5HCZA

Egfr kinase domain mutant "tmlr" with 3-azetidinyl azaindazole compound 21
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
324
structure length
300
Chain Sequence
GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELTSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYDMDDVVDADEYLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
publication title Discovery of a Noncovalent, Mutant-Selective Epidermal Growth Factor Receptor Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 300
sequence length 324
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hczA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hczA01
2O3PA 5H9BA 3TKUA 1JSUA 5HEZA 3DQWA 1GY3A 4D58A 4UWCA 4L7FA 3Q2MA 3TT0A 3MI9A 4FSNA 4ENYA 4XG8A 5CU6A 5DI1A 4A7CA 2UW7A 1REKA 2QOCA 3C13A 5EI2A 3ZXZA 3HGKA 1OKVA 3NNXA 2XK7A 2NPQA 4O6LA 4PQNA 3KK9A 3OW4A 3E62A 1H00A 2JIUA 4BCQA 5AA8A 4EOQA 5IA2A 5ACBC 5DMZA 5K4IA 4IM3A 5C9CA 3NYVA 2A2AA 3FMJA 3BI6A 2F9GA 4FSQA 4QNYA 1OBDA 4WNPA 5EKOA 5AP3A 4IWQA 4IE9A 5M4IA 1JQHA 4FV8A 2VTSA 2G2HA 2VU3A 2ZDTA 3DS6A 4R8QA 5AMNA 3ZFYA 4AP7A 4EHEA 4O82A 1OL6A 3QTRA 4C4JA 4CQEA 5AX9A 5I9XA 2XNPA 4WD5A 3VBQA 3R02A 1B38A 2YZAA 4XG3A 4ANNA 4D1XA 4YBJA 1XKKA 3QQKA 2PMNX 2X8IA 1YHVA 3ZUVA 3A61A 4FV3A 4R1VA 3KEXA 3WI6A 2ZOQA 3IGOA 3MH0A 4X7QA 3FI3A 4W4WA 3RNIA 4DGOA 4H1MA 4O22A 3FMHA 4M69B 4IH8A 2GFSA 5AX3A 3ORNA 5I9UA 2ZM4A 3CQEA 4MD8E 1GNGA 5IA0A 3KRWA 2BIYA 3MA6A 3UJGA 2YCQA 5CLPA 4F9CA 5I4NA 2G01A 5EM6A 3UODA 4KSQA 3E7VA 4RX7A 4EHZA 3FMNA 3VBWA 3IK3A 3KREA 4JG7A 2IVUA 4MXXA 4AZEA 3EZVA 4BFMA 4TN6A 2OIDA 4EK5A 5EQYA 2REIA 1H1PA 5H2UA 4PWNA 1J7UA 3CTHA 3A99A 4KNBA 4ZSEA 2BTSA 3ALNA 2FGIA 2JKOA 1KE9A 2GTNA 4ZY6A 3VIDA 4DTAA 2PMOX 1KE5A 4LOPA 3R7UA 3TTIA 3NUNA 3ATTA 4GH2A 2W1FA 4PL3A 1IA8A 4E7WA 2GS2A 3ZSGA 4YC8A 5EDQA 3RZFA 4GK3A 3LKMA 1OIUA 3O50A 4IACA 4UMQA 3S1HA 2J51A 2CGXA 2VX3A 3TZ9A 2O8YA 2PZRA 4RIYA 3UIUA 4XLVA 3SOCA 2NRUA 2RFEA 1P4FA 4LGDA 4LRJA 4RVKA 1L8TA 5BVOA 2XM9A 3FY0A 4S32A 1U4DA 4ANQA 4BRXA 4L43A 4CFNA 4F7NA 2JGZA 4O7SA 4CG8A 4OR5A 3CLYA 3QQJA 1GIIA 3QA8A 3I6WA 4IM0A 4E93A 2O5KA 4LUEA 3ORZA 4FIHA 1VZOA 1H0WA 4D4RA 4XV1A 3SA0A 2YM5A 4NM3A 4C4FA 4L53A 2Y8OA 4FTJA 3PPKA 3ID6C 1P5EA 2PYWA 4Y73A 4AW0A 4E4LA 1UA2A 4ZSAA 1BMKA 5BQ0A 3I79A 2VO3A 3D5WA 3V5TA 4RIYB 3UPZA 2UW0A 4AN3A 3DLSA 3FSKA 4FKTA 4J52A 3R8VA 5LVPA 3F5UA 3ZZWA 2PSQA 4GYGA 4EWHA 4DA5A 4I6HA 5IKWA 3DK7A 2XKCA 3G9LX 3RWPA 4JIKA 4QT1A 4FL1A 2J5EA 5GIOE 4JBQA 2JDOA 4G3FA 5HESA 4CTBA 1UNGA 2R5TA 4FEXA 4O84A 3NWWA 4ZTRA 5LMBA 2EB2A 2W17A 3O8TA 4O0UA 4G5JA 5AV3A 3NAXA 2YWVA 4LOQA 4C38A 1IG1A 3WOWA 4BCFA 3PIZA 3QYZA 4C57A 3D2KA 3C9WA 3BYVA 4BYJA 4TWNA 3A7HA 4BBFA 3DZQA 1CKJA 1PMVA 3Q3BA 5HLPA 3TWJA 4BDJA 4YTCA 2CKOA 2GNLA 2W9ZB 3BV3A 3EQIA 3OEFX 2I0VA 3DQXA 4BTKA 2BDJA 5HG8A 4FSYA 4EH9A 4WRGA 5C4LA 4C62A 2OF4A 3GP0A 2X9EA 2XIXA 3U54A 3IDPA 5E8XA 3DT1A 3WARA 2C69A 3MGYA 2XCKA 4P5ZA 2XRWA 3HMNA 2VX0A 4CLJA 4ANMA 2ACXA 3ODYX 4JR3A 3V5PA 5HTCA 3PTGA 3VRYA 5EQPA 2IW9A 3PJCA 3R2BA 5T68A 5J9ZA 4M84A 5M08A 1ZYLA 4E4NA 5T6KA 4ACGA 2XS0A 4HYIA 4MBIA 4W8DA 4XRLA 4KIKB 3V3VA 3VULA 4C2WA 4KS8A 2XP2A 4IWDA 5EHLA 3R8MA 4BKYA 2B7AA 3O7LD 3D7TA 4AZFA 2UZTA 5HQ0A 2CCIA 3R30A 2QR7A 5D7AA 4A9TA 4W4XA 3ZBXA 4CMUA 1OITA 4I6BA 5BMSA 4O6EA 1YHSA 3NYXA 5C01A 5A6NA 3FHIA 3NDMA 4I41A 2KTYA 3F9NA 5IQIA 2CLQA 4GYIA 4BHNA 5HCYA 3A2CA 3N9XA 4EH5A 3KF7A 4H3QA 4A4OA 3MVLA 3QLFA 4IVCA 2BRNA 4F1OA 2IWIA 4TWOA 4CV8A 1KV1A 4K77A 2P33A 3OOMA 3QX2A 2CNVA 3SOAA 3BQRA 2EWAA 2B9FA 3EYGA 3ZBFA 3FQSA 4XRJA 5M07A 3G2FA 4QYYA 3UOLA 1U54A 1R39A 2VTAA 5FEEA 5CALA 2YM6A 3ZM4A 4KD1A 5HCXA 4G3CA 2IW8A 3UG2A 4RC3A 3MVHA 4M8TA 5CASA 3SVVA 3W1FA 2X81A 3IW4A 4JLCA 5L3AA 3G15A 4NM0A 1XBAA 3EL7A 3G6GA 3RM7A 3QGYA 4ZTHA 3CC6A 2YCSA 3KVXA 3MY5A 1Z9XA 3Q9ZA 4OTPA 3TNWA 5AP7A 2IO6A 2ONLA 4UYAA 3EKNA 3VS6A 4BICA 2XYNA 3G51A 2X1NA 4L9IA 1JPAA 3GU5A 4G6OA 4ARKA 5DYJA 1WVWA 2ZMDA 2R3OA 4FL2A 2UW9A 4YO4A 1JAMA 4BCNA 3P7CA 2YERA 4UX9A 3AOXA 3KGAA 3LFBA 4FTMA 5JFVA 3GFWA 1OIYA 3RINA 5KMOA 4M66A 1JSVA 3SDJA 4JS8A 2XIYA 4KBCA 3ETAA 3CIKA 3KXZA 4A9RA 2C3LA 4CRSA 5HICA 2YITA 4M14A 1OZ1A 4FSWA 4ERKA 4UWBA 3MY0A 4D4YA 3FZTA 3C50A 2BRBA 4AW1A 3JUHA 2C3JA 4AF3A 3I5ZA 2OI4X 4IB5A 2CDZA 3VBXA 5L2SA 4DT9A 1KWPA 3OS3A 3R8PA 1WBWA 3L9MA 2XJ1A 5CT7A 4FTOA 3PXQA 4HNFA 2RL5A 3Q4TA 5I3RA 4NSTA 4KIKA 3HDNA 4KABA 4GIIA 5IISA 3TACA 2YAAA 3C5UA 3DU8A 3PZHA 4U8ZA 2VTTA 2XK3A 5HTBA 2V62A 3BHTA 3R7VA 3UP7A 5A4TA 2PMLX 3PJ2A 4F70A 2GNFA 2VZ6A 5A14A 1UWJA 4CT2A 5A4QA 4AZSA 4ZTSA 3E5AA 3QKMA 3F3WA 3OWLA 3GB2A 4FSRA 4PX6A 4P90A 4AE9A 2QG5A 4JDHA 3BGPA 4YZDA 2O64A 1YKRA 3BEAA 4JX7A 4KIPA 3G6HA 3HYHA 4RA4A 5AA9A 4EHGA 5J5TA 3AMBA 4O38A 3ENMA 2R3MA 5AWMA 4MTAA 1QPJA 2BZKB 3F2AA 1Q61A 4ZY5A 3MV5A 3HV3A 5TOZA 1YI6A 2VD5A 3GU8A 3P7BA 4A07A 5BVWA 4CD0A 5AEPA 2GDOA 4J96A 5GNKA 3ELJA 5TKDA 4JIAA 5D11A 4BGQA 2UV2A 3W10A 5J7HA 5EH0A 1ZMVA 4QMYA 3OT3A 4ACCA 4AGWA 1OIQA 2H9VA 2ZB0A 1YW2A 3OXZA 5AADA 2O63A 5JQ8A 4JBOA 1ZYJA 3VN9A 4MXYA 3R21A 4PPCA 5H8GA 3F7WA 5CNNA 4EOLA 2X39A 4OTWA 