2GNGA

Protein kinase a fivefold mutant model of rho-kinase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
340
structure length
338
Chain Sequence
EQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTIGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYMPGGDMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIKVADFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Structural analysis of protein kinase A mutants with Rho-kinase inhibitor specificity
pubmed doi rcsb
source organism Bos taurus
total genus 108
structure length 338
sequence length 340
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2006-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2gngA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2gngA02
5E90A 3LPBA 4EH5A 3OC1A 5HD7A 4UWBA 1Q8YA 2HY81 2XS0A 5BUIA 3SOAA 3C4XA 4AGCA 2RG6A 1XR1A 2XIRA 4ERWA 3DNEA 3RGFA 2RFSA 3QRJA 3S1HA 3OTUA 3PZEA 4PF4A 5TF9A 4DEDA 1S9IA 1OL2A 3PG3A 2RFEA 3MVLA 3GU4A 3GCQA 4ZTHA 4RQVA 5E8VA 3QXOA 3IW4A 2P2HA 4M13A 4MK0A 3Q3BA 2OICA 5CSVA 4DLIA 1Q41A 2H34A 1VEBA 5J7HA 2PHKA 4AW0A 4ZAUA 1H1WA 2I7QA 2WB8A 4RA5A 4D0WA 3UG2A 5JZJA 4RJ7A 2GPHA 3R9OA 4XCUA 3R7VA 3O8UA 4M3QA 2PMOX 4FT0A 2R3NA 4PMSA 1GIJA 3O17A 1PRYA 3D15A 4FL1A 2BAQA 3SG9A 3C50A 3FKLA 5DWRA 3S2PA 4XRLA 3PSCA 4YLLA 4L7SA 3BU6A 4HVGA 3QLFA 1ZMUA 5LARA 4AQCA 1Z9XA 2HENA 3E64A 3NCGA 4BZDA 4EK4A 2W5HA 4M8TA 4EKKA 1PMUA 3GU7A 1H27A 2WGJA 3WYYA 4AGUA 3FYJX 2HZ4A 2GNFA 3QA8A 4K0YA 1J3HA 1Q5KA 3FV8A 3NGAA 4M67A 3W2SA 4U8ZA 3ZSGA 1GZKA 4BDAA 3FXWA 1MRVA 1GZOA 5DR2A 4YJOA 3FMKA 3R8ZA 4R77A 4FT5A 2OH0E 4QYFA 2RFNA 3OWKA 3WILA 3C9WA 1PKDA 1H00A 3PE2A 3W8LA 4L3LA 4ANNA 3KXXA 4BCNA 2X7OA 2VX1A 3G33A 3JVRA 3ZC6A 3IGGA 4ZS4A 4ZXTA 4LYNA 3C13A 2BRHA 3BZ3A 4CLJA 4HVSA 3F2AA 3GU8A 4GIIA 1JSTA 3QZGA 2ERKA 4WSQA 4CCUA 4EZ5A 3E3BX 4O21A 3RZFA 4NCTA 2HWPA 3B2TA 2XIKA 3FLNC 4BCPA 4ZTMA 5J5TA 2OI4X 3C4ZA 3DLZA 4G6OA 4RFMA 4GYGA 2XNPA 4GFOA 3G90X 3ZSIA 3IK3A 4DEBA 4R8QA 4BB4A 5M56A 3UOJA 2OU7A 2PZIA 4KRCA 2C3IB 5E1SA 1MRYA 2WD1A 3RPYA 5GZ9A 4CV9A 5HG9A 4DH5A 1J7UA 3NIZA 4IX6A 2F49A 2QOLA 3UVQA 4EK3A 3BYOA 5HNIX 4JBVA 5BVEA 3F66A 2JDOA 3UP7A 4O7YA 4F0FA 2OFUA 3L8SA 3PY0A 2J6MA 4QP8A 3ANQA 2J90A 3OEZA 4EORA 4EOPA 4EWHA 2X39A 2X4FA 3K3JA 2BIYA 3HNGA 4RA4A 5J5SA 4RMZA 2W1EA 3MB7A 3TIYA 3F2NA 2QOCA 3ZUVA 4N0SA 3ZFYA 4ITJA 2YWVA 4CTCA 1U5QA 3I60A 2UVXA 3NYXA 5BUEA 4FV3A 4BTJA 4RIWA 3CXWA 2JKQA 5FD2A 1UU9A 3N4VA 2XH5A 1F5QA 2C69A 3NNWA 3W10A 3EN7A 3W2OA 5E4HA 5HBHA 3E3PA 5EYCA 2CN8A 3CLYA 3O8PA 5ANOA 4PDYA 4QTCA 4FEUA 5EW9A 3U9NA 3W2PA 4AAAA 5JGDA 4MQ2A 5K4JA 5TKDA 1Z5MA 2XK9A 3LHJA 3Q6UA 3R2YA 4IJ9A 3ZLXA 4DC2A 4TXCA 2GHMA 4YJRA 4X2KA 3EB0A 4Z3VA 2HY0A 4CFWA 4O81A 4CT1A 5DE2A 2BFXA 1LEZA 5HBJA 4O82A 4AN2A 2WXVA 1YXUA 4L00A 4LM5A 3K5UA 1OL7A 3ZDIA 3HA6A 4DFNA 3FWQA 3DXQA 2W4OA 5BYZA 5FXRA 4OBQA 5HLPA 2C3LA 2IWIA 4S34A 2P33A 2R9SA 3SAYA 5HIBA 4X7QA 4C4IA 2ESMA 5AP0A 2XM9A 5FXQA 3N51A 4FGRA 5EQYA 3NNUA 1H25A 2WMTA 4GG5A 4ALUA 5BVOA 2C5OA 3EZVA 2PE0A 5HZNA 2RIOA 4R3PA 4CFFA 4EUUA 3JY9A 4XV9A 4ALVA 3PDTA 2JC6A 3UO5A 5CAOA 2VZ6A 2FB8A 5D1JA 1Q8WA 4XV2A 3VS7A 4UYNA 5I3RA 4NL0A 5C4KA 2BZIB 3UC4A 3ZCLA 4AG8A 4TYIA 1CKJA 4UZHA 5IUIA 5H8GA 5EHOA 4BBEA 4DGMA 3R7OA 3ITZA 1CM8A 2QOIA 4OBOA 2PK9A 2C6TA 2ZVAA 3EQRA 1KSWA 4IAZA 2QOOA 3EZRA 4HCTA 3EHAA 4KIKA 5C9CA 3ZTXA 4FV0A 4A9YA 1DS5A 4UY9A 5E8XA 4I21A 3FHIA 3HRBA 3KVXA 3AC2A 3G0EA 4PMTA 5EHYA 5K3YA 2HCKA 3DFAA 3FLZA 2FGIA 4EZ7A 4QMQA 3T3UA 1OI9A 1FMOE 2EUFB 1OGUA 3NSZA 1K2PA 4RFYA 3H30A 3V5TA 3ATSA 3F3TA 4EOOA 3GOKA 3FJQE 3TJDA 4CZTA 2PVNA 4FIHA 1FGIA 2FUMA 3VN9A 2QG7A 3SRVB 3F3VA 4YPDA 2XRWA 4BCGA 3R71A 3JR1A 5IMEA 3F9NA 3Q4UA 2OO8X 4FSRA 3LAUA 3QD0A 2X81A 5CAUA 3FI8A 2C1BA 2ETRA 2F57A 3BWJA 4U9AA 3MBLA 3SVVA 1MQBA 3QTXA 4X2JA 4AZFA 4NW5A 4PTEA 5DEWA 3AT2A 4RIXA 3OXTA 3KXHA 3R1YA 4PPAA 1VJYA 4JVGA 1IEPA 2W1ZA 4QMZA 5BUJA 2GU8A 4HJOA 2PYWA 4YJSA 3VQUA 2I0VA 3I5ZA 4I0TA 4M12A 2PZ5A 5D7VA 3HMMA 4V0GA 4P2KA 5EI2A 3U4UA 4ZSGA 4F4PA 3Q4ZA 3NUYA 1OUKA 3BEGA 4MKCA 3UZPA 4YGAA 3ZFMA 4BDBA 4NIFA 2PVFA 3ENHA 4A4LA 4AZSA 1KE9A 2X6DA 4L01A 3OWJA 2R5TA 3R7YA 1H28A 4I20A 2O65A 3MB6A 2C5YA 3CJFA 3AG9A 3QL8A 3ORPA 3SV0A 3AGMA 5HQ0A 4E7WA 3ZYAA 2V7OA 4IANA 4L46A 4F09A 3VJNA 5HBEA 2FA2A 4EK8A 2GHLA 2CDZA 3DA6A 2R0UA 3GNIB 3TTIA 2OGVA 3PUPA 3RM6A 2RG5A 3OMVA 3DBCA 3KL8A 1R39A 3BYSA 4RX7A 4FZ6A 4K18A 1OPKA 2H96A 3FLWA 3K3IA 4F7NA 4OT5A 5KMIA 3TUBA 4RLKA 3HYHA 4FEXA 4Y8DA 2G2HA 2X2KA 2W1GA 3EKNA 2BDJA 4IQ6A 4GUBA 3C5IA 2C6EA 5GJDA 3HV7A 3GC9A 1ZY5A 5CQUA 4BTFA 4DTAA 4IHPA 4WNOA 5HI2A 3UMWA 2W0JA 4BBFA 2CMWA 4FKRA 2GSFA 5FG8A 5A6NA 3CD8A 5A46A 4C4JA 4KB8A 4YSMA 1O6LA 5HGIA 4XP3A 5IDPA 2JEDA 2VX3A 2JKMA 2XKDA 4W9WA 3P86A 1O9UA 4BZNA 1SNXA 2XNGA 4F6WA 1W98A 3UC3A 4F9YA 4AGWA 5TOZA 3NS9A 4ASZA 2VWVA 3LQ5A 3QTUA 5I9ZA 4FSMA 4IVAA 3GU5A 3MPMA 2WMXA 3I4BA 3FZ1A 1PXLA 4QYYA 3G6GA 3COMA 4IB3A 4U42A 5CAQA 3CGFA 5AP6A 4P7EA 1PHKA 2QU5A 4FF8A 4IFCA 4HYHA 2B9JA 3PWDA 4GH2A 4BGHA 1H4LA 3HMPA 4YTFA 2XF0A 3ORTA 2ZDUA 5DRDA 4BCFA 4LV5A 3MY0A 4O0RA 4OTHA 3REPA 