2GNGA

Protein kinase a fivefold mutant model of rho-kinase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
340
structure length
338
Chain Sequence
b'EQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTIGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYMPGGDMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIKVADFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Structural analysis of protein kinase A mutants with Rho-kinase inhibitor specificity
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/transferase inhibitor
total genus 108
structure length 338
sequence length 340
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2006-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2gngA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2gngA02
1ZY5A 4J1RA 4QMYA 4D1XA 3FZ1A 1T46A 3DDPA 1YDSE 3WZJA 3PZHA 4IJ9A 2YLFA 4FV1A 2ETMA 2F2UA 3LHJA 4JAIA 3EFJA 5AP2A 3VULA 4F6WA 3BYSA 3QA0A 3S1HA 2XK7A 2YLEA 2QNJA 4J8NA 5HICA 3NUYA 2VTHA 3DAKA 4QPAA 4E4LA 2B9FA 4JIKA 4I5PA 4E6CA 5HI2A 3EFLA 2B4SB 3GVUA 3VQHA 3R0TA 4BFMA 4C58A 3HAMA 2OGVA 2BAKA 5AADA 4BIEA 2XZSA 2C0OA 4AGCA 3OXZA 4D5HA 2W5AA 3EJ1A 4NJ3A 3F3UA 4RIXB 4K2RA 2C0IA 4M68A 3F2RA 2IZSA 3OHTA 3CGFA 4EHGA 3TI1A 5HIEA 2YDJA 2IW6A 3AXWA 3U51A 1OUKA 5L2QA 2X7OA 3E64A 2HY81 2HK5A 3HZTA 4OBPA 4RQVA 4ZIMA 3WYXA 4BHNA 4EEVA 4TYGA 3AT3A 4G9RA 3OWLA 3OEFX 1QCFA 4YLJA 2CDZA 3WZDA 5K5NA 5CASA 2BIYA 3A2CA 3C13A 4FG8A 4BDBA 3BIZA 3V8TA 5LWNA 2VTQA 4FL3A 3RK5A 4J53A 3SOCA 1P4OA 2ZM4A 2UZUE 4WG5A 4Q9ZA 3VWAA 2HZ4A 5JGAA 3NNWA 3QZGA 3ZC5A 4MD9E 3S0OA 4CFNA 3UNZA 2BRBA 4F9AA 4FSMA 4ZOGA 2WKMA 3LLAA 3H9FA 3PJCA 4FV7A 4D58A 1P2AA 2F57A 4EHEA 3LCOA 2RGPA 1FQ1B 1Q3WA 2ITUA 3QC4A 4GSBA 4EORA 5HESA 4PL5A 3VJNA 3N4VA 3RPOA 1PXOA 2OFVA 3LXKA 3MDYA 4QMZA 2JITA 4W8DA 3KRLA 1YVJA 4B99A 2JKQA 2E2BA 5F9EA 3AC5A 5JQ8A 2ETRA 4L68A 1U5RA 3OTUA 2FH9A 1OL2A 5D41A 3E7OA 4DA5A 3BGZA 4ALVA 4RWKA 4ACCA 1MUOA 3MIYA 5JN2A 4RG0A 5HD4A 2LGCA 1LP4A 1URCA 4F65A 2JKMA 2NRUA 3BV2A 5BX0A 2GPHA 4EONA 1I09A 5FTGA 3G15A 1H1RA 2XVDA 3QCYA 4QP8A 3WZEA 5IH6A 5HCXA 4JI9A 5EYKA 3DKOA 4H1MA 4WT6A 1H27A 4YJPA 3OBJA 4LGGA 1V1KA 4GJ3A 4HVDA 4IX6A 1R0PA 3HV6A 4CFXA 5CSWA 3P1AA 3IO7A 3AQVA 5AIRA 3HEGA 3ZCLA 5CT7A 1W98A 4AZSA 2YM6A 3V01A 1J7UA 3EHAA 5GJGA 3F82A 5HORA 2GNHA 2UW8A 3QF9A 3QRIA 4JR3A 2BCJA 3QAME 1GZOA 4FSRA 2XA4A 4JQEA 3RK9A 4I23A 3R9NA 1BX6A 4OTFA 4FSYA 4F9CA 4QMQA 4YSJA 1TQMA 4FTCA 1ATPE 3EN9A 3H0ZA 1PMEA 4J52A 3QTSA 4DYMA 3UOHA 4C4FA 5BPYA 1DAWA 1GNGA 4FTIA 3G90X 2HZ0A 4BCGA 3WZUA 5M51A 2QU6A 2B52A 4BRXA 3OXTA 5CAPA 5CF8A 3E92A 3A61A 4Y85A 2ITZA 4JLCA 1R1WA 5CS6A 1G8AA 4ITIA 2P2HA 4LYNA 3UOKA 3D9VA 4K6ZA 4KBCA 3U9NA 4H3PA 4RJ3A 3DA6A 4F0FA 3DK7A 5FM2A 4N70A 4OT5A 3A7FA 5HE1A 5DHJA 1FVTA 5H3QA 4AZVA 3TT0A 2C6DA 4NW5A 3FUPA 3FI3A 3BEGA 2G1TA 3P79A 4RVKA 2YWVA 4BR3A 2C5XA 5GIOE 2IWIA 1JBPE 3IOPA 3KXHA 1CTPE 4U79A 4WUNA 5D11A 4IZ5A 3C0GA 3AT4A 5EI8A 4ASEA 3C4XA 5IQEA 2Y7JA 3UVRA 4IAKA 1MQ4A 4AXAA 3Q4TA 4BDIA 4HCTA 4BIBA 4M0YA 3KXXA 4BTFA 3MV5A 4EWQA 2G9XA 4QMXA 3LJ0A 3RPSA 3HKOA 1APME 2CKQA 4O7YA 3MTLA 1V0OA 2V5QA 4UALA 5FUTA 1FINA 1FMOE 3I0QA 2VNYA 4JQ8A 2O63A 2HZIA 3PRFA 4UMQA 1F5QA 4F4PA 2YZLA 2J0KA 5ANOA 4J71A 3RK7A 5CF6A 2OZOA 3UO4A 4IX3A 5A3XA 1LPUA 2C6LA 3UMWA 3R01A 3FLSA 3QX4A 4P5ZA 1YWNA 2OF2A 4O82A 2BROA 3U6JA 4R78A 3SG8A 2WGJA 4I1ZA 5DNRA 4F1MA 4MVFA 3E63A 3MIAA 5DA3A 3UQCA 2DQ7X 5AIKA 4CCBA 3EMGA 3FY0A 3EN6A 2W06A 4C3FA 5L3AA 4DCAA 1SYKA 4IC7A 3F2NA 3TTJA 4AWIA 5C4LA 3MJ2A 2QG5A 3MJ1A 2ZYBA 4GYIA 5B2MA 3HYHA 3MYGA 1WBSA 3P0MA 4OTQA 2JDRA 4IB0A 5AV1A 3L8SA 3QUPA 4XUFA 2J4ZA 4JL9A 5DRBA 3GCVA 5CSVA 4DG2E 5C26A 3VS3A 3N51A 4FTQA 3DB8A 4G9CA 4LOPA 4TYHA 3I4BA 4CQGA 4FE2A 2WZJA 3Q4CA 5AV4A 4C2VA 1PMUA 4W9XA 3RHXA 5L8LA 4KNBA 1HOWA 3FXWA 2J5FA 3F7WA 4FTNA 3PG1A 2IJMA 3H4JA 5E8VA 3LJ2A 5JZJA 4FI1A 4RX8A 3VW6A 1OL1A 2WAJA 4TYEA 2ERKA 4OAVB 4DINA 3NAXA 3KK8A 5LQFA 4O21A 1OL6A 2HELA 2UW5A 4LL0A 1XH8A 5BUEA 4CG9A 3DBEA 1T45A 4IZ7A 2OZAA 4WRGA 2CKEA 3R7EA 3CPBA 2BKKA 1M7NA 3Q4ZA 2JIIA 5BVOA 1OKYA 2QOQA 2X7GA 3V8SA 4ENXA 5KKRB 5G6VA 4FKTA 1OBGA 3OVVA 1WBTA 2R2PA 3W10A 2BRMA 3O7LD 3P08A 2X0GA 2YDIA 4IWQA 1Y6AA 3RTPA 4ACDA 4E4XA 3ULIA 4IADA 3QU0A 1K9AA 3WF5A 1DM2A 3QL8A 4OR5A 4XG7A 2WHBA 4EC9A 4XOZA 1HCKA 3O23A 1REJA 1YDRE 2YCSA 1FGIA 3FC2A 3FMMA 2XNOA 3HDNA 3BQCA 3MPTA 3EH9A 3O0GA 4I5MA 4X3FB 4APPA 5JK3A 3JS2A 3R30A 5ETFA 3ROCA 3MY0A 5J79A 2YDKA 4XBRA 3P5KA 4O6LA 3ZC6A 1E9HA 2UW0A 3T3VA 4CRLA 4NK9A 5E8WA 5AV2A 1OZ1A 5M07A 2XB7A 3CE3A 3FKNA 3UNJA 5J9LA 3LFQA 3FL5A 5GJDA 1O6LA 5CXHA 2A0CX 1Y6BA 4PDPA 5EYMA 2NP8A 3Q9XA 4MNEB 4Y8DA 5M44A 1S9JA 3JYAA 4BI1A 3POZA 1WCCA 4H3QA 4CYJA 4X2KA 3PWDA 3AMYA 4FGRA 4ZSAA 3C4WA 2CSNA 3A62A 4YBKA 3Q6WA 4QO9A 3NSZA 1XH5A 3TNPC 5D10A 3RGFA 2F7ZE 3MY5A 1ZZLA 4FODA 3TUDA 3ANQA 2FYSA 3MFRA 4C61A 5E8YA 2XP2A 3PSCA 3ZH8A 4KIOA 3UP2A 1VZOA 2ITPA 4U42A 4H1JA 3MI9A 5HE0A 3R8VA 4AGWA 4DH3A 4UBAA 2XYNA 3R9DA 3V8WA 2YISA 3QQHA 4EK8A 2Z7SA 4RJ4A 1WZYA 2XKCA 3SA0A 4YR8A 4E4NA 4KIQA 4G3DA 1Y8YA 4X6QC 2GU8A 2GQGA 3VHKA 