4KIOA 4QTDA 4F99A 1JBPE 4AOTA 3L8XA 2WFYA 3EN5A 4KB8A 1U59A 3LFNA 3Q5IA 3R83A 5AIRA 3VVHA 4HVSA 3EQHA 3UO5A 5ANIA 4FKOA 4K0YA 3GGFA 4CVAA 2YIRA 5IU2A 1PMUA 3C0IA 3MH2A 4FGBA 1E1XA 4FZ6A 3PSDA 5CWZA 4CLIA 4ZTMA 3VUDA 2ERKA 4EOPA 2FA2A 2IN6A 3JS2A 2QNJA 3PA5A 3B8QA 4O21A 4RQVA 4I6FA 5M56A 1V0OA 1YXVA 1HCKA 2C5NA 2JEDA 4OGRA 3RTPA 4MNFA 5IF1A 4YU2A 4ZSLA 2X9FA 4XV3A 3C4XA 3NYOA 4IHPA 3ULIA 2BHHA 4BCPA 5IQAA 2CNUA 1BYGA 4I92A 2FSLX 2B9HA 4R3CA 2DUVA 5F4NA 4EJ7A 5BVNA 3DBCA 3DK6A 3NS9A 5BMMA 3TUCA 2NRYA 3HZTA 1Q24A 2SRCA 3AC8A 2GNGA 4FKIA 4HYHA 4QTAA 3MVJA 4TYJA 4GT4A 2QOQA 1MRYA 3HVCA 4DG3E 2H96A 3TIZA 3ZO4A 2C5OA 5I9WA 3EFWA 4IW0A 3AC4A 1KOAA 3MW1A 4IDTA 3F69A 2W1DA 4F9YA 2HW7A 3G0FA 3MBLA 2QO2A 3SXFA 3JY9A 3RJCA 3PSBA 4FIEA 5CZIA 5C8NA 4IWOA 4WKQA 2OFUA 4FG9A 3NGAA 4GUEA 4I21A 4DEDA 4EBWA 3KC3A 3L8PA 3Q53A 2PK9A 3O0GA 2R7IA 4J99A 2W9FB 4W9XA 2PU8A 2VWYA 4PP9A 1ZOHA 3KMMA 3VWAA 3GQLA 3K54A 3CPBA 1Y6AA 4I0TA 4KKHA 4RJ7A 4XCUA 3PA4A 4FV4A 4FZAB 3SD0A 1R3CA 3QFVA 5KHXA 1U46A 2XNBA 3F5GA 3DAJA 2X6EA 3C5IA 5A4EA 3PSCA 4AN9A 1J7IA 1YQJA 3JXWA 2QU5A 5CX9A 4E6AA 1W98A 3GU6A 5CVGA 3ZU7A 5HG7A 4R5YA 3E87A 4EK6A 1NXKA 3E88A 4NFMA 3R8LA 2VWIA 5EYMA 4DAWA 3UPXA 5KNJA 2JDTA 2R3PA 4UY9A 4HJOA 3OWJA 3L9PA 4XP2A 5H8EA 3TUBA 4I93A 4Y85A 2WD1A 5BVDA 3D15A 2YACA 4AACA 4FKRA 3CD8A 4FZDB 3R7IA 3NUXA 5AR5A 3QXPA 2FB8A 4TZRA 3WIGA 3RWQA 1Q3DA 2AUHA 1PXKA 2C30A 3I4BA 4RA5A 4FBXA 3VHKA 2V22A 4PL4A 4USDA 4BKZA 5A4LA 2J7TA 2EXMA 4NZWB 5IQCA 4YP8A 4WOVA 3WYXA 1XH5A 3ZLSA 4YURA 4D2WA 4BR3A 2BUJA 4JRNA 2GTMA 1XO2B 1ZY5A 2CN8A 5IQEA 3FPQA 4ZTQA 4NKSA 1PXNA 3DBFA 4LV8A 3LQ3A 2YFXA 2Z60A 4YZCA 3Q4CA 5HLWA 2GCDA 2YJRA 1GZ8A 4ZXTA 1ZOEA 5IUGA 4V0GB 4O0XA 3LLAA 4Z3VA 1M7NA 4QYFA 2VWXA 3D94A 3EJ1A 5M09A 3IW5A 1QMZA 4RZVA 4QPMA 4UEUA 4YJTA 5M55A 3UQCA 1XH7A 2C6TA 4L52A 4QP7A 3F3UA 3IDBA 4JOAA 3A7GA 3IDCA 4D9UA 3RAWA 4C59A 3LQ8A 4PTCA 4V05A 4EL9A 2NP8A 3OUKA 3FLWA 3OUNB 1URCA 4NCTA 2J4ZA 2P4IA 4FODA 4WBBB 1IA9A 3O51A 4NT4A 2ZJWA 5G1XA 4E26A 2XB7A 1URWA 4EC8A 5FD2A 4IADA 1Y8YA 2XKEA 2PL0A 5L2TA 2X7FA 3D0EA 3QUEA 2ITTA 4MYGA 5AUVA 4USEA 2C5VA 4JAJA 4ZLYA 3Q52A 3VBYA 2YAKA 4GKIA 2VO6A 4FT3A 3SG8A 3HRFA 4HPUE 5LARA 4USFA 3QD0A 4IANA 5KMIA 3NVKI 4ZJJA 3H0YA 3EQRA 5DPVA 3NIZA 3POOA 2PUPA 2JFMA 1H28A 4FEWA 4GS6A 4GU9A 4HGLA 4L42A 5G6VA 3ROYA 4R6VA 3PYYA 2VUWA 4X6RA 3U51A 4BCOA 4N0SA 4I24A 4BIBA 3VJOA 2GNJA 3M2WA 3PXKA 4OUCA 4I0RA 4XG2A 3WZUA 4TNBA 1WFCA 2PVHA 2VGOA 4BDDA 3ROCA 3SG9A 3GQIA 3C7QA 5KBQA 3M42A 5JT2A 5LMKC 4PPBA 4ZK5A 2DWBA 4QMVA 4JVGA 3E7OA 3O71A 3UQGA 2FH9A 4PF4A 4EK4A 3WE8A 1TKIA 3THBA 4PL5A 4RPVA 3LM0A 2PZIA 3BZ3A 5EI6A 4L3LA 1YRPA 5EDRA 2DYLA 2QOKA 4IJ9A 1DM2A 3QRIA 3FZOA 1SVEA 3BLHA 2X7OA 3OW3A 4F9WA 5HX6A 3RPOA 3TL8A 1MQ4A 4V0GA 4D5KA 3OVVA 4O0YA 3RAKA 4ANLA 3D83A 4D55A 3JPVA 4CGAA 2KULA 3R7EA 5F95A 3UOHA 3ZFMA 1KOBA 5L8LA 1WBTA 1PYEA 4BB4A 4B6LA 1PXIA 1REJA 3KB7A 4MCVA 3L8SA 4OTFA 3LXPA 3HMOA 4DCAA 5DH3A 4YJVA 3DJ6A 1MP8A 3NCZA 3ITZA 3K2LA 3Q60A 4FK3A 4GL9A 2OJFE 2UVXA 2WMQA 1P2AA 3IECA 4IAYA 4IEBA 3H0ZA 4IX4A 4QMWA 4Y72A 5CU4A 4ANSA 4C36A 1UWHA 4DITA 4J53A 3DY7A 4AAAA 1CKPA 4EOSA 3DXNA 1M17A 1O6KA 2GHGA 4ZS0A 2Y4IB 4FTUA 4E4MA 2B0QA 4NM7A 1MRUA 3PVUA 3DOGA 3IW8A 3FJQE 3QU0A 4O7WA 2XKFA 1I44A 3FPMA 4FNXA 4KRCA 3WIKA 2W1GA 3KKVA 4FTRA 2H8HA 3NNUA 2C0TA 3LHJA 4LRMA 3P23A 4DH7A 3OMVA 4EUUA 2YIQA 4QP1A 4DEIA 1S9JA 1XWSA 4Q5HA 2UZBA 5LCKA 1M2QA 4DEEA 2ZM1A 1MUOA 4AOIA 3A60A 5D9HA 2ITUA 3C4WA 4RJ5A 1JKKA 2V7AA 5EYCA 1OECA 4N6YA 3NSZA 4HYSA 4FV9A 4DFNA 5M44A 4QMZA 3FHRA 4OTQA 3PXRA 5JN2A 4L7SA 4YR8A 4L67A 3CE3A 1PXJA 2GS6A 2I0EA 4XP0A 3P86A 3RM6A 5M4CA 4C7TA 3KRJA 3P4KA 5KCVA 3T3VA 2FUMA 3COHA 4C0TA 5BVKA 3MDYA 5K9IA 5FEDA 3H3CA 3GBZA 5HCZA 3RPYA 2QHMA 2YISA 3GOKA 3LFSA 3F3ZA 2PZPA 4L00A 1JOWB 4UV0A 2GQGA 2ERZE 2OWBA 4C3RA 4EH3A 5HGIA 5C8KA 1KE7A 1BLXA 4IVBA 4O0WA 5CU3A 5GZAA 5HIBA 4NUSA 4ZOGA 3VRZA 4KSPA 4NW6A 3GCVA 4O1PA 4WUAA 5FXQA 4FTCA 4B8LA 4EONA 3FDNA 4F0GA 3FY2A 5AP1A 3HV4A 2OZOA 3R7YA 1OL5A 2B53A 2X7GA 4FGRA 2VAGA 4IIRA 2JDRA 3D14A 4DFXE 1GAGA 4LMNA 5IMEA 1IAJA 1ZZ2A 1QPEA 5E7RA 3VHEA 2RF9A 3H4JA 4MF0A 5BPYA 5GJFA 4BTMA 4BY9E 2YLEA 4G31A 1PJKA 4I5PA 4O7TA 2WMSA 2JDSA 3RKBA 5JKGA 4RIXB 3LFDA 2ITVA 3FKNA 3NUPA 4E1ZA 4EH2A 5KMKA 3SAYA 3FV8A 3LCSA 3ORLA 2VTOA 5FM2A 3B8RA 2W0JA 4YSJA 2YIYA 4RG0A 3ZO2A 1ZMWA 4YZMA 2QOHA 3KFAA 4CKJA 2PE0A 1WVXA 1XHAA 3EHAA 1PRYA 3HL7A 4RVMA 5AP2A 3RAIA 4CFVA 1ZYCA 3H9OA 4TWCA 2OU7A 4HVHA 4ZTNA 5HBJA 2ITZA 2YIWA 3JVSA 3R6XA 4P5QA 4CQGA 1Q99A 3G9NA 4PDYA 2BFXA 3MH1A 3QTXA 1DAYA 5TF9A 5CEMA 4FV1A 2B54A 4EZ3A 4FC0A 3BLQA 3FZRA 3KQ7A 3CXWA 5EHYA 2WQEA 4J7BA 5CZHA 3S95A 4XG9A 5K5XA 4MF1A 4CTCA 1LP4A 3G90X 4FNYA 3MA3A 3ET7A 3TXOA 3UYSA 4WA9A 4CZYB 3Q04A 4Q5EA 1ND4A 4J95A 1JKSA 5M4UA 2Y4IC 3CQWA 5J7BA 4H05A 1B6CB 2JIIA 4XG6A 4TYIA 1IRKA 5L4QA 4BKJA 4MKCA 3FLQA 3ZFXA 3R00A 3FMMA 4C33A 4U5JA 5DT0A 4C4HA 4OTHA 4LMUA 4G1WA 3TCPA 3BYOA 5CYIA 1BUHA 4C3PA 2P2HA 1CM8A 3WE4A 2Z7RA 4BDHA 2C6IA 4H39A 4XP3A 1YXUA 2ITNA 3OCGA 1OI9A 1T46A 4R1YA 4FKSA 1O6YA 3AD5A 4ZZMA 