3H9RA

Crystal structure of the kinase domain of type i activin receptor (acvr1) in complex with fkbp12 and dorsomorphin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
328
structure length
312
Chain Sequence
TTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activin receptor type-1
publication title Structure of the Bone Morphogenetic Protein Receptor ALK2 and Implications for Fibrodysplasia Ossificans Progressiva.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/protein kinase
total genus 105
structure length 312
sequence length 328
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
A PF08515 TGF_beta_GS Transforming growth factor beta type I GS-motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3h9rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3h9rA01
4OLIA 1ZARA 4EL9A 3OT8A 4ANNA 1W83A 4R7BA 3ZFXA 2BRMA 5BPYA 4GT3A 4EK4A 5IUHA 2ITYA 2VWBA 4XV9A 4S31A 3ZTXA 1SMHA 3RM6A 4TYHB 1QCFA 3WF8A 4HVHA 4CFUA 2XM8A 4PMMA 4ACHA 4GJ2A 5CEPA 1TQPA 1GAGA 3V5QA 3VS1A 3PA5A 4E73A 3FHIA 2NP8A 2WTCA 3MTFA 3GCUA 2OW3A 2BCJA 1GOLA 1DAYA 4WHZA 2W4KA 5CENA 3COIA 2WB8A 2GDOA 4IEBA 3TM0A 4EKLA 1WAKA 3PXQA 3NWWA 4G6LA 3ORLA 3HMPA 2J50A 4IACA 5LJJA 3ZRKA 1FVRA 5C9CA 4CCBA 4D2WA 2XKFA 3L1SA 2IZRA 2XP2A 5K0XA 3QD2B 1Y57A 4PUZA 4I22A 5AP1A 2IN6A 3TNQB 3TUBA 4PNIA 4CLIA 1LUFA 4RVKA 4QMOA 3QZIA 3F82A 3OBJA 5D1JA 1H0VA 3LW0A 2YM5A 4XH6A 3SC1A 4DFZE 4R8QA 4G3DA 5DLSA 2PZRA 4IHPA 4WO5A 2R3FA 5ANGA 3KN6A 3OTVA 3EQPA 1XO2B 2FSLX 2R4BA 4UMQA 4V0GA 3JY0A 2WIPA 2ZDTA 5CZHA 3LLTA 4CMTA 2OLCA 1XR1A 3QKLA 3R8ZA 2C69A 3QF9A 3KK8A 2CCHA 1GJOA 4LRKA 2W1EA 4D4SA 3FC1X 3CY3A 2PL0A 3Q4CA 5EW9A 4JX3A 1YRPA 2Y0AA 5LMAA 4O7RA 3NW5A 4PL3A 5TR6A 4FTMA 3FL4A 2ZV2A 4FKOA 1E1XA 3FPMA 4ID7A 5AUWA 4NM0A 3PTGA 4F9CA 1R39A 4YMJA 2BALA 3ORIA 3TUCA 2OZAB 2VTLA 3FZPA 2X8EA 2GSFA 1ZY5A 3PRIA 1PJKA 4DH7A 5E8ZA 4IB0A 3DK6A 5BUIA 3VBTA 3JY9A 4APCA 4LL0A 2HW7A 2XIKA 3MTLA 4FKUA 1ZMVA 4LOPA 3V04A 3Q60A 5KMIA 3P4KA 4FKPA 3Q52A 1OECA 3PVGA 4N4SA 3AD4A 3VNTA 4E5WA 3FZ1A 3FZSA 4F9YA 1OL7A 4FL2A 2PVYA 3AD5A 4O0TA 3MY1A 4K8AA 3SG9A 3KMUA 1MP8A 3GT8A 4E1ZA 3HV4A 3DQXA 4DHFA 1CKIA 3CTQA 4S32A 4X2KA 5CEQA 4EH6A 5IEYA 4F6UA 4KKEA 4IVCA 3P7BA 4YHFA 5AR2A 1KOAA 3QQFA 4LV8A 4I23A 4BI0A 5BX0A 3JXWA 3QXPA 4UMPA 4FV6A 3KVXA 4CT2A 4WKQA 4LQMA 3R9DA 2QOHA 4FIJA 1CM8A 2HY81 3BQCA 4O7YA 4GU9A 4QQCA 2IJMA 1KUTA 5IDPA 3FJQE 1M2RA 4RA4A 1VJYA 3PXKA 2BR1A 4FNZA 4UXLA 3PWDA 5A6OA 1YI3A 3H4JA 3N4VA 1K3AA 3FKLA 3FSKA 2VWZA 4GL9A 2WTKB 3OCGA 2JKKA 1J7IA 4P90A 5EQPA 2R3IA 2ESMA 3BZ3A 3VJOA 3C1XA 4ZTSA 5IA3A 4YZ9A 2XRWA 4XMOA 5IUIA 4TYHA 4EBWA 4HCTA 4BWKA 4Q9SA 3NUNA 2Q83A 3LIJA 4IB1A 1Z57A 3HUBA 4O0XA 5DEYA 5HX6A 4RRVA 2FB8A 2R3GA 4X6RA 1XH8A 4ZXTA 5DHJA 4EH4A 2AC3A 4YBJA 3E3BX 4AT3A 1OVEA 2ITUA 4DEEA 5KX8A 2GU8A 5JGBA 2IVVA 2PULA 3BYOA 3PSDA 4F7NA 2XB7A 5BNJA 3BPRA 3ZHPC 3S1HA 2R3JA 2VO3A 4J97A 5HIDA 3FYKX 4QP4A 5FXQA 5JZJA 2UUEA 1YDSE 3PE2A 4L44A 5EKOA 2OFVA 3CPCA 4RVLA 3VS4A 3NX8A 2XKDA 2PU8A 1FPUA 2W1DA 1GNGA 3CQUA 3MS9A 3U9NA 5J95A 3HL7A 3R1QA 3T9TA 2ZV9A 3NW7A 4BB4A 2VU3A 5IG1A 2YIYA 4FODA 4ZSAA 4E7WA 3EJ1A 1XH9A 3BI6A 2A19B 4YZMA 4BDDA 5A4QA 4DF3A 2C30A 4XLIA 2J0MB 5M09A 2H8HA 3Q04A 4GKIA 1Q62A 3HDMA 2GNIA 2GMXA 2WMRA 3A7JA 3EN7A 4ZTLA 4R5SA 1LEWA 4C3RA 2X9FA 4EH7A 3QTUA 3HNGA 3R9OA 4IAZA 4ZLZA 2C5OA 3SW4A 2FA2A 5IKWA 5AV0A 2VX3A 2PZPA 2OZAA 4E5AX 5HNGA 4RJ7A 3TNPC 4NIFB 5HE2A 4UN0C 5DMZA 2QOCA 3I4BA 3QCQA 3S00A 5JEBA 1IASA 4CGAA 1OKZA 5G6VA 4F6SA 5ACKA 4JBQA 4TNDA 2UZVA 2RGPA 3UIMA 4ACGA 3AMBA 3QUDA 5FRIA 3RINA 3S3IA 4FYOA 4LYNA 5LVLA 5AIRA 5L2IA 3FMHA 1XWSA 3LFQA 5CXZA 4M69B 4BGGA 1VEBA 5CI6A 1WBVA 4L9IA 3PY0A 1H1WA 3RHKA 4G9RA 4QP1A 3QCYA 5DR2A 1XBAA 2B9FA 3OWJA 3FMEA 4FTRA 4R3PA 4BDFA 2YCFA 3EFLA 4M0ZA 3OZ6A 3HEGA 1K2PA 2Z7RA 4GIHA 4MD9E 4X2FA 4TPTA 3FLZA 3PY3A 5AP6A 3H9OA 5HVJA 4DFNA 4FX3A 2J51A 2OF2A 3SW7A 1PXOA 1BKXA 5CU3A 4WNKA 2J0IA 3NGAA 3H0YA 3MA6A 5DI1A 3IDPA 1XBBA 5K3YA 1UV5A 5TT7A 3RK7A 4P2KA 3PLAE 1E1VA 3GCQA 1YOMA 2VGOA 2YWPA 3W2PA 4FKSA 5EI8A 3RAHA 3CD3A 4TWPA 4R78A 5BVOA 3I60A 3TDWA 2XK6A 2PK9A 3FMLA 5E90A 4O7WA 2BMCA 2XK4A 1FVVA 3ZO1A 3U51A 2B55A 3A7FA 3PIZA 2B9JA 5AUXA 5KO1A 1ERKA 3EYGA 5J1VA 3KC3A 2P2HA 3UNZA 2NRYA 2YZAA 5IEXA 3O7LB 2W5HA 3ZLWA 2XKCA 4CT1A 1BMKA 3EQGA 3TT0A 3VRYA 4OTRA 3DU8A 4BDBA 2VV9A 4C4GA 2CGXA 4HYUA 3VS7A 5HVYA 2UV2A 2YIXA 1FGIA 3VW6A 3FMNA 5AUYA 2FH9A 4FKLA 3Q9ZA 4GFMA 3DJ5A 4II5A 4C4HA 4C34A 1BUHA 5EQYA 3GCPA 1U4DA 2PUPA 4L52A 3L8XA 4EK5A 1CDKA 4C2VA 4GK3A 4BF2A 3BRBA 3R7GA 1MUOA 3REPA 4S34A 4XV1A 4CD0A 3MFTA 2C5XA 3I0QA 2J5FA 4YBKA 2WU6A 4FI1A 5JK3A 3L9MA 3QXOA 3TNWA 1HCKA 2PVLA 3WYXA 2IW6A 4QMPA 3QWJA 2GNLA 5AR7A 4UY9A 1TQIA 4L68A 4FVQA 4YJPA 2PMOX 2GNFA 2R3MA 4IWDA 5L8KA 5M4FA 4C61A 3WF6A 4LL5A 4BDGA 4GJ3A 3NYOA 3FY0A 3GB2A 5HG7A 4DG0E 3OCTA 4QYEA 4RFZA 3PPKA 3KKVA 3EIDA 3ZFYA 4QTBA 5BVKA 4YHJA 1Q24A 3PE1A 4DGOA 3IGOA 3PG3A 1ZMWA 4LGHA 4MXXA 3TV6A 1J7LA 4BCOA 2B9IA 4C3PA 4JIKA 3SX9A 1P4FA 3PXZA 2ZM3A 3AC5A 3WBLA 4TTHB 3ZYAA 4IWQA 4E4NA 2PUUA 3QRUA 4NIFA 4FICA 3VC4A 