3H9RA

Crystal structure of the kinase domain of type i activin receptor (acvr1) in complex with fkbp12 and dorsomorphin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
328
structure length
312
Chain Sequence
TTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Bone Morphogenetic Protein Receptor ALK2 and Implications for Fibrodysplasia Ossificans Progressiva.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/protein kinase
molecule keywords Activin receptor type-1
total genus 105
structure length 312
sequence length 328
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
A PF08515 TGF_beta_GS Transforming growth factor beta type I GS-motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3h9rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3h9rA01
3A61A 3H9RA 3VIDA 5LARA 2H6DA 3PWYA 2J5EA 2F49A 2QVSE 4Q9SA 2HAKA 4FNXA 4AW0A 4AW5A 4CFWA 4O7TA 4CFVA 4JDHA 1XBBA 1Y91A 2ZJWA 4FV3A 2HYYA 4N6YA 3NUUA 5B0XA 4FKIA 1H01A 3GFWA 3ZSHA 2E9NA 1U46A 4IJ9A 4R3CA 2BZKB 4ASDA 4QMTA 3DXNA 3RAIA 3QQGA 1KE5A 1J3HA 1ZOGA 4CVAA 4N0SA 2VWWA 1E9HA 3U9NA 2XNGA 3KXMA 4ID7A 2YZLA 3LCOA 4AA4A 4Z16A 1W82A 4RSSA 4TKSA 4YJQA 4AZVA 4WA9A 5CF6A 2OSCA 3Q4ZA 3NCGA 2RFEA 2YM7A 1KV1A 5FLFA 4EK3A 3PJ1A 5GJDA 1YHWA 1R78A 4BGHA 3E88A 4YNOA 2W06A 3ZS5A 4ZSGA 4WSYA 3BPRA 1FINA 3N51A 2ETRA 1O9UA 3CLYA 4IW0A 4D55A 5HBJA 5I0BA 2Y0AA 1KOBA 4KD1A 3OS3A 3NAXA 5DRDA 4L44A 4YHJA 3ZMMA 2HY81 5J5SA 4DTBA 5AUYA 2CCIA 5D7VA 3DK3A 5GINE 4Y46A 4GJ2A 3CQUA 3R8UA 2W4JA 3KXHA 5IQBA 2ZV2A 3L9NA 3BZ3A 4IAKA 4BIDA 4QMQA 3IONA 5I9XA 2RFNA 4FZAB 3QYWA 2QU5A 1H26A 2YM8A 2ZV7A 5C4LA 4QMVA 4B8MA 4GIHA 2ERZE 3QZFA 3LFAA 3A60A 3VS5A 1F5QA 2W1ZA 3DJ6A 1WBNA 5LMBA 5HI2A 4BY9E 2F7ZE 3C0IA 3PG3A 4BICA 2I1MA 2O0UA 4MNEB 4NJ3A 1H1QA 5JRQA 3CD3A 4ACDA 4QMSA 3BE9A 1J7UA 1FGKA 4ZTRA 2BVAA 4BCMA 4J97A 3E7VA 5A4EA 5E4HA 3TZ7A 2X4ZA 2OH4A 5IKWA 2WAJA 2OZAA 3W1FA 3M11A 5L8KA 3BGZA 4BTFA 1YOMA 1GIHA 4K2RA 5DMZA 4LFIA 3UVQA 2X9FA 3LM0A 5IUIA 3HNGA 4UMUA 1CSNA 1H1WA 3DFAA 3QX4A 4FYOA 3OVVA 4AOTA 3GFEA 3C5IA 5L8JA 1Q8TA 3LIJA 3PE1A 4IANA 2I7QA 2W0JA 1CMKE 3CBLA 4Y83A 3QUEA 2P33A 3FHRA 1GZ8A 5FTOA 1YHVA 4KRCA 4AUAA 4I92A 4QPSA 3VUKA 2QODA 4YO4A 5BX0A 2J0JA 3LQ8A 3WF7A 3R7GA 2XKEA 3BBWA 2UZOA 3HX4A 2BZHB 4O0WA 3Q53A 5AV3A 3C9WA 4GT3A 3D2KA 2VO0A 3DY7A 4LUEA 3I4BA 3A4OX 5CAOA 1GY3A 4NFMA 3I5NA 4Y72A 4AX8A 4YR8A 4ZSJA 3COIA 3GOPA 4CMOA 4JRVA 4PV0A 1JNKA 3SW4A 1OM1A 3GCPA 2QOQA 5EOBA 5CEMA 3VO3A 3TXOA 2CPKE 3HRFA 3R21A 4NWMA 4C7TA 2QO2A 4F7NA 2NPQA 3QAME 3MS9A 2X6EA 4L68A 4GT4A 3CTJA 5JH6A 3ID6C 4MBIA 4KABA 3MFSA 5CT0A 3CQWA 4D1XA 1ZARA 4C36A 4AQCA 5I5ZA 3PXQA 5CYIA 5DGZA 2CGWA 5J1WA 4MVFA 3KFAA 4UV0A 4F4PA 4FV4A 4HNIA 3OOMA 2WU7A 3KC3A 3QZHA 4FSYA 4A9SA 3Q32A 5HESA 3EKKA 4NL0A 5EI8A 1V0OA 2C6DA 2JBOA 4NTSA 2VNWA 4PDYA 4LMNA 2ITWA 3DZQA 1IRKA 4C35A 3UZPA 3EZVA 2H9VA 4O38A 4QYEA 4F6WA 3PXYA 3DNEA 4HYSA 5IU2A 2JGZA 3UZTA 3QXPA 4FMQA 3BU5A 3IGOA 3L1SA 4TYJA 3SXSA 4A7CA 5CZHA 3SXRA 2PZIA 2UVYA 3R02A 2BTSA 2XNBA 4EUTA 4Q2AA 1OL1A 1H08A 2R64A 4ANMA 2GHGA 2W4OA 4YZNA 2X2LA 4FODA 1LR4A 4IDVA 4FGBA 4QYYA 5CXHA 3OCGA 4FV0A 2HZ0A 4PQNA 3GU7A 2CGXA 3IW7A 4ZTMA 4BZOA 3PVWA 3VUTA 4UYAA 4FK6A 4TWPA 4BDFA 2DYLA 3FQHA 1H25A 3DV3A 2F7XE 2QO9A 3AMAA 2O3PA 4ZSEA 2GDOA 4DC2A 3L8SA 5HU9A 3QLFA 1W0XC 4X3JA 4XCUA 4YTCA 3TNPC 1AD5A 1TQIA 3UIBA 1Q4LA 3MTFA 3AG9A 2J0KA 2YLEA 4FSTA 3VF8A 2WOTA 3MVLA 3BHTA 5I3RA 4EZ5A 2WEIA 3EHAA 4DGLC 2Y7JA 4ZY6A 3KRLA 3QU0A 3IDPA 1YOJA 2BRMA 2XRWA 3GQLA 2OBJA 4F1OA 5IQGA 1LEWA 5F9EA 4EH6A 4I6HA 4MXAA 4E4LA 2R3RA 4DEAA 4DEHA 2UZWE 3ANRA 5J95A 3ZYAA 2EB2A 3C0HA 4PTGA 3DZOA 1Y57A 4M84A 3RCJA 3DK7A 4MD8E 3HA8A 4M7IA 4EOJA 5IA2A 1YWNA 4U80A 2NO3A 3R73A 1WBSA 2B55A 2PWLA 3OG7A 4FTAA 4TRLA 4EQCA 5FDPA 3PTGA 3T8OA 3S0OA 2PUUA 4FKGA 5FM3A 2ZM3A 1JKSA 4RVTA 4O1PA 2BKZA 4TWCA 4AZFA 3GVUA 4V0GB 3UNZA 3W33A 4AN2A 4K1BA 5A54A 3UQFA 5EQEA 3THBA 4C59A 4G9RA 4J95A 1WBVA 4XG4A 4XV3A 4EOPA 3O17A 5KKRB 5C8MA 1VR2A 3BGPA 4D58A 1OPJA 2BMCA 4GRBA 1WFCA 4LGHA 4OTDA 4R1YA 4RZVA 5HGIA 3UC4A 4EOOA 4D4RA 4EUUA 4TNDA 4FKJA 4DH5A 4I23A 3OT3A 4BI1A 4OTFA 1JKKA 2AYPA 4L3LA 4MBJA 4CEGA 4EOIA 3EQFA 5IQFA 4H05A 1ZXEA 4DEDA 5CEQA 4KBKA 5F95A 4W9XA 2GS7A 4LV5A 5FTGA 4MD7E 3UC3A 3WF8A 4F65A 1H8FA 2P3GX 3AD4A 5DR2A 2IWIA 4FT3A 4BKYA 4CLJA 3ALOA 1Q8YA 1FMOE 3P1AA 2WTIA 4UBAA 4WNKA 5E9EA 1SNXA 2CGUA 4WIHA 4FUYA 4L7SA 3VQHA 1PXMA 4N6ZA 1W84A 4FT9A 1V0BA 1A9UA 2OKRA 3FLWA 2B9HA 3D5UA 1ZMVA 4FKQA 4QOXA 4RZWA 1NA7A 4H39A 5EDQA 1GIJA 4NM7A 3FKLA 5AP0A 5AP1A 3PXZA 4XP0A 4H1MA 3UMXA 3C5UA 1U5QA 1WBWA 5HQ0A 2W05A 2YM3A 4G16A 5DRBA 3WZJA 1XBCA 2G01A 3K3JA 3UOLA 2Y4IB 3D5XA 5EI6A 3QZIA 5EKNA 5H9BA 1M52A 2BAKA 1YDTE 2IVSA 3V04A 3V01A 4AG8A 2BR1A 3C51A 4EH4A 5IH5A 4RG0A 2YIWA 3MBLA 2YHVA 4GK4A 5D12A 5FDXA 3TKUA 4BTMA 5CAQA 4GVJA 5E8SA 2PPQA 3LMHA 4RVMA 3EFKA 2B9FA 2GNFA 3PJ8A 4UALA 5C8KA 4M67A 3V5JA 5HNGA 5E7RA 1I44A 5BVEA 2WQBA 3UYSA 4O7NA 2X7OA 5A3XA 1UWHA 4IM3A 3HV7A 3HP5A 3QTUA 4WUAA 5E92A 4HCTA 4JOAA 4W8DA 1KWPA 2IZTA 2XM9A 5HOAA 4I6FA 4A4LA 1UNLA 1GIIA 5AAGA 1GZNA 