4QNAA 4IWPA 3IGGA 3OCBA 4FKGA 4O0TA 3DFCB 4IJPA 4NTSA 3TNIA 4PMPA 3BCEA 5KZ0A 1WBPA 5ETIA 5AAEA 4GK4A 5M06A 5M51A 4X2FA 3QAME 4LV5A 1WMKA 3B2TA 3AT2A 3KMUA 5EI8A 3BE9A 3LFCA 2WKMA 5ANKA 2IZSA 4HZSA 2WZJA 3VS1A 4CKIA 3AC2A 4AU8A 3N4VA 3QZIA 4WG3A 3C4EA 3JVRA 4FOBA 3MTLA 4RIXA 4WNOA 4HYUA 4XOZA 3QUDA 1YI3A 3OT8A 3WF7A 3IW6A 4FF8A 4CT1A 3M11A 2HOGA 3A4OX 4YUQA 2OF2A 4FV2A 3VF8A 2X2KA 2ITWA 4O1OA 2C1AA 4RWJA 3F82A 3QHRA 4ITJA 3TUDA 3VW6A 3ANQA 3BHVA 3LJ1A 4MWIA 3P5KA 1RW8A 4RVTA 3FEGA 4OBPA 4G9RA 3TNQB 3MFSA 3AD6A 4I6QA 3V51A 4CNHA 3Q6UA 2XK6A 3A7FA 4GT3A 4IB0A 3BLRA 3EYHA 5EOBA 3ZTXA 1PXPA 3DKGA 3UDBA 3IPHA 3FUPA 5IZFA 4CZUA 5CEIA 1GZOA 1X8BA 3ORIA 3P08A 4OTIA 3R7OA 3BYMA 4UZHA 4TKSA 1DI9A 4PMTA 4Y5QA 2WO6A 3E64A 1J1CA 5LWMA 2Z7QA 4B9DA 4XBRA 3W2PA 4M69A 4JQ8A 2XKDA 3T3UA 5DFPA 4E5AX 4DE4A 3PWDA 1F3MC 5LXMA 2P2IA 4U43A 1H4LA 1YXSA 3RK5A 1UKIA 4II5A 2WQMA 1Q3WA 4CFMA 2YDIA 2UW6A 3H9FA 4H3PA 4JBPA 2IJMA 3QD2B 4M0YA 3R8UA 4BDBA 3NNVA 3VUGA 4QMNA 3PUPA 4KINA 2PHKA 1A9UA 2UVYA 3D5XA 3R1NA 4MHAA 1M14A 2IVSA 2WMXA 3V04A 3C51A 4D0XA 4XLIA 2XCHA 1FMKA 2CPKE 2R3QA 3E93A 2EXEA 3R73A 4NEUA 3M1SA 4O81A 1CDKA 4BCMA 4MXZA 4L8MA 3EIDA 4J1RA 3WF9A 2YN8A 3F61A 4BDKA 4PRJA 2R3RA 5JEBA 3LW0A 4IC7A 5DE2A 1K3AA 3TDWA 1H1WA 1FGIA 3PRFA 2WTVA 4D0WA 1V0PA 4LFIA 3BU3A 5CANA 1ZYDA 3GC9A 1V0BA 4YLLA 5E1EA 5AUYA 4K18A 4JG8A 4EC9A 4J97A 2O2UA 4DC2A 4U9AA 3VS3A 5JSMA 3BX5A 3DV3A 4C8BA 3QTIA 2BZJA 4YSMA 2C47A 3MFUA 5AR3A 4LQMA 4K11A 3RGFA 5I3OA 2W7XA 4K2RA 3DNEA 4AW5A 4CXAA 2CKPA 2H34A 1I09A 4WG4A 3QRJA 4FTKA 2ZYBA 1OL2A 4GCJA 4RZWA 3A8XA 4QQCA 4C4EA 2YM4A 4DEGA 2XNEA 1U5QA 1OKWA 4YGAA 3QKLA 3ZUTA 1IASA 4D2TA 5HVKA 2HZIA 5IQGA 4FVRA 2BAJA 4N4SA 4AG8A 2W1IA 4YTIA 1XBCA 4XNEA 2EB3A 4APPA 5IH5A 2ZM3A 3ORKA 1EH4A 2PVRA 2JITA 3FQEA 4QTCA 5FTGA 3RK9A 3ZONA 5GZ8A 2I7QA 4C02A 4IDVA 1UNLA 5FGKA 4FEUA 1Q5KA 3W18A 5FP5A 5C03A 2PE1A 3FMEA 4ZIMA 2RKUA 3HV7A 3UIBA 3OCSA 4G5PA 3UO4A 3OTUA 3RHXA 4DBXA 2J5FA 3PPJA 4O91A 3L9LA 5DN3A 4BDIA 4IZ5A 5B2KA 2YCRA 3KXGA 4Q9SA 4I5CA 4UMUA 4HW7A 3QTUA 3LCOA 3EMGA 3RMFA 1RQQA 3BKBA 4YZ9A 2BIKB 4AT5A 4DLJA 4EZ5A 4HCUA 3FZPA 3LCKA 4UB7A 3V8TA 4XEYA 5ANGA 4Z7GA 2QQ7A 2ZV9A 2ZV2A 2E9NA 5L2QA 4AZVA 2B1PA 3R2YA 4DEBA 5EFQA 5CSPA 3CJFA 2J0MB 5LVLA 4BC6A 5J9LA 3BE2A 2W5BA 3R28A 1R1WA 3KXHA 2JDVA 4DH5A 4Y83A 5E8ZA 1RE8A 3V5WA 4P2KA 3FI8A 5HVJA 4E73A 2ZMCA 4ITHA 4RC4A 3VS5A 3ZLXA 4JQ7A 4AA4A 5IH4A 4FA2A 5BX0A 2XBJA 3FWQA 3S4QA 3QCQA 3V8WA 4RSSA 4EQMA 3VS2A 3CY3A 3HX4A 4ACDA 2OFVA 5LWNA 5GZ9A 1LEZA 3T9TA 2WMVA 1FGKA 3GXLA 4QP3A 3BYUA 4KKEA 1UKHA 3QX4A 2CCHA 3R63A 2PPQA 4G16A 4BWPA 3HV6A 4TL0A 4KWPA 3NIEA 1QPCA 5KX8A 2VTRA 4WBOA 2J9MA 4BGHA 3A8WA 4IAIA 4ZP5A 3EL8A 5CENA 3SV0A 5DGZA 3F5XA 3NMUF 1OIRA 3BU5A 4G2FA 1Q8TA 1YXXA 5AIKA 4ALWA 3IW7A 5H8BA 2BDFA 2V7OA 4G3GA 1Y6BA 3DXQA 1UV5A 5AR2A 4IAFA 3FL5A 2CKQA 3GI3A 2VWVA 5DA3A 4CFFA 4FYOA 4IFGA 2QOOA 1ZARA 3FLZA 2W1HA 4S34A 3ZYAA 3LVPA 4FUXA 2OJIA 4QP8A 4L3PA 1PMNA 3IO7A 3C4ZA 4EBVA 4B4LA 2E9PA 4E5BA 3RALA 2X6DA 1B39A 1XJDA 1UNHA 3ATSA 4O7LA 3BYSA 3OOGA 3GVUA 3V5JA 3CP9A 4GSBA 2XF0A 4M13A 3KY2A 3PE1A 2IZRA 4DCEA 3PPZA 2RGPA 3CGOA 4D2RA 5CSHA 4EH8A 4HOKA 4QMUA 2NO3A 4F6UA 5BYYA 4A4XA 5A3XA 1ZOGA 4TPTA 3MWUA 4BZOA 5DHJA 4I94A 1L3RE 4DEHA 4BBEA 3SKCA 3PIYA 3QTZA 4YC3A 3R9DA 4AOJA 2F7XE 2WELA 2QD9A 3FE3A 2CKEA 2JKMA 3UYTA 3PY0A 2GMXA 2OXDA 3F3TA 4GG5A 2R4BA 2QR8A 3AMAA 4IC8A 5EYKA 3LAUA 4CFWA 4U6RA 5JFSA 3QF9A 5AUXA 3LOKA 4ZLOA 5AV2A 2C1BA 2Q83A 3D7ZA 2PUUA 1UU8A 3TNHA 5IQHA 3I0OA 4Q9ZA 4FTQA 2R3JA 2OG8A 4GJ3A 5EG3A 1W84A 3K3JA 4M67A 3QUPA 3GCPA 1W0XC 2G15A 4IAAA 5KZIA 2OZAB 2VX1A 5J1VA 4ASDA 4YJUA 5C8MA 4D4SA 1S9IA 2RSVA 2VWWA 2BRGA 2R3LA 3NYNA 4HCVA 3MYGA 4O2ZA 2XZSA 5FBNC 4DH3A 3ZO1A 4A9SA 4LOOA 3R1SA 4FKWA 5A54A 2V55A 3SC1A 3BU6A 1YDRE 3OZ6A 4E5WA 1GZKA 4GFOA 3I81A 2J0JA 3BELA 3DJ5A 4G17A 2XK4A 4R3RA 3EFJA 4BL1A 4GUBA 5I9VA 4FTAA 3F6XA 2BRMA 2R2PA 3LQ5A 3QCXA 4U44A 3DB6A 3PXFA 3R9NA 3KRXA 3LMHA 3R71A 2WQNA 5K3YA 4ERWA 1YDTE 2OJ9A 3WF6A 2J90A 2ITOA 4RIWB 2G2IA 1KSWA 4K8AA 4DGMA 4ZJVA 1PXMA 4AA5A 1IAHA 4QRCA 3QRKA 4C2VA 5C26A 4KKGA 4OTDA 5K0KA 1A48A 3MY1A 5DT4A 4W4YA 5CEQA 3TZ7A 3O8UA 3V6RA 4L3JA 4BBMA 4HVIA 2W06A 4N6ZA 5HD7A 4GRBA 2O65A 4FK6A 4JX3A 5D7VA 4MD9E 4YNEA 4ORKA 4K9YA 4F6SA 3QQHA 5HNIX 4V01A 1AQ1A 4EOMA 1FINA 4M12A 1Q97A 5M4FA 5I5ZA 2XEZA 3R0TA 1F5QA 3HUCA 3KULB 4I4EA 4QP2A 4DFLA 4D2VA 4RX5A 1W82A 2YDKA 3L1SA 4JI9A 4GW8A 4RRVA 5IQBA 1K9AA 4F0FA 3AD4A 3ZHPC 4F0IA 2VTJA 5AM7A 2YDJA 4QMSA 4AFEA 1Q8WA 3SXRA 2QI8A 3ZDIA 4EYJA 2UZVA 3BIZA 4WIHA 4F08A 4O96A 5J95A 1G8SA 3PZEA 2ITPA 2X4FA 5TE0A 3FMLA 3MB7A 2XNGA 4TYGA 1LUFA 3U9NA 4PTGA 2X2LA 2OH4A 2R3HA 3QRUA 4IZ7A 3R8ZA 4D9TA 4FV5A 5HI2A 4EOOA 5FLFA 5TO8A 2BKZA 2E2BA 4RX9A 3ZC6A 1YWRA 3LXNA 4I1ZA 1IEPA 3UOJA 4UMTA 4ZSJA 4RBLA 4RWIA 4DFZE 3FLYA 4DEAA 3EFLA 3TJCA 3VUTA 5C1QB 4IX6A 1FVTA 4BWXA 2OZAA 2BFYA 4TNDA 5AAGA 4NL0A 4NKAA 5E8YA 4AGDA 2J6MA 4QMLA 3QQUA 3BGZA 3A4PA 4LUDA 4CEGA 4UALA 4QTBA 4X3JA 4U45A 4QMQA 4ZY4A 4NJDA 1NA7A 1J3HA 4QOXA 3QTWA 2XIZA 5DBXA 2LGCA 4UMPA 3NR9A 2E9UA 