3ZBXA 3L9LA 1GZNA 3WIKA 4PNKA 2WU7A 3QYZA 2X2LA 2WOUA 4ZY4A 4F0GA 5KCVA 1HCLA 2PMLX 3H3CA 4R3RA 4USFA 3VWAA 4RIOA 4CFXA 4PPBA 4AOJA 3SQQA 4JG8A 5AP4A 4HYHA 2Z8CA 4ZIMA 3R28A 2QD9A 3DFAA 2YZLA 4RIWB 3MGYA 3PVBA 3ULIA 1B39A 2RFDA 3DBCA 3ZBFA 4ALVA 4LUDA 2CDZA 4BVUA 3QUPA 5CQWA 1FMKA 2R3KA 4IC8A 3FMKA 3A2CA 4FTOA 5EM8A 2EUFB 4BL1A 2W96B 4TXCA 3V6RA 2QOFA 4PPCA 3TTIA 4QYGA 1LR4A 4G5PA 4O96A 4BN1A 4QD6A 2EU9A 5F20A 4WNPA 2RF9A 3VIDA 4QP9A 2JIUA 2WNTA 3GU4A 5CVHA 2JD5A 5TO8A 2QNJA 3MIAA 4HGLA 3D94A 5KZIA 3C0GA 3MFSA 4R1YA 4O86A 4BWPA 3ZUUA 2GHLA 5FXRA 3DDPA 1F3MC 1Z9XA 2W1GA 3D2IA 4Q5EA 5D10A 4ZJIA 5C1QB 3R8MA 2R2PA 4EH9A 2VO0A 2Y4IB 2VNYA 5HG5A 5CEIA 2EB2A 4DINA 1Q61A 2BDFA 2H96A 2ZM1A 4Y95A 5CSPA 2RSVA 5L6WL 4C4JA 1SVHA 5HLPA 2BRHA 3HECA 2JDSA 3IONA 3BE2A 4K6ZA 4EQUA 2JKQA 3ZLXA 3ZLYA 5HGIA 4C37A 4F4PA 1Y91A 3WYYA 3H9RA 4C57A 3QZFA 3ODYX 3GENA 2GFCA 3ANQA 2C0OA 3KCKA 4UMRA 3PXRA 4ZTQA 2FSTX 5HESA 2OXXA 3TJDA 4C62A 4F9BA 1IA9A 2OU7A 2W9FB 3GQIA 4I0TA 4O0VA 5M4UA 4E4MA 2OFUA 2YISA 5LWNA 4CYIA 3NSZA 4IM0A 5K0KA 4EZ3A 4RC4A 1PKDA 5GZ9A 5IZFA 4EUUA 4PQNA 3VUHA 3HDNA 3O8UA 2GQGA 5FBOA 3DXQA 3V5WA 4ZAUA 1RE8A 5GHVA 1OL6A 3OWLA 4BHNA 3LFCA 3F6XA 3SRVA 2BZIB 3MVMA 1STCE 2J6MA 4USDA 4WBOA 4D2TA 3G0FA 3ZS5A 1KV2A 4LG4A 3ZSIA 2QCSA 3MV5A 3RJCA 2UW0A 2UW7A 5E9EA 4BDHA 4FV3A 2HYYA 5DA3A 4KBKA 1H1RA 4YPDA 3QGWA 4FL3A 5J8IA 3GCVA 2YLFA 2P4IA 4IZYA 5I9UA 2VTRA 3ZEWA 4OT6A 3DBQA 1RDQE 3O50A 3U4UA 2VTPA 2WMVA 2R3PA 4L3LA 3DAKA 5HOAA 2HZ0A 2REIA 2Y6MA 4M0YA 4RX8A 2PWLA 4O0UA 4BDJA 2C5YA 1BI7A 2UZNA 3ZH8A 4QTAA 3UOKA 2C6DA 2DUVA 2YABA 4FV2A 4GIIA 4U9AA 2JC6A 2PZYA 3LCDA 3FKOA 4OUCA 3QKKA 2JKMA 3SHEA 3I5NA 3PDTA 4MK0A 3TACA 3R9RA 4I6FA 3LJ1A 5DIAA 3KA0A 3RHXA 3K5VA 3LQ3A 3RCJA 3IO7A 4XYFA 4FOBA 3MY0A 5JH6A 4O84A 1A48A 3MB6A 3R2BA 1IRKA 2GPHA 3ERKA 4BFMA 3P5KA 4UMUA 1PMUA 1OIQA 3Q5ZA 4EQCA 4DTAA 4V04A 2IVTA 4RIWA 4KNBA 5F94A 5AV3A 4E6QA 4FSRA 4NCTA 3SKCA 4YGAA 3NUUA 5D7VA 4MCVA 2UZLA 2BILB 2I0HA 3PJ3A 5DGZA 4E8AA 2XM9A 3MFUA 3MVHA 5CT0A 1ZZLA 1YWVA 5M4CA 1FBNA 4FKVA 4ZJJA 5KNJA 5CSHA 3R73A 1XH6A 4M8TA 3FAAA 2B1PA 3OVVA 4JBVA 4YP8A 5J87A 3NNUA 5A46A 3ZFMA 1CSNA 5AA9A 2NPQA 4FSWA 2X8DA 1PY5A 3EL8A 2VD5A 3LXLA 4J99A 5JSMA 3II5A 4DH1A 3NW6A 1Q5KA 3EQHA 4W4WA 2UZOA 4TYIA 3CCNA 4UYAA 2OJJA 4D28A 3NNVA 4UWCA 4YJRA 4L3PA 5CTPA 5IQBA 1DAWA 3MJ1A 4ANMA 5IMEA 4E20A 2ZAZA 2HZNA 4D4YA 1XJDA 4XG3A 4FTJA 4QRCA 2VTNA 3UE4A 1NT2A 2XS0A 4ALWA 4KIPA 4PL4A 1W82A 4LGDA 3LMGA 3GVUA 3R1SA 2WHBA 2VNWA 4WA9A 4XX9A 3T8OA 5DYJA 4PDOA 4FEWA 1JPAA 4FTUA 3QX2A 4MAOA 4CV9A 2E9NA 4FGBA 2RIOA 2I0VA 2KTYA 3ETAA 4FSTA 3KRLA 4ZLYA 5FXSA 2YN8A 3RBWA 4O1OA 5DWRA 2OJFE 5AM6A 5DT0A 3SLSA 4CSVA 3SXRA 5CF6A 5L8JA 3TNIA 3R7EA 5BVWA 3PPJA 1OKWA 3Q4TA 1IG1A 1JKLA 5IQCA 3AT4A 3CXWA 3KXGA 3UG1A 4AX8A 2OKRA 4CG9A 5FEDA 4FVRA 4I24A 4MQ2A 2V7AA 4J7BA 3G51A 3GOPA 5AUUA 2R9SA 3D5WA 3OWPA 2OO8X 4PF4A 3OWKA 3EQBA 4JR3A 4O7LA 4DEDA 5K5XA 4FYNA 1H28A 5IPJA 3BHUA 4DE4A 4QMMA 4FNYA 4FZ7A 5ANEA 4ANOA 3VS5A 4GS6A 2XIXA 4I5HA 3FXWA 4F7LA 2ZVAA 3EH9A 4JDHA 4KA3A 2YCQA 3MDYA 4EC8A 3TUDA 3F2AA 3AT3A 4X3FB 3CD8A 5AV1A 4EWHA 5CU0A 1Q8YA 2RFEA 5I5ZA 2PY3A 4ACDA 1URCA 5IH4A 3MH2A 4U41A 4AA0A 5D11A 5F1ZA 1R78A 3CIKA 3FLYA 3KREA 4I6BA 3KN5A 4QP3A 5EHOA 1KWPA 5DT3A 3Q3BA 2F7XE 3FDNA 1NVRA 5AP7A 2GQRA 3MJ2A 2XZSA 3SD0A 3QX4A 3BKBA 5J7HA 4XRLA 3MY5A 3QQUA 5M07A 1FQ1B 1UU9A 4ZZOA 4KIQA 3WZKA 2WKMA 4X2NA 3WZEA 3KF4A 4FIFA 3N9XA 4XG6A 3RPOA 2YIRA 4Z16A 3E8EA 5HBJA 3QKMA 3DLSA 4UB7A 2OXYA 1EH4A 2QURA 5CVGA 2GNGA 1GY3A 4Y85A 3RNIA 3E7VA 4IANA 4EONA 5IQGA 3ZOSA 3TNHA 4ANSA 3RNYA 4JVGA 3MA3A 4CKJA 3UMXA 3IS5A 1X8BA 1YXVA 5G1XA 4BICA 2G2FA 5KUPA 3BEAA 2C3JA 2VWYA 3LCSA 3PSBA 2PPQA 5CAVA 1A06A 4FNXA 2ZB1A 4Y46A 2PVFA 5AADA 4GFOA 5E4HA 4UEUA 2JGZA 3G9NA 3DXNA 3WOWA 3PY1A 1J3HA 2XNBA 5EHLA 4YURA 2V55A 5AEPA 4QO9A 2PTKA 3LKMA 4IW0A 4S30A 4YLLA 2C3KA 4AU8A 4DEHA 4ERKA 1U5QA 1ZYCA 3W8QA 3KXXA 4PP7A 2C0IA 2Z7SA 2CCIA 4KSQA 2XEYA 1GZ8A 3FMMA 2YFXA 2X7FA 3NYXA 4GT4A 3BHYA 4C4FA 4A9UA 1UNLA 4K18A 2B0QA 4IX5A 4YO6A 1ZYSA 4C3FA 4MH7A 3VBYA 1VYWA 3BGQA 4FIEA 4GVJA 2B52A 5CAOA 5L4QA 1UVRA 1YDTE 4L7FA 3EHAA 4K11A 3H0ZA 4IMYA 4C0TA 4ZTRA 4D2SA 1V0BA 5HIEA 4OTPA 1H1PA 4LV5A 2XCHA 3SDJA 4PMTA 5IQFA 3Q4ZA 4IBMA 4IB5A 3F3VA 3UPXA 1WFCA 3DTCA 3LFBA 3VUMA 4GV1A 3U4WA 1URWA 1P14A 4W4VA 4MD8E 3I7BA 4JQ8A 3OTUA 3AG9A 4U7ZA 3CR0A 4HGEA 5DH3A 4CCUA 5A4TA 4UBAA 3JR1A 3K54A 4YNEA 1H1SA 2QI8A 3UIXA 1OPLA 3GU5A 3DS6A 1G8SA 5E91A 2UW6A 4CXAA 2I1MA 4W8DA 3VULA 3R7UA 2GNJA 4X3FA 4MQ1A 3T3VA 5KMKA 3PZHA 3E92A 2ETRA 2WTWA 3ET7A 4RX9A 3D5UA 2WZJA 4PMPA 3NPCA 5EOLA 1BL7A 4KKGA 5JZNA 3ZMMA 4JIAA 2OZOA 4ZLOA 4S33A 1LPUA 1SZMA 4XEYA 5HCXA 3NVMB 3DCVA 1APME 3ZONA 2RFSA 3UTOA 4FT9A 4NKSA 5HO8A 2F9GA 2IVSA 3FC2A 4FV8A 5B2KA 3QA0A 4KD1A 5EH0A 2O5KA 3KXMA 4JNWA 5LMKA 2YM4A 3GEQA 4ZY5A 2WQBA 2EXCX 3QRJA 3SVVA 1G8AA 2WPAA 3N4UA 3QU0A 3IW4A 4ZK5A 3POZA 4C2WA 3UOJA 3IW6A 3EB0A 4ARKA 3SGCA 2A27A 3UVQA 4QTDA 5LVNA 3OOGA 3RMFA 4C58A 4A4XA 4IAAA 4IAKA 4CLJA 3EYHA 4YTCA 4XLVA 1ZXEA 3GC7A 4D0XA 5J5TA 4NJ3A 4GT5A 4RWKA 