5HCZA

Egfr kinase domain mutant "tmlr" with 3-azetidinyl azaindazole compound 21
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
324
structure length
300
Chain Sequence
GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELTSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYDMDDVVDADEYLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of a Noncovalent, Mutant-Selective Epidermal Growth Factor Receptor Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
total genus 91
structure length 300
sequence length 324
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hczA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hczA01
2QHMA 3RWQA 3FI4A 2Y4PA 1LEZA 4OAUC 4BGQA 4JIAA 3SGCA 2VTMA 1KE9A 1UWJA 3VUMA 5J95A 5A3XA 4JXFA 1SMHA 2WTWA 3F82A 4O0UA 3ZBFA 4F7JA 3QQJA 3HL7A 4CMUA 5ANEA 3I79A 4IB1A 3HNGA 4E6CA 4WNOA 2O8YA 1TQMA 2C6IA 4W4YA 3FLNC 4RZWA 3NYOA 2R3RA 1GY3A 4YC8A 4FKOA 3VJOA 1JSUA 1W84A 3TEIA 3MH3A 2ITQA 3ZRMA 3H9OA 5DMZA 3F2RA 4QMYA 2FA2A 2QODA 1NA7A 3RBWA 4OLIA 4OTIA 5H9BA 1H0VA 1WBSA 4DFUA 4ALWA 2JITA 4CEGA 5FXRA 4IZAA 2Y9QA 2E9NA 4HYHA 4D4RA 5IA0A 5JMSA 4K77A 2NNWB 3LMIA 3MIAA 3WF6A 2ESMA 3KXNA 2QU6A 3JY0A 5K4IA 3DLSA 4ZIMA 4CFFA 3MV5A 4XG7A 3I6UA 2C5NA 3FPMA 4IZYA 5E8YA 4MF0A 2UZEA 2YDKA 2VRXA 4TRLA 1OIUA 3PTGA 4IW0A 1K9AA 5EHOA 1ZLTA 3ROYA 5E1EA 4TN6A 3UZTA 3D2KA 3CJGA 3C1XA 4YLJA 3O8TA 1H24A 5CF6A 4YHTA 5JFSA 2R3IA 3G0EA 4AN9A 4LL5A 4USFA 4LGGA 5ANIA 1OL7A 4R6VA 2R0UA 2V62A 3SW4A 5KKRC 4BCJA 4EC9A 2A19B 5IQBA 5D11A 4A4LA 5DYJA 4R7IA 3OBGA 5DR6A 2UZUE 4O21A 3H30A 3KQ7A 4U43A 2WTKB 3RP9A 4BTKA 3B2TA 4CKRA 4FTTA 4L45A 4RFMA 2F7ZE 2Z60A 4C3FA 4UX9A 4YP8A 1YI4A 5FEQA 2CDZA 3FMNA 4ZEGA 1RW8A 5AR5A 4NYEA 4GT4A 5ANOA 1ATPE 4A4XA 4EORA 4XP2A 2OH4A 4HNIA 2FGIA 3AQVA 4XS2A 2WQEA 4ENXA 3JVRA 3F9NA 1UU9A 3Q52A 4WUAA 2PK9A 5IA5A 4W4WA 5J9ZA 5JRSA 3S95A 1E1VA 4JBOA 3I5ZA 4NT4A 5CZIA 1JWHA 4K9YA 3A7JA 2WQMA 4N0SA 5KKRB 4XEYA 4IAFA 4ANSA 2HY0A 1RJBA 3BV2A 3U9CA 4HVIA 2UVXA 4HCUA 3PG3A 4FTAA 1UA2A 3L8SA 4QP1A 5HNGA 1O6KA 4NCTA 5K3YA 4EOSA 5AX9A 2OZAA 3R1QA 4GFMA 3VS6A 4YO4A 5GINE 2JC6A 1JVPP 1YDSE 3E87A 3HA6A 3MH0A 4FF8A 4RIXB 1UNHA 2HZ0A 1Q61A 2XK3A 4E6DA 5J1WA 5JFWA 4O1OA 4AFJA 2R5TA 1ZYSA 4ONAA 1Z5MA 3A7IA 4QTEA 1VR2A 3MVJA 4IFGA 4RIOA 4C7TA 4IX5A 1OBGA 3BBTB 4X3FC 1T46A 3V5JA 3R01A 3TI1A 4GUBA 4DEHA 3SOCA 2WQNA 4FOCA 3LE6A 3TNQB 2BIKB 4ZZOA 3DFCB 2J0JA 4FKPA 4FV4A 2GNHA 4YBJA 1QCFA 3EYHA 3HYHA 3MYGA 3ZLSA 5BVFA 5CAUA 3BE9A 4Y5QA 5CAVA 5CXZA 3WBLA 4IX3A 2UW0A 2XKFA 3UYTA 3RM6A 2VU3A 3BKBA 1M14A 3LFQA 4KUJA 5EG3A 1MP8A 2OGVA 3OTUA 4DTKA 2OZAB 5EM5A 3DK7A 1Q24A 3SC1A 4RZVA 5HO8A 5IDNA 3U9NA 2R3LA 3QCSA 2JAMA 3W2PA 1OB3A 4LMUA 3QYZA 5LJJA 2CHLA 4P7EA 5J79A 1URCA 4QYYA 3IKAA 4ASXA 1PXNA 1VEBA 4D5HA 1KUTA 4EKKA 3ZM9A 3R8ZA 4BGHA 3P08A 5DG5A 5AP4A 2VWWA 2Z2WA 3M2WA 1YOLA 3BWFA 4DEAA 3VF9A 4O0SA 2J2IB 4I22A 5E90A 4FG8A 3NMUF 5KE0A 1YI6A 5FWKK 3O51A 3PPKA 2QOCA 5A4TA 3ORTA 4G3GA 2YCSA 2JIVA 3GFWA 2J0KA 2WXVA 3MTLA 2CPKE 5LARA 1PXLA 2ITWA 3P78A 3LFBA 4GG7A 3O23A 5DRBA 4AN3A 3LXPA 4J1RA 1ZMUA 3FAAA 3QXPA 3R8UA 4FKRA 4OBPA 2CSNA 3PJ3A 5TO8A 2BZHB 4JR7A 4CFXA 1BMKA 4BDFA 3PWYA 3I6WA 3U6IA 1H1PA 1XWSA 2BDFA 2YM8A 3HP5A 5HE0A 1WVXA 3WZDA 5FD2A 4J8NA 4CFUA 5CAPA 3TZ9A 1PXJA 2YWVA 3DDQA 5GIOE 4AW1A 3CTHA 4TYHA 3OBJA 4BWXA 3Q9ZA 3CQWA 1OZ1A 3FQHA 3JS2A 3WF8A 5KMLA 2PZ5A 3OUNB 1PXOA 4K11A 3KK9A 4BCOA 2IZSA 5IQGA 1XH4A 3DDPA 2XCHA 3QTUA 4O83A 4C57A 1MRVA 4WBOA 2W06A 1KWPA 2YJSA 5TE0A 3W10A 5DEYA 4BZNA 3U6JA 4FSYA 2OI4X 1UU7A 5AX3A 2HWPA 3IDBA 1RQQA 3NNVA 4BWPA 2VWZA 5GZAA 5BVEA 3I0OA 2HCKA 4RJ4A 3Q9YA 4FV2A 4GCJA 4Q9ZA 3TNIA 3FKOA 4W4XA 1URWA 4FIHA 4EWHA 5L8LA 4ARKA 3PVGA 4NW6A 3BLQA 3RVGA 4ENYA 3ZBXA 5ETCA 3OCTA 4AA5A 3HRBA 4O96A 1QL6A 3R0TA 3Q32A 5EDPA 4DEEA 3VUTA 1B6CB 3UP7A 4NIFB 2OU7A 1MUOA 5KMJA 4JT3A 4Y46A 4ZK5A 3S3IA 5CEOA 4XOZA 4FTMA 2QLUA 4L6QA 1RDQE 2PY3A 1FQ1B 3VQUA 3QALE 4JX7A 3CTJA 4TYHB 4BF2A 4F1MA 5LVLA 3U51A 4EH5A 3LQ3A 2C47A 4FNXA 3FL4A 1BUHA 3A8WA 4X2KA 4XMOA 4DEDA 4Y95A 3WARA 3RTPA 5AIRA 2FO0A 4G3DA 5DR2A 3D7TA 4K33A 2I40A 2E9VA 2JLDA 3V5WA 3QQFA 4YNOA 4E5AX 5HE3A 1OL6A 1GIIA 2XK4A 3LM5A 4AZFA 4LMNA 4GIHA 4AW5A 4QMQA 3PVBA 5J7BA 2UZTA 2UZOA 2KULA 4ASDA 5H8EA 4CZYB 2B9IA 3QUDA 4M69A 5M44A 3ZRKA 3RPSA 2PVFA 2RFDA 3RI1A 2VZ6A 4QQJA 4D5KA 1H0WA 3DQWA 5GZ8A 4FL2A 2YCQA 1ZY5A 3DAKA 4ANNA 4YZDA 2ONLA 4PDYA 2C3LA 1YQJA 4X6RA 1SZMA 4FV1A 2XM8A 3IW5A 3FV8A 1OBDA 5GJGA 3SV0A 2NRYA 5LWMA 3OXIA 4S33A 3TXOA 1KE5A 3C4CA 3ZCLA 3ZO1A 1R1WA 1CKPA 3HEGA 4IBMA 4IAAA 4YTHA 4QRCA 4OTQA 3F3VA 4O0RA 4N57A 5A4LA 4BCNA 3I60A 4CKJA 1UU3A 3QCYA 1W0XC 3IO7A 5IQCA 4X0MA 3GOKA 4ZLYA 2LGCA 5K0KA 2HZ4A 1UV5A 3MTFA 5HX6A 1ERKA 3VN9A 3N4VA 2JDVA 2QONA 3A7HA 3HECA 4R1VA 3O7LD 1YXSA 4I41A 2JKOA 1BLXA 1P4FA 2VWVA 5HE1A 4AT3A 5CANA 4G5JA 2YABA 1VJYA 4TYGA 3R1SA 3ORZA 1NVSA 4A4OA 3FXXA 4Y73A 3VHEA 3PJCA 5BVOA 4GKIA 4ZTLA 3V51A 2X9FA 2FUMA 5F20A 3VUKA 3ZO4A 3QZHA 4BKJA 4M13A 2BRHA 2X7OA 3ZUUA 4E73A 4ERWA 4ACCA 1GZKA 4KAOA 3C5IA 3BGZA 1BX6A 4GYGA 4P2KA 4A7CA 4FNWA 4BVUA 3ORXA 2GS2A 