5BVNA 3RWQA 3ELJA 5AM6A 3RAKA 4HVDA 4MXXA 1VYWA 2PE1A 3NIEA 3ZBXA 3R9RA 3O8TA 3TI1A 1Y91A 3OHTA 3UO6A 3QD2B 3ETAA 2X2LA 5HVJA 5EYMA 4IEBA 1P14A 3FMHA 4QTEA 4IE9A 4LRMA 5AX3A 3KA0A 4R78A 2QO9A 2YIRA 3FXXA 1M2RA 2BCJA 1JKKA 1NY3A 3L9NA 4K33A 4CYJA 4A9SA 1G8SA 3FUPA 5M07A 4UXQA 2PUNA 2ZB0A 1WFCA 3OZ6A 3PVWA 3IDCA 3WZJA 3BV2A 3EJ1A 5CSXA 3BYUA 3KCKA 3KQ7A 5AR5A 3SD0A 2VX0A 1PXJA 3DK6A 3OXIA 4D9TA 4FTTA 2A19B 2JIVA 5CT0A 4YTHA 2PSQA 3CTHA 4MH7A 5L8LA 3VUKA 4DTBA 4W8DA 3DBDA 3EQPA 3QX2A 4FSQA 5D10A 4C2WA 2W9FB 3K2LA 2E9PA 4MWIA 2IJMA 1H8FA 3BKBA 4NM0A 3SG8A 4F1MA 3ORNA 4YHJA 4Y95A 4BCQA 4BI0A 4DG2E 2WTKC 2ACXA 3A8XA 3FQSA 4L9IA 2OKRA 5H8EA 4A9RA 1PF8A 3E8NA 4DTKA 4C0TA 4TY1A 4EOLA 3QAME 4YZCA 3FY0A 3AGLA 2ZV2A 4Z7GA 2HWOA 4DFXE 1BL7A 1XH7A 3Q5ZA 3KXGA 3O71A 4XH6A 5L6OA 3EIDA 3FDNA 2YM5A 3COHA 5LMKA 3V5WA 4EK6A 3ZXZA 4GV1A 3TZ7A 3ZLWA 3ZEWA 4DGGA 3MS9A 3HMIA 3LXLA 4LL5A 5J87A 1UKIA 1XH5A 3DBFA 4XBRA 3BHTA 1UVRA 4FSNA 1YXTA 1IG1A 5J7BA 2HXQA 3W1FA 1BMKA 1Q62A 4IAAA 4JQEA 4TWCA 3UYTA 3OCTA 5ETAA 4JDIA 2JFMA 2FSTX 1YVJA 5ITAA 4H58A 4EOKA 4IDVA 4UXLA 3DB6A 4HCVA 5B7VA 3MFSA 4YZDA 4BCIA 3D9VA 2CNVA 2FSOX 4IX3A 2WMQA 3TIZA 3FL5A 2WKMA 3EH9A 3ORXA 2FH9A 3PSDA 5IA5A 1JVPP 3ZSHA 1REKA 3D83A 4KBCA 3QKMA 4QD6A 2OFVA 4AF3A 5E8WA 5E91A 2ZOQA 2NP8A 5BVWA 4QP2A 2XNNA 5EM7A 3G9LX 3RNIA 4ZTNA 3MH2A 2C5NA 3H10A 5KO1A 2P0CA 1ZLTA 1Y8YA 5HEZA 4HPTE 4OTQA 2R2PA 3RHXA 5HE1A 2W1IA 4HYUA 4YPSA 5GJFA 4C02A 5JRQA 3PVBA 3I6UA 4KS8A 2X8EA 5LMAA 3PIXA 4GT5A 4A4XA 3CR0A 1GIIA 3M1SA 4NH1A 3IW6A 3OBGA 3GQLA 2XJ2A 3O96A 3TM0A 1XHAA 2R3MA 3GFWA 4ZS0A 3Q4TA 3ANRA 2BR1A 3DK7A 4WG4A 4W9XA 4X3FC 3LFDA 3RHKA 4EJNA 3P7CA 4U5JA 4I1ZA 3TACA 5HG7A 4EQUA 4E73A 3H9FA 1OZ1A 4O7SA 5EM6A 1E9HA 3NAXA 3KCFA 3WF8A 2CKPA 4OTDA 5DT3A 4RIYB 5CS6A 4C59A 3FPQA 1OBGA 4GS6A 5K9IA 3TV4A 1XBCA 2G1TA 2W1FA 4IZYA 4TWNA 5DH3A 5AP7A 3JPVA 4OTRA 3FMLA 2DWBA 4C4HA 2QHNA 1HCKA 3LCOA 3R8PA 3L8XA 4GRBA 2O63A 4FTNA 2PVKA 5B2LA 4Q9ZA 1G3NA 4YLKA 4ALWA 4QP1A 2PZPA 3ZDUA 4AT5A 5AAGA 5KMOA 3BELA 3GP0A 4CMOA 4EONA 5IQIA 4KNBA 4I5MA 4GU9A 4YUQA 2OJJA 2RFDA 2B7AA 3RJCA 4WSYA 5EK7A 5FP5A 3R21A 5LOHA 3PP1A 4D2WA 4PDSA 2BPMA 2BZKB 2B0QA 3LVPA 2YM8A 5JSMA 3CQWA 3TTJA 3II5A 2X4ZA 2CGVA 3CCNA 5L2WA 3RKBA 1IA8A 4HZRA 4RBLA 3VHKA 2KTYA 2YAKA 1LR4A 3JS2A 4TYEA 2W1CA 4LGDA 2BHEA 1OPLA 4NM3A 3RWPA 4FSWA 4EOSA 3Q6WA 5JMSA 3VF8A 4MTAA 3F7WA 4U45A 1KUTA 4DG0E 2PTKA 4DA5A 4RGJA 3EQBA 4DFZE 5L6WL 4DFYA 3SRVA 2VWUA 5IA4A 1R0PA 2WU7A 5EDPA 3EOCA 4RZWA 1T46A 2FYSA 4KWPA 1WVYA 2C30A 4YZBA 1YWNA 4ASEA 3O7LB 5C26A 3PRIA 1X8BA 3R1SA 4GK3A 3UVPA 2B1PA 4FOBA 4Y46A 3HVCA 4IVBA 4J98A 4KIKB 5M4CA 5C1QB 5FRIA 1YDTE 4YNOA 4FYOA 1KOBA 2R3FA 4M7IA 4O0XA 1HOWA 4OTPA 4PQNA 1Y57A 1H01A 3OUKA 3D4QA 2C0IA 4CMUA 2G2FA 4Z7HA 1IR3A 1FMKA 5IG1A 4I3ZA 5I5ZA 4GT3A 5FBOA 1NW1A 2C0OA 1ZYSA 2ITQA 4I4FA 2G01A 4BIEA 4YJUA 1PJKA 3DKFA 4RVLA 4S32A 3WZEA 4FV2A 4A9UA 3RNYA 4BCHA 2Z60A 4DH7A 2BKKA 4B8LA 3BRBA 2WTJA 4JJRA 4TWPA 2YIQA 3A60A 3U4WA 1WBVA 5J95A 5DRBA 3QC4A 4G34A 4QP9A 3Q9WA 4P5ZA 4S2ZA 3D94A 5DIAA 2XIXA 3SXRA 4F6UA 3DDPA 1JPAA 2V62A 2XYUA 4I94A 4FTLA 3QGWA 4RPVA 4BDIA 3R8UA 3TT0A 4NK9A 4F63A 3GC0A 4LOOA 5A4TA 4GKIA 1REJA 1CTPE 5AV3A 3CGOA 1ATPE 3D5VA 4AT4A 3QZIA 4JL9A 4ERKA 4O83A 4E8AA 3WIGA 3VNTA 4AA4A 2VWYA 3K54A 4LRJA 2YA9A 3WZUA 2F4JA 3I79A 4JS8A 3CY2A 1RQQA 4XP0A 4ID7A 3MA3A 3IG7A 3NUXA 2UZLA 2XKCA 4FA2A 3T9TA 1YXXA 3JXWA 2YCFA 1GAGA 2V7AA 1WVWA 1M14A 5CVHA 3TL8A 4AFJA 1XQZA 2VTOA 4DINA 4QQTA 4RJ4A 5M51A 5IF1A 1TKIA 3JUHA 2EU9A 3QU0A 3UTOA 1YHSA 4TRLA 2PMLX 2E9UA 3PVUA 2WQEA 3QKLA 4MX9A 1GIHA 3SHEA 2A2AA 3W18A 5KMMA 1ZOHA 2CKOA 5CAVA 1PYXA 4CNHA 3P1AA 3ZUUA 3A4OX 3MSSA 3QTRA 4O7VA 4MXAA 4L67A 1OKZA 4RWJA 5EG3A 3R9NA 4EOJA 2JIIA 3V8SA 1URWA 2UZBA 4M0YA 4XLVA 2W4KA 5T6KA 4XRJA 5LCKA 3BLRA 2AC3A 4HGTA 5TR6A 3W2CA 3P5KA 3Q9ZA 3RBWA 3CPCA 3RM7A 2YM3A 3CD3A 2P2IA 1PXKA 1OIUA 4WG3A 3FPMA 2OG8A 4IIRA 4QMXA 4BY9E 4XG6A 4C3RA 2UVYA 4BDGA 5FTQA 5D9HA 4EH7A 3MH1A 4PP9A 2PULA 3SW7A 2XK3A 2C5XA 2OJGA 3VUTA 2HAKA 4HZSA 4C2VA 2QLUA 5AX9A 1UU7A 5DBXA 4EH9A 2X0GA 4FR4A 4IDTA 4FKQA 4XV3A 2ZM3A 2Y6MA 5FDXA 2XM8A 3BI6A 4BN1A 4LG4A 2VTNA 3TNQB 5EM5A 4BHZA 5IMXA 4E26A 4XYFA 5L8JA 5JH6A 4J8NA 2OJFE 4TTHB 3OXZA 5HIDA 2YJRA 4KAOA 5CALA 5JQ8A 2BTRA 2Y4PA 3F5PA 3FQHA 1SNUA 3R30A 4MYGA 5ANEA 4RRVA 3PYYA 3VUGA 3R2BA 3E92A 4RWLA 2CNUA 5CANA 1MQ4A 1ZAOA 3DBQA 4J97A 4XMOA 4BCKA 3BU3A 5ETIA 3NYOA 4S33A 4MXOA 2XNMA 3NR9A 2WMUA 2EXMA 4IM2A 2XJ0A 4U97A 4QOXA 4X6RA 2NO3A 2XEYA 5CF5A 1P4FA 5CSPA 4MVFA 2GDOA 1JLUE 4O7RA 4FSUA 3R1QA 4FKTA 3ZFXA 3FI2A 3GFEA 3HDNA 4FTUA 4X3FA 3R7IA 4ACMA 4ZSJA 4C38A 5CQWA 1FGKA 1U46A 3QQHA 4QMSA 4RIOA 4ZIMA 4DITA 4UMPA 3A2CA 2PUUA 1IAJA 4LUEA 5AV2A 4E4LA 1PMEA 2X7GA 4O7NA 2XNEA 3C7QA 4NKSA 4MBJA 4Y83A 3UJGA 2WFYA 1A48A 4EEVA 5AM7A 2XBJA 1YOMA 4AOIA 2VRXA 2J51A 4E4NA 2HK5A 2HELA 4RSSA 4AZTA 3HV6A 4PX6A 2WZJA 1GOLA 4CKJA 1HCLA 4RC2A 3ZM9A 1L3RE 4H39A 1YI6A 3WF9A 3OWPA 4E3CA 4GYIA 3CE3A 3MGYA 1OVEA 3GCUA 4HGEA 4GL9A 5IISA 3QTZA 5JFXA 2I0HA 2Z7QA 5AIRA 4IJPA 3TZMA 4PL4A 3EKKA 4D5KA 