5KMJA

Trka jm-kinase with {n}-(2-pyridylmethyl)-2-[2-(2-thienyl)indol-1-yl]acetamide
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
310
structure length
300
Chain Sequence
LQGHIIENPQACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords High affinity nerve growth factor receptor
publication title Structural characterization of nonactive site, TrkA-selective kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 94
structure length 300
sequence length 310
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5kmjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5kmjA01
3DT1A 2JFLA 2R7BA 4H3QA 3BLHA 3LE6A 5HI2A 3ATTA 3FKLA 3AD4A 4UALA 3KREA 3A7HA 4PF4A 4ALWA 3HMMA 4YZCA 5DNRA 5D7AA 3RPVA 4BCNA 4IBMA 4RA5A 4V04A 3CXWA 3R21A 4CTCA 2WAJA 2YN8A 1URCA 5DMZA 4O0XA 2RFSA 4KWPA 2R3NA 3KMUA 4F9AA 4L8MA 3E5AA 3G0EA 4IVAA 5FM2A 5IA1A 1WMKA 2ZV8A 1BL7A 2I0EA 5KNJA 2WTDA 5CX9A 5BVFA 4D0WA 3TV7A 4USDA 4L45A 3I81A 1P14A 3FMMA 3R22A 3ZCLA 4NYEA 4MQ1A 2BRBA 4IW0A 5EW3A 3MWUA 5CI7A 2KTYA 3ATSA 3QWJA 1ZZLA 4BF2A 3UNZA 3R7GA 4B6LA 4CFMA 5JGDA 1G8AA 2W5HA 4O0RA 5FGKA 2UVXA 3T9TA 3TI1A 1YHWA 2W4OA 4MCVA 4CFUA 4J52A 5AMNA 2GNFA 4FSZA 3II5A 4NTSA 1OITA 4QMWA 4YUQA 3MY5A 4DGMA 3QD3A 4FEUA 3NAYA 3VF8A 3SD0A 1UKIA 1KV1A 2WXVA 3MN3A 3PJ8A 4HYSA 1R3CA 3MPMA 2P55A 4QQCA 2YCFA 3D0EA 3LJ0A 1HOWA 1V1KA 4JAJA 3TUCA 2A27A 2VGPA 5HBJA 3EN7A 4FSQA 4CTBA 2BUJA 4BRXA 4RGJA 2NPQA 4N57A 3DBCA 4BTFA 3LQ5A 3SRVB 5CZIA 1FQ1B 3U9CA 2GCDA 4F7JA 1PHKA 4ZLZA 4GKHA 3QWKA 1Q8TA 3D7TA 4LMNA 3QALE 2C68A 3R0TA 4C7TA 5JFWA 4IWQA 4Y46A 4YBKA 3R9RA 4XG6A 4JBOA 4M14A 5J5SA 2G1TA 4EOMA 1YQJA 4YHTA 5AR5A 4WSYA 2OLCA 5EH0A 5A6OA 3OT3A 5JQ8A 2C69A 5CU3A 4BDHA 4CG9A 4XG4A 4S2ZA 2PVLA 4ANNA 4FT3A 4GYGA 2ZYBA 3ZUTA 4NM3A 4JX3A 5AWMA 5BYLA 2YM3A 4C38A 4J1RA 1J7LA 5IH4A 4ZJJA 2OI4X 2EXMA 2B9HA 2EB3A 3D4QA 4HZSA 3CQWA 5CEOA 1FINA 2CSNA 4M7IA 2XYNA 5IEYA 3NYNA 4DEDA 1VR2A 3U55A 2E9OA 4RJ7A 3W2RA 5CSXA 1RW8A 3JY0A 4I93A 3AC8A 4L67A 5G6VA 5IDNA 2YACA 3RM6A 2C6MA 3F3WA 3QQKA 4XBUA 2RFDA 5ANKA 4QPSA 3DB8A 5ACBC 3ZEPA 4LL0A 5A54A 3FV8A 5F4NA 4F65A 3GC7A 3B2WA 3MBLA 4BCFA 3PY0A 4IH8A 1WBSA 4ANLA 4E6DA 2XS0A 3IDCA 4XYFA 4YTFA 4FKIA 5IH5A 3BGZA 5M4FA 5E8WA 3KMWA 4PP9A 1XBBA 3LFFA 2WMUA 5C01A 5GJGA 4R3CA 3W8LA 4Z7GA 1GZ8A 3U4WA 1IAJA 1YHSA 2R3MA 3SW4A 1BI8A 2W1FA 1JOWB 4C2WA 5H2UA 4M67A 4WUNA 4O7LA 2X2MA 3MVLA 5IU2A 3VVHA 4M97A 3VF9A 2R2PA 3SDJA 3AGMA 3TZ8A 2YIWA 3DK3A 1MQBA 3EQGA 3R02A 4FNXA 3EJ1A 1NVSA 5K0KA 4ZZOA 2X81A 3KXMA 3QTSA 1OL5A 4IVBA 1Q99A 3MYGA 3WF5A 2PPQA 3F2NA 3LQ3A 3SVVA 4OTRA 4J95A 5IQHA 2BHHA 2J5EA 3HKOA 4HVIA 4E20A 3F88A 1RE8A 4E5AX 2GNHA 3ZXTA 4CGAA 3A4OX 2V5QA 3HL7A 3UOHA 4NU1A 2UW5A 3KXHA 4ASZA 3H30A 4ACMA 4ZLOA 1NVRA 3UIMA 3VHEA 2OJGA 2YIYA 4TT7A 4FSWA 4YLJA 1FGKA 3QF9A 3NIZA 1J3HA 5DT4A 4AACA 2XF0A 2UUEA 4CLIA 4EK4A 3I4BA 4FTJA 3KRWA 4QTDA 