2XH5A 5BYZA 4IC7A 3HV6A 4YJUA 2IZTA 3ZUTA 1DAYA 4BKYA 3MESA 3O50A 3FZ1A 4BBMA 4DCEA 1LR4A 4H36A 4MTAA 4FBXA 4YJOA 5AUVA 3JVSA 2OKRA 3P5KA 3WF5A 5IU2A 3W32A 3OROA 4A9YA 4M67A 3RCDA 1G3NA 4RWJA 3F5PA 1B39A 5EOBA 2EXCX 3DB8A 3KXHA 4PMTA 5EQEA 3PWDA 4FK3A 4I6FA 1SM2A 2BZKB 1ZYLA 3EFLA 3QHRA 4IB0A 3TTJA 4U80A 4C59A 4ZY5A 2W1IA 1M17A 5IQIA 1XH8A 4M69B 4FT5A 2WQOA 4GFGA 2BKZA 2XJ0A 3UYSA 4MX9A 2PYWA 2VAGA 4MNEA 4WNPA 4AZSA 4JAJA 4FSMA 1OKZA 5I0BA 2W0JA 3ODYX 4YJVA 4ANBA 3LFDA 2QNJA 2BCJA 4BDJA 2WMSA 4ZJVA 4O6EA 1PXKA 2C0IA 4E5WA 5LOHA 2ITVA 3BU5A 4DBXA 4D28A 4C2VA 4EWQA 5IQEA 3IOPA 4F63A 4G3FA 2GFSA 3JXWA 2B0QA 4JG6A 3W18A 1YHVA 4MHAA 4WO5A 5FEEA 4CG9A 3QCQA 4IVCA 4Z7HA 2C6TA 3QD4A 1QPEA 4U3ZA 2IN6A 2JEDA 4L42A 3R8PA 2GTMA 4GK3A 2GQRA 5IDPA 1GJOA 4PNKA 3DK3A 1I09A 4RT7A 2C5OA 5KZIA 3P9JA 4I4EA 3KRXA 3GEQA 4JRNA 4PPCA 2RFEA 4EK5A 2F4JA 2FSTX 2BRMA 3ZZEA 4PWNA 1V0OA 2A27A 4O91A 4H3PA 4KS7A 3KF7A 1PKGA 2XA4A 4OT5A 2ITOA 4AUAA 4DC2A 3CIKA 5AA9A 5KHXA 5FGKA 3BYVA 3FZOA 4C4JA 4U42A 5KX8A 4DLIA 3WZKA 1LP4A 1U46A 4C4FA 4DBNA 3G33A 3TNHA 3LLAA 3UE4A 3FEGA 3SRVA 4RWIA 5HU9A 4R77A 4AAAA 5I3RA 4DA5A 4LUEA 4JS8A 4EHGA 3HDMA 3WF9A 4QTCA 3MH2A 2O3PA 5AADA 5KCVA 2HK5A 4QP6A 3R7GA 3P23A 4XJ0A 5EYDA 5IUIA 5FM3A 3FBVA 3ORPA 4RVKA 4EZ7A 4XV3A 5EI6A 4AZVA 3SLSA 5HORA 4CGAA 4QPSA 2IVVA 4F9YA 1OITA 4D2RA 2PWLA 1STCE 2ITNA 1H1WA 4IAKA 5LQFA 1U5QA 4XG9A 4XG6A 4Y72A 3RK7A 2V22A 3LXNA 3VJNA 1PYEA 3A4PA 5EM6A 2PSQA 4KSQA 2ITXA 1FMKA 3L8VA 4M7IA 3VHKA 2BAJA 5K9IA 5EK7A 2XIZA 1FGKA 3KRWA 3PLSA 4LGDA 2YITA 5TKDA 3B8QA 3CP9A 3P7BA 3TWJA 3RKBA 1HCKA 2QQ7A 2C5VA 4WUNA 3CCNA 3OHTA 3POZA 4CYJA 1PMEA 4C4EA 2B4SB 2AYPA 4HZRA 5L6PA 2O0UA 2V5QA 3C4ZA 4E93A 5J5TA 3OF0A 3EQIA 3FKLA 4USDA 5CT7A 3NUXA 5M4CA 4GW8A 4RIYA 4HCTA 4QOXA 4B8LA 3KK8A 3HGKA 3LVPA 2I6LA 4FSUA 5ANJA 4APCA 1PXMA 3HMNA 3ODZX 4LRJA 4WD5A 5BVNA 3QTIA 4ID7A 4E4LA 5HI2A 1XO2B 3PY3A 1V0PA 4BFMA 3H4JA 5JKGA 2W1GA 3MY1A 2EU9A 4RG0A 1H25A 5EYKA 1MQBA 4KS8A 3W33A 2RKUA 2VD5A 2X2LA 2QO9A 1R0PA 4D1SA 2PUNA 3OXZA 3ROCA 2ZV2A 3E8CA 4YSMA 4YJNA 4QNYA 1W83A 3K3JA 4OTPA 1OIRA 1PMVA 3MPMA 5EM7A 4ANOA 2H34A 2XEZA 5C8NA 2G2FA 2QO7A 2YIXA 3KEXA 1H27A 3EQGA 4OTFA 5CSWA 5EOLA 4J97A 4HJOA 1ZAOA 4W8DA 1F5QA 3D0EA 3AT3A 4Z3VA 4EOMA 2WMWA 4ACMA 3QYWA 1BYGA 4W4VA 1YW2A 5D7VA 4EEVA 4XCUA 1YHWA 3BELA 3KB7A 3BYOA 1VZOA 2PE2A 4XNEA 4N6YA 4EK8A 5LVOA 3V04A 4D9TA 5BX0A 4EOKA 5IH5A 4Q9SA 5ACBC 4GH2A 3IGGA 2VTPA 5KMMA 2YCRA 4L3PA 5A9UA 3VNTA 2EVAA 2WMTA 5GZ9A 3LCOA 5E8TA 5HIEA 2HOGA 5DEWA 2JIIA 4O0WA 1FGIA 3O8PA 3VUDA 5CSXA 3ZSIA 1YDRE 3FI3A 3ORNA 3ANRA 1R3CA 2CN8A 4UWYA 2W9ZB 1XBCA 5AM6A 4MXYA 5CU6A 4GS6A 3WIKA 3L1SA 5CU3A 3GENA 4YO6A 4NJ3A 5E8SA 4JX3A 3EKNA 1OMWA 4MD9E 4XX9A 2QVSE 4JJRA 3NW7A 3HX4A 3PZEA 4FKTA 3U6HA 5IA3A 4XHKB 4FR4A 3RAWA 3E64A 2OIBA 4DHFA 3NWWA 3IPHA 1JSTA 3LOKA 5IUHA 2IW8A 2Z02A 2WU6A 1H00A 3CR0A 3MB7A 4FV6A 2ZM3A 3ALNA 4CT1A 2ZMDA 4FTNA 2J9MA 3C4FA 2RIOA 3E62A 5DBXA 5C27A 3O8UA 1ND4A 5M51A 5FTQA 2Y6MA 5K0XA 5HTIA 2VTNA 1SVHA 4X7QA 2PE0A 4GUEA 3NIEA 5AV4A 2G2HA 3KC3A 2OWBA 3LCTA 3MA6A 3QD0A 4O7VA 2UW3A 3NAXA 2Y7JA 2VTSA 4S32A 1KOAA 3CEKA 4OTWA 4CMOA 4HPTE 3EYGA 2VX1A 3F3WA 3ZU7A 3KU2A 5A6NA 2ZM1A 3R7UA 3W2SA 3TDVA 3TL8A 3PVWA 5J9LA 3OT8A 3RPVA 2CJMA 2R3GA 3H3CA 3I4BA 3WZEA 3GP0A 1FBNA 4X3FB 4AOTA 2W1FA 1UKIA 1J1BA 5AEPA 4MKCA 4UV0A 3RPRA 3MVHA 3BX5A 4L3JA 3JR1A 4KIKB 5L2SA 4G9RA 2ITZA 3VW6A 4AZWA 4KNBA 2NO3A 4LV5A 4RA5A 4WT6A 4BI0A 2WMQA 4QQTA 3EQHA 3MBLA 4QMWA 1YKRA 4XRJA 2UVYA 2JDRA 2QKRA 5IISA 2JDSA 3PPJA 1JKKA 3WYXA 3SG8A 4G6LA 2P33A 4MXOA 1YI3A 3AC3A 5L6OA 4TWNA 1PRYA 4S30A 2GS7A 1M2PA 2XNPA 4R3RA 4AACA 4O7WA 5CAOA 4IMYA 1OUKA 2GNLA 1OL1A 3TNPC 2GNJA 4KKEA 4ZTHA 3BU3A 4E4XA 3IW6A 3D94A 4AWIA 2J4ZA 3ETAA 4BYIA 4D9UA 5CEMA 1EH4A 3UG2A 4O81A 2I0YA 3FI2A 4DH3A 3SRVB 2P55A 3G90X 3LCDA 4QMOA 5IPJA 4ZS4A 1U5RA 1ZMVA 3EZRA 4HYSA 3THBA 4GK2A 5CVHA 3DTCA 4KIKA 4IVAA 4KA3A 5EHYA 4L00A 1ZZ2A 4L67A 5IA1A 4FKQA 2W9FB 3QWKA 5IMEA 3UBDA 4QTAA 2AC3A 4QQ5A 3F3TA 3R9DA 4JLCA 3F2AA 2GHMA 1IA9A 1WBTA 3HAVA 4BCPA 3EKKA 4FMQA 2PL0A 2QG5A 5C26A 3NZ0A 1W82A 2F57A 4FSZA 4FV0A 3UDBA 4JNWA 3UVPA 5EKNA 4R5SA 4EUUA 2VO6A 2VWUA 1KV2A 4IM3A 4RGJA 2X7GA 3F6XA 4EL9A 2ZDUA 2ERZE 2W1HA 4QPAA 2C6EA 5K5XA 2W5HA 4J53A 3EN6A 5DOSA 2XRUA 5HICA 4EH3A 4BDIA 2HZNA 3GC0A 5EYCA 2C6KA 2CNUA 4EOQA 2YAKA 2XBAA 4FIGA 5KNJA 3HA8A 4PPAA 5M57A 3BYUA 3OWLA 4IAIA 1DI9A 2VWYA 4O86A 5GIPE 4FKVA 3RINA 3AMYA 3LQ5A 3R9RA 1YVJA 4QP9A 3PUPA 5FTOA 1OVEA 1NXKA 5H2UA 3GOPA 2HY81 1Q8WA 2BR1A 5CLPA 3L9MA 4FVRA 1ZRZA 4FKGA 3FZRA 1PKDA 3R7YA 4ZJJA 1KE6A 4U45A 3ZFXA 5L8KA 3QBNA 2OIDA 2VTLA 5F1ZA 4ORKA 1Q3DA 3QTSA 1Z9XA 3EN7A 3QGWA 2ZV7A 2BRBA 3Q4UA 5BQ0A 5IMXA 2UV2A 3DTWA 1O9UA 4OTDA 4FT7A 1JBPE 3EQBA 4J98A 4Z9LA 3TZ8A 4U3YA 2F2CB 3OG7A 3D15A 3S1HA 4IE9A 4G5PA 5LWNA 3DB6A 2C1BA 3D5VA 1SNXA 3R7VA 4EQUA 4HVDA 3EQCA 3EL8A 2FSLX 2W99B 2I0HA 3KRLA 1GAGA 2YEXA 2SRCA 3E7OA 5HG8A 3AG9A 2YCFA 4J7BA 2KTYA 2BFYA 3ZH8A 4I0RA 4E26A 4JDIA 4NKSA 5CX9A 4UMTA 5JFVA 4PTEA 3PYYA 4JG8A 3Q53A 4JQ7A 4ZMEA 4TYEA 1Q41A 2W05A 