5HCZA

Egfr kinase domain mutant "tmlr" with 3-azetidinyl azaindazole compound 21
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
324
structure length
300
Chain Sequence
GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELTSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYDMDDVVDADEYLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of a Noncovalent, Mutant-Selective Epidermal Growth Factor Receptor Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
total genus 91
structure length 300
sequence length 324
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hczA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hczA01
3A7FA 4OTWA 4U44A 3FLQA 4GK3A 5CASA 2UW0A 3HDMA 4J8NA 3KREA 4I22A 3KKVA 4M97A 3VHEA 4DHFA 1Q61A 5B0XA 3RK7A 4QRCA 4IHPA 3LXPA 4FIFA 4ZTNA 3GNIB 4F0GA 4IVAA 3UP7A 2EVAA 4ZY4A 1KV2A 2PVKA 2VTOA 4YGAA 2P0CA 1JVPP 3PSDA 5A9UA 2REIA 4JRNA 1ZYLA 1BKXA 2R0UA 2RF9A 2WTJA 4FTCA 2WQNA 3ZFYA 4CRLA 4O6LA 4DGMA 4DN5A 2PZYA 4PQNA 1H1RA 1UKIA 1AD5A 3V5WA 3R21A 3AQVA 4HYIA 5FXQA 4NSTA 3LCDA 2XIYA 2GTMA 3A4OX 2ZV7A 5CZHA 5I5ZA 5CQWA 3VF8A 2WTVA 4RFYA 2R3IA 2OJIA 2YIXA 4CXAA 5E8SA 1SM2A 3BU5A 4XUFA 4E3CA 3NIZA 5E8YA 2R3GA 2Y4PA 3F61A 3HEGA 1MRUA 3B8RA 4L9IA 5CSXA 4I20A 3BGPA 4FZFB 4IX5A 4DT9A 3D5UA 4NUSA 4TYIA 2WFYA 3LPBA 5CU4A 5JGAA 4QMYA 3K54A 3MPAA 4DEBA 1E1VA 5EM6A 4HZRA 4JDJA 3R9NA 2CCIA 4CFXA 1W82A 5DR9A 4BBMA 4XP3A 5M55A 3VQHA 5E4HA 4USEA 3QRIA 5B2LA 1O9UA 5T68A 5DHJA 4EBWA 3HV5A 3NUAA 3G6HA 5FBNC 5H2UA 1Q4LA 4FL2A 5B7VA 4L46A 4MTAA 1VYZA 2X8EA 3LFEA 4G3FA 2FYSA 4ZSJA 2X6EA 3PXRA 4H3QA 2J0MB 3FC1X 3AGMA 1CKPA 4JR3A 4YZNA 2ZOQA 3NAYA 2WMSA 5IU2A 2YLFA 1FVTA 1MUOA 5E8ZA 4C4IA 4QTEA 2VV9A 5C4LA 3LFQA 3ID6C 3THBA 3V5PA 1MQ4A 3SAYA 1R39A 4LV5A 2NP8A 4QD6A 5TT7A 2ITVA 4E4MA 2YAAA 5CEIA 2C3KA 4AN3A 5J5TA 1H1QA 3OT3A 5D7VA 2QKRA 3EQBA 4BRXA 4TWCA 4LL0A 3RNYA 1PKDA 5IMXA 2ERZE 4R1VA 4ONAA 5EI6A 4O0SA 4JAIA 2UVXA 3V01A 2W1HA 3ZU7A 3TNQB 4BIEA 4BCKA 3R1QA 4XV9A 2J7TA 5KZ0A 5M4CA 2WMAA 3ZC6A 3LMHA 3HA8A 2A0CX 5TKDA 2IG7A 3HAVA 4AS0A 2OZAA 3BGQA 3FLNC 4EOQA 1PMNA 4TYEA 5IPJA 1XBAA 3FYKX 3VS0A 3IS5A 1W84A 2X4FA 3ENHA 4OR5A 4IXPA 2J0JA 2XKDA 2ZB0A 1OL2A 3KXGA 4C3RA 3DQWA 4G6LA 5ANEA 5AP7A 5FEDA 3JUHA 3RZFA 2O0UA 3L9MA 4Q2AA 3TKHA 3O71A 1OGUA 4DFXE 4DGGA 5CVGA 3DS6A 2C6MA 3HV7A 2WU7A 5AMNA 4A9SA 3FLYA 2J5EA 2WTKC 4OT5A 4X3FB 3ATTA 4J1RA 3R71A 4YTHA 3OUNB 2QR7A 3PIZA 4I94A 4PNIA 3RM6A 4RSSA 2O2UA 2XNPA 2RKUA 1UKHA 3BX5A 3QTXA 2VO3A 3NEWA 1Z57A 4GCJA 5EM7A 1J1CA 1FGKA 4QYYA 5KKRC 3H9OA 3GCUA 5E92A 3Q9WA 1XO2B 4JI9A 4FKVA 2JKOA 5EOBA 3LXNA 4ZTHA 4CFNA 3RMFA 1OBGA 5DPVA 3A7HA 5DE2A 4NEUA 4BIBA 5CZIA 4ZTRA 5CY3A 2Q83A 2YN8A 3QXOA 1HCLA 5HG9A 4LGDA 1KUTA 3IPHA 4DH7A 3A4PA 5KMLA 3HRBA 4O7WA 2W4OA 5CSPA 1UU3A 4XG4A 3GCSA 4QMUA 4O0WA 3AXWA 2OG8A 4IQ6A 4ANSA 4UN0C 3WIKA 5A54A 4JQ7A 3COIA 4R78A 3R8MA 5FDPA 2C6KA 4IM2A 4X2JA 3PVUA 2BROA 5CU2A 3FZ1A 4Z55A 1YKRA 2F2UA 4B4LA 3SHEA 2B9FA 4OTFA 4G1WA 2H8HA 5FRIA 3T3UA 3IW8A 3MYGA 4FKJA 5E8TA 3REPA 4JVGA 3RPYA 2PMIA 4PTGA 5FM3A 5AP3A 2CJMA 3HKOA 3OWPA 3P7AA 4S32A 3SRVA 4NTSA 5KMKA 4E5WA 4RLKA 4RJ3A 1UNHA 3SOAA 4N70A 4EK6A 4M68A 4D2PA 5I9ZA 5EDQA 4RX5A 4RJ4A 5D1JA 3FZRA 3HZTA 3CGOA 3FSKA 2FSTX 4NTTA 4GKIA 3EZVA 2H9VA 4FIGA 3NNUA 5EW3A 3RK5A 3BPRA 4Z3VA 3TM0A 5AFVA 2J0LA 5JZNA 5M44A 5EYCA 4UY9A 3V8TA 1YDTE 3MIAA 1YXXA 3O51A 4HZSA 4BTJA 1NY3A 4RX7A 4TWPA 4DEIA 4V01A 4LL5A 1TKIA 2CPKE 2NRUA 2VO0A 2X7FA 3HNGA 1JPAA 3LCSA 1YWRA 3DLSA 3EQHA 4QPSA 4AE6A 5IDNA 1B39A 5CEPA 2XIRA 2HXLA 3FMNA 4JOAA 4FSZA 4I41A 4EKKA 3BCEA 3D15A 2X9EA 3MTFA 1FGIA 1H0WA 2QNJA 3TUBA 1BLXA 4D2RA 4TWNA 3HGKA 3A8WA 5EM5A 3BV3A 4HVDA 3W2PA 4XLIA 2C6EA 3HMOA 2Z7LA 4BCIA 3JR1A 4FNYA 4BL1A 3EN5A 4PDOA 3TZ9A 3ZONA 4DEGA 4D55A 5AP1A 5HLPA 3I5ZA 5L8JA 4U79A 1W98A 3PDTA 1STCE 3FKOA 1OL1A 3NGAA 5I3OA 5GZAA 1LUFA 2RG6A 4BFMA 1KE9A 4E4NA 1OUYA 4BTKA 4OTGA 5FBOA 2O8YA 2QOQA 4YLKA 3SOCA 3QUEA 4AF3A 4C0TA 1NA7A 2XM9A 4GKHA 3UODA 4IIRA 4XX9A 3AT4A 3N9XA 3BYMA 4PMMA 3E63A 2Y0AA 4DFNA 5AAGA 1REJA 3FI2A 3RM7A 5IH4A 5EQPA 2QONA 4CG9A 5IQFA 4GU6A 2BDFA 2W9ZB 1IA9A 4ZZNA 2CMWA 5L2TA 3QA0A 4NJ3A 3ZOSA 1SYKA 2ZMCA 4EKLA 2YDIA 4BDFA 2XIXA 4U3YA 3DJ7A 2Y7JA 3NX8A 4LYNA 3KC3A 2HIWA 2YIYA 1Q8UA 4HCTA 3GOPA 3T9TA 4CV8A 4UWYA 4Y95A 5HX6A 2PVYA 3CD3A 3QHWA 3VBQA 4W4WA 4FIEA 1OVEA 4CZTA 3SVVA 2QCSA 4O0UA 1YI6A 1QPJA 4AQCA 4BR3A 4I5PA 2BILB 1DI9A 3UBDA 5J9ZA 4IX4A 3TZMA 4ACGA 4JX7A 4EOSA 4XG6A 5CU0A 3W10A 5KUPA 4MX9A 5L6OA 2PYWA 4UZDA 5KMNA 4RGJA 4D4VA 2C0TA 5L6WL 4ARKA 5AV3A 5EDPA 2G2HA 5IA2A 2PZ5A 2Y8OA 3TEIA 1SVEA 3OCGA 2Z60A 5BVOA 5IF1A 4GL9A 1NVQA 4W4YA 3FMMA 4Y72A 3GQLA 1DM2A 3KQ7A 4BGQA 5CAPA 4ANOA 4FKQA 1SNXA 5CT7A 3EQDA 4FG7A 3UQCA 3CQWA 2GNGA 4HVIA 2WTCA 3LFSA 4DAWA 2WZJA 5A4QA 2YWVA 4FZDB 5HE2A 4ACHA 3VW6A 1OKWA 1Q8YA 2WTIA 3PA5A 4RX8A 4Y83A 4A9TA 3BWFA 5LVOA 4F9BA 4CLJA 4HYSA 4D2WA 5AA8A 2WQMA 2OGVA 4EI4A 5KNJA 4PF4A 4PL4A 4DH1A 3QHRA 4F6SA 2X7GA 4IACA 2BZHB 5HE0A 5BMSA 4AE9A 2V22A 4QMLA 4GYIA 4XBRA 3NWWA 3R7GA 2RIOA 3GGFA 2BIKB 2V7AA 2H34A 3BU3A 4IB3A 1JSTA 2VNWA 