIJA 2QU5A 5CSPA 4KBCA 4MH7A 2UZDA 3QKKA 3EYGA 4ZAUA 3QXOA 2PZYA 3GVUA 1Q3DA 4A06A 3VS7A 4QD6A 3DNEA 1FINA 4OW8A 3VQHA 5I0BA 1OUYA 4X3FB 4XRLA 4Z7HA 3KULB 4ZOGA 1R39A 4U80A 1H4LA 4DHFA 3CC6A 3TUDA 2FSMX 3F69A 2P3GX 3LCKA 4Q5EA 4RWKA 4EONA 2VWZA 3O50A 4R8QA 2OIQA 4O21A 2VTJA 5CVFA 1URWA 2GS2A 1LR4A 2ETRA 2X0GA 4CZYB 1RDQE 4J8NA 2J90A 3PY0A 3VQUA 4HJOA 5J79A 1UU7A 4UWYA 5AUVA 4EZ3A 4CD0A 2OF2A 3MW1A 4YSMA 3GU6A 5E7RA 2ITUA 3HV5A 2HCKA 4I0SA 2BZKB 1WBTA 2E9NA 3VRZA 1KWPA 3WBLA 2OW3A 3PA3A 2C47A 4UALA 4L8MA 4EKKA 2FSTX 4UXQA 3FEGA 2F7EE 3I0QA 3M42A 3VBQA 4J96A 3AGMA 5KUPA 2RL5A 4Y46A 3DKCA 3HMNA 4JDJA 4WSQA 1YI6A 4AZWA 3RM6A 3P08A 4HCUA 3H9RA 4EBVA 1MRUA 3RMFA 3KK9A 4PPBA 3QTWA 1UA2A 1TKIA 2W17A 4DCAA 4XG4A 4QMOA 5H8GA 3KMUA 4PL5A 4Z55A 4DLJA 4CG8A 3RP9A 5EH0A 4M0YA 3UC3A 3NW5A 2GTMA 3DXQA 3KEXA 1MUOA 2VNWA 4DT9A 5HKMA 3HLLA 1OGUA 4IXPA 5KMIA 2WB8A 1MQBA 4PTEA 3HRFA 4A9RA 4F6SA 5KE0A 4UY9A 3SC1A 3MFTA 3UZPA 2ZM4A 4HYUA 4F1TA 1Q5KA 3D7TA 4UBAA 3RBWA 5BVOA 5I3RA 4RA4A 4DINA 4AT5A 1VEBA 3TJDA 4C2WA 5BVWA 5M06A 5BYYA 2XNOA 4X3FC 1YOJA 3FXWA 4TZRA 2BPMA 4CRLA 2XNEA 4FSYA 3UNJA 5KX8A 2PUUA 4MXCA 2W99B 1WVXA 5HU9A 3DBCA 4RX9A 4WNMA 3W2OA 2JD5A 3DOGA 5AFVA 4PF4A 5IQEA 3KRJA 4G17A 3QD0A 4IVAA 4XJ0A 4ALVA 3MI9A 3QLFA 2C6TA 3TTIA 3MDYA 3Q6UA 4EQUA 1M2QA 2VTHA 3EQPA 4NIFB 3PWYA 4PP7A 2Z7SA 4XH6A 1T45A 1IRKA 3W55A 3GCSA 4V0GA 3H10A 4F9WA 4GU9A 2XIZA 2V5QA 2HELA 4K9YA 4U8ZA 2H9VA 3R9HA 4BVUA 4JBOA 5J1WA 2R3PA 2X7FA 2W1ZA 2ZV2A 3ORPA 4I6QA 4MK0A 3PRIA 4EEVA 1UU8A 4D4VA 2YWVA 5IEYA 3O51A 4ZTHA 3Q3BA 1GIJA 2YEXA 1A06A 2WTJA 3I1AA 4A4OA 3C51A 1YDRE 5CASA 5KZIA 2A2AA 4QMVA 2JEDA 3Q96A 2XKEA 4YO6A 4WO5A 4BCOA 5EQPA 5E8WA 3ZM4A 4QPSA 3U6IA 4E3CA 4DG0E 5E8TA 1OKVA 3R28A 4IC7A 4BN1A 4CMUA 4CKJA 5HCYA 4E5AX 2B53A 4C4HA 1UV5A 3S3IA 2JDRA 4K33A 4XMOA 4EUUA 5A3XA 4P7EA 5FM3A 2CJMA 1H26A 1YXSA 4JRVA 5H9BA 3V5PA 5E4HA 5M09A 1ZOGA 3EN7A 4FKUA 3A8XA 4U6RA 4YNEA 2CKOA 3GC7A 2EU9A 2ZYBA 4BDDA 4FEQA 3O7LB 3WARA 4X2KA 4CXAA 2HZNA 3QUDA 3TL8A 3ZH8A 4YJRA 4XG2A 4GT3A 5FEDA 4IHPA 1GJOA 1K3AA 3FV8A 1XBCA 1Q62A 4AP7A 4BCFA 2I6LA 2E2BA 3QYWA 3KXMA 4IVBA 3QRTA 4QTCA 2ITNA 5A4TA 2IVVA 4FSZA 2PMNX 1ZAOA 3DU8A 4RFMA 4C4EA 2FB8A 5CU4A 5HCXA 1LEZA 5CF5A 3UOJA 4NZWB 4AW5A 3KXXA 4IAFA 3RM7A 4USFA 1G8SA 4JG7A 3AT3A 2R7IA 2OBJA 5EOBA 3G6HA 4TL0A 4KD1A 5AX3A 3IW8A 1FOTA 3VUKA 3IQ7A 3R04A 1HCLA 4ZZNA 1JQHA 3GT8A 3UQFA 1CKJA 4KNBA 4XOZA 4BI2A 4GRBA 3PVWA 2OJGA 5AA8A 3SW7A 4MXOA 4K0YA 2IVUA 2UW6A 3MFSA 4C35A 4IAYA 3TJCA 1VZOA 1OMWA 3QAME 3O71A 3FLQA 3LFCA 3PPKA 4FZFB 5ANDA 1F0QA 3RPVA 3SDJA 4BGGA 1BL7A 3TNQB 1OIQA 3BGZA 4XEYA 1PW2A 3UVPA 5C4LA 1YHSA 1OITA 1Y6AA 2R3QA 1CKIA 2W9FB 3R1YA 4IZAA 4X21A 5J5SA 4LOQA 4R3CA 2VO6A 2W5AA 3KY2A 3L9PA 