3HRBA 3QWKA 4ASDA 5IEVA 3GU6A 4U81A 1H25A 5BYYA 5D7AA 2O64A 1WBPA 1L8TA 3G33A 4RWLA 2E2BA 2JEDA 4TYEA 2XIRA 3QHRA 1Q3WA 2VTTA 3OEZA 4MXOA 5CF4A 2NNWB 2BHEA 4EHVA 3P86A 1BYGA 2XYUA 5ANIA 3TKHA 4D2RA 5GINE 2XNMA 2HAKA 2VWUA 3O0GA 1Q41A 4Q5HA 5IF1A 4NM7A 2VRXA 4I21A 4DGLC 4IAFA 1DM2A 4RJ8A 2YEXA 3E88A 4FTTA 4AW1A 5IA4A 4JDIA 3CKXA 2J0KA 3D7TB 4BCNA 4MVFA 2YCRA 3E7OA 4CFMA 3EQDA 3R22A 4YNOA 3C0IA 4UXQA 5AAFA 1WVXA 3UGCA 2O63A 2PVRA 2XNNA 3AC2A 2V0DA 4HJOA 4XOZA 3VF8A 3WARA 2W9ZB 4FKTA 5EKNA 3U6HA 5KMLA 4R7IA 5IA2A 4U5JA 3U6IA 3D5XA 5E1EA 5EHYA 3CTHA 1XHAA 4PDSA 4AZTA 2CLQA 3ANRA 3MVLA 3UO5A 1VYZA 3DOGA 2GTMA 1FMOE 4XG4A 4E4XA 4DA5A 5EDQA 2O3PA 4QP8A 3QBNA 5EDPA 3DXPA 1H24A 3PJCA 4NT4A 4EOLA 1UU7A 3LQ8A 4J95A 1OGUA 4J96A 1K9AA 3KK9A 2HWPA 5LQFA 3ALNA 3Q9WA 3EQFA 3DZQA 3RPVA 3CQWA 3RPYA 2WTKC 4TT7A 1ZAOA 4JJRA 3QTSA 3WZDA 2VO7A 5EFQA 3IGGA 5KMOA 4I41A 4QT1A 3RKBA 1WVWA 4QPMA 4YZCA 4C38A 4F6WA 4EBVA 3F5GA 2XNGA 3QALE 2IW9A 3UIBA 4F9WA 4BDIA 5AUTA 3CQEA 4RIYB 3LMHA 4X7QA 3QCSA 3F7ZA 5HE0A 5HU3A 1NA7A 4IVAA 3PG1A 3AD6A 3NR9A 2C1BA 5AUVA 4DBNA 4YPSA 4AN9A 4EI4A 3COHA 2WTJA 2FO0A 4M12A 2IPXA 4G3EA 2C3IB 5KMJA 2BTSA 3QL8A 4GRBA 3HMOA 1R1WA 4KIOA 1UKHA 2X7OA 3UODA 4ZJVA 4X2GA 3K3IA 4YJOA 4XS2A 2I6LA 5F9EA 4G31A 3I6WA 3GP0A 4GCJA 3E64A 3VUIA 5A4LA 2JBPA 2PUNA 2BTRA 2OIBA 5HORA 4QNAA 4NH1A 4WNOA 4EC9A 4O6EA 5KMMA 5CF8A 1PMVA 3E5AA 4IQ6A 2XVDA 3R21A 4NW6A 3TV7A 2OICA 1YXSA 3IDBA 5T68A 3FHRA 4BWXA 5BUJA 4I5PA 4FV0A 1HOWA 5HE3A 3FQSA 4DC2A 4FKIA 4CTBA 1I09A 1OKVA 2YAAA 3Q2MA 5LXMA 2W1CA 5I4NA 3F2RA 1DI9A 2I40A 1DS5A 5AR8A 2BIYA 5ITAA 1IAHA 2VX0A 4J71A 4FV5A 2PE0A 3DAEA 4IDTA 3T3UA 4EJ7A 4USEA 3HUCA 4I92A 5E8TA 3FI4A 1P4OA 3ID6C 2QG7A 4FTNA 3SAYA 3CGOA 3W32A 4B0GA 4XBUA 3PJ8A 4RJ3A 4G3FA 4MNEB 4DFYA 5FTQA 1CKPA 3K5UA 3KULB 2WD1A 5DN3A 5ETCA 4YU2A 3AMAA 4MXYA 2X2MA 4BDCA 4ZSJA 4RQKA 5ETIA 2C0TA 4NM5A 4P5ZA 4YC6A 3BU3A 3GC8A 3JVSA 4GW8A 4NEUA 1T46A 4ACMA 5HG8A 1UU8A 2Z7QA 2ZMCA 4X3JA 4M68A 3VUTA 4H3QA 1UA2A 5H3QA 2OXDA 4J8NA 3EKNA 1YXXA 2HW6A 3D7TA 3CKWA 3OP5A 4FT5A 4OAVB 4LOOA 3CS9A 4A07A 2F7ZE 2GQSA 3FLNC 3ZC6A 3M2WA 4ALUA 5L8LA 3W2RA 4XG8A 5GJDA 2J9MA 4M7IA 5I9YA 3G15A 2GHGA 5HTBA 3SG8A 2HELA 2CN8A 1VR2A 4MD7E 5DG5A 3OUNB 4UWBA 4FA2A 2CMWA 1L3RE 3F66A 4FTKA 4XBRA 5BUEA 2Z60A 2C5VA 2PVHA 3U8WA 3A60A 4EHGA 5M06A 2JIVA 4YJTA 4DTBA 2B9HA 4IM2A 1SYKA 5EDRA 4JX7A 4AF3A 4J52A 1JKKA 2E9UA 2JAVA 2BAJA 2QVSE 4C4EA 3NUAA 4AXAA 4CVAA 4XUFA 3V3VA 4LOQA 2QKWB 2YJRA 4IX3A 4AA4A 4OBQA 3JPVA 4BCHA 4EOSA 2ZDUA 3C51A 4IFCA 4YLKA 5ANJA 4RJ4A 5L2SA 4NWMA 2AUHA 4EOKA 4FTQA 3TI1A 5EOBA 1BL6A 1QL6A 2VWVA 3R7OA 2R3QA 4RGJA 2HK5A 4O1PA 4EHEA 3OMVA 2XK3A 5EK7A 4RIYA 1Y6BA 4C7TA 4OAUC 4NL0A 5K4JA 2YM6A 2IZTA 3GFEA 3TZMA 4U79A 2QG5A 3GU7A 3LJ0A 4AP7A 3MN3A 4EOMA 3OY1A 5AM7A 2FSOX 4EOIA 3R2YA 4E6DA 3W33A 2EWAA 2WAJA 4I3ZA 4G9CA 3R7VA 3TWJA 4OBOA 3F3ZA 3Q32A 4LMUA 4ZTHA 5HHWA 4KWPA 4YTIA 2R3NA 4EHZA 3U87A 4A9RA 5B2LA 5E8WA 2B54A 2VN9A 1S9IA 2XMYA 4U8ZA 3DV3A 5AJQA 3SXFA 5HD4A 4AGWA 2R3HA 4M66A 3QHWA 2C6KA 4G2FA 4O0YA 3HMIA 5E8XA 3GGFA 2HWOA 4PX6A 4DLJA 1PMEA 3GFWA 4DG2E 2I0YA 2RFNA 1OB3A 2B53A 4YSMA 4UYNA 4CKIA 2H9VA 5CNNA 2QOLA 2QLQA 5AR4A 4JT3A 1JKTA 3FKNA 3A7GA 4XG2A 5FG8A 2VTSA 1CKJA 4KABA 4FTCA 3DK3A 4J1RA 5KBRA 2IW8A 5HCZA 4RBLA 3AOXA 2J2IB 4RLLA 4MNEA 4BTMA 4WSQA 1RJBA 3R04A 3AQVA 1ZOEA 2BRGA 2HZ4A 3KFAA 3RTPA 5A4CA 2BIKB 2ITOA 1LEZA 4TWNA 2QODA 1OI9A 1QPEA 3TEIA 1OL2A 1F0QA 2WMQA 2OJGA 3OXTA 1P5EA 2CGWA 3PVUA 4MKCA 5HCYA 4Z7HA 5HU9A 5BYLA 3AGMA 1MQ4A 2OK1A 1PXMA 3D9VA 3MBLA 4FKQA 2IO6A 2R3RA 4NKAA 4TN6A 3WIGA 5DPVA 4PDYA 1UWHA 3F9NA 5FP5A 3CEKA 5GJGA 3BEGA 3NUXA 4C59A 3LXPA 3B8RA 4FZAB 4QQTA 4UZDA 5I9WA 2JDVA 3OXZA 1NVQA 2JDRA 4NCTC 3WE4A 4AA5A 1H8FA 4IX4A 1QPDA 3FI3A 3GXLA 3R8LA 4M69A 1OZ1A 5DFPA 2NRUA 4BKZA 2Z7LA 3LMIA 3BLRA 3ZUTA 1YDRE 3FZOA 3KEXA 4AGCA 4O0SA 2W06A 3KRXA 4FV1A 4AZFA 4IIRA 3R71A 1OL5A 3R01A 3UYSA 4I4EA 5IDNA 4BI1A 2X1NA 2XBJA 3D0EA 4A7CA 4FKWA 1M52A 4E6AA 2CSNA 3MFRA 1H00A 4RPVA 2PE2A 3CC6A 4OTGA 5FBNC 5JGDA 3G6GA 4D5HA 4BBMA 5HBEA 4O7TA 3JS2A 2Y4IC 2BZJA 2X8IA 3F7WA 3NIZA 5AP5A 4CQEA 3OFMA 4YJSA 3QLGA 3RVGA 4DH5A 2JAMA 3M11A 4QMSA 3OS3A 3F3WA 4BC6A 2YIWA 2I0EA 3HX4A 5JFVA 3DQWA 4JBOA 2ZMDA 3HMMA 3PXFA 3V5TA 1Z5MA 3NAYA 3Q96A 1U59A 2HXLA 5KHXA 4O7SA 4IZ5A 4G3GA 3VBXA 1YQJA 2F4JA 4NTSA 5J1WA 3FBVA 3G0EA 1JVPP 3PLSA 3LE6A 1TQMA 2JKOA 3LPBA 4FSQA 4HOKA 2OJ9A 4UZHA 3KL8A 1PXPA 3RAWA 3D83A 3UMWA 4ZMEA 1KV1A 2P2IA 4BTFA 4NFMA 3KXNA 4O38A 4E5BA 2HXQA 1YXUA 3E8CA 5FM2A 1NXKA 5C03A 4CNHA 4NFNA 4I20A 4U6RA 4XV3A 4QTCA 3RPSA 3MYGA 4BCIA 3TDVA 2XBAA 1KE8A 2OF4A 3DKOA 1J7UA 3CSVA 3OOMA 1M14A 4AE9A 1T45A 4MWHA 3E87A 4BCMA 3L8VA 4KBCA 4WUAA 5DR9A 3ZU7A 4MXAA 4G3CA 3AT2A 3IOKA 3A8XA 2XNEA 4W9WA 4A06A 2YDJA 3DGKA 2W17A 3PUPA 4QMLA 1SNXA 3Q6WA 5CEMA 2XCKA 5JFWA 1W0XC 3HV5A 3HRFA 4MYGA 3R30A 4GSBA 4CZUA 5BQ0A 5FUTA 2JFLA 2XA4A 2F57A 3ENMA 4NK9A 4M97A 5AX3A 4XCUA 5IUGA 4O83A 4ZS4A 1FVTA 1SVGA 2UVZA 4MBLA 3NYVA 3RAKA 4D1SA 5AA8A 3D15A 3VQHA 4ENXA 5IQIA 3PA3A 4IDVA 3C0HA 4O0WA 4L3JA 4F9AA 4K33A 