4XBUA 4Y5QA 4O96A 3OZ6A 3LQ5A 3WF5A 3OT8A 3Q60A 3O8TA 4JDIA 4M67A 5HBJA 4RRVA 3A62A 4AW0A 4WSYA 1H28A 4V0GA 3S00A 4D4SA 3UOLA 2PVHA 2YCRA 4FV5A 3A7JA 4EONA 4LM5A 4P90A 1TQPA 1U46A 4NFMA 4PMTA 4QMQA 3LFNA 4FA2A 4M15A 3C4EA 1M7NA 2ZVAA 4YO6A 3AD6A 5CAVA 3P4KA 4U81A 3U87A 2W96B 3MGYA 3SG8A 5CSVA 4JS8A 4FTTA 5LOHA 2CLQA 3ZEPA 4L44A 2O64A 3GFWA 4FTQA 4C4GA 5BYLA 1FMKA 2ESMA 3V8WA 2YABA 5BUEA 5IEVA 4DF3A 4GW8A 4TT7A 3E8NA 4ZK5A 2OXYA 3GC0A 2Y4IC 3VRYA 4ZSAA 4NWMA 4P7EA 3EN6A 3LFCA 3ZEWA 1Y6AA 3ZO3A 4LOQA 3ZUUA 2GPHA 4OW8A 4FVRA 4OTQA 4UWCA 2XZSA 1WBOA 3RPSA 3UYTA 4GUBA 3LLAA 3LOKA 3DAJA 3CJFA 4JXFA 3E8CA 3TN8A 4AGWA 4WG5A 4FL1A 1OM1A 3AC8A 4O0XA 4RIXB 3ZSHA 4QMMA 4BCJA 2B4SB 4IW0A 3LZBA 4FSTA 4MBLA 5HTIA 4KAOA 4ZLZA 4DCAA 2CN5A 3I5NA 3RBWA 3QZFA 3U4UA 5HICA 4IVBA 5A4TA 1YXSA 4X7QA 1PYEA 2EU9A 4IVCA 4HCVA 1WFCA 3RHXA 3UQGA 3QBNA 5C4KA 1SVHA 3OY1A 3QD4A 4IWDA 4F0IA 4FV2A 4DGLC 3FL4A 3R0TA 2BKKA 3HLLA 4L43A 3NNWA 5F95A 3KMMA 5F94A 5IA5A 1YRPA 4M3QA 5AR5A 3GC8A 3QLGA 4XYFA 3ZZEA 5DNRA 4ZAUA 3KK8A 2VTRA 4L8MA 2JKKA 2Z8CA 3GCVA 3MA6A 3POOA 5IEXA 2OSCA 3TKUA 5D11A 4G9RA 2C6DA 5L2QA 4O7RA 1Z9XA 3G90X 3OG7A 2BHEA 2IZUA 5DYJA 3EQRA 2CNVA 2UV2A 4D5KA 1H01A 4DTKA 3LMIA 5DG5A 2VZ6A 2PUUA 4JIAA 3QLFA 3V5TA 5D9HA 3I0OA 5LVMA 1FBNA 3KVWA 2QOLA 2J0KA 5EW8A 3ZS5A 2R3PA 3CXWA 1GAGA 2E2BA 3NYOA 3QRKA 4FKWA 4FUXA 4IANA 4U97A 2PULA 2PY3A 3I79A 3GB2A 4O6EA 2I0HA 4IJPA 4OBPA 2GNLA 3FMKA 2BTRA 3E93A 4QP6A 3HUCA 3AC4A 1J1BA 1PKGA 5TOZA 1YXTA 4A07A 4ZTMA 1MP8A 2HK5A 1SMHA 2XBAA 2Z7QA 5E7RA 3C0HA 4YR8A 3DXQA 2VO6A 2VTLA 1H00A 2YDJA 3O96A 3V51A 4UYNA 3F7WA 1M7QA 2VWVA 3I6UA 2UZOA 3IDBA 4FTAA 1G3NA 4ACDA 4MD9E 4L45A 5GHVA 1CKIA 4YJSA 4X2NA 3TNIA 5FEEA 5AR3A 1J7LA 5D7AA 3SGCA 4DH3A 1EH4A 2F4JA 2C1BA 4YJTA 4I6QA 5DRDA 3I4BA 5F1ZA 3KY2A 4YJVA 4K11A 3C50A 4JG8A 4X21A 2R3RA 4AT3A 2G9XA 2GHMA 5AR7A 4USFA 5FLFA 3TTJA 3KFAA 1OIUA 1P2AA 3BBTB 3PLSA 4W9XA 4YTIA 3V5JA 4BWKA 5AV4A 2IZSA 4M8TA 2YIRA 5A6NA 1ZZ2A 2IN6A 3CTJA 3BHHA 3FKLA 3GVUA 3PYYA 2J51A 4F9CA 2OWBA 3SLSA 3FQHA 1A06A 3Q5ZA 2XNMA 4IM0A 4Y5HA 1FINA 3PA3A 3U6HA 5LVLA 5K0XA 5DN3A 2R3LA 2V62A 1HCKA 3UNKA 5J5SA 2WMUA 5FEQA 2NPQA 4X3FA 2CNUA 3GT8A 4KIOA 4PDYA 2WO6A 2ITUA 1F0QA 4MHAA 3EYHA 2DUVA 2F9GA 5ANDA 3U55A 3RWPA 3ZBFA 4E6DA 3CPBA 1Q8WA 3G0FA 2C30A 4AW5A 2GNJA 5BQ0A 3D83A 2PUIA 5KO1A 3NR9A 5HG8A 5DVRA 2C5OA 2WQOA 5L8LA 4OT6A 3R7YA 4C35A 4XG9A 5KBQA 1M52A 1KOAA 3FLZA 4MXCA 5HQ0A 2PMOX 5I9VA 2E9VA 1IG1A 1BI8A 4YJRA 2GS7A 3QGWA 2OW3A 2UW3A 4RA4A 1OL7A 2GQGA 3NUXA 2JLDA 1ZRZA 1XH8A 1YOJA 4NKSA 1ZY5A 4U7ZA 3R7EA 5IA1A 3NYXA 5M09A 1O6LA 2BRHA 5BVWA 3BEGA 4YC6A 2WMQA 3QFVA 3GU7A 3CGFA 4CMUA 2QO2A 4RWIA 4UWBA 3BHVA 4C34A 4QOXA 4U40A 4XMOA 3VNTA 5C1QB 3UZTA 3RP9A 4J99A 3ANRA 3G6GA 4KSQA 4FSWA 4BF2A 4IC7A 3ETAA 4EZ3A 1YOLA 4FKRA 4PL3A 1R0EA 4JRVA 4FV0A 3VJNA 4CKRA 5C8MA 4LG4A 3DXPA 1HOWA 4E73A 1T45A 2PE1A 3ZDUA 3AMAA 4D1ZA 4J97A 4KWPA 3A61A 3DTCA 2C6LA 3MTLA 4YU2A 4K33A 4BDJA 4H36A 3VUTA 2XNOA 3NYNA 4C58A 3BIZA 5CEKA 5JZJA 2OICA 3PPJA 4L7FA 5IH6A 3TG1A 2JFLA 4AT4A 4O83A 4S33A 5AAEA 2GSFA 5BMMA 3VC4A 4F70A 1M2RA 3VW8A 3RK9A 4XNEA 4FTIA 2XNNA 3DB8A 3ZLXA 1W8CA 3PY0A 4Q9SA 4DINA 4RVLA 3AC5A 1PMVA 4Y73A 4HYUA 5BUJA 2WAJA 3AD5A 1UNGA 3GENA 2UZDA 3OWLA 3Q9XA 4JBVA 3FPQA 4EH3A 1YXUA 3H9FA 4LOOA 5KE0A 2WEIA 3U9CA 2CN8A 2YM7A 4H1MA 4NCTA 4D5HA 3VS2A 3C0GA 4FK3A 1U5QA 3WZKA 4EQMA 5CXHA 5IA3A 4K8AA 4QNAA 3IGOA 4FT9A 2QOCA 1YI4A 4M0ZA 5KMOA 3G51A 3PJ1A 3VBYA 3A60A 4C4HA 3PVGA 4D28A 1CKJA 4YHJA 4GV1A 3UQFA 3POZA 2WMWA 2FSLX 2VTPA 5ITAA 1XH4A 3UVQA 4G31A 5I9WA 5EM8A 2G01A 3ZFMA 3TL8A 3SRVB 4O84A 4MWIA 2VTTA 5DT3A 4FGBA 2AC3A 3PY1A 2VWZA 3EQFA 4O91A 1ZMVA 3LHJA 2BFXA 3UVPA 1AQ1A 2PZPA 1WVXA 1H25A 4KBAA 4B8MA 5ACKA 3VWAA 3DFAA 5G6VA 2X4ZA 3Q5IA 1M2PA 2X8IA 3VRZA 4AUAA 5DA3A 4M69A 2JBPA 2ZAZA 2Y6MA 5IDPA 2R3MA 5I3RA 5L8KA 3MH1A 2XNBA 3WZEA 2BZJA 3KRRA 3EN9A 4F9WA 4P5ZA 4R3RA 3DT1A 4G5PA 4UZHA 4A7CA 4YZ9A 4B0GA 4DBNA 4K0YA 4PTEA 5EFQA 4YJQA 3LKMA 2VO7A 4PTCA 4CSVA 2E9OA 4FYOA 2ITQA 4QQCA 4B6LA 1RJBA 1BMKA 2YCFA 3PWYA 3NYVA 3PA4A 4YLLA 4KD1A 3GU6A 4FSUA 3EOCA 3CC6A 3PSBA 4GJ3A 3WIGA 4D2SA 4IJ9A 4AZEA 1IEPA 2VX1A 4QMZA 5AUVA 5M08A 2VWIA 3C0IA 3Q2JA 2Z2WA 2XRUA 3BYSA 3OTVA 4UX9A 2QG5A 1JQHA 3DK3A 3EFKA 1OKYA 3RJCA 1I09A 4QMTA 3FJQE 3UIMA 4R7IA 4HOKA 1ZLTA 1OI9A 4TXCA 3PRFA 4NCTC 3UDBA 3ZO4A 3ANQA 2BCJA 2FGIA 4GFOA 5HG5A 3MB7A 2E9PA 3SA0A 2IPXA 5CF8A 4RFZA 1LP4A 4KUJA 4G6OA 4RX9A 2BDWA 3UGCA 2GFSA 4MXZA 4P4CA 4EOIA 2JIUA 5C8KA 4O7ZA 5DEWA 3DZQA 4D4YA 1NW1A 5JFWA 4ZZMA 4C38A 4OGRA 4BY9E 4GG5A 3DJ6A 4WKQA 2C6TA 5HO6A 4Z7GA 3RAWA 4PDSA 2IZTA 4BTMA 2CGUA 3PWDA 3BRBA 3MPTA 2B9JA 1IR3A 2R3FA 3QC4A 4DEHA 4F6WA 3T9IA 4GU9A 5AM7A 4A9YA 4UYAA 5AP4A 1JSUA 3R9DA 3BEAA 3MB6A 4TNBA 4AU8A 4QTAA 4CV9A 5M56A 4ITHA 4IWQA 4S34A 4YUQA 4WOVA 4RJ6A 2ERKA 4WBOA 3MY1A 4RVTA 1FPUA 4LFIA 3OW3A 2XM8A 4S2ZA 3FXZA 4ZZOA 4K9YA 5LJJA 3ZRLA 3UZRA 2BR1A 1UU8A 1VR2A 4FKIA 3AC2A 3DAKA 3KXMA 2WIHA 4FKLA 2VTHA 5B2MA 2HOGA 3KULB 5J87A 3QTZA 4PV0A 2HY0A 2PUPA 2YHVA 4C02A 4OTRA 4F08A 2F7ZE 4EK4A 2VWUA 