1PF8A 2CMWA 2V0DA 3EFKA 3QC9A 1SM2A 2QLUA 4EWQA 3HAVA 4R3PA 4DH1A 2C6KA 3FMKA 3LMIA 4BF2A 4XS2A 3DDPA 5FTQA 4DINA 2WQOA 4W4VA 3COMA 4FKVA 1Q8YA 2W1EA 4XV2A 5BVEA 1OL1A 5LMKA 3I5NA 4EJNA 1ATPE 4QQ5A 2C3IB 2HENA 2IZUA 3NLBA 4YTHA 2BDWA 4CZTA 4E20A 4OBOA 4RIWA 3CS9A 5DR2A 2XH5A 1Q8ZA 3OWKA 1O6LA 1KE8A 2UUEA 2JBPA 3U8WA 2DS1A 3MPMA 4QP9A 3QZGA 3ZDUA 2J0KA 4DFBA 4ACHA 1YXTA 4LGHA 4O0SA 3SGCA 4L44A 2W1ZA 3ZLWA 4XYFA 3AMYA 4QYGA 2GSFA 2GS7A 2ESMA 2CNQA 2BROA 2VWUA 3H9RA 2QURA 4OT5A 5AP4A 1WVYA 4G3EA 3MJ2A 1VJYA 4HPTE 4GU6A 3W2CA 5L6OA 3WILA 3FLSA 4GMYA 3E8NA 4A06A 2HXLA 4MBLA 4TT7A 4BDEA 4ASXA 4EH6A 4FSTA 3VC4A 2R3FA 2PVKA 3IKAA 5CU2A 3FKOA 3OG7A 4FT5A 2HWPA 4UYNA 1JSTA 2HZ4A 4F7SA 2W96B 3UIXA 5B2MA 2XK8A 3QTQA 4TW9A 2Y0AA 2PY3A 3KXNA 4I20A 1YOLA 2EU9A 2UW4A 2W05A 2C3KA 2WPAA 5JGBA 4M97A 5CXHA 2W1CA 4X2KA 2C6DA 3SQQA 1QCFA 3VUKA 3LFAA 4N57A 5C4KA 4ZMFA 3ACJA 3SHEA 3L8VA 3KK8A 1P14A 2WNTA 3OXTA 4FI1A 4LL5A 2HIWA 1NY3A 1W8CA 3K5UA 3MFRA 1OUYA 4IAKA 2OXXA 4F4PA 2UW8A 3EN9A 4QO9A 3BEGA 5FRIA 4RT7A 4EOIA 1J1BA 3MTFA 5FWKK 4FT0A 5EM7A 3PY1A 1DI8A 1K2PA 1Q62A 4ALVA 5CEKA 2JKQA 3PE2A 3RBWA 4AS0A 3UOKA 1OPLA 4GEOA 3UNJA 3VS4A 3AC5A 2WMUA 3TI1A 2UW5A 2OJGA 2UZOA 3Q4UA 4LL0A 4R7IA 5HX8A 3C0HA 4MXOA 2JKKA 4IXPA 2OGVA 4IFCA 1BL6A 3KF4A 5CTPA 3RPRA 3F88A 1Y8GA 4YZBA 1KUTA 1H8FA 2YWPA 5ANDA 4XV9A 4ZEGA 1TQIA 5CEOA 3FL4A 5HO6A 3KCFA 1V1KA 3DK3A 3QKKA 4YJSA 3RPVA 4BYIA 5CAVA 4D1ZA 4MNEB 4GIHA 2RFDA 5EW9A 2OLCA 3ORXA 2YM3A 4Y95A 5HBHA 4DG0E 4F63A 4K6ZA 4DT8A 3E8DA 2C0IA 4YTFA 3DXPA 3Q9YA 1FVVA 5KMJA 4NK9A 5E9EA 4JJRA 4EK3A 4AXAA 2C5XA 3BBWA 2XJ0A 3LIJA 4FIJA 4IX3A 2QOIA 4RQKA 2X4ZA 5DRBA 4PP7A 2Z02A 4O7NA 5K4JA 1YI4A 4GVJA 2J0IA 1NT2A 4DGLC 3PLSA 4F9BA 2BILB 3OC1A 4ZTLA 5CAUA 4ZMEA 4EZ7A 2BCJA 2R64A 4JBVA 4E3CA 2Z7SA 5DRDA 3GT8A 3P7AA 1YDSE 2A4LA 1CMKE 2WMBA 3R22A 4X3FB 2QC6A 3DB8A 3LXLA 3P0MA 4X6QC 3E8CA 4I23A 3EN6A 5DR6A 5L8JA 3NW5A 3FXWA 5TT7A 3MIAA 3R9OA 2FSTX 3CGFA 3KXMA 3EN7A 3OFMA 4FG8A 2VN9A 3UMWA 4CRLA 4RJ8A 2X8DA 3VAPA 4E6CA 4F7JA 5AFVA 4DH8A 4YHJA 3QGWA 2PVMA 1TQMA 4BWKA 5AV4A 4EH4A 4AWIA 3RI1A 1APME 3BV2A 2A19B 4K1BA 3CR0A 4QMOA 3IS5A 4XG7A 5CY3A 4I3ZA 4J8MA 3TJDA 2IVVA 5F94A 2QHNA 2R0IA 2UZEA 1XH6A 2BMCA 2VTQA 1T45A 4RMZA 3VF9A 3RPSA 3FZSA 1ZZLA 3NPCA 3ZOSA 3PLAE 3BPRA 4RFZA 4KAOA 3W2RA 2WGJA 4B99A 4JQEA 2JLDA 4U79A 5HKMA 4WRSA 4FMQA 1VYWA 2WHBA 1RDQE 1ZY4A 1F0QA 3U87A 5LVNA 3C0GA 2OXYA 4BGGA 3CQUA 3VBTA 3HP5A 4MD7E 3VW8A 3W8LA 4GJ2A 3ZUUA 1H01A 3TNPC 4D2SA 4F65A 4S30A 4Q2AA 3IONA 4AGCA 5H3QA 3QWKA 3KN6A 2QOLA 5KE0A 1RJBA 1PMEA 2CGVA 2CLXA 2B4SB 3WZDA 4JDIA 3I60A 3CY2A 4MNEA 3EKKA 3BBTB 3QRTA 4TRLA 5JGAA 3O8PA 5EW3A 1OM1A 4RC2A 3VQUA 5KMMA 2PUIA 3AT4A 3AQVA 2C5YA 2W5HA 3LFQA 3ZC5A 3UVQA 2F57A 2OIQA 4BI2A 2C0OA 5TR6A 4PUZA 4CYJA 3DA6A 5AP0A 3R04A 2X2MA 1M2RA 2E9OA 1UVRA 3EQDA 3UZPA 3RCJA 4BCGA 5EYDA 5FXRA 4IZYA 2WOTA 4OT6A 2J50A 3S3IA 2A27A 4ASZA 4DYMA 5KUPA 2VWBA 4BZNA 2WMRA 4FKUA 1VR2A 2WMAA 5AR7A 2HELA 4AGUA 5HVYA 1WBOA 3VUIA 1H25A 5J79A 2GQSA 5HNGA 3F7ZA 4C34A 4PMMA 5KBRA 5FTOA 2RIOA 3D9VA 3CPCA 4ANOA 4M68A 2BKKA 4O83A 2GPHA 3A7IA 2UW3A 3O7LB 4CKRA 3CTJA 5A4CA 4X2JA 5D12A 2WXVA 4EORA 3HNGA 2IW6A 2IVTA 2PVNA 4O7ZA 3ZS5A 1JKTA 5IG1A 4EHVA 5J8IA 3F66A 5A46A 4Y46A 3E3PA 2Y7JA 4YZNA 3QA0A 2W4OA 1OKYA 5FDPA 1O9UA 5CI6A 3ZEPA 4MAOA 3FC2A 4QD6A 5E8TA 3GUBA 4E8AA 2FSMX 2I0YA 3I7CA 4YJNA 2ZDUA 5AR8A 4UWYA 4TYEA 5HO7A 1YWNA 3LPBA 5IEXA 5IUHA 5HZNA 1VEBA 4U42A 5LMAA 5I0BA 4IB1A 4YO6A 4X3FC 1CSNA 5B7VA 3R9HA 2HK5A 3L9NA 4BDCA 1XQZA 5CVHA 4ID7A 5CSWA 3QXOA 2JD5A 2PMIA 2IG7A 2PULA 4KIQA 2GQRA 2UVZA 3NNWA 2F4JA 3FC1X 1OUKA 4EKLA 5GHVA 2Z2WA 2VO7A 3H30A 3BHUA 4GK2A 3F3VA 4ZZOA 3SW7A 1Y91A 1ZAOA 4EEVA 2CHLA 5ETCA 2VWZA 3GC7A 2YM8A 3FMDA 1XH8A 5AP5A 3UG1A 5BUEA 2EUFB 1R0EA 5IEVA 4FTIA 1J91A 5FBOA 3MB6A 1ZYSA 1STCE 3LMGA 4YJQA 5KO1A 3TKHA 3FSFA 2XIRA 5L6WL 2J0LA 1VYZA 3MFTA 4PPAA 3TV6A 3LJ0A 3LE6A 2R3NA 1ZRZA 3ZRMA 4FIFA 2YJSA 4HGTA 2X8EA 3A7JA 3PJ3A 4OAVB 3ZO3A 4WNMA 4U7ZA 3DKFA 2YHVA 4JG6A 5F9EA 4DFUA 5CT0A 2HZ0A 3C4CA 3Q9XA 1Q4LA 2WTIA 4YHFA 4MWHA 4TY1A 4YC6A 4FIIA 4EOKA 3DDQA 4EQUA 3NVMB 4OTGA 1R78A 4XJ0A 2ETRA 2W4KA 2VO0A 1G8AA 2HCKA 5CAQA 2X0GA 3FXXA 4O0VA 5E91A 5IDPA 1UU3A 3PG1A 4PY1A 3DNDA 2UZDA 4F64A 2G9XA 3F2NA 3NW7A 1PW2A 4UZDA 3UC4A 3ZSHA 5CXZA 2XNMA 2XNOA 2BTRA 2UZNA 4OLIA 4APCA 3FBVA 4PDOA 5HTIA 3D7TB 1BKXA 4S31A 5HG5A 3OEZA 5BYLA 2BR1A 2GNHA 3KVWA 2A0CX 1M7QA 4OTRA 3GU4A 4XHKB 4EYMA 3U4UA 4R7HA 5E8UA 1TQPA 2R7BA 2B52A 2VV9A 3WZKA 3QTSA 1OPJA 3PP0A 5AR4A 3P1AA 4XG4A 3W8QA 5HBEA 3HRCA 2F49A 5E8VA 3OP5A 5GJDA 5AUWA 4BHZA 5IH6A 1OBGA 4AT3A 3OF0A 5CF8A 5B0XA 4BI1A 4YPDA 5FDXA 3QWJA 4ANBA 4BI0A 3AC3A 3KMWA 1HOWA 3R1YA 4I5HA 5E8SA 5JZNA 4U3ZA 2YZLA 4MX9A 3O23A 2VGPA 2R3GA 3DZOA 1U54B 4IVAA 3ORPA 2I40A 4PV0A 2XJ2A 3PVGA 3MSSA 3WZJA 4C4IA 3RK7A 2VNWA 4JAIA 4RWKA 4EUTA 3NW6A 3UTOA 3IOKA 2BZHB 3COKA 2IZTA 3EH9A 3EQPA 3G0EA 3R7GA 4ZS4A 2GNIA 5E92A 4BTFA 2ZB1A 4LG4A 5D41A 4RJ6A 5HE1A 4MXCA 2OICA 4BZDA 2XK9A 1H27A 4MH7A 3W2OA 1JNKA 4UXQA 2FYSA 1ZWSA 4ZLZA 1FOTA 4ZZNA 5B2LA 