5AM7A 5AP0A 3NCZA 3R28A 2ZV8A 4FV7A 2F49A 3DT1A 3ZRLA 2CGWA 4FKJA 4RJ5A 4D4YA 4BICA 4PMSA 4L52A 4QMZA 5AP6A 4R5YA 1W98A 4EJNA 3DJ5A 3ORLA 3MY0A 4M84A 1F3MC 4QMXA 5I4NA 3TUCA 2RFNA 2BZJA 4RIXA 4D55A 4AOIA 5EM8A 2QCSA 4F09A 3VS2A 5IA2A 2Q83A 4PDSA 3DV3A 1LPUA 4EONA 1XHAA 4PQNA 2GQGA 2F7XE 3FMLA 4AU8A 2BIYA 4DT9A 5ACKA 1K3AA 5CWZA 5C4LA 3H9FA 2YDJA 1GZOA 3I7BA 4KBAA 4W9WA 5K4JA 4EH6A 4O0TA 3ANQA 5GNKA 2GFCA 4IWOA 3A62A 3OXTA 4II5A 4GVJA 3RAKA 3EWHA 3ORMA 2UUEA 2W1CA 1P2AA 4XOYA 2LAVA 5ITAA 5AV2A 1OECA 3CS9A 4IIRA 3TZMA 4CD0A 3R6XA 4NEUA 3UIXA 4MD7E 2J51A 2QURA 4I21A 4NM7A 4YJTA 5EW3A 3C0IA 4AFEA 3C0HA 5AP2A 5I9XA 5FUTA 2WIPA 4U5JA 4RLKA 4L7SA 4QD6A 3RJCA 3TUBA 3DPKA 4KINA 4O0YA 4YBKA 3QZGA 5E8VA 3TIYA 2YIQA 4DH1A 3ERKA 4AOJA 3ATTA 2C5YA 3OVVA 3QUEA 5LVMA 3HV3A 3L9PA 2CCIA 4CTBA 3PXQA 3EN5A 3R04A 4XV1A 3WZJA 2Y4IB 5HE2A 1YWRA 4FKSA 5HZNA 3UTOA 3QRIA 3PY0A 3Q5IA 5IQAA 5BVWA 4FTJA 4JDHA 3R71A 4DEGA 4KKGA 4QMLA 3OT3A 4O1PA 5EQPA 3QGYA 4UZHA 4F0FA 1REKA 2X4ZA 4MNEB 5AUXA 3O17A 2P2HA 4BTFA 3G9LX 4KWPA 3AMBA 3H9RA 3MVLA 4XYFA 4DGGA 5GJDA 3UPXA 4WA9A 2J5EA 3MFTA 4TYIA 3UO5A 3D5XA 4JDJA 4BI1A 2BPMA 4C34A 1QMZA 3T3VA 3MJ1A 3QZFA 3GBZA 5IQFA 2R7BA 1JQHA 3L9LA 2XYUA 3G6GA 1U54B 2GPHA 3NUUA 4DEIA 4LRKA 3HLLA 3KFAA 5AUZA 3OCGA 2XNGA 5CU0A 5CNOA 3LXLA 4BCKA 4D4VA 3IW8A 3DKCA 4YJSA 4EC8A 4YZCA 3VRYA 1OIYA 4IXPA 3NYXA 4E3CA 4MBIA 3K5VA 1NVQA 5HG7A 4B0GA 2OICA 1V1KA 4AT5A 1XQZA 4PP7A 5A14A 5BMSA 2GS6A 3FZTA 3QLFA 3KRJA 2OW3A 1IRKA 4BZOA 3T9TA 4DFBA 5E7RA 3R1YA 2UW9A 3E8EA 5J1VA 5CT0A 5DT4A 5HHWA 4A9TA 4RIYB 2PULA 4RWLA 2X8EA 2XNBA 4F08A 4FEQA 3JUHA 3NNWA 3OY1A 2JKQA 4XH6A 1DS5A 2G01A 4ZZNA 3LFAA 3COKA 4EZ5A 4OR5A 3ZLYA 1QPCA 3VUGA 1ZYDA 2VTRA 3QLGA 2FYSA 4HGLA 4F99A 4U7ZA 3R30A 4XG8A 5M56A 2JDTA 4KSPA 4YURA 2UZLA 2XNNA 3R7OA 3QQKA 1NVRA 4YLKA 4EH7A 4BDCA 2BALA 4F4PA 3EQDA 2WTKC 3O7LB 4CZUA 3RAIA 3NNUA 4IM0A 3ZXTA 4F7NA 3E3BX 5E8UA 3FLYA 3S4QA 2XUUA 4QP4A 3ULZA 4BTJA 5B0XA 4FTQA 3Q9WA 3KULB 5E8XA 3E92A 5FRIA 3PG1A 5HCZA 5CTPA 4BIBA 2XKDA 3SAYA 4MD8E 4G9CA 4O2ZA 1A06A 4U8ZA 4D2TA 4CV9A 2BMCA 1U4DA 4FIJA 2XS0A 4FIFA 5AR2A 3PXYA 2XIRA 4CT2A 4E20A 5FTGA 4D4SA 3FMKA 2BHHA 3EZVA 4PF4A 2H8HA 2WTJA 3CBLA 1XKKA 4C02A 1MQ4A 5AUTA 3JY9A 3ZM4A 3C4XA 3OUKA 5CASA 5DRDA 4FEXA 4DFYA 3IECA 4LYNA 3OEZA 4EYMA 4BDAA 4UMPA 3RWPA 2XJ1A 3R8LA 4M15A 3KCFA 3TNWA 1XH5A 2W1DA 3ELJA 3POOA 4ZTRA 4C0TA 5BYYA 3NIZA 1CSNA 5TOZA 2WMAA 2OFUA 3QL8A 4JL9A 4OTRA 3UIMA 5AAFA 4JDKA 2EB2A 1OUYA 4IVDA 4BCQA 4F64A 4XLIA 2PVYA 2VGOA 4GJ2A 5I9YA 4GYIA 4ZTMA 1OKVA 5E4HA 3DAEA 4K8AA 2UVZA 4G16A 4J96A 4K6ZA 5FLFA 3UMWA 2WELA 4FT0A 3UPZA 5EW9A 3BBWA 3LHJA 2XEYA 3UOJA 4MH7A 3TJCA 4RJ3A 4JRVA 3NUAA 4WG4A 2Y4IC 5KMOA 4MBLA 1H1SA 1W7HA 3P86A 5EQYA 1REJA 3WYYA 4IFCA 3D14A 3D7ZA 3VBQA 3U54A 4AZTA 4BCFA 3R83A 3EL7A 5CEPA 4WRGA 5HIDA 3KY2A 3W8QA 3IG7A 2WTDA 5DE2A 3OEFX 2PVMA 3V8WA 3ATSA 2VWIA 1BKXA 2J0LA 2XKEA 3CJFA 3FLWA 4FNZA 4PL4A 3GU6A 4R3CA 4RX7A 4M66A 4FZ6A 5E1SA 4O7NA 3PRFA 4KABA 3PA4A 4R7BA 5JQ8A 2C68A 1Q8YA 4LGHA 2ETKA 2F9GA 3IDPA 5ANGA 2VTIA 2XM9A 4F65A 3KXZA 3R9HA 2ONLC 4ANQA 5E91A 3PRIA 3PIZA 5CQWA 3QKMA 4I0TA 3F61A 1P14A 3OP5A 5HVYA 2YM7A 2QOOA 5AP3A 4AZEA 4JOAA 3FY2A 2FB8A 2R3QA 2CGXA 3DKGA 4CXAA 4B9DA 3LJ0A 4RX8A 4FV3A 2PVJA 5JH6A 3N4TA 4X2NA 3HDNA 4M0ZA 2ZYBA 4YPDA 3GQIA 2GHLA 4MXCA 4IVBA 5CEQA 2H9VA 3ZXZA 3TM0A 5GHVA 5BMMA 5HTCA 5F4NA 4CV8A 5AUWA 1TQPA 3LPBA 3F7ZA 2ITUA 3EFKA 2EUFB 2O65A 4F7LA 2PZIA 4K0YA 4NKAA 3CGFA 4JBVA 5E8WA 4B7TA 4NIFA 1OI9A 2CLXA 3R22A 4GT5A 4AW0A 5JRQA 2JD5A 3BGQA 2R9SA 2BTRA 4NZWB 4IJPA 4V05A 5DPVA 5HOAA 3KMUA 3Q4CA 3ZDUA 1H1QA 3CTQA 4PDOA 4IANA 4P90A 1M2QA 3BPRA 3QXOA 2Z8CA 2XB7A 2X7FA 2IW6A 3DXQA 4HGTA 4IH8A 4AGUA 1U59A 2Q0NA 5KZ0A 4NTTA 3EQFA 3N4UA 4ANLA 4Y85A 3JYAA 3LAUA 2B52A 3FY0A 3H10A 3FXWA 1BI7A 2RF9A 4CTCA 2OF4A 4EH2A 4IWQA 3BEAA 3HZTA 4UALA 3IONA 4X3JA 4CQGA 5KO1A 4YJRA 3OMVA 3GFEA 4J95A 4MF1A 4BN1A 4EKLA 4FI1A 4QYFA 2V55A 3HRFA 3HMOA 4EYJA 4I5MA 5L2WA 4DCAA 3UGCA 4EOLA 3VIDA 2PZYA 2YIWA 5CZHA 4CRLA 3COMA 3KKVA 5I9UA 2CKPA 4G17A 3P7AA 3PE1A 3IK3A 2VWBA 3PSCA 4YHFA 4C61A 4EH9A 4W8EA 4LI5A 5AR3A 3VUHA 3EIDA 4D1ZA 3T8OA 4XUFA 2IVSA 5HG9A 2VNYA 2IO6A 3I5NA 1TVOA 3DS6A 3MIYA 4XG3A 5HNIX 5AWMA 5L6WL 3NNXA 3FQSA 4ACGA 2ACXA 2REIA 3FC1X 3CD8A 3NLBA 4QP2A 4YC3A 4BYJA 3AD6A 5JGDA 3CPBA 3R21A 3D5UA 1J7UA 4I1ZA 4ZSEA 4CNHA 3KVWA 3V01A 2QR8A 4L9IA 2OK1A 2WHBA 4LM5A 3T9IA 4G31A 2P3GX 3UVRA 4AE6A 3MFRA 2ITPA 2EB3A 3D83A 4BDKA 4BDEA 4I94A 5JN2A 3MDYA 2WMXA 4FT3A 4FSTA 4IJ9A 3WE4A 3G51A 3HMPA 5D9HA 2UZBA 3BYMA 3VS4A 4ZY4A 1H07A 1WVYA 3ZEWA 2BZIB 3TKIA 3UVQA 3C9WA 4HCVA 4ALVA 5HTBA 4FUXA 1ZYJA 3EMGA 2XNMA 3DZQA 5EKOA 4ITIA 5BUEA 2CN5A 2I0EA 3D2IA 4H1MA 2YWPA 4GU9A 3D7TB 3DBEA 3LXKA 5AP1A 4KD1A 3QHWA 3A99A 4F70A 5C8MA 4ZS0A 3OWJA 4PL5A 4YHJA 2WMRA 3KCKA 5ETAA 2XKCA 5M53A 4QTDA 2HYYA 4YC6A 4X2GA 4AW2A 3EQRA 2WTVA 3BRBA 3QZIA 3NW6A 3FL5A 5EYMA 5AUUA 4Z16A 3IGOA 3QKKA 3I0QA 4GJ3A 5I5ZA 1QPDA 5IEVA 5JEBA 4YPSA 2YISA 3VS3A 4BBEA 1UWHA 2CKEA 2BROA 5DNRA 4L46A 3Q96A 3CC6A 4C4IA 2ZOQA 2BTSA 3EQPA 