2DWBA 3G0FA 4QMYA 3Q04A 4WSQA 4XG8A 3QHRA 3IGGA 4GFGA 2JAVA 5DNRA 3GU8A 3UVRA 1CKJA 1T45A 1ZYJA 3QRIA 4C57A 5L2IA 4QQ5A 3M1SA 1S9JA 2XYNA 1U59A 2G2IA 3MB6A 3R28A 3U4WA 5CAUA 4MK0A 3D0EA 3QQKA 5ANDA 4O1OA 3QZGA 4QYFA 4CRLA 4O6LA 3F5PA 2C1AA 4YP8A 4XJ0A 4C8BA 4HCUA 4PPCA 4TYGA 2OJ9A 4EHZA 5FTQA 1SVHA 4ANLA 2ZM1A 1ZY5A 4O7RA 4K8AA 3KULB 5AV0A 4Q9ZA 1J1CA 3C4CA 4LL0A 4ZMFA 4K6ZA 3PJ2A 4FZ6A 1YDRE 2IN6A 4YBJA 3Q4CA 4BGGA 4FGRA 3KVWA 4QP7A 5J1VA 3I1AA 5HZNA 5HCXA 5BNJA 3LW0A 1REKA 5DN3A 3AC4A 4NM5A 5IZFA 4APCA 5IUHA 4AXAA 3I81A 2EUFB 4USFA 3CEKA 5HICA 4OGRA 4BKJA 3ORMA 3R7YA 1ZZ2A 2OJJA 3DAKA 3SD0A 2A0CX 2OXXA 3EL7A 3DS6A 3M2WA 3OWKA 3ROYA 3ZBFA 5AJQA 4IH8A 2UW5A 4QTBA 4O2ZA 4C37A 2WIHA 3SHEA 3U8WA 1OL7A 3O71A 4PMTA 3ZO1A 4KNBA 2R3KA 3R7UA 3HL7A 2W1FA 4NZWB 5CVGA 3PSCA 3CIKA 3PVUA 5J79A 3R8ZA 4YPSA 3VS2A 4OTIA 3TI1A 5HORA 2HOGA 3CTHA 2UVZA 2QI8A 3NNVA 4HGLA 2IW9A 3W8LA 1OKWA 2GQGA 3RK7A 1OL6A 3HAMA 2R0IA 2WPAA 4X7QA 2CLQA 2PTKA 4H58A 3AC5A 3K2LA 3KF4A 3OW3A 3R71A 3WE4A 4YPDA 3DB8A 2VTOA 1OKZA 3ANQA 3FWQA 3PJ3A 1SVEA 1BL7A 3QCYA 4TXCA 2PY3A 3FLSA 2J51A 5HD4A 3G2FA 5BYYA 3TNQB 3KCKA 1BLXA 3VUIA 3GC0A 1YI3A 3H0YA 1OKYA 3MESA 3FMHA 2PZPA 3WIGA 3V8SA 4BRXA 3UODA 2GS2A 3OFMA 5EM6A 3TIZA 3IECA 2IW8A 3SX9A 2GMXA 2R3MA 1QPEA 3D15A 4FOBA 3D2IA 3P7BA 3QQLA 4PNIA 4OAUC 3PP1A 4E5AX 3NDMA 4FL2A 4F9CA 4V01A 5A6NA 4I3ZA 3WIKA 5ANOA 4FEXA 2HXLA 2OFVA 2XS0A 5HHWA 3PY1A 1E1VA 2V55A 4YO6A 4XG2A 4E6DA 2IZRA 4AP7A 4BVUA 3C0GA 4J1RA 4LQMA 4AFEA 2J0LA 4M66A 2RG6A 4C4FA 3ATTA 3QC4A 5CTPA 3MVMA 4CNHA 1JVPP 2X81A 4EHEA 3PIZA 2UV2A 2WNTA 3ORZA 5IA1A 5KX8A 1P14A 2YZAA 3QRKA 5BVKA 2OF2A 2WMRA 3A8WA 3V3VA 3KULA 2R3IA 5KMIA 4UXLA 3KK8A 2DS1A 2R3FA 4Z7GA 4WNMA 4HYUA 4JJRA 1U4DA 5EHYA 1J7IA 2QNJA 5GIOE 3F66A 3EQIA 4I5HA 2Z02A 4HZSA 4GEOA 3FMJA 4U43A 4R3PA 5AV2A 3H30A 5DEWA 2QLQA 1PXPA 4GKHA 4OAVB 3PIXA 2X2KA 3KMUA 1CTPE 4FI1A 1IG1A 3T3VA 3R7EA 4BN1A 5E91A 4AN9A 4XLIA 4EK6A 3OWPA 1PMNA 2R0UA 4FT0A 1MRYA 1V1KA 3IQ7A 3EFJA 2J0IA 3O7LB 2WFYA 3OT8A 4IIRA 3QF9A 3MA6A 3CE3A 2F57A 1XH8A 5ANJA 5I9WA 4LRJA 1REJA 5ANKA 4I4EA 3NUPA 3ZM4A 3IS5A 3LFCA 4UYNA 5AP5A 5FQDC 5TT7A 4BWPA 5AA9A 3E7OA 3UP7A 4G3GA 4TWNA 2CLXA 2XIZA 3I0OA 3OUNB 3Q4UA 4IVCA 2XKCA 4XP2A 4CZTA 5AEPA 2CGVA 1W7HA 4DFUA 4FEQA 4QNYA 4FV5A 3FL4A 3LLTA 2C0OA 3EQGA 4JIAA 4WHZA 4RJ5A 5L2SA 3N4TA 2CN5A 4QP4A 3GC8A 4BBFA 5M44A 2YJRA 3QTWA 4E20A 3NUYA 2ITTA 2EB3A 1QPJA 3LFEA 4U81A 3DFCB 2KTYA 3R83A 3RHKA 4FV7A 3PWDA 3QCQA 1STCE 2QURA 2PUNA 3GC9A 1AGWA 5E1EA 2WMWA 3GNIB 3VWAA 2YCSA 5AUVA 4HPTE 3ZFXA 4EJNA 4KIKB 3ZZWA 5L2TA 4AGDA 1YQJA 4FTIA 1JBPE 3GU4A 3Q6WA 4P5QA 4D4YA 2O8YA 5C1QB 1GOLA 3REPA 4A9RA 4LGDA 5F4NA 2V22A 2WMVA 4HVGA 3BCEA 3KB7A 3NUSA 4B8LA 4BCPA 4O91A 4X21A 5AP6A 4YTIA 3AD6A 2PE1A 3NEWA 3ZFMA 4A4XA 4FTNA 2WD1A 4AZTA 3R30A 4IWDA 2JKQA 4FG7A 4YC8A 4O27B 3LOKA 4NU1A 5E8TA 4FK3A 5E8XA 2E9UA 3D14A 3WYXA 4BDCA 4BDBA 5M4IA 3SLSA 1WBPA 4FTKA 1K9AA 4EHVA 4CZYB 4PL4A 4F0FA 5LMKA 5KMJA 3Q2JA 3RZFA 3FUPA 3CQEA 2XK9A 3COHA 3OD6X 3R22A 4JBOA 4FL1A 5EM8A 4ANQA 4B99A 4BIBA 5E1SA 4DN5A 5I9ZA 4RC2A 1U5RA 4JI9A 5B7VA 4IX6A 4FV8A 4NIFA 4F9BA 1O6KA 3R1SA 3TT0A 3BHUA 4IZYA 4J53A 4MKCA 2WU6A 5CU2A 3ZO3A 2OZOA 4O86A 2YIQA 3R9DA 2XP2A 4UMQA 3DBDA 4CKRA 3DBCA 1OMWA 2RG5A 2CJMA 2VO6A 4M69A 4L7FA 4QQCA 4BI0A 1JQHA 4LMUA 2ZV8A 3Q6UA 3QRTA 3H4JA 3QTSA 1MP8A 4O7WA 4LRMA 5L2WA 1KE7A 3B2WA 5GZAA 3AC2A 4TT7A 5JFXA 5AR3A 5JFVA 4B4LA 2YN8A 3E5AA 1PXIA 3NPCA 4QMZA 3V51A 4RQVA 3MGYA 3F5UA 3JXWA 4YZDA 5CSWA 3FXWA 1H1RA 3PG1A 4CFXA 3TZ9A 4AN3A 3NNXA 3UIUA 4LOOA 4X2FA 1J91A 3RK5A 2RSVA 3UGCA 4E1ZA 4O81A 3G15A 4KA3A 3SA0A 1PY5A 1NVRA 5LOHA 5JFWA 2CNVA 4LL5A 3AMBA 4ZP5A 2IVVA 3R01A 4ANBA 1JWHA 2BALA 4AS0A 5IA0A 1UU8A 5B2MA 3OY1A 3UP2A 5HE0A 2PULA 2UZDA 3BV2A 1OECA 3MIAA 1V0PA 3IW8A 1GJOA 3F88A 4FZ7A 3ETAA 4WG5A 4YZBA 5JRSA 3MB7A 3BHHA 4E4MA 4EI4A 3UTOA 3F9NA 5CVFA 4YUQA 5J9ZA 3ATSA 3PPKA 4O82A 2Z60A 2WGJA 3R0TA 1BI7A 3KXGA 2GQRA 3PP0A 3HMNA 4RMZA 5FD2A 2QOFA 3RM6A 5IH6A 2JFMA 4CYJA 5AP4A 3P4KA 4F6SA 5EW9A 5L6OA 5L4QA 2BDFA 3R63A 2OXYA 5C26A 2BILB 5KBRA 4I6BA 3VS7A 3FKOA 3NWWA 5KZ0A 2Y6MA 3UE4A 3G90X 4WOVA 4KS8A 3DA6A 1WVYA 4IEBA 3EFWA 4EWHA 3T3UA 4APPA 3UQCA 2XM8A 3NGAA 5DHJA 2V7OA 3BLQA 2PSQA 3TV7A 4L46A 3IW4A 3PJCA 3V5QA 2ITOA 2CHLA 2Z8CA 3EQPA 3OUKA 5LQFA 3RI1A 3ZFYA 4DGOA 3UOJA 1YXUA 4PDOA 5K4IA 2W96B 2PVJA 3HV3A 5TO8A 3DKCA 2OG8A 1SNUA 3LPBA 3TZMA 5HTCA 3WYYA 4DBXA 2JKOA 2C6LA 2G15A 5HBHA 4AGWA 1OI9A 3P79A 3DOGA 4EWQA 3TUDA 5J87A 2J5FA 2ZMCA 4FKLA 4TZRA 2Z7SA 3BQRA 4FSQA 4TYHA 5AP3A 4DTKA 2WQMA 1H1SA 5EK7A 1G8AA 4TY1A 4GMYA 5LMKC 3SC1A 4OBPA 5G1XA 5D9HA 4FTRA 3ITZA 4PRJA 3D5WA 4Q5HA 4FIIA 4QP2A 4R7HA 5K5NA 1M7QA 2WMTA 1AQ1A 2W1HA 3EN6A 3GCUA 3W2PA 4AZEA 2C6EA 4WO5A 3KREA 3BU6A 2QHNA 3H9FA 4JT3A 4RJ7A 4DLJA 2R2PA 1WCCA 2OO8X 4BDIA 4E4XA 5HE3A 1ERKA 5M07A 5JFSA 5FXQA 3QUDA 3FY0A 1WBOA 4I22A 4C34A 4K11A 4Y5HA 3UG1A 5HX6A 3IK3A 3I0QA 1P2AA 5KMLA 3N4VA 3OROA 4AE6A 2UZLA 4CLIA 4M3QA 1FOTA 2FSOX 4X6RA 5L8LA 5DH3A 1YW2A 3E8NA 1UU3A 3LMGA 4CD0A 3K54A 1OB3A 2OICA 3CD8A 3NW6A 4BCHA 