1SVEA 3GUBA 4DEHA 4E6QA 4U79A 3HECA 2ONLC 5F4NA 3S3IA 3Q5IA 2ZAZA 4QP3A 4OTWA 3GT8A 3TCPA 4DEGA 4J99A 3HUCA 2W7XA 3DKOA 4CEGA 1B38A 1VYZA 4UEUA 3VBVA 3B8RA 4QT1A 3EQCA 3UOHA 3ZZWA 4F64A 3SA0A 5IQAA 3QWKA 3VJOA 4BI1A 3VBWA 4U3YA 3PFQA 3I1AA 3Q52A 4AP7A 2PPQA 3EFLA 3NVKI 5HHWA 3Q2MA 3UO4A 4KS7A 4A06A 3MN3A 4R7IA 2ITOA 3NAYA 5AV1A 3NVMB 1O6YA 2VWXA 3I7CA 3A61A 4O96A 3GQIA 2YEXA 2YWPA 4O7LA 3UQFA 4V04A 3MV5A 2V5QA 5HE2A 5HVYA 4AACA 4BDKA 5M4FA 3OF0A 1CSNA 2WHBA 4WNMA 1OL5A 2VAGA 3P78A 3DBEA 3CEKA 4O6LA 3CQUA 4I24A 3MIAA 5CX9A 5EOLA 2VGPA 3KXNA 4LOQA 1CKIA 3KULA 5BVKA 3V6RA 2J5EA 2QHMA 3G2FA 1UNHA 2ITTA 3D7TA 5H9BA 5JEBA 2B4SB 2YCSA 1QMZA 2Y6OA 5EDRA 4USEA 3QRTA 4KKHA 3E88A 4O38A 4YHTA 3VUHA 4QMUA 1V0PA 1IA9A 1J1BA 4FKJA 3UPXA 4BBMA 4RIYA 1B6CB 4AU8A 2E2BA 1JSVA 2UW8A 2WTIA 5AUVA 2YERA 4Y72A 2ITNA 2X9EA 3UG1A 4D4YA 3QQKA 2QVSE 4GVAA 3F3UA 2JFLA 3PA4A 4EH3A 3QTQA 2QO2A 3VVHA 3HKOA 2VTSA 3VS3A 5ANKA 4RT7A 5JT2A 5AUWA 4CD0A 1J1CA 4E4XA 1Q99A 2VU3A 5CENA 5ACBC 2PVLA 3FXZA 3E63A 3P79A 3Q04A 3R6XA 4DFBA 1OIQA 2B9HA 3TG1A 4P5QA 4G5JA 2W5AA 4XG2A 3AC1A 2WO6A 3AC5A 4JRNA 5C27A 2UZEA 3QD4A 2NPQA 4IADA 4IZAA 2PZYA 4EYJA 5IQFA 4C7TA 3R04A 3OVVA 4YR8A 1H1RA 4BKJA 3U9CA 2WTCA 4X3JA 4BCJA 5AFVA 2VTQA 1YOJA 1WAKA 4IBMA 3RCDA 3AD6A 2E9OA 3CIKA 4NM5A 3MVJA 4GG7A 4RJ5A 5AP3A 1XWSA 4ZTRA 4AW1A 3CKXA 4E4MA 4DH3A 1MRUA 1PXMA 5I9UA 3VS2A 4ZJVA 5L2TA 4FKVA 2C6MA 2X6EA 2B53A 1AQ1A 2A1AB 4PPBA 1NVSA 4R1VA 4YC3A 4L53A 4F7LA 4JDHA 3CTQA 3LCKA 3VBYA 2J0MB 2CN5A 2GS6A 5FM3A 5FTOA 3R22A 3AD5A 4IAIA 4CXAA 2Y4IC 4F6SA 4FKGA 5HG8A 4K77A 3V5PA 5CU0A 5KMKA 4EJ7A 4CQEA 4FI1A 2VO7A 3MPTA 4KSPA 2CKQA 4F9CA 1Q61A 2C1AA 4UMUA 1UNGA 3BGPA 4M15A 4RJ6A 4FTAA 3KMUA 5CT7A 2AC5A 4ANBA 3MTFA 4IB1A 4PL5A 1Q8ZA 1YWVA 3R0TA 1JKLA 3RAIA 5FTGA 2PVHA 1PMNA 2Y0AA 4HGSA 2YIYA 3EN4A 3TZ8A 3WI6A 1J7LA 3EN9A 3IPHA 4NYEA 3NYNA 2GNHA 5KKRC 3MFTA 2O2UA 2JBOA 2WU6A 4FNZA 4B4LA 1BX6A 3ALNA 4IB5A 3RPSA 2E9NA 2PL0A 4XOYA 3ID6C 3TXOA 5KNJA 1L8TA 2R3JA 3QX4A 3THBA 3F82A 3MIYA 5CVFA 3LE6A 1H1QA 4O27B 3A7JA 3G51A 4BKYA 2B52A 3KRLA 3NW7A 2QR7A 3NX8A 4AZVA 2HOGA 2Z7SA 5L6PA 4C4GA 3GGFA 4RWKA 1H1SA 1PXPA 2Y7JA 4WD5A 5BNJA 4LFIA 5J9LA 5CY3A 4FG9A 2O0UA 2WTVA 3SOCA 4CQGA 4O7WA 4E5WA 4F65A 1AD5A 4CFXA 2HYYA 3ORZA 2OH4A 3DS6A 5DEYA 4I22A 2IW6A 2QC6A 3VS5A 4YMJA 4PNKA 1FBNA 4KBKA 4ORKA 3RTPA 2XKFA 3L1SA 4FV4A 4PY1A 3DAJA 3O50A 3IONA 4BWPA 4AZWA 2OF2A 4N4SA 3R9DA 3LZBA 5CNNA 3VC4A 3OD6X 2GS7A 2VNYA 2C6IA 1V0BA 5CF8A 3HMOA 3LMIA 1PMVA 3WZDA 1H07A 1YDRE 5J79A 2W96B 3GCVA 2CLQA 3PJ2A 5AUUA 4EBWA 4DGOA 3HDMA 5LVPA 4ACCA 2PE2A 3T9IA 4DHFA 4JG6A 1DAYA 3WBLA 5GIOE 4FEQA 4FKOA 5FDPA 5AP5A 5LXMA 1PYEA 4FVPA 4DH1A 4HCUA 5HOAA 4L3PA 3FKNA 2Q0NA 1URCA 4NM7A 4ZJIA 1V0OA 1DAWA 2AYPA 3MWUA 3COIA 3RZBA 4DEAA 1Y6BA 4FIGA 1GNGA 2QODA 2VTAA 1ZYDA 3LXPA 4O7ZA 3WZKA 4AS0A 4LMUA 3A8WA 4Z9LA 2FSMX 3UYSA 3FZSA 4NJ3A 4YURA 4IWDA 2WTKB 4UALA 2BAKA 2KULA 4DAWA 3QBNA 3S95A 4R3CA 5AR2A 1XH8A 4FKUA 2ONLA 5CEOA 4E6AA 5HTBA 5KCVA 2PMNX 2R7BA 2JIUA 3QQUA 4R7HA 4EH4A 4ZOGA 3DOGA 4IWOA 4C62A 5AA8A 3PIYA 4KSQA 1WVXA 4L3JA 1OL1A 4A9TA 4E5BA 4PMMA 3QALE 4F1OA 4QTAA 4ASXA 4PMPA 3G0FA 5AUTA 4H3QA 5F95A 4QNAA 4I5CA 1YOLA 4JG8A 4MF1A 1ZOEA 4ZTLA 4YNEA 4ZTSA 3BV3A 4FL2A 2PZRA 3V5LA 3DLSA 4C37A 1YHWA 2W99B 1Q3WA 4FE2A 4U7ZA 3GCSA 4FYNA 4YZ9A 1BUHA 3ZEPA 1OBDA 4RQKA 3IDBA 4LQMA 2JKKA 4WUAA 3PIZA 4JBQA 4XBUA 1A9UA 5G6VA 3VW6A 5DR9A 4F9BA 5AUXA 3ALOA 5JGAA 3HGKA 1OL6A 4C4EA 3VAPA 2UZVA 2J4ZA 4FG8A 2IW8A 2IPXA 4FTQA 2YCQA 4B9DA 1WBOA 2QKWB 1YKRA 5ANIA 5FQDC 4EYMA 3QWJA 4AGDA 1G8AA 3DJ7A 5JRSA 1K9AA 3PY3A 1I09A 5AP2A 4NW6A 4GU6A 4YLJA 3SC1A 4F0IA 3SDJA 3V5QA 4YO4A 2GNJA 2Z2WA 4C35A 3BLHA 3QCXA 5TE0A 3HAMA 3GC7A 4FKPA 2XZSA 3ZRMA 4ARKA 2QONA 1KV1A 4J1RA 5HESA 2UW4A 1PKGA 4X2GA 4TW9A 2UVZA 3RPOA 3EWHA 5AP4A 4DT9A 4B99A 5D41A 3QHRA 1O6KA 2UW9A 4W4WA 2BIKB 5GNKA 2GMXA 1G5SA 3VQHA 4F7JA 3E7VA 4J53A 4X3FB 4FV1A 3E7OA 3TV7A 4W4VA 4FV8A 4FTRA 4M69A 3A99A 4XG7A 3UGCA 3UNKA 4FZ7A 3V3VA 2B9FA 3VRYA 4KUJA 4L52A 2Z8CA 3CQEA 5AV0A 3TDVA 5EOBA 4MXCA 3UODA 4CG8A 1R78A 2XK6A 4BIDA 5LJJA 4ZY5A 5AP1A 4I5PA 4AN3A 3EQDA 5CWZA 3NWWA 3OFMA 5AR7A 5AUYA 4W8EA 3W33A 4CRLA 4OUCA 4IZ7A 4Q2AA 3VBTA 4CCBA 3L9LA 5E8SA 3NUNA 1YW2A 1APME 1ZZ2A 3HV4A 4FZDB 4I6HA 4BDJA 3KVWA 2EXEA 4O84A 1WBSA 5EW8A 3BIZA 2ZYBA 3LFEA 5CNOA 3U51A 1RW8A 2OK1A 3QCQA 3NUSA 3QZHA 4F99A 2R3HA 5CU3A 3IW8A 4CLIA 4QMYA 2JDVA 5HX6A 3QLGA 3SGCA 4O2ZA 2GNIA 4ZJJA 2J50A 3AT3A 4RVKA 1S9JA 4XG9A 3BHVA 1QPCA 5E8TA 5I9XA 1NVQA 2CCHA 2B54A 2IZSA 2NRUA 5H3QA 2XUUA 5BYLA 4G17A 4K1BA 4F9AA 3W32A 5CZIA 3RK5A 3QC9A 3PP0A 4IVCA 5BYYA 1QPDA 3TZ9A 4Q5HA 4JX3A 3ZXTA 3UE4A 1ZYLA 4D2SA 5E7RA 2XNOA 4AUAA 4D1ZA 2ZV7A 4O0SA 4GEOA 1BKXA 2J2IB 3ACKA 2FVDA 2OXXA 3NUAA 1I44A 3FHRA 2OXYA 5I0BA 5A54A 4FMQA 2VWWA 2YZLA 4FVRA 2X2MA 4JQ7A 1H1PA 2WQOA 3OROA 4RVMA 4HW7A 4Y85A 5E92A 1JOWB 2CGXA 5AA9A 4L68A 2VWIA 2ITXA 2IVUA 4I0RA 4NEUA 1KOAA 5AJQA 4BRXA 4FEVA 3C4EA 4O6EA 1XJDA 2UW7A 4QRCA 2YDJA 4MD9E 3UVRA 2R3QA 3KULB 1ZXEA 1ZZLA 4IX4A 2OSCA 5CASA 2QURA 3HAVA 3D7TB 4JBOA 3G5DA 