1ZAOA 4AAAA 3K2LA 2CHLA 5CU0A 2UVXA 3UPXA 3KN6A 4IXPA 2VTTA 3DXPA 2ZB1A 3BU6A 3DQXA 2GHLA 1PJKA 3GOKA 3M1SA 3FMDA 5KKRC 2ZVAA 3Q2MA 1BL6A 1SVGA 2GS6A 1EH4A 3NUUA 4MD8E 2OIDA 1R0EA 3HA8A 2OICA 5E1SA 4AP7A 4LUEA 3GENA 3E88A 4ITHA 4RVTA 4U80A 1YXVA 1NW1A 4BZDA 5CT0A 4FNXA 4I41A 4RIYB 2IZRA 2WTCA 2IVSA 4GT4A 3O8PA 4ANQA 2YIQA 1UV5A 1H25A 1YKRA 3BELA 3ZU7A 3BYMA 4BL1A 4UMPA 2ZDUA 2WTIA 3LXPA 3FYJX 5A6NA 4X3FC 5AUTA 4FT5A 3V6SA 3UNKA 4O7VA 4FZ7A 4FKSA 3AMAA 2WOUA 5IQDA 4Q5HA 2HZNA 4E6DA 1YHVA 4OTRA 3FJQE 3KULB 4EOPA 2H96A 3LM0A 5CEMA 5K5XA 3ZXZA 4AN3A 3CR0A 2BFXA 4RVMA 3V5LA 4BICA 4ZZOA 1H4LA 1J1CA 3QTIA 5TE0A 3R2YA 4Q9SA 3KVWA 1W0XC 5CVFA 4BTMA 4EH8A 4E1ZA 3H3CA 3MFUA 4ID7A 4Z7HA 3HMOA 3E87A 4GUEA 2CCHA 4D28A 1JLUE 5E8ZA 5HVJA 4FTMA 2J51A 3OT3A 3N4TA 1M7QA 3GNIB 3NUXA 3KC3A 5CU6A 3RZBA 4BCKA 2ZV7A 3R1NA 3BKBA 3CY3A 1NVQA 3LFCA 3DJ6A 4RJ6A 4QMMA 4JDKA 2R4BA 2XJ1A 5FRIA 4E73A 4FIIA 4M84A 2BDFA 4I6HA 4HW7A 2UZWE 3Q3BA 4FKUA 3DT1A 5D12A 5LOHA 3O8UA 4FIGA 3VUTA 3RAWA 4IM0A 5BNJA 1ZLTA 3ACJA 5CANA 2O0UA 3FZTA 4CKRA 5FG8A 3PVUA 4CSVA 4PMPA 4XJ0A 2P33A 2W5BA 3SG9A 3G51A 3O96A 2ZV8A 2VN9A 1JSUA 3IG7A 3MA3A 3QWKA 5LCJA 4W9WA 2JIVA 2C6OA 4YMJA 2BRHA 5GINE 4FKOA 3UIXA 2JC6A 1WFCA 5IG1A 2IN6A 2OW3A 4D55A 3MTFA 4FVPA 2G15A 3REPA 4QMPA 2WTWA 4MWHA 3DAEA 5AA8A 3ETAA 3NVKI 3BZ3A 3SXSA 2R0IA 4FEUA 2GCDA 2O2UA 4U6RA 3R8PA 2R3KA 1AQ1A 4RC3A 4A9SA 4EBVA 2VWVA 3FSFA 2XK6A 5A54A 3E62A 4GMYA 3D5UA 4J7BA 4UMRA 4FV3A 3KGAA 2P3GX 3PSDA 4XV1A 4FSTA 5AJQA 4Z16A 3EQCA 3RBWA 4QMWA 2ITOA 3ORPA 4IANA 3FQEA 4FGBA 3LVPA 3C4EA 3ZUVA 3UIMA 3TUBA 4GK3A 1IAJA 3OUKA 5HCZA 4EOLA 1J1BA 1YHSA 4O7ZA 5DFPA 2XKDA 4EI4A 3F3WA 3QCXA 3VBXA 3ZDIA 4AE6A 1M2PA 2BRNA 3DZOA 3FY2A 5CLPA 5FTQA 4RX9A 4ZLZA 3FEGA 3CQEA 4IAZA 4LQMA 5KZIA 3U8WA 2CMWA 2CCIA 2RFSA 3NYVA 3TZ7A 2FVDA 2WQMA 4IVDA 1V0BA 3U9CA 3QKKA 3UO5A 4A06A 4YBJA 2PZYA 1IASA 4DLJA 4EZ3A 1XH6A 3EL7A 3SRVB 4RSSA 5JZNA 1QPEA 2QQ7A 1U46A 4K8AA 3FXZA 5L2TA 2R3NA 4U43A 1UA2A 1CKIA 1ZOEA 4BI2A 4X0MA 4RBLA 4LGHA 4FTLA 3RAHA 3LFFA 5FTOA 4CGAA 2X7FA 4HVSA 3QUDA 4M12A 1LUFA 1BUHA 2GS2A 4FEVA 3OMVA 3R7UA 1WMKA 4DHFA 4FKJA 4YHFA 3UQFA 3EYHA 1PXNA 4I3ZA 3QRKA 3ORKA 1M2RA 3O50A 3RAKA 5FXSA 1Z5MA 2FSMX 4EYJA 3QHWA 5IZFA 3KQ7A 4LV5A 4S34A 5L2SA 3C50A 3OS3A 4AFJA 3TWJA 2X8DA 4FNYA 4KWPA 1ERKA 3LE6A 5KMOA 1YI6A 2YHVA 2R64A 5ANKA 1MP8A 3EQGA 4IVAA 4YJTA 4EJNA 2XIZA 5GJFA 5T6KA 3SDJA 3ACKA 5AAGA 5L2WA 5CQUA 2EB2A 4QPSA 5DR9A 3EQIA 4GT5A 5HE3A 3ZM4A 4CZYB 2OJIA 1O6YA 1WVWA 4R3CA 3P78A 2QKRA 4DITA 2Z8CA 5KO1A 4WG4A 2JD5A 1REKA 4JBOA 2X2KA 4N6ZA 5FXQA 4QMNA 4KBKA 4NTTA 3PIZA 3QLGA 3PY3A 4O2ZA 4UZHA 4YUQA 5JGBA 2XBJA 1XQZA 4DC2A 2RG5A 4I4FA 1Z9XA 3G5DA 4X2JA 3CJGA 2QODA 3CLYA 2VX3A 5EI2A 2PTKA 3DLSA 3K5UA 1W82A 4FT7A 3E93A 4QMOA 4Y5QA 3HP2A 1XH4A 4BCPA 4KIPA 4JXFA 4A9UA 1ZYSA 2EUFB 4TWNA 4XS2A 5CZHA 3OTVA 3UZRA 5BQ0A 2WQBA 1WBOA 3MA6A 3PTGA 3ORXA 4YZMA 4DEHA 5IH5A 2YCRA 2ITYA 3GI3A 5EM8A 1SZMA 3AMBA 4TXCA 3EYGA 5ANDA 5AP5A 2YM5A 4AOTA 4MNFA 4I0SA 4RIWB 4BTKA 3OWPA 3R8LA 2HWPA 1VEBA 2FSTX 4FEWA 3KCFA 5J5SA 3ZYAA 5I0BA 3ALNA 3QC9A 4QP1A 3QALE 4IJPA 1UU7A 2YZAA 1ZYDA 2IVTA 3FLZA 3QKMA 4GFOA 3RVGA 1OKWA 5AUVA 3WF8A 5IH4A 3MESA 1OB3A 4JQ7A 3W33A 1YXSA 4L6QA 5C27A 3O2MA 3FKLA 5EHOA 4K33A 4DEAA 4PQNA 2VTPA 3OY1A 1YOMA 4RWLA 2WPAA 5CSXA 3RM7A 4TRLA 3NWWA 4MEDA 3JXWA 1KV1A 4WSYA 3BWFA 5C1QB 5I9WA 5M4IA 4KD1A 1F3MC 1NY3A 3BLRA 4GV1A 3LZBA 1P14A 4B0GA 5KBRA 1K3AA 3CJFA 4QQJA 2UUEA 4B9DA 4JDHA 4WD5A 2E9NA 3NYXA 2PVFA 3R73A 3R63A 4XG9A 2JEDA 4L3PA 4FYOA 2BZHB 5JMSA 4TL0A 4O96A 3TXOA 1UNHA 1UKHA 4UWCA 2W17A 2WQNA 4XCUA 4QYEA 4X3FA 2QKWB 3FDNA 4X21A 4DTBA 2GNLA 3G9NA 5DVRA 5AUWA 5LARA 4FV9A 5BMSA 1K2PA 4PP7A 2P2IA 4NFNA 3AG9A 4R5YA 4NM3A 2X9EA 3GT8A 3BI6A 4FSQA 4R7IA 5HO6A 4F0GA 5I3OA 2KULA 1YXUA 4YNEA 3V5QA 2WTVA 2JGZA 2ZJWA 2W1HA 3EN5A 2XK8A 5HX8A 4CG8A 5FEEA 4XP3A 3NYNA 2ZMDA 3ZLYA 5DWRA 2QOCA 3OWKA 5LVLA 4H39A 3BBWA 3HLLA 3LFSA 5KNJA 5IA2A 3OFMA 3VS6A 4FEXA 3DJ7A 3L9MA 5AX9A 4KRDA 4AZWA 4G1WA 3DZQA 3DJ5A 2R3HA 4U45A 1BMKA 1PYXA 3ORLA 2XF0A 4DCEA 4IAIA 3V3VA 2GFSA 4LRJA 4FKLA 4LOOA 4FKGA 4XLVA 4G31A 4BCJA 2B9IA 2IVUA 3WYYA 4BIDA 1Q99A 3DTCA 2YJRA 5H8BA 1QPDA 1RE8A 2XIRA 3W32A 2X4FA 4LMUA 4YJVA 4CLJA 3EWHA 3PRIA 2OIBA 4GU6A 4BVUA 3QA8A 4F1OA 4BCIA 3HAVA 4IWDA 5IQFA 2PWLA 2X4ZA 3UC3A 4EOMA 2R3FA 2A2AA 2VTRA 3W2PA 2QR8A 3MB6A 4L00A 4JBVA 3R8UA 4YZDA 4DFNA 3VO3A 1DS5A 4JNWA 1LR4A 1HCLA 2JAVA 2XKFA 4FT0A 4K0YA 4L44A 4XV9A 2GQRA 2PU8A 3ZONA 1W8CA 2DYLA 2G01A 4AGUA 3WILA 5BUIA 5KMMA 1PRYA 4L42A 3LQ3A 3ZOSA 2BZKB 2I6LA 4R8QA 4O7RA 4V0GB 5HU9A 4HZSA 4PPCA 3VN9A 2Q0BA 4NT4A 5HO7A 3OCGA 1IRKA 3Q52A 4RIYA 5HLPA 4DGNA 4MH7A 3UE4A 3CQUA 4DT8A 2Y4PA 5AMNA 1H0VA 4AA0A 5EQYA 1BL7A 4MTAA 4YU2A 5JSMA 2GHMA 5IDPA 3G6HA 5FGKA 4AFEA 4WHZA 4XG2A 3NUAA 5BYZA 4R7HA 4HYHA 2PVLA 3HV4A 4KINA 2PL0A 2A27A 4FTTA 4IQ6A 5ACBC 3VQUA 5ANIA 4EUTA 2Z7LA 3NPCA 3QTZA 3ZZWA 5CQWA 1OPJA 1VJYA 3KULA 4ANBA 4C38A 4CFMA 2X8IA 5E4HA 1JKTA 2GNIA 1R39A 5KMJA 2ITVA 3F69A 5L6OA 2F9GA 4PPAA 1E1VA 2PMLX 2UZBA 3AC8A 4CV8A 3ZRMA 5IDNA 3UYSA 2CPKE 