3IW7A 2RF9A 5FG8A 4BVUA 4UX9A 3UJGA 4IQ6A 5IF1A 3AC1A 3RNYA 2XNEA 3FLZA 4OTDA 3NLBA 5AUUA 5F95A 2IW9A 3CKXA 1Q8YA 3EQHA 4BCOA 1MRVA 3R01A 2R5TA 3VUHA 2XEZA 2XRUA 1OL6A 4QTBA 3UPXA 4V0GA 3M1SA 3S95A 3K3IA 4O38A 5HTBA 4V05A 1JKTA 3C0IA 3ZFMA 4HPUE 4M15A 2UZBA 3EN5A 3PPJA 3SRVA 1YI6A 3UIBA 3ENMA 4AE6A 4Q9ZA 3OEFX 4TRLA 4YSMA 1UU9A 4BHNA 4M3QA 1GIJA 3IG7A 2ONLA 1FBNA 3T8OA 3C4ZA 3HP2A 3V01A 5FXRA 2JGZA 3UYSA 4NJDA 4BN1A 3EOCA 4RT7A 2ITTA 1YXUA 5EM5A 4RX9A 4RJ6A 5AM7A 4O86A 4GYIA 2F7XE 2FVDA 2PULA 1WBVA 2WMBA 5ANEA 4DHFA 4O7YA 1JLUE 4OTIA 1GY3A 3PUPA 4FKPA 4QP7A 1TQIA 5KMIA 4IEBA 4QMVA 3JR1A 4J98A 3QYZA 2GHLA 4ZSGA 2ACXA 2CGUA 4JQ8A 4B0GA 4RC3A 3GCQA 5K9IA 1G8SA 4QRCA 5KMNA 1PXNA 2YM5A 4OGRA 4X0MA 2QHMA 4BBFA 5I0BA 1YW2A 5E8UA 5BVKA 5C03A 4U43A 5AAFA 4AOJA 4EYJA 4EZ3A 2JIUA 5JH6A 3OD6X 4U7ZA 2WB8A 2UZTA 4AW0A 4FKRA 5HTIA 4GFOA 5AP0A 3W1FA 2PZPA 5EW8A 4H05A 5K5XA 3CPCA 4IWOA 1A48A 4AP7A 4IAZA 2E9NA 4PWNA 4TY1A 3UVRA 3EQIA 3ZMMA 5G1XA 4C3FA 1PMUA 5E4HA 4W8DA 1PKGA 4FTQA 5FBNC 3G2FA 4RIOA 3E88A 3Q04A 3RAHA 3PLAE 4UEUA 2EXCX 3BI6A 4IX3A 4FTKA 2OXDA 3C50A 4GK4A 1XH5A 5JFXA 4RIYA 1BI7A 5EQPA 1H1SA 3R28A 2E9PA 4NCTC 4O0VA 2YCQA 2FUMA 3BKBA 4FGBA 3TDWA 2HWOA 2G01A 3Q5ZA 2JDOA 5JZNA 4JBQA 2CMWA 3GVUA 5FBOA 3ORIA 1TKIA 4Z16A 3I6WA 3ZO1A 3HECA 5FXQA 4CKJA 1KE8A 2HENA 5DWRA 3KULA 4BTKA 3V8SA 3T3UA 4DC2A 5CAPA 3DDQA 4AQCA 3BQCA 1ZXEA 3NW6A 1QPJA 3RINA 4EH9A 5LMBA 2PUIA 4DCEA 1GZKA 1W0XC 3N51A 2HOGA 4R77A 4UN0C 3BCEA 1LUFA 3KF7A 1IEPA 2I40A 4B7TA 5ETAA 1GNGA 2XEYA 3ORTA 4PL3A 4OAVB 5BVWA 2G2FA 3SLSA 3M11A 3MIYA 3G6GA 3LXLA 3NSZA 3P4KA 4TNDA 2PVFA 4ZLYA 2YZAA 3ZLSA 3PSBA 5E91A 3W10A 3DXQA 4OT5A 4JDKA 4O7WA 5CF6A 3SOAA 3F3VA 4JR3A 4P90A 3FLWA 3KMMA 5LMKC 4WRGA 2QOQA 2RFEA 3DJ5A 3NDMA 1WBNA 3F2AA 1U5RA 3MJ1A 5GHVA 2XBAA 3CP9A 4R7IA 4GK3A 3R9OA 2NRUA 4RPVA 3FMKA 3QQJA 4YNOA 4BC6A 1PMVA 3AT4A 5HTCA 2BRMA 2GNJA 4N6ZA 3NUPA 4R8QA 1E1XA 4S34A 4TWPA 2PL0A 2X7GA 3KFAA 2VO0A 4NTTA 2R0UA 1BLXA 3BLQA 3MH2A 3QTQA 4JRVA 4UXQA 4K11A 3RBWA 3CE3A 4CYIA 4FZ7A 3Q3BA 4QMXA 3FXWA 3NUNA 3TZ7A 3QQFA 5J95A 5L2QA 5FD2A 3BLRA 1IG1A 3DKCA 3P0MA 4JG7A 2WOTA 5DR9A 5AFVA 5EHLA 3O7LB 3EWHA 4C3RA 2JAMA 1YWNA 3GNIB 4JQ7A 4L3JA 4E26A 2HCKA 1MUOA 2PVJA 2JIIA 3R30A 2C6DA 2V62A 3HZTA 2R3RA 3AC5A 2XKCA 5HICA 3ZC6A 4FA2A 2WQMA 5EQEA 2VWWA 2XIKA 4P4CA 4HVHA 3NS9A 3FKOA 2PVMA 5BPYA 3QAME 5LARA 1F3MC 4FKGA 1BYGA 3NUXA 4GEOA 4YZDA 4JNWA 2QKWB 2FSMX 3EN9A 3UC4A 3FZ1A 3UNKA 2YABA 4GFGA 3V51A 3AQVA 4BHZA 3BGPA 3QTXA 5HU3A 2B54A 4X3FC 2XH5A 2OF4A 2OFVA 5KZIA 4FEXA 3NNVA 3F2RA 2G9XA 3T3VA 5L4QA 1JQHA 1JPAA 3GQLA 3PJCA 2JC6A 2QOHA 1IA8A 5DEWA 5EDQA 3RJCA 2QO7A 4XJ0A 3QU0A 4AZSA 3ANRA 3QQLA 3NEWA 3LIJA 4KBCA 4KIOA 4BZNA 5HORA 4FGRA 2YLFA 1JBPE 2X4ZA 4PX6A 3OBJA 3TACA 2XRWA 2R3OA 4J99A 3RP9A 4EOJA 3GI3A 2R3GA 2R3LA 2QO9A 3HP5A 4UZHA 5J9ZA 4IM3A 3N4TA 1OIQA 2HXLA 5A4EA 