3QHWA 5IQFA 4F1MA 5HD4A 1CTPE 1H26A 3QBNA 3QALE 2Y6MA 4AZWA 3BHYA 4C3FA 5HU9A 3LFFA 3KN5A 5CQWA 4FV0A 5JZJA 5EQEA 2HY0A 2BAKA 2OSCA 3RP9A 3PWYA 3FZ1A 3H10A 5AP6A 5JGDA 2XEYA 4H36A 4MQ1A 4KRDA 4AW2A 2R3KA 2WIPA 3EN4A 4FV6A 3U9CA 3DJ7A 4EOJA 3NUSA 2BVAA 4K33A 2XUUA 4FR4A 2QONA 2VTNA 4HGEA 4ITIA 4WT6A 4DFYA 3U6HA 2ETKA 2AYPA 4RLKA 5AM6A 5L2IA 5J5SA 1M2PA 3TM0A 1YVJA 3Q4ZA 3GCUA 3U4WA 5M57A 3LJ2A 3COIA 4H1JA 2A1AB 4JDJA 1PKDA 3F5PA 2P55A 2Y6OA 3E92A 4GG7A 4JXFA 4BCJA 3HECA 3FXZA 1OPKA 3REPA 3OHTA 3LCTA 4QP4A 3VS7A 4WNKA 5GJGA 4AQCA 1PY5A 3R01A 5IQDA 4WUNA 1G5SA 3V5QA 4ZJIA 3QD3A 4YHTA 3VS0A 3EQFA 3WBLA 2OW3A 2VTHA 3QYWA 2GHLA 2WAJA 3GFEA 3HA8A 5IDNA 1OGUA 1JKLA 2VTPA 3VUMA 4LYNA 5GINE 4ACMA 3POZA 2ZV7A 4AE6A 5JRQA 1LR4A 3KU2A 4U0IA 4FTTA 3NZ0A 4Z9LA 4Z55A 1XH4A 5CF6A 1XH9A 3HMPA 3FKLA 3VO3A 3U55A 1ZMUA 3KRLA 4RIOA 3SLSA 4BDGA 4G6NA 4RGJA 3FI2A 4RFMA 2ZAZA 5BNJA 5KKRB 4AUAA 5JRSA 3NEWA 4S2ZA 5E90A 4DHFA 5DWRA 4P7EA 2XMYA 4M3QA 3O17A 4G3DA 3MS9A 2WQBA 1YHWA 4U80A 4KA3A 3AXWA 3OD6X 1UU9A 4FEVA 3NUUA 2PTKA 2WTDA 3QQFA 4QP6A 1LEWA 2E9VA 3GOPA 4IM2A 3CKXA 3JY0A 1BX6A 4NM5A 4EQCA 3D5UA 4BCKA 4FTLA 3PG3A 4TTHB 1LPUA 4JRVA 5T3QA 4BIEA 2QO9A 3UIMA 3HV5A 3Q6WA 3W32A 4C35A 1FMOE 3JYAA 4WSYA 5EM8A 4AX8A 2ZV8A 2XRUA 3ERKA 4CCUA 3O2MA 4NWMA 4FVPA 3ZXTA 1UU7A 5L6PA 3I6UA 2PUNA 3MPAA 4UN0C 3OXIA 2HW6A 3BGQA 1AGWA 1NVRA 4J98A 2JFLA 3RZBA 2R0UA 4IVDA 5FP6A 4MXAA 3E3BX 3ZRLA 4EKKA 4HVDA 3FYKX 3DFAA 4Y5HA 5L2WA 4FZ7A 4PNIA 3DAEA 3PFQA 5DLSA 3CEKA 4GKHA 2UZLA 5FXSA 2CGUA 4FOCA 1NVSA 4FE2A 5CSVA 5A6OA 3MVMA 2WTCA 4PDPA 5AJQA 3UNKA 4IMYA 1XR1A 4CFXA 3TTJA 1GOLA 3R1QA 2W4JA 2F7ZE 2ZVAA 4ASEA 5CS6A 5ICPA 2HY81 2Y4PA 1H1RA 2YLFA 3DCVA 3I0QA 3NRMA 3A62A 3Q96A 2ITXA 5DVRA 2Z7LA 5DG5A 2ONLC 3IG7A 4EI4A 1OB3A 5DEYA 1PXOA 2BHEA 5HOAA 5CAOA 3NX8A 1CKIA 4JT3A 3QLGA 5EM5A 3UP2A 2CGWA 3UO6A 2WIHA 4NJ3A 3ULZA 4IZAA 5IPJA 3DGKA 3RNYA 4A9YA 1FPUA 5L8KA 3PA3A 4FSUA 2F2CB 2VNYA 5E1SA 3CD3A 4AN2A 4HVGA 4Z7HA 3I7BA 4O86A 1SMHA 2FO0A 3PJ1A 2HAKA 5CSXA 3ZSIA 3UE4A 3ZH8A 4BVUA 4UMRA 2VTMA 5JK3A 3S00A 2JIVA 4F7LA 4RFYA 4IB3A 5J87A 3LCDA 3MESA 2PVYA 2AC3A 2OIBA 5C27A 1PYXA 3II5A 4LGGA 3BRBA 2CSNA 2J2IB 3HUBA 4YJPA 3LXKA 4G9CA 3TIYA 3UVRA 2RFSA 3OWPA 4N70A 5HO8A 3S0OA 3TV7A 2YEXA 2XBAA 5HE3A 1J7LA 5LCJA 4R78A 1OVEA 2YA9A 1ZLTA 2QOBA 2RFNA 2XIKA 4CMTA 1WZYA 3KL8A 2QO7A 2C4GA 4RJ4A 5JFWA 2CN5A 5E4HA 4TXCA 3OTVA 4FSZA 5GIPE 4FV7A 1YOJA 2C68A 4BN1A 4GFMA 2VRXA 1BI8A 3PY3A 3QC4A 4KBAA 3TG1A 4YJRA 4UBAA 4MEDA 4I0SA 4UXLA 1SYKA 3LFEA 5HU3A 2B9JA 4XUFA 4S33A 3UVPA 3FI4A 3W16A 3ZMMA 5CU0A 3QCYA 2OK1A 4KS7A 4QMPA 2YM7A 3LM5A 2Y9QA 2WMWA 4IAZA 3W55A 4BTJA 4MVFA 3NAYA 5CNOA 5A9UA 1H1SA 2BALA 4A4LA 4CSVA 3UNZA 3AT3A 2WTKB 2HXQA 2CJMA 2OKRA 3KRRA 4IQ6A 2QKRA 4G6LA 4I5MA 4FEQA 4FSMA 4AFJA 5AV0A 5D1JA 4DTKA 4MQ2A 5KKRC 4NIFB 4DGNA 1YWVA 5HLNA 3N4TA 3PXZA 4FKPA 5IA3A 4RLLA 5IEYA 4FKLA 4RWLA 3G5DA 1FBNA 1W7HA 2WU7A 2YABA 4U3YA 5BUJA 5LJJA 1XBBA 4FNWA 4C37A 3QCSA 3C4FA 2HWOA 2JAMA 3DPKA 1NVQA 4F09A 5EK7A 4HGSA 4BCHA 4R5SA 4L46A 5CVFA 4FNZA 4FUYA 4NU1A 5HE0A 2WEVA 3DAKA 1H24A 4JR7A 4YLKA 3MN3A 4L45A 4W8EA 3P78A 5AUTA 4FL3A 4AZTA 3GCSA 3NUYA 2PVJA 2PVFA 3UC3A 5IA1A 2JC6A 2I1MA 5E8WA 4QPSA 3P79A 3HLLA 2QG7A 3HA6A 3F2RA 1Q8UA 2EVAA 3AGMA 1Q41A 4IX5A 5ANEA 3V6SA 4CCBA 4YMJA 4ZAUA 3UMXA 4FX3A 3TDVA 5CEPA 2AC5A 5ETAA 1OKZA 2C6EA 2DQ7X 1KV2A 3WF8A 3E63A 4B7TA 4CYIA 3ZM9A 4OW8A 2JBOA 1QL6A 4ALUA 1R0PA 2QODA 3K5VA 3PVWA 5HIEA 4O27B 3TN8A 3DKCA 1SNUA 3W2SA 4E4XA 3WF5A 1JLUE 2WU6A 3OY1A 2QCSA 3PDTA 4F6WA 1ZXEA 4QQJA 5CI7A 1E1VA 4QQTA 5LQFA 3N51A 4NH1A 4X2GA 3S2PA 3QQLA 3FQHA 3JR1A 4J8NA 4O7VA 3TZMA 4HNIA 1Y57A 3MH3A 4O0RA 5ANOA 1PHKA 3SRVB 4DG2E 4X2NA 1YOMA 3RVGA 2BAQA 3I1AA 4E6DA 1E9HA 3EB0A 2QVSE 3CJGA 5LVMA 3QQGA 3WYYA 4DTBA 2OBJA 2WB8A 3DBQA 4OBQA 1M52A 3GC8A 3ORTA 4C4GA 4PTEA 4FG7A 4X21A 2ETMA 1BI7A 2PE2A 2QOFA 3HP2A 2VTLA 3CTQA 5CQUA 3ORMA 2GU8A 3ENHA 3DTWA 1BL7A 4HCTA 3DBDA 4FKJA 2EXCX 3BQCA 4U81A 5FEQA 3FYJX 5JMSA 1WAKA 5HNBA 4NYEA 2RG5A 2BPMA 2JAVA 4BDFA 2BZIB 4CV9A 1NW1A 3BHHA 5ITAA 4NIFA 3SW4A 4WO5A 4WSQA 3ZEWA 3CSVA 3RHKA 1PKGA 5DEWA 3TZ8A 3GCQA 3GU7A 4JL9A 2B9IA 4TYHB 5HE2A 3ZLYA 4AT4A 4BIDA 2PVLA 4WHZA 3VBVA 4MK0A 1SVHA 2OO8X 3K3IA 1FVRA 4V04A 4O7RA 4XH6A 3V8SA 2FVDA 2WTWA 4LI5A 1H08A 3TEIA 2XM8A 2XNNA 5HIDA 3PRIA 2PWLA 4L6QA 4NFNA 5DIAA 5F20A 4EH7A 2YCFA 5JFXA 3UZTA 3NCGA 5AUZA 1IR3A 5IA4A 3WZEA 5FUTA 4QTEA 3TKIA 5IA5A 3PXYA 2QKWB 4FTNA 4LM5A 2UZUE 3KULA 2LAVA 3D4QA 3FLNC 4D28A 4OAUC 2PZYA 4QMMA 3O96A 5FQDC 2XA4A 5I9YA 3EZRA 4JDKA 2ITQA 2P3GX 1H1QA 3ALOA 2WMTA 4NW5A 1KE6A 5HG9A 2WTKC 4FVQA 4L68A 4I22A 5KMNA 3V01A 5LOHA 3UBDA 5F1ZA 4GV1A 4QYHA 3Q5ZA 3Q9WA 3LLTA 4U41A 3RCDA 4MBJA 1DS5A 4RX8A 5AV1A 3U6JA 5CF5A 3D5VA 4Y8DA 1HCLA 4C61A 4PNKA 3CKWA 1WBVA 3AG9A 2FSOX 3FAAA 4DBNA 3P9JA 2XYUA 4FT7A 3AGLA 3B2WA 3C1XA 1GIHA 1PXLA 4JNWA 5K5NA 2F7EE 2ITYA 4QMTA 4WG5A 4X0MA 3SRVA 3VQHA 1Z5MA 3UZRA 4QPAA 3IOPA 5AUUA 3U6IA 4NCTC 3ACKA 4YJOA 2WOUA 3Q32A 4EK8A 1H0VA 4XBUA 3ZCLA 3QZFA 5D10A 5KMLA 5ANJA 4BDAA 2YIXA 4PDSA 3DKOA 3QD4A 