3AMBA 3ORIA 2C4GA 3RI1A 3ZTXA 5IUGA 3R7VA 3KCFA 4AGCA 3QWKA 4PUZA 5FP6A 4WRSA 2E9UA 4XV3A 5JRQA 2XK8A 4AFEA 5HTBA 3KRXA 4E5BA 3PJCA 3ZXTA 4YTCA 3IG7A 4AGUA 3M11A 4KA3A 4YZDA 5IH5A 4ITIA 3QC9A 3OROA 3ZFXA 3QTWA 4QYEA 4XRLA 3EFWA 4NK9A 3L8VA 2A4LA 3RAHA 1BUHA 3IGGA 4BGHA 5T3QA 5HI2A 2EXEA 1JKKA 4AACA 2J9MA 2QVSE 1PMEA 4C57A 3Q96A 4PMSA 2XK6A 4O0RA 2W5BA 4BN1A 3WE8A 5CAUA 2BZIB 3MFRA 4BCGA 4I1ZA 2GHLA 3L8PA 2R3OA 4DTBA 1FOTA 2AUHA 1H07A 1WBTA 3QD0A 1PMUA 2VTIA 3KF4A 4AT5A 3VULA 4ERWA 5JH6A 4R7BA 4ZTLA 3CEKA 5LWNA 1OBDA 1GJOA 4DA5A 4EUTA 2C3IB 4UMUA 1W0XC 2P55A 2PVMA 3HRFA 1FVRA 4FEUA 1M14A 3UMXA 2PZRA 5DLSA 4IEBA 4JNWA 5GZ8A 5D12A 1YOMA 2OI4X 4ID7A 1PHKA 2C47A 2UW6A 4J53A 4FI1A 3PJ8A 1XHAA 2RFEA 3BLHA 3NRMA 2Y4IB 4WRGA 3FMJA 4EORA 3OOMA 4WNMA 5ANOA 3OXZA 3CJGA 4LGGA 4R7HA 2YFXA 3WF8A 4BVUA 4EC8A 2QC6A 3II5A 4FUYA 3C4FA 4FVQA 4MEDA 4O27B 4TYHA 4WNOA 3R7IA 5AP6A 3BQRA 4AOJA 4IDTA 4MWHA 2YDKA 5JFXA 1GOLA 4JJRA 3W32A 5IQAA 2UW5A 3BU6A 4QPAA 4QMOA 3DZOA 5F4NA 3FI3A 5CS6A 2XKEA 3DV3A 2C5YA 4ANBA 1JSVA 3PUPA 3KN6A 2IWIA 3TZ7A 5KBRA 3Q9YA 4FV4A 3G5DA 2PUNA 2YAKA 3CSVA 4RIYA 3AT2A 3DDQA 2QU6A 4XV1A 3ROCA 1JKTA 4J95A 2P4IA 1JLUE 4ALWA 2C5XA 2DWBA 4PPAA 1A9UA 5FQDC 4EWQA 5LARA 2QU5A 4ZOGA 2YM3A 3FDNA 4ZS4A 3VO3A 5BVNA 2XJ0A 3HECA 3FQEA 1H8FA 3HYHA 3R30A 2FSMX 4EH9A 3R9OA 4BB4A 3ZMMA 2OJFE 4H05A 5EG3A 3BYVA 1GZOA 3DBCA 3ODYX 1YQJA 2O65A 4G17A 4O38A 4MNEA 5AP0A 3DGKA 5CANA 3MWUA 5GZ9A 4QYGA 4KIQA 3IDCA 1NVRA 4ZS0A 1ZWSA 3FHRA 2YERA 2EB3A 1YW2A 4BDAA 4DGNA 1R0PA 1L8TA 5AV2A 4OTPA 4V04A 4XG7A 1GZ8A 4ACCA 4RIWB 4E8AA 4X2FA 4NKAA 5HIEA 2R5TA 2F7EE 3Q53A 5LXMA 4PRJA 5IZFA 5KMIA 2ZDUA 1J91A 4CRSA 1DI8A 4BCMA 2W99B 5GJGA 4OLIA 5H9BA 5HO7A 4Z16A 4BHZA 2B1PA 3EH9A 2GNHA 1R3CA 1OZ1A 3VJOA 5BYYA 3QZIA 4FTRA 4QMXA 4EYMA 5AP2A 2WXVA 4JG6A 1YDRE 3LIJA 4MXYA 4AN2A 5CQUA 3MH2A 3EQGA 4G6NA 5DOSA 4YZMA 3SX9A 3MIYA 4FT0A 1KOBA 2FA2A 4LQMA 4B99A 3D7TB 4AP7A 2PVFA 3DXNA 4L68A 4R8QA 4IAYA 3VS7A 3KK9A 4JQEA 3S95A 3KU2A 4XP2A 3TUCA 4FKOA 1CDKA 4AG8A 2XJ1A 3I7CA 3Q4CA 4UMQA 3P79A 5I9UA 4M66A 2XYUA 1CMKE 3OWKA 3QRTA 4ZIMA 4IAAA 4X6QC 2ITWA 3S2PA 4FG9A 3V5QA 3RINA 3KXXA 4I6BA 5CSHA 3G15A 2HY81 4PX6A 4QP2A 4FIIA 2OKRA 3NDMA 4JAJA 3LJ2A 4C8BA 4F09A 4AOIA 3QRUA 5AIRA 3DDPA 4C62A 3ODZX 3V3VA 5ACBC 2W4KA 2HENA 3G9LX 3FY2A 4BDIA 4FL3A 3KEXA 4N0SA 4GJ2A 3DKFA 5FTQA 4GG7A 5JK3A 5ANJA 4IADA 3V6RA 2HYYA 2ZB1A 3DA6A 4BKJA 4M7IA 2GTNA 4ZTQA 4X3FC 5L2WA 4D2TA 4FEWA 4JL9A 5C03A 4BKZA 3JY9A 2W1CA 4F7NA 4BCFA 3NNVA 5AAFA 4AA0A 3COKA 2VTNA 1P4OA 3W8LA 4AW1A 3F5XA 4L6QA 2R9SA 3UYSA 2YLEA 4FR4A 3RCDA 3QKMA 4FC0A 2WELA 5DIAA 3I1AA 1GNGA 5DT4A 4IVDA 2IW6A 3GCPA 4I5HA 4F1TA 2ITTA 1G8AA 4YJUA 3RVGA 4E6AA 4C33A 3A2CA 3QGYA 4KKEA 4BCPA 2ZMDA 4WNPA 3CY2A 3Q4UA 2BAQA 1J7IA 1U54B 4FNZA 4QYFA 2XCHA 5TO8A 4B7TA 1U59A 3VS1A 5HD7A 4WHZA 2EUFB 3BLQA 4O22A 4USDA 4YC8A 2XH5A 4BI1A 4IAIA 2OLCA 4R77A 2GU8A 4RC3A 5AR4A 3AC3A 4YO4A 3HP2A 5LCKA 1QCFA 4XH6A 4DEDA 3FUPA 1OKZA 3HV6A 3QALE 3WILA 3F2RA 1G5SA 3FEGA 2I1MA 3D2IA 3R2YA 2YWPA 4MQ1A 3IKAA 3TZ8A 1LEZA 4CKJA 2R64A 4F64A 2OJ9A 3QCYA 2UVYA 5DRBA 2I0YA 2RG5A 5HZNA 2YZLA 3S1HA 3FV8A 5E8XA 1OUKA 2CGVA 4O81A 2HELA 3OF0A 4QQ5A 3RALA 3VUMA 5GIPE 2Z02A 3R02A 2OJJA 4HYHA 4DCEA 4DFZE 4F7JA 4GIIA 4IAFA 5HEZA 3DU8A 3RGFA 1F5QA 2R3JA 2W9FB 3O8PA 3PIYA 3EFLA 3Q9ZA 4I24A 4IZ5A 3QXPA 4U42A 4AN9A 4HW7A 3LCKA 3MFTA 5M07A 3Q32A 3NCGA 4FTUA 3CIKA 3D9VA 4FOCA 2AYPA 4WIHA 3R1YA 3EB0A 4X0MA 4YPSA 4ANMA 3EN4A 5BVDA 5J1VA 1W7HA 2XJ2A 4TYHB 4LV8A 5CENA 2W1GA 3BWJA 3JPVA 4UB7A 1P14A 2WHBA 4PY1A 4CG8A 3IO7A 4NW6A 4RFMA 5HE1A 4H58A 3COMA 5FWKK 4UBAA 4QTBA 3H3CA 3UC4A 2W1FA 3VS5A 2HZ4A 2O3PA 1Q24A 4RZVA 5CWZA 5KMMA 2CNQA 3RZBA 3OP5A 4FEQA 1K9AA 3OXIA 5M53A 3A7IA 2Y9QA 1RDQE 4I23A 4TRLA 1F3MC 3DPKA 3TTIA 3ORNA 4M69B 3VF9A 5HCZA 1MRVA 3OTUA 4IB1A 4EZ5A 2I7QA 2X7OA 4I21A 3MESA 1XH5A 3QD2B 4OTIA 3NNXA 4TTHB 3EL7A 3QU0A 4RQVA 4UEUA 5JSMA 4HVGA 2X2KA 4R5YA 5IG1A 4JDHA 3AD4A 5TR6A 5DWRA 1URWA 4FMQA 4YBJA 2XKFA 4DG0E 5JFVA 4ALUA 1OL6A 5C01A 3OCSA 3UIXA 3HV3A 2OJGA 3F3TA 3PP1A 3DNDA 4JIKA 3R22A 4Q5HA 5HNIX 5AP5A 3ULIA 2XEZA 3MBLA 2QLUA 3DKGA 4L52A 2UW4A 3FMLA 3TNHA 3BYOA 2OIQA 3QTQA 4IWPA 1OIRA 3D2KA 2XK3A 1JAMA 4EWHA 3RAKA 3NUPA 3ZRKA 5EI2A 3QYZA 4CZUA 4HVSA 2XK9A 3E3PA 4KB8A 4M14A 3QKLA 4JG7A 4CFFA 3NMUF 4MD8E 3WBLA 2ITXA 4CMTA 4FSNA 3MN3A 4BC6A 1YHSA 2B52A 5HU9A 3R8PA 4BZOA 2IVTA 2XNGA 2R4BA 1O6YA 3PTGA 4R6VA 2CKOA 3UO5A 3BLRA 2JDRA 2PVRA 4C61A 3ZHPC 3D7TA 4I93A 3H10A 3BGZA 2BRNA 4G16A 3EIDA 3P08A 4RT7A 1XQZA 2VD5A 1K2PA 4FSRA 3V6SA 3GFEA 1ZMUA 2QI8A 4QPMA 4Y85A 4FK6A 4ERKA 3N4VA 2PHKA 4N4SA 4E26A 3V5LA 4TYGA 3I6WA 4NIFB 4MF1A 3AOXA 5CVFA 1XR1A 4FZ6A 5M4UA 3ZO2A 1U5RA 1KE5A 4ENXA 3JYAA 4ZJJA 4CQEA 5JQ8A 3WZDA 4NJDA 2W1EA 2KTYA 4AZVA 2CSNA 5L3AA 2FUMA 2VGPA 4MXOA 3R7OA 3VBVA 2QOHA 2UZBA 5CI6A 1Y91A 3ZDIA 4DGOA 4BDCA 2XA4A 4D1SA 4DEAA 4RC4A 4QP3A 2XK7A 4BDHA 1R1WA 3EQPA 4G3CA 2VX0A 3CCNA 4KSPA 4U8ZA 4WBBB 4Z9LA 4HNIA 1G8SA 4JLCA 5FXSA 3DFCB 2YZAA 1KE6A 2W5AA 5GJFA 4NM0A 5DFPA 5EYKA 5IQDA 5EH0A 1Q97A 2JAVA 4ZLYA 