4MNEB 2Q0BA 2FGIA 3R6XA 5GNKA 4I3ZA 4XRLA 2OW3A 4XRJA 2X1NA 2XP2A 5BQ0A 2J9MA 4LGHA 5GZAA 1XH9A 5E8YA 3Q9WA 4F6WA 3NW5A 1F5QA 2BR1A 3QHRA 2ZB0A 4DGNA 5I4NA 5ANJA 4O81A 4FKJA 4NFNA 3ZZEA 3BWFA 3QCXA 5A4CA 3S0OA 5HO6A 1XH6A 5DRBA 1RQQA 4ZTHA 2QU5A 4YPSA 2GSFA 1OUYA 5BUIA 5CEMA 3CSVA 4S33A 3NAXA 3I79A 1Z5MA 5JT2A 1Y91A 1PY5A 2PZIA 4AW5A 4BKYA 3MI9A 5CY3A 4FKWA 4WRSA 5DI1A 2EVAA 3Q6WA 5EQYA 1OZ1A 4YTIA 5ETCA 4OW8A 2PMNX 4CXAA 1A9UA 2R9SA 4J7BA 3RK9A 4M0YA 1H07A 2IZTA 1Q3WA 3O7LD 3AMYA 1DS5A 3VNTA 3LMHA 3OY1A 5DHJA 4WBBB 4RIWB 1GJOA 1YKRA 1YOJA 3MV5A 5DVRA 5L2SA 3AMAA 4DLIA 2EB2A 5KX8A 5M57A 1APME 4BGHA 3ULIA 4JVGA 2PMIA 2NRYA 2VTJA 1G3NA 3C4EA 3EZVA 3PVUA 3R7YA 4FTRA 3R1SA 3W2OA 1UWJA 2OH0E 5FRIA 1OL1A 1ZAOA 3ALOA 4C8BA 4XOZA 4EONA 3CC6A 4L6QA 4BKZA 5I5ZA 3BBWA 1G5SA 3BYVA 4PTCA 5LWNA 2FSLX 3O17A 2BPMA 3FSFA 4HYHA 4DINA 4E5WA 2GFCA 1ZOHA 2OBJA 3S1HA 3TG1A 4BL1A 4GUEA 4D28A 3A7JA 3M42A 2W1IA 4Y5HA 4EQCA 3RCJA 4E4XA 3D5XA 3MS9A 3H10A 3TNQB 4LUDA 2RSVA 2WO6A 3LHJA 3PA3A 5TT7A 3EL7A 3NYXA 4NZWB 3S2PA 4ANSA 3EQDA 3QLGA 2PUNA 2BROA 2O64A 5I3OA 4CFVA 4CVAA 5L2IA 4QQJA 3UTOA 2R3HA 1CM8A 3BZ3A 4EHGA 5LWMA 4FZFB 2CLQA 3QTZA 1UU7A 3WE4A 2WMRA 3LMGA 4DTAA 2VTTA 4J96A 2A0CX 4EH4A 4A9UA 4W4XA 4XLIA 2P2IA 5AP7A 4B8LA 3NW7A 2BMCA 1WBTA 4Z3VA 3F7WA 1Q62A 1YWVA 2ITUA 3PJ1A 4CSVA 4BGQA 5IQDA 4FF8A 3QUPA 5M55A 4FV8A 2DUVA 3TIZA 4JG8A 4S30A 3VS1A 3A7FA 5JFSA 3UQCA 3GCSA 1H25A 4D9UA 1RDQE 2ITPA 3P7BA 4G6NA 3V5JA 3RMFA 4AA5A 3GFEA 4YZNA 2Y4IC 3L9PA 3OOGA 4E93A 3RPRA 3GC0A 2CGVA 2KULA 2C0IA 2W9FB 2IW6A 1K3AA 3WZUA 3EFLA 4U97A 5KMKA 5IA5A 3V5PA 4M68A 2WMQA 4BCGA 3SG8A 4KINA 4BKJA 4BBMA 4DEHA 4QNYA 2WKMA 1MQ4A 4HGLA 3WARA 4APCA 3R9DA 2J7TA 3ZUVA 4CRLA 4F0GA 3BHHA 1PXPA 3IW4A 3LFQA 5DA3A 4ANBA 4BIDA 4BZOA 2HW7A 1FOTA 3FL4A 5AUXA 5AEPA 5HLNA 4IDTA 3QGWA 1OKWA 2F7ZE 2PE0A 3BYMA 3QUDA 2B1PA 4GJ2A 4FTCA 4PV0A 4AA4A 5B2MA 4DH5A 4Z7HA 3UQFA 4YHJA 4MXOA 5CAUA 4GKIA 4F1MA 4UWCA 3ZRMA 5ICPA 2YCSA 2W4JA 5T68A 3SQQA 4GS6A 1BUHA 2Y0AA 3F5GA 4QYHA 2C5OA 2I0VA 2C0OA 3GB2A 3TJCA 2YAKA 4CFNA 4ZSJA 3FMEA 2Z2WA 3WYXA 2JITA 3ORPA 4PQNA 5AUWA 3LPBA 4I5CA 4L52A 3VBWA 2UW8A 4R78A 2WMSA 3OCSA 4GMYA 1YOLA 4PMSA 3PP0A 4ZTLA 4ZJVA 3O51A 5LVNA 1OIYA 3PJ3A 5CVHA 1YXVA 5BMMA 3UOJA 2GNGA 2QOCA 4RIWA 1JKKA 4FV9A 4U45A 5HG7A 1Q41A 2F4JA 1Q5KA 2UW6A 4UV0A 2C6EA 3DAJA 3OW4A 3GU8A 4NWMA 4IAIA 4LMUA 5C1QB 5JMSA 3GGFA 5HCZA 4MHAA 1YXSA 3ZXZA 4AT4A 4GIHA 4D1XA 3MH3A 5FTOA 4ANQA 1W83A 3HV5A 2QO2A 2WPAA 2X8EA 3LM0A 4IZAA 4RSSA 2VTMA 4AGCA 4F08A 5KBQA 2WELA 4ANMA 4EKKA 5AR2A 4F9YA 4PUZA 4ZXTA 2IVUA 2PMLX 4J71A 3VS0A 4O7RA 3EZRA 1SM2A 4MNFA 2CKEA 4QTCA 2A4LA 3VW8A 4E73A 4FSUA 2XNNA 4FBXA 4MWHA 4FSYA 5AR7A 3H9OA 3V5WA 5IPJA 4G3FA 1ZY5A 4K9YA 4LOOA 5BVEA 4KBAA 2WMVA 3EFKA 4DFNA 2AC5A 1P4OA 4L01A 5FP6A 2I7QA 2R3KA 4YU2A 4DFUA 5CEKA 4IDVA 4WG5A 4NCTA 3RHXA 5GIOE 3HYHA 5I9YA 