4W9WA 5JQ5A 1WBSA 2W5AA 1MRVA 4FICA 2OH0E 3HMMA 5DT3A 4C58A 3VJNA 3HDMA 4R77A 2C6MA 1H07A 2I0HA 3KCKA 4YPSA 5BYZA 5HORA 5HHWA 5JH6A 3MJ1A 2I6LA 3OBGA 4P4CA 3KA0A 3QZHA 3ZRKA 4FT9A 3DBEA 5ETFA 3GENA 4DGGA 4E6QA 4ENXA 5K0XA 4LRKA 1QPDA 3PIXA 1U5RA 1DAWA 4H58A 2HYYA 3T8OA 3QL8A 4TYHA 3EWHA 5ACKA 3SX9A 3CBLA 5EHOA 1TVOA 5FM3A 2Q0NA 2UZWE 4XMOA 4CG9A 2QLQA 3EOCA 3VUHA 2R3IA 4BCIA 4DF3A 4F1TA 4HZRA 4O2PA 4DN5A 5J1WA 3VNTA 2B55A 3R9RA 1WBNA 3MIYA 3T9IA 3W33A 3V5LA 4M15A 4RJ3A 3GC0A 4D5HA 5CF4A 2IPXA 4IBMA 5KHWA 2OJJA 3KXXA 1GZNA 3OCTA 4M0ZA 4U40A 1JWHA 3AC1A 5IUIA 2G2FA 4YBKA 3N4UA 3UGCA 2PZ5A 4Z16A 2VTIA 3RAHA 4U97A 3TV4A 3HAMA 2G1TA 4GVAA 4ZSGA 3W2QA 3PJ8A 5DR9A 1MQBA 4XX9A 2F2UA 3HEGA 4YNOA 4CFUA 1GIJA 4FZFB 1A06A 3DTCA 4TWPA 1FQ1B 2GFCA 3ANRA 3OY3A 5EW8A 4GT5A 5FG8A 3GEQA 5DNRA 5LVOA 3PP1A 5DOSA 1OL7A 2C6LA 1JVPP 4M7IA 2WTJA 1OMWA 3PVBA 5BUIA 4FIGA 2P0CA 3D2IA 2BRHA 3ZZEA 5AAFA 1WCCA 2Z8CA 1GJOA 4G34A 4RVLA 5EDPA 4B0GA 2H6DA 2QU6A 3BWJA 3Q2JA 2W99B 4YLJA 2R9SA 2NNWB 4D1SA 2V5QA 4FYNA 4I4FA 4ONAA 1W83A 3HMIA 3SXSA 2WEIA 4GFGA 1SNXA 3EQCA 5I9ZA 3EQBA 4L01A 1SVGA 4QYEA 2GHMA 2C6OA 3HRBA 4NTTA 5CAPA 3UQFA 3LZBA 1AD5A 3G33A 1Z57A 4XOYA 1G3NA 5M53A 3E8EA 4O7YA 4PMSA 4KBKA 3BWFA 5EKNA 3DLZA 4D2PA 3GNIB 2Q0BA 3ODZX 3NUAA 2HZNA 4CMOA 1SZMA 4A9UA 4H3BA 4AA0A 5BVFA 2RG6A 1ERKA 3IQ7A 3MPTA 5J9YA 3OBJA 3CCNA 4J71A 2XVDA 3HKOA 4QMXA 4R7BA 4F9AA 4FKQA 4B8MA 5EOLA 5IMXA 4DLIA 4KUJA 3EQGA 4X3FA 3OROA 4D4VA 2O0UA 1P4OA
chains in the Genus database with same CATH superfamily
2O3PA 5H9BA 3TKUA 1JSUA 5HEZA 3UDSA 3DQWA 1GY3A 4D58A 4UWCA 4L7FA 3Q2MA 3TT0A 3MI9A 4FSNA 4ENYA 4XG8A 5CU6A 5DI1A 4A7CA 2UW7A 1REKA 2QOCA 3C13A 5EI2A 3ZXZA 3HGKA 1OKVA 3NNXA 2XK7A 2NPQA 4O6LA 4PQNA 3KK9A 3OW4A 3E62A 1H00A 2JIUA 4BCQA 5AA8A 4EOQA 5IA2A 5ACBC 5DMZA 5K4IA 4IM3A 5C9CA 3NYVA 2A2AA 3FMJA 3BI6A 2F9GA 4FSQA 4QNYA 1OBDA 4WNPA 5EKOA 5AP3A 4IWQA 4IE9A 5M4IA 1JQHA 4FV8A 2VTSA 2G2HA 2VU3A 2ZDTA 3DS6A 4R8QA 5AMNA 3ZFYA 4AP7A 4EHEA 4O82A 1OL6A 3QTRA 4C4JA 4CQEA 5AX9A 5I9XA 2XNPA 4WD5A 3VBQA 3R02A 1B38A 2YZAA 4XG3A 4ANNA 4D1XA 4YBJA 1XKKA 3QQKA 4MUQA 2PMNX 2X8IA 3W0SA 1YHVA 3ZUVA 3A61A 4FV3A 4R1VA 3KEXA 3WI6A 2ZOQA 3IGOA 3MH0A 4X7QA 3FI3A 4W4WA 3RNIA 4DGOA 4H1MA 4O22A 3FMHA 4M69B 4IH8A 2GFSA 5AX3A 3ORNA 5I9UA 2ZM4A 3CQEA 4MD8E 1GNGA 5IA0A 3KRWA 2BIYA 3MA6A 3UJGA 2YCQA 5CLPA 4F9CA 5I4NA 2G01A 5EM6A 3UODA 4KSQA 3E7VA 4RX7A 4EHZA 3FMNA 3VBWA 3IK3A 3KREA 4JG7A 2IVUA 4MXXA 4AZEA 3EZVA 4BFMA 4TN6A 2OIDA 4EK5A 5EQYA 2REIA 1H1PA 5H2UA 4PWNA 1J7UA 3CTHA 3A99A 4KNBA 4ZSEA 2BTSA 3ALNA 2FGIA 2JKOA 1KE9A 2GTNA 4ZY6A 3VIDA 4DTAA 2PMOX 1KE5A 4LOPA 3R7UA 3TTIA 3NUNA 3ATTA 4GH2A 2W1FA 4PL3A 1IA8A 4E7WA 2GS2A 3ZSGA 4YC8A 5EDQA 3RZFA 4GK3A 3LKMA 1OIUA 3O50A 4IACA 4UMQA 3S1HA 2J51A 2CGXA 2VX3A 3TZ9A 2XAMA 2O8YA 2PZRA 4RIYA 3UIUA 4XLVA 3SOCA 2NRUA 2RFEA 1P4FA 4LGDA 4LRJA 4RVKA 1L8TA 5BVOA 2XM9A 3FY0A 4S32A 1U4DA 4ANQA 4BRXA 4L43A 4CFNA 4F7NA 2JGZA 4O7SA 4CG8A 4OR5A 4DHZA 3CLYA 3QQJA 1GIIA 3QA8A 3I6WA 4IM0A 4E93A 2O5KA 4LUEA 3ORZA 4FIHA 1VZOA 1H0WA 4D4RA 4XV1A 3SA0A 2YM5A 4NM3A 4C4FA 4L53A 2Y8OA 4FTJA 3PPKA 3ID6C 1P5EA 2PYWA 4Y73A 4AW0A 4E4LA 1UA2A 4ZSAA 1BMKA 5BQ0A 3I79A 2VO3A 3D5WA 3V5TA 4O4CA 4RIYB 2UW0A 3UPZA 3P5JC 4AN3A 3DLSA 3FSKA 4FKTA 4J52A 3R8VA 5LVPA 3F5UA 3ZZWA 2PSQA 4GYGA 4EWHA 4DA5A 4I6HA 5IKWA 3DK7A 2XKCA 3BL7A 3G9LX 3RWPA 4JIKA 4QT1A 4FL1A 2J5EA 5GIOE 4JBQA 2JDOA 4G3FA 5HESA 4CTBA 1UNGA 2R5TA 4FEXA 4O84A 3NWWA 4ZTRA 5LMBA 2EB2A 2W17A 3O8TA 4O0UA 4G5JA 5AV3A 3NAXA 2YWVA 4LOQA 4C38A 1IG1A 3WOWA 4BCFA 3PIZA 3QYZA 4C57A 3D2KA 3C9WA 3BYVA 4BYJA 4TWNA 3A7HA 4BBFA 3DZQA 1CKJA 1PMVA 3Q3BA 5HLPA 3TWJA 4BDJA 4YTCA 2CKOA 2GNLA 2W9ZB 3BV3A 3EQIA 3OEFX 2I0VA 3DQXA 4BTKA 2BDJA 2IF8A 4FSYA 5HG8A 4EH9A 4WRGA 5C4LA 4C62A 2OF4A 3GP0A 2X9EA 2XIXA 3U54A 3IDPA 5E8XA 3DT1A 3WARA 2C69A 3MGYA 2XCKA 4P5ZA 2XRWA 3HMNA 2VX0A 4CLJA 4ANMA 2ACXA 3ODYX 4JR3A 3V5PA 5HTCA 3PTGA 3VRYA 4AXDA 5EQPA 2IW9A 3PJCA 3R2BA 5T68A 5J9ZA 4M84A 5M08A 1ZYLA 4E4NA 3PUFC 5T6KA 4ACGA 2XS0A 4HYIA 4MBIA 4W8DA 4XRLA 4KIKB 3V3VA 3VULA 4C2WA 4KS8A 2XP2A 4IWDA 5EHLA 3R8MA 4Z7HA 4BKYA 2B7AA 3O7LD 3D7TA 4AZFA 2UZTA 5HQ0A 2CCIA 3R30A 2QR7A 5D7AA 4A9TA 4W4XA 3ZBXA 4CMUA 1OITA 4I6BA 5BMSA 4O6EA 1YHSA 3NYXA 5C01A 5A6NA 3FHIA 3NDMA 1W2DA 2KTYA 3F9NA 4I41A 2CLQA 4GYIA 5IQIA 4BHNA 5HCYA 3A2CA 3N9XA 4EH5A 3KF7A 4H3QA 4A4OA 3MVLA 3QLFA 4IVCA 2BRNA 4F1OA 2IWIA 4TWOA 4CV8A 1KV1A 4K77A 2P33A 3OOMA 3QX2A 2CNVA 3W0QA 3SOAA 3BQRA 2EWAA 2B9FA 4FJVA 3EYGA 3ZBFA 3FQSA 4XRJA 5M07A 3G2FA 4QYYA 3UOLA 1U54A 1R39A 2VTAA 5FEEA 5CALA 2YM6A 3ZM4A 4KD1A 5HCXA 4G3CA 2IW8A 3UG2A 4RC3A 3MVHA 4M8TA 5CASA 3SVVA 3W1FA 2X81A 3IW4A 4JLCA 5L3AA 3G15A 4NM0A 1XBAA 3EL7A 3G6GA 3RM7A 3QGYA 4ZTHA 3CC6A 2YCSA 3KVXA 3MY5A 1Z9XA 3Q9ZA 4OTPA 3TNWA 5AP7A 2IO6A 2ONLA 4UYAA 3EKNA 3VS6A 4BICA 2XYNA 3G51A 2X1NA 4L9IA 1JPAA 3GU5A 4G6OA 4ARKA 5DYJA 1WVWA 2ZMDA 2R3OA 4FL2A 2UW9A 4YO4A 3AKKA 1JAMA 4BCNA 3P7CA 2YERA 4UX9A 3AOXA 3KGAA 3LFBA 4FTMA 5JFVA 3GFWA 1OIYA 3RINA 5KMOA 4M66A 1JSVA 3SDJA 4JS8A 2XIYA 4KBCA 3ETAA 