1XKKA 2QOIA 3JXWA 5GJDA 5BVFA 4IFCA 2FSOX 2Y6OA 3UC3A 4ASZA 5I9YA 3ZBXA 4HNFA 1BX6A 3O7LD 5HOAA 2G2IA 3GI3A 2BHHA 3C13A 4RBLA 1UU9A 3OC1A 1Z5MA 4I5CA 5T6KA 1PYXA 3ORTA 3QQHA 4MH7A 4XLVA 4KIPA 2W0JA 3QTUA 3E8EA 2H96A 4GUEA 4WSQA 4YP8A 4C36A 1MRYA 1APME 3NPCA 2PMNX 5JQ5A 2B0QA 3LXLA 4BWXA 3GBZA 4RVKA 5CSWA 5AM6A 2WTWA 4FSQA 4QQTA 2HWOA 3WF7A 3VBWA 2VGOA 3VIDA 4QP7A 2PE2A 4YMJA 3PG1A 4Q9ZA 2DS1A 3H30A 3Q52A 2XBJA 3EKNA 4HGLA 2QR8A 2X2MA 3VAPA 2A2AA 3F88A 4NW5A 1ZARA 4O1PA 3FMEA 3R9RA 4TPTA 4DG3E 4LI5A 4C37A 4HGTA 2F2CB 3VUHA 3WF9A 1IAJA 2DQ7X 4BDEA 2JDOA 2VTSA 2VX3A 4HGSA 3GXLA 4YNOA 4P2KA 3UZPA 4Y8DA 5L4QA 4CFMA 1GIJA 3R01A 4CFWA 4O82A 3JY0A 2WU6A 5E90A 2C5VA 3ZYAA 3BQCA 5IQGA 3QCSA 2UZUE 4R5SA 3HMNA 4UMTA 2IO6A 4JQ8A 4KBCA 2YEXA 4MQ2A 4EJNA 3GQIA 4APCA 4C4JA 5I0BA 4APPA 1E9HA 1PRYA 4N6YA 1PY5A 1OMWA 2GFCA 4TKSA 1SNUA 4I92A 4K77A 4BIDA 3TXOA 4F99A 3FMDA 1PXJA 1OKVA 1TVOA 3HL7A 4EK3A 5AUTA 4R3PA 2C68A 3PXYA 2LGCA 4GT3A 3D5XA 2UVZA 4A4OA 5CF4A 3PE2A 1Y6BA 4EHZA 1Q62A 4KBKA 3P78A 1BL6A 2WMBA 5A4CA 2XNEA 3VUGA 3FAAA 2IVSA 3LLTA 4MNEB 3GU8A 5M06A 4QYHA 4BYJA 4EH4A 4X2GA 4EHGA 3OHTA 4HPTE 5CNOA 2C1AA 3OBJA 2PE0A 4J7BA 3UG1A 2PU8A 5EQYA 4EJ7A 2J50A 5HVJA 3ATSA 4G2FA 4JX3A 3ZSGA 3HX4A 4LMUA 5L2IA 2VTQA 3W16A 3D0EA 3BHYA 4AA5A 4ALVA 1ZYJA 1WBPA 3NZ0A 2B9IA 1TQMA 4FOBA 2C0OA 3EQIA 3OFMA 4CEGA 5KHXA 2Q0NA 2NRYA 3ALNA 3OCBA 4OTDA 2BALA 5M51A 2BTSA 3G9NA 2OFVA 3KMUA 3LFFA 1PXPA 3HDNA 3O7LB 1L3RE 3QA8A 3IW5A 3UPXA 3HUBA 3QL8A 3WF6A 5A14A 3QX2A 5AIKA 5M4IA 2QG7A 1ZXEA 1Q5KA 4GK2A 3MJ1A 2RL5A 3SD0A 3ET7A 3V8SA 3B2TA 4QNYA 5AUZA 2XVDA 3UO4A 4UV0A 5HLWA 3NS9A 2PVNA 5ANIA 2I0EA 3RPVA 4O0VA 2F7XE 1DAYA 3FLSA 3KB7A 4DG2E 4LMNA 5JFSA 2X1NA 4BBEA 3F69A 4FX3A 4KS8A 2W1DA 3FMHA 4EHEA 4O7NA 3LFDA 2ZM4A 4NH1A 4LRJA 4ACMA 3P1AA 3EWHA 3NAXA 4W4XA 3DKOA 4CQGA 4ANLA 4D4RA 4E20A 4RJ8A 3DOGA 3CTQA 3TI1A 3K5VA 5FM2A 3TCPA 4KINA 4HGEA 5M4FA 4XV2A 3H4JA 5CEMA 4HCUA 2PTKA 5E1SA 2BDJA 4F4PA 4L67A 2UZTA 5AEPA 1K3AA 5BPYA 4U3ZA 4RIWA 4I6HA 1OL5A 4NM5A 3E8DA 4S31A 1JKSA 4U45A 5FG8A 3ZSIA 4C59A 4WUAA 1LEWA 1PXNA 1ZZLA 3R04A 4FV9A 4QP4A 4G3DA 4BYIA 1S9IA 5FDXA 2YM5A 4FGRA 2QKWB 5ANKA 3CQEA 5CTPA 5K0KA 4OAUC 4QP8A 3ULZA 3LAUA 1OPKA 4IMYA 4MVFA 5IISA 4F1MA 1ZYCA 4U43A 3TIZA 3GOKA 1YXVA 3HMIA 3MDYA 5HVYA 3PSCA 4MK0A 3R8VA 3KCKA 4IH8A 1OECA 3NSZA 1O6KA 4IBMA 4YHFA 3TNPC 4BCQA 4F9YA 4G9CA 1M2QA 3KRWA 4FTNA 4XJ0A 5C8NA 3CE3A 5KMJA 3PPKA 2HAKA 2OIBA 4S30A 2IZRA 2V7OA 2GNIA 3HVCA 4NM3A 1WVYA 4O1OA 1J7UA 2W4JA 2JGZA 4IX3A 4E6QA 3AG9A 4CFUA 3AMYA 4FICA 3F82A 2QO7A 2FH9A 3LFBA 3U6JA 4C2WA 3FWQA 3DBDA 2BRBA 4BI2A 1BYGA 3OOGA 3SXSA 3PP0A 3SV0A 2XKCA 1H08A 1QPDA 2JDVA 2P2HA 1NXKA 4ENYA 3A99A 3ZXZA 4DE4A 2BAJA 3WZUA 3BE9A 1UNLA 3P5KA 5BVEA 4EH7A 1H24A 2BZKB 2GCDA 5IUHA 4O7TA 2BKZA 3FQSA 4K1BA 2A27A 4FNXA 5BNJA 5HU3A 3DQXA 1Y57A 4TNDA 2RFNA 3QRJA 1Y8YA 3TWJA 3WYXA 3SDJA 3FKNA 3D5WA 4YBKA 5EDRA 4E7WA 5TF9A 3GCQA 4EOJA 4TWOA 2F57A 4XCUA 3PE1A 4NM7A 5AA9A 5HHWA 2OXXA 3PXFA 4OAVB 2R3KA 2YITA 2WOUA 2DYLA 2JD5A 2WMTA 4RC2A 4D58A 5K5XA 1KSWA 3V04A 4EC9A 1ZOHA 3VS6A 2R0IA 4QP9A 4FBXA 4IB5A 3K3IA 3D14A 3PRIA 5EHLA 4L3JA 5EKOA 4QO9A 4CT1A 2X9FA 4GT4A 3UE4A 2XYNA 4KKHA 3FZOA 3U54A 4FSMA 4ITJA 4EOMA 2VU3A 3OD6X 4YURA 4BHNA 2JEDA 2XK4A 1WZYA 4KRCA 3SXRA 2QOBA 3ZLYA 4F1OA 4I5MA 4UALA 3SQQA 2YCQA 4FIHA 2PZIA 3EFJA 3MH3A 1U54A 4RZWA 2YM6A 3C4CA 4KRDA 4CCBA 1PXKA 4UMPA 4QT1A 4IDVA 5CI7A 3DBFA 2ZYBA 3AT3A 3E88A 3VS3A 4OTHA 3DK7A 5FP5A 3FLWA 4TYJA 3L9LA 4N57A 3BHUA 3G2FA 1XBCA 4CVAA 3KRJA 2OO8X 3MJ2A 4G3GA 2C3LA 3KVXA 5B2KA 4QMVA 3C51A 4G3EA 3RCJA 4V0GB 2B54A 5K9IA 2VTMA 2X6DA 4LUEA 3MVHA 5IEYA 2W7XA 2JBOA 3FZPA 3KA0A 4KS7A 2BRMA 3NUNA 1V0BA 5KKRB 5F20A 5CVHA 3W33A 2VWWA 4AX8A 3LQ3A 3U8WA 2JIVA 4G34A 1KV1A 3ACKA 3BBWA 3GC9A 4OBQA 4O0YA 4C4FA 3G0EA 1U4DA 4YZCA 5DEYA 3Q2MA 3S3IA 2A1AB 2VUWA 4EH2A 3Q4ZA 1SZMA 3PXKA 4AXAA 1WVWA 4FT5A 1PXOA 5LCJA 5DR2A 3Q6UA 4I6FA 3R73A 4O2ZA 3HA6A 3Q3BA 4EBVA 4DFUA 5EW9A 1PXLA 3KMWA 5EHYA 5JT2A 3BHTA 4IC8A 4FEXA 3ZH8A 4CGAA 3GUBA 4GFMA 4V05A 2VTAA 3PJ3A 3QUPA 3VHKA 3NLBA 2UW7A 2XCKA 5JGDA 1PW2A 1VEBA 2OFUA 2VWBA 4CD0A 2GQSA 3PXZA 3MFSA 3QKKA 3QTSA 1H4LA 4AAAA 4F7SA 5HNGA 4F9AA 4FG8A 1B38A 5CYIA 5CU3A 5HIDA 3ORXA 4DC2A 5E9EA 3W2QA 4FV7A 2EWAA 4JBPA 1XWSA 5DMZA 4BWPA 2B55A 2IJMA 3TDVA 1SVGA 4J71A 4O7SA 4AZFA 3RAIA 2HZIA 3FSFA 3O50A 4IFGA 1GY3A 3NW6A 4YSMA 3FY0A 4C7TA 2OF4A 2WPAA 4XP0A 3TV7A 5JGBA 2X39A 4FT3A 3M1SA 4FTKA 4J8MA 4ZSGA 2OXDA 3TJDA 3F7ZA 3MS9A 5ETFA 5ETIA 4RJ7A 5IKWA 4XG2A 4DH8A 2BUJA 3UPZA 5IQBA 5IQCA 2CGWA 2R3HA 2VWXA 4I4FA 3UNZA 3E87A 5LMKC 2ZJWA 4N6ZA 3QCQA 4FKTA 2JC6A 2A19B 4J98A 5EYDA 5HCYA 2WTDA 4BTFA 3VN9A 4F63A 4ANQA 3FHIA 3S4QA 3NW7A 2Q0BA 3AGLA 4WUNA 4RIOA 3LM0A 2VRXA 2GHGA 5GNKA 3W8QA 3QTRA 3LJ1A 4MBIA 3CLYA 5CT0A 4BKYA 1OB3A 2OH0E 5AR8A 5FUTA 3MPMA 2GNFA 5GINE 3RHKA 4F6UA 3E5AA 5C9CA 3OCTA 3BZ3A 1ERKA 2OBJA 1XBBA 2BPMA 4F0FA 2BVAA 2ITOA 1OPJA 1JKLA 3A8XA 4YJOA 4RJ5A 3W1FA 3C5IA 1B6CB 4J96A 5J9YA 1JOWB 3IOKA 5HG7A 1Q8ZA 2J6MA 2KULA 3FI4A 2JIIA 3UNJA 2JKQA 4IZAA 3HP5A 4L3LA 3ERKA 