4FR4A 2ZOQA 4TKSA 1AGWA 3W55A 3O17A 3Q6UA 1ZOGA 2LAVA 3QTQA 1M7QA 1KE5A 4QP6A 5FEEA 3EN6A 3UQGA 3AC1A 2QU6A 2WELA 3E8NA 3UPZA 4JG6A 1ZZ2A 3ACKA 3CE3A 4IWPA 3V5PA 5H9BA 1JQHA 2ETKA 4OTHA 3G6HA 5I3RA 2C4GA 3P7AA 3VS0A 1WBWA 1SVEA 4R3CA 5CAQA 5KE0A 4D2VA 3HRCA 5BMSA 1JSUA 3NIEA 4IE9A 1OPJA 5JRQA 3LVPA 4N6YA 4QP7A 3H10A 4XRJA 3I5ZA 4WT6A 4YUQA 1NW1A 2V7OA 4N70A 2IWIA 3GBZA 4MWIA 5E8YA 2W05A 4TZRA 3U6JA 1RQQA 3B2WA 1YHWA 4QOXA 4AACA 2OSCA 3JUHA 1WBSA 2GNHA 3PIXA 3CP9A 4JQ7A 3BGPA 2XKEA 4P7EA 3R7IA 4EH2A 3F5UA 4MTAA 3UVRA 4I5MA 4AZWA 4XNEA 1FINA 2VTAA 4OGRA 3IG7A 2BAQA 4EZ5A 3BBWA 4ASEA 2WEIA 5DOSA 2DYLA 4D4VA 1H27A 2R3OA 3NS9A 5FWKK 2PHKA 2WMAA 3P1AA 4CZTA 4O22A 3EQRA 3QA8A 4O27B 3C4WA 3UZTA 5KHWA 2WTDA 3DKFA 4B8MA 4C4IA 4R6VA 3PJ2A 3BX5A 4IH8A 3QZHA 3SV0A 4GH2A 4PY1A 4DGNA 3D2KA 4IXPA 3A7HA 3CY2A 4WRGA 4BGHA 2C1AA 3GC9A 3IDCA 3HMNA 2ITWA 3QRIA 3FXXA 2J7TA 4V01A 5DVRA 4EOPA 1PRYA 1YXTA 5H2UA 2J4ZA 2G9XA 4EH8A 2PSQA 4RSSA 3R1YA 2WTIA 1H01A 2WOTA 3M42A 2W5AA 2JDTA 3QFVA 4BDEA 2PYWA 4RIXB 5DE2A 3VW8A 3ZLSA 5C8KA 4FK3A 4UX9A 4PDPA 1Q4LA 4XP3A 3F3TA 5BVEA 2BRNA 1JAMA 2BFXA 4GU6A 4AS0A 3P0MA 4RFMA 5L6OA 5AV4A 4ZY6A 4PL5A 3BBTB 2YITA 1JWHA 4UALA 1V0PA 2C6OA 4U44A 3EN5A 4F1OA 5AIKA 5KMNA 3HV6A 2GCDA 5L3AA 5LCJA 3QQLA 5EW8A 1CMKE 2QOOA 3R02A 2RG5A 3NLBA 4PRJA 3IK3A 3BQRA 2QQ7A 3UC4A 5CANA 1PW2A 4FSYA 4U42A 5FD2A 4F63A 2W1IA 4DEGA 3LFFA 3EZVA 4I6QA 4X3FC 1OUYA 2PUIA 4DYMA 2YHVA 3H9FA 5IU2A 4W4XA 1XBCA 1YHSA 2VTJA 4L46A 3E93A 2ITQA 4KKHA 4Q2AA 4QMQA 4DFXE 4D4RA 2C47A 5EW3A 3RI1A 4X21A 5AP2A 3WI6A 4AWIA 4BYJA 4NW5A 4FUXA 2UZDA 4DLIA 4AGDA 5M53A 1KE9A 3B8QA 3BWFA 4F0FA 1OBDA 2YIQA 5AWMA 3I0OA 5D9HA 3PA4A 5JRSA 4DT9A 2ETMA 1Q8ZA 4NU1A 1WMKA 5HZNA 3FZRA 3PPZA 1ZOHA 5EI6A 5IA1A 1PF8A 4FC0A 4HNFA 4ZOGA 5GIOE 2I7QA 4DFBA 1FGKA 4B99A 4BIDA 3THBA 3DBDA 3IECA 2AYPA 2BRBA 3QQHA 5LVPA 4WD5A 2J0LA 4RX7A 5I9XA 5J7BA 1RW8A 4NSTA 2GS2A 4RX5A 3QLFA 3TG1A 3PFQA 2C6EA 3A61A 2W1FA 3W2SA 2WFYA 5EM5A 4BRXA 4BZNA 3NMUF 4AQCA 4TWOA 2Y4PA 5KZ0A 4LM5A 2VWWA 5HQ0A 3VF9A 2P33A 1Q8UA 1YWRA 3R6XA 5CNOA 4YZNA 5L2TA 3V6SA 4WIHA 1IR3A 3BCEA 3PP1A 1KE7A 2WTVA 2C6LA 4FK6A 4D58A 4Y8DA 2BFYA 3UJGA 4U45A 4BZDA 4ANQA 5JT2A 3FMDA 4CRSA 3CJGA 4L67A 2B4SB 1OIRA 1Y6AA 2JIIA 4H58A 4JAJA 2NO3A 1KOBA 5K9IA 4FEVA 5CEOA 2ZM4A 4EWQA 4XV2A 4F65A 5DBXA 4OTQA 1ZWSA 3KCFA 1WVYA 5KKRB 2QLUA 3R8PA 4I0SA 2G2HA 4Y72A 3TV4A 2FGIA 3DBFA 2O0UA 5AUZA 3W8LA 1BX6A 3UNKA 2X39A 3D14A 5HNIX 2HZIA 4CFNA 1JNKA 4H05A 4V05A 1W84A 1UWJA 1FOTA 4U97A 5EYKA 4D55A 2IZUA 3VS3A 4V0GB 4IX6A 3LXKA 5EM6A 1JSVA 3JVRA 3ROCA 2CKOA 3W16A 2EVAA 3FQEA 4TNBA 4FOCA 3RWPA 4FMQA 4O6LA 4F70A 4QYFA 3WF5A 4QMXA 2YAKA 2XJ0A 1Q3DA 3DFCB 4TYGA 2VX1A 3VS2A 3DB6A 3E8DA 3MH0A 2QR8A 4FIGA 5HG9A 3CBLA 5EI2A 4JS8A 4EEVA 2Y7JA 2PMNX 2C5NA 3FL5A 3HKOA 4QQ5A 4FF8A 4ZTMA 5JFSA 3CGFA 4FKJA 4EZ7A 4FVPA 3ZO3A 1A9UA 3N51A 1BI8A 4M14A 2C6TA 2BDJA 4W4YA 2ONLA 4J98A 4RMZA 2Q0BA 4BI2A 4RVTA 3ZDIA 2GS6A 3DDQA 3OW3A 4Y83A 3OD6X 4NJDA 4HVGA 5T3QA 4HCVA 2XK9A 1S9JA 3F2NA 5FDXA 3AC4A 1M2QA 2EXEA 5DT4A 5FDPA 3MESA 2R0UA 3HYHA 5H8GA 4E26A 4OW8A 2X7GA 2VZ6A 4QMTA 3ORKA 2LGCA 1AQ1A 4EK8A 5LOHA 3DKGA 3ALOA 4IADA 4JBPA 3Q5IA 4G17A 5CSWA 4F7SA 4HNIA 4DCAA 4HYIA 5L2WA 3PRFA 2UZUE 2YERA 3LFEA 3QD3A 3A99A 3EWHA 2X9EA 4M84A 4XHKB 3UDBA 2HIWA 2E9PA 2WQNA 1H07A 3RAIA 2R64A 3UP7A 3NCGA 3ZDUA 4CFVA 4AN3A 1KE6A 2GS7A 4O0RA 3ZZEA 5A54A 2XIYA 4FV7A 4QYHA 3KXZA 3VBQA 5EQEA 1REJA 4AT5A 3VHEA 4TWCA 3U54A 3MH1A 4M3QA 5CWZA 2QHMA 1SNUA 3HP2A 4FV4A 4BR3A 5BMMA 3F5XA 3U55A 3P78A 4QMUA 3QTZA 3ZM4A 4K9YA 4OTDA 2CNUA 4FTLA 3NYNA 3P7CA 4D2PA 2QO9A 4JRVA 2H6DA 4LFIA 2XJ1A 2XF0A 3HV7A 4DGGA 4AN2A 1Q8TA 4XOYA 1REKA 2UZTA 1PMNA 3R1NA 2QOIA 4RZWA 4AZEA 1OMWA 4D1XA 2GHMA 3QRTA 3C4XA 3DJ6A 3OCSA 4LUEA 4QMWA 5IA5A 3AGLA 3RK9A 2E9OA 2P3GX 4NYEA 1YOLA 5CALA 3OEFX 3KU2A 4GUEA 4QNYA 4ORKA 1PHKA 1I44A 4M13A 3U9CA 3NDMA 3DNDA 3TXOA 5FTOA 1SM2A 5HD7A 3UQFA 4ITHA 4YTFA 2OGVA 5I9ZA 5ETAA 2QOBA 2DWBA 2CGUA 5EYDA 1JSTA 2JDOA 4U0IA 2ZJWA 2UZWE 4DEAA 3VRZA 3POOA 4DTKA 4AW2A 4ERWA 2J0JA 1PYEA 5EG3A 4MHAA 4RT7A 2ZYBA 2ITZA 4M67A 3NZ0A 3GUBA 1Q97A 4JAIA 3EQIA 5IH6A 3MPMA 4QMYA 4XP2A 4JOAA 2O2UA 3G90X 3VBVA 2SRCA 4RZVA 4FUYA 3LLAA 5LCKA 3DKCA 3V5LA 4RLKA 3G5DA 4QMZA 3OT3A 3LOKA 5FP6A 4L42A 3C50A 3C4CA 2X4ZA 4LRJA 4BIBA 4TL0A 3EFWA 5HLWA 4F1TA 4IB3A 3RZBA 1GIHA 3UNJA 2UW4A 4RWJA 4XJ0A 1J1CA 4O21A 1E9HA 5DR6A 2A1AB 3C4FA 3KF7A 5FGKA 3ZO4A 2PVNA 3UO6A 5JN2A 3P08A 5CT7A 3HAMA 3BYVA 4P5QA 4O82A 3IW8A 2CJMA 5LWMA 5TOZA 3FLQA 4KRDA 1TKIA 3NRMA 3ORTA 3LM5A 4KB8A 4I94A 5ANOA 4Y5HA 5E8VA 1G5SA 2YDIA 2ITPA 4G34A 4CG8A 5M57A 3DT1A 4L45A 3C5UA 3COMA 2VWIA 3W2CA 1R0PA 3RZFA 3DBEA 5GNKA 3RP9A 4EOQA 1U5RA 3NUYA 3C9WA 2WIHA 4CMUA 3BHTA 3BHVA 2JITA 4HGTA 2G15A 3BELA 5DRDA 4IZ7A 2XUUA 3OF0A 3EKKA 3VBWA 1G3NA 4FSZA 4KBAA 4DAWA 5DRBA 2H34A 5JQ8A 1UKIA 5LMKC 5IQHA 1WBTA 2HENA 1JBPE 2Y6OA 4IC7A 3CJFA 3LZBA 4QMVA 5B0XA 3BYUA 3CPBA 3NVKI 1YW2A 2OH0E 3MSSA 3H30A 3KVWA 3E3PA 2G2IA 2FSMX 1F5QA 1J91A 3BE9A 3FV8A 1ZYDA 4YC8A 1UNGA 1ZY4A 5AAEA 5JFXA 3TZ8A 2XNPA 1ZYLA 