2X0GA 2WNTA 3TTIA 1Z57A 3NYNA 2JGZA 5L3AA 2CMWA 3PE2A 4UYAA 2QU5A 5C03A 4FEVA 4NWMA 4F1TA 2A1AB 1XJDA 3E8DA 1CKJA 3GNIB 5IQDA 1WBOA 3NSZA 3PA5A 3PJ8A 3QC4A 4QO9A 5CI6A 5DLSA 5GJFA 3Q6WA 2XRWA 4X6QC 4BI2A 4CYIA 3BLHA 3FMEA 3ZC6A 3DBCA 3Q2JA 1NT2A 3ITZA 3VC4A 2R3FA 3OWPA 4DGMA 3DJ7A 1CDKA 4GVAA 5LMBA 2XP2A 3W2CA 3C13A 1XBAA 3KL8A 3GU5A 5AR4A 4QYHA 4AP7A 5B7VA 4FTLA 4S34A 5HLPA 3OWKA 3QTQA 2WOUA 4FE2A 2WD1A 1ZZLA 1J7LA 2QD9A 4IEBA 5HBJA 2Z7SA 5I9ZA 2WZJA 3HUCA 4YNEA 4RJ7A 5JQ5A 4BCMA 2A2AA 2R2PA 3WOWA 4KRCA 2E9OA 5DVRA 4BL1A 1YRPA 3RM7A 4CQEA 4IC8A 2WO6A 3E63A 1VYWA 3OOGA 4ERKA 2UW8A 1JNKA 3R2BA 2WEIA 4V0GA 3COHA 5F95A 1R39A 2BHEA 1Q99A 2XVDA 3F5XA 4JQEA 4L3LA 3FYKX 4NSTA 4ANMA 2O5KA 3R00A 4GG5A 4KRDA 3UO4A 2VTTA 4XP0A 4EK6A 5L4QA 2XYNA 4QP3A 3W2OA 4EHEA 4HW7A 3HRCA 4DFLA 5L8JA 2QOBA 1CM8A 3F69A 3OOMA 3CXWA 3VVHA 1G5SA 1FVTA 3LJ1A 4F7SA 4F6SA 2VTQA 3GCPA 4BIEA 4UMUA 4JI9A 3V3VA 4RA4A 3OY3A 3FLQA 2X81A 3UZRA 1P4OA 3AC5A 5CU4A 4QMMA 4BDBA 1V0BA 4OTGA 4XV2A 3EJ1A 3TJDA 3S0OA 4F6UA 4JR3A 5H3QA 2BRGA 3OW4A 3K5UA 4YLLA 2JDOA 2QOLA 3NW5A 4G6OA 3MY5A 4OAVB 2PMLX 4AGDA 5CYIA 4PTCA 4JVGA 4DH5A 3MPTA 3SQQA 4L43A 1GOLA 2VO0A 3C7QA 4GU6A 4MXXA 2X6EA 4RFYA 4X2FA 3VAPA 4FL1A 2JBOA 2QC6A 2C5XA 3EHAA 2XNOA 3QCXA 2GSFA 3UOKA 3A61A 3AD5A 3MN3A 3LW0A 3QQHA 4UMQA 3WILA 4FZAB 3PA3A 4FGBA 1Y8GA 2AC5A 5E92A 5CF4A 4S31A 4AXAA 3OCBA 4QNAA 3NX8A 4XBUA 2XZSA 2DUVA 2IWIA 5JGAA 2XK6A 2AUHA 5ETIA 3F3ZA 1ZWSA 4WSQA 4CLIA 3HV5A 3KN6A 4BTMA 1IA8A 3S2PA 4LV8A 2VO7A 3RCJA 4RVMA 3FXZA 1XH7A 4IWDA 4RQKA 2B9HA 5TT7A 5ANDA 4QTBA 2ITTA 4YUQA 5KMKA 4FVQA 4HGSA 3C50A 4BWKA 3RHXA 1PY5A 1KV1A 4TPTA 5D41A 2UZDA 5ICPA 4ZY6A 4F6WA 2HW7A 3FDNA 1OGUA 3MI9A 3QA0A 4RWKA 5FM2A 5LXMA 3W1FA 3ULIA 4QP7A 3CGOA 4O7ZA 4C3PA 4AS0A 2F7EE 3VWAA 1IG1A 5AV0A 3UG1A 5HX8A 2XK7A 5C01A 3V5QA 3W55A 4I3ZA 4WSYA 4UXQA 2ZAZA 1OPLA 4J52A 3KXGA 4QP8A 4C38A 3MH1A 3V8SA 4YMJA 5IH6A 1WVWA 3GCVA 2W1ZA 4HVHA 2PVHA 3BGPA 1YXXA 4MK0A 1KE7A 3O2MA 3ZDIA 4BRXA 4FKUA 2X39A 4F0GA 3R63A 3G15A 5IQHA 5DN3A 4D1XA 4HVGA 5HU3A 4QT1A 1PW2A 5DH3A 3RK5A 1OKWA 2XMYA 3ZYAA 4NL0A 4U9AA 1SVGA 3ENMA 3GI3A 2UW7A 2J7TA 3C0GA 2W96B 3V6RA 5DWRA 5EDRA 3MFUA 4O7YA 2IVTA 3C5UA 2P2IA 1ZYCA 3MS9A 3FWQA 4NFNA 4WKQA 4UWBA 5L2QA 4K18A 3NR9A 4BCHA 3U87A 3DA6A 3ZLXA 4O7RA 2QOQA 3AGMA 5LMKA 4FKWA 3SA0A 5HKMA 4HVSA 2YA9A 2B9JA 2WTCA 1H1RA 3LFFA 3DKFA 3R1NA 5EFQA 4DEBA 1H4LA 4BHNA 3RMFA 4F1OA 3LFNA 2P0CA 4L01A 4PMPA 1BI8A 2GNFA 1HOWA 4CFNA 4MQ2A 2WKMA 3F3UA 4H3BA 2X8DA 4QQCA 4WHZA 4O2PA 2FSOX 2R64A 1Y6BA 4M68A 4WG5A 3LCKA 5AJQA 5JSMA 3EN9A 2WQBA 2Y6OA 3ET7A 3IW4A 4DGOA 1UU8A 4HOKA 4FTUA 3TCPA 4ASEA 4DINA 3QX2A 3GU8A 2BILB 2VV9A 3NCGA 3NAYA 1TQIA 1SVEA 4D0WA 3QTXA 4AG8A 3B2WA 5LCKA 3W16A 2OF2A 3CY3A 3FSFA 4PDPA 4QMTA 4MWHA 3LQ8A 3LJ2A 3A2CA 4GFOA 1XBBA 5IA4A 3FQEA 3SG9A 4I5CA 2IJMA 1ZOEA 4TYJA 2GQSA 1KOBA 3CD3A 2PPQA 3QAME 5J87A 3ALOA 3GC8A 3AC4A 4KIPA 3MGYA 3GVUA 3FI8A 1UNLA 3TN8A 2EWAA 4RVTA 1WBWA 5M4FA 3HV4A 2WAJA 3LZBA 2HENA 4C3RA 3UQFA 2W4JA 3GC7A 3UC4A 2OLCA 1YWNA 3LM0A 3V6SA 2E9UA 4G2FA 3QTWA 4P5ZA 3DOGA 3PJ1A 2I0VA 4RJ6A 2JFLA 1WZYA 4EK4A 1DAWA 5DIAA 3UODA 4XLVA 4EQCA 3RZFA 1Q3WA 1OM1A 3IW7A 5EI2A 1CKIA 1IASA 3ZUVA 5CQUA 4GT3A 4GSBA 1JSVA 1CMKE 5HBHA 3PXRA 3E93A 2IZUA 1YXUA 4YSJA 5BVDA 3NS9A 4G3CA 4H1JA 4CVAA 3DQXA 4DYMA 5CVFA 3TIZA 3A7FA 3OS3A 3QRJA 4DG3E 3MFSA 1QPJA 2NRUA 3K2LA 2IVUA 4EK3A 2PZRA 4I93A 3CQEA 1FVVA 1WBPA 2UW5A 4MVFA 4N70A 4FZDB 3R8VA 3L9NA 3PXZA 4FUYA 4UWCA 1GZNA 2R3HA 4NH1A 4PNIA 3PZHA 3NEWA 4WRSA 4R78A 3QA8A 5K5NA 3OTVA 3AT4A 4PPBA 2R3NA 3H0ZA 1OL2A 2H6DA 3DFAA 4UYNA 4YJPA 1X8BA 4F9AA 5HLNA 3CKWA 5LMKC 4FK6A 4L68A 3PLAE 5DI1A 2QLQA 4IZ7A 1KE8A 3SX9A 4FSWA 2PMOX 3R2YA 1YHSA 1FPUA 3SXRA 5DGZA 4ZJIA 3D9VA 5TR6A 3VRZA 2YIYA 5M07A 3TKUA 2YACA 4R8QA 3BU6A 3UZPA 4LFIA 3BI6A 2W17A 2B7AA 2C6LA 3QQUA 3ZO3A 5FXQA 4BIDA 2PVNA 1JKLA 3UP2A 3WIGA 3Q5ZA 4U40A 4GEOA 4FTKA 2G15A 2PZPA 2Y8OA 4BCGA 3ENHA 4YU2A 5JZJA 1PHKA 3OFMA 3B8RA 2O63A 4C35A 4YTCA 1OPJA 5L2IA 1PXIA 2R0IA 3I7CA 4DT8A 3VUIA 2XF0A 4IAZA 4RVLA 5DR9A 4R3PA 4AA4A 4EOPA 1IAHA 2C3KA 3ZZWA 3QU0A 4E1ZA 3NYVA 3HV7A 5A4QA 3SKCA 2C30A 2VTAA 4V04A 4O82A 5J8IA 4I6HA 2B53A 2EXEA 2WOTA 2ZVAA 3MVMA 4A9RA 5KHWA 1ZY4A 3HMIA 2CGUA 2B9FA 3GGFA 3ZOSA 1OPKA 2J0MB 3DNEA 1PF8A 3SOAA 4Z55A 4F0IA 4A9SA 4JBQA 3PPZA 3BE2A 1GIJA 1Q97A 2F2UA 2YDIA 3GC9A 4RX9A 5DT3A 4ZLOA 1FOTA 3DCVA 3RZBA 2OH0E 2PMIA 5HEZA 3ZFMA 3TV7A 1M52A 2VO3A 5CXHA 2DS1A 4CLJA 4DH8A 5HVKA 4LG4A 2R3KA 5C8KA 5JGBA 5LVPA 2WU7A 4U79A 1YWVA 4EOIA 1OKYA 2IG7A 2FSMX 2CCHA 4EBWA 1A9UA 3VS5A 4AGCA 4P5QA 4Y8DA 3LKMA 1HCLA 4L53A 5CS6A 3R7EA 3KXMA 2OXXA 3WF7A 4M0YA 1AD5A 4R7HA 5AIKA 3UNZA 3VS1A 3UIBA 2OXYA 4PX6A 3P79A 4TNDA 4RBLA 4EI4A 4JIKA 2QHNA 4IQ6A 2YM5A 3OD6X 3SD0A 1CTPE 4BY9E 5T3QA 5ANKA 1NY3A 4V0GB 5JFXA 5F9EA 4RX5A 4AE9A 3FMJA 4XG2A 2CNQA 2OSCA 2X9EA 1P5EA 2YM3A 3BYSA 4CMTA 5A4EA 3KREA 5IEXA 5LVNA 5HBEA 3N9XA 4JAIA 2FH9A 3IS5A 5HQ0A 1E1XA 4U44A 2GU8A 3ZLWA 5BNJA 3TKHA 3RNYA 5CY3A 3TV6A 2X6DA 3GB2A 4UB7A 4BDHA 2CNVA 5JZNA 2VNWA 4XRLA 1WMKA 3NGAA 1I44A 2BAKA 