3ROYA 1M7QA 2XYNA 1SYKA 2WMRA 2YCRA 3GENA 4XHKB 1UV5A 4O7TA 2ETKA 1F3MC 3LM0A 2G15A 2HIWA 2VTRA 4I6FA 3WF6A 4BDCA 3D5WA 2W9ZB 3EQGA 2UZWE 3U55A 3NNXA 1XH9A 1YWRA 2WEIA 3DZQA 3OG7A 4Y5HA 2HW7A 2X8DA 3LFNA 4TNDA 4CZYB 3RK7A 2BROA 3UZRA 3F69A 5EH0A 3L8VA 3ZZEA 4IAFA 4MD8E 2QR8A 1RE8A 1W8CA 3PJ8A 2WMBA 4MBLA 5I9WA 3KMMA 5BVDA 2WEVA 5KUPA 3MY1A 2WOTA 5HORA 3HLLA 4PDPA 2IVTA 2IVSA 2YZAA 3BBWA 4FL3A 3N9XA 3P08A 2GS2A 3MPAA 4ZZMA 4GCJA 2ZM4A 1OPJA 3P7AA 2IZUA 3BYVA 3TN8A 4ANLA 4CFMA 3I5NA 4JAJA 4Q5EA 1OKVA 1CMKE 3E62A 2A0CX 4D55A 3UOKA 3UPZA 1KWPA 2A4LA 1Z57A 4O22A 4K9YA 1ZYCA 1PXIA 2IZTA 2GCDA 2PVJA 5LWMA 2VV9A 3LW0A 3QF9A 5AEPA 4OT6A 4AX8A 2YM6A 5C8NA 4ZSLA 4RJ3A 4IWPA 4IACA 5AMNA 4GJ2A 5F20A 3DFCB 3PE1A 2PVRA 4H05A 3R8MA 4M68A 2EVAA 4CZUA 1VR2A 3G6HA 4X0MA 4G3DA 4L42A 2B55A 4C8BA 4K11A 5JZNA 2YAAA 2P55A 3CKWA 3CP9A 4QMTA 3RAWA 3TKIA 4QTBA 3LKMA 2VD5A 4ZSEA 2UZTA 4D58A 4J7BA 5AV4A 4ZMFA 2W5BA 4MWHA 2CGUA 2C68A 3QYWA 5EI8A 4NKAA 4X2FA 4XS2A 1J91A 5FLFA 3ZO4A 2R7IA 4RZVA 4EH8A 5IQGA 1OKWA 3DTCA 4EC9A 4FTMA 4PTGA 2IVVA 3DJ6A 5FUTA 2R0IA 2QOQA 3D14A 3OW3A 4MNEA 4OW8A 4YBKA 3MESA 5LCJA 4FV6A 4FKWA 4AE6A 3PWYA 4G6LA 3U6HA 3Q2JA 2XJ1A 3DV3A 4WNPA 1OM1A 4FTOA 4PDOA 1WBWA 1U59A 5HIEA 4WUNA 2YHVA 5CF6A 4BZOA 4S30A 3PG1A 3Q96A 2BDFA 2UUEA 4CTBA 3H0ZA 5J1WA 2IG7A 3NZ0A 2OBJA 2CLXA 2WMAA 4L44A 4DGNA 4E20A 5H2UA 2I40A 4EK5A 2PUPA 4WT6A 2ERZE 5FBNC 4MNFA 2R3LA 3KRRA 3TJCA 4D2RA 3VF9A 3DXPA 2WQNA 5BX0A 2GFCA 4IB0A 1IRKA 2YACA 3GXLA 3P23A 3LM5A 4IX5A 2R64A 2JDTA 2WIPA 3EL7A 3RCJA 3R7GA 5T68A 1BI7A 4FVQA 4A7CA 3D5XA 4FNXA 4QP4A 1Q3DA 4LMNA 5J8IA 3PLAE 2WOUA 3FAAA 4WRGA 4EHGA 1OB3A 3HL7A 4P4CA 3R02A 4QYGA 2LAVA 4O91A 1WMKA 4RG0A 3I0OA 2F2UA 2WTWA 4XG8A 4IM3A 4B0GA 1YXSA 2Z02A 5KX8A 3QZFA 2V55A 5IKWA 3FBVA 5GINE 3A7GA 2BMCA 1SZMA 3H9RA 3QQJA 4GT4A 5ETFA 4EH6A 5IEYA 5IQEA 5IA1A 4D28A 2X7FA 5HTCA 5HG5A 3HX4A 1CDKA 3FE3A 4DE4A 4G9CA 3PSBA 4H1MA 4YBJA 3HMNA 1FPUA 3DNDA 3HV3A 4RWIA 4AA5A 3U8WA 5JQ5A 3SLSA 5JFWA 3LIJA 4PNIA 4LGHA 5IH6A 3PXQA 5KZIA 5CEPA 2JBPA 1KE5A 3LJ0A 3HRFA 2CKEA 4AE9A 1QL6A 4BDFA 4JAIA 1JKSA 3V5JA 4RVTA 4AOJA 1XBAA 4IMYA 4N6YA 3VWAA 4FZFB 4LRKA 3M42A 4FIFA 3HV5A 3SX9A 4QYHA 3UDBA 4BKZA 4UMRA 4DYMA 3V51A 5M4UA 4FKIA 3LFCA 2ITWA 5DVRA 4B6LA 4BWKA 2IN6A 3IO7A 3EFKA 5DA3A 2GFSA 4Z16A 5F1ZA 3EN5A 3D2KA 3FMMA 5B2MA 4ITHA 5GJGA 4P90A 4WG5A 4MAOA 4GW8A 1SM2A 2OLCA 4TPTA 3MVMA 5LMBA 3ULZA 1Q8TA 4J52A 2I0EA 3ET7A 3BQCA 3KK9A 1XKKA 4QP6A 4F1TA 5KMLA 3LCTA 3ZHPC 4FNYA 1LPUA 3KRWA 2ITUA 4MBIA 2XK4A 4DGLC 3VW8A 1FOTA 2XIZA 4ZY4A 4K6ZA 1W7HA 2W17A 3GOPA 4KIPA 5HO8A 3D0EA 5KMJA 5HTIA 4FK3A 5LVNA 5IPJA 1Q8UA 5BVFA 1JBPE 2RL5A 4ENXA 1W0XC 4EL9A 4LL0A 3ZMMA 3IGOA 4YC8A 1SMHA 2VTIA 3KGAA 3RK9A 1WBNA 4O1PA 5B2KA 4QPMA 3DU8A 4QP7A 3ZS5A 1U54A 4FNWA 3DCVA 3GB2A 4L7FA 4U44A 3VBXA 5M08A 3W16A 3HZTA 4FOCA 2QLQA 3DTWA 4V01A 4C3FA 3AOXA 3LJ1A 4JX7A 3W2RA 2EB2A 3IECA 4I6QA 3S00A 4EUTA 4ACGA 5DG5A 5BQ0A 3TWJA 1STCE 4QMMA 5DFPA 4EOQA 5HU3A 3N4UA 3QQGA 3QYZA 4MQ1A 3UNJA 3Q4CA 5EFQA 4BWXA 3DY7A 4EOMA 4RX9A 4ACHA 3C0HA 3OBJA 3QCYA 3RALA 2OIQA 4OAUC 4BTKA 3NEWA 3V8TA 3BCEA 1K3AA 1Q97A 4JR7A 4AW5A 5CSHA 1ZYJA 4AXAA 4TYJA 2YISA 3BLQA 2CSNA 4HVHA 3AT4A 4EQCA 3P0MA 4R6VA 5EDQA 3EL8A 2VTHA 2P4IA 2XMYA 3DAEA 4D1SA 2VO0A 3POZA 2YN8A 3ZONA 2J0KA 3F61A 3G15A 2W05A 4R5YA 3R7EA 3E8DA 4KD1A 4CKRA 3KK8A 3PPJA 3NYVA 2ITPA 2XKEA 4QYEA 4U41A 4MXZA 1XBBA 5H8BA 4C58A 4TL0A 4M14A 5C01A 4GJ3A 4DG3E 1LP4A 4NFMA 4XP2A 2Q0BA 3IOPA 5HCZA 3BX5A 2CHLA 3KRXA 3KB7A 5E8YA 2J7TA 4JIKA 5KHXA 3UQCA 4U80A 2XK7A 3BWFA 4M66A 5DI1A 3QHWA 4FZAB 4KINA 4M69B 3WF5A 5M4IA 3SQQA 2XBAA 5JFSA 3SW4A 1XH6A 4BF2A 4MF0A 3DQWA 4QMLA 3QUDA 4YO6A 1BLXA 2QO7A 1BYGA 3QTSA 4NZWB 3UIXA 2GQGA 2OJ9A 5CI6A 5GHVA 1YHVA 3BGQA 4MD7E 1KE8A 2LGCA 4ENYA 4G3GA 2F2CB 3C1XA 3FQEA 4JQ8A 3H4JA 1QPJA 2DS1A 3E8EA 3ODZX 3RAHA 1M2PA 4FGBA 4ZLYA 2WMSA 1ZMWA 3KKVA 3M11A 3ZLYA 2PY3A 3CY3A 5CU6A 2W06A 5DOSA 1H24A 3FLYA 4WBBB 1H08A 2Y4IB 2J0JA 5EM8A 3OT8A 2QNJA 4EOIA 3Q9YA 5ACKA 3VULA 3QKKA 4BTMA 1TQMA 2FSLX 3LJ2A 4LUDA 4EBVA 3W55A 5K5NA 1AGWA 5T3QA 2EWAA 4DN5A 4QNYA 4RFZA 4AWIA 1TQIA 2YFXA 3ORLA 3MFUA 5M44A 4J8MA 2C6OA 3FMEA 1ZMVA 2H8HA 3U87A 3TDWA 5KKRB 5A14A 4ZZNA 3ULIA 2ITVA 2RF9A 1UA2A 3NPCA 4XUFA 3T3VA 4E1ZA 4FX3A 3ZBFA 3O2MA 2PWLA 3NLBA 2XRUA 3QUEA 4FT9A 1JAMA 5C8KA 2OZAB 4U0IA 4QQJA 5IQBA 3C4FA 3QQLA 5L2IA 3U6JA 1UU3A 4GMYA 1CKPA 3D2IA 4KKGA 4HYIA 4R1YA 4FODA 3MVHA 1T45A 3TV6A 5IQDA 4YJNA 1SVGA 3KRJA 5E9EA 4I4EA 4IWQA 5TT7A 4UMQA 2BRBA 3VBQA 2NNWB 2P3GX 1OMWA 3P7BA 4OR5A 3CS9A 5CYIA 3BHYA 3GC8A 4FICA 4TZRA 5A4LA 4BGGA 4X2NA 5IUHA 4HNIA 3PVGA 4MXYA 3C5UA 3SXSA 2JLDA 4KRDA 4PP7A 5IEXA 1JQHA 3OS3A 5AR8A 3TKHA 4OGRA 4JRVA 5I9YA 3NUUA 4IXPA 3U6IA 5HE3A 3D7ZA 2YIXA 2VGOA 4HYSA 3PY1A 3OWLA 4DEIA 5HU9A 1OECA 2J9MA 3MDYA 2IW9A 2UW0A 2C6DA 1R0EA 3OY3A 5HLWA 1UKHA 2YABA 4ANOA 5EI6A 3QTIA 3Q60A 3E8CA 5KZ0A 3BE9A 3N4TA 4IAYA 4XEYA 4FSTA 4UMTA 4CFUA 3PXFA 5CSWA 4U3ZA 5LMKC 3GBZA 4C57A 2ZMDA 3F3WA 4BIBA 1LEWA 3HRCA 3O0GA 4H3BA 3C0GA 2XP2A 4L43A 4JXFA 5HNGA 3L9PA 3QA0A 4ZTQA 