2XIZA 4CNHA 4K2RA 4DH7A 2ZM4A 5KMMA 1YWRA 4KRCA 2VRXA 3LLTA 4AN2A 2BZHB 4RX8A 3RZFA 3VN9A 2BRNA 4FIEA 4FVPA 3ELJA 4G6LA 3EKNA 3FZTA 4JDIA 4NT4A 2ZAZA 5AUZA 4B8MA 5AV4A 1WVYA 4H3PA 3JY9A 3JYAA 5L6WL 1FVRA 4XCUA 3GEQA 4U79A 1KE7A 2XJ2A 4BIBA 3G9NA 3GUBA 4ZTRA 3L8VA 5HD4A 5HHWA 2C5YA 3IW5A 3RCDA 5BX0A 3WZKA 4ZSAA 3DU8A 1O6YA 3NUAA 4EZ7A 4MBJA 5EFQA 3UODA 5F20A 4FUXA 4HCUA 3LAUA 1DAWA 4QPMA 3QX2A 4EWQA 4JI9A 4A7CA 1FPUA 3ZU7A 1ZARA 4M0ZA 2YM4A 2QLUA 5LMKA 4KD1A 4C35A 1B6CB 1R0EA 4A4LA 1UVRA 2UZVA 4KS8A 3U6IA 1P2AA 3ZM9A 4FEWA 4NFMA 3I0OA 1ZWSA 5KMLA 4C4IA 3GU6A 4PTEA 4MBIA 3VS3A 1JSUA 2XK6A 3F3ZA 4O22A 4ACHA 2WMAA 1FMKA 2C5VA 2OK1A 3WE8A 4O83A 3BX5A 3WIKA 2J51A 3DCVA 3MSSA 5DEYA 4R6VA 5AV1A 3FYKX 4EOOA 4RX5A 3VWAA 5EYKA 3LKMA 3FMJA 2Z7QA 3PP1A 4BTJA 2PK9A 4C02A 4ZY5A 4CMUA 3CBLA 1U4DA 3POOA 2VTHA 5J87A 4I5HA 3EHAA 4JG6A 2CPKE 2C1AA 1W84A 3ZSGA 3V5TA 3OCTA 1OMWA 3WF7A 3ZH8A 4PPCA 4DE4A 3E62A 2OIDA 3BV2A 4IAKA 5DYJA 4MXXA 1ZOGA 3EL8A 4ZZNA 5E1SA 3PWDA 4ACGA 1X8BA 3HRCA 2UZWE 2E2BA 4UMRA 3UO5A 5CNOA 3OUKA 4DFLA 1I44A 4FT5A 3RPOA 2B53A 3QQUA 2W7XA 4UZDA 4O96A 1GAGA 3GCUA 4FTUA 3KB7A 1LR4A 3GFWA 1J1BA 4KABA 1GOLA 4JAIA 4QYGA 4RJ3A 2W1HA 3ZYAA 5CQWA 4M8TA 4AOIA 5KUPA 2WTKB 4FNWA 2HWPA 5M56A 2BZIB 3HAMA 3B8QA 3R7UA 3AT3A 2W99B 3EQBA 4JT3A 5CT0A 3SHEA 4ASDA 1SYKA 4B99A 1IAHA 2W0JA 4V0GB 1Y8GA 2BFXA 5A9UA 5FUTA 3WI6A 3G51A 4HCTA 4LI5A 4X3FA 3IW8A 3Q9YA 4FICA 5CENA 2VWBA 1OPLA 3R7OA 3WBLA 3DY7A 4PY1A 4C4HA 5LVLA 3Q32A 3S3IA 4IMYA 2E9UA 2XMYA 2WMWA 5D11A 5C26A 4F7NA 4AG8A 4RLKA 2X2KA 2WU6A 3QKMA 2XCHA 2PZ5A 5B2KA 3FDNA 3QTIA 2WTJA 2BZKB 4DLJA 4EOLA 2FSOX 4MKCA 3KQ7A 3RWPA 2QQ7A 2CKQA 4WT6A 3W55A 3H3CA 3U9NA 5M07A 2WQBA 1OM1A 4IB5A 4P7EA 5H8GA 2X8IA 4MD9E 4QYFA 1OIRA 3ZLXA 4F99A 4KKHA 2ZV9A 4EOQA 1H27A 1PXLA 3GBZA 3FLNC 4U80A 4FG8A 3MH1A 3TDVA 3R2BA 4NSTA 5C8KA 4Y95A 4X7QA 1YDSE 3R7EA 2J50A 3CLYA 4HGTA 5AV3A 3TTIA 3L1SA 4C62A 3TZ9A 2YM6A 3UP7A 3KVWA 3RPYA 4P5QA 2OFUA 3TNIA 5HE0A 3VW6A 4CT2A 1K9AA 1M14A 3AXWA 4D2PA 2C3KA 3Q2MA 4D1SA 1V0OA 1PXOA 3VS7A 1S9IA 2QOIA 4LG4A 3BV3A 2HAKA 5HE3A 3GCPA 3NUSA 2QOFA 2OWBA 4TYEA 5FDPA 5JGBA 2OF2A 2X6EA 4CCUA 2HY81 4QMLA 4N70A 4F1TA 2PVHA 3P9JA 3R1NA 4YP8A 3SGCA 1NVQA 1JVPP 2BDWA 4RIYB 4MXZA 4KNBA 3DZOA 5CVGA 4BCQA 5CWZA 3WF8A 3GOKA 5LJJA 3WF6A 3C4FA 4YJTA 4HVSA 2BKKA 3FI3A 4C59A 3KULB 5LOHA 2OG8A 2V7AA 3MPAA 4FSTA 4L00A 4C36A 4R3RA 5KO1A 5KBRA 4QMQA 4DN5A 1ATPE 3CQEA 4GSBA 3W2QA 5CANA 5M4IA 5AJQA 4NM5A 2BZJA 4CMOA 4DBNA 4JRNA 5HZNA 3U6JA 3MIAA 4KA3A 2XUUA 4QP8A 4A06A 1GIHA 2OIBA 2W17A 2OJ9A 3D5VA 3DKGA 1WBOA 2W06A 1UKHA 3F5PA 3F61A 4RIXB 3ZFYA 3ODZX 3V3VA 2P2HA 3A60A 5LVPA 5M4CA 2A1AB 2VD5A 4MD7E 1YXTA 4IB1A 3NYOA 4IX4A 3UZPA 4KBKA 1OGUA 4U41A 3R8UA 3OUNB 4I6HA 4G9CA 3R9NA 4KSQA 3LFAA 4EH6A 3E3BX 4C33A 4XH6A 4QMOA 4X2NA 5DT0A 5JK3A 4K6ZA 3FWQA 5CEPA 2PWLA 2BHEA 2VO6A 3OWLA 