4C36A 5KBRA 4MQ1A 2H96A 2YM4A 3LCSA 4L8MA 5IUGA 4A06A 3V8TA 4C4HA 1J7IA 2W4KA 4DF3A 3TT0A 1Y8YA 4I5PA 4ACHA 3PSBA 2OO8X 4FYOA 5J7HA 3FZSA 4OTHA 4CCUA 2PHKA 3AC2A 3G9NA 3TV4A 3O96A 4IWPA 2WEVA 4FSQA 4IM2A 4XG4A 2HW6A 4K1BA 5M55A 3I1AA 3MA3A 1Q62A 3RGFA 4AA0A 4CFWA 5E8ZA 1K2PA 5AP7A 4OBOA 4U81A 2ZDTA 4U6RA 2OXDA 3E7VA 3R8MA 5M4IA 4ZTQA 4PP9A 1YXTA 3UO6A 5KUPA 3RALA 4CFMA 3LIJA 4JG7A 4G1WA 2C3IB 2PVLA 5AV3A 3DU8A 2JKMA 2WTIA 3MJ2A 4G3EA 4RMZA 3M11A 4MEDA 4HPUE 5M06A 1O6YA 1SYKA 1L3RE 4ITJA 1H28A 5AUYA 4NUSA 3GU4A 1PMNA 4O22A 2O64A 4O6LA 2VTOA 2XNEA 2GDOA 5LCJA 3K54A 3ZS5A 5BYLA 2B1PA 4PRJA 4TWCA 4FTIA 3C4EA 3M1SA 2RSVA 2HXQA 2G1TA 1PMUA 2PVKA 4MWIA 1ZARA 4O0VA 4D2WA 4EZ3A 4E5BA 4YZ9A 1JPAA 4RC3A 2CLQA 2C3JA 3FMDA 3Q4TA 5JK3A 2I7QA 4GKHA 4FG9A 1H8FA 3BLRA 2VX3A 3NPCA 4IADA 3DKOA 4FOBA 4TY1A 3PDTA 3GQLA 2W1EA 3AXWA 3ZEPA 2X2KA 3JPVA 2JFMA 3FKNA 4EBVA 2X4FA 3DY7A 1XH6A 4LOQA 2X8IA 2RG5A 2A4LA 2XK8A 3D5WA 3TG1A 4BB4A 1FMOE 3RNIA 3QFVA 4XBRA 5AMNA 1YOMA 3DNDA 4ZXTA 5HLWA 4RRVA 4D2PA 3H0YA 2G2IA 2IPXA 4YTFA 5BUJA 3KULA 4FV5A 2UZVA 3A4OX 4IZ5A 3SHEA 4O84A 3ZC5A 1H01A 3QKLA 3I81A 4O0XA 3G6HA 2HWOA 3Q6UA 4RQVA 3DXPA 3GT8A 5CNNA 4I5HA 5BPYA 1Q8UA 3COIA 5HIBA 2OJJA 4H39A 4I23A 4TWPA 5HCYA 4AT4A 1JAMA 4QYGA 4O7SA 4E7WA 5I3OA 4Q5HA 5FXSA 5C1QB 3PFQA 5EW8A 1E9HA 4AGWA 2C69A 3N51A 5DA3A 4TZRA 5D7AA 3OCSA 3FSKA 5AAGA 5AR8A 4OW8A 3FZPA 4C62A 1JLUE 4WNKA 5FDXA 1ZOHA 4TW9A 4FIEA 4Q2AA 2UZWE 2CKOA 5DFPA 4L44A 4WNMA 1PYXA 3MSSA 3OW3A 3DBQA 3AC8A 4FNYA 4UZDA 3RK9A 1DI8A 3PXKA 3ZSHA 4O27B 4C37A 5B2MA 3DXNA 1NW1A 4I4FA 4DITA 2OFVA 1G8SA 1AQ1A 5D1JA 3O71A 2ETMA 2Q0BA 3F66A 3P4KA 2YN8A 3F5GA 4I24A 5CENA 2IW9A 4BZDA 5B2LA 4FGRA 2QO2A 1IEPA 3GUBA 3CE3A 5TF9A 2C4GA 2EXMA 3CSVA 5FBNC 1G8AA 3UMXA 1W8CA 4I0SA 2JAVA 2XIKA 4UXLA 4C33A 2J50A 4EHVA 4TL0A 4UEUA 1J91A 4UMRA 5KMIA 3U55A 3SXSA 2OIQA 3NUSA 4EJ7A 4F9CA 4FV8A 4UBAA 5H8BA 3VS7A 1WCCA 3QC9A 1PXPA 2XK9A 3Q3BA 5ETFA 2UZNA 4AF3A 1VYZA 3FUPA 3QD3A 4FZFB 4DFNA 4FYNA 3PSDA 2ZJWA 4U97A 1XR1A 5HD7A 3NUYA 2JKKA 3C51A 2GNIA 3C4WA 4PTGA 3ZFYA 2JIUA 4G34A 1FINA 3MB6A 4FTRA 2W4OA 4TNBA 4CRSA 5FG8A 3ORIA 3ZTXA 2J0IA 5C9CA 1Y91A 3F5UA 4E6AA 3VBXA 4YZNA 4ZTNA 5HG5A 4GL9A 4RJ8A 4DG2E 4MXZA 3DJ6A 3U4UA 4ZLZA 1Q8ZA 3DGKA 1UVRA 3VBVA 1GIHA 2B54A 3PP1A 4O38A 4MNFA 3LFSA 4FSNA 2BDWA 5D10A 4B99A 4FEUA 5BVKA 4AN2A 4CSVA 2YLFA 3RAHA 3QD2B 4RIWB 2RGPA 4EHZA 3UNKA 4DN5A 3QF9A 3W2QA 1S9IA 2ZB0A 5CF8A 2OBJA 3W2RA 5FP5A 1R0EA 5KMNA 2YAAA 4FTCA 4IDVA 5DT0A 4TT7A 3QRTA 5EI8A 4AX8A 4O7TA 3KXXA 3HP2A 4PMMA 4X21A 2YHVA 4DGNA 3FMMA 4E8AA 1OL5A 3BQCA 2J5FA 4L7FA 4QMUA 3BV3A 4YJQA 1IR3A 4FODA 4BC6A 2C6DA 2PTKA 3IQ7A 5EH0A 5CEIA 2J90A 2QOHA 3PIXA 4OGRA 3T3UA 3V5TA 1GZ8A 2R7IA 3S00A 3DZOA 1H08A 4W9XA 3VULA 4HGEA 5DHJA 3AD4A 4JBPA 4LOPA 4EH8A 4YR8A 2QR7A 5A54A 1M2RA 5AA8A 2OJFE 2YJRA 4N4SA 2WMVA 3VBWA 4ITHA 5LMAA 3BHVA 4TWOA 5CEKA 4FKIA 3R9NA 5HNBA 3ZSGA 4M12A 3Q2MA 3HMMA 4C8BA 4YGAA 4IB5A 1JKSA 1APME 3ACKA 4RLLA 5HGIA 2VTJA 2R3PA 3QWJA 4DLJA 4FC0A 4Y83A 3HVCA 4ZOGA 2VN9A 4ZSLA 4XV9A 3NVMB 2W5AA 2W5BA 4QYEA 3QTRA 3VO3A 2RFSA 2RG6A 3FYJX 5FDPA 3A8XA 3KGAA 4RIWA 5AAEA 2HZIA 3VS0A 3P7CA 4BHZA 2Y0AA 2WB8A 2Z7LA 3U8WA 2VGPA 2E9PA 3OZ6A 3QX4A 4RSSA 4UY9A 3Q60A 4IDTA 4X2JA 4ACDA 3CQUA 3VW8A 2C1AA 3KF4A 5C4KA 3Q9XA 2G9XA 4NCTC 4O7LA 3PJ2A 1JOWB 4NW5A 2IZRA 4J99A 4WOVA 4BGGA 3BZ3A 3LFEA 1UKHA 2ZB1A 4TTHB 3AC1A 4CG8A 5B2KA 4ZSAA 4EQMA 3PVUA 2HIWA 5M08A 2BAQA 4OT6A 4FSRA 1MRYA 2ETRA 3G0FA 4DAWA 4I6BA 1U54A 3REPA 3FPQA 3II5A 5FEDA 3NDMA 4MBJA 4DTBA 4DH7A 3LLTA 3WI6A 5IF1A 3P0MA 2R4BA 1DM2A 2WMBA 4ZP5A 4UN0C 1BL7A 3UQGA 5CU2A 5BUIA 4J8MA 5J9YA 2BUJA 4FICA 4BDDA 2HAKA 5IZFA 2UW4A 2DQ7X 4YZBA 3EOCA 4M3QA 2PUPA 3MW1A 5AP5A 4HZSA 1PJKA 4HNFA 4ZTSA 3IDCA 5EHLA 2XBJA 4B6LA 4E6QA 4KB8A 3V5PA 4FIIA 4FEWA 4A9UA 5CF5A 2XIYA 3WZUA 3NUNA 4MCVA 3BHUA 3R73A 3EH9A 3BWJA 4FZ7A 4C58A 3TZ7A 3QTZA 2V0DA 3HUBA 3VQHA 2HXLA 2JBPA 3DAJA 3MPAA 2I1MA 4RC4A 2OJIA 3FHIA 3QQGA 4HYUA 4V01A 1Q5KA 4KIQA 3SDJA 4CKIA 2XCKA 1IAJA 2CKQA 4H3QA 3QUPA 4I6QA 3UNJA 3CPCA 2PVRA 2WPAA 3CY2A 3ACJA 4D0XA 1UNGA 2GTNA 1O6LA 4ZAUA 3GXLA 5I9WA 2V7OA 2QKWB 3UJGA 2YZLA 4LOOA 4KBCA 3AT2A 1JKTA 2C6OA 1WFCA 5HESA 3A60A 5M09A 3ZONA 4KIOA 2A0CX 2OG8A 2C0TA 4IX4A 4B8MA 3M42A 2C6MA 4NM3A 4IX6A 4FT9A 1S9JA 4QMSA 1J1CA 2XIXA 2Z7QA 1ZOGA 2PE1A 4FA2A 4D2VA 4ZZMA 3ZMMA 2PUIA 4H58A 2QG7A 3K3IA 5CALA 3R02A 3EFWA 4ZSJA 2OJ9A 4MYGA 5A46A 2BKKA 2J6MA 4USEA 1Y57A 5A4CA 2OJGA 5FQDC 2NPQA 1LUFA 2VUWA 4I20A 2X2MA 4NJDA 4P4CA 3L8XA 4FTOA 4Q5EA 4WG3A 3AGLA 3DLZA 3P1AA 4U0IA 4CZTA 4EH4A 3E88A 4DFXE 3O0GA 4LL0A 4APPA 4ZMFA 1GNGA 3ID6C 2X1NA 3DBFA 2R3OA 3CKXA 4WIHA 4KKHA 4GMYA 4B4LA 3PY1A 3ZO2A 3LMHA 2GCDA 3GCUA 3EB0A 3GU7A 3QRUA 4TXCA 2FVDA 3UOHA 5M4UA 3IOKA 3LFCA 3TDWA 2XJ2A 3G5DA 2V7AA 2YERA 2PMNX 2HELA 4GIIA 5T68A 5A6OA 3UIUA 4MAOA 5HO7A 2VTHA 3KN5A 1WAKA 4FVPA 4NU1A 2WIHA 4NTSA 5D12A 2W7XA 2YIRA 5JT2A 5G6VA 4ZSGA 4DE4A 4FL3A 2C0OA 3U4WA 3WE8A 1WBVA 3LMGA 3UC3A 3SW7A 2DYLA 2QOKA 1L8TA 1Y6AA 4BDGA 1TKIA 1ZMWA 4ASZA 3GCSA 4DGLC 5KBQA 3SXFA 3A7GA 3BQRA 