1H26A 3ERKA 4YJTA 4EC8A 5D7AA 1KE6A 2WIHA 5GZ8A 5IZFA 2BRMA 3KEXA 2GTNA 5BPYA 4CT2A 4O86A 3A7IA 3KU2A 4GVJA 4H3PA 4BGQA 4NUSA 5CEMA 2QOBA 4WBOA 5AR3A 4BR3A 1OIRA 1PY5A 3QUPA 2JITA 3HEGA 5BMMA 1RJBA 3DT1A 4M84A 4F08A 4I41A 3VUIA 4TT7A 2WPAA 2XCKA 4CV8A 4ZLZA 2VO6A 3BPRA 5L3AA 1WBTA 3JVSA 4MNEB 5FEDA 3DQXA 4CFNA 4D0XA 3M2WA 4FIJA 4PUZA 3R9HA 5EYKA 3V01A 1NT2A 3VIDA 5CTPA 1M2QA 4BC6A 3LMGA 4FEWA 1P2AA 3QTWA 3BEAA 4V05A 5ANJA 3EN6A 3DK3A 4LGGA 4ZLOA 1GZ8A 3QFVA 4O0UA 4BHNA 4C36A 1ZWSA 2GHGA 1OUYA 4FUYA 4BICA 4YJQA 2OW3A 2GQRA 4QTDA 4DFUA 2YIWA 5I4NA 3KY2A 4C61A 4DBNA 4EWQA 3CBLA 4DCAA 4G16A 4TYHA 4QPSA 4PPCA 4YP8A 2UW3A 3R8LA 1GZNA 1YI3A 3FKOA 4A4OA 4BYJA 4YC6A 3FLSA 3PLSA 2C5VA 3AXWA 4EH2A 1E1XA 5BMSA 1M52A 3H9OA 5I9VA 2OXDA 5A9UA 4G6NA 2YJSA 3EFWA 5TO8A 4A07A 2AUHA 1YQJA 4XOZA 2YLFA 4BYIA 2I6LA 3QRIA 5EKOA 4RX5A 1NXKA 4JR3A 2OWBA 5FEQA 3I7BA 4LOPA 2DYLA 4BDDA 4NWMA 4FV9A 5M06A 2BDWA 1OKYA 2BILB 4FG7A 5EKNA 3P9JA 3A62A 2F7XE 1RDQE 3BQRA 3QRKA 3RP9A 5AAEA 5CEKA 3QRUA 4MCVA 5HLNA 2C6LA 3NRMA 2OIDA 2J0LA 3DZOA 3H0YA 2OF4A 5IU2A 4IAKA 5CLPA 4YZMA 5KMNA 3PXKA 5A4CA 3ATTA 2ZV9A 2C6KA 4MEDA 3C0IA 2JAVA 3I0QA 4JI9A 3ZO3A 4EI4A 4G2FA 1JNKA 3POOA 3DB8A 3WARA 2JKOA 3ZRKA 2VWBA 3R01A 1TQPA 1BI8A 3CSVA 4G5PA 4CKIA 5EQPA 2Z7RA 4WO5A 5M09A 3RPVA 1DI8A 4UB7A 3R8VA 3V6SA 4BL1A 2RGPA 3ORKA 3R63A 3Q53A 4NFNA 5FGKA 3OCBA 5DR6A 3V8WA 4C34A 4D4SA 4QQCA 3COKA 5HKMA 3WOWA 2QG5A 2X1NA 3IW7A 1TVOA 4OTFA 3SXFA 2H6DA 2XK8A 2XVDA 4C33A 2OJIA 4W4YA 4APPA 4D4RA 4JIAA 4QMOA 3DPKA 3FEGA 4QMPA 4ANSA 2R4BA 4CVAA 5LWNA 2WNTA 4I6BA 2W1HA 5EYDA 4GK4A 2V22A 2QI8A 3QQFA 2BVAA 4AT3A 1MP8A 4B7TA 4QMNA 3FZTA 5ANDA 5HX8A 2C4GA 3EQIA 4UWCA 2R3OA 1FINA 3DAKA 3OT3A 3LLTA 2ZDTA 3F7ZA 4HGLA 2CPKE 3BHHA 3CC6A 4WKQA 3WF7A 3ZOSA 1FVTA 2Y8OA 2R3RA 1ZY4A 4YZNA 4E93A 2UZNA 2ZMCA 2BZHB 2ZM1A 4FV5A 3VRZA 3VUMA 3HP5A 3OOMA 4ANQA 3AC3A 3NUPA 4D5HA 4J71A 4R7BA 3FY2A 2IZRA 1JKTA 2O8YA 3KXZA 4Q9SA 3ORMA 3DKGA 5K4IA 4XLIA 3KF4A 4NU1A 5CEQA 1KV2A 1P5EA 2YDIA 1FVRA 1PXNA 5EHLA 3F3ZA 3LXNA 3QXPA 2ZB1A 3DDQA 5FP6A 1EH4A 1U54B 2UZUE 2UZDA 4G31A 5EW3A 3R00A 2QOHA 4Z55A 3GVUA 4H36A 3MJ1A 2CCIA 4ZMEA 4U6RA 4YHFA 3PA3A 1UWHA 2OIBA 3R7UA 2WAJA 3BU5A 4M97A 2VTPA 2BUJA 4O0YA 4D4VA 4IM0A 2XIYA 1U4DA 4PWNA 3BYMA 2BFYA 4JLCA 5CU2A 4BCOA 5IH5A 3BBTB 4G3FA 4MHAA 2QU6A 4FKLA 4XNEA 4RX8A 5K0KA 3MFRA 4KABA 4M0ZA 5L2QA 4CYIA 5DNRA 5L2SA 2Q83A 4OTIA 4FIEA 1QPEA 3R1NA 5A6OA 3E87A 1YRPA 3G9NA 4KIQA 2BKZA 4PTCA 1UNLA 1R1WA 1W84A 2I1MA 3PXYA 3UOLA 4BDHA 1NVRA 4E6DA 4O1OA 2CGWA 3CJGA 4E6CA 4GSBA 4F0GA 3DGKA 2ITYA 2JD5A 3BGZA 3LCSA 5JN2A 1QCFA 3PJ3A 3PPKA 1KE7A 3RI1A 4EHEA 4X6QC 4U40A 1BL6A 2WTDA 3LFBA 5AWMA 4QPAA 5LVOA 3HA8A 2BALA 5M55A 4G3CA 4PRJA 3WIKA 4U81A 5AADA 2ZJWA 5CVGA 2IO6A 4K8AA 5JKGA 4WIHA 3IW5A 2G9XA 5A4QA 1UWJA 3FZOA 5FXSA 1PXOA 2EB3A 2BHHA 4O0WA 1B39A 2RKUA 2WELA 4I0SA 3VS6A 3LOKA 4OAVB 3T8OA 3PJCA 4FTCA 3ORIA 4R5SA 3ROCA 3UIUA 5IA2A 5K0XA 4II5A 5LVLA 5JFVA 4IC8A 4D9UA 3PTGA 3H3CA 1WBPA 3F2RA 4Y73A 1W82A 5HO7A 2XEZA 3TUDA 2XA4A 4IW0A 2BAJA 4C3PA 5GIPE 2V0DA 4DH8A 4L8MA 4ITIA 2EXCX 3LFFA 5HCXA 3B8QA 4IC7A 4ASDA 3OOGA 4RJ8A 4ZY6A 3KMWA 5E8UA 3OCGA 4LV8A 3W8QA 1ND4A 2NRYA 3EYHA 5I3OA 3UZTA 2GQSA 3NMUF 3DJ5A 4TYGA 4XG3A 4HNFA 3O51A 3IQ7A 3MJ2A 3NCZA 4JDKA 5LVMA 1M7NA 3LQ8A 3PXRA 3FC2A 1MUOA 2QOKA 4G9RA 5JK3A 4KA3A 4XX9A 2B9IA 3WE8A 4YSJA 3U54A 2RSVA 4AN9A 3LFQA 5FEEA 4IH8A 3EMGA 5A3XA 4HVIA 3KXMA 4ZP5A 5DGZA 5CXZA 3I81A 2OZAA 1IAHA 2GNLA 4AFEA 1OIYA 1F0QA 2VTJA 3R83A 4FC0A 4TN6A 2ETMA 5IUGA 3LQ3A 5CF4A 2O5KA 4DLJA 5IDNA 3PA5A 3GEQA 4JT3A 3LFSA 4DFLA 3S0OA 4JOAA 1A06A 3TNIA 2F7ZE 2R3GA 2O64A 3A4PA 5AIKA 5HE0A 2R3KA 4ZSAA 2E9VA 3C51A 2BTSA 3PXZA 5C8MA 2QKRA 3TKUA 4RLLA 2I0YA 2XCHA 5IH4A 2W1DA 4I23A 4WA9A 4WOVA 4ZZOA 3AC4A 4FTKA 4JNWA 3VS4A 5L4QA 3NW6A 4U43A 4CSVA 3ZH8A 3MA6A 2W4JA 4RC4A 4O0VA 2VWZA 5E1EA 5IEVA 5CI7A 3FMNA 4JDJA 4AOTA 3FC1X 4USDA 3MTLA 3ENMA 1ZARA 3TNHA 3GCPA 1H0VA 1JWHA 3R73A 4E5AX 4YTIA 3UIBA 5E8ZA 1JSUA 3A7FA 3FZPA 3NNVA 1YI4A 3LFAA 3AMBA 5F94A 5FM2A 5GZAA 3LMHA 3IS5A 3VUDA 4XJ0A 5CU4A 4RIWB 3OEFX 1YXVA 2REIA 3KREA 5IQCA 3FL4A 4TKSA 3R28A 2JDRA 2F7EE 5DHJA 5A4EA 5HNBA 3UNZA 2PMIA 4WRSA 3ZO1A 5C03A 3ACJA 3HP2A 2WMWA 1GY3A 2VTTA 4IFGA 5D12A 5JGBA 3F5UA 5ANGA 1W83A 3Q9XA 4GFGA 4FT7A 5B0XA 4DCEA 3FSFA 3L8PA 3FMJA 4UZDA 1ZRZA 4D2PA 1VZOA 3VS0A 3LLAA 3AQVA 3IOKA 4FTIA 4GK2A 2PVMA 4F7SA 3ZM4A 3F5GA 4BDEA 3SKCA 4UWYA 5EQEA 2O3PA 4QMVA 3AMYA 4FSYA 2R3IA 4QQ5A 3L9MA 3PJ1A 2WMVA 2HZNA 4N70A 4S31A 1M17A 3MYGA 2A27A 5HD4A 2JDSA 4NCTC 4FTJA 2VTMA 5DLSA 4ZK5A 3LCDA 1WCCA 3PPZA 3WE4A 3CPBA 4NSTA 3UBDA 3ZLSA 3TNWA 5DMZA 3O7LD 2HW6A 3ODYX 3VO3A 3OP5A 5M57A 3ZO2A 5M53A 3OCSA 2DUVA 2VNWA 3GI3A 4L45A 4OLIA 2UV2A 4GIHA 5K5XA 2HZIA 4G3EA 5KHWA 2VUWA 3MH3A 3RVGA 3JY0A 3O23A 3BE2A 1XO2B 1PW2A 4FT3A 2FO0A 2PVYA 3TUCA 2CNQA 2UW5A 4IZ5A 3FMDA 4I93A 4PV0A 5KE0A 1E1VA 5KBQA 4I5HA 5C4LA 2F9GA 3E93A 3C4WA 4DEEA 4EKLA 5CXHA 4D2TA 4YU2A 2BRGA 4EHVA 2OZOA 4UN0C 2X9FA 5DYJA 4OBPA 4J96A 4BCMA 4F70A 4D1XA 2R3PA 4GFMA 3ZC5A 4B8MA 2XNBA 1DM2A 3F88A 4EHZA 