4FKQA 2XM9A 3R8LA 5CF4A 4O82A 4KKGA 4RWKA 3OCGA 2R3IA 3TT0A 4WIHA 4O0WA 3LCSA 4RC4A 5HQ0A 2R0IA 5AP1A 4RVTA 4EORA 4QMNA 2V0DA 4IAFA 1UNGA 4HNIA 4AUAA 4DYMA 4R5YA 2ZVAA 3OXZA 2YJRA 5DE2A 3RK7A 4FEVA 4EUTA 2XKFA 3L9MA 3NWWA 4IANA 3A4PA 4QP3A 1H1QA 4ITIA 5FQDC 2OJIA 3WF9A 5CASA 3HNGA 4RC2A 3VJOA 1R1WA 3DZQA 4WG3A 2O2UA 2X6DA 3KRJA 4PDSA 4PMMA 3GT8A 4BDDA 1Q8WA 2ETMA 4K18A 2RKUA 4FTAA 3P78A 1AD5A 2J2IB 1HCLA 2CGWA 3R04A 2XIYA 4D9TA 5CI6A 2VTQA 4ALUA 5DLSA 2F49A 4FV1A 4W4YA 3R9HA 4FR4A 4BDBA 4X2GA 5CAVA 4KB8A 5J5TA 3UZRA 3MVHA 1U54A 5AA9A 3MVMA 1QMZA 2ZV7A 3P7CA 3OY3A 3UDBA 4ITJA 4O7NA 3C5IA 2GQSA 4U40A 1NY3A 4OBPA 5C8NA 4UY9A 2QHNA 3CS9A 3DAEA 5L2TA 4JL9A 4QMZA 2RIOA 3LZBA 4GCJA 1FGIA 2C6TA 3FL5A 5HNGA 3PXYA 1H00A 2P0CA 3GQIA 3QBNA 4V01A 3SKCA 3U4UA 4DFYA 2YWPA 3MGYA 4N0SA 2Z60A 2R3FA 2YIXA 3BWJA 4LQMA 4MWIA 4D0XA 4DEBA 4EL9A 3ORKA 4NKAA 1Q24A 1VJYA 4AW1A 2NO3A 3I60A 3SC1A 4JXFA 3NIEA 1JNKA 3ZDIA 4S31A 2G2IA 3LJ1A 5AR8A 4DFZE 5J8IA 4DH8A 4DEIA 5E7RA 4YSJA 2VNWA 5GJDA 3D94A 1YI4A 2W1ZA 2J0KA 3NUUA 3R7VA 3QL8A 5E8TA 3ITZA 3HDNA 3HX4A 5HOAA 5BUJA 2X0GA 3PY1A 2O0UA 4L9IA 4U44A 3CJFA 4H3BA 4ZIMA 4DEGA 4DG0E 4IM0A 4MTAA 3GC9A 4G34A 4OBQA 4D4VA 3PXRA 5FDXA 1NXKA 1REJA 2B55A 2YDJA 4DGLC 4U6RA 3JS2A 5AV0A 3P86A 4AX8A 5K4IA 5HLWA 1OBGA 2IO6A 2IPXA 2X7OA 4JR7A 4EK8A 4APPA 3FC1X 4GVJA 4YC3A 4A4XA 4AZEA 4FL1A 3RM7A 2WGJA 4YJRA 4BTMA 4R1VA 2EU9A 3SX9A 5FEEA 4G5JA 4EHEA 1ZZ2A 2IVVA 2XK8A 4QO9A 2CCIA 3PYYA 1M2QA 5HO7A 4G3DA 4I94A 4OR5A 3RWQA 5CSHA 4TN6A 4O0YA 1H26A 1LP4A 1OPJA 2G15A 4BCIA 2WNTA 5HVKA 2O8YA 4PPAA 5AIKA 4AWIA 4RIXA 4EK6A 4WD5A 4CZYB 4YJPA 3U51A 3Q4UA 2B0QA 4E4MA 4YGAA 1BL6A 5EDPA 4HPTE 3VRYA 3TKIA 3A7GA 1J7UA 3CJGA 1M7QA 5EI2A 4FIHA 3LCDA 3FAAA 3KK9A 3ACKA 3H4JA 5B7VA 2IJMA 1NA7A 3LM5A 3KA0A 2XK9A 4DT9A 2Z8CA 3CR0A 2A19B 3ANQA 3NNWA 2UZUE 4FT7A 2OSCA 4IX6A 4O21A 4LYNA 3ZO4A 4DTKA 5FLFA 2RFNA 2XIRA 4DG2E 2BTSA 4BBEA 3U54A 5C4LA 3FHRA 2VTSA 3ORXA 4U9AA 4ORKA 4I5MA 3C5UA 5HBEA 4BCMA 2IN6A 3UMWA 5C4KA 1RJBA 3O8PA 3DA6A 2IW8A 4HYUA 2VWXA 4QMSA 3GENA 4M12A 1CKIA 4E8AA 4DA5A 4HVDA 4MQ2A 4XHKB 3MDYA 2R64A 3JXWA 4G3CA 5TR6A 3VS4A 3CPBA 5BYYA 2Z02A 3GU5A 4HGSA 1SZMA 4MF1A 4I4EA 5LQFA 3VULA 4MVFA 3VUDA 3BEAA 3PWYA 4Y83A 3ZO3A 4DAWA 4M13A 5I3RA 4IM2A 4FSNA 3RNIA 2UW7A 3WYYA 1MRYA 3RAIA 2VAGA 4GK2A 3SA0A 4AA0A 3LXKA 4CD0A 2QOLA 5D1JA 2CNUA 4XV2A 4CZUA 4AGUA 2PY3A 5HVYA 3ZUUA 2ZM3A 3OFMA 5AIRA 3SG9A 4A9RA 3TTJA 3DLZA 2P3GX 2PVRA 4FV3A 4G16A 5HE2A 4D2VA 4EH3A 4EI4A 4OUCA 4ZY4A 3PE2A 5CLPA 2QOKA 3QZFA 4YR8A 1PF8A 1YDTE 3DKFA 1YVJA 1J91A 5AP3A 5IEVA 5J7BA 4YJVA 1F0QA 4LOQA 5TE0A 4R7BA 4QP4A 1PXIA 4DH1A 1H24A 3AC2A 4XX9A 5I9ZA 1LEZA 4DBXA 4Q9SA 4KUJA 3RK5A 4WNKA 4FOCA 2O65A 3F5XA 5IH6A 3JVSA 2ESMA 2F2CB 3FMLA 4NUSA 4ZP5A 3OCBA 5E8SA 5B0XA 4BYJA 5EM8A 4ZTNA 2XM8A 2WQEA 4XOYA 4X21A 4LOPA 3KRXA 2C47A 2H34A 2Y6MA 3NNUA 4BI0A 