5IMEA 3TKIA 4CZUA 2X7FA 2GNHA 2UVXA 3FXXA 3K5UA 4R5YA 3MJ1A 4Y5QA 5HVJA 3Q3BA 3TV6A 4CTCA 4DH1A 4L3PA 2IZSA 4WBOA 4TYIA 3QBNA 4UMRA 5HEZA 1PYXA 4YHTA 4WKQA 3FZTA 3PYYA 5D1JA 4G2FA 3VBTA 2UW8A 3FYKX 4RT7A 5IQHA 4OTGA 3FV8A 1YRPA 2PL0A 3BYSA 5EH0A 3EL8A 3UIXA 3QQFA 2C3IB 5K9IA 4GU6A 1Q8ZA 3WOWA 3QGWA 2VRXA 2C6IA 2I0VA 4WNOA 3TL8A 1URCA 2QC6A 1UNHA 2REIA 2XMYA 2YCQA 3ZLWA 4D2PA 2WTKC 4AE9A 2IZUA 4BWKA 5DFPA 5BVWA 3GU6A 3PY0A 5AADA 2VTHA 2WTWA 4JL9A 3R8VA 1YXVA 1RW8A 5CEPA 3GI3A 2UZNA 2YWVA 5KKRC 2B7AA 2X2MA 5LVOA 3AT2A 3QFVA 2VGOA 3QC9A 3AGLA 2DQ7X 5EM5A 3NNWA 3PRFA 1VZOA 2X1NA 4M69B 5DT3A 1OGUA 3HMIA 4EH7A 3GCVA 2W9FB 1Q3WA 3DQXA 3RWPA 4ZJIA 2X9EA 1W83A 2C4GA 1UA2A 5JGBA 4TL0A 4G34A 2C47A 1UU9A 1PRYA 3UVPA 2BFXA 2X8IA 3IG7A 2OIDA 5M56A 3I5ZA 5TOZA 4U9AA 3IW5A 1JSUA 5FEQA 4DAWA 5IQAA 3CKWA 2YDKA 4GUBA 4X2KA 4FX3A 3DKOA 2GU8A 4I4FA 4XOZA 4ZLYA 4G3FA 3B8RA 5AWMA 5HLNA 3QQUA 4CMUA 2B54A 3B2TA 4RX8A 1IAJA 4ACMA 4D2RA 4FKRA 4XH6A 5EYKA 3KRRA 3E3BX 3I7BA 3W8QA 4DGMA 3ZSIA 2X0GA 5HG8A 5CSVA 4PUZA 2BRBA 1ZY4A 4ASEA 1R39A 4IB3A 3ZDIA 2XEZA 4I41A 2A4LA 4D1ZA 4U41A 1YDSE 4X2GA 1OKVA 4W4VA 3VUHA 1G8SA 3FLYA 4IBMA 3NUAA 4ANNA 2J6MA 4OTHA 2VTAA 3ORKA 3UO6A 2QOBA 3EQCA 5H8EA 3R8MA 3A7IA 4G6OA 3OBJA 4AGCA 4U45A 4RJ3A 4F9AA 2ZYBA 5CY3A 2VTPA 3WZKA 4IVDA 4NFNA 5ICPA 4FTTA 4BCNA 4IFCA 1O6YA 5A14A 1PKGA 4S30A 4UY9A 2ZAZA 2PU8A 2ACXA 4NT4A 3MI9A 4B6LA 5CF5A 1MRVA 2ITZA 2OIQA 3CXWA 2VO7A 3U6IA 2HZIA 2WZJA 3BHYA 3PA3A 4FTCA 1LPUA 2RKUA 3CTQA 3R7OA 3KGAA 4V04A 2E9PA 2PYWA 4D28A 3ACJA 1H07A 2UZTA 3HMPA 2UW9A 3FLQA 4HGEA 4PTEA 3W10A 4E73A 2XNOA 3POOA 3R8PA 4Y85A 2I0YA 5M4FA 4QMXA 3QCSA 2OU7A 4FV2A 5CAPA 3GUBA 3EYGA 4X3FA 1R3CA 4FKWA 3PIYA 4BTJA 1MRUA 3TUBA 1PXKA 4BDAA 4Y95A 4F64A 3FZOA 3W18A 3F3WA 4RFMA 4DTAA 5JQ8A 1XJDA 3S2PA 2VZ6A 4GYIA 2GFSA 1DS5A 1YHSA 1X8BA 5FBNC 4JS8A 4EORA 4QQJA 2XIXA 2B0QA 3HMOA 3DXQA 5F94A 3S4QA 2CNUA 4DYMA 2F7EE 3FKNA 4CFNA 5LVPA 3FQSA 4ZOGA 3RK9A 1RDQE 3POZA 4ITJA 5FXSA 2C6OA 4KIPA 3WF6A 3QKKA 1F3MC 3KK9A 3MVJA 1QCFA 1H00A 4J71A 5CNNA 1GNGA 3QD4A 2X6DA 4RWKA 2PK9A 5JQ5A 5HU3A 3HRBA 2KULA 4KBCA 2VTTA 4MXXA 4WBBB 4ANOA 2X8EA 5F20A 3LJ1A 1OIYA 2C1BA 2YERA 4G3CA 4C02A 2Y8OA 5CT7A 4Y73A 3ULZA 3E8CA 2JDSA 3EFLA 3ZLSA 4I0RA 4F7LA 3R04A 2C6MA 4ZSAA 3ORXA 2VTJA 3PVGA 5CU4A 3HA6A 4K77A 3COKA 5BUEA 4BDJA 3SOAA 4H3PA 4TWOA 3KXNA 3LFNA 3KXXA 4C33A 3L8PA 4CKIA 5GZ8A 1UKHA 4C3FA 3TJDA 4ZTQA 3H9OA 4YJRA 3EB0A 5DEYA 1A06A 1ZWSA 3HDNA 5T3QA 4ENXA 2W1DA 3KQ7A 3NYXA 2CSNA 1XHAA 3MY1A 5DT0A 5A6OA 4S2ZA 2HW7A 3TTIA 5ANIA 3WBLA 1DAWA 2GCDA 4ZZNA 3F7ZA 2PUPA 3LAUA 3MH0A 4HNFA 4M68A 4ERKA 2R3OA 2BCJA 3BLHA 3IDBA 3QX2A 5HLWA 5ITAA 4OTWA 2J7TA 3P7AA 4P7EA 3OF0A 2CCHA 4IDTA 4RC4A 4AOIA 2R7IA 2WKMA 3KU2A 2W17A 3K5VA 3RAKA 4DFLA 2B52A 3R1NA 2UW4A 1Q62A 1Q8WA 4USDA 2XCHA 5AMNA 1OPKA 3A7FA 3JY9A 2VTMA 3KMMA 2OJIA 5T68A 2WTJA 4RLLA 3R9RA 3O51A 2BZIB 3HDMA 3MPAA 3QXOA 3BI6A 4IAAA 5H8GA 4JBVA 2WXVA 2VTRA 3BRBA 4FKOA 4RIXA 1HCLA 4ZAUA 3GP0A 1PMUA 5FBOA 5I4NA 2UUEA 3I6WA 4ZJVA 2R3JA 2VTNA 5DIAA 4BCQA 5BUJA 1OUKA 4HZRA 2EXEA 4ACHA 5HNIX 4FEUA 5AUTA 2ITUA 4MWIA 4GW8A 3ZTXA 5M4UA 4GU9A 4LM5A 4NYEA 1RQQA 4NK9A 5AIRA 5M55A 4XG7A 4Z3VA 2BZJA 2NRYA 4GFMA 3NYVA 1F0QA 3QTQA 4MD9E 3RVGA 2IVUA 1BKXA 2PVYA 4ITIA 3QA0A 2RL5A 3IDCA 2G1TA 1G5SA 4Z7HA 5LCJA 4YU2A 4L6QA 4K33A 4DFBA 4E7WA 4EZ3A 4R7IA 1Z5MA 3A4PA 2CKPA 5EYDA 4RIXB 3PRIA 2YWPA 4RIYA 4AZWA 5M4CA 4IACA 2YIXA 4CTBA 1WAKA 2WB8A 4ZTLA 3UJGA 5AA8A 5KZIA 3VBWA 5M09A 2ONLC 3QTRA 4HJOA 2FSMX 3GENA 2X39A 5D11A 3MY0A 2NNWB 5TKDA 2J50A 1UKIA 3JS2A 4PMMA 3NMUF 4HOKA 1H28A 2R5TA 4G3EA 2AC5A 4M8TA 4RJ6A 5IDNA 1NT2A 2QU6A 1SVGA 3FMLA 3I60A 1OIQA 4E3CA 4FKUA 4FSZA 2F2CB 3NS9A 3HRCA 4MXCA 2GPHA 3ZH8A 4C3RA 1U54B 2W9ZB 4I5CA 5L6PA 3G9LX 5IQDA 2V7AA 5ANGA 2JIUA 3NSZA 5HO8A 1NVQA 5IUGA 2XRUA 4A9TA 1FQ1B 4FIGA 3SKCA 2BRHA 1KSWA 1SZMA 4QTCA 4TYEA 1DI9A 3TCPA 4EEVA 5CAVA 3VHKA 5ACKA 3DJ5A 3BX5A 4KIQA 4OW8A 2ZMDA 4YSMA 3FC2A 4QD6A 1FVVA 2WTCA 3NCZA 5DR9A 4F9WA 4FTMA 4PPBA 4OTQA 3ZSGA 4YJPA 4F6UA 2H8HA 4D2VA 5AFVA 4JDKA 2E9OA 3TV4A 4ACCA 4DF3A 4PP7A 1NY3A 3SDJA 3ORLA 2BHEA 4I24A 1ZOHA 2OW3A 4TN6A 4YTHA 2LGCA 3FI2A 3LCKA 2XA4A 4O96A 4E8AA 3S1HA 5AX9A 2W5AA 3LFFA 3G6HA 3EMGA 2A2AA 2QOLA 5HNBA 1JSVA 1ZAOA 4DG0E 4YLKA 5CU0A 5DWRA 2J9MA 2E9VA 4YLLA 2XBJA 3W2QA 3NVKI 5ETFA 4G5JA 5KMOA 1MQ4A 3QTIA 2G2FA 3LQ5A 3AGMA 4L52A 3CY3A 4F7JA 1IA9A 2ZOQA 2PVMA 3Q2MA 1YXSA 5GHVA 1OBGA 2Z7RA 5KMNA 4PPAA 3VN9A 1OZ1A 4E6QA 1SMHA 2YM6A 4M0ZA 1QPCA 4PX6A 1PYEA 4NSTA 3MFRA 3ZZEA 3RPSA 5JEBA 4BWXA 1UWJA 3IOPA 4GKIA 3EN5A 4IAIA 3MTLA 3V5TA 5IEYA 4L53A 4TW9A 3CY2A 3OW4A 3HV6A 4UMTA 3ZUVA 5HE1A 2WMAA 2BFYA 4F1TA 4G3DA 4BCFA 2ESMA 3ACKA 3FDNA 4HYHA 4IX5A 2P2HA 4G6NA 1L3RE 2BRGA 3Q9YA 4O22A 3PA5A 4GG7A 3QUPA 5EM7A 5CX9A 2X8DA 4QMUA 4O0XA 4IAYA 5K0KA 2ZV9A 4FSWA 2YISA 4AF3A 4QQTA 4JAIA 2P2IA 4CSVA 3P7CA 4L3JA 4C4EA 3WZDA 4RA5A 4AT5A 2BDWA 3OHTA 4KIKA 1Q5KA 4CQEA 4Z55A 3BWJA 3W2CA 4O7ZA 1EH4A 3W16A 2V5QA 2GSFA 5IA3A 5IF1A 1VJYA 3VAPA 1ZMUA 2O63A 4FIHA 1K2PA 4KWPA 5CEOA 2JD5A 3U9CA 4LGGA 1GZKA 2GNIA 