3MH1A 3S00A 3F88A 2I7QA 3PPJA 5CEPA 4LMUA 2PSQA 3OXTA 4I41A 2YIXA 2CSNA 4RVMA 4ARKA 4R78A 5L6OA 2QURA 5D10A 3UYTA 4YJQA 3SV0A 5E8YA 4KRDA 3E92A 3HECA 2O2UA 4LL0A 4BDBA 4WSYA 4BDCA 3DJ6A 3K5UA 4C3FA 4NCTC 5HI2A 4EHZA 2F7XE 3NVMB 4AAAA 4IAAA 4JI9A 4FKLA 2YDIA 3NGAA 4FT5A 4ITHA 2B55A 3ZBFA 2YACA 2ZM3A 3CQEA 3FLWA 4OTHA 5CSVA 4BIEA 4QTEA 4ZXTA 4O7YA 3EFLA 2IZUA 3MJ2A 2VTIA 3FI3A 4UEUA 4DEDA 2X9EA 4KA3A 5IG1A 2QG5A 4MF0A 4ID7A 1G3NA 2J9MA 2XNNA 2WZJA 3JUHA 2WNTA 2YJRA 4QT1A 4I0TA 5ICPA 3PWDA 4UYAA 2YCFA 3ROCA 4C38A 2XB7A 2ZV9A 3R1SA 4O0TA 4GKHA 3EL8A 3NNUA 2VWVA 2B9IA 4XYFA 3ZZWA 3QTQA 4FTRA 2OH0E 3MB6A 4GUEA 4IE9A 5HVJA 1B38A 2OWBA 3JYAA 3O8PA 3ZUTA 4ANBA 4AGWA 2HY81 4EK6A 3KU2A 5IEXA 2GCDA 5HVYA 1M7NA 3VBXA 4E73A 1TQPA 3ULIA 3RPRA 4EH4A 5JFWA 4B6LA 3FBVA 2RG6A 4AZVA 3NR9A 3CQWA 2CCHA 4M97A 3UG2A 3ZXZA 4LV8A 5CYIA 5LOHA 2J0KA 3DAKA 2DYLA 4U41A 3VBYA 3ZU7A 2F9GA 2VX3A 3CP9A 3ORXA 2GNHA 3CKWA 4WNPA 3R0TA 3EN5A 2ZOQA 4OR5A 4TXCA 3P7BA 2PUPA 5GZ8A 1PKGA 3GC9A 4PX6A 1J91A 2R9SA 1YVJA 4LRMA 2PVNA 2FSOX 4XP3A 4O38A 5JFVA 3CTHA 5HIBA 3BWJA 3ORKA 4U7ZA 4DFLA 5FTGA 4QP8A 3E8EA 4TWNA 2UZWE 5CY3A 4E4XA 5J5TA 4O84A 4QP9A 5HE0A 1V1KA 1WBNA 3PSCA 4EOQA 3EMGA 5CSHA 3D9VA 3V5TA 1YW2A 4IAZA 5JZJA 3CIKA 4XCUA 2VUWA 1UWJA 3GFWA 4IC8A 3QGYA 4IADA 2WMWA 4XP2A 5EG3A 4ANLA 4F0GA 4R1YA 4YTFA 4QQJA 4YJSA 4C4JA 4R77A 3REPA 3QQFA 4WBOA 4KS7A 2WGJA 5HD7A 3FL5A 4AZTA 5FDPA 5HIEA 5JN2A 3RK5A 4IB5A 4DEAA 5EFQA 2Z7QA 3ULZA 4KIQA 5T6KA 3QX2A 4EC9A 4I5PA 4NK9A 4E6CA 4D1SA 5JH6A 3CJGA 3LPBA 1TQMA 4O0XA 4CSVA 4YPSA 4G3EA 2YCQA 2JGZA 2R3FA 5H3QA 2PMIA 2PVMA 2QO9A 4QPAA 4Y5QA 1YKRA 3ETAA 3FMHA 3R22A 1PXIA 3EH9A 2UW8A 5AR8A 4JDKA 1OVEA 4LI5A 3ZUVA 1GZKA 1WMKA 4BDJA 4UWBA 3GCQA 1F3MC 4FUXA 1IA9A 2J0LA 5DH3A 3NUYA 2IJMA 3DZQA 3LLAA 2F2CB 4OLIA 5CXHA 4F0IA 3HKOA 1GZ8A 1Q99A 2OIDA 4BHZA 2YIRA 4DH7A 3GU4A 4QYEA 3I0OA 5EKNA 5M4UA 3TG1A 3QUEA 4LOPA 5CU2A 5DPVA 5DMZA 5FBOA 5J9ZA 1KV1A 4FV0A 4GMYA 1VYZA 4BGQA 1OPKA 3VN9A 3R7IA 3CTQA 1FGKA 1XH8A 4XOYA 3G51A 2JKOA 4I5CA 3O8UA 2PVYA 3FLYA 5CNOA 5AR2A 2HW7A 3IO7A 3VF9A 4L3JA 2WKMA 4RQVA 4QMPA 4ZIMA 2XUUA 4FVPA 4OGRA 3HGKA 1YI3A 3Q9WA 4NU1A 2VX1A 4FL1A 3HL7A 3ORTA 2XJ0A 3C1XA 4YO4A 3NEWA 5ETFA 2O63A 4MD9E 4AXAA 2YM4A 5EYDA 3V6RA 3A7GA 4O82A 5CZIA 3UOKA 3GUBA 1W0XC 3FKLA 2J5FA 2YERA 5DT3A 4EYJA 4YHJA 3LFNA 4CFFA 5ITAA 4F7JA 3TZMA 1OIRA 4F99A 3U6HA 5M44A 1Q24A 3Q53A 3D5VA 3IW4A 2OJJA 4I24A 3CR0A 4QMQA 4UZHA 3F3VA 3Q9YA 5BUIA 4DFBA 4M69A 2XK8A 3OCBA 5JGDA 3A99A 4BWXA 4PPCA 4RC3A 3NPCA 3BYMA 3DDPA 3HYHA 5BVFA 3EFWA 2XKCA 3DJ5A 4S33A 3ZONA 3AMAA 4FL2A 3GU7A 5LMKA 2PVJA 3F3ZA 3O96A 4YJTA 4FX3A 4FV9A 4QQ5A 3ZLWA 3E88A 4FV4A 5IH4A 3E64A 1MQ4A 2X6EA 1OBDA 2XBAA 4EBWA 4ASZA 2W4JA 5BNJA 1DI9A 