3PY3A 4PDYA 1PXJA 4IACA 4QYYA 1M17A 5C27A 3BGQA 3VUTA 3KC3A 1AGWA 5DR2A 3FMHA 3PJ2A 4JDJA 5L3AA 2IZRA 3E8CA 1M2PA 1B38A 4XMOA 5J1WA 2VGOA 1Y8YA 2HK5A 2PVYA 4QNAA 4I5PA 3NVKI 4K33A 5CXHA 1A06A 3ZONA 3R8MA 3DOGA 3VBTA 3DJ7A 3ZO2A 5ETFA 5BVNA 3DBDA 4X2JA 3EFJA 3TNPC 1PJKA 1XQZA 2WHBA 2UV2A 3BE9A 3FLQA 5AUYA 5EM6A 2VTLA 5TOZA 3S4QA 5EOBA 4LUEA 3W33A 2YM8A 2W05A 1H01A 4FG9A 2BILB 4FIJA 3MPTA 3PG1A 4BYIA 5D41A 4E3CA 4KIKA 1H8FA 4Y85A 4UYNA 4QQ5A 2CDZA 2XK7A 2X39A 2C6KA 3PRFA 3SAYA 1JWHA 2VNYA 3LW0A 2ITQA 3OXIA 3QCYA 4H1MA 4ENXA 4ZMFA 5IQGA 2Z7SA 4IZYA 2GTMA 3PLSA 4QMUA 4AGDA 3KY2A 4EC9A 1ZY4A 1ZRZA 1CDKA 3IONA 3QQHA 3R8VA 4D2TA 4CMTA 5KCVA 2HZIA 4ZTQA 2Z7LA 3RAKA 4GUBA 2QG5A 4FTIA 1KUTA 1TQMA 2V55A 4FODA 3UMXA 1JSVA 4XLVA 1DM2A 3TJDA 2YHVA 2AYPA 1PW2A 4QYEA 4UYAA 1B39A 4D55A 5IKWA 4QQTA 4E4LA 1JKLA 1P5EA 4I0SA 2GNLA 3BHYA 3E8DA 4C3PA 4O7SA 4RLLA 4XUFA 3AC4A 3PZEA 4USFA 2WTVA 2V7OA 3CTHA 3IDBA 4L7FA 4LGGA 2OH4A 2OXYA 2ITOA 2VTAA 3T9IA 5TKDA 4DGGA 3EIDA 5JGAA 4L68A 3ORZA 4N6YA 2CJMA 2JKOA 3N9XA 3QQGA 5HCXA 5L8JA 4FTMA 4ACDA 3FKNA 3DAKA 4RWLA 4M66A 2PUUA 3MA3A 2YWVA 5FTGA 2HXQA 4FV5A 2WD1A 2VO7A 3QKKA 3UG1A 3TKHA 4YMJA 3NX8A 3QTRA 3EQRA 2BFYA 3K5VA 4BIEA 2DQ7X 3N4VA 5F94A 4ENYA 4OTGA 4K8AA 4II5A 3LCOA 4E5BA 3PIXA 4PL4A 2ITYA 2Y9QA 4BDFA 1HCKA 2C6OA 3O8TA 1U5QA 3DQXA 1UNLA 5CU2A 3A8WA 3OWJA 4DFXE 4RJ8A 4G5PA 2YITA 2QR7A 4F09A 2F7EE 2WZJA 3UP2A 5A4QA 5CU6A 5DPVA 4HW7A 3ID6C 2X9FA 3GU7A 5BVOA 5CYIA 5KKRC 2PVKA 3KN5A 3DB6A 5DFPA 2PUPA 4FKTA 3VS6A 1MRUA 4FNZA 2VUWA 3DPKA 3U87A 3PFQA 3ZOSA 3D15A 4FTNA 3HGKA 4IHPA 3V6RA 5E8XA 4IWDA 2C3JA 1H0WA 4EKLA 3EN4A 1WCCA 3FLSA 3CKWA 3V5LA 3PSCA 4LRJA 4R1YA 3VUMA 3E63A 2CLXA 4B4LA 4O27B 1GIIA 4U3ZA 2C4GA 3IKAA 2BDFA 3Q4ZA 2Q0NA 2JBPA 3W32A 3PIYA 3RI1A 3FHIA 4JBVA 3O71A 1E1VA 4XP3A 3E93A 5L8LA 3TNWA 2BTRA 2C5XA 3NNXA 3VAPA 3HUBA 1W98A 3QD0A 4FVRA 4YPDA 2QODA 4FKSA 3MFSA 5EG3A 3G33A 3VBQA 3VQUA 4NK9A 4IWPA 4PMTA 3LVPA 2G2HA 3Q60A 5ETIA 2JD5A 5JFVA 4EOPA 2A2AA 2Z7RA 4I0RA 4K77A 2NP8A 2XB7A 2C30A 4TKSA 3R8PA 4ERKA 3G6HA 1PMEA 1JAMA 4AFEA 4JIAA 2W96B 3BYUA 3DTWA 5AA8A 4GL9A 2P4IA 2UZOA 2W9ZB 2QLQA 3MY1A 4R3PA 1IASA 2ETRA 2JKMA 3PIZA 4RG0A 4RJ4A 5AAEA 2LAVA 3W16A 1UV5A 1YRPA 4FL3A 5D7VA 3ROYA 4LV5A 4EH8A 1WVXA 4OBOA 3UVPA 1IRKA 4CQEA 3OWKA 1QCFA 4BDCA 4CV9A 3NCZA 5CSWA 2DS1A 2YEXA 4KIPA 5DGZA 1OKYA 2VX0A 3VHKA 1YOMA 4EUUA 5CAQA 4JJRA 2HZ0A 2DWBA 4CQGA 3IPHA 1KE9A 1SNUA 5AADA 3LXNA 3MFTA 1NT2A 3FSKA 4MYGA 4ZJIA 2W4KA 2YDKA 3DLSA 3FLYA 1UU8A 2YLEA 3FI2A 2PMOX 1O6KA 2VTOA 2Y7JA 3I7BA 4FV0A 5JRSA 2HZNA 1NW1A 5F9EA 4CCBA 4GU6A 2R3QA 3PVGA 3H9FA 3SXSA 3KGAA 4CFXA 4FC0A 3CTQA 3OVVA 4X3FB 3D14A 4E4NA 1Z9XA 3PSDA 3W8QA 3PXFA 5AM6A 1VEBA 1XH4A 4AGWA 2PSQA 3LLAA 1K2PA 3I5ZA 2YIRA 4NJ3A 3Q9ZA 1QPEA 2HY0A 3D5WA 1Q8UA 3LOKA 4XBRA 4UXLA 4YZ9A 4YJSA 4R7HA 4JLCA 1OIUA 1V0PA 3EKKA 4UMQA 2IVSA 2UW9A 