3ORIA 4A7CA 2VO0A 2Y8OA 2WMTA 2Y0AA 3VUDA 4JG8A 3VBYA 5IMXA 3R8ZA 4OAUC 5LJJA 3FC1X 4F09A 1WBNA 4F9BA 1IAHA 2XEZA 1PXLA 4LFIA 1H26A 3JY9A 3C4ZA 3Q4UA 1XH9A 2PE2A 3ZEPA 5FD2A 2OF4A 1Q61A 2J0LA 5HKMA 4DF3A 2WU7A 2UZOA 1ZRZA 3I60A 1IA8A 3DNEA 3LM5A 5D1JA 5FBOA 4ANMA 5KHXA 4BGQA 3HP5A 2QVSE 2WMVA 3UOLA 1YW2A 4GG5A 4KKEA 2QU5A 5I9UA 3VUKA 3MVMA 3PXFA 4O27B 3EQBA 4OW8A 3FMNA 4QYFA 4B8LA 3O71A 4EOIA 2XCKA 4R1YA 1G8SA 1XR1A 5HNIX 1Q3DA 2W0JA 2YIWA 4R7BA 4YSMA 3TV7A 3MH1A 3I5NA 3H9RA 1JWHA 3LAUA 5GZ9A 5CF5A 3QX2A 4YPDA 2C3LA 2QURA 4IM3A 2RSVA 2VU3A 2WMXA 4UEUA 3EB0A 3GP0A 3PPKA 3QTXA 2EXCX 4Y5HA 5CENA 3LXLA 4YJOA 2PK9A 4OTGA 3ATSA 2UZTA 2PZ5A 3GU8A 5AX3A 1JSTA 3IGGA 2OJ9A 5M4UA 1MQBA 3CEKA 3OWJA 3MFTA 2W1EA 4ARKA 4BCMA 2W4JA 2R0UA 1FGKA 5JKGA 3CP9A 2B9HA 4P90A 3V5WA 1YWVA 2JDVA 4AQCA 4HOKA 5EW9A 5ICPA 5IISA 2WIHA 5JT2A 4E5WA 4B6LA 1GZNA 2W9FB 4FEQA 3LXNA 3RNYA 3TCPA 3GXLA 3NDMA 4ALUA 4FZDB 4F7JA 4NW6A 5CYIA 4FSNA 4OTPA 5C8MA 3EKNA 3PXKA 5HQ0A 4ANNA 4FG9A 4XBUA 3DBCA 3BEAA 2EXEA 3VS0A 5A46A 5IA0A 3VVHA 4EWHA 4NJDA 4EK5A 5A6OA 4FBXA 1M17A 3QGWA 4CXAA 1DI9A 2PUNA 4KA3A 4DEGA 4GVAA 4JRNA 2W99B 4CFUA 5HTBA 4XNEA 5AV3A 5AAFA 1ZY4A 4S30A 3RM6A 4ANLA 4BDHA 4C4EA 3BLHA 3COKA 4XHKB 5KMIA 2J0MB 1YXTA 2X1NA 4FKQA 3SRVA 4BDKA 4DFBA 4X2FA 1ZMUA 5CF4A 2V22A 3OT8A 2W1FA 5AP0A 3R9HA 3MW1A 3SAYA 4DGGA 4IFGA 4G5JA 3HV3A 4UWYA 3ZO4A 4BDDA 1GIJA 3BHHA 5A4EA 4EOQA 1PHKA 4AA5A 4EOSA 3LQ8A 4QRCA 3SOAA 4FKRA 3DKGA 3PJ8A 5DT4A 5TF9A 3UDBA 3QLFA 3RNIA 5AFVA 3KXGA 3R8MA 5HCYA 2IG7A 3DXNA 3IW8A 2HENA 3NMUF 3TZ9A 4QTEA 3ZFXA 4QP6A 3KXMA 3TDWA 4UV0A 4G3FA 3QRTA 5HTCA 2C69A 2F49A 2BKZA 1UWJA 2OXDA 5T68A 3Q53A 5CU2A 3FWQA 5HG8A 4FOCA 4CFVA 4IX5A 3ODYX 4FV0A 1A48A 1DI8A 2W9ZB 3OC1A 4BF2A 5IEVA 4BDGA 2QLUA 3F2AA 3ANRA 4W8EA 3VW8A 4U8ZA 4DTKA 1G5SA 2WMSA 4P5QA 2Y6MA 4AN2A 2NNWB 2EXMA 3FSKA 4QOXA 2VNWA 4EH6A 3B2TA 2R3QA 3GB2A 3NW5A 4NL0A 1B6CB 5EQEA 3R83A 4F08A 2J50A 4RZWA 3GCPA 3KKVA 5J5TA 4CMTA 3PWYA 3BQRA 2J7TA 4RQKA 4F64A 5ITAA 3GCUA 5EYDA 4MXAA 5CSPA 1H1SA 2QOBA 3ENHA 4YTCA 3DB6A 3SKCA 4AT3A 3OW4A 3NUNA 4B4LA 2W1DA 3TTIA 2UZEA 2UW4A 3ZUTA 2QO7A 4EH3A 3TDVA 1WBPA 2WTKB 4RA5A 1KUTA 4CZTA 3NAYA 3OF0A 1KOAA 3PJ1A 3R00A 4YC8A 5F20A 4PUZA 5DGZA 3VBWA 3ZXTA 2A1AB 2BTSA 3PVWA 2WELA 3ULZA 3UZPA 2B7AA 4GKIA 4ERKA 3MN3A 2YN8A 2UZNA 2HY0A 4E4MA 4KIKB 3RMFA 3R22A 4RIWA 2WQEA 5H8GA 4JG7A 4R6VA 4WNOA 5AR5A 3DY7A 3TJDA 4Y95A 3OBGA 3O7LB 5FP6A 3W2OA 2QOFA 1J91A 2W1IA 3M11A 3PJ2A 2RFEA 4O91A 2CNVA 3VBVA 4FR4A 3WF7A 4A9RA 1YOJA 5LVPA 3PP1A 3W2CA 4ZY4A 3VIDA 1FVVA 2ERZE 4ZZMA 4XV3A 3QFVA 2QHNA 2WTDA 3VS5A 4M15A 4PDOA 4DFZE 2VTAA 4DH5A 3NCZA 4P2KA 5EDQA 1YHWA 2GS7A 2W5HA 5JFVA 3MGYA 2YITA 4GK4A 5DPVA 4IAFA 4WNKA 4IHPA 2XIKA 4C34A 4BCHA 4PMTA 5DBXA 3Q2JA 4G3EA 4D2VA 4G6LA 4WBOA 3GUBA 1ZWSA 3A7JA 5FEDA 2OG8A 2PMIA 4NM5A 3FZRA 4PL4A 1PYEA 3QHRA 1RW8A 2Y4IB 5IUIA 3UIUA 5CAUA 2JKOA 2BZIB 3ZTXA 4BDAA 3NW7A 4GVJA 4GFGA 1XBBA 4DEEA 2JBPA 5EOBA 5TT7A 3DPKA 3ZLSA 3VC4A 3GBZA 2H9VA 1Y57A 3FZOA 3W2QA 3WF6A 5M09A 3P7BA 5AP1A 3NR9A 4RVLA 3UVQA 1PXPA 3FPMA 4HNFA 5C9CA 4EK6A 4FSWA 4E3CA 3IKAA 5IUHA 2IW9A 1JSVA 4ZSEA 2VGPA 3E7VA 2YERA 2C5OA 2BHEA 2WTKC 4FIJA 3R04A 3DLZA 4O83A 2ZDTA 4O38A 2PE1A 4IDVA 3C5IA 5F95A 3MBLA 3U87A 4HYUA 5LVOA 4ZMEA 4IVCA 4TY1A 4I24A 4Z7GA 3GCSA 2WMAA 3GU6A 4C57A 1A06A 3JY0A 5EDPA 3UIBA 3ZO2A 1KE5A 4XG8A 5AV0A 5HVYA 5C8NA 4USFA 4YHJA 4YP8A 3FHRA 1YDTE 4RJ8A 5CY3A 2C6TA 2F7EE 4G6NA 5E90A 5DN3A 2V62A 4EZ7A 2A4LA 5M56A 3HGKA 3D15A 4FL1A 4WKQA 1PMVA 4JG6A 2BZJA 2QO9A 2XNMA 4PNIA 2XM9A 3PUPA 4RFZA 4W4VA 4QTAA 3KRWA 4XP0A 4G16A 4ACGA 3V6RA 2XJ0A 4AA4A 3FQHA 2HCKA 4BB4A 4FV6A 4DGMA 3B2WA 4CTBA 4HYSA 3IS5A 4NH1A 3AGLA 1ZYCA 3SLSA 3DGKA 4MXXA 4RFYA 3ENMA 3C1XA 4GK2A 3NRMA 4UXLA 4E26A 5A14A 3S3IA 3QD0A 3V5TA 4ZJVA 3BRBA 2J0IA 2B55A 2FO0A 4O1OA 4IC8A 3BX5A 1NXKA 1PKGA 4I5CA 5FBNC 2UZVA 4ZP5A 4ANOA 2CLQA 2YM3A 2XM8A 3Q9ZA 5KHWA 1RDQE 2Z7QA 3RPRA 4AOJA 4C59A 4ZZNA 1UU8A 2Y4IC 3KMWA 4WRSA 3TZ8A 3ZMMA 3FI4A 4ZTRA 5M06A 2C3JA 3MH0A 2JLDA 2VWIA 2C6IA 3MPMA 2V7OA 3O51A 4P7EA 3VAPA 3ITZA 2YA9A 3QKLA 1H1PA 4RIXA 4FUXA 4L53A 1MRVA 4BBEA 4IE9A 5DMZA 3QTRA 4O7LA 3FLYA 2R3OA 4HYIA 4IAYA 2YAKA 4C4JA 5HG7A 2R3JA 2OH4A 2AC3A 3FMLA 4QTBA 2IW8A 3UZTA 4QP2A 3D5WA 5KE0A 5T3QA 1OBDA 3D14A 5IUGA 4FK3A 2OJFE 3S95A 3PA5A 4TT7A 4IWOA 5AP4A 4JX7A 3R02A 4FUYA 1CKJA 2ZOQA 4KKHA 5CNNA 4I20A 4ZTLA 2V7AA 2FSLX 3NNUA 3BGQA 3QZIA 1H28A 1Y91A 3JR1A 4ZTQA 2P4IA 5AUZA 4KABA 4PTCA 5DE2A 3UGCA 5LMKC 3D94A 4CQEA 2BIKB 4L9IA 5D7VA 4I22A 3IQ7A 4PMMA 3OOMA 4A4XA 4NUSA 5B0XA 4FVQA 3CY2A 3TNWA 5I3RA 3VS7A 2G2HA 1U54B 3ORNA 5E1EA 4NSTA 5BVFA 4L01A 4BKJA 2XYUA 1VYZA 3E3PA 2JDSA 4WUAA 4J96A 3W1FA 4G3GA 4XOYA 4PF4A 2QOIA 2IZUA 4U44A 1Z57A 2WQOA 4AF3A 5EW3A 3NEWA 3FAAA 2W96B 5CAOA 4MYGA 2BAQA 4GFMA 2X2LA 3GEQA 3IDBA 3LFAA 4YZCA 4I21A 3V5PA 3VUGA 4BBFA 1R78A 4L7SA 2Y9QA 4J97A 3GGFA 2VRXA 3SV0A 5JFSA 4FNWA 5EDRA 2BPMA 1SMHA 4OLIA 4BYIA 2GMXA 4FTJA 5GNKA 4Y46A 3LCSA 2XNPA 2OIQA 3KU2A 1SNXA 4XRJA 3WOWA 4O7NA 5IEYA 5E8SA 2ACXA 2R9SA 4JJRA 4FC0A 3SXFA 3HRCA 3U54A 4QP9A 