2G2HA 4BTFA 4HGTA 4C58A 2GQGA 4X2NA 2EB2A 4WUAA 4F08A 4WRGA 3OVVA 4EWQA 2I1MA 3OEZA 4I23A 4YUQA 5E9EA 4YLKA 4CKRA 2OXXA 5AV1A 3EQDA 4I21A 5M55A 3IK3A 4B8LA 1YRPA 3MN3A 4FZAB 4JS8A 4P5QA 3ORNA 3S4QA 4Z7GA 2WTDA 5L8LA 1ZLTA 2OXDA 5DN3A 3VW8A 4CEGA 3N4UA 3SVVA 3AD5A 3GBZA 3OOMA 2HYYA 2W4OA 3QZHA 3TNHA 1H0VA 2PVKA 5C8NA 5JGAA 4L7FA 1JNKA 3P7AA 4FOBA 2A19B 4AZFA 2RFEA 3HNGA 2OGVA 2Y0AA 1Q8UA 1RQQA 2UW0A 4J98A 1K9AA 5LVOA 3JR1A 3VS2A 4HZSA 4O0SA 2WMQA 4CFNA 1CMKE 4YJOA 4FKPA 3D7ZA 4AG8A 3QRIA 4XG7A 3BGQA 2RIOA 4MF1A 4BKZA 2IZSA 2QKRA 4YZBA 3E3PA 5EM7A 3VHKA 3D0EA 5KMOA 5LVMA 4HGLA 4BYIA 4WG3A 3SRVA 4Q9SA 4DH8A 3FKNA 4NT4A 2WXVA 4MBIA 2ACXA 1H08A 3EFKA 1QMZA 4PRJA 5G6VA 3C4XA 3WZKA 4K11A 4GYGA 2W1EA 3FSFA 3R71A 3NAYA 3NLBA 4I93A 5IISA 2UVYA 2VN9A 2XVDA 4TYGA 2R4BA 4G3DA 4GH2A 3NUXA 4MYGA 2VWUA 2XH5A 2JAVA 3D94A 3G0FA 3IKAA 4K77A 5DEYA 4O86A 1JBPE 3AC1A 5E8VA 2R3NA 3NIZA 1FMOE 5HVKA 5LWNA 2CLQA 3VUHA 4AGDA 4IWQA 5CEKA 4IH8A 1YOLA 4RGJA 3LMHA 3UIXA 3H0YA 4GG5A 5J95A 3UODA 4CKIA 1FBNA 2PULA 4JLCA 3JS2A 5CSXA 4B0GA 5A9UA 5LVNA 4CZTA 3SG9A 4OTFA 3FHIA 4CRSA 1BI7A 3EQGA 3QBNA 3HZTA 5J7HA 3C4CA 4QNYA 5L2SA 2GSFA 2O5KA 3EKKA 3FQHA 4X2FA 4BDEA 3DY7A 3RGFA 5KHXA 3ZXTA 1U59A 4PWNA 4OTQA 4RT7A 5C26A 2WMRA 2YHVA 3LW0A 5AUYA 3R8UA 2XIYA 2JKMA 4AE6A 2QLUA 2OXYA 4O96A 5BVKA 5AEPA 2XK9A 2V55A 3FLNC 4J52A 2YABA 3G5DA 3CSVA 3C5UA 3EQHA 3GNIB 3Q60A 5A4LA 5GIPE 2WMBA 4LV5A 4BCJA 4YTCA 4JBQA 2RGPA 2PYWA 4RIYB 2C0OA 4U81A 3P1AA 4OUCA 4WOVA 4USEA 3KC3A 4AGCA 1JSVA 2Z60A 4MKCA 4YJNA 1NT2A 4KKHA 2ITOA 3ODZX 4EYMA 1EH4A 2RFDA 2FH9A 2G2IA 1REKA 2B52A 3FL4A 4LOOA 4KAOA 4CYJA 4NWMA 4ENXA 3FC1X 2W5HA 2QR8A 4YZMA 3OROA 1FGIA 4N4SA 5HE1A 5IMXA 1OKWA 4QPMA 2BTRA 3LFSA 4DEGA 4DE4A 5HHWA 2P2IA 4NFMA 3HA6A 5HNIX 3HDMA 5CWZA 4CQEA 4YC3A 4F6WA 3TUBA 5HESA 4ZLZA 3UP2A 3WI6A 3KREA 3R6XA 2XIKA 5C27A 4BCQA 1GY3A 3HRBA 2VTRA 5A4EA 2JAMA 2PZRA 1SZMA 3NYNA 4DGLC 2X8IA 3BE2A 1R0EA 3DFAA 4GEOA 2PZPA 3AT2A 1OL5A 3TEIA 4U97A 3THBA 5KBQA 2H96A 3D2IA 3FKOA 4IX3A 5HNBA 3BYOA 3EJ1A 4E5BA 2YAKA 4EZ7A 5IKWA 4O83A 3F6XA 4AOJA 2VTNA 2KTYA 3S2PA 2GHGA 2O3PA 1H24A 3VVHA 2BR1A 3CGOA 4XG8A 5CQUA 1OB3A 4UYNA 5GJDA 2B7AA 5DG5A 3LM0A 3R2YA 2DWBA 4CV8A 4R3RA 4FTJA 2WEVA 1BI8A 2C6IA 4G3CA 4DG2E 4QTAA 3FQSA 4DFXE 5GJFA 4BF2A 2WMXA 3Q9XA 4MWHA 4GKIA 1XBBA 4AE9A 1UKHA 3PJ3A 2G2FA 2QOHA 3Q4UA 5IA1A 3KFAA 3L8SA 1Y57A 1S9IA 4ZSGA 4IFCA 2PU8A 5IUIA 4I6HA 4ZS4A 2WTKC 3P86A 1OM1A 5L6WL 3GFEA 4DLIA 1WBPA 3C0IA 3FI2A 1XR1A 3DXNA 4YP8A 4FF8A 3EYHA 4XNEA 3KXZA 4ZTLA 2EUFB 2R5TA 3FY2A 3BU6A 2XIRA 3E63A 3T8OA 3AC3A 1YI4A 4RWLA 2QCSA 3PZHA 5L2TA 2ITXA 1Q8ZA 2HWOA 3AC4A 3QCQA 1ZARA 3NCZA 3U8WA 3R73A 2Y4PA 3VUMA 2BIYA 5CAUA 3PSBA 5TR6A 2Y8OA 3TZ7A 5HOAA 3D83A 1BL6A 3OW3A 4F7SA 4FNYA 3C4WA 4O22A 1I09A 3VS0A 3ZEWA 1YHWA 5JEBA 2O8YA 1QL6A 2B1PA 4XG3A 5AM7A 3LQ3A 5IZFA 3QQHA 4RA5A 4F9AA 5GHVA