4O81A 2W4JA 2HCKA 4CRLA 1IEPA 3VHKA 3BYMA 5CXHA 3ZM9A 3EN4A 1YOJA 5J9YA 5HBHA 2YM7A 4HCUA 4FT0A 4AE6A 2FVDA 2QONA 3VVHA 5AV2A 3QTIA 3A4PA 4OTWA 3ORNA 2BZHB 3DK7A 4LMNA 4MF0A 4F08A 2YDKA 5CU6A 2C6IA 3UZPA 2CHLA 3WF9A 5T6KA 4IM3A 4RWIA 3R9HA 4CTCA 3ROYA 3EN9A 3S0OA 3LFDA 4BCPA 2OWBA 2BPMA 3JYAA 4QPSA 1O6YA 5E92A 3SA0A 4PTEA 4EK3A 4WRSA 3S95A 3FQHA 2XEZA 3K3JA 4L7SA 2ITVA 3GU8A 1WCCA 5CU4A 2VUWA 4ZS0A 2BZKB 4DH3A 3HLLA 5CU2A 5HLNA 2WMWA 1TVOA 4N0SA 4HPTE 4RG0A 5CASA 3MIYA 3QRKA 3KRJA 2BHHA 3OC1A 2VAGA 3R83A 1PXNA 4FIHA 2O65A 4FE2A 5M56A 4HPUE 1OBGA 3Q53A 4BHZA 4HGSA 5H8BA 4OR5A 3ZCLA 4O7ZA 4AZSA 1PXIA 4TRLA 1GIJA 2OJIA 1YHVA 1M17A 1ZYJA 4FG8A 4IWOA 4TY1A 3VUDA 4FKRA 4H1JA 4GMYA 2YLEA 3KB7A 3LCTA 4YJNA 4CYJA 4HVIA 5DEWA 3R8VA 2JLDA 4GUBA 4N6ZA 4GK2A 5HNBA 4JL9A 5ACBC 1XH4A 4AT4A 1Q8WA 2X6DA 1O9UA 3QTRA 5FQDC 4FEXA 4I5CA 3RCDA 3VO3A 5AR5A 3C7QA 4B8LA 5C27A 2CKQA 4FZ6A 2G01A 1JKSA 2E9VA 5A4EA 1O6KA 1O6LA 4L00A 5F4NA 3ZO2A 3ZUVA 3ZXZA 4E6CA 4CMOA 4Q9ZA 3BGZA 3TCPA 1OKYA 2DQ7X 3TTJA 4KS7A 4A9TA 3BHHA 4EORA 3FMJA 1XQZA 4IJPA 3ZZWA 3DPKA 4E4LA 4DFUA 2R3LA 3ZEPA 3R0TA 4C8BA 3RALA 5B7VA 4QPAA 2J5EA 5HE1A 4D0WA 4KS8A 1B6CB 3LCKA 2Q0NA 2DS1A 4R1VA 5BVDA 3AC3A 3HA6A 5GIPE 3I7CA 3EFJA 2VTMA 4U43A 1UNHA 3EL7A 1OIUA 3P9JA 3PVWA 4LGGA 5C01A 5JKGA 2UW9A 2F2UA 2WMBA 3MI9A 3NNWA 4G1WA 3NAXA 4I93A 3GC0A 3UP2A 5FM3A 3DLZA 3TKIA 4BTKA 4DFLA 4M15A 2QOQA 5CSXA 2UZBA 4IAIA 4DGMA 5J9ZA 3K2LA 2P55A 4GG7A 4J53A 3VUGA 3PSCA 4BCFA 1MRVA 2IZSA 4IJ9A 1CTPE 4D9UA 5C26A 4AG8A 4JQEA 4D1ZA 3UG2A 3FWQA 4IVBA 4RQVA 5A14A 3T9IA 1GIIA 3C4EA 3NUSA 3FLSA 4MBIA 4QQJA 2PMIA 2WO6A 2XK7A 3IOPA 4P4CA 4F1MA 4G16A 4IAYA 3FPQA 5AP3A 4WSYA 3F5PA 2JFMA 3O2MA 3UOLA 2BKKA 4GEOA 3QQJA 5A9UA 4AW5A 4KINA 2YA9A 4GYIA 2OH4A 3QTWA 4ONAA 4X6QC 4IZAA 5CX9A 3PZEA 2FUMA 3WF7A 3ENHA 5M08A 3RGFA 3EMGA 2Z02A 2OI4X 2BDWA 3FE3A 3KULA 4PV0A 3NCZA 4WBBB 2A2AA 2EB3A 3RM7A 4ZMFA 4YJVA 2HOGA 2R7IA 3A7IA 3UVPA 4EYMA 3HV3A 2W4OA 1ZMUA 4XG9A 3V8WA 1U54B 3TZ7A 4AGUA 5HO7A 2ZB0A 2YJSA 3QQKA 4JG7A 4K2RA 4B4LA 1J1BA 3SRVB 4BDAA 2Z2WA 3P79A 2F2CB 4RVMA 3A8WA 3VS6A 1W7HA 5A6NA 1GZKA 5AFVA 3V01A 3V51A 3SOCA 4FV9A 5CI7A 3C4ZA 3R00A 5IQDA 4QMNA 5HEZA 1JLUE 1QPCA 1OUKA 3QCXA 4FTIA 2X4FA 3VUKA 3LFNA 2W1HA 5E8UA 5C4LA 1MRYA 3L8PA 5TF9A 4O7VA 3E63A 4JRNA 4I6HA 4G6OA 4MXZA 4UMTA 3RK5A 1PYXA 5HX8A 2AC5A 3O7LD 4FSNA 3ATSA 3F69A 5BYZA 1IAJA 1WZYA 4L43A 4XP0A 4AFJA 1WBOA 2PVKA 1OM1A 3IW7A 1IA8A 3EZRA 3UC3A 4AOTA 4K1BA 4BBFA 1WBNA 2R7BA 1ND4A 3IPHA 4O91A 3UYTA 4A9SA 1NY3A 3KQ7A 2PVMA 4RJ5A 5CEKA 3QYWA 4I1ZA 5LARA 3PWYA 4HW7A 5LMBA 5CLPA 3AC8A 4GYGA 5HO6A 3ITZA 3PXYA 1ZLTA 5J5SA 1OIYA 3DAJA 5CSVA 3UQCA 4ASZA 3R7YA 3ORMA 4FEUA 2WMUA 2XRUA 3OROA 3FI8A 5BVFA 5FLFA 3SXSA 4MEDA 3DTWA 3N4TA 3FYJX 3LQ5A 4EJNA 4RC2A 3KMWA 2X2KA 3W2OA 4W8EA 2RKUA 5JGAA 4GK4A 4FTAA 5IMXA 2YCSA 3V8SA 3FI2A 2EXMA 3GCSA 3LAUA 4DCEA 5L6PA 3BLQA 3IQ7A 3QQGA 4MNFA 4LI5A 4F99A 5HKMA 2QU5A 2X81A 3Q9YA 3QC9A 4AUAA 1KSWA 1OITA 3S2PA 4CFFA 4KAOA 3ZC5A 2QKRA 3TIZA 3GQLA 2VO6A 4GFGA 3BU5A 4LRMA 4FSMA 4BGQA 4D9TA 3BLHA 1V1KA 3ODZX 4L53A 2BROA 4WG5A 4BTJA 5I9VA 3CTJA 4FIIA 5CS6A 4PTCA 2O8YA 5ANDA 4B9DA 3O96A 3KGAA 3DZOA 4BCKA 2HY0A 3A62A 3TJCA 4E93A 4RFYA 3W18A 2CLXA 2X6EA 3P23A 3GOKA 4UWYA 1OPKA 3PYYA 2G1TA 3QUEA 2VTIA 3OUKA 3R8UA 3OBGA 3WZJA 4A9YA 2WXVA 4JDJA 3D5VA 3R9NA 4BDKA 4ITJA 1YKRA 3DNEA 5EYMA 3ATTA 2W1ZA 3MVJA 3NNXA 1V0OA 2GTNA 2ITNA 5K5NA 3AXWA 3ELJA 4DT8A 4PPAA 4ZSEA 4O2PA 1UU3A 4WOVA 4YJQA 4EKKA 4TW9A 2YM3A 3C5IA 3QD4A 2WEVA 5HVKA 2VTHA 3VJNA 4PWNA 3UIUA 5HTIA 4FGRA 5JMSA 4AZVA 1U46A 5LVOA 1PXKA 4AOIA 1U54A 3COKA 3QTXA 5C8NA 4U3YA 3E62A 2QO7A 5D41A 3FXZA 4AW0A 4EOJA 1R3CA 3I79A 4FBXA 4FZDB 3ORZA 2WMXA 4JI9A 5CZIA 3VAPA 3I6UA 5A3XA 2RL5A 4U80A 5C8MA 2X0GA 4YJUA 3F88A 3ZRMA 2VWXA 2Y8OA 2QOKA 3GNIB 5M4IA 4JDKA 5M44A 3PIYA 3S4QA 4WG4A 4Y73A 5HICA 3D4QA 3HAVA 5FTGA 1B38A 4U40A 1MQBA 5CYIA 3FSFA 4FKGA 1R0EA 5F95A 5GJFA 3QD0A 2ZV8A 5ICPA 4EK6A 3BYSA 4OTIA 5FEQA 5CVFA 4EOOA 2P0CA 4O2ZA 2C68A 2CN5A 3TIYA 3I1AA 4HVDA 4PP9A 4BKYA 2GFSA 4F7JA 2VGPA 3QGYA 3LXNA 4I0RA 4KSPA 4YTHA 4DEBA 5GZAA 1ATPE 4CFWA 4APPA 2IG7A 4ANBA 5CY3A 4H36A 3IW5A 1H1QA 4FL1A 2XJ2A 5J9LA 5M51A 2VTOA 4J8MA 3QZGA 2IVUA 2XNOA 5HTCA 4DITA 4PTGA 4BCJA 2RG6A 3ORPA 4MBJA 5CAPA 1H0WA 5IA0A 5J79A 2V62A 4TYJA 2UZEA 5I3OA 1W8CA 3MH3A 4NUSA 4B6LA 3ZXTA 4CKRA 4L6QA 3EQCA 2CGVA 4BCGA 3TL8A 3TN8A 2CKEA 1QMZA 2WQOA 5TE0A 1XKKA 4ASXA 3KMMA 3ORXA 4CQGA 4MX9A 4K0YA 3SOAA 4ITIA 4ACCA 3ZSHA 3EOCA 4FT3A 2CKPA 4R77A 4FG9A 4N57A 2ZV7A 3EFKA 3QAME 3OXIA 4FG7A 5E8SA 4EYJA 4EH5A 4WUNA 4RC3A 2ITXA 2ONLC 2W99B 3VN9A 4DH8A 4H1MA 5ANKA 4GKHA 3RWQA 4X2JA 4H3BA 2OBJA 1Q99A 1YVJA 2W0JA 4YSJA 5HIBA 4OTFA 3LHJA 4WNMA 3ZRLA 5AMNA 4EQMA 3O71A 5M55A 1Y8GA 3KXHA 3V5JA 3W10A 2UW5A 4KIKB 4Z7GA 2XK8A 2OIQA 5I0BA 3CLYA 3MPAA 3MWUA 1M2PA 2A4LA 3GI3A 4ENYA 4HVSA 4BKJA 2J90A 4U3ZA 4HZSA 2XYNA 1PKGA 2ACXA 2F7EE 5AAGA 3HP5A 4C36A 5ETFA 3D7ZA 4HYSA 3OHTA 4YZBA 2WQEA 4L01A 2CNQA 4FT7A 3UOHA 2R0IA 4XG7A 4JXFA 3KY2A 3LFSA 3ULZA 4CV8A 4FZFB 2R5TA 4B7TA 2UVYA 2YACA 4D5KA 4Z3VA 