3CIKA 3KXZA 4A9RA 2C3LA 4CRSA 5HICA 2YITA 4M14A 1OZ1A 4FSWA 4ERKA 4UWBA 3MY0A 4D4YA 3FZTA 3C50A 2BRBA 4AW1A 3JUHA 2C3JA 4AF3A 3I5ZA 2OI4X 4IB5A 2CDZA 3VBXA 5L2SA 4DT9A 1KWPA 3OS3A 3R8PA 1WBWA 3L9MA 2XJ1A 5CT7A 4FTOA 3PXQA 4HNFA 2RL5A 3Q4TA 5I3RA 4NSTA 4KIKA 3HDNA 4KABA 4GIIA 5IISA 3TACA 2YAAA 3C5UA 3DU8A 3PZHA 4U8ZA 2VTTA 2XK3A 5HTBA 2V62A 3BHTA 3R7VA 3UP7A 5A4TA 2PMLX 3PJ2A 4F70A 2GNFA 2VZ6A 4O4FA 5A14A 1UWJA 4CT2A 5A4QA 4AZSA 4ZTSA 3E5AA 3QKMA 3F3WA 3OWLA 3GB2A 4FSRA 4PX6A 4P90A 4AE9A 2QG5A 4JDHA 3BGPA 4YZDA 2O64A 4O4BB 1YKRA 3BEAA 4JX7A 4KIPA 3G6HA 3HYHA 4RA4A 5AA9A 4EHGA 5J5TA 3AMBA 4O38A 3ENMA 2R3MA 5AWMA 4MTAA 1QPJA 2BZKB 3F2AA 1Q61A 4ZY5A 3MV5A 3HV3A 5TOZA 1YI6A 2VD5A 3GU8A 3P7BA 4A07A 5BVWA 4CD0A 5AEPA 2GDOA 3ML1A 4J96A 5GNKA 3ELJA 5TKDA 4JIAA 5D11A 4BGQA 2UV2A 3W10A 5J7HA 5EH0A 1ZMVA 4QMYA 3OT3A 4ACCA 4AGWA 2ZFYA 1OIQA 2H9VA 2ZB0A 1YW2A 3OXZA 5AADA 2O63A 5JQ8A 4JBOA 1ZYJA 3VN9A 4MXYA 3R21A 4PPCA 5H8GA 3F7WA 5CNNA 4EOLA 2X39A 4OTWA 4KIOA 4QTDA 4F99A 1JBPE 4AOTA 3L8XA 2WFYA 3EN5A 4KB8A 1U59A 3LFNA 3Q5IA 3R83A 5AIRA 3VVHA 4HVSA 3EQHA 3UO5A 5ANIA 4FKOA 4K0YA 3GGFA 4CVAA 2YIRA 5IU2A 1PMUA 3C0IA 3MH2A 4FGBA 1E1XA 4FZ6A 3PSDA 5CWZA 4CLIA 4ZTMA 3VUDA 2ERKA 4EOPA 2FA2A 2IN6A 3JS2A 2QNJA 3PA5A 3B8QA 4O21A 4RQVA 4I6FA 5M56A 1V0OA 1YXVA 1HCKA 2C5NA 2JEDA 4OGRA 3RTPA 4MNFA 5IF1A 4YU2A 4ZSLA 2X9FA 4XV3A 3C4XA 3NYOA 4IHPA 3ULIA 2BHHA 4BCPA 5IQAA 2CNUA 1BYGA 4I92A 2FSLX 2B9HA 4R3CA 2DUVA 5F4NA 4EJ7A 5BVNA 3DBCA 3DK6A 3NS9A 5BMMA 3TUCA 2NRYA 3HZTA 1Q24A 2SRCA 3AC8A 2GNGA 4FKIA 4HYHA 4QTAA 3MVJA 4TYJA 4BJJB 4GT4A 2QOQA 1MRYA 3HVCA 4DG3E 2H96A 3TIZA 3ZO4A 2C5OA 5I9WA 3EFWA 4IW0A 3AC4A 1KOAA 3MW1A 4IDTA 3F69A 2W1DA 4F9YA 2HW7A 3G0FA 3MBLA 2QO2A 3SXFA 3JY9A 3RJCA 3PSBA 4FIEA 5CZIA 5C8NA 4IWOA 4WKQA 2OFUA 4FG9A 3NGAA 4GUEA 4I21A 4DEDA 4EBWA 3KC3A 3L8PA 3Q53A 2PK9A 3O0GA 2R7IA 4J99A 2W9FB 4W9XA 2PU8A 2VWYA 4PP9A 1ZOHA 3KMMA 3VWAA 3GQLA 3K54A 3CPBA 1Y6AA 4I0TA 4KKHA 4RJ7A 4XCUA 3PA4A 4FV4A 4FZAB 3SD0A 1R3CA 3QFVA 5KHXA 1U46A 2XNBA 3F5GA 3DAJA 2X6EA 3C5IA 5A4EA 3PSCA 4AN9A 1J7IA 1YQJA 3JXWA 2QU5A 5CX9A 4E6AA 1W98A 3GU6A 5CVGA 3ZU7A 5HG7A 4R5YA 3E87A 4EK6A 1NXKA 3E88A 4NFMA 3R8LA 2VWIA 5EYMA 4DAWA 3UPXA 5KNJA 2JDTA 2R3PA 4UY9A 4HJOA 3OWJA 3L9PA 4XP2A 5H8EA 3TUBA 4I93A 4Y85A 2WD1A 5BVDA 3D15A 2YACA 4AACA 4FKRA 3CD8A 4FZDB 3R7IA 3NUXA 5AR5A 3QXPA 2FB8A 4TZRA 3WIGA 3RWQA 1Q3DA 2AUHA 1PXKA 2C30A 3I4BA 4RA5A 4FBXA 3VHKA 4AQKA 2V22A 4PL4A 4USDA 4BKZA 5A4LA 2J7TA 2EXMA 4NZWB 5IQCA 4YP8A 4WOVA 3WYXA 4QDEA 1XH5A 3ZLSA 4YURA 4D2WA 4BR3A 2BUJA 4JRNA 2GTMA 1XO2B 1ZY5A 2CN8A 5IQEA 3FPQA 4ZTQA 3TYKA 4NKSA 1PXNA 3DBFA 4LV8A 3LQ3A 2YFXA 2Z60A 4YZCA 3Q4CA 5HLWA 2GCDA 2YJRA 1GZ8A 2XALA 4ZXTA 1ZOEA 5IUGA 4V0GB 4O0XA 3LLAA 4Z3VA 1M7NA 4QYFA 2VWXA 3D94A 3EJ1A 5M09A 3IW5A 1QMZA 4RZVA 4QPMA 4UEUA 4YJTA 5M55A 3UQCA 1XH7A 2C6TA 4L52A 4BJJA 4QP7A 3F3UA 3IDBA 4JOAA 3A7GA 3IDCA 4D9UA 3RAWA 4C59A 3LQ8A 4PTCA 4V05A 4EL9A 2NP8A 3OUKA 3FLWA 3OUNB 1URCA 4NCTA 2J4ZA 2P4IA 4FODA 4WBBB 1IA9A 3O51A 4NT4A 2ZJWA 5G1XA 4E26A 2XB7A 1URWA 4EC8A 5FD2A 4IADA 1Y8YA 2XKEA 2PL0A 5L2TA 2X7FA 3D0EA 3QUEA 2ITTA 4MYGA 5AUVA 4USEA 2C5VA 4JAJA 4ZLYA 3Q52A 3VBYA 2YAKA 4GKIA 2VO6A 4FT3A 3SG8A 3HRFA 4HPUE 5LARA 4USFA 3QD0A 4IANA 5KMIA 3NVKI 4ZJJA 3H0YA 3EQRA 5DPVA 3NIZA 3POOA 2PUPA 2JFMA 1H28A 4FEWA 4GS6A 4GU9A 4HGLA 4L42A 5G6VA 3ROYA 4R6VA 3PYYA 2VUWA 4X6RA 3U51A 4BCOA 4N0SA 4I24A 4BIBA 3VJOA 2GNJA 3M2WA 3PXKA 4OUCA 4I0RA 4XG2A 3WZUA 4TNBA 1WFCA 2PVHA 2VGOA 4BDDA 3ROCA 3SG9A 3GQIA 3C7QA 5KBQA 3M42A 5JT2A 5LMKC 4PPBA 4ZK5A 2DWBA 4QMVA 4JVGA 3E7OA 3O71A 3UQGA 2FH9A 4PF4A 4EK4A 3WE8A 1TKIA 3THBA 4PL5A 4RPVA 3LM0A 2PZIA 3BZ3A 5EI6A 4L3LA 1YRPA 5EDRA 2DYLA 2QOKA 4IJ9A 1DM2A 3QRIA 3FZOA 1SVEA 4QDVA 3BLHA 2X7OA 3OW3A 4F9WA 5HX6A 3RPOA 3TL8A 1MQ4A 4V0GA 4D5KA 3OVVA 4O0YA 3RAKA 4ANLA 3D83A 4D55A 3JPVA 4CGAA 2KULA 3R7EA 5F95A 3KIOC 3UOHA 3ZFMA 1KOBA 5L8LA 1WBTA 1PYEA 4BB4A 4B6LA 1PXIA 1REJA 3KB7A 4MCVA 3L8SA 4OTFA 3LXPA 3HMOA 4DCAA 4F78A 5DH3A 4YJVA 3DJ6A 1MP8A 3NCZA 3ITZA 3K2LA 3Q60A 4FK3A 4GL9A 2OJFE 2UVXA 2WMQA 1P2AA 3IECA 4IAYA 4IEBA 3H0ZA 4IX4A 4QMWA 4Y72A 5CU4A 4ANSA 4C36A 1UWHA 4DITA 4J53A 3DY7A 3W0NA 4AAAA 1CKPA 4EOSA 3DXNA 1TZDA 1M17A 1O6KA 2GHGA 4ZS0A 2Y4IB 4FTUA 4E4MA 2B0QA 4NM7A 1MRUA 3PVUA 3DOGA 3IW8A 3FJQE 3QU0A 4O7WA 2XKFA 1I44A 3FPMA 4FNXA 4KRCA 3WIKA 2W1GA 3KKVA 4FTRA 2H8HA 3NNUA 2C0TA 3LHJA 4LRMA 3P23A 4DH7A 3OMVA 4EUUA 2YIQA 4QP1A 4DEIA 1S9JA 1XWSA 4Q5HA 2UZBA 5LCKA 1M2QA 4DEEA 2ZM1A 1MUOA 4AOIA 3A60A 5D9HA 2ITUA 3C4WA 4RJ5A 1JKKA 2V7AA 5EYCA 1OECA 4N6YA 3NSZA 4HYSA 4FV9A 4DFNA 5M44A 4QMZA 3FHRA 4OTQA 3PXRA 5JN2A 4L7SA 4YR8A 4L67A 3CE3A 1PXJA 2GS6A 2I0EA 4XP0A 3P86A 3RM6A 5M4CA 4C7TA 3KRJA 3P4KA 5KCVA 3T3VA 2FUMA 3COHA 4C0TA 5BVKA 3MDYA 5K9IA 5FEDA 3H3CA 3GBZA 5HCZA 3RPYA 2QHMA 2YISA 3GOKA 3LFSA 3F3ZA 2PZPA 4L00A 1JOWB 4UV0A 2GQGA 2ERZE 2OWBA 4C3RA 4EH3A 5HGIA 5C8KA 1VLRA 1KE7A 1BLXA 4IVBA 4O0WA 5CU3A 5GZAA 5HIBA 4NUSA 4ZOGA 3VRZA 4KSPA 4NW6A 3GCVA 4O1PA 4WUAA 5FXQA 4FTCA 4B8LA 4EONA 3FDNA 4F0GA 3W0OA 3FY2A 5AP1A 