chains in the Genus database with same CATH superfamily
1OBGA 1JLUE 3BHVA 4EUTA 2IVSA 5AP4A 3IW6A 5E8XA 4CFMA 5I9XA 4NUSA 5EI2A 1WCCA 1WFCA 3NUPA 3VUIA 3EQBA 2G01A 2B9FA 4BTMA 4EH7A 2A4LA 5K9IA 3K2LA 4IANA 4RG0A 5M4IA 2ZAZA 1W84A 2YDJA 5KMJA 4E6DA 4ACMA 1DAYA 1NA7A 3QRKA 2BILB 4DG3E 4MNEA 4J1RA 4O6EA 5EW9A 4BL1A 1SYKA 5AP3A 4BDFA 3VS4A 5FP6A 3BWFA 5DIAA 5AM6A 4IFGA 1M2PA 4HVGA 1J7LA 1GIHA 3G6GA 4V04A 1OL7A 4F9BA 3P5KA 4M14A 1UNLA 1AGWA 3S0OA 1DM2A 5CXZA 2BUJA 2QOQA 3BYVA 3FC2A 4L6QA 4ZSEA 5HU3A 5LMAA 5F95A 2QO2A 4XV2A 4QNAA 2JBOA 4MXYA 3VO3A 2XM8A 5K5XA 5BV3A 4F63A 4BFMA 3VJNA 3ERKA 3SHEA 2H6DA 4ZZMA 3KXGA 4FV8A 3TUCA 4LMNA 4YZ9A 5EM8A 4ZY5A 5D12A 4H1JA 5F9EA 4FI1A 4O7VA 3Q9ZA 1PMVA 3SW4A 2BMCA 3NDMA 2WQOA 4IZYA 2XKFA 2EVAA 4CQGA 3UVRA 2E9OA 4FIHA 1LPUA 3DK7A 2AC5A 2CGWA 2WD1A 3OUKA 3V3VA 4D28A 4WA9A 4W4WA 2WMUA 1NXKA 1YXUA 5JZNA 2IWIA 4O0YA 4NW6A 3TCPA 3QA8A 4YR8A 4OBOA 3ZMMA 2QO7A 4FJVA 2QD9A 4RC2A 3D7TB 4MX9A 2XYUA 4C8BA 2XAOA 4IB3A 2G9XA 4FSRA 3SXSA 5CAQA 3F82A 4O91A 3W0QA 4AN3A 4BDHA 4D5KA 2X2KA 2RFSA 3NYVA 3OP5A 4LM5A 4P5ZA 3MH3A 2XRWA 4XLVA 5JRSA 2YIQA 1A48A 3DZOA 3CTJA 4I4EA 5EK7A 4DCEA 3F2RA 2W1CA 3LXKA 4FGBA 4GT5A 5M51A 5IA2A 1IASA 1U46A 3FMDA 3FPMA 3WZEA 2XIXA 4IB0A 5CEIA 4F70A 2V7OA 3NVKI 1OECA 3A7HA 4IZ5A 4ZEGA 3RPOA 3BRBA 3TXOA 1GIIA 3LZBA 3TDVA 3FJQE 2NP8A 4ZZOA 5AIKA 3FI4A 3PIZA 4FV5A 4BY9E 4I1ZA 4CG9A 4E1ZA 2GU8A 2UW5A 2JDTA 4FT9A 2JFLA 4V0GB 4TTHB 2CPKE 2OLCA 2XMYA 4H58A 5F4NA 4ONAA 5HO6A 3BI6A 2QLQA 5GZAA 3TNPC 4AW1A 3FE3A 3ANRA 4FUYA 4O6LA 3OFMA 1O6YA 3WZUA 2R2PA 2X7OA 5JSMA 4UMTA 4L44A 4L43A 5C1QB 3S1HA 4YU2A 5AP6A 4AFJA 5IQGA 5FXQA 4FTUA 5CNNA 3EB0A 2J50A 3R83A 4F1OA 4FIJA 1XWSA 3KRRA 4NM0A 3TKIA 3ATSA 3QU0A 4ZP5A 2Y9QA 3OWLA 4MWIA 3PP0A 4XP0A 5FBNC 5FWKK 1W2FA 3OD6X 5DI1A 1KE8A 2I40A 3EL7A 3HEGA 3L9LA 5AADA 3PRFA 1OL1A 5AAGA 3QD2B 4RPVA 5TOZA 1PXMA 4I4FA 3UZTA 3HA8A 4HOKA 3QTSA 4HPTE 1OPJA 3QXPA 4BCHA 4TNBA 4DT8A 1M52A 1VYWA 2UZTA 3DBDA 5C9CA 3COMA 4JL9A 5EKOA 2YWPA 4DN5A 4W9WA 4BBEA 4GT4A 4C34A 3HAMA 3BYSA 1PKDA 3OXZA 2X2LA 3PVUA 3U51A 2J5EA 3E8CA 3W1FA 5I9WA 3VBTA 1TFFA 3IPHA 4FZ7A 4GVAA 1UNHA 1MRVA 2HW6A 4QMWA 4F64A 3A7JA 3D2KA 4NKSA 4O1PA 1H1PA 1PXKA 4EOKA 2R3JA 4AN2A 4IJPA 3A60A 2H34A 3I81A 4PV0A 4M0ZA 2EXEA 3TIZA 4L68A 4A9UA 3C4FA 1QCFA 3ZSIA 1YQJA 4P90A 3KRXA 2I0YA 4FOCA 4YBJA 4O7RA 3U54A 5K3YA 3RAHA 3MH0A 4F9CA 2XARA 2HZ0A 4L00A 1VLRA 5CEQA 4O7ZA 3QF9A 2B54A 3V04A 2QOLA 2BDJA 2YM6A 2GFSA 3BIZA 4WG5A 3E62A 4JOAA 4Y95A 3WIKA 1B39A 2JKQA 4M68A 4D1XA 5I5ZA 3KXHA 3DNDA 1KUTA 5L2IA 3LQ5A 2O0UA 5FP5A 1HOWA 3AMBA 4C3PA 3KF4A 4CMOA 