5E8TA 3C4CA 3D0EA 2W1ZA 5AA9A 4DFLA 4FVRA 5AR3A 5A9UA 5EKNA 4UX9A 4YLLA 3MVHA 2F7XE 4ZSJA 4C35A 4DGOA 3MVLA 5E91A 5DEYA 1A9UA 5JH6A 5HGIA 5E9EA 3RALA 3CD3A 4W4XA 4FICA 3KMUA 5GZ8A 4ZMFA 3FI8A 5KBQA 2VTLA 4C4HA 4L45A 1JOWB 1YWRA 1OKVA 2PVYA 4GCJA 4WOVA 2WTJA 5CU4A 4ZSGA 2C1BA 3LFEA 5DT3A 4CT1A 3FLNC 2W7XA 5IQAA 3L8PA 5L2IA 5M08A 2OBJA 4H36A 4YO4A 1TQPA 3EIDA 3P23A 4YJQA 1Q8ZA 4BWPA 3F88A 4JIAA 1XBCA 3TKUA 4CMOA 4EH5A 3OP5A 4HVHA 3ZHPC 4F7SA 1Q24A 1M14A 2G2FA 3G9LX 3CIKA 4V05A 4ENYA 1H8FA 2X6DA 4M3QA 5BMMA 5CEKA 3P86A 4NIFB 2VWBA 3LCKA 4L67A 4MF0A 5EH0A 5FEQA 3TKHA 4NYEA 3LMGA 3MVJA 4G2FA 4RA4A 3KRXA 4MXOA 3L9PA 4K11A 4MQ1A 4EZ5A 3EFWA 3P7AA 1IEPA 2PZRA 3TIYA 1OL7A 2J5EA 3O17A 4OTDA 2P0CA 3DV3A 2XIYA 4PTGA 4NTSA 3EKKA 4AW1A 1KE9A 2I0YA 4FKIA 2W05A 4IM2A 2WU6A 3I7CA 3KB7A 4WA9A 5CEOA 3F6XA 5LVMA 1GY3A 4IB1A 3LMHA 4E20A 1STCE 3D7ZA 4UB7A 4GIIA 3THBA 3IW5A 1OPKA 4MBIA 4J95A 4NM7A 1O6KA 5D9HA 4IB3A 3GQLA 2YM8A 4JX3A 4C3RA 4ZJIA 1OUYA 4EUUA 4EK4A 3PG3A 4S31A 5AUYA 4BBMA 5ACKA 3TNQB 4EKKA 5BVEA 3P4KA 3W16A 4Y83A 4NCTC 3COIA 2VX1A 3KVXA 3S2PA 4YHTA 5CAVA 3COHA 3HNGA 3PXZA 4I6QA 1PKDA 4I4EA 5BUJA 5HBJA 4HVIA 3CGOA 5B7VA 5A4QA 5EQPA 4H58A 5K0XA 2OSCA 3SVVA 5AAEA 1W84A 1B38A 2UW7A 3K3JA 5DH3A 3DKFA 4AT5A 2V55A 3B8RA 2OXXA 1YXXA 1J7IA 4HGLA 4IZYA 2H8HA 2QR7A 3ROYA 3DKCA 5TKDA 2XRUA 1ZZ2A 5HG9A 4AN9A 3I81A 4OTWA 2UZDA 2E9OA 2R3GA 3DNDA 2Z2WA 3R7VA 4O7SA 1H1WA 3AC2A 4PWNA 5TR6A 4E5AX 3SXRA 1URWA 5ETAA 3RAIA 5I9ZA 1U4DA 5KUPA 4BDFA 1XBAA 1FOTA 4HNIA 4ACMA 2B1PA 4ZTSA 3WARA 2OXYA 1X8BA 5L8KA 4KB8A 1SVEA 1H01A 2H6DA 3C9WA 4LRMA 4XLIA 2CJMA 2G2IA 3Q5IA 2ZV9A 2HOGA 3RPVA 3AC1A 3F5PA 4M66A 2C47A 4ZAUA 4GKHA 2B0QA 4ZLYA 2QOOA 2CN8A 4GW8A 3H0YA 5IA5A 3LQ5A 2BDJA 5CALA 5A4LA 1OM1A 2C6KA 3Q9WA 4FNZA 2JFMA 2NRYA 3LIJA 2WXVA 2WNTA 4Y72A 2ITTA 2CGXA 4ACHA 2Q0NA 4OBQA 3ZFMA 5IQGA 4O22A 2XRWA 1ZYLA 3V51A 4Z55A 3DU8A 3HV5A 4RZVA 4UWBA 2UW3A 4DH8A 3KF7A 4F7NA 4YTIA 2VWXA 2R3IA 4O0WA 2WD1A 4RT7A 5KZ0A 1ZMWA 3PXQA 4D9UA 4HCUA 3IPHA 3QRJA 3RCJA 4BWXA 1YQJA 3FBVA 3PYYA 5IKWA 3OEZA 2WMRA 3UC4A 3I7BA 3K3IA 4U97A 3VUHA 2HW6A 4ZEGA 3U4UA 4IH8A 5IA1A 3A7GA 4H3BA 3ZSGA 2C3KA 4PMSA 4JVGA 1JKSA 4DH1A 3G0EA 4X7QA 1FPUA 5J7HA 4GIHA 1L3RE 4HZRA 1OL5A 3CSVA 3PDTA 3ODZX 4M14A 4O0RA 3VHEA 1XO2B 4MNEA 5CSHA 4CRSA 2PPQA 3H30A 3PJ3A 4D4YA 1CSNA 3TNIA 3UG1A 4QYYA 2QI8A 4FZ6A 3PZEA 2WMQA 3SQQA 4JOAA 4L46A 4BCQA 5E7RA 5IQIA 3BHVA 3AD5A 1H24A 3GU5A 3GQIA 3MPAA 3Q96A 5LMKA 3C7QA 4QMVA 4F63A 2GQSA 3P7CA 4H05A 1ZYJA 1BKXA 3E8DA 3Q32A 4HJOA 4TZRA 3RCDA 3NW6A 5HG5A 3GCQA 3JVSA 3A4OX 4C3PA 4I0RA 4K18A 4JRVA 4GG7A 4L8MA 4BKYA 3L8XA 4RJ7A 4ERWA 1GIIA 3RZFA 4AE9A 3Q60A 1PXJA 2CKOA 3TV4A 4FOBA 4V04A 3ZLXA 3KL8A 3FMJA 4J8MA 1J3HA 3OW3A 4EH7A 3TACA 2PYWA 3DXQA 4EH9A 4CNHA 3AOXA 3BCEA 2CKPA 3NIZA 4TW9A 1AD5A 2OK1A 2CNQA 3ATTA 3TNHA 1M2QA 1PXKA 2ESMA 4PY1A 5HOAA 5DG5A 4DFYA 3WIGA 4B7TA 4FSUA 1QMZA 5DRDA 3GC8A 3R1QA 4QQ5A 4TKSA 4F0IA 4BDEA 2RFDA 5CVGA 2XKEA 1WBVA 2QOHA 3ZSIA 4PDYA 2BDWA 4ASDA 2PHKA 3FMKA 2BRGA 2PVRA 4D2PA 5GHVA 3IW6A 3BE2A 3FLQA 5I9XA 3AD6A 3FYKX 4NZWB 4LM5A 2X39A 3ALOA 1LEWA 2C68A 3BWJA 3D2KA 5DLSA 4S32A 4U81A 4BY9E 2FUMA 2JBOA 4D0WA 4DEDA 3QD2B 2QCSA 4DEBA 2RG6A 4HCVA 5FP5A 2CGWA 3A8XA 2PUIA 3M42A 1H0WA 2SRCA 3QWJA 2YM4A 3NX8A 4KKGA 1OMWA 2QLQA 3F5XA 3OD6X 4FTUA 4I92A 1YI3A 1YI4A 4GYGA 5B2KA 2GTMA 2XCHA 4ZK5A 4PNKA 5FDPA 2OWBA 3LFBA 4HGSA 3GFWA 5EOLA 3TV6A 4A4LA 4BI0A 4LGDA 4JAJA 1UKIA 1OIQA 2KTYA 3HA6A 3VS1A 3NVMB 5C03A 4DTAA 3RJCA 3TJCA 4L43A 4QP7A 3OY3A 4HPUE 2VTIA 1BYGA 1WAKA 3CTHA 3VRZA 1OVEA 4ONAA 3E8EA 5DEWA 4PPBA 5HTIA 4XP2A 3TIZA 1L8TA 4X3JA 2XEYA 4C8BA 4IVBA 5FWKK 3C0HA 3FI2A 3D5XA 3BYOA 3F5GA 3R7OA 5AM7A 1Q97A 4W4WA 3ZBFA 4EC8A 1SVHA 1UVRA 4GH2A 5JEBA 1U54A 4ZY6A 3D4QA 1GAGA 1BI8A 2FA2A 3QD4A 2AC5A 4I93A 1PF8A 5HHWA 4D2SA 2GFCA 2ZMCA 3KF4A 3QYWA 3LKMA 2BFYA 2VX0A 4W4YA 2ITWA 4DFXE 5GIPE 4M69B 4E93A 1H1QA 5EFQA 2R5TA 2W4KA 3QQLA 3DBFA 4EJ7A 3UVPA 4WBBB 4CD0A 2C5YA 3II5A 4AS0A 4C62A 1UU9A 3CKWA 3QUEA 5ANEA 4C33A 2X81A 5HE2A 4AG8A 3C0IA 4BTJA 4TYJA 4XMOA 3QXOA 4IMYA 5HO8A 5BYYA 4FA2A 3K54A 5HNGA 3BHYA 5LXMA 3C5UA 3QBNA 1SM2A 4PTEA 1MRUA 1U5QA 3R7GA 2WMBA 4RC2A 4UMTA 3RP9A 3RPYA 3HMNA 3AGMA 3MWUA 3V5JA 4Y73A 4YNOA 4YGAA 2VO6A 4MBLA 4UYNA 1P4FA 2YIXA 3H10A 2HAKA 4FKVA 4XG4A 3K5VA 3NGAA 1UNLA 1FMKA 2DUVA 4NCTA 5F94A 4JBQA 3CTQA 4QPMA 5KMLA 2ETKA 3QQUA 3KMMA 2PZIA 4O81A 3DBDA 4ASXA 1IR3A 3F3TA 4MF1A 4NEUA 4YLKA 4EQMA 2XNGA 2HIWA 3PY0A 2XK3A 3EOCA 2FB8A 4BZOA 4CLIA 4IFCA 5G1XA 2PE0A 3UYTA 2YABA 3TKIA 3TEIA 4IDTA 2HYYA 3E3BX 2PZPA 3VNTA 2PVJA 3FZSA 5M4FA 1ZXEA 4I0TA 4FT9A 2CGUA 1MRYA 3BPRA 3VRYA 4WG3A 3VBTA 1KV2A 2JDTA 4U3ZA 1PXMA 2E9PA 2O8YA 2VO3A 4G5PA 2I0VA 4MX9A 5KX8A 4FIEA 5D7AA 3KRRA 4OTIA 4UYAA 3PIXA 3WI6A 5AR8A 4E6AA 2IZTA 4RFMA 3KRJA 1NA7A 2WMUA 3OCTA 4MWIA 4CEGA 2QOLA 5C4KA 3TG1A 3ZBXA 5HD7A 5J1VA 4LV8A 5CEQA 3W18A 3AC4A 4FX3A 4MBJA 4RMZA 4R1VA 4QYHA 3FMEA 4NIFA 4IBMA 3GU4A 1S9IA 3ID6C 5ANGA 3COMA 3PY1A 2QO2A 3G2FA 1OIUA 1PY5A 4PP9A 3ORTA 3QZHA 4DEIA 3NCGA 4F9WA 2J6MA 4CKJA 1PW2A 4M7IA 4EH4A 