4DEIA 4X0MA 4YLJA 4F64A 3O51A 1H4LA 4F0IA 4UV0A 5CAUA 3C13A 4ZEGA 3IKAA 3FY2A 4KUJA 4NM3A 2OIDA 5BVNA 4EH3A 3Q2JA 4DBXA 1ZRZA 4K77A 3L9PA 3WILA 2WMSA 2W5BA 3DA6A 1M7NA 4C02A 4E3CA 4Z55A 4O7NA 2PZIA 4QP2A 3L9NA 3QC4A 5D12A 5AX9A 4I4FA 1QPJA 1P2AA 4YO4A 4MXCA 4BYIA 4ZZNA 3TKUA 5TKDA 3G9LX 4JR7A 2UVXA 2JBOA 1XH5A 4OT5A 1DI8A 2W7XA 3O8PA 4G6NA 5EYCA 1PXLA 3FZTA 1JOWB 5IQAA 5AP0A 3MB7A 3W1FA 3O23A 3O8TA 4CZYB 2CPKE 1YI6A 3B2TA 3I81A 1OL1A 2ITTA 2V22A 3BV2A 3BV3A 3WE8A 4ZTNA 3UO4A 4ANLA 4BBEA 3WZUA 5KKRC 2XIZA 4IVDA 3KRWA 2BVAA 3TZ9A 4H3PA 2QHNA 4W9XA 4EUTA 1Y8YA 2QR7A 4ZZMA 4C35A 3LJ2A 4FNWA 5GZ8A 4FEQA 4BIEA 2ERKA 3PJ1A 1XH7A 5CF5A 3HVCA 3FUPA 4Z9LA 3AMYA 4F09A 3V8TA 4AAAA 3UZRA 4H39A 2VTQA 3KRRA 2OG8A 4KRCA 2C6MA 5DNRA 4R5YA 5B2MA 3Q9XA 4FSUA 2WMTA 5EM7A 4A4LA 2QO2A 2YWVA 2A0CX 5LVMA 4GVAA 2BAKA 2WQMA 3L8SA 1PXJA 4AFEA 1AD5A 2V5QA 3BIZA 3LFAA 2PVJA 2PE1A 4IFGA 1YWNA 5E1SA 1MRUA 1YI4A 2UW8A 4ZSLA 4BY9E 5C4KA 3MW1A 4HZRA 4C33A 3LM0A 1H26A 3NEWA 4YHTA 4OBPA 4RIXA 4DG3E 3R63A 2F49A 4NTTA 5JQ5A 4ZP5A 3HA8A 4BZOA 4RJ6A 2ERZE 3HZTA 3FEGA 3DY7A 4YC3A 2Y9QA 4G5JA 2XH5A 4WG3A 2UW3A 3OG7A 5K4IA 3OY3A 1LP4A 5CQUA 4ZSGA 5L2QA 3G2FA 4NZWB 4DN5A 3LCOA 3OCBA 4MF1A 4GG5A 4QYYA 4KIKA 4L8MA 5AR3A 4YR8A 1GZOA 1H08A 2B7AA 3ACJA 3MPTA 3DB8A 3PP0A 2BUJA 5IH5A 3F3UA 5E7RA 2WGJA 3VQUA 4YZDA 3HGKA 4QTEA 4PMSA 3UBDA 1VZOA 4BCQA 2QC6A 5IISA 3M1SA 4R7HA 2FYSA 3NUPA 3Q4UA 3W2QA 4A4OA 5IQEA 3OW4A 3BU6A 2BKZA 3F61A 1NVSA 5HI2A 2PZ5A 4RA5A 2KULA 1BLXA 4S2ZA 5H8EA 4CEGA 3BWJA 3RPRA 3A4OX 1W98A 3FLWA 4Y5QA 5KBQA 2C3LA 3ZSGA 4JLCA 2CNVA 3DJ7A 2YM8A
chains in the Genus database with same CATH superfamily
4OLIA 1ZARA 4EL9A 3OT8A 4ANNA 1W83A 4R7BA 3ZFXA 2BRMA 5BPYA 4GT3A 4EK4A 5IUHA 2ITYA 2VWBA 4XV9A 4S31A 3ZTXA 1SMHA 3RM6A 4TYHB 1QCFA 3WF8A 4HVHA 4CFUA 2XM8A 4PMMA 4ACHA 4GJ2A 5CEPA 1TQPA 1GAGA 3V5QA 3VS1A 3PA5A 4E73A 3FHIA 2NP8A 2WTCA 3MTFA 3GCUA 2OW3A 2BCJA 1GOLA 1DAYA 4WHZA 2W4KA 5CENA 3COIA 2WB8A 2GDOA 4IEBA 3TM0A 4EKLA 1WAKA 3PXQA 3NWWA 4G6LA 3ORLA 3HMPA 2J50A 4IACA 5LJJA 3ZRKA 1FVRA 5C9CA 4CCBA 4D2WA 2XKFA 3L1SA 2IZRA 2XP2A 5K0XA 3QD2B 1Y57A 4PUZA 4I22A 5AP1A 2IN6A 3TNQB 3TUBA 4PNIA 4CLIA 1LUFA 4RVKA 4QMOA 3QZIA 3F82A 3OBJA 5D1JA 1H0VA 3LW0A 2YM5A 4XH6A 3SC1A 4DFZE 4R8QA 4G3DA 5DLSA 2PZRA 4IHPA 4WO5A 2R3FA 5ANGA 3KN6A 3OTVA 3EQPA 1XO2B 2FSLX 2R4BA 4UMQA 4V0GA 3JY0A 2WIPA 2ZDTA 5CZHA 3LLTA 4CMTA 2OLCA 1XR1A 3QKLA 3R8ZA 3TYKA 2C69A 3QF9A 3KK8A 2CCHA 1GJOA 4LRKA 2W1EA 4D4SA 3FC1X 3CY3A 2PL0A 3Q4CA 5EW9A 4JX3A 1YRPA 2Y0AA 5LMAA 4O7RA 3NW5A 4PL3A 5TR6A 4FTMA 3FL4A 2ZV2A 4FKOA 1E1XA 3FPMA 4ID7A 5AUWA 4NM0A 3PTGA 4F9CA 1R39A 4YMJA 2BALA 3ORIA 3TUCA 2OZAB 2VTLA 3FZPA 2X8EA 2GSFA 1ZY5A 3PRIA 2IEWA 1PJKA 4DH7A 5E8ZA 4IB0A 3DK6A 5BUIA 3VBTA 3JY9A 4APCA 4LL0A 2HW7A 2XIKA 3MTLA 4FKUA 1ZMVA 4LOPA 3V04A 3Q60A 5KMIA 3P4KA 4FKPA 3Q52A 1OECA 3PVGA 4N4SA 3AD4A 3VNTA 4E5WA 3FZ1A 3FZSA 4F9YA 1OL7A 4FL2A 2PVYA 3AD5A 4O0TA 3MY1A 4K8AA 3SG9A 3KMUA 1MP8A 3GT8A 4E1ZA 3HV4A 3DQXA 4DHFA 1CKIA 3CTQA 4S32A 4X2KA 5CEQA 4EH6A 5IEYA 4F6UA 4KKEA 4IVCA 3P7BA 4YHFA 5AR2A 1KOAA 3QQFA 4LV8A 4I23A 4BI0A 5BX0A 3JXWA 3QXPA 4UMPA 4FV6A 3KVXA 4CT2A 2X0OA 4LQMA 4WKQA 3R9DA 2QOHA 4FIJA 1CM8A 2HY81 3BQCA 4O7YA 4GU9A 4QQCA 2IJMA 1KUTA 5IDPA 3FJQE 1M2RA 4RA4A 1VJYA 3PXKA 2BR1A 4FNZA 4UXLA 3PWDA 5A6OA 1YI3A 3H4JA 3N4VA 1K3AA 3FKLA 3FSKA 2VWZA 4GL9A 2WTKB 3OCGA 2JKKA 1J7IA 4P90A 5EQPA 2R3IA 2ESMA 3BZ3A 3VJOA 3C1XA 4ZTSA 5IA3A 2XALA 4YZ9A 2XRWA 4XMOA 5IUIA 4TYHA 4EBWA 4HCTA 4BWKA 4Q9SA 3NUNA 2Q83A 3LIJA 4IB1A 1Z57A 3HUBA 4O0XA 5DEYA 5HX6A 4RRVA 2FB8A 2R3GA 4X6RA 1XH8A 4ZXTA 5DHJA 4EH4A 2AC3A 4YBJA 3E3BX 4AT3A 1OVEA 2ITUA 4DEEA 5KX8A 2GU8A 5JGBA 2IVVA 2PULA 3BYOA 3PSDA 4F7NA 2XB7A 5BNJA 3BPRA 3ZHPC 3S1HA 2R3JA 2VO3A 4J97A 5HIDA 3FYKX 4QP4A 5FXQA 5JZJA 2UUEA 1YDSE 3PE2A 4L44A 5EKOA 2OFVA 3CPCA 4RVLA 3VS4A 3NX8A 2XKDA 2PU8A 1FPUA 2W1DA 1GNGA 3CQUA 3MS9A 3U9NA 5J95A 3HL7A 3R1QA 3T9TA 2ZV9A 3NW7A 4BB4A 2VU3A 5IG1A 2YIYA 4FODA 4ZSAA 4E7WA 3EJ1A 1XH9A 3BI6A 2A19B 4YZMA 4BDDA 5A4QA 4DF3A 2C30A 4XLIA 2J0MB 5M09A 2H8HA 3Q04A 4GKIA 1Q62A 3HDMA 2GNIA 2GMXA 2WMRA 4DHIB 3A7JA 3EN7A 4ZTLA 4R5SA 1LEWA 4C3RA 2X9FA 4EH7A 3QTUA 3HNGA 3R9OA 4IAZA 4ZLZA 2C5OA 3SW4A 2FA2A 5IKWA 5AV0A 2VX3A 2PZPA 2OZAA 4E5AX 5HNGA 4DDGA 2X0PA 4RJ7A 3TNPC 4NIFB 5HE2A 4UN0C 5DMZA 2QOCA 3I4BA 3QCQA 3S00A 5JEBA 1IASA 4CGAA 1OKZA 5G6VA 4F6SA 5ACKA 4JBQA 4TNDA 2UZVA 2RGPA 3UIMA 4ACGA 3AMBA 3QUDA 5FRIA 3RINA 3S3IA 4FYOA 4LYNA 5LVLA 5AIRA 5L2IA 3FMHA 1XWSA 3LFQA 5CXZA 4M69B 4BGGA 1VEBA 5CI6A 1WBVA 4L9IA 3PY0A 1H1WA 3RHKA 4G9RA 4QP1A 3QCYA 5DR2A 1XBAA 2B9FA 3OWJA 3FMEA 4FTRA 4R3PA 4BDFA 2YCFA 3EFLA 4M0ZA 3OZ6A 3HEGA 1K2PA 2Z7RA 4GIHA 4MD9E 4X2FA 4TPTA 3FLZA 3PY3A 5AP6A 3H9OA 5HVJA 4DFNA 4FX3A 2J51A 2OF2A 3SW7A 1PXOA 1BKXA 5CU3A 4WNKA 2J0IA 3NGAA 3H0YA 3MA6A 5DI1A 3IDPA 1XBBA 5K3YA 1UV5A 5TT7A 3RK7A 4P2KA 3PLAE 1E1VA 3GCQA 1YOMA 2VGOA 2YWPA 4O4CA 3W2PA 4FKSA 5EI8A 3RAHA 3CD3A 4TWPA 4R78A 5BVOA 3I60A 3TDWA 2XK6A 2PK9A 3FMLA 5E90A 4O7WA 2BMCA 2XK4A 1FVVA 3ZO1A 3U51A 2B55A 3A7FA 3PIZA 2B9JA 