4H3QA 3BHYA 4J95A 4LRJA 5A4CA 3S95A 4WUNA 2BROA 4E4MA 4DFNA 4DAWA 1P5EA 3PG3A 4CFVA 1ZYJA 4DEHA 4FIIA 1RE8A 4C57A 2EXMA 4MCVA 5B2KA 4DC2A 2GS6A 4YJUA 3QC4A 3VS1A 5CF4A 3PVGA 4XG9A 2C1BA 3LFEA 3F2AA 2HY0A 3QKMA 2OZAA 4AXDA 4DA5A 4L53A 4BI0A 3W32A 4AX8A 2ETKA 4HCVA 4JQEA 5KHWA 4GIIA 4W4YA 4EL9A 1Q61A 2OI4X 4MBJA 3CGFA 3D5WA 3BU3A 3LXNA 4KS8A 4BIDA 1HCKA 5L8JA 4IX6A 2QU6A 4OT6A 3V6SA 4O81A 4WBBB 5FEEA 3ZM9A 3BELA 4F0FA 3MY0A 4BCNA 3FZRA 5KBRA 3MIYA 5ACBC 3ZRLA 2AYPA 5L8KA 1Z57A 3AOXA 5HBHA 1CM8A 3FMJA 3K54A 3I5NA 2WMAA 2OK1A 2XNGA 4S34A 1OI9A 3KK8A 1FVRA 3R1NA 3R7GA 4C4FA 4O1OA 4O2PA 3TWJA 3EHAA 4YZNA 4H36A 4W8EA 4D2SA 3CCNA 4EH5A 3GCPA 5A6OA 1LEWA 4QYYA 3NW7A 3R63A 2XRUA 2QQ7A 4H3PA 2J51A 2XK4A 4TT7A 3VHEA 3OBGA 1NVQA 4LGDA 4IDVA 4XV1A 5IDPA 4ITIA 3FXZA 3W2QA 3ZLYA 2I0HA 4QRCA 4C7TA 2YM3A 5C8KA 3F3TA 3O8TA 1JPAA 2ZDUA 3GC0A 3OWKA 5IF1A 2W05A 2YM7A 3GCUA 3MTLA 4ZSJA 4QOXA 3BQRA 5HD4A 4RX7A 1Y6BA 3FUPA 3PZEA 5DOSA 4FTKA 3CKXA 5M57A 4OTWA 3UNKA 5AP5A 1PXPA 2DS1A 2PL0A 4RFZA 4QMXA 4DEEA 4TWPA 4BCPA 2UUEA 3IGGA 4BJJB 2LAVA 5ANOA 5E1SA 3CS9A 3POOA 2QHMA 2C6KA 2RKUA 4W9XA 4C61A 2PZIA 3RK7A 4FTIA 3R7UA 2VO7A 3ZFXA 2V22A 2YCRA 3KVWA 2Z7RA 4QYFA 5AR7A 4E20A 5JFSA 1XH6A 3D14A 4OBQA 3ZS5A 2YLEA 5F20A 2UZLA 4FVRA 4G16A 2XK6A 3VC4A 4U44A 2DUVA 4DGNA 3QZIA 4YGAA 3UG1A 1WBOA 3MBLA 4LGHA 2WIHA 5CI7A 3C5IA 1AQ1A 2C6MA 3IDBA 3L8VA 4ANNA 1JKSA 2P55A 4JG6A 2X39A 4E5WA 1L8TA 3MESA 3UVQA 4BWPA 4J53A 4FT7A 2C30A 5KMKA 4AU8A 3WILA 4RJ7A 1KE9A 3V5JA 2R3RA 3PY1A 2OZOA 1PMEA 2XEYA 3C4EA 3LCTA 4HPUE 5ETCA 2WO6A 3IW5A 3UTOA 3R9DA 4XUFA 2FO0A 3EFJA 3GCVA 5BVEA 3ZFMA 5TE0A 5TF9A 4RLKA 3JY9A 4L01A 4R6VA 2BFXA 3EOCA 3HV4A 4Q2AA 2C3KA 1ZOEA 4X7QA 3FMNA 3FMKA 5JQ8A 4Y8DA 5K4JA 2C5XA 2ZB1A 3PXYA 3ZUUA 4DGOA 4KINA 2R0UA 1F5QA 2BTSA 4L67A 5EOLA 3A4OX 4RJ6A 5AV2A 4J97A 2OF4A 3RAWA 3VWAA 2XM9A 5BPYA 4U43A 4BDIA 4IWOA 2YLFA 3OS3A 3A7IA 4C37A 4TYHB 2PUIA 4EKLA 1KOBA 3CQUA 2NPQA 2Y7JA 4W4VA 5AUXA 3VRYA 4YSJA 2CKQA 3FDNA 4IIRA 4FTCA 3V51A 4PDYA 1JAMA 4GW8A 3SD0A 3II5A 3KN6A 2V62A 3VULA 2HOGA 1XH4A 3B8QA 4NM3A 3WF9A 4U79A 3GU5A 2BRBA 4O7LA 5AV0A 2ITQA 4A07A 2PPQA 2BKKA 3L8XA 4N6ZA 4ENYA 2Z8CA 4C2VA 3MVMA 3QYZA 1XQZA 3FQEA 5DRDA 5J9LA 3KB7A 3U9NA 1LP4A 2GS7A 3ZO4A 5DR9A 1H1RA 2C68A 4U40A 3RNIA 4O0UA 3ZZEA 4CGAA 4PDPA 5HX8A 2O65A 2RG5A 3GEQA 3F3WA 5AP2A 2X0OA 4YTIA 2WEIA 1RW8A 3LM5A 3TN8A 2PY3A 3EZVA 3UQCA 3N4TA 4W8DA 3QRUA 4JAIA 5GINE 3A61A 2X9FA 4OBPA 4PP9A 5D7VA 5FTOA 4AN9A 4L46A 4N57A 4TYHA 4A9YA 3ZSGA 1P14A 4EQCA 3CXWA 3OWPA 2WQNA 3UIMA 3HV7A 4HYHA 3TDWA 2UW7A 4FODA 4M69B 3RI1A 5EM6A 4WIHA 5EM5A 2GNLA 2VWXA 3Q32A 2G15A 4FTMA 4NEUA 4FV7A 2WTCA 3MY5A 4YC8A 5FM2A 4EOIA 4D4RA 1ZRZA 4FNZA 4GYIA 5CT0A 4Z16A 3R8LA 3QQKA 4LGGA 3MFRA 