3DDPA 4CCBA 3U6HA 4U3YA 4V0GA 3G9NA 5DVRA 2RFDA 5IG1A 3CGFA 1H0VA 3HYHA 5LWMA 3DLSA 4MQ2A 4E6AA 4OBOA 1XBAA 4QTDA 3C50A 5M57A 1H24A 4PL5A 1U54A 4JQEA 4FTJA 4MQ1A 4U44A 3SG9A 1ZZLA 4FKSA 1JKTA 2WQNA 4FIJA 3KF7A 3HECA 5GJGA 4A9YA 5M53A 5K4JA 2PHKA 4ZSLA 5EKOA 4BYJA 4FSRA 3ROCA 5JGAA 4ZZOA 4R8QA 4RQKA 2I6LA 2YIRA 1OL5A 2ZDUA 4IWQA 4BTKA 4KIOA 3FI3A 1H27A 4AA5A 2F2UA 1MQBA 3QRJA 5ETIA 3ERKA 2A1AB 3FYJX 3BLRA 5K3YA 4GVAA 4AAAA 4BL1A 5M51A 2VTSA 2GS6A 4N70A 2QCSA 3FBVA 1XH6A 4P4CA 4U0IA 3VUMA 4M97A 4U7ZA 4MX9A 4WNPA 4MF1A 4M13A 5HVYA 3V8TA 3FMMA 4XV9A 3BEGA 3UQGA 4XNEA 3OTUA 4ALWA 3AT3A 3F5XA 4GT5A 3R9HA 4IZAA 4QP8A 4UMPA 3I6UA 3E62A 5AR5A 3CJFA 2HENA 4D5HA 2XYUA 3ULIA 5HTBA 1M2PA 4YMJA 1XH5A 3PE2A 2JAMA 2YEXA 3TEIA 4CMTA 2JITA 2P0CA 4WD5A 3TM0A 4HVHA 2HK5A 3ENMA 2P55A 3RPOA 1PMEA 5DLSA 3MN3A 4P2KA 5FGKA 3II5A 3F2NA 5E8VA 3QLGA 2W5HA 4EYJA 2J4ZA 3LFDA 4TNBA 2VTLA 3WZEA 2W7XA 4FZDB 4K18A 4CFUA 4JXFA 2R3NA 4DEBA 3C13A 4MXYA 3UNJA 3E92A 2XZSA 3L8VA 5CZIA 4D2SA 4ITHA 2IG7A 3IO7A 4W9WA 3WE8A 4ALUA 4BCGA 2C6TA 2GFCA 2BUJA 4S34A 3W2RA 2WMXA 1YWRA 4EZ7A 4EOSA 4W4WA 3BQCA 2FB8A 3UG2A 4CFFA 4HW7A 3MWUA 5IDPA 1TQMA 1ZYCA 4WRGA 1ZYSA 2HCKA 4CT1A 1J7LA 3VBQA 4JDJA 3U6JA 4KKGA 4NTTA 4RIOA 4U3ZA 5J8IA 4O83A 3FEGA 3NZ0A 2FSLX 4XBUA 4NCTC 4DH7A 2WHBA 2WQOA 4XV1A 3AT4A 2ITPA 3AXWA 3BBTB 3NIEA 3QTXA 3BYOA 5FRIA 3RHXA 4O0VA 4AFJA 3QL8A 5CASA 3D9VA 2IW6A 4GH2A 5E8YA 4N4SA 2RF9A 3EN7A 1Q61A 4JRNA 4D4SA 3EKNA 3KRWA 1BX6A 1Y6BA 3KRJA 5FXRA 2SRCA 3ZU7A 4NJDA 3DKFA 5B2KA 3DLZA 5BVNA 5BPYA 1DM2A 2R3HA 3D94A 4FSMA 4M0YA 1QPDA 4MNFA 4ALVA 2PUIA 3O0GA 3DTCA 5JSMA 2ITNA 3NUNA 4FTOA 2CDZA 3A7HA 3FJQE 4RIWB 4TPTA 5HBEA 2JDTA 3ZO2A 5CSXA 4F09A 5AR8A 3ZRMA 4EJ7A 4YBKA 3TIYA 3EYHA 4IWOA 3ZLYA 5C03A 3DPKA 4BCJA 1ZYLA 1PXLA 3NUXA 4F7SA 3W2OA 3MVHA 1W8CA 4EBWA 2W4KA 3EQRA 4OLIA 3RNYA 2PMOX 1K3AA 2Y4IC 2XK3A 2YITA 4HPUE 1ZRZA 4I0TA 4C0TA 5JGDA 3VVHA 3TACA 1Z9XA 2W1GA 3H0ZA 3ORPA 2RIOA 5I9VA 2YIYA 2YCRA 4RPVA 2WELA 1HCKA 3HKOA 3QQHA 5ETCA 3UZRA 4F63A 2ZDTA 4D5KA 2ONLA 2R3PA 3W2SA 2J90A 3TG1A 1E1XA 3U55A 5A4QA 5KMMA 2XH5A 4UWYA 3TN8A 2XBAA 3DKGA 5I9UA 2FA2A 3OEZA 5BYZA 5HCYA 4H36A 2C0IA 1GAGA 3L9PA 5DOSA 2I0EA 4C4HA 1T46A 2J0MB 1FMKA 2PVRA 3ORIA 5DG5A 1YVJA 3R00A 4O7LA 3AC3A 4A06A 4J98A 3LLAA 1KV2A 4PTCA 5FUTA 2BDJA 2C68A 4UB7A 4BR3A 1L8TA 4ZEGA 4D9TA 4GIIA 4KKEA 1SM2A 4F99A 3LQ3A 4BBEA 3FAAA 3KN6A 4QNAA 5BMSA 2UZUE 3MW1A 1PW2A 3F3VA 4H3QA 4IM0A 3R1QA 4GUEA 4RJ4A 5CXZA 5KHWA 3CSVA 3ODZX 4KINA 4XX9A 5H3QA 3SGCA 3JVSA 3M42A 4BHZA 3LXLA 2XNEA 4EHGA 5KCVA 3Q96A 2WTKB 4XUFA 5CF4A 1OPLA 2W1IA 4IAZA 5AR2A 2WTVA 3KRXA 5GJFA 3TZ8A 3E87A 4MCVA 2FGIA 3FMKA 4BDKA 3AMYA 4FKTA 1FVRA 4XG9A 5I9YA 2VD5A 4NKAA 3OWJA 5KHXA 1Q8UA 4EK5A 4O7SA 2QR7A 1UU7A 2R3GA 5EQPA 4AA0A 4YNEA 4IADA 5TE0A 2CN8A 5BUIA 3F3UA 4FOCA 3DJ7A 3SV0A 5EHOA 4QMNA 3UOHA 4ZS4A 4FKVA 2HXQA 2JDVA 2HZ4A 3MPTA 3OC1A 4FTLA 4XV2A 2XKDA 5D10A 1CM8A 3MJ2A 2QO7A 3ALNA 3R6XA 3OCSA 4AWIA 3D83A 2ITQA 3BGQA 4I5PA 4RFYA 1PKDA 4JBQA 3TDWA 3KA0A 4FUXA 3V5WA 3VRYA 3MFUA 2ERKA 4F0GA 3DCVA 2WIPA 3HGKA 3UBDA 4S31A 1BL6A 4JX3A 5E8WA 3VS6A 3UDBA 4DA5A 4ZJJA 5F1ZA 4G6LA 3RP9A 3MIYA 3R1YA 2C5YA 5AUXA 3C4EA 4OUCA 4NKSA 4EOKA 4DCEA 4WG3A 2C0TA 2JBPA 3F5GA 5CWZA 5HD7A 3IOKA 2GNJA 4DFYA 4ZMEA 4QT1A 5CU3A 3ZXTA 3QWJA 5IH4A 2WQEA 3HLLA 1IASA 2OI4X 4RX7A 1JPAA 3N9XA 4KBAA 2YACA 2XKFA 4EK8A 5H2UA 3VS3A 1ZYDA 5HX8A 1GZOA 1OL2A 3UPZA 4DCAA 4O2PA 4RC3A 1XH4A 4ONAA 5D7AA 3ZONA 4N57A 3ET7A 4IM2A 4CGAA 2LAVA 4IXPA 4IHPA 2QHMA 4LYNA 5DA3A 3R7IA 1APME 3HVCA 4ASZA 4D0XA 5AAFA 5JN2A 5KUPA 5AR4A 4AZSA 3OTVA 4QP9A 5AM6A 5KE0A 1OITA 4QRCA 3WF5A 4CQGA 4MBLA 2UW7A 4IVBA 5CQWA 2XK4A 4KKHA 4C4JA 5LVMA 3GB2A 5EDRA 3ZDUA 4IFGA 5J9LA 1Q97A 3S3IA 2UW0A 1RE8A 2Q0BA 4K9YA 4A4OA 4GG5A 4FT5A 3KMWA 3QQJA 4NEUA 4BI2A 2EU9A 3LHJA 4JQ8A 2W5BA 3ORNA 5DR6A 5ACBC 2VWBA 4HGSA 1PHKA 2H34A 4IX4A 5CI7A 5KO1A 1XR1A 4E4NA 5LVLA 4ZY5A 3C1XA 5HIBA 4DH8A 3HUCA 3FXZA 4RGJA 1FGIA 2C5OA 3WILA 1QMZA 2PVKA 4ZS0A 4GSBA 4FE2A 5IA5A 3IKAA 3QTZA 4J99A 2GQSA 3SQQA 4S32A 5EYCA 4HGTA 3A7GA 5HVKA 3FHIA 4AU8A 4G1WA 4FNWA 4FR4A 2BAQA 4QMMA 4PY1A 2PE0A 4EBVA 1WVWA 2C69A 2EXMA 1WBTA 2B1PA 5IEXA 4LV8A 3R9NA 3FMDA 2ITVA 4XEYA 5CS6A 2OJGA 5BMMA 3MSSA 1RJBA 4QYGA 5JK3A 4MXOA 4GS6A 4JR3A 3ZM9A 4U8ZA 3PZEA 2HY0A 4FG8A 4PL3A 3NYNA 2XK6A 5IQIA 2IPXA 5CI6A 3V6RA 5CANA 2C3JA 3MYGA 4FVPA 3UIMA 3ZRLA 1P5EA 4USEA 3O7LD 2PVLA 2JEDA 3JY0A 2BAJA 4EC8A 3QCXA 4G5PA 4O7VA 4IZ7A 5DPVA 5HG7A 2YM5A 3LM5A 4O0YA 4XRJA 4RIYB 3GU5A 3F69A 4EH3A 4R5SA 4ZTHA 5J7HA 5JT2A 2R7BA 4YJUA 5C27A 2OLCA 3LCDA 4CV9A 4DT8A 3VQUA 4I21A 2XEYA 4DEIA 5HKMA 3U51A 4L42A 2QLUA 5TR6A 1R1WA 2IVTA 4EL9A 4YURA 3D5VA 3NNUA 3KL8A 4DFXE 3DB6A 2UZEA 2QD9A 3DDQA 3OCTA 3NR9A 5B2LA 4YSJA 5DT4A 2YAAA 3UO5A 3AC8A 4YZ9A 5FEDA 2BKKA 3RGFA 1ZMWA 2YDIA 4ASXA 3FE3A 4P90A 3RPYA 2OH0E 3D7ZA 4DLIA 4NUSA 3BV3A 2WMBA 2Z7LA 2OIBA 3QALE 4DG3E 5A9UA 4YZMA 2QKRA 2PVHA 5BVFA 3PPJA 4O0UA 3GGFA 3MA3A 5HLPA 4S33A 3WARA 3N4UA 2YLFA 2XNNA 3I79A 4AW1A 1XH9A 4FA2A 5HG5A 2EWAA 2DUVA 3OCBA 3L9LA 3FPQA 2QR8A 4BHNA 4NIFB 