1WZYA 2G2IA 3CTJA 3EYGA 4RC3A 2Y9QA 4ACDA 4DBXA 4L6QA 4CMTA 1IASA 3OUNB 4K2RA 4BVUA 4CG9A 3VS1A 3EQFA 1Y8GA 2YDKA 4KKEA 5J9ZA 5LQFA 5ETCA 3RPRA 2J5FA 1J7IA 5FWKK 4N57A 2PU8A 1Q24A 1FVVA 1V1KA 2Z7LA 5D11A 3ZU7A 4BI2A 4BFMA 3ZRLA 2QD9A 3KC3A 1LUFA 4TNBA 4TYHB 3F5XA 4D2VA 3LXKA 2C47A 2GTMA 1GJOA 2HXLA 1ERKA 2UW6A 3EQHA 3FI3A 3FYKX 4KBAA 3MY5A 4C4FA 2PUIA 3WYXA 1SVHA 5IQHA 3KN6A 5CAPA 2C0TA 4YTCA 4R3RA 4X21A 2QOFA 3QGYA 4J95A 3F6XA 1H0WA 2QCSA 3OW4A 5HO6A 4XG4A 2C3JA 3W2QA 4UX9A 3OTVA 3BHUA 2BZJA 4RIXB 5IA3A 2UZOA 3FLQA 2H9VA 3DKCA 2YLEA 4FIIA 3NW5A 3KN5A 4O0TA 4OTGA 3UMXA 1OITA 4EZ3A 4QO9A 4UBAA 4V0GB 4WHZA 5DPVA 3AC8A 5J9YA 4DF3A 2WQBA 2JAMA 4IVDA 5AAFA 4I92A 4O2PA 4GUEA 4NIFB 4NJDA 2WQMA 3Q32A 4NTSA 4YJPA 5CZHA 3RINA 3VHEA 2J0IA 5DT0A 2QQ7A 4ZEGA 5ICPA 1DI9A 2VN9A 3KF7A 3PRFA 1Y6AA 5AUZA 3ZUTA 5KBRA 4XV1A 4LI5A 1U5RA 3QCSA 2ITZA 4CRSA 2GNGA 3JYAA 2HZ0A 3MH0A 5J1VA 1NA7A 2VO3A 4FKSA 3K5VA 2YITA 3KFAA 4FUXA 3AD4A 2YM4A 3FZRA 4HPUE 4UV0A 1Q4LA 5HICA 3V04A 3MI9A 4FSZA 3S4QA 4CFVA 3HUBA 3PZHA 4QMWA 5HVKA 4G1WA 3MW1A 2JGZA 4FV7A 2CJMA 1P4OA 5CEIA 3IKAA 4JG7A 3EFJA 1R3CA 4NT4A 5DT4A 3TEIA 3QD3A 4YJVA 4KIOA 3UQGA 3C4CA 4W4XA 5L8KA 4Y5QA 3OY1A 4FK6A 1UU8A 3IDPA 4GKHA 4DT8A 1XH4A 2ZV8A 2C3KA 3UP2A 3FI4A 2BRNA 4CGAA 4APCA 1FQ1B 4ONAA 3AMAA 5AR4A 2SRCA 3D5UA 4FBXA 4N6ZA 2X8IA 2YM7A 4F9WA 4AZEA 3I6WA 3NDMA 5F9EA 5HCYA 4EQMA 2DQ7X 3B2WA 4HOKA 4ANMA 5IA0A 4TWOA 4AW2A 1ZOGA 4NTTA 2VTLA 1YDSE 3P4KA 5G1XA 4USFA 3A7HA 3RMFA 4UYAA 3E5AA 3DXNA 3GU6A 4H1JA 5DN3A 4WNKA 4AA0A 3TNPC 4JBPA 3FSKA 2XB7A 4PL3A 3UIMA
chains in the Genus database with same CATH superfamily
5E90A 3LPBA 4EH5A 3OC1A 4DDIA 5HD7A 4UWBA 1Q8YA 2HY81 2XS0A 5BUIA 3SOAA 3C4XA 4AGCA 2RG6A 1XR1A 2XIRA 4ERWA 3DNEA 3RGFA 2RFSA 3QRJA 3S1HA 3OTUA 3PZEA 4PF4A 5TF9A 4DEDA 1S9IA 1OL2A 3PG3A 2RFEA 3MVLA 3GU4A 3GCQA 4ZTHA 4RQVA 5E8VA 3QXOA 3IW4A 2P2HA 4M13A 4MK0A 3Q3BA 2OICA 5CSVA 4DLIA 1Q41A 2H34A 1VEBA 5J7HA 2PHKA 4AW0A 4ZAUA 1H1WA 2I7QA 2WB8A 4RA5A 4D0WA 3UG2A 5JZJA 4RJ7A 2GPHA 3R9OA 4XCUA 3R7VA 3O8UA 4M3QA 2PMOX 4FT0A 2R3NA 4PMSA 1GIJA 3O17A 1PRYA 3D15A 4FL1A 2BAQA 3SG9A 3C50A 3FKLA 5DWRA 3S2PA 4XRLA 3PSCA 4YLLA 4L7SA 3BU6A 4HVGA 3QLFA 1ZMUA 5LARA 4AQCA 1Z9XA 2HENA 3E64A 3NCGA 4BZDA 4EK4A 2W5HA 4M8TA 4EKKA 1PMUA 3GU7A 1H27A 2WGJA 3WYYA 4AGUA 3FYJX 2HZ4A 2GNFA 3QA8A 4K0YA 1J3HA 1Q5KA 3FV8A 3NGAA 4M67A 3W2SA 4U8ZA 3ZSGA 1GZKA 4BDAA 3FXWA 3UDSA 1MRVA 1GZOA 5DR2A 4YJOA 3FMKA 3R8ZA 4R77A 4FT5A 2OH0E 4QYFA 2RFNA 3OWKA 3WILA 3C9WA 1PKDA 1H00A 3PE2A 3W8LA 4L3LA 4ANNA 3KXXA 4BCNA 2X7OA 2VX1A 3G33A 3JVRA 3ZC6A 3IGGA 4ZS4A 4ZXTA 3KIOC 2AQXA 4LYNA 3C13A 2BRHA 3BZ3A 4CLJA 4HVSA 3F2AA 3GU8A 4GIIA 1JSTA 3QZGA 2ERKA 4WSQA 4CCUA 4EZ5A 3E3BX 4O21A 3RZFA 4NCTA 2HWPA 3B2TA 2XIKA 3FLNC 4BCPA 4ZTMA 5J5TA 2OI4X 3C4ZA 3DLZA 4G6OA 4RFMA 4GYGA 2XNPA 4GFOA 3G90X 3ZSIA 3IK3A 4DEBA 4R8QA 4BB4A 5M56A 3UOJA 2OU7A 2PZIA 4KRCA 2C3IB 5E1SA 1MRYA 2WD1A 3RPYA 5GZ9A 4CV9A 5HG9A 4DH5A 1J7UA 3NIZA 4IX6A 2F49A 2QOLA 3UVQA 4EK3A 3BYOA 3PUFC 5HNIX 4JBVA 5BVEA 3F66A 2JDOA 3UP7A 4O7YA 4F0FA 2OFUA 3L8SA 3PY0A 2J6MA 4QP8A 3ANQA 2J90A 3OEZA 4EORA 4EOPA 4EWHA 2X39A 2X4FA 3K3JA 2BIYA 3HNGA 4RA4A 5J5SA 4RMZA 2W1EA 3MB7A 3TIYA 3F2NA 2QOCA 3ZUVA 4N0SA 3ZFYA 4ITJA 2YWVA 4CTCA 1U5QA 3I60A 2UVXA 3NYXA 5BUEA 4FV3A 4FRFA 4RIWA 3CXWA 4BTJA 2JKQA 1ST0A 5FD2A 1UU9A 3N4VA 2XH5A 1F5QA 2C69A 3NNWA 3W10A 3EN7A 3W2OA 5E4HA 5HBHA 3E3PA 5EYCA 2CN8A 3CLYA 3O8PA 5ANOA 4PDYA 4QTCA 4FEUA 5EW9A 3U9NA 3W2PA 4AAAA 5JGDA 4MQ2A 5K4JA 5TKDA 1Z5MA 2XK9A 3LHJA 3Q6UA 3R2YA 4IJ9A 3ZLXA 4DC2A 4TXCA 2GHMA 4YJRA 4X2KA 3EB0A 4Z3VA 2HY0A 4CFWA 4O81A 4CT1A 5DE2A 2BFXA 1LEZA 5HBJA 4O82A 4AN2A 2WXVA 1YXUA 4L00A 4LM5A 3K5UA 1OL7A 3ZDIA 3HA6A 4DFNA 3FWQA 3DXQA 2W4OA 5BYZA 5FXRA 4OBQA 5HLPA 2C3LA 2IWIA 4S34A 2P33A 2R9SA 3SAYA 5HIBA 4X7QA 4C4IA 2ESMA 5AP0A 2XM9A 5FXQA 3N51A 4FGRA 5EQYA 3NNUA 1H25A 2WMTA 4GG5A 4ALUA 5BVOA 2C5OA 3EZVA 4BJJA 2PE0A 5HZNA 2RIOA 4R3PA 4CFFA 4EUUA 3JY9A 4XV9A 4ALVA 3PDTA 2JC6A 3UO5A 5CAOA 2VZ6A 2FB8A 5D1JA 1Q8WA 4XV2A 3VS7A 4UYNA 5I3RA 4NL0A 5C4KA 2BZIB 3UC4A 3ZCLA 4AG8A 4QEBA 4TYIA 1CKJA 4UZHA 5IUIA 5H8GA 5EHOA 4BBEA 4DGMA 3R7OA 3ITZA 1VLRA 1CM8A 2QOIA 4OBOA 2PK9A 2C6TA 2ZVAA 3EQRA 1KSWA 4IAZA 2QOOA 3EZRA 4HCTA 3EHAA 4KIKA 5C9CA 3ZTXA 4FV0A 4A9YA 1DS5A 4UY9A 5E8XA 4I21A 3FHIA 3HRBA 3KVXA 3AC2A 3G0EA 4PMTA 5EHYA 5K3YA 2HCKA 3DFAA 3FLZA 2FGIA 4EZ7A 4QMQA 3T3UA 1OI9A 1FMOE 2EUFB 1OGUA 3NSZA 1K2PA 4RFYA 3H30A 3V5TA 3ATSA 3F3TA 4EOOA 3GOKA 3FJQE 3TJDA 4CZTA 2PVNA 4FIHA 1FGIA 2FUMA 3VN9A 2QG7A 3SRVB 3F3VA 4YPDA 2XRWA 4BCGA 3R71A 3JR1A 5IMEA 3F9NA 3Q4UA 2OO8X 4FSRA 3LAUA 3QD0A 2X81A 5CAUA 2ZFYA 2C1BA 2ETRA 3FI8A 2F57A 3BWJA 4U9AA 3MBLA 3SVVA 1MQBA 3QTXA 4X2JA 4AZFA 4NW5A 2A98A 4PTEA 5DEWA 3AT2A 4RIXA 3OXTA 3KXHA 3R1YA 4PPAA 1VJYA 4JVGA 1IEPA 2W1ZA 4QMZA 5BUJA 2GU8A 4HJOA 2PYWA 4YJSA 3VQUA 2I0VA 3I5ZA 4I0TA 4M12A 2PZ5A 5D7VA 3HMMA 4V0GA 4P2KA 5EI2A 3U4UA 4ZSGA 4F4PA 3Q4ZA 3NUYA 1OUKA 3BEGA 4MKCA 3UZPA 4YGAA 3ZFMA 4BDBA 4NIFA 2PVFA 3ENHA 4A4LA 4AZSA 1KE9A 2X6DA 4L01A 3OWJA 2R5TA 3R7YA 