3FLSA 3ZHPC 5CSHA 3NVKI 3UQCA 1Q4LA 2ZMCA 3MWUA 2E2BA 4EOOA 5AR7A 2NP8A 3DK6A 3BCEA 3TUDA 2Z7RA 3VBYA 4J71A 3E5AA 5HD4A 4LRMA 3KRRA 4DFZE 3HKOA 3KMWA 2WMUA 3OC1A 2OZOA 3W8LA 5E9EA 4IHPA 4OUCA 4RC2A 4C2WA 1ZXEA 2B55A 4FG7A 3HAMA 4R1YA 3V5LA 2QI8A 4LUDA 1YDTE 1RE8A 4BBFA 2CGVA 4NM0A 1M7QA 4QMNA 2ZV9A 4Z7GA 5L2TA 1LEWA 1H26A 2WFYA 4K2RA 4GK4A 4M8TA 5CSVA 4FX3A 3NUPA 4PY1A 4OBQA 1F0QA 2UW6A 5CVGA 3F7WA 1R78A 3RHKA 3VBTA 3VF8A 5F94A 5H8GA 2BDJA 4BKZA 3Q04A 2BRNA 4QMPA 3BEGA 3FE3A 4IB3A 4RPVA 2YZAA 3FJQE 3QQLA 4BCIA 5J5SA 2RL5A 4GV1A 4D2SA 1M7NA 1WBNA 4PL3A 1OIQA 5FBOA 3BHYA 4TKSA 5HVJA 4DTAA 2YM6A 4YTIA 4G6NA 5G1XA 1A48A 2QOFA 3CLYA 3EFJA 2R3JA 4DG0E 2R3MA 3F88A 3DBDA 5CI7A 2YLEA 5IEYA 3RPYA 1BL6A 4IACA 2O2UA 4PUZA 4U41A 4M97A 1FVRA 4S2ZA 3R7IA 2ERKA 4WBBB 2VWXA 5CAQA 3ORKA 3F2NA 4M14A 1SNUA 3UOLA 5EDQA 3BHTA 1YOJA 5IH4A 3Q4ZA 3D4QA 3KA0A 1XH9A 2YFXA 4EOJA 5IG1A 1J3HA 4HYIA 3GCQA 4KBKA 2WGJA 4A07A 5FP6A 1Q8TA 4C4GA 4D58A 4BR3A 3R9OA 3AOXA 4NM5A 4CCBA 4AQCA 4EUTA 4QMVA 4RFZA 3E3PA 2GMXA 3FHRA 3FLZA 2GHGA 3L8PA 3G2FA 3FC2A 1AGWA 4YZMA 4ALUA 4F9WA 5I9VA 5T6KA 3QRKA 3KVXA 2VX0A 1T45A 3EN4A 4QPMA 1KSWA 2BVAA 3TACA 3AMAA 4JQ8A 4NFMA 4Y5HA 4E4NA 3SVVA 3PXFA 2PU8A 2QOIA 4N6ZA 1MRUA 2BFXA 4IAYA 3PIYA 2PUUA 2ITYA 3FMHA 4GRBA 4I92A 5HO6A 2GNGA 4MXAA 5IKWA 4FKLA 4H05A 2ZM4A 3KMMA 3BIZA 3NRMA 4PV0A 2P4IA 5HCXA 3E8NA 3PP0A 3RPOA 4CFVA 1YXVA 4E4MA 5AV1A 4FV9A 4XP3A 2DWBA 4X3FA 4F9BA 1B38A 4LQMA 5CSPA 5AFVA 4NK9A 3BHHA
chains in the Genus database with same CATH superfamily
2QHMA 3RWQA 3FI4A 2Y4PA 1LEZA 4OAUC 4BGQA 4JIAA 3SGCA 2VTMA 1KE9A 1UWJA 3VUMA 5J95A 5A3XA 4JXFA 1SMHA 2WTWA 3F82A 4O0UA 3ZBFA 4F7JA 2NYAA 3QQJA 3HL7A 4CMUA 5ANEA 3I79A 4IB1A 3HNGA 4E6CA 4WNOA 2O8YA 1TQMA 2C6IA 4W4YA 3FLNC 4RZWA 3NYOA 2R3RA 1GY3A 4YC8A 4FKOA 3VJOA 1JSUA 1W84A 3TEIA 3MH3A 2ITQA 3ZRMA 3H9OA 5DMZA 3F2RA 4QMYA 2FA2A 2QODA 1NA7A 3RBWA 4OLIA 4OTIA 5H9BA 1H0VA 1WBSA 4DFUA 4ALWA 2JITA 4CEGA 5FXRA 4IZAA 2Y9QA 2E9NA 4HYHA 4D4RA 5IA0A 5JMSA 4K77A 2NNWB 3LMIA 3MIAA 3WF6A 2ESMA 3KXNA 2QU6A 3JY0A 5K4IA 3DLSA 4ZIMA 4CFFA 3MV5A 4XG7A 3I6UA 2C5NA 3FPMA 3W0MA 4IZYA 5E8YA 4MF0A 2UZEA 2YDKA 2VRXA 4TRLA 1OIUA 3PTGA 4IW0A 1K9AA 5EHOA 1ZLTA 3ROYA 5E1EA 4TN6A 3UZTA 3D2KA 3CJGA 3C1XA 4YLJA 3O8TA 1H24A 5CF6A 4YHTA 5JFSA 2R3IA 3G0EA 4AN9A 4LL5A 4QDVA 4USFA 4LGGA 5ANIA 1OL7A 4R6VA 2R0UA 2V62A 3SW4A 5KKRC 4BCJA 4EC9A 2A19B 5IQBA 5D11A 4A4LA 5DYJA 4R7IA 3OBGA 5DR6A 2UZUE 4O21A 3H30A 3KQ7A 4U43A 2WTKB 3RP9A 4BTKA 3B2TA 1XMMA 4CKRA 4FTTA 4L45A 4RFMA 2F7ZE 2Z60A 4C3FA 4UX9A 4YP8A 4DHZA 1YI4A 5FEQA 2CDZA 3FMNA 4ZEGA 1RW8A 5AR5A 4NYEA 4GT4A 5ANOA 1ATPE 4BJJA 4A4XA 4EORA 4XP2A 2OH4A 4HNIA 2FGIA 3AQVA 4XS2A 2WQEA 4ENXA 3JVRA 3F9NA 1UU9A 3Q52A 4WUAA 2PK9A 5IA5A 4W4WA 5J9ZA 5JRSA 3S95A 1E1VA 4JBOA 3I5ZA 2A98A 4NT4A 5CZIA 1JWHA 4K9YA 3A7JA 2WQMA 4N0SA 5KKRB 4XEYA 4IAFA 4ANSA 2HY0A 1RJBA 3BV2A 3U9CA 4HVIA 2UVXA 4HCUA 3PG3A 4FTAA 1UA2A 3L8SA 4QP1A 5HNGA 1O6KA 4NCTA 5K3YA 4EOSA 5AX9A 2OZAA 3R1QA 4GFMA 3VS6A 4YO4A 5GINE 2JC6A 1JVPP 1YDSE 3E87A 3HA6A 3MH0A 4FF8A 4RIXB 1UNHA 2HZ0A 1Q61A 2XK3A 4E6DA 5J1WA 5JFWA 4O1OA 4AFJA 2R5TA 1ZYSA 4ONAA 1Z5MA 3A7IA 4QTEA 1VR2A 3MVJA 4IFGA 4RIOA 4C7TA 4IX5A 1OBGA 3BBTB 4X3FC 1T46A 3V5JA 3R01A 3TI1A 4GUBA 4DEHA 3SOCA 2WQNA 4FOCA 3LE6A 3TNQB 2BIKB 4ZZOA 3DFCB 2J0JA 4FKPA 4FV4A 2GNHA 4YBJA 1QCFA 3EYHA 3HYHA 3MYGA 3ZLSA 5BVFA 5CAUA 3TYKA 3BE9A 4Y5QA 5CAVA 5CXZA 3WBLA 4IX3A 2UW0A 2XKFA 3UYTA 2XARA 3RM6A 2VU3A 3BKBA 1M14A 3LFQA 2XANA 4KUJA 5EG3A 1MP8A 2OGVA 3OTUA 4DTKA 2OZAB 5EM5A 3DK7A 1Q24A 3SC1A 4RZVA 5HO8A 5IDNA 3U9NA 2R3LA 3QCSA 2JAMA 3W2PA 1OB3A 4LMUA 3QYZA 5LJJA 2CHLA 4P7EA 5J79A 1URCA 4QYYA 3IKAA 4ASXA 1PXNA 1VEBA 4D5HA 1KUTA 4EKKA 3ZM9A 3R8ZA 4BGHA 3P08A 5DG5A 5AP4A 2VWWA 2Z2WA 3M2WA 1YOLA 3BWFA 4DEAA 3VF9A 4O0SA 2J2IB 4I22A 5E90A 4FG8A 3NMUF 5KE0A 1W2FA 1YI6A 5FWKK 3O51A 3PPKA 2QOCA 5A4TA 3ORTA 4G3GA 2YCSA 1TFFA 2JIVA 3GFWA 2J0KA 2WXVA 3MTLA 2CPKE 5LARA 1PXLA 2ITWA 3P78A 3LFBA 4GG7A 3O23A 5DRBA 4AN3A 3LXPA 4J1RA 1ZMUA 3FAAA 3QXPA 4O4DA 3R8UA 4FKRA 4OBPA 2CSNA 2XALA 3PJ3A 3UDZA 5TO8A 2BZHB 4JR7A 4CFXA 1BMKA 4BDFA 3PWYA 3I6WA 3U6IA 1H1PA 1XWSA 2BDFA 2YM8A 3HP5A 5HE0A 1WVXA 3WZDA 5FD2A 4J8NA 4CFUA 5CAPA 3TZ9A 1PXJA 2YWVA 3DDQA 5GIOE 4AW1A 3CTHA 4TYHA 3OBJA 4BWXA 3Q9ZA 3CQWA 1OZ1A 3FQHA 3JS2A 3WF8A 5KMLA 2PZ5A 3OUNB 1PXOA 4K11A 3KK9A 4BCOA 2IZSA 5IQGA 1XH4A 3DDPA 2XCHA 3QTUA 4O83A 4C57A 1MRVA 4WBOA 2W06A 1KWPA 2YJSA 4O4FA 5TE0A 5DEYA 3W10A 4BZNA 3U6JA 4FSYA 2OI4X 1UU7A 5AX3A 2HWPA 3IDBA 1RQQA 3NNVA 4BWPA 2VWZA 5GZAA 5BVEA 3I0OA 2HCKA 4RJ4A 3Q9YA 4FV2A 4GCJA 4Q9ZA 3TNIA 3FKOA 4W4XA 1URWA 4FIHA 4EWHA 5L8LA 4ARKA 3PVGA 4NW6A 3BLQA 3RVGA 4ENYA 3ZBXA 5ETCA 3OCTA 4AA5A 3HRBA 4O96A 1QL6A 3R0TA 3Q32A 5EDPA 4DEEA 3VUTA 1B6CB 3UP7A 4NIFB 2OU7A 1MUOA 5KMJA 4JT3A 4Y46A 4ZK5A 3S3IA 5CEOA 4XOZA 4FTMA 2QLUA 4L6QA 1RDQE 2PY3A 3W0RA 1FQ1B 3VQUA 3QALE 4JX7A 3CTJA 4TYHB 4BF2A 4F1MA 5LVLA 3U51A 4EH5A 3LQ3A 2C47A 4FNXA 3FL4A 1BUHA 3A8WA 4X2KA 4XMOA 4DEDA 4Y95A 1TZDA 3RTPA 3WARA 5AIRA 2FO0A 4G3DA 5DR2A 3AKLA 3D7TA 