3ORTA 4BZNA 5LMAA 3ENHA 2Y4PA 3V8WA 4IB0A 3GCQA 4JBPA 2XNPA 4BFMA 3P9JA 4MF0A 3FSFA 4YGAA 2ZB0A 3NLBA 3EH9A 2V62A 3P08A 3JYAA 4WG4A 3VF9A 3EQHA 2BPMA 3RALA 2VN9A 4YC6A 3PXKA 2XK8A 3QKLA 4QMWA 4FVRA 4X3FB 4H1JA 4YZCA 4IZ5A 2B9IA 3A8XA 1KUTA 3HV5A 3VUDA 3OOGA 5ETAA 3P23A 5A4LA 1OBDA 1M7NA 4R78A 5EI2A 4QO9A 3FQEA 4KB8A 3E93A 1PMVA 3G5DA 3V5LA 4BKZA 5HG9A 2W1CA 4YJNA 4DT9A 5IISA 4ORKA 1BUHA 4X2JA 2VWIA 5C9CA 4XMOA 3BYMA 4QP6A 1ZOEA 4GCJA 1W98A 2QG5A 5EFQA 4RFZA 2FH9A 5JZNA 3Q4TA 3ZEPA 3HV4A 4DGGA 3EN4A 3HAVA 2Y9QA 2VWXA 1IR3A 3KKVA 4QMLA 5AP2A 4EH5A 4NCTA 5EDPA 1YXXA 3FI4A 5EW3A 4YJTA 3BEAA 3RPRA 4C4IA 3PY3A 3WF9A 1Z57A 3NW7A 5T6KA 3LXNA 1CKPA 4BCIA 2QOOA 4MH7A 4HVIA 5AV4A 1IA8A 2B53A 4CYIA 4M14A 4PWNA 3DT1A 4AOJA 3TUCA 3RJCA 2F9GA 3UMWA 1CDKA 3RINA 3F82A 5FWKK 2PMIA 4O21A 3DBFA 3DAEA 3PLSA 3NX8A 3VNTA 2QG7A 4CG8A 5AAEA 2VO3A 5GIPE 4L67A 2X7GA 4GL9A 4I1ZA 1P4OA 2OJFE 1PJKA 2YDJA 3L8XA 4PMSA 4Q5EA 4YJOA 5LWNA 2GHMA 1XO2B 4QPMA 4XG3A 4E5BA 4M12A 4FSUA 3VRZA 5G6VA 2YJSA 3RWQA 3Q5ZA 4GYGA 3QD3A 1WVXA 3ZUUA 1YI6A 2VWUA 3QKMA 4J7BA 3HEGA 4DEGA 3FZSA 3OP5A 4IMYA 2UZVA 4CT2A 3GT8A 3Q60A 4R3RA 1ZLTA 4DH3A 3KY2A 4EOLA 4EOQA 2FUMA 3VUGA 1VYWA 4JAJA 5CALA 4O0SA 5KBQA 3Q9ZA 1NW1A 4CG9A 1VEBA 4FICA 2AC3A 1UVRA 2VWYA 5A4CA 4PP9A 4MTAA 4FC0A 4JG6A 5FM2A 4FL3A 3QD2B 3VW8A 4D2TA 4DBNA 3EIDA 3TNWA 5LCKA 4O84A 3PXRA 2YA9A 4IE9A 2IJMA 4FKPA 1OIRA 5AUWA 4BZDA 2NRUA 3OEFX 1LUFA 2XCKA 3FMEA 3DK6A 2C3KA 3A62A 1JKLA 5HIEA 3L9MA 3ODYX 2NP8A 4X0MA 4IX3A 3O8PA 3D4QA 5AX3A 2XJ1A 4F70A 2CKQA 4J8MA 4E26A 2AUHA 4FVQA 4X2NA 1M17A 3KXZA 5CVHA 5EHLA 3H10A 1Y6AA 3ZRKA 4EOMA 3S00A 4FIEA 3MH3A 4IVAA 3FZ1A 4BB4A 4E5WA 1NVSA 4C62A 4XOYA 3FL5A 4QPAA 2C5XA 5AUUA 5EQYA 4FTQA 1B39A 2OZAB 4NM3A 2ZM4A 3ZEWA 3T9IA 2B9JA 5EW8A 2XIKA 4MEDA 1YI4A 3LJ0A 2HIWA 3C4ZA 4NH1A 1UNGA 4XBRA 3HUBA 4XS2A 4ZTNA 3U4UA 3FSKA 4UWBA 3OXTA 5EYMA 4G17A 4A9UA 2VNYA 3GC7A 2VX1A 4X3FC 5E90A 5CEIA 3R2YA 4HVSA 4XG6A 3FI8A 1KE8A 2JFLA 4J52A 4I93A 3MDYA 5AP7A 3T9TA 4D2WA 4O7YA 1TQPA 4OT5A 4DEEA 3U54A 5GZ9A 3VW6A 1FPUA 3I7CA 3DU8A 3QHWA 3RKBA 2HWOA 4FV9A 3VS1A 4BCOA 2A27A 3PZHA 1B6CB 3ZC5A 2B4SB 4OT6A 3S95A 2WMSA 4RVKA 2WTDA 1A48A 1BMKA 3CGOA 5IMXA 2OXDA 4YLJA 4DITA 3FLNC 4FBXA 2GNGA 2E2BA 3BIZA 2CMWA 3ZBXA 1TVOA 2RFSA 3BE2A 2VU3A 3C4FA 4CCUA 4BYIA 1XWSA 2C3LA 3BYVA 2XVDA 3KVXA 5C8NA 4DE4A 4U40A 5LJJA 3JR1A 1YXTA 3UYTA 2EXCX 3AOXA 3G0EA 3O23A 4I0SA 2WO6A 1J1BA 3SRVA 5E8ZA 3G33A 4F08A 5BQ0A 2GHLA 3V5PA 5AUZA 3UO4A 2G9XA 4B9DA 5CF8A 5IA4A 5JZJA 3F3ZA 1Q24A 4QP3A 2JDRA 3CPCA 3FZRA 3RNIA 4CV8A 4D4VA 2CKEA 5DYJA 2HELA 4X6QC 3EZRA 2UZBA 4ZZMA 4EQUA 5BVOA 1H0WA 2ITYA 3CS9A 3FMNA 3TDVA 3EQBA 4R1VA 4RWIA 2Y6OA 4RA4A 2JC6A 4BDEA 2BIYA 2QOIA 2PZYA 2OFUA 2IO6A 4AT4A 4O6EA 1O6LA 4CRSA 5AM7A 4QP1A 4F1MA 3TJCA 3A2CA 4FSNA 3SRVB 3Q9WA 5HO6A 5J5TA 2JKMA 3FC1X 1PXOA 4FV1A 3OBGA 2HZNA 4JX7A 4BF2A 5M08A 4QMPA 4UN0C 3CKXA 5C01A 3VJNA 3GCSA 2WOUA 5BYLA 3HZTA 3LVPA 4DINA 2GTNA 4EQMA 1H4LA 1R0PA 4QTEA 2CNQA 3PSBA 4O0RA 4MHAA 5CU6A 4IJPA 1JLUE 2P4IA 4UZHA 2XNMA 3JUHA 3LZBA 4J8NA 2PZRA 4Y8DA 2R3LA 3ZCLA 2O64A 2UW6A 3D7TA 2EVAA 3LFBA 1HOWA 2OWBA 3IPHA 3CP9A 2XIYA 3QWKA 4Z9LA 3FY2A 3ZC6A 2F4JA 3F7WA 4II5A 4C4GA 1DAYA 3EOCA 4UWCA 5L2QA 4KRDA 4HCVA 4F9YA 3E3PA 4WRSA 3A99A 4F0IA 3HP2A 4TYHB 3ZHPC 5C4KA 4KUJA 2BRNA 2XB7A 4CXAA 3UPXA 3DXPA 3FLZA 4AGUA 5FP5A 3RBWA 5HIDA 3QD0A 5CLPA 4BGQA 3DNDA 2YAKA 2YCFA 4U6RA 4UX9A 4ZIMA 3F6XA 5HTIA 3D7TB 2RGPA 3VJOA 3G6GA 4ZTSA 2BHHA 4JQ7A 3CC6A 4FT7A 2JKKA 4K0YA 2VTQA 3MPMA 3Q5IA 4IQ6A 5LVNA 1PXNA 4BCKA 5GNKA 4NM0A 3DBQA 2QOCA 4AW2A 4FF8A 1KE9A 1Y8GA 4U42A 5D41A 5DE2A 5TF9A 3LXKA 5CENA 1JAMA 2Z2WA 2JIIA 3O96A 3VS0A 4OTPA 4ARKA 4ZK5A 3E64A 1SYKA 2XUUA 4BC6A 3LFQA 4RWJA 3VS4A 3ZO4A 4AT3A 3SG8A 1IAHA 1PXJA 3E8DA 1JOWB 3LXPA 4L01A 4DFNA 1URWA 3DAJA 2X4FA 5AV1A 2V0DA 4L9IA 3VBXA 4DG2E 3FPMA 4RBLA 3KN5A 5HE2A 4RX5A 4KAOA 1YKRA 3QYZA 5EG3A 4LG4A 4UXQA 4XRLA 4LOPA 3Q52A 2QOKA 2VUWA 5KNJA 5IPJA 4DHFA 3OMVA 4EH2A 1LEZA 4CFMA 3LCTA 5LXMA 3LMIA 4V05A 2JDOA 1R0EA 5L6WL 4EKLA 2Q0NA 3BWFA 4YC3A 4LOQA 4YJSA 3C7QA 5JKGA 1OVEA 4L8MA 2VGPA 4GK2A 2W99B 3ELJA 5IEVA 1VYZA 5CNOA 2YFXA 5JMSA 1H1PA 2OGVA 2PE2A 2QOHA 4R7BA 3NAYA 3F2RA 4R77A 4RX9A 4HYIA 4E93A 3NW5A 2WMUA 2VWVA 4M15A 4QTAA 4O0TA 3R8LA 4YTFA 2FSTX 2ZB1A 3PSDA 5ANEA 4C2WA 4J96A 5DI1A 3PLAE 4FNZA 4I94A 3UNKA 1IEPA 3WI6A 3SAYA 4I6QA 5DBXA 5AR7A 4B7TA 4XHKB 3C4XA 3COMA 4ZXTA 2XF0A 2O2UA 4XP3A 4JNWA 4ZLOA 5CEKA 5J9YA 3LFSA 3R2BA 2QQ7A 2C30A 4RLKA 4ZY4A 4C3PA 1OUYA 4MXZA 1UV5A 3CR0A 2FO0A 3F61A 4JLCA 1ATPE 2ETMA 3EQDA 3KEXA 3MFTA 4YJVA 1QL6A 4W4YA 5BVDA 3OWLA 1YOLA 4B0GA 4BDHA 3RM7A 3QGYA 1OIUA 2OK1A 4FNYA 3EJ1A 4RJ8A 2CKOA 1WZYA 1XKKA 3O8UA 4GJ3A 4MYGA 4ANSA 3MY5A 4JVGA 3O50A 4FV6A 5EOLA 5FP6A 4IB1A 1XQZA 3TNHA 2C5NA 4U5JA 2BTRA 3DGKA 4ACGA 3KCFA 3EN9A 1FVTA 3DTWA 4I20A 4OBQA 3P86A 4C58A 2JLDA 4I5MA 3GBZA 5IQEA 2H96A 4RRVA 1I09A 2PMNX 4GFOA 3SVVA 3GEQA 1M14A 3OZ6A 3PFQA 4FYNA 5HO7A 3LKMA 2G2HA 3BKBA 1BYGA 1ND4A 2Q83A 1YWVA 4EKKA 4HVDA 3AQVA 4ERWA 3B8QA 1KE6A 2O5KA 4P5ZA 1BI8A 3WZUA 4E6CA 1P4FA 