3HV4A 2OZOA 3R7YA 1OL5A 2B53A 2X7GA 4FGRA 4AAYA 2VAGA 4IIRA 2JDRA 3D14A 4DFXE 1GAGA 3VONA 4LMNA 5IMEA 1IAJA 1ZZ2A 1QPEA 5E7RA 5BV3A 3VHEA 2RF9A 3H4JA 4MF0A 5BPYA 5GJFA 4BTMA 4BY9E 2YLEA 4JMQA 4G31A 1PJKA 4I5PA 4O7TA 2WMSA 2JDSA 3RKBA 5JKGA 4RIXB 3LFDA 2ITVA 3FKNA 3NUPA 4E1ZA 4EH2A 5KMKA 3SAYA 3FV8A 3LCSA 3ORLA 2VTOA 5FM2A 3B8RA 2W0JA 4YSJA 2YIYA 4RG0A 3ZO2A 1ZMWA 4YZMA 2QOHA 3KFAA 4CKJA 2PE0A 1WVXA 1XHAA 3EHAA 1PRYA 3HL7A 4RVMA 5AP2A 3RAIA 4CFVA 1ZYCA 3H9OA 4TWCA 2OU7A 4HVHA 4ZTNA 5HBJA 2ITZA 2YIWA 3JVSA 3R6XA 4P5QA 4CQGA 1Q99A 3G9NA 4PDYA 2BFXA 3MH1A 3QTXA 1DAYA 5TF9A 5CEMA 4FV1A 2B54A 4EZ3A 4FC0A 3BLQA 3FZRA 3KQ7A 3CXWA 5EHYA 2WQEA 4J7BA 5CZHA 3S95A 4XG9A 5K5XA 4MF1A 4CTCA 1LP4A 3G90X 4FNYA 3MA3A 3ET7A 3TXOA 3UYSA 4WA9A 4CZYB 3Q04A 4Q5EA 1ND4A 4J95A 1JKSA 5M4UA 2Y4IC 3CQWA 5J7BA 4H05A 1B6CB 2JIIA 4XG6A 4TYIA 1IRKA 5L4QA 4BKJA 4MKCA 3FLQA 3ZFXA 3R00A 3FMMA 4C33A 4U5JA 5DT0A 4C4HA 4OTHA 4LMUA 4G1WA 3TCPA 3BYOA 5CYIA 1BUHA 4C3PA 2P2HA 1CM8A 3WE4A 2Z7RA 4BDHA 2C6IA 4H39A 4XP3A 1YXUA 2ITNA 3OCGA 1OI9A 1T46A 4R1YA 4FKSA 1O6YA 3AD5A 4ZZMA 4QNAA 4IWPA 3BLAA 3IGGA 3OCBA 4FKGA 4O0TA 3DFCB 4IJPA 4NTSA 3TNIA 4PMPA 3BCEA 5KZ0A 1WBPA 1ST4A 5ETIA 5AAEA 4GK4A 5M06A 5M51A 4X2FA 3QAME 4LV5A 1WMKA 3B2TA 3AT2A 3KMUA 5EI8A 3BE9A 3LFCA 2WKMA 5ANKA 2IZSA 4HZSA 2WZJA 3VS1A 4CKIA 3AC2A 4AU8A 3N4VA 3QZIA 4WG3A 3C4EA 3JVRA 4FOBA 3MTLA 4RIXA 4WNOA 4HYUA 4XOZA 3QUDA 1YI3A 3OT8A 3WF7A 3IW6A 4FF8A 4CT1A 3M11A 1G8KA 2HOGA 3A4OX 4YUQA 2OF2A 4FV2A 3VF8A 2X2KA 2ITWA 4O1OA 2C1AA 4RWJA 3F82A 3QHRA 4ITJA 3TUDA 3VW6A 3ANQA 3BHVA 3LJ1A 4MWIA 3P5KA 1RW8A 4RVTA 3FEGA 4OBPA 4G9RA 3TNQB 3MFSA 3AD6A 4I6QA 3V51A 4CNHA 3Q6UA 2XK6A 3A7FA 4GT3A 4IB0A 3BLRA 3EYHA 5EOBA 3ZTXA 1PXPA 3DKGA 3UDBA 3IPHA 3FUPA 5IZFA 4CZUA 5CEIA 1GZOA 1X8BA 3ORIA 3P08A 4OTIA 3R7OA 3BYMA 4UZHA 4TKSA 1DI9A 4PMTA 4Y5QA 2WO6A 3E64A 1J1CA 5LWMA 2Z7QA 4B9DA 4XBRA 3W2PA 4AXEA 4M69A 4JQ8A 2XKDA 3T3UA 5DFPA 4E5AX 4DE4A 3PWDA 1F3MC 5LXMA 2P2IA 4U43A 1H4LA 1YXSA 3RK5A 1UKIA 4II5A 2WQMA 1Q3WA 4CFMA 2YDIA 2UW6A 3H9FA 4H3PA 4JBPA 2IJMA 3QD2B 4M0YA 3R8UA 4BDBA 3NNVA 3VUGA 4QMNA 3PUPA 4KINA 1OGYA 2PHKA 1A9UA 2UVYA 3D5XA 3R1NA 4MHAA 1M14A 2IVSA 2WMXA 3V04A 3C51A 4D0XA 4XLIA 2XCHA 1FMKA 2CPKE 2R3QA 3E93A 2EXEA 3R73A 4NEUA 3M1SA 4O81A 1CDKA 4BCMA 4MXZA 4L8MA 3EIDA 4J1RA 3WF9A 2YN8A 3F61A 4BDKA 4PRJA 2R3RA 5JEBA 3LW0A 4IC7A 5DE2A 1K3AA 3TDWA 1H1WA 1FGIA 3PRFA 2WTVA 4D0WA 1V0PA 4LFIA 3BU3A 5CANA 1ZYDA 3GC9A 1V0BA 4YLLA 5E1EA 5AUYA 4K18A 4JG8A 4EC9A 4J97A 2O2UA 4DC2A 4U9AA 3VS3A 5JSMA 3BX5A 3DV3A 4C8BA 3QTIA 2BZJA 4YSMA 2C47A 3MFUA 5AR3A 4LQMA 4K11A 3RGFA 5I3OA 2W7XA 4K2RA 3DNEA 2X0OA 4AW5A 4CXAA 2CKPA 2H34A 1I09A 4WG4A 3QRJA 4FTKA 2ZYBA 1OL2A 4GCJA 4RZWA 3A8XA 4QQCA 4C4EA 2YM4A 4DEGA 2XNEA 1U5QA 1OKWA 4YGAA 3QKLA 3ZUTA 1IASA 4D2TA 5HVKA 2HZIA 5IQGA 4FVRA 2BAJA 4N4SA 4AG8A 2W1IA 4YTIA 1XBCA 4XNEA 2EB3A 4APPA 5IH5A 2ZM3A 3ORKA 1EH4A 2PVRA 2JITA 3FQEA 4QTCA 5FTGA 3RK9A 3ZONA 5GZ8A 2I7QA 4C02A 4IDVA 1UNLA 5FGKA 4FEUA 1Q5KA 3W18A 5FP5A 5C03A 2PE1A 3FMEA 4ZIMA 2RKUA 3HV7A 3UIBA 3OCSA 4G5PA 3UO4A 3OTUA 2AEGA 3RHXA 4DBXA 2NYAA 2J5FA 3PPJA 4O91A 3L9LA 5DN3A 4BDIA 4IZ5A 5B2KA 2YCRA 3KXGA 4Q9SA 4I5CA 4UMUA 4HW7A 3QTUA 3LCOA 4QEBA 3EMGA 3RMFA 1RQQA 3BKBA 4YZ9A 2BIKB 4AT5A 4DLJA 4EZ5A 4HCUA 3FZPA 3LCKA 4UB7A 3V8TA 4XEYA 5ANGA 4Z7GA 2QQ7A 2ZV9A 2ZV2A 2E9NA 5L2QA 4AZVA 2B1PA 3R2YA 4DEBA 5EFQA 5CSPA 3CJFA 2J0MB 5LVLA 4BC6A 5J9LA 3BE2A 2W5BA 3R28A 1R1WA 3KXHA 2JDVA 4DH5A 4Y83A 5E8ZA 1RE8A 3V5WA 4P2KA 3FI8A 5HVJA 4E73A 2ZMCA 4ITHA 4RC4A 3VS5A 3ZLXA 4JQ7A 4AA4A 5IH4A 4FA2A 5BX0A 2XBJA 3FWQA 3S4QA 3QCQA 3V8WA 4RSSA 4EQMA 3VS2A 3CY3A 3HX4A 4ACDA 2OFVA 5LWNA 5GZ9A 1LEZA 3T9TA 2WMVA 1FGKA 3GXLA 4QP3A 3BYUA 4KKEA 1UKHA 3QX4A 2CCHA 3R63A 2PPQA 4G16A 4BWPA 3HV6A 4TL0A 4KWPA 3NIEA 1QPCA 5KX8A 2VTRA 4WBOA 2J9MA 4BGHA 3A8WA 4IAIA 4ZP5A 3EL8A 5CENA 3SV0A 5DGZA 3F5XA 3NMUF 1OIRA 3BU5A 4G2FA 1Q8TA 1YXXA 5AIKA 4ALWA 3IW7A 5H8BA 2BDFA 2V7OA 4G3GA 1Y6BA 3DXQA 1UV5A 5AR2A 4IAFA 3FL5A 2CKQA 3GI3A 2VWVA 5DA3A 4CFFA 4FYOA 4IFGA 2QOOA 1ZARA 3FLZA 2W1HA 4S34A 3ZYAA 3LVPA 4FUXA 2OJIA 4QP8A 3UDZA 4L3PA 1PMNA 3IO7A 3C4ZA 4EBVA 4B4LA 2E9PA 4E5BA 3RALA 2X6DA 1B39A 1XJDA 1UNHA 3ATSA 4O7LA 3BYSA 3OOGA 3GVUA 3V5JA 3CP9A 4GSBA 2XF0A 4M13A 3KY2A 3PE1A 2IZRA 4DCEA 3PPZA 2RGPA 3CGOA 4D2RA 5CSHA 4EH8A 4HOKA 4QMUA 2NO3A 4F6UA 5BYYA 4A4XA 5A3XA 1ZOGA 4TPTA 3MWUA 4BZOA 5DHJA 4I94A 1L3RE 4DEHA 4BBEA 3SKCA 3PIYA 3QTZA 4YC3A 3R9DA 4AOJA 2F7XE 2WELA 2QD9A 2X0PA 3FE3A 2CKEA 2JKMA 3UYTA 3PY0A 2GMXA 2OXDA 3F3TA 4GG5A 2R4BA 2QR8A 3AMAA 4IC8A 5EYKA 3LAUA 4CFWA 4U6RA 5JFSA 3QF9A 5AUXA 3LOKA 4ZLOA 5AV2A 2C1BA 2Q83A 3D7ZA 2PUUA 1UU8A 3TNHA 5IQHA 3I0OA 4Q9ZA 4FTQA 2R3JA 2OG8A 4GJ3A 5EG3A 1W84A 3K3JA 4M67A 3QUPA 3GCPA 1W0XC 2G15A 4IAAA 5KZIA 2OZAB 2VX1A 5J1VA 4ASDA 4YJUA 5C8MA 4D4SA 1S9IA 2RSVA 2VWWA 2BRGA 2R3LA 3NYNA 4HCVA 3MYGA 4O2ZA 2XZSA 5FBNC 4DH3A 3ZO1A 4A9SA 1XMMA 4LOOA 4LV7A 3R1SA 4FKWA 5A54A 2V55A 3SC1A 3BU6A 1YDRE 3OZ6A 4E5WA 1GZKA 4GFOA 3I81A 2J0JA 3BELA 3DJ5A 4G17A 2XK4A 4R3RA 4DDGA 3EFJA 4BL1A