5AUXA 5KO1A 1ERKA 3EYGA 5J1VA 3KC3A 2P2HA 3UNZA 2NRYA 2YZAA 5IEXA 3O7LB 2W5HA 3ZLWA 2XKCA 4CT1A 1BMKA 3EQGA 3TT0A 3VRYA 4OTRA 3DU8A 4BDBA 2VV9A 4C4GA 2CGXA 4HYUA 1G8KA 3VS7A 5HVYA 2UV2A 2YIXA 1FGIA 3VW6A 3FMNA 5AUYA 2FH9A 4FKLA 3Q9ZA 4GFMA 2XAOA 3DJ5A 4II5A 4C4HA 4C34A 1BUHA 5EQYA 3GCPA 1U4DA 2PUPA 4L52A 3L8XA 4EK5A 1CDKA 4C2VA 4GK3A 4BF2A 3BRBA 3R7GA 1MUOA 3REPA 4S34A 4XV1A 4CD0A 3MFTA 2C5XA 3I0QA 2J5FA 3W0NA 4YBKA 2WU6A 4FI1A 5JK3A 3L9MA 3QXOA 3TNWA 1HCKA 2PVLA 3WYXA 2IW6A 4QMPA 3QWJA 2GNLA 5AR7A 4UY9A 1TQIA 4L68A 4FVQA 4YJPA 2PMOX 2GNFA 2R3MA 4IWDA 5L8KA 5M4FA 4C61A 3WF6A 4LL5A 4BDGA 4LV7A 4GJ3A 3NYOA 3FY0A 3GB2A 5HG7A 4DG0E 3OCTA 4QYEA 4RFZA 3PPKA 3KKVA 3EIDA 3ZFYA 4QTBA 5BVKA 4YHJA 1Q24A 3PE1A 4DGOA 3IGOA 3PG3A 1ZMWA 4LGHA 4MXXA 3TV6A 1J7LA 4BCOA 2B9IA 3ML1A 4C3PA 4JIKA 3SX9A 1P4FA 3PXZA 2ZM3A 3AC5A 3WBLA 4TTHB 3ZYAA 4IWQA 4E4NA 2PUUA 3QRUA 4NIFA 4FICA 3VC4A 3ZBXA 3L9LA 1GZNA 3WIKA 4PNKA 2WU7A 3QYZA 2X2LA 2WOUA 4ZY4A 4F0GA 5KCVA 1HCLA 2PMLX 3H3CA 4R3RA 4USFA 3VWAA 4RIOA 4CFXA 4PPBA 4AOJA 3SQQA 4JG8A 5AP4A 4HYHA 3O5AA 3PUFC 2Z8CA 4ZIMA 3R28A 2QD9A 3DFAA 2YZLA 4RIWB 3MGYA 3PVBA 3ULIA 1B39A 2RFDA 3DBCA 4O4FA 3ZBFA 4LUDA 2CDZA 4ALVA 3QUPA 5CQWA 4BVUA 1FMKA 2R3KA 4IC8A 3FMKA 3A2CA 4FTOA 5EM8A 1TFFA 2EUFB 4BL1A 2W96B 4TXCA 3V6RA 2QOFA 4PPCA 3TTIA 4QYGA 1LR4A 4G5PA 4O96A 4BN1A 4QD6A 2EU9A 5F20A 4WNPA 2RF9A 3VIDA 4QP9A 2JIUA 2WNTA 3GU4A 5CVHA 2JD5A 5TO8A 2QNJA 3MIAA 4HGLA 3D94A 5KZIA 3C0GA 3MFSA 4R1YA 4O86A 4BWPA 3ZUUA 2GHLA 5FXRA 3DDPA 1F3MC 1Z9XA 2W1GA 3D2IA 4Q5EA 5D10A 4ZJIA 5C1QB 3R8MA 2R2PA 4EH9A 2VO0A 2Y4IB 2VNYA 5HG5A 5CEIA 2EB2A 4DINA 1Q61A 2BDFA 2H96A 2ZM1A 4Y95A 5CSPA 2RSVA 5L6WL 4C4JA 1SVHA 5HLPA 2BRHA 3HECA 2JDSA 3IONA 3BE2A 4K6ZA 4EQUA 2JKQA 3ZLXA 3ZLYA 5HGIA 4C37A 4F4PA 1Y91A 3WYYA 3H9RA 4C57A 3QZFA 3ODYX 3GENA 4MUQA 2GFCA 3ANQA 2C0OA 3KCKA 4UMRA 3PXRA 4ZTQA 2FSTX 5HESA 2OXXA 3TJDA 4C62A 4F9BA 1IA9A 2OU7A 2W9FB 3GQIA 4I0TA 4O0VA 5M4UA 4E4MA 2OFUA 2YISA 5LWNA 4CYIA 3NSZA 4IM0A 5K0KA 4EZ3A 4RC4A 1PKDA 5GZ9A 5IZFA 4EUUA 4PQNA 3VUHA 3HDNA 3O8UA 2GQGA 5FBOA 3DXQA 3V5WA 4ZAUA 1RE8A 5GHVA 1OL6A 3OWLA 4BHNA 3LFCA 3F6XA 3SRVA 2BZIB 3MVMA 1STCE 2J6MA 4USDA 4WBOA 4D2TA 3G0FA 3ZS5A 1KV2A 4LG4A 3ZSIA 2QCSA 3MV5A 3RJCA 2UW0A 2UW7A 5E9EA 4BDHA 4FV3A 2HYYA 5DA3A 4KBKA 1H1RA 4YPDA 3QGWA 4FL3A 5J8IA 3GCVA 2YLFA 2P4IA 4IZYA 5I9UA 2VTRA 3ZEWA 4OT6A 3DBQA 1RDQE 3O50A 3U4UA 2VTPA 2WMVA 2R3PA 4L3LA 3DAKA 5HOAA 2HZ0A 2REIA 2Y6MA 4M0YA 4RX8A 2PWLA 4O0UA 4BDJA 2C5YA 1BI7A 2UZNA 3ZH8A 4QTAA 3UOKA 2C6DA 2DUVA 2YABA 4FV2A 4GIIA 4U9AA 2JC6A 2PZYA 3LCDA 3FKOA 4OUCA 3QKKA 2JKMA 3SHEA 3I5NA 3PDTA 4DHJA 4MK0A 3TACA 3R9RA 4I6FA 3LJ1A 5DIAA 3KA0A 3RHXA 3K5VA 3LQ3A 3RCJA 3IO7A 4XYFA 4FOBA 3MY0A 5JH6A 4O84A 1A48A 3MB6A 3R2BA 1IRKA 2GPHA 3ERKA 4BFMA 3P5KA 4UMUA 1PMUA 1OIQA 3Q5ZA 4EQCA 4DTAA 4V04A 2IVTA 4RIWA 4KNBA 5F94A 5AV3A 4E6QA 4FSRA 4NCTA 3SKCA 4YGAA 3NUUA 5D7VA 4MCVA 2UZLA 2BILB 2I0HA 3PJ3A 5DGZA 4E8AA 2XM9A 3MFUA 3MVHA 5CT0A 1ZZLA 1YWVA 5M4CA 1FBNA 4FKVA 4ZJJA 5KNJA 3VONA 5CSHA 3R73A 1XH6A 4M8TA 3FAAA 2B1PA 3OVVA 4JBVA 4YP8A 5J87A 3NNUA 5A46A 3ZFMA 1CSNA 5AA9A 2NPQA 4FSWA 2X8DA 1PY5A 3EL8A 2VD5A 3LXLA 4J99A 5JSMA 3II5A 4DH1A 3NW6A 1Q5KA 3EQHA 4W4WA 2UZOA 4TYIA 3CCNA 4UYAA 2OJJA 4D28A 3NNVA 4UWCA 4YJRA 4L3PA 5CTPA 5IQBA 1DAWA 3MJ1A 4ANMA 5IMEA 4E20A 2ZAZA 2HZNA 4D4YA 1XJDA 4XG3A 4FTJA 4QRCA 2VTNA 3UE4A 1NT2A 2XS0A 4ALWA 4KIPA 4PL4A 1W82A 4LGDA 3LMGA 3GVUA 3R1SA 2WHBA 2VNWA 4WA9A 4XX9A 3T8OA 5DYJA 4PDOA 4FEWA 1JPAA 4O4BB 4FTUA 3QX2A 4MAOA 4CV9A 2E9NA 4FGBA 2RIOA 2I0VA 2KTYA 3ETAA 4FSTA 3KRLA 4ZLYA 5FXSA 2YN8A 3RBWA 4O1OA 5DWRA 2OJFE 5AM6A 5DT0A 3SLSA 4CSVA 3SXRA 5CF6A 5L8JA 3TNIA 3R7EA 5BVWA 3PPJA 1OKWA 3Q4TA 1IG1A 1JKLA 5IQCA 3AT4A 3CXWA 3KXGA 3UG1A 4AX8A 2OKRA 4CG9A 5FEDA 4FVRA 4I24A 4MQ2A 2V7AA 4J7BA 3G51A 3GOPA 5AUUA 2R9SA 3D5WA 3OWPA 2OO8X 4PF4A 3OWKA 3EQBA 4JR3A 4O7LA 4DEDA 5K5XA 4FYNA 1H28A 5IPJA 3BHUA 4DE4A 4QMMA 4FNYA 4FZ7A 5ANEA 4ANOA 3VS5A 4GS6A 2XIXA 4I5HA 3FXWA 4F7LA 2ZVAA 3EH9A 4JDHA 4KA3A 2YCQA 3MDYA 4EC8A 3TUDA 4QDVA 3F2AA 3AT3A 4X3FB 3CD8A 5AV1A 4EWHA 5CU0A 1Q8YA 2RFEA 5I5ZA 2PY3A 4ACDA 1URCA 5IH4A 3MH2A 4U41A 4AA0A 5D11A 5F1ZA 1R78A 3CIKA 3FLYA 3KREA 4I6BA 3UDZA 3KN5A 4QP3A 5EHOA 1KWPA 5DT3A 3Q3BA 2F7XE 3FDNA 1NVRA 5AP7A 2GQRA 3MJ2A 2XZSA 3SD0A 3QX4A 3BKBA 5J7HA 4XRLA 3MY5A 3QQUA 5M07A 1FQ1B 1UU9A 4ZZOA 4KIQA 3WZKA 2WKMA 4X2NA 3WZEA 3KF4A 4FIFA 3N9XA 4XG6A 3RPOA 2YIRA 4Z16A 3E8EA 5HBJA 3QKMA 3DLSA 4UB7A 2OXYA 1EH4A 2QURA 5CVGA 2GNGA 1GY3A 4Y85A 3RNIA 3E7VA 4IANA 3W0MA 4EONA 5IQGA 3ZOSA 3TNHA 4ANSA 3RNYA 4JVGA 3MA3A 4CKJA 3UMXA 3IS5A 1X8BA 1YXVA 5G1XA 4BICA 2G2FA 5KUPA 3BEAA 2C3JA 2VWYA 3LCSA 3PSBA 2PPQA 5CAVA 1A06A 4FNXA 2ZB1A 4Y46A 2PVFA 5AADA 4GFOA 5E4HA 4UEUA 2JGZA 3G9NA 3DXNA 3WOWA 3PY1A 1J3HA 2XNBA 5EHLA 4YURA 2V55A 5AEPA 4QO9A 2PTKA 3LKMA 4IW0A 4S30A 4YLLA 2C3KA 4AU8A 4DEHA 4ERKA 3W0QA 1U5QA 1ZYCA 3W8QA 3KXXA 4PP7A 2C0IA 2Z7SA 2CCIA 4KSQA 2XEYA 1GZ8A 3FMMA 2YFXA 2X7FA 3NYXA 4GT4A 3BHYA 4C4FA 4A9UA 1UNLA 4K18A 2B0QA 4IX5A 4YO6A 1ZYSA 4C3FA 4MH7A 3VBYA 