3F2AA 3NRMA 4OTRA 4UEUA 1M2RA 3PDTA 2QONA 3TTJA 1S9IA 2O65A 5K5XA 4JIKA 2R3QA 3F3TA 4MNEA 3AD5A 3G51A 3PVBA 1Q99A 4TTHB 3JPVA 3CPBA 3GXLA 4IC8A 1TKIA 4KS7A 5K0XA 2XJ2A 5AIKA 4IWPA 2ETKA 5HCZA 4IB5A 4D9UA 4EONA 1XH7A 2R4BA 3SW7A 2XK7A 3C4WA 5L3AA 1FBNA 4JR7A 4MWHA 2OF4A 4FZFB 2ZVAA 2XJ0A 3A7JA 3VC4A 3SOCA 4LI5A 3RPVA 4LUDA 3GQIA 2BIKB 1G3NA 3DQWA 3O8TA 2HWPA 4JG7A 1WMKA 4JG8A 3OY3A 4RVLA 3V6SA 5H8BA 3ZUTA 4BIEA 4EYMA 2GNLA 4PDSA 4W8EA 4KSPA 3BELA 3UOKA 2PVNA 3U87A 4BDDA 2UW3A 4H3BA 4KSQA 4BDGA 4C2VA 2C6KA 3LE6A 4A07A 3PPZA 3BYUA 3FZPA 5A4TA 4QMOA 3NIZA 3PA4A 3RMFA 4W4XA 4PDPA 3W32A 2J2IB 3OXIA 2I40A 4U79A 4FEVA 3DBEA 3BHVA 1NXKA 2VX3A 3ZXZA 3QA8A 4MAOA 3RTPA 3VULA 1CKIA 3NVMB 1Y8YA 3R7VA 3O2MA 4EC9A 5CQUA 3LJ2A 4EH9A 3E8EA 4G9CA 1MUOA 2FYSA 3LCSA 1M2QA 4IAFA 2QKWB 4ENYA 4GV1A 2R9SA 4WT6A 2PMLX 4EK4A 4PMPA 3HMMA 3SXFA 4WUNA 3MH1A 3PUPA 5E8UA 4DFZE 3H3CA 4XLVA 2VTIA 4GK3A 1Q41A 2VV9A 4LRKA 3P78A 4FTUA 5IQCA 4RWLA 4QYHA 3RAHA 3OXZA 3W55A 5FG8A 5CSPA 3PXFA 1DI8A 3CCNA 4EH8A 2YABA 3P0MA 4NW6A 3ZOSA 4BBMA 3RAWA 3R9OA 1Q3DA 3P5KA 4D1SA 3TKHA 4JDIA 3AC1A 4G31A 4IC7A 5A46A 2GTMA 1PF8A 2I0HA 3EWHA 3VBVA 4ZLZA 2JIVA 5KMKA 2HW6A 3RZBA 2BROA 3NYOA 4NW5A 4R6VA 1KOAA 2W1EA 3E63A 2PZ5A 3TNIA 3MV5A 3ZLXA 4L43A 2VAGA 3K3IA 4YHFA 5J7BA 2YM4A 4RIWA 4FG9A 5CSHA 4C38A 3QRUA 3Q9XA 4AACA 2Z7QA 2WMQA 2FVDA 3MH2A 1LP4A 5FEEA 4DGNA 5I3OA 3VBYA 3CJGA 2C5VA 4L00A 4L45A 4FEWA 1B38A 4FIFA 4XYFA 3VHEA 3IW6A 4CKJA 4UZDA 2WEVA 2ITXA 1JSTA 3JVRA 4PF4A 4OR5A 5M06A 2A19B 3TWJA 4C61A 2VX0A 4D0WA 2PVFA 2VWZA 3GOKA 2XIRA 3BU3A 4PNKA 3RCDA 4U97A
chains in the Genus database with same CATH superfamily
3VONA 3A61A 3H9RA 3VIDA 5LARA 2H6DA 3PWYA 2J5EA 2F49A 2QVSE 4Q9SA 2HAKA 4FNXA 4AW0A 4AW5A 4CFWA 4O7TA 4CFVA 4JDHA 1XBBA 1Y91A 2ZJWA 4FV3A 2HYYA 4N6YA 3NUUA 5B0XA 4FKIA 1H01A 3GFWA 3ZSHA 2E9NA 1U46A 4IJ9A 4R3CA 2BZKB 4ASDA 4QMTA 3DXNA 3RAIA 3QQGA 1KE5A 1J3HA 1ZOGA 4CVAA 4N0SA 2VWWA 1E9HA 3U9NA 2XNGA 3KXMA 4ID7A 2YZLA 3LCOA 4AA4A 4Z16A 1W82A 4RSSA 4TKSA 4YJQA 4AZVA 4WA9A 5CF6A 2OSCA 3Q4ZA 3NCGA 2RFEA 2YM7A 1KV1A 5FLFA 4EK3A 3PJ1A 5GJDA 1YHWA 1R78A 4BGHA 3E88A 4YNOA 2W06A 3ZS5A 4ZSGA 4WSYA 3BPRA 1FINA 3N51A 2ETRA 1O9UA 3CLYA 4IW0A 4D55A 5HBJA 5I0BA 2Y0AA 1KOBA 4KD1A 3OS3A 3NAXA 5DRDA 4L44A 4YHJA 3ZMMA 2HY81 5J5SA 4DTBA 5AUYA 2CCIA 5D7VA 3DK3A 5GINE 4Y46A 4GJ2A 3CQUA 3R8UA 2W4JA 3KXHA 5IQBA 2ZV2A 3L9NA 3BZ3A 4IAKA 4BIDA 4QMQA 3IONA 5I9XA 2RFNA 4FZAB 3QYWA 2QU5A 1H26A 2YM8A 2ZV7A 5C4LA 4QMVA 4B8MA 4GIHA 2ERZE 3QZFA 3LFAA 3A60A 3VS5A 1F5QA 2W1ZA 3DJ6A 1WBNA 5LMBA 5HI2A 4BY9E 2F7ZE 3C0IA 3PG3A 4BICA 2I1MA 2O0UA 4MNEB 4NJ3A 1H1QA 5JRQA 3CD3A 4ACDA 4QMSA 3BE9A 1J7UA 1FGKA 4ZTRA 2BVAA 4BCMA 4J97A 3E7VA 5A4EA 5E4HA 3TZ7A 2X4ZA 2OH4A 5IKWA 2WAJA 2OZAA 3W1FA 3M11A 5L8KA 3BGZA 4BTFA 1YOMA 1GIHA 4K2RA 5DMZA 4LFIA 3UVQA 2X9FA 3LM0A 5IUIA 3HNGA 4UMUA 1CSNA 1H1WA 3DFAA 3QX4A 4FYOA 3OVVA 4AOTA 3GFEA 3C5IA 5L8JA 1Q8TA 3LIJA 3PE1A 4IANA 2I7QA 2W0JA 1CMKE 3CBLA 4Y83A 3QUEA 2P33A 3FHRA 1GZ8A 5FTOA 1YHVA 4KRCA 4AUAA 4I92A 4QPSA 3VUKA 2QODA 4YO4A 5BX0A 2J0JA 3LQ8A 3WF7A 3R7GA 2XKEA 3BBWA 2UZOA 3HX4A 2BZHB 4O0WA 3Q53A 5AV3A 3C9WA 4GT3A 3D2KA 2VO0A 3DY7A 4LUEA 3I4BA 3A4OX 5CAOA 1GY3A 4NFMA 3I5NA 4Y72A 4AX8A 4YR8A 4ZSJA 3COIA 3GOPA 1ST0A 4CMOA 4JRVA 4PV0A 1JNKA 3SW4A 1OM1A 3GCPA 2QOQA 5EOBA 5CEMA 3VO3A 3TXOA 2CPKE 3HRFA 3R21A 4NWMA 4C7TA 2QO2A 4F7NA 2NPQA 3QAME 4FRFA 3MS9A 2X6EA 4L68A 4GT4A 3CTJA 5JH6A 3ID6C 4MBIA 4KABA 3MFSA 5CT0A 3CQWA 4D1XA 1ZARA 4C36A 4AQCA 5I5ZA 3PXQA 5CYIA 5DGZA 2CGWA 5J1WA 4MVFA 3KFAA 4UV0A 4F4PA 4FV4A 4HNIA 3OOMA 2WU7A 3KC3A 3QZHA 4FSYA 4A9SA 3Q32A 4AXDA 5HESA 3EKKA 4NL0A 5EI8A 1V0OA 2C6DA 2JBOA 4NTSA 2VNWA 4PDYA 4LMNA 2ITWA 3DZQA 1IRKA 4C35A 3UZPA 3EZVA 2H9VA 4O38A 4QYEA 4F6WA 3PXYA 3DNEA 4HYSA 5IU2A 2JGZA 3UZTA 3QXPA 4FMQA 3BU5A 3IGOA 3L1SA 4TYJA 3SXSA 4A7CA 5CZHA 3SXRA 2PZIA 2UVYA 3R02A 2BTSA 2XNBA 4EUTA 4Q2AA 1OL1A 1H08A 2R64A 4ANMA 2GHGA 2W4OA 4YZNA 2X2LA 4FODA 1LR4A 4IDVA 4FGBA 4QYYA 5CXHA 3OCGA 4FV0A 2HZ0A 4PQNA 3GU7A 2CGXA 3IW7A 4ZTMA 4BZOA 3PVWA 3VUTA 3W0QA 4UYAA 4FK6A 4TWPA 4BDFA 2DYLA 3FQHA 1H25A 3DV3A 2F7XE 2QO9A 3AMAA 2O3PA 4ZSEA 2GDOA 4DC2A 3L8SA 5HU9A 3QLFA 1W0XC 4X3JA 4XCUA 4YTCA 3TNPC 1AD5A 1TQIA 3UIBA 1Q4LA 3MTFA 3AG9A 2J0KA 2YLEA 4FSTA 3VF8A 2WOTA 3MVLA 3BHTA 5I3RA 4EZ5A 2WEIA 3EHAA 4DGLC 2Y7JA 4ZY6A 3KRLA 3QU0A 3IDPA 1YOJA 2BRMA 2XRWA 3GQLA 2OBJA 4F1OA 5IQGA 1LEWA 5F9EA 4EH6A 3W0NA 4I6HA 4MXAA 4E4LA 2R3RA 4DEAA 4DEHA 2UZWE 3ANRA 5J95A 3ZYAA 2EB2A 3C0HA 4PTGA 3DZOA 1Y57A 4M84A 3RCJA 3DK7A 4MD8E 3HA8A 4M7IA 4EOJA 5IA2A 1YWNA 4U80A 2NO3A 3R73A 1WBSA 2B55A 2PWLA 3OG7A 4FTAA 4TRLA 4EQCA 5FDPA 3PTGA 3T8OA 3S0OA 2PUUA 4FKGA 5FM3A 2ZM3A 1JKSA 4RVTA 4O1PA 2BKZA 4TWCA 4AZFA 3GVUA 4V0GB 3UNZA 3W33A 4AN2A 4K1BA 5A54A 3UQFA 5EQEA 3THBA 4C59A 4G9RA 4J95A 1WBVA 4XG4A 4XV3A 4EOPA 3O17A 5KKRB 5C8MA 1VR2A 3BGPA 4D58A 1OPJA 2BMCA 4GRBA 1WFCA 4LGHA 4OTDA 4R1YA 4RZVA 5HGIA 3UC4A 4EOOA 4D4RA 4EUUA 4TNDA 4FKJA 4DH5A 4I23A 3OT3A 4BI1A 4OTFA 1JKKA 2AYPA 4L3LA 4MBJA 4CEGA 4EOIA 3EQFA 5IQFA 4H05A 1ZXEA 4DEDA 