5JN2A 4FT7A 5CX9A 2W05A 1RQQA 3FZSA 5E8WA 4EH5A 4HPUE 3W2SA 3ZUVA 4NIFA 2IW8A 1QPCA 4DH5A 3DLZA 2B9HA 1V0PA 3UIBA 4ASEA 4F65A 4E4XA 4MCVA 3E92A 4W9WA 2YISA 3GC7A 2V55A 3AC1A 5G1XA 3F5GA 3MI9A 4W8EA 4RWLA 4EOOA 2ZV2A 2WB8A 2EXMA 3FC2A 1Q3WA 5AJQA 5KHWA 4FKPA 2BFYA 4YPDA 1FVVA 3O23A 4JBOA 1RW8A 3WOWA 3IONA 4WD5A 4NU1A 2QQ7A 4MBJA 4X6RA 3N51A 4FKGA 4GK4A 4ZXTA 1KWPA 5IQEA 1P5EA 3LQ8A 3L9NA 1DS5A 4YC3A 2CLXA 3ACJA 4OUCA 3UVRA 4DFLA 4E6CA 1WCCA 3JS2A 3W55A 5IQIA 3P9JA 4L01A 4QTDA 2R7IA 4BDKA 2FVDA 4AZTA 5H3QA 2JFMA 4EH8A 1ND4A 2XMYA 2QHNA 4D1XA 4D9UA 2SRCA 4RLLA 2Z7RA 4R3CA 3DNEA 3WI6A 4ZLOA 1IA8A 4DT8A 2YM8A 4P5QA 3I7BA 5D10A 4CKIA 2C0IA 3EHAA 1UWHA 2J2IB 5DT0A 1BI7A 4U41A 1LR4A 2PVJA 2J0IA 2ITYA 2RFDA 4YTFA 4H3PA 2R2PA 3RNIA 5J1WA 1WBNA 4JBQA 2ACXA 2G15A 4FKUA 2UZWE 3OVVA 3F3VA 5ETAA 4KKGA 1JWHA 2CGXA 2RGPA 2CKQA 1UWJA 2OF2A 2YJSA 2ZV9A 3KF7A 3QQKA 4H39A 3EQCA 3R00A 3Q4TA 4ZJVA 3BYUA 2RSVA 4I0SA 2XIKA 3R6XA 4RA5A 4U0IA 3A7GA 2HXQA 3U9NA 2LAVA 5AX9A 4CLIA 5HKMA 4K18A 5LVPA 1GIIA 5FGKA 1MQBA 4IE9A 3KN5A 4EOLA 1REKA 3R83A 4DYMA 2E9NA 3LJ0A 3LM5A 4UXQA 1UVRA 2QURA 5EOLA 4W8DA 1ATPE 3I81A 5LVNA 4O7LA 3F9NA 2WIPA 3MVJA 3N4UA 3CR0A 4E1ZA 3Q6WA 4I3ZA 3ZM9A 5IA4A 2XUUA 5ICPA 4FSYA 3L8SA 4QQJA 1ZAOA 2IVVA 4CTCA 4E93A 2PL0A 4FV1A 5L2SA 2O5KA 4EOPA 4ZY5A 3SG9A 3D4QA 3O0GA 5HORA 3NUSA 3R1NA 5LWMA 5AADA 3CPCA 3EZRA 4U6RA 5DBXA 3PZHA 3COHA 2UZEA 4BICA 3K3JA 3K5UA 2YIQA 2I40A 5AUXA 4ZEGA 2GDOA 2WMRA 4FV3A 5HX8A 4C4EA 1JBPE 5HTCA 3MV5A 1ZMWA 3I60A 3TV6A 2WOTA 4DLJA 2I0VA 3QQJA 3F66A 5HGIA 3VUDA 3F5PA 3CTHA 3LCOA 3E7OA 4CCUA 3E3BX 2O63A 4WG4A 3SKCA 3RPRA 4FV8A 2PVLA 3LFAA 4E5AX 1X8BA 3QQFA 4DLIA 2VNYA 2HW6A 2W5HA 4X3JA 2QLQA 3ZCLA 4F7LA 3OWJA 4UMRA 1AGWA 4AZSA 4RMZA 3LE6A 1QMZA 1V0OA 5E8VA 3VBTA 4E4LA 4RQKA 4WT6A 3C1XA 1IRKA 2ONLA 4BDBA 2CDZA 2YA9A 2JITA 3T3VA 1FQ1B 5AX3A 3DBQA 3S0OA 4EUUA 3FL5A 4QMSA 1Q41A 5FTGA 1XH7A 3R2BA 4M12A 5F9EA 3VBXA 1XH9A 5D41A 2C5NA 3ORKA 3K2LA 4FVPA 5A6OA 3PG3A 1WBWA 5ETCA 4NFNA 3BI6A 1WBSA 2UW8A 3MY5A 3NCZA 1VJYA 2P2IA 2ZDTA 3FXWA 3OEFX 4GVJA 4NT4A 5HE3A 5A46A 5A4LA 4RG0A 2ETMA 4GYGA 4C3PA 2ITPA 3FZTA 3IECA 4CFVA 4II5A 4PP7A 4XS2A 1YHVA 4FE2A 4RVMA 4IZYA 3PPZA 3C4WA 4FTOA 5AV0A 3DY7A 4AZWA 4X2KA 4A9UA 1KE8A 4CZYB 5KCVA 4DEEA 2CHLA 3FI8A 2X0GA 5L6PA 4DFBA 1ZY4A 5CLPA 5K5NA 2FB8A 1CSNA 2WD1A 1FMOE 3OBGA 4YNEA 1J3HA 3PIXA 1M17A 4FTLA 3CS9A 1UU7A 4FF8A 4QMPA 1YWNA 2PWLA 4AW2A 2VTJA 3QUDA 5E1EA 3HAMA 3P0MA 5IUIA 5K4IA 4ZSLA 3O17A 4ASDA 3R9HA 3ZC5A 3P7BA 2UZLA 2QOOA 3EJ1A 5CF5A 4TY1A 3C7QA 2X8DA 4M13A 5EYMA 5CEOA 3ORPA 4XRJA 3BELA 3UG2A 3R7UA 3BV2A 1E1XA 4K6ZA 2C6IA 3B8QA 1QL6A 3PXQA 3EN7A 2UW9A 3KULA 4PPBA 5BX0A 2G1TA 2R7BA 3G33A 1GIHA 3CD8A 3JVRA 4O86A 5HESA 1IASA 3IW7A 5FD2A 2YM4A 1H1SA 2QOFA 3UIUA 2OZAB 4D9TA 5J7BA 2V0DA 1VYWA 4GSBA 4FZAB 5C26A 1LPUA 3UOHA 2WGJA 4C3FA 2J5FA 4A4LA 1T46A 4XG3A 3F3WA 3OUKA 3TJCA 3W2CA 3DKCA 2NNWB 3C9WA 3DJ5A 1H1WA 3OEZA 5HBEA 5HNBA 4WA9A 3M42A 4FIJA 1Q8TA 3W2RA 2QOKA 2WNTA 5J8IA 2WMVA 3R28A 3LVPA 2EB2A 3KXZA 4C2VA 3F3UA 2ETKA 2BAKA 2HW7A 4AFJA 5JKGA 3DK6A 1GZNA 4ASXA 3LW0A 2ZV8A 3CKXA 3PFQA 3WE4A 3H0ZA 3EYGA 1PXIA 4KIKA 3ENMA 3U51A 3D5VA 4EOKA 5LMBA 4GH2A 3HMMA 4DTAA 2JDTA 3VUIA 5KX8A 3C5UA 5BUIA 1YHWA 4RPVA 1Q99A 4IWOA 3R8UA 4EH6A 4ORKA 5DH3A 2W1IA 3M2WA 2VWYA 1BL7A 4OBOA 5BVKA 1A48A 2IVUA 4CYJA 2VAGA 2GS6A 2BMCA 4YJPA 3NUYA 4UXLA 5LMAA 3QZGA 4EHVA 5LQFA 5BYZA 4R1YA 1YI3A 4GEOA 2VN9A 4JDKA 1PF8A 2YJRA 4DITA 1IAHA 3MH0A 4L42A 2WMXA 5IMEA 3QAME 2XIZA 5DR6A 4XOYA 2WQEA 3F6XA 2JAMA 3E62A 4MKCA 2QD9A 3F2AA 3PJ2A 4XG8A 1H1PA 5KZIA 2QHMA 2CCHA 3NUUA 3ORLA 2PK9A 2PMLX 3I0QA 3W2OA 4CYIA 4QTCA 3IQ7A 2GQRA 5A4EA 4ZMFA 4GMYA 1ZOEA 2OK1A 3TIYA 3CY3A 2G2FA 2OZOA 4IAKA 5CALA 2QODA 5J95A 3W18A 3QYWA 3IW6A 4LRMA 2GMXA 4CNHA 1WMKA 4EEVA 4GT5A 4B8LA 3NW5A 3O8UA 4QP1A 2JDSA 3OY3A 4MXXA 4GIHA 5H8EA 2XS0A 3D94A 3BE2A 3SW4A 4A9RA 4D2VA 2XB7A 1PJKA 5LMKA 3HV4A 2UUEA 2V5QA 3E7VA 4I4EA 2X2LA 3R8LA 1NT2A 1V1KA 4AGDA 3FXXA 3PZEA 4FEVA 3B2WA 3R1SA 5JRSA 4BZDA 4EZ7A 4I0TA 3H9RA 4L7SA 2IW9A 3ZRMA 2HWPA 5GIOE 3SC1A 4H3BA 2UZNA 4BCNA 1H27A 5AR2A 3BKBA 3QQLA 3OXTA 3MW1A 1ZYDA 3EL8A 5CNNA 3L9PA 1YVJA 3HMPA 3R63A 4MD7E 3JVSA 3TACA 4EYJA 3UTOA 3UOKA 5I4NA 2F49A 5K3YA 1R78A 2XRWA 4ZSEA 3C4ZA 3ZLSA 2FO0A 3FBVA 5EI8A 5E8UA 2CKPA 5HBHA 4FKSA 5EHOA 4RWJA 4YJNA 5HLNA 2X81A 3LMGA 4Y46A 1Q3DA 4KNBA 3ZM4A 3QWJA 2PSQA 1YDSE 5EK7A 4U9AA 4WG3A 3TDWA 4I0RA 4O7VA 3KGAA 3E64A 3ROYA 5CU6A 2ZM3A 5CEQA 5FXRA 4BZNA 3C4XA 3QQUA 4A4XA 4MXAA 3TV4A 4QMNA 4YSJA 3U4WA 5JMSA 4KABA 3D7ZA 3CP9A 4DFYA 2XEYA 5E91A 2PPQA 4YZBA 3VS4A 1NVSA 4NZWB 2ITZA 3ALOA 3TT0A 3RWQA 1CTPE 1OIYA 2YCSA 4CMOA 5ANGA 3Q04A 4D0WA 3SW7A 5IQHA 2AC5A 4AA4A 2CKEA 4BI0A 5HVKA 2J4ZA 3VVHA 4EQCA 4PWNA 2YACA 1DAWA 2C3JA 4BDGA 4JR7A 4AWIA 4DBXA 1OPLA 2YIWA 3QF9A 4FTJA 4D0XA 3PVBA 3CQUA 4FV6A 1CM8A 4LOPA 2ZM1A 3NVMB 2Z7SA 3P23A 3WZJA 3DCVA 5H8GA 2HZNA 4H1JA 3U6IA 1ZYSA 4ZTSA 4RWKA 2W06A 1UV5A 3IDPA 1VZOA 4O0TA 5A3XA 3QZHA 4ZJIA 3ZZWA 5J79A 3EMGA 4PPCA 2WEVA 5H8BA 4ZP5A 2B7AA 3H0YA 3F2NA 3P7CA 3N4TA 5CXZA 