1VYWA 3BGQA 4FIEA 4GVJA 2B52A 5CAOA 5L4QA 1UVRA 1YDTE 4L7FA 3EHAA 4K11A 3H0ZA 4IMYA 4C0TA 4ZTRA 4D2SA 1V0BA 5HIEA 4OTPA 1H1PA 4LV5A 2XCHA 3SDJA 4PMTA 5IQFA 3Q4ZA 4IBMA 4IB5A 3F3VA 3UPXA 1WFCA 3DTCA 3LFBA 3VUMA 4GV1A 3U4WA 1URWA 1P14A 4W4VA 4MD8E 3I7BA 4JQ8A 3OTUA 3AG9A 4U7ZA 3CR0A 4HGEA 5DH3A 2XAMA 4CCUA 5A4TA 4AXFA 4UBAA 3JR1A 3K54A 4YNEA 1H1SA 2QI8A 3UIXA 1W2FA 1OPLA 3GU5A 3DS6A 1G8SA 5E91A 2UW6A 4CXAA 2I1MA 4W8DA 3VULA 3R7UA 2GNJA 4X3FA 4MQ1A 3T3VA 5KMKA 3PZHA 3E92A 2ETRA 2WTWA 3ET7A 4RX9A 3D5UA 2WZJA 4PMPA 3NPCA 5EOLA 1BL7A 4KKGA 5JZNA 3ZMMA 4JIAA 2OZOA 4ZLOA 4S33A 1LPUA 1SZMA 4XEYA 5HCXA 3NVMB 3DCVA 1APME 3ZONA 2RFSA 3UTOA 4FT9A 4NKSA 5HO8A 2F9GA 2IVSA 3FC2A 4FV8A 5B2KA 4FRFA 1ST4A 4I6LA 3QA0A 4KD1A 5EH0A 2O5KA 3KXMA 4JNWA 5LMKA 2YM4A 3GEQA 4ZY5A 2WQBA 2EXCX 3QRJA 3SVVA 1G8AA 2WPAA 3N4UA 3QU0A 3IW4A 4ZK5A 3POZA 4C2WA 3UOJA 3IW6A 3EB0A 4ARKA 3SGCA 2A27A 3UVQA 4QTDA 5LVNA 3OOGA 3RMFA 4C58A 4A4XA 4IAAA 4IAKA 4CLJA 3EYHA 4YTCA 4XLVA 1ZXEA 3GC7A 4D0XA 5J5TA 4NJ3A 4GT5A 4RWKA 3HRBA 3QWKA 4ASDA 5IEVA 3GU6A 4U81A 1H25A 5BYYA 5D7AA 2O64A 1WBPA 1L8TA 3G33A 4RWLA 2E2BA 2JEDA 4TYEA 2XIRA 3QHRA 1Q3WA 2VTTA 3OEZA 4MXOA 5CF4A 2NNWB 2BHEA 4EHVA 3P86A 1BYGA 2XYUA 5ANIA 3TKHA 4D2RA 5GINE 2XNMA 2HAKA 2VWUA 3O0GA 1Q41A 4Q5HA 5IF1A 4NM7A 2VRXA 4I21A 4DGLC 4IAFA 1DM2A 4RJ8A 2YEXA 3E88A 4FTTA 4AW1A 5IA4A 4JDIA 3CKXA 2J0KA 3D7TB 4BCNA 4MVFA 2YCRA 3E7OA 4CFMA 3EQDA 3R22A 4YNOA 3C0IA 4UXQA 5AAFA 1WVXA 3UGCA 2O63A 2PVRA 2XNNA 3AC2A 2V0DA 4HJOA 4XOZA 3VF8A 3WARA 2W9ZB 4FKTA 5EKNA 3U6HA 5KMLA 4R7IA 5IA2A 4U5JA 3U6IA 3D5XA 5E1EA 5EHYA 3CTHA 1XHAA 4PDSA 4AZTA 2CLQA 3ANRA 3MVLA 3UO5A 1VYZA 3DOGA 2GTMA 1FMOE 4XG4A 4E4XA 4DA5A 5EDQA 2O3PA 4QP8A 3QBNA 5EDPA 3DXPA 1H24A 3PJCA 4NT4A 4EOLA 1UU7A 3LQ8A 4J95A 1OGUA 4J96A 1K9AA 3KK9A 2HWPA 5LQFA 3ALNA 3Q9WA 3EQFA 3DZQA 3RPVA 3CQWA 3RPYA 2WTKC 4TT7A 1ZAOA 4JJRA 3QTSA 3WZDA 2VO7A 5EFQA 3IGGA 5KMOA 4I41A 4QT1A 3RKBA 1WVWA 4QPMA 4YZCA 4C38A 4F6WA 4EBVA 3F5GA 2XNGA 3QALE 2IW9A 3UIBA 4F9WA 4BDIA 5AUTA 3CQEA 4RIYB 3LMHA 4X7QA 3QCSA 3F7ZA 5HE0A 5HU3A 1NA7A 4IVAA 3PG1A 3AD6A 3NR9A 2C1BA 5AUVA 4DBNA 4YPSA 4AN9A 4EI4A 3COHA 2WTJA 2FO0A 4M12A 2IPXA 4G3EA 2C3IB 5KMJA 2BTSA 3QL8A 4GRBA 3HMOA 1R1WA 4KIOA 1UKHA 2X7OA 3UODA 4ZJVA 4DHZA 4X2GA 3K3IA 4YJOA 4XS2A 2I6LA 5F9EA 4G31A 3I6WA 3GP0A 4GCJA 3E64A 3VUIA 5A4LA 2JBPA 2PUNA 2BTRA 2OIBA 5HORA 4QNAA 4NH1A 4WNOA 4EC9A 4O6EA 5KMMA 5CF8A 1PMVA 3E5AA 4O4EA 4IQ6A 2XVDA 3R21A 4NW6A 3TV7A 2OICA 1YXSA 3IDBA 5T68A 3FHRA 4BWXA 5BUJA 4I5PA 4FV0A 1HOWA 3BLAA 5HE3A 3FQSA 4DC2A 4FKIA 4CTBA 1I09A 1OKVA 2YAAA 3Q2MA 5LXMA 2W1CA 5I4NA 3F2RA 4JMQA 1DI9A 2I40A 1DS5A 5AR8A 2BIYA 5ITAA 1IAHA 2VX0A 4J71A 4FV5A 2PE0A 3DAEA 4IDTA 3T3UA 4EJ7A 4USEA 3HUCA 4I92A 5E8TA 3FI4A 1P4OA 3ID6C 2QG7A 4FTNA 3SAYA 3CGOA 3W32A 4B0GA 4XBUA 3PJ8A 4RJ3A 4G3FA 4MNEB 4DFYA 5FTQA 1CKPA 3K5UA 3KULB 2WD1A 5DN3A 5ETCA 4YU2A 3AMAA 4MXYA 2X2MA 4BDCA 4ZSJA 4RQKA 5ETIA 2C0TA 4NM5A 4P5ZA 4YC6A 3BU3A 3GC8A 3JVSA 4GW8A 4NEUA 1T46A 4ACMA 5HG8A 1UU8A 2Z7QA 2ZMCA 4X3JA 4M68A 3VUTA 4H3QA 1UA2A 5H3QA 2OXDA 4J8NA 3EKNA 1YXXA 2HW6A 3D7TA 3CKWA 3OP5A 4FT5A 4OAVB 4LOOA 3CS9A 4A07A 2F7ZE 2GQSA 3FLNC 3ZC6A 3M2WA 4ALUA 5L8LA 3W2RA 4XG8A 5GJDA 2J9MA 4M7IA 5I9YA 3G15A 2GHGA 5HTBA 3SG8A 2HELA 2CN8A 1VR2A 4MD7E 5DG5A 3OUNB 4UWBA 4FA2A 2CMWA 1L3RE 3F66A 4FTKA 4XBRA 5BUEA 2Z60A 2C5VA 2PVHA 3U8WA 3A60A 4EHGA 5M06A 2JIVA 4YJTA 4DTBA 2B9HA 4IM2A 1SYKA 5EDRA 4LDTA 4JX7A 4AF3A 4J52A 1JKKA 2E9UA 2JAVA 2BAJA 2QVSE 4C4EA 3NUAA 4AXAA 4CVAA 4XUFA 3V3VA 4LOQA 2QKWB 2YJRA 4IX3A 4AA4A 4OBQA 3JPVA 4BCHA 4EOSA 2ZDUA 3C51A 4IFCA 4YLKA 5ANJA 4RJ4A 5L2SA 4NWMA 2AUHA 4EOKA 4FTQA 3TI1A 5EOBA 1BL6A 1QL6A 2VWVA 3R7OA 2R3QA 4RGJA 2HK5A 4O1PA 4EHEA 3OMVA 2XK3A 5EK7A 4RIYA 1Y6BA 4C7TA 4OAUC 4NL0A 4F78A 5K4JA 2YM6A 2IZTA 3GFEA 3TZMA 4U79A 2QG5A 3GU7A 3LJ0A 4AP7A 3MN3A 4EOMA 3OY1A 5AM7A 2FSOX 4EOIA 3R2YA 4E6DA 3W33A 2EWAA 2WAJA 4I3ZA 4G9CA 3R7VA 3TWJA 4OBOA 3UDTA 3F3ZA 3Q32A 4LMUA 4ZTHA 5HHWA 4KWPA 4YTIA 2R3NA 4EHZA 3U87A 4A9RA 5B2LA 5E8WA 2B54A 2VN9A 1S9IA 2XMYA 4U8ZA 3DV3A 5AJQA 3SXFA 5HD4A 4AGWA 2R3HA 4M66A 3QHWA 2C6KA 4G2FA 4O0YA 3HMIA 5E8XA 3GGFA 2HWOA 4PX6A 4DLJA 1PMEA 3GFWA 4DG2E 2I0YA 2RFNA 1OB3A 2B53A 4YSMA 4UYNA 4CKIA 2H9VA 5CNNA 2QOLA 2QLQA 5AR4A 4JT3A 1JKTA 3FKNA 3A7GA 4XG2A 5FG8A 2VTSA 1CKJA 4KABA 4FTCA 3DK3A 4J1RA 5KBRA 2IW8A 3UDSA 5HCZA 4RBLA 3AOXA 2J2IB 4RLLA 4MNEA 4BTMA 4WSQA 1RJBA 3R04A 3AQVA 1ZOEA 2BRGA 2HZ4A 3KFAA 3RTPA 5A4CA 3W0SA 2BIKB 2ITOA 1LEZA 4TWNA 2QODA 1OI9A 1QPEA 3TEIA 1OL2A 1F0QA 2WMQA 2OJGA 3OXTA 1P5EA 2CGWA 3PVUA 4MKCA 5HCYA 4Z7HA 5HU9A 5BYLA 3AGMA 1MQ4A 2OK1A 1PXMA 3D9VA 3MBLA 4FKQA 2IO6A 2R3RA 4NKAA 4TN6A 3WIGA 5DPVA 4PDYA 1UWHA 3F9NA 5FP5A 3CEKA 5GJGA 3BEGA 3NUXA 4C59A 3LXPA 3B8RA 4FZAB 4QQTA 4UZDA 5I9WA 2JDVA 3OXZA 1NVQA 2JDRA 4NCTC 3WE4A 4AA5A 1H8FA 4IX4A 1QPDA 3FI3A 3GXLA 3R8LA 4M69A 1OZ1A 5DFPA 2NRUA 4BKZA 2Z7LA 3LMIA 3BLRA 3NFGB 3ZUTA 1YDRE 3FZOA 3KEXA 4AGCA 4O0SA 2W06A 3KRXA 4FV1A 4AZFA 4FJVA 4IIRA 3R71A 1OL5A 3R01A 3UYSA 4I4EA 5IDNA 4BI1A 2X1NA 2XBJA 3D0EA 4A7CA 4FKWA