4O6EA 4FYOA 4O2PA 2WTWA 4RWIA 4I92A 3ZLYA 3AT2A 4EOSA 4NM7A 3FQSA 1T46A 3BYOA 2C5NA 5ANOA 3VS2A 5DRDA 2ITZA 4XV1A 3RZBA 1PXMA 4DT8A 1M2RA 2BDJA 2XNPA 3FZRA 3WIGA 4IADA 2C3IB 4M69A 3VC4A 5IQFA 3PTGA 3TV6A 1XH7A 4J53A 3VQHA 5K5NA 2SRCA 3Q9XA 4WBOA 4YJOA 5CF5A 2X2LA 5HG9A 2REIA 5AP5A 3K54A 3OBGA 4RWJA 1WBWA 2QI8A 3R1YA 5DR6A 2C6IA 4C61A 3QA0A 3ORNA 3TKUA 1OL2A 3UO6A 4AXAA 2QNJA 2HIWA 1H1PA 4W9WA 4YZBA 5KMJA 4IFCA 5I9UA 4BCKA 4IJPA 4BY9E 4QTAA 4O0UA 4DFBA 1YXXA 4BDKA 4CLJA 2GFSA 4I21A 5FTQA 2I0HA 2ZJWA 5HCYA 3NR9A 3GU4A 3MJ2A 3I5NA 4OTPA 3UO4A 4RQKA 5J9YA 3NVMB 4Q5EA 3Q4CA 3UYTA 3FPQA 2PYWA 3C7QA 3MW1A 2BVAA 2QC6A 2XNGA 3BHVA 5ANDA 3DBFA 3W2CA 2PHKA 4C4GA 2HYYA 2WIPA 2R7IA 4EHZA 1M52A 1SVHA 2O3PA 4EBVA 1TVOA 3JUHA 1YDRE 2B52A 3QUEA 3R2YA 4IZ7A 5EHOA 2JDSA 3ZRKA 4KS7A 2PU8A 3RKBA 3ERKA 2XK4A 3ALNA 1TQPA 3LMIA 3QRJA 3EMGA 1W82A 3EYGA 4LRMA 3E8EA 4M84A 3KXXA 4IZ5A 5A46A 1Z57A 3H0ZA 2FH9A 2Y4PA 4YJQA 4TYGA 5EOLA 4MXAA 2PVNA 5IA0A 4IAYA 4MEDA 2ITVA 5IEXA 5J79A 4UMUA 2VV9A 1Q4LA 4D4YA 3CGFA 4TYHB 4XV3A 4LFIA 3NCGA 4H36A 4CZTA 3BHTA 4E6AA 3VS5A 5I9WA 4AT3A 3OHTA 5T6KA 5IA3A 3OROA 4NH1A 3OEZA 2GS6A 4PPBA 5BVDA 3ZLWA 2XK3A 4GU9A 2OXXA 4ZS4A 4G3EA 2WMTA 3QD4A 4I6FA 4GT5A 2F9GA 3DK7A 3IS5A 4WUAA 3DXPA 1REKA 3IECA 1SNXA 3KEXA 3QA8A 2NNWB 1M7NA 3HMIA 4DCAA 3VUIA 2VTPA 3OG7A 2OGVA 5L2WA 4L7SA 5CS6A 4O91A 4MXCA 3DDPA 3F9NA 4CKIA 5B2LA 1H1RA 1QPCA 2QU6A 5FEDA 4WNOA 4BCJA 3P08A 2HZ4A 5E9EA 5CU4A 2B9JA 3IOPA 4TYJA 2OZAA 2ITNA 2W1GA 3FYJX 4OTHA 3KF4A 3PVWA 4MH7A 4BWPA 4YO6A 2DYLA 4O7ZA 5KKRB 3COIA 3KKVA 2OKRA 4CT1A 3UG2A 3UIUA 2OO8X 5A4TA 1WBPA 4GVAA 2E9VA 3PDTA 3MESA 2PE2A 2BRGA 5GJFA 4GIIA 3FI4A 3PA4A 2W5AA 4O1PA 4Y8DA 1Q97A 3R7IA 1U54B 3E7OA 4JIKA 4AOTA 2QG7A 4EJ7A 4F0IA 3QCSA 5ITAA 1FMOE 4AZWA 2Y4IB 3DTCA 3WZJA 2WOUA 1U46A 4H39A 4ZOGA 4AFJA 1VYZA 3KK8A 4BDEA 4BI1A 2CKOA 4AN3A 3DS6A 3BRBA 2CNVA 5GINE 4C2VA 4TZRA 2XJ0A 4DITA 3C4CA 3QRUA 4I6QA 4O0SA 4QMPA 5CEQA 4JS8A 1H28A 3GCVA 2EWAA 3IQ7A 3FQEA 3H0YA 3P79A 3TV4A 3UOLA 3O50A 4GT4A 4BB4A 5M4UA 1ND4A 1YHVA 5JN2A 4D1ZA 5CF8A 2F2UA 2YIQA 4TWNA 4BR3A 3ZBXA 4D2RA 3HA6A 5HIBA 5A14A 3E8NA 4I4FA 3CIKA 5LCKA 3G15A 1DI9A 4FKUA 3RALA 2YA9A 2XNBA 2ZDTA 3MFRA 3VUGA 4DEEA 3FMDA 3F6XA 4FKLA 4EHVA 3TL8A 1MP8A 3FY0A 3HAVA 1XHAA 2VTRA 5C8MA 4TWOA 2H96A 4AF3A 4YJUA 4IX5A 4ASXA 3FZSA 4ZS0A 1L3RE 3QYWA 3NUYA 3OTVA 4F1OA 5HX8A 3MB7A 3PXZA 2Q83A 4XP0A 2JDTA 4GG7A 4I0TA 2ZB1A 4AW2A 5AX9A 3HDMA 4YC8A 1KE5A 4G9RA 2J0LA 2OICA 3HLLA 4AN9A 2EUFB 4P2KA 3C4WA 4CKRA 4J97A 4D2SA 1I09A 2UZNA 4UBAA 3R00A 4IB0A 3QTWA 5L6OA 3L8PA 2VWVA 3OT8A 2X4FA 4ARKA 2B7AA 5BNJA 3KRLA 4QP9A 4JOAA 3AD6A 4FV7A 3M2WA 4F9CA 3KL8A 4KSPA 5DBXA 3WZEA 3ZDUA 4IE9A 4TYHA 5IISA 5EKOA 2XKDA 4L3LA 1GZOA 5E8VA 5FP5A 4MAOA 4ITHA 1VZOA 3COHA 3QRTA 3V6SA 4GV1A 3ZZWA 4A9YA 5AUTA 4ZTSA 3Q2JA 1URWA 2O63A 3ZSIA 2XIXA 2W5BA 3MFUA 3AMBA 5HBHA 