4XEYA 4AOIA 2IPXA 4FYNA 4YJUA 4G17A 5EI6A 3T8OA 4DGLC 2YWPA 3WF9A 5C8KA 2XS0A 3D83A 5CEPA 2BMCA 3VS4A 4A4OA 5EYCA 5H9BA 5K0KA 2XK9A 3G33A 3QD3A 4N57A 5HIBA 4ZTHA 1XKKA 2O3PA 1UWHA 5JRQA 4FTRA 2WEVA 4GEOA 4C7TA 4DG0E 3LFDA 3ZZEA 4WSQA 2PVKA 3HUCA 3HUBA 3MS9A 5CTPA 4C02A 2YIYA 3EQHA 1H07A 1PMNA 1W7HA 4LUDA 3LCTA 3ZRKA 3V04A 5M4CA 3IECA 4D1ZA 4O0UA 4O0TA 2C4GA 3MH2A 4CV9A 3GC9A 3TL8A 1OGUA 2WFYA 3BLQA 4UN0C 1FBNA 1KWPA 2C30A 3U55A 5J7BA 1XH7A 4RWIA 4O1PA 1KOBA 4ANSA 4PV0A 2E9UA 5DIAA 4EOOA 5I4NA 3PLAE 3ELJA 3MB7A 4YJNA 2VTNA 5J9ZA 5FLFA 2WO6A 2O5KA 3DQWA 4DAWA 4JDJA 2X8EA 4FV2A 4KSPA 4HPTE 2GTNA 4AW0A 3N9XA 5J1WA 3KXNA 3NS9A 5FDXA 3SW4A 3CTJA 5CU3A 3BBTB 5EHLA 3W8LA 4TYIA 4NU1A 3FZPA 3FXXA 3JPVA 4BDCA 5BYLA 4WIHA 2R3MA 3HRBA 3D7TB 4C37A 5HVKA 3EZRA 4FV5A 4YO6A 2C1AA 5BVKA 4RGJA 5HBHA 4MKCA 3MSSA 2RFNA 3GU7A 3D5VA 4MQ2A 2PMOX 4U7ZA 4CTCA 4O86A 3L1SA 4KS7A 4EOKA 5L6WL 4N4SA 3NIEA 4QMLA 2DS1A 2HXLA 4F70A 3MY1A 3HMIA 3KN5A 5F4NA 3DTWA 2PVNA 4QMSA 3PPZA 4FV4A 4L7FA 4EH2A 3AD4A 3NLBA 2PUPA 4RC4A 4O0XA 3IK3A 2B9JA 3WE4A 3OCBA 3WE8A 4U3YA 3ORZA 4KS8A 3QYZA 4FSZA 3PLSA 3PFQA 5CWZA 3R7IA 5M57A 5I5ZA 1NVRA 2RIOA 3HVCA 4O84A 1CMKE 5JGDA 3QQKA 1Q62A 4OBOA 4D4RA 3S00A 2C5VA 4FTKA 4C0TA 5AM6A 2YM7A 3EQPA 3DBQA 4YTHA 3F9NA 3KXZA 4O0SA 2GNFA 2XNBA 3DFCB 2YJSA 1YRPA 3C51A 2YFXA 2VUWA 4TPTA 3VS2A 4Q5EA 4RPVA 2PVHA 4FMQA 1JAMA 1ZARA 4TNDA 1QPJA 2VTMA 2F2CB 3QZFA 3ET7A 3ZM9A 3WBLA 5HLWA 2CLXA 2V0DA 3B8QA 2PMNX 3F66A 3R7YA 2A19B 4XX9A 4MHAA 1BLXA 3GC7A 3ZLWA 2OH0E 5EG3A 4U0IA 4EBWA 3R1YA 4QMUA 4ZTMA 3UOJA 3SX9A 4R5SA 1OI9A 5DYJA 5FQDC 3NUPA 2J0JA 4U41A 4R3PA 5JFXA 4D1SA 3A7IA 2H34A 4BZNA 2WMWA 3BU3A 3R1SA 3FHIA 1Q8WA 2P55A 2OJJA 5IMEA 4F7LA 1OITA 3I1AA 2PUUA 2YIRA 3E8CA 4ZY5A 1Q8TA 5ETCA 3EQDA 2NPQA 1UU3A 1GZKA 3HMPA 3A4PA 1XWSA 3LJ1A 1I44A 4ZJJA 4CFWA 3RWPA 4CMUA 3GC0A 1Q41A 4BGHA 3UPZA 5CVHA 4II5A 4U5JA 5KMKA 2AUHA 2FGIA 1JNKA 2W4OA 3SC1A 4QNAA 3T3UA 3ZDUA 4BCOA 1SNUA 3CC6A 4U9AA 5LCKA 3HMMA 3DK3A 3M2WA 2CNUA 2BALA 2QHMA 4BHZA 4AX8A 4WNPA 4ASZA 4QP4A 2VWUA 3I6UA 3Q5ZA 3BHTA 3I0OA 3QTWA 4FKPA 4RIOA 4YJRA 1UNGA 4DLIA 4HVGA 4I6FA 1R3CA 2HW7A 3EQRA 3GFEA 2YEXA 5EK7A 2UVZA 2ITQA 4GL9A 4IACA 3ZO1A 4ALWA 4F1TA 5L6PA 4FL2A 4FZFB 5HEZA 4FF8A 4K9YA 3IGOA 1ZOHA 3HV7A 3R6XA 2YCFA 4NWMA 5KCVA 4BCNA 2VTJA 3CQWA 4V0GA 4F99A 3PP0A 4UMUA 3BU5A 3QQGA 4IIRA 3QQJA 1CM8A 2F4JA 3DAJA 4FK6A 2BAJA 2ONLC 3EZVA 4XG6A 4CCUA 1Q8YA 5M53A 3DS6A 3KREA 4PX6A 3Q6UA 4U40A 2JDOA 1V0PA 3CCNA 4O2PA 4IAAA 1BI7A 3PSBA 1AGWA 4JR7A 1GZ8A 3FE3A 4MXZA 5AP7A 4E7WA 3BYVA 3PE1A 3PXYA 5LVNA 3FL4A 2YAAA 2RL5A 5HNBA 4AACA 3JUHA 5TOZA 4Q2AA 5DR6A 3CS9A 2CN5A 1IG1A 2VWYA 2RF9A 4GS6A 5E8UA 5AR7A 4A07A 2OO8X 4EHZA 3PA3A 4TWCA 5CX9A 4C36A 4BYJA 1GJOA 3R2BA 3CKXA 4E6QA 4QTCA 2XIXA 4X6RA 5ANJA 1KE8A 4JDIA 3SD0A 2VWZA 3UBDA 2WIPA 1CKPA 3MFSA 3O8TA 4L3LA 4Z9LA 3W2SA 1QPCA 4RX5A 1JPAA 3NYOA 4LOQA 5E92A 3L9NA 4C2WA 3I79A 4ZTNA 3BGPA 5IPJA 1U59A 4O7TA 3R21A 3GOPA 3EN7A 3Q04A 4TN6A 4D9TA 4LRKA 4YC6A 3QTUA 5I9VA 3OG7A 2VD5A 4QQTA 5K4JA 4YURA 4GJ2A 4DBNA 1JKLA 2RKUA 1XHAA 5DI1A 5AUXA 2XUUA 4M69A 2YCQA 2REIA 4KRCA 2X6EA 5CEIA 3QTQA 3HECA 4QT1A 4DN5A 2J90A 3DDQA 3I6WA 4M13A 3PVBA 2Z7RA 3EFKA 5EHYA 2NO3A 4LI5A 3SHEA 3UTOA 4EK3A 4J98A 2XNEA 4BWKA 4EYMA 5KMNA 2R3RA 2IO6A 3L8VA 4TWPA 2J9MA 5AP6A 4QQCA 2Y6OA 4GT3A 2GHGA 2X9FA 2OLCA 3AC3A 5AUUA 3JVRA 3ORMA 2BUJA 4C4GA 4IX4A 4DG3E 3OZ6A 3PE2A 3CXWA 3QRUA 2OJGA 3EQFA 3HX4A 1JKKA 3POOA 3NUSA 4FG7A 4TWOA 4XRLA 3W2RA 4QNYA 4CKIA 2C6MA 3QGYA 4N0SA 5E8XA 3UG2A 2X2MA 3IDPA 4AW2A 4KBAA 3QCQA 5A4CA 2QC6A 3RKBA 4ZS4A 4TTHB 3TN8A 3FKOA 1KE7A 2VZ6A 3VBQA 4K77A 5IA3A 4GU9A 3PXRA 4TNBA 5FM3A 4RX7A 4C4IA 4QD6A 4WO5A 4FZAB 4F9YA 4J99A 4ITJA 3OXIA 4UZDA 5J95A 3TM0A 2VAGA 5ETIA 5EW8A 3BE9A 3PVGA 1YOLA 5CXZA 5K4IA 4JT3A 4KUJA 4BGGA 1TVOA 2XNNA 3F61A 3HDMA 2E9VA 5EM7A 3U6IA 4GRBA 4QMTA 4YJSA 5JQ5A 5HU3A 2YACA 5BVNA 2XMYA 4ORKA 3LOKA 5IQHA 4F6SA 5CZIA 5AR2A 3KCKA 2XH5A 2VTSA 4KAOA 4USEA 4BN1A 4D2WA 4ZLOA 3NNXA 4MXCA 3U4WA 5IA4A 2GDOA 5FXRA 5HX6A 2XJ2A 2R7IA 4YZNA 4YC3A 4RWJA 2XBAA 4XYFA 2WEIA 2GNGA 1JQHA 3UP7A 3SW7A 4QYGA 3ZFYA 3ZS5A 1G3NA 1OIYA 5HIDA 3VUMA 2BVAA 4XV2A 5LWMA 1NT2A 2ZV2A 3LFNA 2ITXA 3I5ZA 3LPBA 4E5BA 4RRVA 4V01A 3N4UA 3IW7A 5L4QA 4CFFA 3A99A 4K1BA 4LL5A 4EKLA 3AT2A 3LCDA 3LW0A 2OKRA 5B2LA 2HWOA 2EU9A 3BHUA 3HL7A 2JFLA 2CGVA 2JAMA 3KA0A 4O6EA 3UODA 4E8AA 1OIRA 4IZAA 4S33A 2C6EA 4M97A 5H8EA 3UJGA 4D2TA 2O64A 2BILB 4NFMA 3DK6A 4NM0A 5JFWA 4CT2A 1JVPP 1ZOGA 4G34A 4UY9A 3F3ZA 2OFUA 4M67A 4Z3VA 4BCFA 5LMAA 5EKOA 3KFAA 1XJDA 5K9IA 1QL6A 3KK9A 4GUBA 4IEBA 2VGOA 2VO7A 4MCVA 1ND4A 1RQQA 2C0TA 5DR2A 2O65A 3BYUA 3E5AA 3KEXA 1KSWA 4YZBA 3W55A 1VR2A 4EHVA 4ZXTA 2HXQA 3NZ0A 5CI6A 4DT9A 5AWMA 5AR4A 5DT0A 3G6GA 5CI7A 3OOGA 3RI1A 4X2NA 4OTHA 5L8JA 3FV8A 4MAOA 2QONA 2LAVA 4IWPA 3A8WA 3ERKA 4D4VA 3DOGA 3FPQA 3LMIA 1H00A 3H9OA 5TO8A 4AT4A 4I6BA 4CVAA 3OROA 2JIUA 5J9YA 2Z02A 5J8IA 4DBXA 4JBPA 3P9JA 1OPLA 4KSQA 4ZSLA 5BVWA 3IOKA 3VUIA 1KE6A 4HGEA 3U6HA 1ZMVA 1RJBA 1M52A 5IU2A 3D7TA 3ZEWA 1Y8GA 3Q9YA 4KIKA 4RJ5A 2I40A 4F6UA 3PIYA 