5CEQA 4KBKA 5F95A 4W9XA 2GS7A 4LV5A 5FTGA 4MD7E 3UC3A 3WF8A 4F65A 1H8FA 2P3GX 3AD4A 5DR2A 2IWIA 4FT3A 4BKYA 4CLJA 3ALOA 1Q8YA 1FMOE 3P1AA 2WTIA 2X0QA 4UBAA 4WNKA 5E9EA 1SNXA 2CGUA 4WIHA 4FUYA 4L7SA 3VQHA 1PXMA 4N6ZA 1W84A 4FT9A 4O4CA 1V0BA 1A9UA 2OKRA 3FLWA 2B9HA 3D5UA 1ZMVA 4FKQA 4QOXA 4RZWA 1NA7A 4H39A 5EDQA 1GIJA 4NM7A 3FKLA 5AP0A 3NFFB 5AP1A 3PXZA 4XP0A 4H1MA 3UMXA 3C5UA 1U5QA 1WBWA 5HQ0A 2W05A 2YM3A 4G16A 5DRBA 3WZJA 1XBCA 2G01A 3K3JA 3UOLA 2Y4IB 3D5XA 5EI6A 3QZIA 5EKNA 5H9BA 1M52A 2BAKA 1YDTE 2IVSA 3V04A 3V01A 4AG8A 2BR1A 3C51A 4EH4A 5IH5A 4RG0A 2YIWA 3MBLA 2YHVA 4GK4A 5D12A 5FDXA 3TKUA 4BTMA 5CAQA 4GVJA 5E8SA 2PPQA 3LMHA 4RVMA 3EFKA 2B9FA 2GNFA 3PJ8A 4UALA 5C8KA 4M67A 3V5JA 5HNGA 5E7RA 1I44A 5BVEA 2WQBA 3UYSA 4O7NA 2X7OA 5A3XA 1UWHA 4IM3A 3HV7A 3HP5A 3QTUA 4WUAA 5E92A 4HCTA 4JOAA 4W8DA 1KWPA 2IZTA 2XM9A 5HOAA 4I6FA 4A4LA 1UNLA 1GIIA 5AAGA 1GZNA 2DWBA 3G0FA 4QMYA 3Q04A 4WSQA 4XG8A 4LV7A 3QHRA 3IGGA 4GFGA 2JAVA 5DNRA 3GU8A 3UVRA 1CKJA 1T45A 1ZYJA 3QRIA 4C57A 5L2IA 4QQ5A 3M1SA 1S9JA 2XYNA 1U59A 2G2IA 3MB6A 3R28A 3U4WA 5CAUA 4MK0A 3D0EA 3QQKA 5ANDA 4O1OA 3QZGA 4QYFA 4CRLA 4O6LA 3F5PA 2C1AA 4YP8A 4XJ0A 4C8BA 4HCUA 4PPCA 4TYGA 2OJ9A 4EHZA 5FTQA 1SVHA 4ANLA 2ZM1A 1ZY5A 4O7RA 4K8AA 3KULB 2IEWA 5AV0A 4Q9ZA 1J1CA 3C4CA 4LL0A 4ZMFA 4K6ZA 3PJ2A 4FZ6A 1YDRE 2IN6A 4YBJA 3Q4CA 4BGGA 4FGRA 3KVWA 4QP7A 5J1VA 3I1AA 5HZNA 5HCXA 5BNJA 3LW0A 1REKA 5DN3A 3AC4A 4NM5A 5IZFA 4APCA 5IUHA 4AXAA 3I81A 2EUFB 4USFA 3CEKA 5HICA 4OGRA 4BKJA 3ORMA 3R7YA 1ZZ2A 2OJJA 3DAKA 3SD0A 2A0CX 2OXXA 3EL7A 3DS6A 3M2WA 3OWKA 3ROYA 3ZBFA 5AJQA 4IH8A 2UW5A 4QTBA 4O2ZA 4C37A 2WIHA 3SHEA 3U8WA 1OL7A 3O71A 4PMTA 3W0RA 3ZO1A 4KNBA 2R3KA 3R7UA 3P5JC 3HL7A 2W1FA 4NZWB 5CVGA 3PSCA 3CIKA 3PVUA 5J79A 3R8ZA 4YPSA 3VS2A 4OTIA 3TI1A 5HORA 2HOGA 3CTHA 2UVZA 2QI8A 3NNVA 4HGLA 2IW9A 3W8LA 1OKWA 2GQGA 3RK7A 1OL6A 3HAMA 2R0IA 2WPAA 4X7QA 2CLQA 2PTKA 4H58A 3AC5A 3K2LA 3KF4A 3OW3A 3R71A 1G8KA 3WE4A 4YPDA 3DB8A 2VTOA 1OKZA 3ANQA 3FWQA 3PJ3A 1SVEA 1BL7A 3QCYA 4TXCA 2PY3A 3FLSA 2J51A 5HD4A 3G2FA 5BYYA 3TNQB 3KCKA 1BLXA 3VUIA 3GC0A 1YI3A 3H0YA 1OKYA 3MESA 3FMHA 2PZPA 3WIGA 3V8SA 4BRXA 3UODA 2GS2A 3OFMA 5EM6A 3TIZA 3IECA 2IW8A 3SX9A 2GMXA 2R3MA 1QPEA 3D15A 4FOBA 3D2IA 3P7BA 3QQLA 4PNIA 4OAUC 3PP1A 4E5AX 3NDMA 4FL2A 4F9CA 4V01A 5A6NA 4I3ZA 3WIKA 5ANOA 4FEXA 2HXLA 2OFVA 2XS0A 5HHWA 4DDIA 3PY1A 1E1VA 2V55A 4YO6A 4XG2A 4E6DA 2IZRA 4AP7A 4BVUA 3C0GA 4J1RA 4LQMA 4AFEA 2J0LA 4M66A 2RG6A 4C4FA 3ATTA 3QC4A 5CTPA 3MVMA 4CNHA 1JVPP 2X81A 4EHEA 3PIZA 2UV2A 2WNTA 1W2DA 3ORZA 5IA1A 5KX8A 1P14A 2YZAA 3QRKA 5BVKA 2OF2A 2WMRA 3A8WA 3V3VA 3KULA 2R3IA 5KMIA 4UXLA 3KK8A 2ZFYA 2DS1A 2R3FA 4Z7GA 4WNMA 4HYUA 4JJRA 1U4DA 5EHYA 1J7IA 2QNJA 5GIOE 3F66A 3EQIA 2AQXA 4I5HA 2Z02A 4HZSA 4GEOA 3FMJA 4U43A 4R3PA 5AV2A 3H30A 5DEWA 2QLQA 1PXPA 4GKHA 4OAVB 3PIXA 2X2KA 3KMUA 1CTPE 4FI1A 1IG1A 3T3VA 3R7EA 4BN1A 5E91A 4AN9A 4XLIA 4EK6A 3OWPA 1PMNA 2R0UA 4FT0A 1MRYA 1V1KA 3IQ7A 3EFJA 2J0IA 3O7LB 2WFYA 3OT8A 1W2CA 4IIRA 3QF9A 3MA6A 3CE3A 2F57A 1XH8A 5ANJA 5I9WA 4LRJA 1REJA 5ANKA 4I4EA 3NUPA 3ZM4A 3IS5A 3LFCA 4UYNA 5AP5A 4O4DA 5FQDC 5TT7A 4BWPA 3E7OA 3UP7A 5AA9A 4G3GA 4TWNA 2CLXA 2XIZA 3I0OA 3OUNB 3Q4UA 4IVCA 2XKCA 4XP2A 4CZTA 5AEPA 2CGVA 1W7HA 4DFUA 4FEQA 4QNYA 4FV5A 3FL4A 3LLTA 2C0OA 3EQGA 4JIAA 4WHZA 4RJ5A 5L2SA 3N4TA 2CN5A 4QP4A 3GC8A 4BBFA 5M44A 2YJRA 3QTWA 4E20A 3NUYA 2ITTA 2EB3A 1QPJA 3LFEA 4U81A 3DFCB 4DHZA 2KTYA 3R83A 3RHKA 4FV7A 3PWDA 3QCQA 1STCE 2QURA 2PUNA 3GC9A 1AGWA 5E1EA 2WMWA 3GNIB 3VWAA 2YCSA 5AUVA 4HPTE 3ZFXA 4EJNA 4KIKB 3ZZWA 5L2TA 4AGDA 1YQJA 4FTIA 1JBPE 3GU4A 3Q6WA 4P5QA 4D4YA 2O8YA 5C1QB 1GOLA 3REPA 4A9RA 4LGDA 5F4NA 2V22A 2WMVA 4HVGA 3BCEA 3KB7A 3NUSA 4B8LA 4BCPA 4O91A 4X21A 5AP6A 4YTIA 3AD6A 2PE1A 3NEWA 3ZFMA 4A4XA 4FTNA 2WD1A 4AZTA 3R30A 4IWDA 2JKQA 4FG7A 4YC8A 4O27B 3LOKA 4NU1A 5E8TA 4FK3A 5E8XA 2E9UA 3D14A 3WYXA 4BDCA 4BDBA 5M4IA 3SLSA 1WBPA 4FTKA 1K9AA 4EHVA 4CZYB 4PL4A 4F0FA 5LMKA 5KMJA 3Q2JA 3RZFA 3FUPA 3CQEA 2XK9A 3COHA 3OD6X 3R22A 4JBOA 4FL1A 5EM8A 4ANQA 4B99A 4BIBA 5E1SA 4DN5A 5I9ZA 4RC2A 1U5RA 4JI9A 5B7VA 4IX6A 4FV8A 4NIFA 4F9BA 1O6KA 3R1SA 3TT0A 3BHUA 4IZYA 4J53A 4MKCA 2WU6A 5CU2A 3ZO3A 2OZOA 4O86A 2YIQA 3R9DA 2XP2A 4UMQA 3DBDA 4CKRA 3DBCA 1OMWA 2RG5A 2CJMA 2VO6A 4M69A 4L7FA 4QQCA 4BI0A 1JQHA 4LMUA 2ZV8A 3Q6UA 3QRTA 3H4JA 3QTSA 1MP8A 4O7WA 4LRMA 5L2WA 2NYAA 1KE7A 3B2WA 5GZAA 3AC2A 4TT7A 5JFXA 5AR3A 5JFVA 4B4LA 2YN8A 3E5AA 1PXIA 3NPCA 4QMZA 3V51A 4RQVA 3MGYA 3F5UA 3JXWA 4YZDA 5CSWA 3FXWA 1H1RA 3PG1A 4CFXA 3TZ9A 4AN3A 3NNXA 3UIUA 4LOOA 4X2FA 1J91A 3RK5A 2RSVA 3UGCA 4E1ZA 4O81A 3G15A 4KA3A 3SA0A 1PY5A 1NVRA 5LOHA 5JFWA 2CNVA 4LL5A 3AMBA 4ZP5A 2IVVA 3R01A 4ANBA 1JWHA 2BALA 4AS0A 5IA0A 1UU8A 5B2MA 3OY1A 3UP2A 5HE0A 2PULA 2UZDA 3BV2A 1OECA 3MIAA 1V0PA 3IW8A 1GJOA 3F88A 4FZ7A 3ETAA 4WG5A 4YZBA 5JRSA 3MB7A 3BHHA 4E4MA 4EI4A 3UTOA 3F9NA 5CVFA 4YUQA 5J9ZA 3ATSA 3PPKA 4O82A 2Z60A 2WGJA 3R0TA 1BI7A 3KXGA 2GQRA 3PP0A 3HMNA 4RMZA 5FD2A 2QOFA 3RM6A 5IH6A 2JFMA 4CYJA 5AP4A 3P4KA 4F6SA 5EW9A 5L6OA 5L4QA 2BDFA 3R63A 2OXYA 5C26A 2BILB 5KBRA 