1H28A 4I20A 2O65A 3MB6A 2C5YA 3CJFA 3AG9A 3QL8A 3ORPA 3SV0A 3AGMA 5HQ0A 4E7WA 3ZYAA 2V7OA 4IANA 4L46A 4F09A 3VJNA 5HBEA 2FA2A 4EK8A 2GHLA 2CDZA 1G8JA 3DA6A 2R0UA 3GNIB 3TTIA 2OGVA 3PUPA 3RM6A 2RG5A 3OMVA 3DBCA 3KL8A 1R39A 3BYSA 4RX7A 4FZ6A 4K18A 1OPKA 2H96A 3FLWA 3K3IA 4F7NA 4OT5A 5KMIA 3TUBA 4RLKA 3HYHA 3AKKA 4Y8DA 4FEXA 2G2HA 2X2KA 2W1GA 3EKNA 2BDJA 4IQ6A 4GUBA 3C5IA 2C6EA 5GJDA 3HV7A 3GC9A 1ZY5A 5CQUA 4BTFA 4DTAA 4IHPA 4WNOA 5HI2A 3UMWA 2W0JA 4BBFA 2CMWA 4FKRA 2GSFA 5FG8A 5A6NA 3CD8A 5A46A 4C4JA 4KB8A 4YSMA 1O6LA 5HGIA 4XP3A 5IDPA 2JEDA 2VX3A 2JKMA 2XKDA 4W9WA 3P86A 1O9UA 4BZNA 1SNXA 2XNGA 4F6WA 1W98A 3UC3A 4F9YA 4AGWA 5TOZA 3NS9A 4ASZA 2VWVA 3LQ5A 3QTUA 5I9ZA 4FSMA 4IVAA 3GU5A 3MPMA 2WMXA 3I4BA 3FZ1A 1PXLA 4QYYA 3G6GA 3COMA 4IB3A 4U42A 5CAQA 3CGFA 5AP6A 4P7EA 1PHKA 2QU5A 4FF8A 4IFCA 4HYHA 2B9JA 3PWDA 4GH2A 4BGHA 1H4LA 3HMPA 4YTFA 2XF0A 3ORTA 2ZDUA 5DRDA 4BCFA 4LV5A 3MY0A 4O0RA 4OTHA 3REPA 5BVNA 3RWQA 3ELJA 5AM6A 3RAKA 4HVDA 4MXXA 3BLAA 1VYWA 2PE1A 3NIEA 3ZBXA 3R9RA 3O8TA 3TI1A 1Y91A 3OHTA 3UO6A 3QD2B 3ETAA 2X2LA 5HVJA 5EYMA 4IEBA 1P14A 3FMHA 4QTEA 4IE9A 4LRMA 4DHJA 5AX3A 3KA0A 4R78A 2QO9A 2YIRA 3FXXA 1M2RA 3W0PA 2BCJA 1JKKA 1NY3A 3L9NA 4K33A 4CYJA 4A9SA 1G8SA 3FUPA 5M07A 4UXQA 2PUNA 2ZB0A 1WFCA 3OZ6A 3PVWA 3IDCA 3WZJA 3BV2A 3EJ1A 5CSXA 3BYUA 3KCKA 3KQ7A 5AR5A 3SD0A 2VX0A 1PXJA 3DK6A 3OXIA 4D9TA 4FTTA 2A19B 2JIVA 5CT0A 4YTHA 2PSQA 3CTHA 4MH7A 5L8LA 3VUKA 4DTBA 4W8DA 3DBDA 3EQPA 3QX2A 4FSQA 5D10A 4C2WA 2W9FB 3K2LA 2E9PA 4MWIA 2IJMA 1H8FA 3BKBA 4NM0A 3SG8A 4F1MA 3ORNA 4YHJA 4Y95A 4BCQA 4BI0A 4DG2E 2WTKC 2ACXA 3A8XA 3FQSA 4L9IA 2OKRA 5H8EA 4A9RA 1PF8A 3E8NA 4DTKA 4C0TA 4TY1A 4EOLA 3QAME 4YZCA 3FY0A 3AGLA 2ZV2A 4Z7GA 2HWOA 4DFXE 1BL7A 1XH7A 3Q5ZA 3KXGA 3O71A 4XH6A 5L6OA 3EIDA 3FDNA 2YM5A 3COHA 5LMKA 3V5WA 4EK6A 3ZXZA 4GV1A 3TZ7A 3ZLWA 3ZEWA 4DGGA 3MS9A 3HMIA 3LXLA 4LL5A 5J87A 1UKIA 1XH5A 3DBFA 4XBRA 3BHTA 1UVRA 4FSNA 4LV7A 1YXTA 1IG1A 5J7BA 2HXQA 3W1FA 1BMKA 1Q62A 4IAAA 4JQEA 4TWCA 3UYTA 3OCTA 5ETAA 4JDIA 2JFMA 2FSTX 1YVJA 4O4BB 5ITAA 3AKJA 4H58A 4EOKA 4IDVA 4UXLA 3DB6A 4HCVA 5B7VA 3MFSA 4YZDA 4BCIA 3D9VA 2CNVA 2FSOX 4IX3A 2WMQA 3TIZA 3FL5A 2WKMA 3EH9A 3ORXA 2FH9A 3PSDA 5IA5A 1JVPP 3ZSHA 1REKA 3D83A 4KBCA 3QKMA 4QD6A 2OFVA 4AF3A 5E8WA 5E91A 2ZOQA 2NP8A 5BVWA 4QP2A 2XNNA 5EM7A 3G9LX 3RNIA 4ZTNA 3MH2A 2C5NA 3H10A 5KO1A 2P0CA 1ZLTA 1Y8YA 5HEZA 4HPTE 4OTQA 2R2PA 3RHXA 5HE1A 2W1IA 4HYUA 4YPSA 5GJFA 4C02A 5JRQA 3PVBA 3I6UA 4KS8A 2X8EA 5LMAA 3PIXA 4GT5A 4A4XA 3CR0A 1GIIA 3M1SA 4NH1A 3IW6A 3OBGA 3GQLA 2XJ2A 3O96A 2XARA 3TM0A 1XHAA 2R3MA 3GFWA 4ZS0A 3Q4TA 3ANRA 2BR1A 3DK7A 4WG4A 4W9XA 4X3FC 3LFDA 3RHKA 4EJNA 3NFGB 3P7CA 4U5JA 4I1ZA 3TACA 5HG7A 4EQUA 4E73A 3H9FA 1OZ1A 4O7SA 1TZDA 5EM6A 1E9HA 3NAXA 3KCFA 3WF8A 2CKPA 4OTDA 5DT3A 4RIYB 5CS6A 4C59A 3FPQA 1OBGA 3PFYA 4GS6A 5K9IA 3TV4A 1XBCA 2G1TA 2W1FA 4IZYA 4TWNA 5DH3A 5AP7A 3JPVA 4OTRA 3FMLA 2DWBA 4C4HA 2QHNA 1HCKA 3LCOA 3R8PA 3L8XA 4GRBA 2O63A 4FTNA 2PVKA 2X0QA 5B2LA 4Q9ZA 1G3NA 4YLKA 4ALWA 4QP1A 2PZPA 3ZDUA 4AT5A 5AAGA 5KMOA 3BELA 3GP0A 4CMOA 4EONA 5IQIA 4KNBA 4I5MA 4GU9A 4YUQA 2OJJA 2RFDA 2B7AA 3RJCA 4WSYA 5EK7A 5FP5A 3R21A 5LOHA 3PP1A 4D2WA 4PDSA 2BPMA 2BZKB 2B0QA 3LVPA 2YM8A 5JSMA 3CQWA 3TTJA 3II5A 2X4ZA 2CGVA 3CCNA 5L2WA 3RKBA 4O4FA 1IA8A 4HZRA 4RBLA 3VHKA 2KTYA 2YAKA 1LR4A 3JS2A 4TYEA 2W1CA 4LGDA 2BHEA 1OPLA 4NM3A 3RWPA 4FSWA 4EOSA 3Q6WA 5JMSA 3VF8A 4MTAA 3F7WA 4U45A 1KUTA 4DG0E 2PTKA 4DA5A 4RGJA 3EQBA 4DFZE 5L6WL 4DFYA 3SRVA 2VWUA 5IA4A 1R0PA 2WU7A 5EDPA 3EOCA 4RZWA 1T46A 2FYSA 4KWPA 1WVYA 2C30A 4YZBA 1YWNA 4ASEA 3O7LB 5C26A 3PRIA 1X8BA 3R1SA 4GK3A 3UVPA 2B1PA 4FOBA 4Y46A 3HVCA 4IVBA 4J98A 4KIKB 5M4CA 5C1QB 5FRIA 1YDTE 4YNOA 3W0OA 4FYOA 1KOBA 2R3FA 4M7IA 4O0XA 1HOWA 4OTPA 4PQNA 1Y57A 1H01A 3OUKA 3D4QA 2C0IA 4CMUA 2G2FA 4Z7HA 1IR3A 1FMKA 5IG1A 4I3ZA 5I5ZA 4GT3A 5FBOA 1NW1A 2C0OA 1ZYSA 2ITQA 4I4FA 2G01A 4BIEA 4DHZA 4YJUA 1PJKA 3DKFA 4RVLA 4S32A 3WZEA 4FV2A 4A9UA 3RNYA 4BCHA 2Z60A 4DH7A 2BKKA 4B8LA 3BRBA 2WTJA 4JJRA 4TWPA 2YIQA 3A60A 3U4WA 1WBVA 5J95A 5DRBA 3QC4A 4G34A 4QP9A 3Q9WA 4P5ZA 4S2ZA 3D94A 5DIAA 2XIXA 3SXRA 4F6UA 3DDPA 1JPAA 2V62A 2XYUA 4I94A 4FTLA 3QGWA 4RPVA 4BDIA 3R8UA 3TT0A 4NK9A 4F63A 3GC0A 4LOOA 5A4TA 4GKIA 1REJA 1CTPE 5AV3A 3CGOA 1ATPE 3D5VA 4AT4A 3QZIA 4JL9A 4ERKA 4O83A 4E8AA 3WIGA 3VNTA 4AA4A 2VWYA 3K54A 4LRJA 2YA9A 3WZUA 2F4JA 3I79A 4JS8A 3CY2A 1RQQA 4XP0A 4ID7A 3MA3A 3IG7A 3NUXA 2UZLA 2XKCA 4FA2A 3T9TA 1YXXA 3JXWA 2YCFA 1GAGA 2V7AA 1WVWA 1M14A 5CVHA 3TL8A 4AFJA 1XQZA 2VTOA 4DINA 4QQTA 4RJ4A 5M51A 5IF1A 1TKIA 3JUHA 2EU9A 3QU0A 3UTOA 1YHSA 4TRLA 2PMLX 2E9UA 3PVUA 2WQEA 3QKLA 4MX9A 1GIHA 3SHEA 2A2AA 3W18A 5KMMA 1ZOHA 2CKOA 5CAVA 1PYXA 4CNHA 3P1AA 3ZUUA 3A4OX 3MSSA 3QTRA 4O7VA 4MXAA 4L67A 1OKZA 4RWJA 5EG3A 3R9NA 4EOJA 2JIIA 3V8SA 1URWA 2UZBA 1W2DA 4M0YA 4XLVA 2W4KA 5T6KA 4XRJA 5LCKA 3BLRA 2AC3A 4HGTA 5TR6A 3W2CA 3P5KA 3Q9ZA 3RBWA 3CPCA 3RM7A 2YM3A 3CD3A 2P2IA 1PXKA 1OIUA 4WG3A 3FPMA 2OG8A 4IIRA 4QMXA 4BY9E 4XG6A 4C3RA 2UVYA 4BDGA 5FTQA 5D9HA 4EH7A 3MH1A 4PP9A 2PULA 4O4DA 3SW7A 2XK3A 2C5XA 2OJGA 