2VD5A 3MS9A 1S9JA 1WVYA 5AJQA 3RCJA 5HTCA 3OY1A 1H07A 4FEXA 4TYIA 4PQNA 5KMLA 3VS3A 3CD3A 3OTUA 4X3JA 3I60A 4GSBA 3BV2A 1AD5A 3FI8A 4ZJIA 2W06A 5LWMA 4FC0A 2ZV8A 4ZMEA 3CBLA 4HNIA 3W10A 3UDZA 1WBWA 2PE0A 5HTIA 4E8AA 3GB2A 3IONA 4ITJA 4F65A 3GXLA 4MQ1A 1REJA 3VBVA 3NS9A 4KKEA 4C59A 4CTCA 5A14A 3UDTA 5BVDA 2XNMA 4HVIA 3ANQA 5AX9A 4M12A 1Q41A 2AC3A 2BRHA 2OG8A 4I6BA 4TKSA 4IVCA 3SKCA 4ALUA 5L4QA 3B2WA 2J7TA 4GS6A 5I3OA 2UZBA 3Q04A 4C4IA 1ST4A 3SOCA 1YOMA 4PDOA 3F9NA 4FYNA 1UWHA 3OZ6A 4FA2A 5HZNA 3PE2A 4EOOA 5F94A 4AA0A 2QOKA 3DPKA 3ZCLA 3F2NA 2CNQA 3SGCA 3MPAA 1TZDA 4O27B 4QMNA 2PE2A 5K0KA 3QWJA 4BIBA 2GNIA 4RX5A 1XBAA 2IZTA 4FNWA 3ORMA 3F61A 3SRVB 5HG8A 2HIWA 3CE3A 4FV3A 4O7TA 4B8MA 4KB8A 3LQ8A 1NVRA 1YWNA 3HMMA 4Y83A 2RFNA 3W2SA 4FTAA 4ZTRA 2ITVA 3M1SA 1CDKA 2HZ4A 4KWPA 2R3GA 1JSUA 1OKZA 3DFCB 4O2ZA 1PJKA 4ACCA 4ZLOA 5IPJA 5G1XA 2W1HA 3NZ0A 4EJ7A 3BCEA 4RIXA 4S2ZA 5DGZA 3WIGA 5KKRC 4ZTSA 3UOLA 2OJFE 3PXZA 3NSZA 4A7CA 3WE8A 5LMKC 2ITPA 4O4BB 1SVGA 1G8AA 4AT3A 4B99A 3VJOA 4RMZA 1APME 3IECA 3LMIA 3DB8A 3ORIA 4TNDA 3DKOA 4FSWA 4ANMA 3H3CA 4PMSA 4IQ6A 4GJ3A 1JWHA 5TO8A 3A8WA 3L8PA 5AV4A 5JGBA 3NUSA 3O2MA 2OFUA 3H9FA 4S30A 5GIOE 5CLPA 3VS6A 1M7QA 1OZ1A 2FUMA 2UZUE 3N4VA 1YXVA 5A4QA 3KXNA 5FGKA 4UMPA 2PWLA 5FEQA 1GOLA 4IBMA 1XH9A 4MUQA 2XZSA 3ZRMA 1ST0A 2F57A 5HLPA 5CSWA 3VUGA 4HVSA 4U5JA 3BYUA 4FGRA 4ZS0A 2JDVA 2YIWA 3ENHA 3OCTA 5IQCA 4LFIA 3ZEPA 4M13A 4IM2A 4AA4A 1IAJA 3R7YA 4QTDA 5AP0A 4HNFA 4IEBA 4ZTQA 2BRNA 4XBRA 2Q0NA 5BYLA 4GG7A 4BKYA 4XLIA 4GIHA 2QNJA 2PZ5A 4MNFA 5CI6A 4BGHA 3BZ3A 2BZIB 1E9HA 3MGYA 4EK4A 1Y8YA 4YBKA 4I6FA 3VUDA 3EQCA 4WNOA 3MA6A 4B9DA 1FQ1B 4IWPA 3ML1A 2ONLA 5DFPA 4B7TA 2J6MA 4FTQA 4R5YA 5HBEA 5E8SA 2R3KA 5I9YA 3B2TA 5I9ZA 3F7WA 4RWIA 1TVOA 1YDSE 3F7ZA 1SNXA 3DK6A 3PA4A 4RC4A 1R0PA 5AUWA 3E93A 4HVHA 3P9JA 5L2QA 1IG1A 4WT6A 1JKLA 3AC5A 4I0RA 4QMTA 3LCOA 5ACKA 5FUTA 3QD3A 4U0IA 3MVLA 4A9TA 2ETMA 3UPZA 3QKLA 3LOKA 4UWCA 1QPJA 4CV9A 3MY1A 4YZCA 4YHTA 3UPXA 3ZC6A 4TPTA 2BZJA 2WTKB 3OEFX 5EYKA 5IQFA 3FPQA 2F2UA 1IA8A 5ETAA 2XA4A 4FT0A 5DT4A 4ZTNA 4FKOA 5LQFA 5IH5A 2XK3A 4V05A 3W8LA 3LAUA 3DBEA 2VAGA 1Z9XA 4PDSA 3WYYA 4BCGA 1KOAA 2J0JA 4NM7A 3PUPA 1W83A 3FLSA 4BWKA 4AT4A 4AQCA 2WU7A 4FBXA 3L9MA 5IDNA 5CVGA 2W1GA 1GZNA 3VS5A 5IA0A 1OL6A 1Q3WA 2VX0A 3FLZA 4FIFA 4I5HA 4K6ZA 5DYJA 3GGFA 4KBKA 4L3PA 1K2PA 2WMSA 4RQKA 4EK3A 2R3IA 5EQEA 1G8KA 1NW1A 3MPTA 4FK6A 4ASXA 2YA9A 5A46A 3UMWA 5C4KA 4GK2A 2ZVAA 3JVSA 5EW3A 3O17A 5CF6A 3PDTA 2VU3A 2XNPA 3CEKA 3PVBA 5AR4A 4DITA 1WBSA 2ZMCA 3TKHA 1TQIA 2IZRA 3MVHA 1DAWA 3CY3A 2E9UA 4D55A 4JDHA 4EHVA 4I22A 4G6NA 1ZMVA 3LFAA 5EYCA 3U87A 4O4CA 4AUAA 3FZPA 5J1VA 3EN4A 3NFGB 5J9YA 4YJPA 3ID6C 5EDQA 1BX6A 4D4YA 4TY1A 1ZYDA 2X6DA 3WZJA 4W4XA 