1Y8GA 2OH4A 3SXFA 4TN6A 4PL5A 2OU7A 1JNKA 2C6OA 4TW9A 3GEQA 2HCKA 5FTOA 4ZY6A 3KRLA 2I6LA 4LGHA 3MSSA 4IZ7A 2HZ0A 3UJGA 4AOTA 4J52A 5C27A 2P3GX 3MA3A 4NL0A 3GU4A 3OS3A 5HIBA 3MY0A 3WARA 1OIQA 2ONLC 2BIYA 3ELJA 4MAOA 4XEYA 5HD4A 2JKMA 1WBVA 4IX6A 3NIEA 3DAEA 3O2MA 4L3PA 5AUYA 4K2RA 3HRCA 3PY3A 4BCHA 1RE8A 2XF0A 3ZUTA 4TL0A 4GS6A 2J90A 2W17A 5CAOA 3L8XA 3RTPA 5J7HA 1XJDA 3RPOA 2R3NA 2NO3A 1ZOGA 3MVLA 3KXHA 2RFSA 4BBFA 4YLJA 3TNWA 4MNFA 3LXKA 3CKWA 5I9XA 3NVKI 3R8ZA 4YHTA 1OITA 2C69A 1URCA 3FYJX 4FNWA 2WQBA 2P33A 3IK3A 4LUDA 3RKBA 4MYGA 5M57A 2WKMA 5DGZA 4M0YA 3IW4A 3ORZA 3QTIA 2R3QA 1XH6A 2WTKB 3GU5A 4KIKB 5AV1A 2ETRA 3GP0A 4FTMA 3UO6A 3UOJA 1P4FA 4U80A 2XP2A 1QPEA 2GS2A 4O2PA 5DI1A 3UMWA 4BCOA 1W83A 3KXNA 3KL8A 3T8OA 2UZVA 3P86A 4FZ7A 4FYNA 4XHKB 5TE0A 4CTBA 4Q5EA 4EK5A 1PXMA 4ZMEA 3OW4A 3VQUA 4WNKA 2BRGA 4XOZA 4HVHA 4BGGA 5IA0A 4L00A 4U5JA 2QO9A 4PDPA 4BDDA 5EQEA 4CT2A 5AUWA 4O7YA 5JEBA 1S9JA 3FPMA 4TZRA 3ZO1A 3IOPA 4IAZA 3WYYA 5CAQA 3MFUA 3OMVA 2W1ZA 5HCXA 4QMWA 4A06A 2B53A 3ZLWA 4B9DA 4EK8A 1WAKA 3LCTA 4GVAA 3CBLA 3VUKA 3UP2A 4EL9A 2EXCX 3QD3A 3F3ZA 4G5JA 3DBEA 4M84A 4WO5A 4RIYB 2OIDA 4RIXA 5HO8A 3ORMA 4PMPA 3PVWA 3L1SA 3QX4A 4ANNA 4GFGA 5J9LA 1TQIA 3TUDA 3MVMA 4W4VA 3FE3A 4L53A 1H0VA 5EKNA 3TKIA 3DTWA 4LRKA 4IM3A 1H26A 1KE7A 3EKKA 4GRBA 4HJOA 2H6DA 4PNKA 4NYEA 4EQUA 4Z7HA 1I44A 3DB6A 2ITNA 4O21A 5K4JA 3PLAE 4PP9A 1UA2A 5CF6A 4IB0A 3QCXA 4MF0A 5AUUA 1YWVA 3ITZA 5AWMA 1GZKA 3QQGA 4JT3A 3F5UA 4FODA
chains in the Genus database with same CATH superfamily
3A7FA 4OTWA 4U44A 3FLQA 1XMMA 4GK3A 5CASA 2UW0A 3HDMA 4J8NA 3KREA 4I22A 3KKVA 4M97A 3VHEA 4DHFA 1Q61A 5B0XA 3RK7A 4QRCA 4IHPA 3LXPA 4FIFA 4ZTNA 3GNIB 4F0GA 4IVAA 3UP7A 2EVAA 4ZY4A 1KV2A 2PVKA 2VTOA 4YGAA 2P0CA 1JVPP 3PSDA 5A9UA 2REIA 4JRNA 1ZYLA 1BKXA 2R0UA 2RF9A 2WTJA 4FTCA 2WQNA 3ZFYA 4CRLA 4O6LA 4DGMA 4DN5A 2PZYA 4PQNA 1H1RA 1UKIA 1AD5A 3V5WA 3R21A 3AQVA 4HYIA 5FXQA 4NSTA 3LCDA 2XIYA 2GTMA 3A4OX 2ZV7A 5CZHA 5I5ZA 5CQWA 3VF8A 2WTVA 4RFYA 2R3IA 2OJIA 2YIXA 4CXAA 5E8SA 1SM2A 3BU5A 4XUFA 4E3CA 3NIZA 5E8YA 2XANA 2R3GA 2Y4PA 3F61A 3HEGA 1MRUA 3B8RA 4L9IA 5CSXA 4I20A 3BGPA 4FZFB 4IX5A 4DT9A 3D5UA 4NUSA 4TYIA 2WFYA 3LPBA 5CU4A 5JGAA 4QMYA 3K54A 3MPAA 4DEBA 1E1VA 3ML1A 5EM6A 4HZRA 4JDJA 3R9NA 2CCIA 4CFXA 1W82A 5DR9A 4BBMA 4XP3A 5M55A 3VQHA 5E4HA 4USEA 3QRIA 5B2LA 1O9UA 5T68A 5DHJA 4EBWA 3HV5A 3NUAA 3G6HA 5FBNC 5H2UA 1Q4LA 4FL2A 5B7VA 4L46A 4MTAA 1VYZA 2X8EA 3LFEA 4G3FA 2FYSA 4ZSJA 2X6EA 3PXRA 4H3QA 2J0MB 3FC1X 3AGMA 1CKPA 4JR3A 4YZNA 2ZOQA 3NAYA 2WMSA 5IU2A 2YLFA 1FVTA 1MUOA 5E8ZA 4C4IA 4QTEA 2VV9A 5C4LA 3LFQA 3ID6C 3THBA 3V5PA 1MQ4A 3SAYA 1R39A 4LV5A 2NP8A 4QD6A 5TT7A 2ITVA 4E4MA 2YAAA 5CEIA 2C3KA 4AN3A 5J5TA 1H1QA 3OT3A 5D7VA 2QKRA 3EQBA 4BRXA 4TWCA 4LL0A 3RNYA 1PKDA 2XALA 5IMXA 2ERZE 4R1VA 4ONAA 5EI6A 4O0SA 4JAIA 2UVXA 3V01A 2W1HA 3ZU7A 3TNQB 4BIEA 4BCKA 3R1QA 4XV9A 2J7TA 5KZ0A 5M4CA 2WMAA 3ZC6A 3LMHA 3HA8A 2A0CX 5TKDA 2IG7A 3HAVA 4AS0A 2OZAA 3BGQA 3FLNC 4EOQA 1PMNA 4TYEA 5IPJA 1XBAA 3FYKX 3VS0A 3IS5A 1W84A 2X4FA 3ENHA 4OR5A 4IXPA 2J0JA 2XKDA 2ZB0A 1OL2A 3KXGA 4C3RA 3DQWA 4G6LA 5ANEA 5AP7A 5FEDA 3JUHA 3RZFA 2O0UA 3L9MA 4Q2AA 3TKHA 3W0QA 3O71A 1OGUA 4DFXE 4DGGA 5CVGA 3DS6A 2C6MA 3HV7A 2WU7A 3TYKA 5AMNA 4A9SA 3FLYA 2J5EA 2WTKC 4OT5A 4X3FB 3ATTA 4J1RA 3R71A 4YTHA 3OUNB 2QR7A 3PIZA 4I94A 4PNIA 3RM6A 4RSSA 2O2UA 2XNPA 2RKUA 1UKHA 3BX5A 3QTXA 2VO3A 3NEWA 1Z57A 4GCJA 5EM7A 1J1CA 1FGKA 4QYYA 5KKRC 3H9OA 3GCUA 5E92A 3Q9WA 1XO2B 4JI9A 4FKVA 2JKOA 5EOBA 3LXNA 4ZTHA 4CFNA 3RMFA 1OBGA 5DPVA 3A7HA 5DE2A 4NEUA 4BIBA 5CZIA 4ZTRA 5CY3A 2Q83A 2YN8A 3QXOA 1HCLA 5HG9A 4LGDA 1KUTA 3IPHA 4DH7A 3A4PA 2X0PA 5KMLA 3HRBA 4O7WA 2W4OA 5CSPA 1UU3A 4XG4A 3GCSA 4QMUA 4O0WA 3AXWA 2OG8A 4IQ6A 4ANSA 4UN0C 3WIKA 5A54A 4JQ7A 3COIA 4R78A 3R8MA 5FDPA 2C6KA 4IM2A 4X2JA 3PVUA 2BROA 5CU2A 4FJVA 3FZ1A 4Z55A 1YKRA 2F2UA 4B4LA 3SHEA 2B9FA 4OTFA 4G1WA 2H8HA 5FRIA 3T3UA 3IW8A 3MYGA 4FKJA 5E8TA 3REPA 4JVGA 3RPYA 2PMIA 4PTGA 5FM3A 5AP3A 2CJMA 3HKOA 3OWPA 3P7AA 4S32A 3SRVA 4NTSA 5KMKA 4E5WA 4RLKA 4RJ3A 1UNHA 3SOAA 4N70A 4EK6A 4M68A 4D2PA 5I9ZA 5EDQA 4RX5A 4RJ4A 5D1JA 3NFGB 3FZRA 3HZTA 3CGOA 3FSKA 2FSTX 4NTTA 4GKIA 3EZVA 2H9VA 4FIGA 3NNUA 5EW3A 3RK5A 3BPRA 4Z3VA 3TM0A 5AFVA 2J0LA 4O4FA 5JZNA 5M44A 5EYCA 4UY9A 3V8TA 1YDTE 3MIAA 1YXXA 3O51A 4HZSA 4BTJA 1NY3A 4RX7A 4TWPA 4DEIA 4V01A 4LL5A 1TKIA 2CPKE 2NRUA 2VO0A 2X7FA 3HNGA 1JPAA 3LCSA 1YWRA 3DLSA 3EQHA 4QPSA 4AE6A 5IDNA 1B39A 3PFYA 5CEPA 2XIRA 2HXLA 3FMNA 4JOAA 4FSZA 4I41A 4EKKA 3BCEA 3D15A 2X9EA 3MTFA 1FGIA 1H0WA 2QNJA 3TUBA 1BLXA 4D2RA 4TWNA 3HGKA 3A8WA 5EM5A 3BV3A 4HVDA 3W2PA 4XLIA 2C6EA 3HMOA 2Z7LA 4BCIA 3JR1A 4FNYA 4BL1A 3EN5A 4PDOA 3TZ9A 3ZONA 4DEGA 4D55A 5AP1A 5HLPA 3I5ZA 5L8JA 4U79A 1W98A 3PDTA 1STCE 3FKOA 1OL1A 3NGAA 5I3OA 5GZAA 1LUFA 2RG6A 4BFMA 1KE9A 4E4NA 1OUYA 4BTKA 4OTGA 5FBOA 2O8YA 2QOQA 4YLKA 3SOCA 3QUEA 4AF3A 4C0TA 1NA7A 2XM9A 4GKHA 3UODA 4IIRA 4XX9A 3AT4A 3N9XA 3BYMA 4PMMA 3E63A 2Y0AA 4DFNA 5AAGA 1REJA 3FI2A 3RM7A 5IH4A 5EQPA 2QONA 4CG9A 5IQFA 4GU6A 2BDFA 2W9ZB 1IA9A 4ZZNA 2CMWA 5L2TA 