2ZAZA 2ZM1A 3RWQA 3T9TA 2ITNA 2B54A 1H08A 3OCSA 4X2GA 2QOKA 5F1ZA 5I9YA 4NKSA 3QQFA 3FQSA 1O9UA 4IW0A 1CDKA 4D4SA 1B39A 5GZAA 5LMBA 2I7QA 2EB3A 3SGCA 2VTOA 2W1CA 4PL3A 4UXQA 3FLWA 4MXYA 4WNMA 2R3PA 3NNVA 5BVDA 3BV3A 1GOLA 3LLTA 2B53A 2I0HA 3QCSA 4HGTA 4TYHB 3A7HA 4ZS0A 5CAQA 4AZTA 3UMXA 4FTOA 5HZNA 5JRSA 4LG4A 3WIKA 3EL8A 2WB8A 1W83A 4APCA 4A9TA 2ZM3A 4FKWA 3TUCA 4L3JA 3VJOA 2JKKA 1F0QA 4D0XA 2C3IB 3IONA 2ONLA 2BR1A 5EM5A 4OGRA 5H2UA 4N6YA 4R3RA 2OI4X 2BTRA 4OUCA 2PVMA 1OECA 4G3CA 3R71A 4D5KA 3W8QA 4I94A 4CZUA 2WOTA 1LEZA 5IQBA 2OZAB 2UW9A 4FTAA 3RHKA 4AW5A 4EL9A 3WZKA 5C01A 3TZMA 3DFAA 4EOJA 4FV8A 4G6OA 4DE4A 5K3YA 4USDA 4D2RA 2UVYA 1Q5KA 3PA4A 1FVRA 4RLLA 4A9YA 3HRFA 4IB5A 3E8NA 3R9OA 4O0VA 4AZFA 3T9IA 2ZB0A 2OU7A 4M0ZA 3CD8A 5EM6A 4FT3A 2GSFA 1VYWA 1Q4LA 2J2IB 4OT6A 4AGDA 4FIFA 4NKAA 2PSQA 4I5HA 2QG7A 4AU8A 1WBWA 3A60A 2FSOX 2AYPA 3F3VA 2Z60A 2UW6A 4M8TA 1Q8UA 4L52A 4BDJA 1GIHA 3EN4A 3F7ZA 2XK4A 3CPCA 2BHHA 3G0FA 1DAYA 3RINA 4XH6A 4YTFA 3PPJA 4YPSA 4LMNA 2W1GA 4AUAA 2PULA 3CBLA 2UV2A 3C4FA 3IDCA 1TQIA 2DWBA 4S2ZA 4O0YA 1WVYA 1PXIA 2GNJA 5A4TA 1WVXA 3F5UA 2UZLA 5IF1A 4FIHA 2QD9A 1OKZA 3OUNB 2C5NA 4JS8A 4P4CA 4EQUA 3QXPA 4PDSA 4BKZA 3ZRLA 3R9RA 3DCVA 3S4QA 4B8MA 1TKIA 2VV9A 5DOSA 2EWAA 3KY2A 4YZ9A 5J87A 4BC6A 1E1XA 3ZSHA 2R7BA 4DH7A 2EVAA 3D2IA 5IEXA 4DFUA 3ZUUA 1J7LA 3VF8A 4R77A 3MH3A 4AZEA 4QP3A 4QTDA 3ZO3A 4O7WA 3UQGA 3FMHA 3UO6A 5AEPA 5HLNA 2Q83A 2IVVA 5CNOA 4CYIA 1NVSA 4MD7E 2I0EA 3IW4A 4MK0A 5M55A 5IQCA 4XG3A 2I1MA 5HBEA 5AP3A 4EQCA 1IA9A 2PY3A 3L9LA 3R28A 4PRJA 2R3LA 1P5EA 2VWWA 3VF9A 4RLKA
chains in the Genus database with same CATH superfamily
1ZY5A 4J1RA 4QMYA 4D1XA 3FZ1A 1T46A 3DDPA 1YDSE 3WZJA 3W0RA 3PZHA 4IJ9A 2YLFA 4FV1A 2ETMA 2F2UA 3LHJA 4JAIA 3EFJA 5AP2A 3VULA 4F6WA 3BYSA 3QA0A 3S1HA 2XK7A 2YLEA 2QNJA 4J8NA 5HICA 3NUYA 2VTHA 3DAKA 4QPAA 4E4LA 2B9FA 4JIKA 4QDVA 4I5PA 4E6CA 5HI2A 3EFLA 2B4SB 3GVUA 3VQHA 3R0TA 4BFMA 4C58A 3HAMA 2OGVA 2BAKA 5AADA 4BIEA 2XZSA 2C0OA 4AGCA 3OXZA 4D5HA 2W5AA 3EJ1A 4NJ3A 3F3UA 4RIXB 4K2RA 2C0IA 4M68A 3F2RA 2IZSA 3OHTA 3CGFA 4EHGA 3TI1A 5HIEA 4QDEA 2YDJA 2IW6A 3AXWA 3U51A 1OUKA 5L2QA 2X7OA 3E64A 2HY81 2HK5A 3HZTA 4OBPA 4RQVA 4ZIMA 3WYXA 4BHNA 4EEVA 4TYGA 3AT3A 4G9RA 3OWLA 3OEFX 1QCFA 4YLJA 2CDZA 3WZDA 5K5NA 5CASA 2BIYA 3A2CA 3C13A 4FG8A 4BDBA 3BIZA 3V8TA 5LWNA 2VTQA 4FL3A 3RK5A 4J53A 3SOCA 1P4OA 2ZM4A 2UZUE 4WG5A 4Q9ZA 3VWAA 2HZ4A 5JGAA 3NNWA 3QZGA 3ZC5A 4MD9E 3S0OA 4CFNA 3UNZA 2BRBA 4F9AA 4FSMA 4ZOGA 2WKMA 3LLAA 3H9FA 3PJCA 4FV7A 4D58A 1P2AA 2F57A 4EHEA 3LCOA 2RGPA 1FQ1B 1Q3WA 2ITUA 3QC4A 4GSBA 4EORA 5HESA 4PL5A 3VJNA 3N4VA 3RPOA 1PXOA 2OFVA 3LXKA 3MDYA 4QMZA 2JITA 4W8DA 3KRLA 1YVJA 4B99A 2JKQA 2E2BA 5F9EA 3AC5A 5JQ8A 2ETRA 4L68A 1U5RA 3OTUA 2FH9A 1OL2A 5D41A 3E7OA 4DA5A 3BGZA 4ALVA 4RWKA 4ACCA 1MUOA 3MIYA 5JN2A 4RG0A 5HD4A 2LGCA 1LP4A 1URCA 4F65A 2JKMA 2NRUA 3BV2A 5BX0A 2GPHA 4EONA 1I09A 5FTGA 3G15A 1G8JA 1H1RA 2XVDA 3QCYA 4QP8A 3WZEA 5IH6A 5HCXA 4JI9A 5EYKA 3DKOA 4H1MA 4WT6A 1H27A 4YJPA 3OBJA 4LGGA 1V1KA 4GJ3A 4HVDA 4IX6A 1R0PA 3HV6A 4CFXA 5CSWA 3P1AA 3IO7A 3AQVA 5AIRA 3HEGA 3ZCLA 5CT7A 1W98A 4AXFA 4AZSA 2YM6A 3V01A 1J7UA 3EHAA 5GJGA 3F82A 5HORA 2GNHA 2UW8A 3QF9A 3QRIA 4JR3A 2BCJA 3QAME 1GZOA 4FSRA 2XA4A 4JQEA 3RK9A 4I23A 3R9NA 2A98A 4I6LA 1BX6A 4OTFA 4FSYA 4F9CA 3W0SA 4QMQA 4YSJA 1TQMA 4FTCA 1ATPE 3EN9A 3H0ZA 3W0NA 1PMEA 4J52A 3QTSA 4DYMA 3UOHA 4C4FA 5BPYA 1DAWA 1GNGA 4FTIA 3G90X 2HZ0A 4BCGA 3WZUA 5M51A 2QU6A 2B52A 4BRXA 3OXTA 5CAPA 5CF8A 3E92A 3A61A 4Y85A 2ITZA 4JLCA 1R1WA 5CS6A 1G8AA 4ITIA 2P2HA 4LYNA 3UOKA 3D9VA 4K6ZA 4KBCA 3U9NA 4H3PA 4RJ3A 3DA6A 4F0FA 3DK7A 5FM2A 4N70A 4OT5A 3A7FA 5HE1A 5DHJA 1FVTA 5H3QA 4AZVA 3TT0A 2C6DA 4NW5A 3FUPA 3FI3A 3BEGA 2G1TA 3P79A 4RVKA 2YWVA 4BR3A 2C5XA 5GIOE 2IWIA 1JBPE 3IOPA 3KXHA 1CTPE 4U79A 4WUNA 5D11A 4IZ5A 3VONA 3C0GA 3AT4A 5EI8A 4ASEA 3C4XA 5BV3A 5IQEA 2Y7JA 3UVRA 4IAKA 1MQ4A 4AXAA 3Q4TA 4BDIA 4HCTA 4BIBA 4M0YA 3KXXA 4BTFA 3MV5A 4EWQA 2G9XA 4QMXA 3LJ0A 3RPSA 3HKOA 1APME 2CKQA 4O7YA 3MTLA 1V0OA 2V5QA 4UALA 5FUTA 1FINA 1FMOE 3I0QA 2VNYA 4JQ8A 2O63A 2HZIA 3PRFA 4UMQA 1F5QA 4F4PA 1G8KA 2YZLA 2J0KA 5ANOA 4J71A 3RK7A 5CF6A 2OZOA 3UO4A 4IX3A 5A3XA 1LPUA 2C6LA 3UMWA 3R01A 3FLSA 3QX4A 4P5ZA 1YWNA 2OF2A 4O82A 2BROA 3U6JA 4R78A 3SG8A 2WGJA 4I1ZA 5DNRA 4F1MA 4MVFA 3E63A 3MIAA 5DA3A 3UQCA 2DQ7X 5AIKA 4CCBA 3EMGA 3FY0A 3EN6A 2W06A 2X0QA 4C3FA 5L3AA 4DCAA 1SYKA 4IC7A 3F2NA 3TTJA 4AWIA 5C4LA 3MJ2A 2QG5A 3MJ1A 2ZYBA 4GYIA 5B2MA 4BJJA 3HYHA 3MYGA 1WBSA 3P0MA 4OTQA 2JDRA 4IB0A 5AV1A 3L8SA 3QUPA 4XUFA 2J4ZA 4JL9A 5DRBA 3GCVA 5CSVA 4DG2E 5C26A 3VS3A 3N51A 4FTQA 3DB8A 4G9CA 4LOPA 4TYHA 3I4BA 4CQGA 4FE2A 2WZJA 3Q4CA 5AV4A 4C2VA 1PMUA 4W9XA 3RHXA 5L8LA 4KNBA 1HOWA 3FXWA 2J5FA 3F7WA 4FTNA 2XAOA 3PG1A 2IJMA 3H4JA 5E8VA 3LJ2A 5JZJA 4FI1A 4RX8A 3VW6A 1OL1A 2WAJA 4TYEA 2ERKA 4OAVB 4DINA 3NAXA 3KK8A 5LQFA 4O21A 1OL6A 2HELA 2UW5A 4LL0A 1XH8A 5BUEA 4CG9A 3DBEA 1T45A 4IZ7A 2OZAA 4WRGA 2CKEA 3R7EA 3CPBA 2BKKA 1M7NA 3Q4ZA 2JIIA 5BVOA 1OKYA 2QOQA 2X7GA 3V8SA 4ENXA 5KKRB 5G6VA 4FKTA 1OBGA 3OVVA 1WBTA 2R2PA 