1H1WA 3F3UA 2WTIA 1B6CB 3DT1A 5DA3A 5B2MA 2VO3A 2X0PA 4GFOA 4RIWA 5C8MA 1GAGA 3ZDIA 2C5NA 2CGXA 3HUBA 4G3GA 2YN8A 5DRBA 3VW6A 3U4UA 4AGUA 1IEPA 3QCYA 5KMMA 1MRYA 4NJ3A 4O4EA 1V0OA 2GNJA 3OCGA 2UW9A 3QLGA 3QTXA 3PJCA 3OF0A 3R7OA 4UN0C 4MNEB 1VJYA 3JPVA 3RINA 4F6UA 3RCDA 1VR2A 3NYOA 1OIUA 4BB4A 2FSLX 3T9TA 3RAIA 4LL5A 3ZSHA 3OC1A 4FSMA 5EDRA 1ZMUA 2JITA 4JG8A 4UXLA 2R3HA 4KIPA 3ALOA 2R3MA 3IDCA 2C6OA 4RJ8A 2C5VA 4EOJA 4F7NA 3P5JC 4HYSA 4U3ZA 1RJBA 4ACHA 3TV6A 4JRNA 4KIKA 4QP2A 5H2UA 3KL8A 2ESMA 2J2IB 1JKTA 1KV2A 4H1MA 2EXCX 5H8EA 3R8ZA 5B2LA 3K3IA 4QP1A 2QOOA 1SMHA 2GHMA 1OGYA 1E1VA 3AD4A 3H9OA 4RVKA 2X4ZA 1ATPE 5HX6A 3BU5A 5TKDA 2AUHA 4GV1A 4S31A 1YDTE 5AA9A 4PNKA 4YLJA 2HXLA 4UX9A 1Q8WA 2CN8A 2ERZE 3I7BA 3FHRA 4UB7A 4LRKA 2VWWA 3DBQA 5EI8A 4PNIA 5HGIA 3NIEA 5AAEA 3U55A 4DGMA 5KO1A 1O6KA 4FKRA 5CU3A 5LXMA 2O64A 3RPSA 3DS6A 3MIAA 3ZHPC 5CENA 3TM0A 2OFVA 2PMLX 5DR6A 2W0JA 3QTIA 4E6QA 3P7CA 5T68A 4FV1A 3GOPA 2W9ZB 2PVLA 5FG8A 2WFYA 2QOIA 4FIEA 3HV3A 3DKFA 2HK5A 4EH6A 3BX5A 1M14A 3BPRA 3MYGA 4HCTA 1FVVA 3TIYA 3Q4ZA 3DK3A 3P0MA 3BBTB 3NRMA 4FNXA 5ANGA 2E9PA 1IR3A 4IW0A 4APPA 1STCE 1J7UA 2BAQA 2C4GA 3ODYX 4PMTA 3U6JA 4APCA 4GUBA 4K1BA 4MXXA 2JIVA 3Q5ZA 3LFBA 4K2RA 4M3QA 4F7LA 3FSKA 4IAIA 4YNOA 3UO4A 5HTBA 4OTPA 4OTDA 5EHYA 2PE1A 3ZYAA 3W2RA 4GK3A 5EQYA 3OT8A 4EH9A 2ZM1A 3QQUA 3UJGA 1ZZLA 2ITWA 5HG9A 3KIOC 3MA3A 5L6PA 3B8RA 2VGPA 4RJ4A 4YLLA 3TNIA 3WZDA 3QCSA 4O7WA 4N6YA 1LUFA 4Q5HA 4X6QC 2PUNA 4YTHA 3SOAA 4YURA 4FKIA 3E8NA 5AIRA 3QC9A 4G6LA 3U4WA 1DS5A 3ALNA 4QMZA 3VBWA 4ANSA 4MHAA 4ERWA 4KUJA 1PXJA 2J0MB 4KIOA 1U54A 2C6DA 2KULA 5JK3A 4JDIA 4QMLA 1QPCA 1QPDA 2ITTA 3ZC5A 4EORA 3NUAA 2Y6OA 2Z7LA 4C3RA 3IOKA 3UC4A 1WVWA 2OJIA 2VWIA 3SXFA 5BVNA 2F4JA 3FZ1A 4TWOA 5IA4A 4L42A 3F5XA 4IX5A 1WAKA 5BYZA 3MPMA 2QVSE 4GK4A 4JXFA 4UV0A 1ZXEA 5E8ZA 4DYMA 4DEIA 5K5NA 3G33A 4KSPA 3P23A 1PY5A 2QKWB 4ALWA 5BUJA 4EH2A 3HMIA 4CLIA 3HAVA 4PPAA 4CLJA 4G5PA 3QZFA 1SNUA 3IDPA 4NKAA 4EOMA 4J99A 4FKJA 4OTIA 5JMSA 4RJ5A 4PL4A 4FVQA 4J8MA 2UW3A 1OKYA 4MD8E 3N9XA 4LUEA 2VO0A 3CPBA 4PY1A 1BMKA 3BHTA 3PFQA 3WE4A 3NNVA 5HLNA 4WD5A 4EK8A 4KRCA 3CPCA 3R8VA 2VTMA 5E91A 3OMVA 5DR2A 3Q2JA 1M2RA 3ACJA 3MH2A 4MBLA 4QMYA 1V0BA 2VTPA 4G34A 4N70A 5DBXA 5DWRA 3C0HA 3OUNB 3R9OA 2A1AB 4DBNA 4F09A 3BHUA 4X3FA 4FKTA 3KULA 5CZHA 2W4KA 3F5GA 3NX8A 2UVXA 3V8SA 4QP3A 2XNBA 4DF3A 1QPEA 3DQXA 1P4FA 3DDQA 4WHZA 3QX4A 2W96B 4BCIA 4IVDA 5FXSA 2QI8A 2WU6A 3UDSA 4TYEA 3LE6A 4X6RA 4DHZA 2BCJA 3NW6A 3IS5A 3BHHA 1O6LA 2IG7A 2WQBA 4PL3A 4LDTA 1PHKA 3ET7A 3GENA 5GNKA 4QP4A 4TN6A 2OJ9A 4CFWA 4QYGA 4NTSA 4WG4A 5HQ0A 3WOWA 2C0IA 1G5SA 3BQCA 4AW0A 2GMXA 2QOCA 3BBWA 5DE2A 4HW7A 3G15A 4EK5A 3AKJA 4FTNA 2VGOA 1GNGA 1I44A 1FMKA 5A6NA 4MTAA 1W82A 2BRMA 