4K33A 2I40A 2E9VA 2JLDA 3V5WA 3QQFA 4YNOA 4E5AX 5HE3A 1OL6A 1GIIA 2XK4A 3LM5A 4AZFA 4LMNA 4GIHA 4AW5A 4QMQA 3PVBA 5J7BA 2UZTA 2UZOA 2KULA 4ASDA 5H8EA 4CZYB 2B9IA 3QUDA 4M69A 5M44A 3ZRKA 3RPSA 2PVFA 2RFDA 3RI1A 2VZ6A 4QQJA 4D5KA 1H0WA 3DQWA 5GZ8A 4FL2A 2XAMA 2YCQA 1ZY5A 3DAKA 4ANNA 4YZDA 2ONLA 4PDYA 2C3LA 1YQJA 4X6RA 2AEGA 1SZMA 4FV1A 2XM8A 3IW5A 3FV8A 1OBDA 5GJGA 3SV0A 2NRYA 5LWMA 3OXIA 4S33A 3TXOA 1KE5A 3C4CA 3ZCLA 3ZO1A 1R1WA 1CKPA 3HEGA 4IBMA 4IAAA 4YTHA 4QRCA 4OTQA 3F3VA 4O0RA 4N57A 5A4LA 4BCNA 3I60A 4CKJA 1UU3A 3QCYA 3PFYA 1G8JA 1W0XC 3IO7A 5IQCA 4X0MA 3GOKA 4ZLYA 2LGCA 5K0KA 2HZ4A 1UV5A 3MTFA 5HX6A 1ERKA 3VN9A 3N4VA 2JDVA 2QONA 3A7HA 3HECA 4R1VA 3O7LD 1YXSA 4AXFA 4I41A 2JKOA 4AQKA 1BLXA 1P4FA 2VWVA 5HE1A 4AT3A 5CANA 4G5JA 2YABA 1VJYA 4TYGA 3R1SA 3ORZA 1NVSA 4A4OA 3FXXA 4Y73A 3VHEA 3PJCA 5BVOA 4GKIA 4ZTLA 3V51A 2X9FA 2FUMA 5F20A 3VUKA 3ZO4A 3QZHA 4BKJA 4M13A 2BRHA 2X7OA 3ZUUA 4E73A 4ERWA 4ACCA 1GZKA 4KAOA 3C5IA 3BGZA 1BX6A 4GYGA 4P2KA 4A7CA 4FNWA 4BVUA 3ORXA 2GS2A 2XH5A 5BYZA 4IC7A 3HV6A 4YJUA 2IZTA 3ZUTA 1DAYA 4BKYA 3MESA 3O50A 3FZ1A 4BBMA 4DCEA 1LR4A 4H36A 4MTAA 4FBXA 4YJOA 5AUVA 3JVSA 2OKRA 3P5KA 3WF5A 5IU2A 3W32A 3OROA 4A9YA 4M67A 3RCDA 1G3NA 4RWJA 3F5PA 3PUFC 1B39A 5EOBA 2EXCX 3DB8A 3KXHA 4PMTA 5EQEA 3PWDA 4FK3A 4I6FA 1SM2A 2BZKB 1ZYLA 3EFLA 3QHRA 4IB0A 3TTJA 4U80A 4C59A 4ZY5A 2W1IA 1M17A 5IQIA 1XH8A 4M69B 4FT5A 2WQOA 4GFGA 2BKZA 2XJ0A 3UYSA 4MX9A 2PYWA 2VAGA 4MNEA 4WNPA 4AZSA 4JAJA 4FSMA 1OKZA 5I0BA 2W0JA 3ODYX 4YJVA 4ANBA 3LFDA 2QNJA 2BCJA 2XAOA 4BDJA 2WMSA 4ZJVA 4O6EA 1PXKA 2C0IA 4E5WA 5LOHA 2ITVA 3BU5A 4DBXA 4D28A 4C2VA 4EWQA 5IQEA 3IOPA 4F63A 4G3FA 2GFSA 3JXWA 2B0QA 4JG6A 3W18A 1YHVA 4MHAA 4WO5A 5FEEA 4CG9A 3QCQA 4IVCA 4Z7HA 2C6TA 3QD4A 1QPEA 4U3ZA 2IN6A 2JEDA 4L42A 3R8PA 2GTMA 4GK3A 2GQRA 5IDPA 1GJOA 4PNKA 3DK3A 1I09A 4RT7A 2C5OA 5KZIA 3P9JA 4I4EA 3KRXA 3GEQA 4JRNA 4PPCA 2RFEA 4EK5A 2F4JA 2FSTX 2BRMA 3ZZEA 4PWNA 1V0OA 2A27A 4O91A 4H3PA 4KS7A 3KF7A 1PKGA 2XA4A 4OT5A 2ITOA 4AUAA 4DC2A 3CIKA 5AA9A 5KHXA 5FGKA 3BYVA 3FZOA 4C4JA 4U42A 5KX8A 4DLIA 3WZKA 1LP4A 1U46A 4C4FA 4DBNA 3G33A 3TNHA 3LLAA 3UE4A 3FEGA 3SRVA 4RWIA 5HU9A 4R77A 4AAAA 5I3RA 4DA5A 4LUEA 4JS8A 4EHGA 3HDMA 3WF9A 4QTCA 3MH2A 2O3PA 5AADA 5KCVA 2HK5A 4QP6A 3R7GA 3P23A 4XJ0A 5EYDA 5IUIA 5FM3A 3FBVA 3ORPA 4RVKA 4EZ7A 4XV3A 5EI6A 4AZVA 1W2CA 3SLSA 5HORA 4CGAA 4QPSA 2IVVA 4F9YA 1OITA 4D2RA 2PWLA 1STCE 2ITNA 1H1WA 4IAKA 5LQFA 1U5QA 4XG9A 4XG6A 4Y72A 3RK7A 2V22A 3LXNA 3VJNA 1PYEA 3A4PA 5EM6A 2PSQA 4KSQA 2ITXA 1FMKA 3L8VA 4M7IA 3VHKA 2BAJA 5K9IA 5EK7A 2XIZA 1FGKA 3KRWA 3PLSA 4LGDA 2YITA 5TKDA 3B8QA 3CP9A 3P7BA 3TWJA 3RKBA 1HCKA 2QQ7A 2C5VA 4WUNA 3CCNA 3OHTA 3POZA 4CYJA 1PMEA 4C4EA 2B4SB 2AYPA 4HZRA 5L6PA 2O0UA 2V5QA 3C4ZA 4E93A 5J5TA 3OF0A 3EQIA 3FKLA 4USDA 5CT7A 3NUXA 5M4CA 4GW8A 4RIYA 4HCTA 4LV7A 4QOXA 4B8LA 3KK8A 3HGKA 3LVPA 2I6LA 4FSUA 5ANJA 4APCA 1PXMA 3HMNA 3ODZX 4LRJA 4WD5A 5BVNA 3W0QA 3QTIA 4ID7A 4E4LA 5HI2A 1XO2B 3PY3A 1V0PA 4BFMA 3H4JA 5JKGA 2W1GA 3MY1A 2EU9A 4RG0A 1H25A 5EYKA 1MQBA 4KS8A 3W33A 2RKUA 2VD5A 2X2LA 2QO9A 1R0PA 4D1SA 2PUNA 3OXZA 3ROCA 2ZV2A 3E8CA 4YSMA 4YJNA 4QNYA 1W83A 3K3JA 4OTPA 1OIRA 1PMVA 3MPMA 5EM7A 4ANOA 2H34A 2XEZA 5C8NA 2G2FA 2QO7A 2YIXA 3KEXA 1H27A 3EQGA 4OTFA 5CSWA 5EOLA 4J97A 4HJOA 1ZAOA 4W8DA 1F5QA 3D0EA 3AT3A 4Z3VA 4EOMA 2WMWA 4ACMA 3QYWA 1BYGA 4W4VA 1YW2A 5D7VA 4EEVA 4XCUA 1YHWA 3BELA 3KB7A 3BYOA 1VZOA 2PE2A 4XNEA 4N6YA 4EK8A 5LVOA 3V04A 4D9TA 5BX0A 4EOKA 5IH5A 4Q9SA 5ACBC 4GH2A 3IGGA 2VTPA 5KMMA 3W0OA 2YCRA 4L3PA 5A9UA 3VNTA 2EVAA 2WMTA 5GZ9A 3LCOA 5E8TA 5HIEA 2HOGA 5DEWA 2JIIA 4O0WA 1FGIA 3O8PA 3VUDA 5CSXA 3ZSIA 1YDRE 3FI3A 3ORNA 3ANRA 3NFGB 1R3CA 2CN8A 4UWYA 2W9ZB 1XBCA 5AM6A 4MXYA 5CU6A 4GS6A 3WIKA 3L1SA 5CU3A 3GENA 4YO6A 4NJ3A 5E8SA 4JX3A 3EKNA 1OMWA 4MD9E 4XX9A 2QVSE 4JJRA 3NW7A 3HX4A 3PZEA 4FKTA 3U6HA 5IA3A 4XHKB 4FR4A 3RAWA 3E64A 2OIBA 4DHFA 3NWWA 3IPHA 1JSTA 3LOKA 5IUHA 2IW8A 2Z02A 2WU6A 1H00A 3CR0A 3MB7A 4FV6A 2ZM3A 3ALNA 4CT1A 2ZMDA 4FTNA 2J9MA 3C4FA 2RIOA 3E62A 5DBXA 5C27A 3O8UA 1ND4A 5M51A 5FTQA 2Y6MA 5K0XA 5HTIA 2VTNA 1SVHA 4X7QA 2PE0A 4GUEA 3NIEA 5AV4A 2G2HA 2X0QA 2OWBA 3KC3A 3LCTA 3MA6A 3QD0A 4O7VA 2UW3A 3NAXA 2Y7JA 2VTSA 4S32A 1KOAA 3CEKA 4OTWA 4CMOA 4HPTE 3EYGA 2VX1A 3F3WA 3ZU7A 3KU2A 5A6NA 2ZM1A 3R7UA 3W2SA 3TDVA 3TL8A 3PVWA 5J9LA 3OT8A 3RPVA 2CJMA 2R3GA 3H3CA 3I4BA 3WZEA 3GP0A 1FBNA 4X3FB 4AOTA 2W1FA 1UKIA 1J1BA 5AEPA 4MKCA 4UV0A 3RPRA 3MVHA 3BX5A 4L3JA 3JR1A 4KIKB 5L2SA 4G9RA 3UDTA 2ITZA 3VW6A 4AZWA 4KNBA 2NO3A 4LV5A 4RA5A 4WT6A 4BI0A 2WMQA 4QQTA 3EQHA 3MBLA 4QMWA 1YKRA 4XRJA 2UVYA 2JDRA 2QKRA 5IISA 2JDSA 3PPJA 1JKKA 3WYXA 3SG8A 4G6LA 2P33A 4MXOA 1YI3A 3AC3A 5L6OA 4TWNA 1PRYA 4AXCA 4S30A 4MUQA 2GS7A 1M2PA 2XNPA 4R3RA 4AACA 4O7WA 5CAOA 4IMYA 1OUKA 2GNLA 1OL1A 3TNPC 2GNJA 4KKEA 4ZTHA 3BU3A 4E4XA 3IW6A 3D94A 4AWIA 2J4ZA 3ETAA 4BYIA 4D9UA 5CEMA 1EH4A 3UG2A 4O81A 2I0YA 3FI2A 4DH3A 3SRVB 2P55A 3G90X 3LCDA 4QMOA 5IPJA 4ZS4A 1U5RA 1ZMVA 3EZRA 4HYSA 3THBA 4GK2A 5CVHA 3DTCA 4KIKA 4IVAA 4KA3A 5EHYA 4L00A 1ZZ2A 4L67A 5IA1A 4FKQA 2W9FB 