3W10A 2BRMA 3O7LD 3P08A 2X0GA 2YDIA 4IWQA 1Y6AA 3RTPA 4ACDA 4E4XA 3ULIA 4IADA 3QU0A 1K9AA 3WF5A 1DM2A 3QL8A 4OR5A 4XG7A 2WHBA 4EC9A 4XOZA 1HCKA 3O23A 1REJA 1YDRE 2YCSA 1FGIA 3FC2A 3FMMA 2XNOA 3HDNA 3BQCA 3MPTA 3EH9A 3O0GA 4I5MA 4X3FB 4APPA 5JK3A 3JS2A 3R30A 5ETFA 3ROCA 3MY0A 5J79A 2YDKA 4XBRA 3P5KA 4O6LA 3ZC6A 1E9HA 2UW0A 3T3VA 4CRLA 4NK9A 5E8WA 5AV2A 1OZ1A 5M07A 2XB7A 3CE3A 3FKNA 3UNJA 5J9LA 3LFQA 3FL5A 5GJDA 1O6LA 5CXHA 2A0CX 1Y6BA 4PDPA 5EYMA 2NP8A 3Q9XA 4MNEB 4Y8DA 5M44A 1S9JA 3JYAA 4BI1A 3POZA 1WCCA 4H3QA 4CYJA 4X2KA 3PWDA 3AMYA 4FGRA 4ZSAA 3C4WA 2CSNA 3A62A 4YBKA 3Q6WA 4QO9A 3NSZA 1XH5A 3TNPC 5D10A 3RGFA 2F7ZE 3MY5A 1ZZLA 4FODA 3TUDA 3ANQA 2FYSA 3MFRA 4C61A 5E8YA 2XP2A 3PSCA 3ZH8A 4KIOA 3UP2A 1VZOA 2ITPA 4U42A 4H1JA 3MI9A 5HE0A 3R8VA 4AGWA 4DH3A 4UBAA 2XYNA 3R9DA 3V8WA 2YISA 3QQHA 4EK8A 2Z7SA 4RJ4A 1WZYA 2XKCA 3SA0A 4YR8A 4E4NA 4KIQA 4G3DA 1Y8YA 4X6QC 2GU8A 2GQGA 3VHKA 1ZAOA 4AAAA 3K2LA 2CHLA 5CU0A 2UVXA 3UPXA 3KN6A 4IXPA 2VTTA 3DXPA 2ZB1A 3BU6A 3DQXA 2GHLA 1PJKA 3GOKA 3M1SA 3FMDA 5KKRC 2ZVAA 3Q2MA 1BL6A 1SVGA 2GS6A 1EH4A 3NUUA 4MD8E 2OIDA 1R0EA 3HA8A 2OICA 5E1SA 4AP7A 4LUEA 3GENA 3E88A 4ITHA 4RVTA 4U80A 1YXVA 1NW1A 4BZDA 5CT0A 4FNXA 4I41A 4RIYB 2IZRA 2WTCA 2IVSA 4GT4A 3O8PA 4ANQA 2YIQA 1UV5A 1H25A 1YKRA 3BELA 3ZU7A 3BYMA 4BL1A 4UMPA 2ZDUA 2WTIA 3LXPA 3FYJX 5A6NA 4X3FC 5AUTA 4FT5A 3V6SA 3UNKA 4O7VA 4FZ7A 4FKSA 3AMAA 2WOUA 5IQDA 2XALA 4Q5HA 2HZNA 4E6DA 1YHVA 4OTRA 3FJQE 3KULB 4EOPA 2H96A 3LM0A 5CEMA 5K5XA 3ZXZA 4AN3A 3CR0A 2BFXA 4RVMA 3V5LA 4BICA 4ZZOA 1H4LA 1J1CA 3QTIA 5TE0A 3R2YA 4Q9SA 3KVWA 1W0XC 5CVFA 4BTMA 4EH8A 4E1ZA 3H3CA 3MFUA 4ID7A 4Z7HA 3HMOA 3E87A 4GUEA 2CCHA 4D28A 1JLUE 5E8ZA 5HVJA 4FTMA 2J51A 3OT3A 3N4TA 1M7QA 3GNIB 3NUXA 3KC3A 5CU6A 3RZBA 4BCKA 2ZV7A 3R1NA 3BKBA 3CY3A 1NVQA 3LFCA 3DJ6A 4RJ6A 4QMMA 4JDKA 2R4BA 2XJ1A 5FRIA 4E73A 4FIIA 4M84A 2BDFA 4I6HA 4HW7A 2UZWE 3Q3BA 4FKUA 3DT1A 4O4BB 5D12A 5LOHA 3O8UA 4FIGA 2XANA 3VUTA 3RAWA 4IM0A 5BNJA 1ZLTA 3ACJA 5CANA 2O0UA 3FZTA 4CKRA 5FG8A 3PVUA 4CSVA 4PMPA 4XJ0A 2P33A 2W5BA 3SG9A 3TYKA 3G51A 3O96A 2ZV8A 2VN9A 1JSUA 3IG7A 3MA3A 3QWKA 5LCJA 4W9WA 2JIVA 2C6OA 4YMJA 2BRHA 5GINE 4FKOA 3UIXA 2JC6A 1WFCA 5IG1A 2IN6A 2OW3A 4D55A 3MTFA 4FVPA 2G15A 3REPA 4QMPA 2WTWA 4MWHA 3DAEA 5AA8A 3ETAA 3NVKI 3BZ3A 3SXSA 2R0IA 4FEUA 2GCDA 2O2UA 4U6RA 3R8PA 2R3KA 1AQ1A 4RC3A 4A9SA 4EBVA 2VWVA 3FSFA 2XK6A 5A54A 3E62A 4GMYA 3D5UA 4J7BA 4UMRA 1VLRA 4FV3A 3KGAA 2P3GX 3PSDA 4XV1A 4FSTA 5AJQA 4Z16A 3EQCA 3RBWA 4QMWA 2ITOA 3ORPA 4IANA 3FQEA 4FGBA 3LVPA 3C4EA 3ZUVA 1XMMA 3UIMA 3TUBA 4GK3A 1IAJA 3OUKA 5HCZA 4EOLA 1J1BA 1YHSA 4O7ZA 5DFPA 2XKDA 4EI4A 3F3WA 3QCXA 3VBXA 3ZDIA 4AE6A 1M2PA 2BRNA 3DZOA 3FY2A 5CLPA 5FTQA 4RX9A 4ZLZA 3FEGA 3CQEA 4IAZA 4LQMA 5KZIA 3U8WA 2CMWA 2CCIA 2RFSA 3NYVA 3TZ7A 2FVDA 2WQMA 4IVDA 1V0BA 3U9CA 3QKKA 3UO5A 4A06A 4YBJA 2PZYA 1IASA 4DLJA 4EZ3A 1XH6A 3EL7A 3SRVB 4RSSA 5JZNA 1QPEA 2QQ7A 1U46A 4K8AA 3FXZA 5L2TA 2R3NA 4U43A 1UA2A 1CKIA 1ZOEA 4BI2A 4X0MA 4RBLA 4LGHA 4FTLA 3KIOC 3RAHA 3LFFA 5FTOA 4CGAA 2X7FA 4HVSA 3QUDA 4M12A 1LUFA 1BUHA 2GS2A 4FEVA 3OMVA 3R7UA 1WMKA 4DHFA 4FKJA 4YHFA 3UQFA 3EYHA 1PXNA 4I3ZA 4O4FA 3QRKA 3ORKA 1M2RA 3O50A 3RAKA 5FXSA 1Z5MA 2FSMX 4EYJA 3QHWA 5IZFA 3KQ7A 4LV5A 4S34A 5L2SA 3C50A 3OS3A 4AFJA 3TWJA 2X8DA 4FNYA 4KWPA 1ERKA 3LE6A 5KMOA 1YI6A 2YHVA 2R64A 5ANKA 1MP8A 3EQGA 4IVAA 4YJTA 4EJNA 2XIZA 5GJFA 5T6KA 3SDJA 3ACKA 5AAGA 5L2WA 5CQUA 2EB2A 4QPSA 5DR9A 3EQIA 4GT5A 5HE3A 3ZM4A 4CZYB 2OJIA 1O6YA 1WVWA 4R3CA 3P78A 2QKRA 4DITA 2Z8CA 5KO1A 4WG4A 2JD5A 1REKA 4JBOA 2X2KA 4N6ZA 5FXQA 4QMNA 4KBKA 4NTTA 3PIZA 3QLGA 3PY3A 4O2ZA 4UZHA 4YUQA 5JGBA 2XBJA 1XQZA 4DC2A 2RG5A 4I4FA 1Z9XA 3G5DA 4X2JA 3CJGA 2QODA 3CLYA 2VX3A 5EI2A 2PTKA 3DLSA 3K5UA 1W82A 4FT7A 3E93A 4QMOA 4Y5QA 3HP2A 1XH4A 4BCPA 4KIPA 4JXFA 4A9UA 1ZYSA 2EUFB 4TWNA 4XS2A 5CZHA 3OTVA 3UZRA 5BQ0A 2WQBA 1WBOA 3MA6A 3PTGA 3ORXA 4YZMA 4DEHA 5IH5A 2YCRA 2ITYA 3GI3A 5EM8A 1SZMA 3AMBA 4TXCA 3EYGA 5ANDA 5AP5A 2YM5A 4AOTA 4MNFA 4I0SA 4RIWB 4BTKA 3OWPA 3R8LA 2HWPA 1VEBA 2FSTX 4FEWA 3KCFA 5J5SA 3ZYAA 5I0BA 3ALNA 3QC9A 4QP1A 3QALE 4IJPA 1UU7A 2YZAA 1ZYDA 2IVTA 3FLZA 3QKMA 4GFOA 3RVGA 1OKWA 5AUVA 3WF8A 5IH4A 3MESA 3PUFC 1OB3A 4JQ7A 3W33A 1YXSA 4L6QA 5C27A 3O2MA 3FKLA 5EHOA 4K33A 4DEAA 4PQNA 2VTPA 3OY1A 1YOMA 4RWLA 2WPAA 5CSXA 3RM7A 4TRLA 3NWWA 4MEDA 3JXWA 1KV1A 4WSYA 3BWFA 5C1QB 5I9WA 5M4IA 4FRFA 4KD1A 1F3MC 1NY3A 3BLRA 4GV1A 3LZBA 1P14A 4B0GA 5KBRA 1K3AA 3CJFA 4QQJA 2UUEA 4B9DA 4JDHA 4WD5A 2E9NA 3NYXA 2PVFA 3R73A 3R63A 4XG9A 2JEDA 4L3PA 4FYOA 2BZHB 5JMSA 4TL0A 4O96A 3TXOA 1UNHA 1UKHA 4UWCA 4AAYA 2W17A 2WQNA 4XCUA 4QYEA 4X3FA 2QKWB 3FDNA 4X21A 4DTBA 2GNLA 3G9NA 5DVRA 5AUWA 5LARA 4FV9A 5BMSA 1K2PA 4PP7A 2P2IA 4NFNA 3AG9A 4R5YA 4NM3A 2X9EA 3GT8A 3BI6A 4FSQA 4R7IA 5HO6A 4F0GA 5I3OA 2KULA 1YXUA 4YNEA 3V5QA 2WTVA 4AXCA 2JGZA 2ZJWA 2W1HA 3EN5A 2XK8A 5HX8A 4CG8A 5FEEA 4XP3A 3NYNA 2ZMDA 3ZLYA 5DWRA 2QOCA 3OWKA 5LVLA 4H39A 3BBWA 3HLLA 3LFSA 5KNJA 5IA2A 3OFMA 3VS6A 4FEXA 3DJ7A 3L9MA 5AX9A 4KRDA 4AZWA 4G1WA 3DZQA 3DJ5A 2R3HA 4U45A 1BMKA 1PYXA 3ORLA 2IEWA 2XF0A 