5D9HA 3I6UA 5CEMA 3E87A 2YISA 3KVXA 1JOWB 3QTUA 4IJ9A 3R01A 4U9AA 5CQWA 4NL0A 3FMLA 2R3LA 2OH4A 3AC2A 4UMRA 5DHJA 5J7BA 2OZAB 4FG7A 1ND4A 2BKZA 2VTQA 1OUKA 1M17A 2C6LA 3O7LD 5C03A 4BYJA 4IB1A 1KE6A 2CLXA 3TV4A 1UKIA 4D9UA 5IH6A 2PTKA 1R1WA 2BZHB 3OHTA 4JAJA 4PMPA 4DDIA 3ELJA 1W98A 3PIXA 3RALA 5AP1A 3RVGA 1NY3A 2YM8A 4S32A 4H39A 4RIOA 5JKGA 4EOLA 5AUUA 5M4FA 5CALA 2RSVA 3VNTA 4CYIA 3FZTA 5HG7A 1KSWA 4MD7E 3NMUF 4A4LA 2EWAA 3QQGA 3KKVA 4I3ZA 4FV2A 3N51A 4R5SA 3UOHA 4PUZA 2PVFA 3PJ8A 5FDXA 2QHNA 5GJGA 4D1ZA 4KBAA 4XG6A 4XV3A 1Y91A 1IAHA 3UMXA 4J7BA 2Y4IB 1ZYLA 3FMEA 3F5UA 4BDGA 5LVLA 5T3QA 2NRUA 2FYSA 5ETIA 3PXRA 3QQJA 2OU7A 2SRCA 4NIFA 3OWJA 4GFMA 3RAKA 2BAKA 1URCA 3I79A 4DFYA 4F9YA 4CVAA 4CFUA 4E26A 3DXPA 2REIA 3COKA 4ZTMA 5IUGA 2WQEA 3DB6A 2IO6A 3ORZA 2GPHA 2ZDTA 4HGEA 3RK9A 4JQ7A 4JBPA 4QO9A 4XHKB 4TYJA 4CT1A 4MEDA 2IN6A 4AZEA 4D2TA 3CD8A 5E1EA 5CANA 3PPZA 3G2FA 3R8PA 1PXNA 2PVRA 3FY0A 4O7SA 3A4PA 3TTJA 4FEWA 4R7BA 5IQAA 3QRJA 3WF6A 1PXLA 4O7NA 3WYXA 3VAPA 3KRLA 3V8WA 4CTBA 3W18A 1J1BA 3OY3A 4BDKA 4ZJVA 4FSTA 2UZNA 4QMUA 2JKKA 4BTKA 4NW5A 2NO3A 3NNXA 5ANIA 3UGCA 3VUTA 4CCUA 5KCVA 3FYKX 2F7ZE 4KABA 3T3VA 1T46A 3DBFA 3ZDUA 3PA5A 4EZ5A 1MP8A 3ENMA 4NCTA 3W2PA 3E8DA 4L7SA 5CU0A 3HV6A 2CN5A 2CNUA 5A54A 3BLQA 3T3UA 5D41A 3TACA 4OT5A 3OTVA 4DTKA 4I20A 5CX9A 2WTVA 2R7BA 4BBFA 4HYIA 3V5WA 5EYMA 3LFQA 1XO2B 1U5QA 1XMMA 1H27A 2Y4IC 4DFUA 3NUUA 2BHEA 2WMTA 4JR3A 3EZRA 4USDA 4OTRA 4GFGA 3C50A 3RWQA 2W1IA 3RWPA 1X8BA 1YXTA 1UNGA 3LCDA 3W8QA 4Z9LA 4D4SA 2YITA 3M2WA 4QP6A 3FZOA 1PF8A 2OSCA 5AUTA 4FG8A 4QQCA 3OT3A 4FTTA 5EDPA 4ZSAA 3UO6A 1PYXA 2OIBA 5HO7A 4L52A 3OW4A 2XP2A 2A98A 4BCMA 2NNWB 4QMMA 4UMUA 4JX7A 3QQLA 1WZYA 4X2GA 1R3CA 4FTOA 3UNZA 2FA2A 5CEOA 1L3RE 3TZ8A 3HMOA 2X8DA 4CMTA 2VTOA 4ZY6A 2JDOA 5E92A 5LCKA 5CS6A 5LCJA 4JQ8A 1OIYA 2OICA 3DKGA 3FAAA 3DLSA 4IM0A 2XALA 4RSSA 3DTWA 4HZRA 2V0DA 1Q4LA 3FWQA 4YC6A 5HE3A 5BMMA 3MTFA 2V7AA 4NTTA 3V5QA 3PY3A 1U4DA 3Q52A 5ANKA 5EI6A 2B9HA 5GZ9A 2XK7A 5EHOA 3H4JA 4RFYA 3KA0A 2IW8A 2IPXA 5AR3A 2PHKA 4JX3A 3DLZA 5BMSA 4RZWA 2R3OA 4XV9A 4ZLYA 1E1XA 5LARA 1J7IA 4HGSA 2X4FA 1A9UA 4G5JA 3RZBA 4CT2A 4D0WA 4GJ2A 2YM5A 4MQ2A 2BDWA 4LUDA 1G8JA 4NYEA 3LHJA 2C3IB 2IW6A 1NVSA 2RF9A 2VWBA 4XX9A 5HBJA 3QA0A 3P4KA 1H8FA 2ZJWA 4PTGA 4YJVA 3PXKA 4GCJA 2HWPA 4EQMA 3E7OA 2VWYA 3A2CA 2EB3A 4FICA 2C6EA 2X81A 3K3JA 3JXWA 3TNWA 2G1TA 2IVTA 3RNYA 4C33A 5LJJA 4AQKA 4R7HA 2HZIA 4QP7A 5IA5A 2YDKA 4MAOA 2Y6MA 4O0RA 5AP7A 1H01A 4IWDA 4ASEA 1YXXA 3UZRA 4R1VA 5DT0A 2OKRA 4M84A 4JR7A 3AMYA 3BEGA 4FYOA 4NJDA 3W2CA 5CAOA 3DCVA 1J3HA 2CMWA 1SVEA 3QFVA 3SX9A 4E4LA 3E3BX 2VRXA 4PTCA 4O0VA 2WELA 2GHLA 2ITYA 3MSSA 4AA5A 4CZUA 3KF7A 4RVLA 5L3AA 2BIKB 3UIUA 4X0MA 5M07A 4GVJA 1BKXA 5CAVA 3LJ0