3QWKA 5IMEA 3UBDA 4QTAA 2AC3A 4QQ5A 3F3TA 3R9DA 4JLCA 3F2AA 2GHMA 1IA9A 1WBTA 3HAVA 4BCPA 3EKKA 4FMQA 2PL0A 2QG5A 5C26A 3NZ0A 1W82A 2F57A 4FSZA 4FV0A 3UDBA 4JNWA 3UVPA 5EKNA 4R5SA 4EUUA 2VO6A 2VWUA 1KV2A 4IM3A 4RGJA 2X7GA 3F6XA 4EL9A 2ZDUA 2ERZE 2W1HA 4QPAA 2C6EA 5K5XA 2W5HA 4J53A 3EN6A 5DOSA 2XRUA 5HICA 4EH3A 4BDIA 2HZNA 3GC0A 5EYCA 2C6KA 2CNUA 3TMOA 4EOQA 2YAKA 2XBAA 4FIGA 5KNJA 3HA8A 4PPAA 5M57A 3BYUA 3OWLA 4IAIA 1DI9A 2VWYA 4O86A 5GIPE 4FKVA 3RINA 3AMYA 3LQ5A 3R9RA 1YVJA 4QP9A 3PUPA 5FTOA 1OVEA 1NXKA 5H2UA 3GOPA 2HY81 1Q8WA 2BR1A 5CLPA 3L9MA 4FVRA 1ZRZA 4FKGA 3FZRA 1PKDA 3R7YA 4ZJJA 1KE6A 4U45A 3ZFXA 5L8KA 3QBNA 2OIDA 2VTLA 5F1ZA 4ORKA 1Q3DA 3QTSA 1Z9XA 3EN7A 3QGWA 2ZV7A 2BRBA 3Q4UA 5BQ0A 5IMXA 2UV2A 3DTWA 1O9UA 4OTDA 4FT7A 1JBPE 3EQBA 4J98A 4Z9LA 3TZ8A 4U3YA 2F2CB 3OG7A 3D15A 3S1HA 4IE9A 4G5PA 5LWNA 3DB6A 2C1BA 3D5VA 1SNXA 3R7VA 4EQUA 4HVDA 3EQCA 3EL8A 2FSLX 2W99B 2I0HA 4FRFA 3KRLA 1GAGA 2YEXA 2SRCA 3E7OA 5HG8A 3AG9A 2YCFA 4J7BA 2KTYA 2BFYA 3ZH8A 4I0RA 4E26A 4JDIA 4NKSA 5CX9A 4UMTA 5JFVA 4PTEA 3PYYA 4JG8A 3Q53A 4JQ7A 3VONA 4TYEA 1Q41A 4ZMEA 2W05A 5AM7A 5AP0A 3NCZA 3R28A 2ZV8A 4FV7A 2F49A 3DT1A 3ZRLA 2CGWA 4FKJA 4RJ5A 4D4YA 4BICA 4PMSA 4L52A 4QMZA 5AP6A 4R5YA 1W98A 4EJNA 3DJ5A 3ORLA 3MY0A 4M84A 3W0NA 1F3MC 4QMXA 5I4NA 3TUCA 2RFNA 2BZJA 4RIXA 4D55A 4AOIA 5EM8A 2QCSA 4F09A 3VS2A 5IA2A 2Q83A 4PDSA 3DV3A 1LPUA 4EONA 1XHAA 4PQNA 2GQGA 2F7XE 3FMLA 4AU8A 2BIYA 4DT9A 5ACKA 1K3AA 5CWZA 5C4LA 3H9FA 2YDJA 1GZOA 3I7BA 4KBAA 4W9WA 5K4JA 4EH6A 4O0TA 3ANQA 5GNKA 2GFCA 4IWOA 5BV3A 3A62A 3OXTA 4II5A 4GVJA 3RAKA 3EWHA 3ORMA 2UUEA 2W1CA 1P2AA 4XOYA 2LAVA 5ITAA 5AV2A 1OECA 3CS9A 4IIRA 3TZMA 4CD0A 3R6XA 4NEUA 3UIXA 4MD7E 2J51A 2QURA 4I21A 4NM7A 4YJTA 5EW3A 3C0IA 4AFEA 3C0HA 5AP2A 5I9XA 5FUTA 2WIPA 4U5JA 4RLKA 4L7SA 4QD6A 3RJCA 3TUBA 3DPKA 4KINA 4O0YA 4YBKA 3QZGA 5E8VA 3TIYA 2YIQA 4DH1A 3ERKA 4AOJA 3ATTA 2C5YA 3OVVA 3QUEA 5LVMA 3HV3A 3L9PA 2CCIA 4CTBA 3PXQA 3EN5A 3R04A 4XV1A 3WZJA 2Y4IB 5HE2A 1YWRA 4FKSA 5HZNA 3UTOA 3QRIA 3PY0A 3Q5IA 5IQAA 5BVWA 4FTJA 4JDHA 3R71A 4DEGA 4KKGA 4QMLA 3OT3A 4O1PA 5EQPA 3QGYA 4UZHA 4F0FA 1REKA 2X4ZA 4MNEB 5AUXA 3O17A 2P2HA 4BTFA 3G9LX 4KWPA 3AMBA 3H9RA 3MVLA 4XYFA 4DGGA 5GJDA 3UPXA 4WA9A 2J5EA 3MFTA 4TYIA 3UO5A 3D5XA 4JDJA 4BI1A 2BPMA 4C34A 1QMZA 3T3VA 3MJ1A 3QZFA 3GBZA 5IQFA 2R7BA 1JQHA 3L9LA 2XYUA 3G6GA 1U54B 2GPHA 3NUUA 4DEIA 4LRKA 3HLLA 3KFAA 5AUZA 3OCGA 2XNGA 5CU0A 5CNOA 3LXLA 4BCKA 4D4VA 3IW8A 3DKCA 4YJSA 4EC8A 4YZCA 3VRYA 1OIYA 4IXPA 3NYXA 4E3CA 4MBIA 3K5VA 1NVQA 5HG7A 4B0GA 2OICA 1V1KA 4AT5A 1XQZA 4PP7A 5A14A 5BMSA 2GS6A 3FZTA 3QLFA 3KRJA 2OW3A 1IRKA 4BZOA 3T9TA 4DFBA 5E7RA 3R1YA 2UW9A 3E8EA 5J1VA 5CT0A 5DT4A 5HHWA 4A9TA 4RIYB 2PULA 4RWLA 2X8EA 2XNBA 4F08A 4FEQA 3JUHA 3NNWA 3OY1A 2JKQA 4XH6A 1DS5A 2G01A 4ZZNA 3LFAA 3COKA 4EZ5A 4OR5A 3ZLYA 1QPCA 3VUGA 1ZYDA 2VTRA 3QLGA 2FYSA 4HGLA 4F99A 4U7ZA 3R30A 4XG8A 5M56A 2JDTA 4KSPA 4YURA 2UZLA 2XNNA 3R7OA 3QQKA 1NVRA 4YLKA 4EH7A 4BDCA 2BALA 4F4PA 3EQDA 2WTKC 3O7LB 4CZUA 3RAIA 3NNUA 4IM0A 3ZXTA 4F7NA 3E3BX 5E8UA 3FLYA 3S4QA 2XUUA 4QP4A 3ULZA 4BTJA 5B0XA 4FTQA 3Q9WA 3KULB 5E8XA 3E92A 5FRIA 3PG1A 5HCZA 5CTPA 4BIBA 2XKDA 3SAYA 4MD8E 4G9CA 4O2ZA 1A06A 4U8ZA 4D2TA 4CV9A 2BMCA 1U4DA 4FIJA 2XS0A 4FIFA 5AR2A 3PXYA 2XIRA 4CT2A 4E20A 5FTGA 4DHIB 4D4SA 3FMKA 2BHHA 3EZVA 4PF4A 2H8HA 2WTJA 3CBLA 1XKKA 4C02A 1MQ4A 5AUTA 3JY9A 3ZM4A 3C4XA 3OUKA 5CASA 5DRDA 4FEXA 4DFYA 3IECA 4LYNA 3OEZA 4EYMA 4BDAA 4UMPA 3RWPA 2XJ1A 3R8LA 4M15A 3KCFA 3TNWA 1XH5A 2W1DA 3ELJA 3POOA 4ZTRA 4C0TA 5BYYA 3NIZA 1CSNA 5TOZA 2WMAA 2OFUA 3QL8A 4JL9A 4OTRA 3UIMA 5AAFA 4JDKA 2EB2A 1OUYA 4IVDA 4BCQA 4F64A 4XLIA 2PVYA 2VGOA 4GJ2A 5I9YA 4GYIA 4ZTMA 1OKVA 5E4HA 3DAEA 4K8AA 2UVZA 4G16A 4J96A 4K6ZA 5FLFA 3UMWA 2WELA 4FT0A 3UPZA 5EW9A 3BBWA 3LHJA 2XEYA 3UOJA 4MH7A 3TJCA 4RJ3A 4JRVA 3NUAA 4WG4A 2Y4IC 5KMOA 4MBLA 1H1SA 1W7HA 3P86A 5EQYA 1REJA 3WYYA 4IFCA 3D14A 3D7ZA 3VBQA 3NFFB 3U54A 4AZTA 4BCFA 3R83A 3EL7A 5CEPA 4WRGA 5HIDA 3KY2A 3W8QA 3IG7A 2WTDA 5DE2A 3OEFX 2PVMA 3V8WA 3ATSA 2VWIA 1BKXA 2J0LA 2XKEA 3CJFA 3FLWA 4FNZA 4PL4A 3GU6A 4R3CA 4RX7A 4M66A 4FZ6A 5E1SA 4O7NA 3PRFA 4KABA 3PA4A 4R7BA 5JQ8A 2C68A 1Q8YA 4LGHA 2ETKA 2F9GA 3IDPA 5ANGA 2VTIA 2XM9A 4F65A 3KXZA 3R9HA 4FJVA 2ONLC 4ANQA 5E91A 3PRIA 3PIZA 5CQWA 3QKMA 4I0TA 3F61A 1P14A 3OP5A 5HVYA 2YM7A 2QOOA 5AP3A 4AZEA 4JOAA 3FY2A 2FB8A 2R3QA 2CGXA 3DKGA 4CXAA 4B9DA 3LJ0A 4RX8A 4FV3A 2PVJA 5JH6A 3N4TA 4X2NA 3HDNA 4M0ZA 2ZYBA 4YPDA 3GQIA 2GHLA 4MXCA 4IVBA 5CEQA 2H9VA 3ZXZA 3TM0A 5GHVA 5BMMA 5HTCA 5F4NA 4CV8A 5AUWA 1TQPA 3LPBA 3F7ZA 2ITUA 3EFKA 2EUFB 2O65A 4F7LA 2PZIA 4K0YA 4NKAA 3CGFA 4JBVA 5E8WA 4B7TA 4NIFA 1OI9A 2CLXA 3R22A 4GT5A 4AW0A 5JRQA 2JD5A 3BGQA 2R9SA 2BTRA 4NZWB 4IJPA 4V05A 5DPVA 5HOAA 3KMUA 3Q4CA 3ZDUA 1H1QA 3CTQA 4PDOA 4IANA 4P90A 1M2QA 3BPRA 3QXOA 2Z8CA 2XB7A 2X7FA 2IW6A 3DXQA 4HGTA 4IH8A 4AGUA 1U59A 2Q0NA 5KZ0A 4NTTA 3EQFA 3N4UA 4ANLA 4Y85A 3JYAA 3LAUA 2B52A 3FY0A 3H10A 3FXWA 1BI7A 2RF9A 4CTCA 2OF4A 4EH2A 4IWQA 3BEAA 3HZTA 4UALA 3IONA 4X3JA 4CQGA 5KO1A 4YJRA 3OMVA 3GFEA 4J95A 4MF1A 4BN1A