4O4FA 4I6BA 3VS7A 3FKOA 3NWWA 5KZ0A 2Y6MA 3UE4A 3G90X 4WOVA 4KS8A 3DA6A 1WVYA 4IEBA 3EFWA 4EWHA 3T3UA 4APPA 3UQCA 2XM8A 3NGAA 5DHJA 2V7OA 2XAOA 3BLQA 2PSQA 3TV7A 3PFYA 4L46A 3IW4A 3PJCA 3V5QA 2ITOA 2CHLA 2Z8CA 3EQPA 3OUKA 5LQFA 3RI1A 3ZFYA 4DGOA 3UOJA 1YXUA 4PDOA 5K4IA 2W96B 2PVJA 3HV3A 5TO8A 3DKCA 2OG8A 1SNUA 3LPBA 3TZMA 5HTCA 3WYYA 4DBXA 2JKOA 2C6LA 2G15A 5HBHA 4AGWA 1OI9A 3P79A 3DOGA 4EWQA 3TUDA 5J87A 2J5FA 2ZMCA 4FKLA 4TZRA 2Z7SA 3BQRA 4FSQA 4TYHA 5AP3A 4DTKA 2WQMA 1H1SA 5EK7A 1G8AA 4TY1A 4GMYA 5LMKC 3SC1A 4OBPA 5G1XA 5D9HA 3KIOC 4FTRA 3ITZA 4PRJA 4MUQA 3D5WA 4Q5HA 4FIIA 4QP2A 4R7HA 5K5NA 1M7QA 2WMTA 1AQ1A 2W1HA 3EN6A 3GCUA 3W2PA 4AZEA 2C6EA 4WO5A 3KREA 3AKLA 3BU6A 2QHNA 3H9FA 4JT3A 4RJ7A 4DLJA 2R2PA 1WCCA 2OO8X 4BDIA 4E4XA 5HE3A 1ERKA 5M07A 5JFSA 5FXQA 3QUDA 3FY0A 1WBOA 4I22A 4C34A 4K11A 4Y5HA 3UG1A 5HX6A 3IK3A 3I0QA 1P2AA 5KMLA 3N4VA 3OROA 4AE6A 2UZLA 4CLIA 4M3QA 1FOTA 2FSOX 4X6RA 5L8LA 5DH3A 1YW2A 3W0PA 3E8NA 1UU3A 3LMGA 4CD0A 3K54A 1OB3A 2OICA 3CD8A 3NW6A 4BCHA 5IMEA 3TKIA 4CZUA 2X7FA 2GNHA 2UVXA 3FXXA 3K5UA 4R5YA 3MJ1A 4Y5QA 5HVJA 3Q3BA 3TV6A 4CTCA 4DH1A 4L3PA 2IZSA 4WBOA 4TYIA 3QBNA 4UMRA 5HEZA 1PYXA 4YHTA 4WKQA 3FZTA 3PYYA 5D1JA 4G2FA 3VBTA 2UW8A 3FYKX 4RT7A 5IQHA 4OTGA 3FV8A 1YRPA 2PL0A 3BYSA 5EH0A 3EL8A 3UIXA 3QQFA 2C3IB 5K9IA 3PUFC 3W0MA 4GU6A 1Q8ZA 3WOWA 3QGWA 2VRXA 2C6IA 2I0VA 4WNOA 3TL8A 1URCA 2QC6A 1UNHA 2REIA 2XMYA 2YCQA 3ZLWA 4D2PA 2WTKC 4AE9A 2IZUA 4BWKA 5DFPA 5BVWA 3GU6A 3PY0A 5AADA 2VTHA 2WTWA 4JL9A 3R8VA 1YXVA 1RW8A 5CEPA 3GI3A 2UZNA 2YWVA 5KKRC 2B7AA 2X2MA 5LVOA 3AT2A 3QFVA 2VGOA 3QC9A 3AGLA 2DQ7X 5EM5A 3NNWA 3PRFA 1VZOA 2X1NA 4M69B 5DT3A 1OGUA 3HMIA 4EH7A 3GCVA 2W9FB 1Q3WA 3DQXA 3RWPA 4ZJIA 2X9EA 1W83A 2C4GA 1UA2A 5JGBA 4TL0A 4G34A 2C47A 1UU9A 1PRYA 3UVPA 2BFXA 2X8IA 3IG7A 2OIDA 5M56A 3I5ZA 5TOZA 4U9AA 3IW5A 1JSUA 5FEQA 4DAWA 5IQAA 3CKWA 2YDKA 4GUBA 4X2KA 4FX3A 3DKOA 2GU8A 4I4FA 4XOZA 4ZLYA 4G3FA 3B8RA 5AWMA 5HLNA 3QQUA 4CMUA 2B54A 3B2TA 4RX8A 1IAJA 4ACMA 4D2RA 4FKRA 4XH6A 5EYKA 3KRRA 3E3BX 3I7BA 3W8QA 4DGMA 3ZSIA 2X0GA 5HG8A 4DHJA 5CSVA 4PUZA 2BRBA 1ZY4A 4ASEA 1R39A 4IB3A 3ZDIA 2XEZA 4I41A 2A4LA 4D1ZA 4U41A 1YDSE 4X2GA 1OKVA 4W4VA 3VUHA 2XALA 1G8SA 3FLYA 4IBMA 3NUAA 4ANNA 2J6MA 4OTHA 2VTAA 3ORKA 3UO6A 2QOBA 3EQCA 5H8EA 3R8MA 3A7IA 4G6OA 3OBJA 4AGCA 4U45A 4RJ3A 4F9AA 2ZYBA 5CY3A 2VTPA 3WZKA 4IVDA 3ML1A 4NFNA 5ICPA 4FTTA 4BCNA 4IFCA 1O6YA 5A14A 1PKGA 4S30A 4UY9A 2ZAZA 2PU8A 2ACXA 4NT4A 3MI9A 4B6LA 5CF5A 1MRVA 2ITZA 2OIQA 3CXWA 2VO7A 3U6IA 2HZIA 2WZJA 3BHYA 3PA3A 4FTCA 1LPUA 2RKUA 3CTQA 3R7OA 3KGAA 4V04A 2E9PA 2PYWA 4D28A 3ACJA 1H07A 2UZTA 3HMPA 2UW9A 3FLQA 4HGEA 4PTEA 3W10A 4E73A 2XNOA 3POOA 3R8PA 4Y85A 2I0YA 5M4FA 4QMXA 3QCSA 5BV3A 2OU7A 4FV2A 5CAPA 3GUBA 3EYGA 4X3FA 1R3CA 4FKWA 3PIYA 4BTJA 1MRUA 3TUBA 1PXKA 4BDAA 4Y95A 4F64A 3FZOA 3W18A 3F3WA 4RFMA 4DTAA 5JQ8A 1XJDA 3S2PA 2VZ6A 4GYIA 2GFSA 1DS5A 1YHSA 1X8BA 5FBNC 4JS8A 4EORA 4QQJA 2XIXA 2B0QA 3HMOA 3DXQA 5F94A 3S4QA 2CNUA 4DYMA 2F7EE 3FKNA 4CFNA 5LVPA 1OGYA 3FQSA 4ZOGA 3RK9A 1RDQE 3POZA 4ITJA 5FXSA 2C6OA 4KIPA 3WF6A 3QKKA 1F3MC 3KK9A 3MVJA 1QCFA 1H00A 4J71A 5CNNA 1GNGA 3QD4A 2X6DA 4RWKA 2PK9A 5JQ5A 5HU3A 3HRBA 2KULA 4KBCA 2VTTA 4MXXA 4WBBB 4ANOA 2X8EA 5F20A 3LJ1A 1OIYA 2C1BA 2YERA 4G3CA 2XAMA 4C02A 4F78A 2Y8OA 5CT7A 4Y73A 3ULZA 3E8CA 2JDSA 3EFLA 3ZLSA 4I0RA 4F7LA 3R04A 2C6MA 4ZSAA 4O4EA 3ORXA 2VTJA 3PVGA 5CU4A 3HA6A 4K77A 3COKA 5BUEA 4BDJA 3SOAA 4H3PA 4TWOA 3KXNA 3LFNA 3KXXA 4C33A 2AEGA 3L8PA 4CKIA 5GZ8A 1UKHA 4C3FA 3TJDA 1G8JA 4ZTQA 3H9OA 4YJRA 3EB0A 5DEYA 1A06A 1ZWSA 3HDNA 5T3QA 4ENXA 2W1DA 4DDGA 3KQ7A 3NYXA 2CSNA 1XHAA 3MY1A 5DT0A 5A6OA 4S2ZA 2HW7A 3TTIA 5ANIA 3WBLA 1DAWA 2GCDA 4ZZNA 3F7ZA 2PUPA 3LAUA 3MH0A 4HNFA 4M68A 4ERKA 2R3OA 2BCJA 3BLHA 3IDBA 3QX2A 5HLWA 5ITAA 4OTWA 2J7TA 3P7AA 4P7EA 3OF0A 2CCHA 4IDTA 4RC4A 4AOIA 2R7IA 2WKMA 3KU2A 2W17A 3K5VA 3RAKA 4DFLA 2B52A 3R1NA 2UW4A 1Q62A 1Q8WA 4USDA 2XCHA 5AMNA 1OPKA 3A7FA 3JY9A 2VTMA 3KMMA 2OJIA 5T68A 2WTJA 4RLLA 3R9RA 3O51A 2BZIB 3HDMA 3MPAA 3QXOA 3BI6A 4IAAA 5H8GA 4JBVA 2WXVA 2VTRA 3BRBA 4FKOA 4RIXA 1HCLA 4ZAUA 3GP0A 1PMUA 5FBOA 5I4NA 1XMLA 2UUEA 3I6WA 4ZJVA 2R3JA 2VTNA 5DIAA 4BCQA 5BUJA 1OUKA 4HZRA 2EXEA 4ACHA 5HNIX 4FEUA 5AUTA 2ITUA 4MWIA 4GW8A 3ZTXA 5M4UA 4GU9A 4LM5A 4NYEA 1RQQA 4NK9A 4QDEA 5AIRA 5M55A 4XG7A 4Z3VA 2BZJA 2NRYA 4GFMA 3NYVA 4AXEA 1F0QA 3QTQA 4MD9E 3RVGA 2IVUA 1BKXA 2PVYA 4ITIA 3QA0A 2RL5A 3IDCA 2G1TA 4AXCA 1G5SA 4Z7HA 5LCJA 4YU2A 4L6QA 4K33A 4DFBA 4E7WA 4EZ3A 4R7IA 1Z5MA 3A4PA 2CKPA 5EYDA 4RIXB 3PRIA 2YWPA 4RIYA 4AZWA 5M4CA 4IACA 2YIXA 4CTBA 1WAKA 2WB8A 4ZTLA 3UJGA 5AA8A 5KZIA 3VBWA 5M09A 2ONLC 3QTRA 4HJOA 2FSMX 3GENA 2X39A 5D11A 3MY0A 2NNWB 5TKDA 2J50A 1UKIA 3JS2A 4PMMA 3NMUF 4HOKA 1H28A 2R5TA 4G3EA 2AC5A 4M8TA 4RJ6A 5IDNA 1NT2A 2QU6A 1SVGA 3FMLA 3I60A 1OIQA 4E3CA 4FKUA 4FSZA 2F2CB 3NS9A 3HRCA 4MXCA 2GPHA 3ZH8A 4C3RA 1U54B 2W9ZB 4I5CA 5L6PA 3G9LX 5IQDA 2V7AA 5ANGA 2JIUA 3NSZA 5HO8A 1NVQA 5IUGA 3O5AA 2XRUA 4A9TA 1FQ1B 4FIGA 3SKCA 2BRHA 1KSWA 1SZMA 4QTCA 4TYEA 1DI9A 3TCPA 4EEVA 5CAVA 3VHKA 5ACKA 3DJ5A 3BX5A