3VUTA 2HAKA 4HZSA 4C2VA 2QLUA 5AX9A 1UU7A 5DBXA 4EH9A 2X0GA 4FR4A 4IDTA 4FKQA 4XV3A 2ZM3A 2Y6MA 5FDXA 2XM8A 3BI6A 4BN1A 4LG4A 2VTNA 3TNQB 5EM5A 4BHZA 5IMXA 4E26A 4XYFA 5L8JA 5JH6A 4J8NA 2OJFE 4TTHB 3OXZA 5HIDA 2YJRA 4KAOA 5CALA 5JQ8A 2BTRA 2Y4PA 3F5PA 3FQHA 1SNUA 3R30A 4MYGA 5ANEA 4RRVA 3PYYA 3VUGA 3R2BA 3E92A 4RWLA 2CNUA 5CANA 1MQ4A 1ZAOA 3DBQA 4J97A 4XMOA 4BCKA 3BU3A 5ETIA 3NYOA 4S33A 4MXOA 2XNMA 3NR9A 2WMUA 2EXMA 4IM2A 2XJ0A 4U97A 4QOXA 4X6RA 2NO3A 2XEYA 5CF5A 1P4FA 5CSPA 4MVFA 2GDOA 1JLUE 4O7RA 4FSUA 3R1QA 4FKTA 3ZFXA 3FI2A 3GFEA 3HDNA 4FTUA 4X3FA 3R7IA 4ACMA 4ZSJA 4C38A 5CQWA 1FGKA 1U46A 3QQHA 4QMSA 4RIOA 4ZIMA 4DITA 4UMPA 3A2CA 2PUUA 1IAJA 4LUEA 5AV2A 4E4LA 1PMEA 2X7GA 3W0NA 4O7NA 2XNEA 3C7QA 4NKSA 4MBJA 4Y83A 3UJGA 2WFYA 1A48A 4EEVA 5AM7A 2XBJA 1YOMA 4AOIA 2VRXA 2J51A 4E4NA 2HK5A 2HELA 4RSSA 4AZTA 3HV6A 4PX6A 2WZJA 1GOLA 4CKJA 1HCLA 4RC2A 3W0RA 3ZM9A 3VONA 1L3RE 4H39A 1YI6A 3WF9A 3OWPA 4E3CA 4GYIA 3CE3A 3MGYA 1OVEA 3GCUA 4HGEA 4GL9A 5IISA 3QTZA 5JFXA 2I0HA 2Z7QA 5AIRA 4IJPA 3TZMA 4PL4A 3EKKA 4D5KA 1SVEA 3GUBA 4DEHA 4E6QA 4U79A 3HECA 2ONLC 5F4NA 3S3IA 3Q5IA 2ZAZA 4QP3A 4OTWA 3GT8A 3TCPA 4DEGA 4J99A 3HUCA 2W7XA 3DKOA 4CEGA 1B38A 1VYZA 4UEUA 3VBVA 3B8RA 4QT1A 3EQCA 3UOHA 3ZZWA 4F64A 3SA0A 5IQAA 3QWKA 3VJOA 4BI1A 3VBWA 4U3YA 3PFQA 3I1AA 3Q52A 4AP7A 2PPQA 3EFLA 4JMQA 3NVKI 5HHWA 3Q2MA 3UO4A 4KS7A 4A06A 3MN3A 4R7IA 2ITOA 3NAYA 5AV1A 3NVMB 1O6YA 2VWXA 3I7CA 3A61A 4O96A 3GQIA 2YEXA 2YWPA 4O7LA 3UQFA 4V04A 3MV5A 2V5QA 5HE2A 5HVYA 4AACA 4BDKA 5M4FA 3OF0A 1CSNA 2WHBA 4WNMA 1OL5A 2VAGA 3P78A 3DBEA 3CEKA 4O6LA 3CQUA 4I24A 3MIAA 5CX9A 5EOLA 2VGPA 3KXNA 4LOQA 1CKIA 3KULA 5BVKA 3V6RA 2J5EA 2QHMA 3G2FA 1UNHA 2ITTA 3D7TA 5H9BA 5JEBA 2B4SB 2YCSA 1QMZA 2Y6OA 5EDRA 4USEA 3QRTA 4KKHA 3E88A 4O38A 4YHTA 3VUHA 4QMUA 1V0PA 1IA9A 1J1BA 4FKJA 3UPXA 4BBMA 4RIYA 1B6CB 4AU8A 2E2BA 1JSVA 4AAYA 2UW8A 2WTIA 5AUVA 2YERA 4Y72A 2ITNA 2X9EA 3UG1A 4D4YA 3QQKA 2QVSE 4GVAA 3F3UA 2JFLA 3PA4A 4EH3A 3NFFB 3QTQA 2QO2A 3VVHA 3HKOA 2VTSA 3VS3A 5ANKA 4RT7A 5JT2A 5AUWA 4CD0A 1J1CA 4E4XA 1Q99A 2VU3A 5CENA 5ACBC 2PVLA 3FXZA 3E63A 3P79A 3Q04A 3R6XA 4DFBA 1OIQA 2B9HA 3TG1A 4I6LA 4P5QA 4G5JA 2W5AA 4XG2A 3AC1A 2WO6A 3AC5A 4JRNA 5C27A 2UZEA 3QD4A 2NPQA 4IADA 4IZAA 2PZYA 4EYJA 5IQFA 4C7TA 3R04A 3OVVA 4YR8A 1H1RA 4BKJA 3U9CA 2WTCA 4X3JA 4BCJA 5AFVA 2VTQA 1YOJA 1WAKA 4IBMA 3RCDA 3AD6A 2E9OA 3CIKA 4NM5A 3MVJA 4GG7A 4RJ5A 5AP3A 1XWSA 4ZTRA 4AW1A 3CKXA 4E4MA 4DH3A 1MRUA 1PXMA 5I9UA 3VS2A 4ZJVA 5L2TA 4AXEA 4FKVA 2C6MA 2X6EA 2B53A 1AQ1A 2A1AB 4PPBA 1NVSA 4R1VA 4YC3A 4L53A 4F7LA 4JDHA 3CTQA 3LCKA 3VBYA 2J0MB 2CN5A 2GS6A 5FM3A 5FTOA 3R22A 3AD5A 4IAIA 4CXAA 2Y4IC 4F6SA 4FKGA 5HG8A 4K77A 3V5PA 5CU0A 5KMKA 4EJ7A 4CQEA 4FI1A 2VO7A 3MPTA 4KSPA 2CKQA 4F9CA 1Q61A 2C1AA 4UMUA 1UNGA 3BGPA 4M15A 4RJ6A 4FTAA 3KMUA 4F78A 5CT7A 2AC5A 4ANBA 3MTFA 4IB1A 4PL5A 1Q8ZA 1YWVA 3R0TA 1JKLA 3RAIA 5FTGA 2PVHA 1PMNA 2Y0AA 4HGSA 2YIYA 3EN4A 3TZ8A 3WI6A 1J7LA 3EN9A 3IPHA 4NYEA 3NYNA 2GNHA 1OGYA 5KKRC 3MFTA 2O2UA 2JBOA 2WU6A 4FNZA 4B4LA 1BX6A 3ALNA 4IB5A 3RPSA 2E9NA 2PL0A 4XOYA 3ID6C 3TXOA 5KNJA 1L8TA 2R3JA 3QX4A 3THBA 3F82A 3MIYA 5CVFA 3LE6A 1H1QA 4O27B 3A7JA 3G51A 4BKYA 2B52A 3KRLA 3NW7A 2QR7A 3NX8A 4AZVA 2HOGA 2Z7SA 5L6PA 4C4GA 3GGFA 4RWKA 1H1SA 1PXPA 2Y7JA 4WD5A 5BNJA 4LFIA 5J9LA 5CY3A 4FG9A 2O0UA 2WTVA 3SOCA 4CQGA 4O7WA 4E5WA 4F65A 1AD5A 4CFXA 2HYYA 3ORZA 2OH4A 3DS6A 5DEYA 4I22A 2IW6A 2QC6A 3VS5A 4YMJA 4PNKA 1FBNA 4KBKA 4ORKA 3RTPA 2XKFA 3L1SA 4FV4A 4PY1A 3DAJA 3O50A 3IONA 4BWPA 4AZWA 2OF2A 4N4SA 3R9DA 3LZBA 5CNNA 3VC4A 3OD6X 2GS7A 2VNYA 2C6IA 1V0BA 5CF8A 3HMOA 3LMIA 1PMVA 3WZDA 1H07A 1YDRE 5J79A 3W0QA 2W96B 3GCVA 2CLQA 3PJ2A 5AUUA 4EBWA 4DGOA 3O5AA 3HDMA 5LVPA 4ACCA 2PE2A 3T9IA 4DHFA 5BV3A 4JG6A 1DAYA 3WBLA 5GIOE 4FEQA 4FKOA 5FDPA 5AP5A 3W0MA 5LXMA 1PYEA 4FVPA 4DHIB 4DH1A 4HCUA 5HOAA 4L3PA 3FKNA 2Q0NA 1URCA 4NM7A 4ZJIA 1V0OA 1DAWA 2AYPA 3MWUA 3COIA 3RZBA 4DEAA 1Y6BA 4FIGA 1GNGA 2QODA 2VTAA 1ZYDA 3LXPA 4O7ZA 3WZKA 4AS0A 4LMUA 3A8WA 4Z9LA 2FSMX 3UYSA 3FZSA 4NJ3A 4YURA 4IWDA 3BL7A 2WTKB 4UALA 2BAKA 2KULA 4DAWA 3QBNA 3S95A 4R3CA 5AR2A 1XH8A 1W2CA 4FKUA 2ONLA 5CEOA 4E6AA 5HTBA 5KCVA 2PMNX 2R7BA 2JIUA 3QQUA 4R7HA 4EH4A 4ZOGA 3DOGA 4IWOA 4C62A 5AA8A 3PIYA 4KSQA 1WVXA 4L3JA 1OL1A 4A9TA 4E5BA 4PMMA 3QALE 4F1OA 4QTAA 4ASXA 4PMPA 3G0FA 5AUTA 4H3QA 5F95A 4QNAA 4I5CA 1YOLA 4JG8A 4MF1A 1ZOEA 4ZTLA 4YNEA 4ZTSA 3BV3A 4FL2A 2PZRA 3V5LA 3DLSA 4C37A 1YHWA 2W99B 1Q3WA 4FE2A 4U7ZA 3GCSA 4FYNA 4YZ9A 1BUHA 3ZEPA 1OBDA 4RQKA 3IDBA 4LQMA 2JKKA 4WUAA 3PIZA 4JBQA 4XBUA 1A9UA 5G6VA 3VW6A 5DR9A 4F9BA 5AUXA 3ALOA 5JGAA 3HGKA 1OL6A 4C4EA 3VAPA 2UZVA 2J4ZA 4FG8A 2IW8A 2IPXA 4FTQA 2YCQA 4B9DA 1WBOA 2QKWB 1YKRA 5ANIA 5FQDC 4EYMA 3QWJA 4AGDA 1G8AA 3DJ7A 5JRSA 1K9AA 3PY3A 1I09A 5AP2A 4NW6A 4GU6A 4YLJA 3SC1A 4F0IA 3SDJA 3V5QA 4YO4A 2GNJA 2Z2WA 4C35A 3BLHA 3QCXA 5TE0A 2XALA 3HAMA 3GC7A 4FKPA 2XZSA 3ZRMA 4ARKA 2QONA 1KV1A 2AEGA 4J1RA 5HESA 2UW4A 1PKGA 4X2GA 4TW9A 2UVZA 3RPOA 3EWHA 5AP4A 4DT9A 4B99A 5D41A 3QHRA 1O6KA 2UW9A 4W4WA 2BIKB 5GNKA 2GMXA 1G5SA 3VQHA 4F7JA 3E7VA