3QA0A 4NJ3A 3ZOSA 1SYKA 2ZMCA 4EKLA 2AEGA 2YDIA 4BDFA 2XIXA 4U3YA 3DJ7A 2Y7JA 3NX8A 4LYNA 3KC3A 2HIWA 2YIYA 1Q8UA 4HCTA 3GOPA 3T9TA 4CV8A 4UWYA 4Y95A 5HX6A 2PVYA 3CD3A 3QHWA 3VBQA 4W4WA 4FIEA 1OVEA 4CZTA 3SVVA 2QCSA 4O0UA 1YI6A 1QPJA 4AQCA 2XARA 2XAOA 4I5PA 2BILB 1DI9A 4BR3A 3UBDA 5J9ZA 4IX4A 3TZMA 4ACGA 4JX7A 4EOSA 4XG6A 5CU0A 3W10A 5KUPA 4MX9A 5L6OA 2PYWA 4UZDA 5KMNA 4RGJA 4D4VA 2C0TA 5L6WL 4ARKA 5AV3A 5EDPA 2G2HA 5IA2A 2PZ5A 2Y8OA 3TEIA 1SVEA 3BL7A 3OCGA 2Z60A 5BVOA 5IF1A 4GL9A 1NVQA 4W4YA 3FMMA 4Y72A 3GQLA 1DM2A 3KQ7A 4BGQA 5CAPA 4ANOA 4FKQA 1SNXA 1VLRA 5CT7A 3EQDA 4FG7A 3UQCA 3CQWA 2GNGA 4HVIA 2WTCA 3LFSA 4DAWA 2WZJA 5A4QA 2YWVA 3UDTA 4FZDB 5HE2A 4ACHA 3VW6A 1OKWA 1Q8YA 2WTIA 3PA5A 4RX8A 4Y83A 4A9TA 3BWFA 5LVOA 4F9BA 4CLJA 4HYSA 4D2WA 5AA8A 2WQMA 2OGVA 4EI4A 5KNJA 4PF4A 4PL4A 4DH1A 3QHRA 4F6SA 2X7GA 4IACA 2BZHB 5HE0A 5BMSA 4AE9A 2V22A 4QMLA 4GYIA 4XBRA 3NWWA 3R7GA 2RIOA 3GGFA 2BIKB 2V7AA 2H34A 3BU3A 4IB3A 1JSTA 2VNWA 4XBUA 4Y5QA 4O96A 3OZ6A 3LQ5A 3WF5A 3OT8A 3Q60A 3O8TA 4JDIA 4M67A 5HBJA 4RRVA 3A62A 4AW0A 4WSYA 3P5JC 1H28A 4V0GA 3S00A 4D4SA 3UOLA 2PVHA 2YCRA 4FV5A 3A7JA 4EONA 4LM5A 4P90A 1TQPA 1U46A 4NFMA 4PMTA 4QMQA 3LFNA 4FA2A 4M15A 3C4EA 1M7NA 2ZVAA 4YO6A 3AD6A 5CAVA 3P4KA 4U81A 3U87A 2W96B 3MGYA 3SG8A 5CSVA 4JS8A 4FTTA 5LOHA 2CLQA 3ZEPA 4L44A 2O64A 3GFWA 4FTQA 4C4GA 5BYLA 1FMKA 2ESMA 3V8WA 2YABA 5BUEA 5IEVA 4DF3A 4GW8A 4TT7A 3E8NA 4ZK5A 2OXYA 3GC0A 2Y4IC 3VRYA 4ZSAA 4NWMA 4P7EA 3EN6A 3LFCA 3ZEWA 3W0RA 1Y6AA 3ZO3A 4LOQA 3ZUUA 2GPHA 4OW8A 4FVRA 4OTQA 4UWCA 2XZSA 1WBOA 3RPSA 3UYTA 4GUBA 3LLAA 3LOKA 3DAJA 3CJFA 4JXFA 3E8CA 3TN8A 4AGWA 4WG5A 4FL1A 1OM1A 3AC8A 4O0XA 4RIXB 3ZSHA 4QMMA 4BCJA 2B4SB 4IW0A 3LZBA 4FSTA 4MBLA 5HTIA 4KAOA 4ZLZA 4DCAA 2CN5A 3I5NA 3RBWA 3QZFA 3U4UA 5HICA 4IVBA 5A4TA 1YXSA 4X7QA 1PYEA 2EU9A 4IVCA 4HCVA 1ST4A 1WFCA 3RHXA 3UQGA 3QBNA 5C4KA 1SVHA 3OY1A 3QD4A 4IWDA 4F0IA 4FV2A 4DGLC 3FL4A 3R0TA 2BKKA 3HLLA 4L43A 3NNWA 5F95A 3KMMA 5F94A 5IA5A 1YRPA 4M3QA 5AR5A 3GC8A 3QLGA 4XYFA 3ZZEA 5DNRA 4ZAUA 3KK8A 2VTRA 4L8MA 2JKKA 2Z8CA 3GCVA 3MA6A 3POOA 5IEXA 2OSCA 3TKUA 5D11A 4G9RA 2C6DA 5L2QA 4O7RA 1Z9XA 3G90X 3OG7A 2BHEA 2IZUA 5DYJA 3EQRA 2CNVA 2UV2A 4D5KA 1H01A 4DTKA 3LMIA 5DG5A 2VZ6A 2PUUA 4JIAA 3QLFA 3V5TA 5D9HA 3I0OA 5LVMA 1FBNA 3KVWA 2QOLA 2J0KA 5EW8A 3ZS5A 2R3PA 3CXWA 1GAGA 2E2BA 3NYOA 3QRKA 4FKWA 4FUXA 4IANA 4U97A 2PULA 2PY3A 3I79A 3GB2A 4O6EA 2I0HA 4IJPA 4OBPA 2GNLA 3FMKA 2BTRA 3E93A 4QP6A 3HUCA 3AC4A 1J1BA 1PKGA 5TOZA 1YXTA 4A07A 4ZTMA 1MP8A 2HK5A 1SMHA 2XBAA 2Z7QA 5E7RA 3C0HA 4YR8A 4AXFA 3DXQA 2VO6A 2VTLA 4O4DA 1H00A 2YDJA 3O96A 3V51A 4UYNA 1M7QA 2VWVA 3F7WA 3I6UA 2UZOA 3IDBA 4FTAA 1G3NA 4ACDA 4MD9E 4L45A 5GHVA 1CKIA 4YJSA 4X2NA 3TNIA 5FEEA 5AR3A 1J7LA 5D7AA 3SGCA 4DH3A 1EH4A 2F4JA 2C1BA 4YJTA 4I6QA 5DRDA 3I4BA 5F1ZA 3KY2A 4YJVA 4K11A 3C50A 4JG8A 4X21A 2R3RA 4AT3A 2G9XA 2GHMA 5AR7A 4USFA 5FLFA 3TTJA 3KFAA 1OIUA 1P2AA 3BBTB 3PLSA 4W9XA 4YTIA 3V5JA 4BWKA 5AV4A 2IZSA 4M8TA 1W2FA 2YIRA 5A6NA 1ZZ2A 2IN6A 3CTJA 3BHHA 3FKLA 3GVUA 3PYYA 2J51A 4F9CA 2OWBA 3SLSA 3FQHA 1A06A 3Q5ZA 2XNMA 4IM0A 4Y5HA 1FINA 3PA3A 3U6HA 5LVLA 5K0XA 5DN3A 2R3LA 2V62A 1HCKA 3UNKA 5J5SA 2WMUA 5FEQA 2NPQA 4X3FA 2CNUA 3GT8A 4KIOA 4PDYA 2WO6A 2ITUA 1F0QA 4MHAA 3EYHA 2DUVA 2F9GA 5ANDA 3U55A 3RWPA 3ZBFA 4E6DA 3CPBA 1Q8WA 3G0FA 2C30A 4AW5A 2GNJA 5BQ0A 3D83A 2PUIA 5KO1A 3NR9A 5HG8A 5DVRA 2C5OA 2WQOA 5L8LA 4OT6A 3R7YA 4C35A 3W0NA 4XG9A 5KBQA 1M52A 1KOAA 3FLZA 4MXCA 5HQ0A 2PMOX 5I9VA 2E9VA 1IG1A 1BI8A 4YJRA 2GS7A 3QGWA 2OW3A 2UW3A 4RA4A 1OL7A 2GQGA 3NUXA 2JLDA 1ZRZA 1XH8A 1YOJA 4NKSA 1ZY5A 4U7ZA 3R7EA 5IA1A 3NYXA 5M09A 1O6LA 2BRHA 5BVWA 3BEGA 4YC6A 2XAMA 2WMQA 3QFVA 3GU7A 3CGFA 4CMUA 2QO2A 4RWIA 4UWBA 3BHVA 4C34A 4QOXA 4U40A 4XMOA 3VNTA 5C1QB 3UZTA 3RP9A 4J99A 3ANRA 3G6GA 4KSQA 4FSWA 4BF2A 4IC7A 1XMLA 3ETAA 4EZ3A 1YOLA 4FKRA 4PL3A 1R0EA 4JRVA 4FV0A 3VJNA 4CKRA 5C8MA 4LG4A 3DXPA 1HOWA 4E73A 3UDSA 1T45A 2PE1A 3ZDUA 3AMAA 4D1ZA 4J97A 4KWPA 3A61A 3DTCA 2C6LA 3MTLA 4YU2A 4K33A 4BDJA 4H36A 3VUTA 2XNOA 3NYNA 4C58A 3BIZA 5CEKA 5JZJA 2OICA 3PPJA 4L7FA 5IH6A 3TG1A 2JFLA 4AT4A 4O83A 4S33A 5AAEA 2GSFA 5BMMA 3VC4A 4F70A 1M2RA 1G8JA 3VW8A 3RK9A 4XNEA 4FTIA 2XNNA 3DB8A 3ZLXA 1W8CA 3PY0A 4Q9SA 4DINA 4RVLA 3AC5A 1PMVA 4Y73A 4HYUA 5BUJA 2WAJA 3AD5A 1UNGA 3GENA 2UZDA 3OWLA 3Q9XA 4JBVA 3FPQA 4EH3A 1YXUA 3H9FA 4LOOA 5KE0A 2WEIA 3U9CA 2CN8A 2YM7A 4H1MA 4NCTA 4D5HA 3VS2A 3C0GA 4FK3A 1U5QA 3WZKA 4EQMA 5CXHA 5IA3A 4K8AA 4QNAA 3IGOA 4FT9A 2QOCA 1YI4A 4M0ZA 5KMOA 3G51A 3PJ1A 3VBYA 3A60A 4C4HA 3PVGA 4D28A 1CKJA 4YHJA 4GV1A 3UQFA 3POZA 2WMWA 2FSLX 2VTPA 5ITAA 1XH4A 3UVQA 4G31A 5I9WA 5EM8A 2G01A 3ZFMA 3TL8A 3SRVB 4O84A 4MWIA 2VTTA 5DT3A 4FGBA 2AC3A 3PY1A 2VWZA 3EQFA 4O91A 1ZMVA 3LHJA 2BFXA 3UVPA 1AQ1A 2PZPA 1WVXA 1H25A 4KBAA 4B8MA 5ACKA 3VWAA 3DFAA 5G6VA 2X4ZA 3Q5IA 1M2PA 2X8IA 3VRZA 4AUAA 5DA3A 4M69A 2JBPA 2ZAZA 2Y6MA 5IDPA 2R3MA 4LV7A 5I3RA 5L8KA 3MH1A 2XNBA 3WZEA 2BZJA 3KRRA 3EN9A 4F9WA 4P5ZA 4R3RA 3DT1A 4G5PA 4UZHA 4A7CA 4YZ9A 4B0GA 4DBNA 4K0YA 4PTEA 5EFQA 4YJQA 3LKMA 2VO7A 4PTCA 4CSVA 2E9OA 