4DCEA 4IAIA 3V3VA 2GFSA 4LRJA 4FKLA 4LOOA 4FKGA 4XLVA 3BL7A 4G31A 1XMLA 4BCJA 2B9IA 2IVUA 3WYYA 4BIDA 1Q99A 3DTCA 2YJRA 5H8BA 1QPDA 1RE8A 2XIRA 3W32A 2X4FA 4LMUA 4YJVA 4CLJA 3EWHA 3PRIA 2OIBA 4GU6A 4BVUA 3QA8A 4F1OA 4BCIA 3HAVA 4IWDA 5IQFA 2PWLA 2X4ZA 3UC3A 4EOMA 2R3FA 2A2AA 2VTRA 3W2PA 2QR8A 3MB6A 4L00A 4JBVA 3R8UA 4YZDA 4DFNA 3VO3A 1DS5A 4JNWA 1LR4A 1HCLA 2JAVA 2XKFA 4FT0A 4K0YA 4L44A 4XV9A 2GQRA 2PU8A 3ZONA 1W8CA 2DYLA 2G01A 4AGUA 3WILA 5BUIA 5KMMA 1PRYA 4L42A 3LQ3A 3ZOSA 2BZKB 2I6LA 4R8QA 4O7RA 4V0GB 5HU9A 4HZSA 4PPCA 3VN9A 2Q0BA 4NT4A 5HO7A 3OCGA 1OGYA 1IRKA 3Q52A 4RIYA 5HLPA 4DGNA 4MH7A 3UE4A 3CQUA 4DT8A 2Y4PA 5AMNA 1H0VA 4AA0A 5EQYA 4LV7A 1BL7A 4MTAA 4YU2A 5JSMA 2GHMA 5IDPA 3G6HA 5FGKA 4AFEA 4WHZA 4XG2A 3NUAA 5BYZA 4R7HA 4HYHA 2PVLA 3HV4A 4KINA 2PL0A 2A27A 4FTTA 4IQ6A 5ACBC 3VQUA 5ANIA 4EUTA 2Z7LA 3NPCA 3QTZA 3ZZWA 5CQWA 1OPJA 1VJYA 3KULA 4ANBA 4C38A 4CFMA 2X8IA 5E4HA 1JKTA 2GNIA 1R39A 5KMJA 2ITVA 3F69A 5L6OA 2F9GA 4PPAA 1E1VA 2PMLX 2UZBA 3AC8A 4CV8A 3ZRMA 5IDNA 3UYSA 2CPKE 3ORIA 4A7CA 2VO0A 2Y8OA 2WMTA 2Y0AA 3VUDA 4JG8A 3VBYA 5IMXA 3R8ZA 4OAUC 5LJJA 3FC1X 4F09A 1WBNA 4F9BA 1IAHA 2XEZA 1PXLA 4LFIA 1H26A 3JY9A 3C4ZA 3Q4UA 1XH9A 2PE2A 3ZEPA 5FD2A 2OF4A 1Q61A 4LDTA 2J0LA 5HKMA 4DF3A 2WU7A 2UZOA 1ZRZA 3I60A 1IA8A 3DNEA 3LM5A 5D1JA 5FBOA 4ANMA 5KHXA 4BGQA 3HP5A 2QVSE 2WMVA 3UOLA 1YW2A 4GG5A 4KKEA 2QU5A 5I9UA 3VUKA 3MVMA 3PXFA 4O27B 3EQBA 4OW8A 3FMNA 4QYFA 4B8LA 3O71A 4EOIA 2XCKA 4R1YA 1G8SA 1XR1A 5HNIX 1Q3DA 2W0JA 2YIWA 4R7BA 4YSMA 3TV7A 3MH1A 3I5NA 3H9RA 1JWHA 3LAUA 5GZ9A 5CF5A 3QX2A 4YPDA 2C3LA 2QURA 4IM3A 2RSVA 2VU3A 2WMXA 4UEUA 3EB0A 3GP0A 3PPKA 3QTXA 2EXCX 4Y5HA 5CENA 3LXLA 4YJOA 2PK9A 4OTGA 3ATSA 2UZTA 2PZ5A 3GU8A 5AX3A 3P5JC 1JSTA 3IGGA 2OJ9A 5M4UA 1MQBA 3CEKA 3OWJA 3MFTA 2W1EA 4ARKA 4BCMA 2W4JA 2R0UA 1FGKA 5JKGA 3CP9A 2B9HA 4P90A 3V5WA 1YWVA 2JDVA 4AQCA 4HOKA 5EW9A 5ICPA 5IISA 4DHJA 2WIHA 5JT2A 4E5WA 3TMOA 4B6LA 1GZNA 2W9FB 4FEQA 3LXNA 3RNYA 3TCPA 3GXLA 3NDMA 4ALUA 4FZDB 4F7JA 4NW6A 5CYIA 4FSNA 4OTPA 5C8MA 3EKNA 3PXKA 5HQ0A 4ANNA 4FG9A 4XBUA 3DBCA 3BEAA 2EXEA 3VS0A 5A46A 5IA0A 3VVHA 4EWHA 4NJDA 4EK5A 5A6OA 4FBXA 1M17A 3QGWA 4CXAA 1DI9A 2PUNA 4KA3A 4DEGA 4GVAA 4JRNA 2W99B 4CFUA 5HTBA 4XNEA 5AV3A 5AAFA 1ZY4A 4S30A 3RM6A 4ANLA 4BDHA 4C4EA 3BLHA 3COKA 4XHKB 5KMIA 2J0MB 1YXTA 2X1NA 4FKQA 3SRVA 4BDKA 4DFBA 4X2FA 2X0PA 1ZMUA 5CF4A 2V22A 3OT8A 2W1FA 5AP0A 3R9HA 3MW1A 3SAYA 4DGGA 4IFGA 4G5JA 3HV3A 4UWYA 3ZO4A 4BDDA 1GIJA 3BHHA 5A4EA 4EOQA 1PHKA 4O4CA 4AA5A 4EOSA 3LQ8A 2ZFYA 4QRCA 3SOAA 4FKRA 3DKGA 3PJ8A 5DT4A 5TF9A 3UDBA 3QLFA 3RNIA 5AFVA 3KXGA 3R8MA 5HCYA 2IG7A 3DXNA 3IW8A 2HENA 3NMUF 3TZ9A 4QTEA 3ZFXA 4QP6A 3KXMA 3TDWA 4UV0A 4G3FA 3QRTA 5HTCA 2C69A 2F49A 2BKZA 1UWJA 2OXDA 4O4EA 5T68A 3Q53A 5CU2A 3FWQA 5HG8A 4FOCA 4CFVA 4IX5A 4AXDA 3ODYX 4FV0A 1A48A 1DI8A 2W9ZB 3OC1A 4BF2A 5IEVA 4BDGA 2QLUA 3F2AA 3ANRA 4W8EA 3VW8A 4U8ZA 4DTKA 1G5SA 2WMSA 4P5QA 2Y6MA 4AN2A 2NNWB 2EXMA 3FSKA 4QOXA 2VNWA 4EH6A 3B2TA 2R3QA 3GB2A 3NW5A 4NL0A 1B6CB 5EQEA 3R83A 4F08A 2J50A 4RZWA 3GCPA 3KKVA 5J5TA 4CMTA 3PWYA 3BQRA 2J7TA 4RQKA 4F64A 5ITAA 3UDZA 3GCUA 5EYDA 4MXAA 5CSPA 1H1SA 2QOBA 3ENHA 4YTCA 3DB6A 3SKCA 4AT3A 3OW4A 3NUNA 4B4LA 2W1DA 3TTIA 2UZEA 2UW4A 3ZUTA 2QO7A 4EH3A 3TDVA 1WBPA 2WTKB 4RA5A 1KUTA 4CZTA 3NAYA 3OF0A 1KOAA 3PJ1A 3R00A 4YC8A 5F20A 4PUZA 5DGZA 3VBWA 3ZXTA 2A1AB 2BTSA 3PVWA 2WELA 3ULZA 3UZPA 2B7AA 4GKIA 4ERKA 3MN3A 2YN8A 2UZNA 2HY0A 4E4MA 4KIKB 3RMFA 3R22A 4RIWA 2WQEA 5H8GA 4JG7A 4R6VA 4WNOA 5AR5A 3DY7A 3TJDA 4Y95A 3OBGA 3O7LB 5FP6A 3W2OA 2QOFA 1J91A 2W1IA 3M11A 3PJ2A 2RFEA 4O91A 2CNVA 3VBVA 4FR4A 3WF7A 2X0OA 4A9RA 1YOJA 5LVPA 3PP1A 3W2CA 4ZY4A 3VIDA 1FVVA 2ERZE 4ZZMA 4XV3A 3QFVA 2QHNA 2WTDA 3VS5A 4M15A 4PDOA 4DFZE 2VTAA 4DH5A 3NCZA 4P2KA 5EDQA 1YHWA 2GS7A 2W5HA 5JFVA 3MGYA 2YITA 4GK4A 5DPVA 4IAFA 4WNKA 4IHPA 2XIKA 4C34A 4BCHA 4PMTA 5DBXA 3Q2JA 4G3EA 4D2VA 4G6LA 4WBOA 3GUBA 1ZWSA 3A7JA 5FEDA 2OG8A 2PMIA 4NM5A 3FZRA 4PL4A 4AXEA 1PYEA 3QHRA 1RW8A 2Y4IB 5IUIA 3UIUA 5CAUA 2JKOA 2BZIB 3ZTXA 4BDAA 3NW7A 4GVJA 4GFGA 1XBBA 4DEEA 1ST0A 2JBPA 2XARA 5EOBA 5TT7A 3DPKA 3ZLSA 3VC4A 3GBZA 2H9VA 1Y57A 3FZOA 3W2QA 3WF6A 5M09A 3P7BA 5AP1A 3NR9A 4RVLA 3UVQA 1PXPA 3FPMA 4HNFA 5C9CA 4EK6A 4FSWA 4E3CA 3IKAA 5IUHA 2IW9A 1JSVA 4ZSEA 2VGPA 3E7VA 2YERA 2C5OA 2BHEA 2WTKC 4FIJA 3R04A 3DLZA 4O83A 2ZDTA 4O38A 2PE1A 4IDVA 3C5IA 5F95A 3MBLA 3U87A 4HYUA 5LVOA 4ZMEA 4IVCA 4TY1A 4FJVA 4I24A 4Z7GA 3GCSA 2WMAA 3GU6A 4C57A 1A06A 3JY0A 5EDPA 3UIBA 3ZO2A 1KE5A 4XG8A 5AV0A 5HVYA 5C8NA 4USFA 4YHJA 1W2FA 3FHRA 1YDTE 4YP8A 4RJ8A 5CY3A 2C6TA 2F7EE 4G6NA 5E90A 5DN3A 2V62A 4EZ7A 2A4LA 5M56A 3HGKA 3D15A 4FL1A 4WKQA 1PMVA 4JG6A 2BZJA 2QO9A 2XNMA 4PNIA 2XM9A 3PUPA 4RFZA 4W4VA 4QTAA 3KRWA 4XP0A 4G16A 4ACGA 3V6RA 2XJ0A 4AA4A 3FQHA 2HCKA 4BB4A 4FV6A 4DGMA 3B2WA 4CTBA 4HYSA 3IS5A 4NH1A 3AGLA 1ZYCA 3SLSA 3DGKA 4MXXA 4RFYA 3ENMA 3C1XA 4GK2A 3NRMA 4UXLA 4E26A 5A14A 3S3IA 3QD0A 3V5TA 4ZJVA 3BRBA 2J0IA 2B55A 2FO0A 4O1OA 4IC8A 3BX5A 1NXKA 1PKGA 4I5CA 5FBNC 2UZVA 4ZP5A 4ANOA 2CLQA 2YM3A 2XM8A 3Q9ZA 5KHWA 1RDQE 2Z7QA 3RPRA 4AOJA