4FYOA 2ITQA 4QQCA 4B6LA 1RJBA 1BMKA 2YCFA 3PWYA 3NYVA 3PA4A 4YLLA 4KD1A 3GU6A 4FSUA 3EOCA 3CC6A 3PSBA 4GJ3A 3WIGA 4D2SA 4IJ9A 4AZEA 1IEPA 2VX1A 4QMZA 5AUVA 5M08A 2VWIA 3C0IA 3Q2JA 2Z2WA 2XRUA 3BYSA 3OTVA 4UX9A 2QG5A 1JQHA 3DK3A 3EFKA 1OKYA 3RJCA 1I09A 4QMTA 3FJQE 3UIMA 4R7IA 4HOKA 1ZLTA 1OI9A 4TXCA 3PRFA 4NCTC 3UDBA 3ZO4A 3ANQA 2BCJA 2FGIA 4GFOA 5HG5A 3MB7A 2E9PA 3SA0A 2IPXA 5CF8A 4RFZA 1LP4A 4KUJA 4G6OA 4RX9A 2BDWA 3UGCA 2GFSA 4MXZA 4JMQA 4P4CA 4EOIA 2JIUA 5C8KA 4O7ZA 5DEWA 3DZQA 4D4YA 1NW1A 5JFWA 4ZZMA 4C38A 4OGRA 4BY9E 4GG5A 3DJ6A 4WKQA 2C6TA 5HO6A 4Z7GA 3RAWA 4PDSA 2IZTA 4BTMA 2CGUA 3PWDA 3BRBA 3MPTA 2B9JA 1OGYA 1IR3A 2R3FA 3QC4A 4DEHA 4F6WA 3T9IA 4GU9A 5AM7A 4A9YA 4UYAA 5AP4A 1JSUA 3R9DA 3BEAA 3MB6A 4TNBA 4AU8A 4QTAA 4CV9A 5M56A 4ITHA 4IWQA 4S34A 4YUQA 4WOVA 4RJ6A 2ERKA 4WBOA 3MY1A 4RVTA 1FPUA 4LFIA 3OW3A 2XM8A 4S2ZA 3FXZA 4ZZOA 4K9YA 5LJJA 3ZRLA 3UZRA 2BR1A 1UU8A 1VR2A 4FKIA 3AC2A 3DAKA 3KXMA 2WIHA 4FKLA 2VTHA 5B2MA 2HOGA 3KULB 5J87A 3QTZA 4PV0A 2HY0A 2PUPA 2YHVA 4C02A 4OTRA 4F08A 2F7ZE 4EK4A 2VWUA 3AMBA 3ORIA 2C4GA 3RI1A 3ZTXA 5IUGA 3R7VA 3KCFA 4AGCA 3QWKA 4PUZA 5FP6A 4WRSA 2E9UA 4XV3A 5JRQA 2XK8A 4AFEA 5HTBA 3KRXA 4E5BA 3PJCA 3ZXTA 4YTCA 3IG7A 4AGUA 2AQXA 3M11A 4KA3A 4YZDA 5IH5A 4ITIA 3QC9A 3OROA 3ZFXA 3QTWA 4QYEA 4XRLA 3EFWA 4AXEA 4NK9A 3L8VA 2A4LA 3RAHA 1BUHA 3IGGA 4BGHA 5T3QA 5HI2A 2EXEA 1JKKA 4AACA 2J9MA 2QVSE 1PMEA 4C57A 3Q96A 4AAYA 4PMSA 2XK6A 4O0RA 2W5BA 4BN1A 3WE8A 5CAUA 2BZIB 3MFRA 4BCGA 4I1ZA 2GHLA 3L8PA 2R3OA 4DTBA 1FOTA 2AUHA 1H07A 1WBTA 3QD0A 1PMUA 2VTIA 3KF4A 4AT5A 3VULA 4ERWA 5JH6A 4R7BA 4ZTLA 3CEKA 5LWNA 1OBDA 1GJOA 4DA5A 4EUTA 4DHJA 2C3IB 4UMUA 1W0XC 2P55A 2PVMA 3HRFA 1FVRA 4FEUA 1M14A 3UMXA 2PZRA 5DLSA 4IEBA 4JNWA 5GZ8A 5D12A 1YOMA 2OI4X 4ID7A 1PHKA 2C47A 2UW6A 4J53A 4FI1A 3PJ8A 1XHAA 2RFEA 3BLHA 3NRMA 2Y4IB 4WRGA 3FMJA 4EORA 3OOMA 4WNMA 5ANOA 3OXZA 3CJGA 4LGGA 4R7HA 2YFXA 3WF8A 4BVUA 4EC8A 2QC6A 3II5A 4FUYA 3C4FA 4FVQA 4MEDA 4O27B 4TYHA 4WNOA 3R7IA 5AP6A 3BQRA 4AOJA 4IDTA 4MWHA 2YDKA 5JFXA 1GOLA 4JJRA 3W32A 5IQAA 2UW5A 3BU6A 4QPAA 4QMOA 3DZOA 5F4NA 3FI3A 5CS6A 2XKEA 3DV3A 2C5YA 4ANBA 1JSVA 3PUPA 3KN6A 2IWIA 3TZ7A 5KBRA 3Q9YA 4FV4A 3G5DA 2PUNA 2YAKA 3CSVA 4RIYA 3AT2A 3DDQA 2QU6A 4XV1A 3ROCA 1JKTA 4J95A 2P4IA 1JLUE 4ALWA 2C5XA 2DWBA 4PPAA 1ST0A 1A9UA 5FQDC 4EWQA 5LARA 2QU5A 4ZOGA 2YM3A 3FDNA 4ZS4A 3W0SA 3VO3A 5BVNA 2XJ0A 3HECA 3FQEA 1H8FA 3HYHA 3R30A 2FSMX 4EH9A 3R9OA 4BB4A 3ZMMA 2OJFE 4H05A 5EG3A 3BYVA 1GZOA 3DBCA 3ODYX 1YQJA 2O65A 4G17A 4O38A 4MNEA 5AP0A 3DGKA 5CANA 4LDTA 3MWUA 5GZ9A 4QYGA 4KIQA 3IDCA 1NVRA 4ZS0A 1W2CA 1ZWSA 2YERA 2EB3A 1YW2A 3FHRA 4BDAA 1R0PA 4DGNA 1L8TA 5AV2A 4OTPA 4V04A 4XG7A 1TFFA 1GZ8A 4ACCA 4RIWB 4E8AA 4X2FA 4NKAA 5HIEA 2R5TA 2F7EE 3Q53A 5LXMA 4PRJA 5IZFA 5KMIA 2ZDUA 1J91A 4CRSA 1DI8A 4BCMA 2W99B 4I6LA 5GJGA 4OLIA 5H9BA 5HO7A 4Z16A 4BHZA 2B1PA 3EH9A 2GNHA 1R3CA 1OZ1A 3VJOA 5BYYA 3QZIA 4FTRA 4QMXA 4EYMA 5AP2A 2WXVA 4JG6A 1YDRE 3LIJA 4MXYA 4AN2A 5CQUA 3MH2A 3EQGA 2IEWA 4G6NA 5DOSA 4YZMA 3SX9A 3MIYA 4FT0A 1KOBA 2FA2A 4LQMA 4B99A 4BJJB 3D7TB 4AP7A 2PVFA 3DXNA 4L68A 4R8QA 4IAYA 3VS7A 3KK9A 4JQEA 3S95A 3KU2A 4XP2A 3TUCA 4FKOA 1CDKA 4AG8A 2XJ1A 3I7CA 3Q4CA 4UMQA 3P79A 5I9UA 4M66A 2XYUA 1CMKE 3OWKA 3QRTA 4ZIMA 4IAAA 4X6QC 2ITWA 3S2PA 4FG9A 3V5QA 3RINA 3KXXA 4I6BA 5CSHA 3G15A 2HY81 4PX6A 4QP2A 4FIIA 2OKRA 3NDMA 4JAJA 3LJ2A 4C8BA 4F09A 4AOIA 3QRUA 5AIRA 3DDPA 4C62A 3ODZX 3V3VA 5ACBC 2W4KA 2HENA 3G9LX 3FY2A 4BDIA 4FL3A 3KEXA 4N0SA 4GJ2A 2A98A 3DKFA 5FTQA 4GG7A 5JK3A 5ANJA 4IADA 3V6RA 2HYYA 2ZB1A 3DA6A 4BKJA 4M7IA 2GTNA 4ZTQA 4X3FC 5L2WA 4D2TA 4FEWA 4JL9A 5C03A 4BKZA 3JY9A 2W1CA 4F7NA 4BCFA 3NNVA 5AAFA 4AA0A 3COKA 2VTNA 1P4OA 3W8LA 4AW1A 3F5XA 4L6QA 2R9SA 3UYSA 2YLEA 4FR4A 3RCDA 3QKMA 4FC0A 2WELA 5DIAA 3I1AA 1GNGA 5DT4A 4IVDA 2IW6A 3GCPA 4I5HA 4F1TA 2ITTA 1G8AA 4YJUA 3RVGA 4E6AA 4C33A 3A2CA 3QGYA 4KKEA 4BCPA 2ZMDA 4WNPA 3CY2A 3Q4UA 2BAQA 1J7IA 1U54B 4FNZA 4QYFA 2XCHA 5TO8A 4B7TA 1U59A 3VS1A 5HD7A 4WHZA 2EUFB 3BLQA 4O22A 4USDA 4YC8A 2XH5A 4BI1A 4IAIA 2OLCA 4R77A 2GU8A 4RC3A 5AR4A 3AC3A 4YO4A 3HP2A 5LCKA 1QCFA 4XH6A 4DEDA 3FUPA 1OKZA 3HV6A 3QALE 3WILA 3F2RA 1G5SA 3FEGA 2I1MA 3D2IA 3R2YA 2YWPA 4MQ1A 3IKAA 3TZ8A 1LEZA 4CKJA 2R64A 4F64A 2OJ9A 3QCYA 2UVYA 5DRBA 2I0YA 2RG5A 5HZNA 2YZLA 3S1HA 3FV8A 5E8XA 1OUKA 2CGVA 4O81A 2HELA 3OF0A 4QQ5A 3RALA 3VUMA 5GIPE 2Z02A 3R02A 2OJJA 4HYHA 4DCEA 4DFZE 4F7JA 4GIIA 4IAFA 5HEZA 3DU8A 3RGFA 3W0MA 1F5QA 2R3JA 2W9FB 3O8PA 3PIYA 3EFLA 3Q9ZA 4I24A 4IZ5A 3QXPA 4U42A 4AN9A 4HW7A 3LCKA 3MFTA 5M07A 3Q32A 3NCGA 4FTUA 3CIKA 3D9VA 4FOCA 2AYPA 4WIHA 3R1YA 3EB0A 4X0MA 4YPSA 4ANMA 3EN4A 5BVDA 5J1VA 1W7HA 2XJ2A 4TYHB 4LV8A 5CENA 2W1GA 3BWJA 3JPVA 4UB7A 1P14A 2WHBA 4PY1A 4CG8A 3IO7A 4NW6A 4RFMA 5HE1A 3AKKA 4H58A 3COMA 5FWKK 4UBAA 4QTBA 3H3CA 3UC4A 2W1FA 3VS5A 2HZ4A 2O3PA 1Q24A 4RZVA 5CWZA 5KMMA 2CNQA 3RZBA 3OP5A 4FEQA 1K9AA 3OXIA 5M53A 3A7IA 2Y9QA 3AKLA 1RDQE 4I23A 4TRLA 1F3MC 3DPKA 3TTIA 3ORNA 4M69B 3VF9A 5HCZA 1MRVA 3OTUA 4IB1A 4EZ5A 2I7QA 2X7OA 4I21A 3MESA 1XH5A 3QD2B 4OTIA 3NNXA 4TTHB 3EL7A 3QU0A