3F7ZA 4UB7A 3TCPA 5EM7A 1PYXA 2CN5A 3CD3A 1ZMUA 1OPKA 1T45A 3BHUA 3DKOA 4J8MA 4JX7A 4MXYA 4EH7A 5IG1A 3FMNA 4O1OA 5KHWA 3JVRA 3DBQA 4QMTA 3QKLA 2ZV2A 5TO8A 3FY2A 3D2KA 3PG3A 4Y72A 2RG5A 4Y73A 1Q61A 4A4OA 5DG5A 4A9SA 4UMPA 4EEVA 4TYIA 4FG7A 3D2IA 5M09A 4DF3A 4H58A 2I6LA 1JSTA 2XCKA 3IGGA 1E9HA 4LRKA 3HMOA 4EJNA 4JBPA 4UWYA 5FWKK 3R8ZA 3SW7A 4EQMA 4ZTMA 5ACKA 1UA2A 5IUIA 1ZMWA 5AX3A 4C58A 4O0TA 3BE2A 4TL0A 5LMAA 4TWCA 2VO3A 4KIQA 3QXOA 3BPRA 3E3PA 4OLIA 3UZTA 5HLPA 3LXPA 2OU7A 3FC2A 5EHYA 5FXSA 3E64A 1R0PA 3VO3A 1Y6BA 4XG8A 4EWHA 3QZHA 4WNMA 2GHGA 2QOOA 3CY3A 4L44A 4F7SA 2BAQA 4C4FA 3HUCA 2J0JA 5ANIA 4FE2A 4W4VA 5CVFA 4ID7A 5LXMA 3FJQE 5JEBA 4WG4A 3TM0A 4YJNA 2FSTX 4C4JA 3CD8A 2BIYA 3A2CA 2CNQA 4I23A 2W1EA 4G6OA 1ZOEA 5EYCA 1QL6A 3IOKA 4FSMA 4AZFA 3ORLA 4FIIA 4F63A 1SVGA 4RVKA 3Q53A 4PTGA 2H6DA 5K4JA 2BKZA 4B9DA 4FMQA 3FUPA 4NW6A 3ZSHA 4FTLA 5JRQA 2QCSA 1ZYSA 3PXKA 4FKOA 1O6LA 2OJJA 3DBEA 3G5DA 4FZAB 5IQCA 1LEWA 3OW3A 4FEQA 1XJDA 3BYSA 4O84A 5HGIA 5HG5A 4FX3A 4QD6A 2I1MA 3AG9A 3VBXA 4EZ5A 3V8TA 2XA4A 3L9LA 2VX1A 2XYUA 4JDHA 3WOWA 3ZTXA 2OJFE 3D7ZA 2WQNA 1PKDA 3AD5A 3AOXA 5HNBA 3POZA 4AAAA 3QC9A 3JPVA 1EH4A 4F6UA 4U5JA 5IQIA 3OOMA 3WILA 5GZ9A 3IGOA 2WTIA 3AGLA 3KVXA 4AZVA 5CSPA 3FEGA 2XNOA 3UBDA 3W2SA 3MTFA 2CGXA 3ROCA 2C0TA 4U0IA 4K1BA 1UWHA 3TN8A 2IZSA 1XBCA 3NYVA 4XV9A 4ZAUA 5EK7A 3OMVA 4DEAA 2B4SB 4FT0A 4QP6A 2FO0A 3CEKA 4PDPA 1P4FA 3IW6A 3L9NA 4I20A 3P7AA 5I9XA 4U8ZA 1KWPA 2UVYA 4BICA 3F3UA 4MK0A 4HJOA 5CTPA 3MH0A 1R39A 4Q2AA 5AP2A 1W7HA 3C1XA 3EQCA 3F82A 5BYZA 4BFMA 4GJ3A 1BKXA 2ERZE 2GS7A 2R3JA 3TNHA 1WAKA 2OIQA 3PXQA 3BQRA 3HVCA 2GMXA 3L8SA 2PE1A 3ORMA 4LM5A 4WHZA 3O8UA 4KIKB 4YLLA 2Y8OA 3VIDA 4BGGA 4E1ZA 5I9VA 4TPTA 3HRBA 3P1AA 3ZC5A 5IMXA 4LL5A 5CNNA 2IG7A 1H0VA 3PA5A 3A61A 3QRKA 4CG8A 4IVDA 2J90A 2BALA 2YISA 3RHKA 3UGCA 5M06A 2V22A 3DGKA 3I0QA 5D10A 3BU5A 5JZJA 3D9VA 3OWPA 5HX6A 4YO4A 4PL5A 3C51A 4XG3A 4X2FA 1O9UA 4OTWA 4BDAA 5EW9A 1QPDA 3ZM4A 3P5KA 2WQOA 4RQVA 4AZTA 5BUEA 1YI3A 3QCQA 1GZNA 4NEUA 1ZMVA 4C37A 5IQAA 3A7IA 3DJ6A 4YC6A 2XVDA 1OI9A 4CFWA 4RRVA 1ZYDA 3UC3A 4YTHA 5M08A 5HG8A 4AE9A 4BWKA 4YNEA 3NMUF 3HMPA 2JBOA 1CMKE 4XEYA 4J8NA 5AP4A 4XNEA 2WEIA 3SXFA 4O7TA 2B9IA 5FM3A 5AR3A 5H9BA 4X3JA 3IO7A 1SVEA 4L43A 4XP2A 4AU8A 1XO2B 1ZYJA 5GIPE 5K3YA 4ALVA 5IA4A 4QPAA 3F5UA 5IZFA 5KMOA 4RMZA 3EFWA 5HE1A 4WO5A 3ZFXA 4IXPA 3HV3A 1OECA 4FT9A 4TXCA 2AUHA 2BAJA 4L53A 5T3QA 4FIGA 2WTCA 3H9RA 3TIYA 5M53A 5H8BA 4FL2A 5D9HA 4OTFA 2QOBA 2H9VA 3TUBA 4MF0A 2QONA 3BEGA 3B2TA 3LFEA 2WIHA 3W18A 2UW3A 4EC8A 4BI2A 1J7IA 3HRFA 2H8HA 3CTJA 3A8XA 4FV4A 5EYMA 4IC7A 4RFMA 3PZHA 3QLFA 2QURA 3GP0A 3LCTA 4N4SA 3U8WA 3ZBFA 4C34A 1KSWA 3ET7A 4A9TA 4FK3A 3RAWA 3OF0A 1JKSA 3ZEWA 3ENHA 4FZDB 2FA2A 3BIZA 3HA8A 4W8EA 2ETKA 3TZMA 5E8ZA 4ERWA 3R73A 3OZ6A 2ZOQA 1J1CA 2YFXA 3K2LA 5AR4A 2YM7A 4ACCA 3HV4A 4D4SA 4L46A 3HV7A 1OUKA 2C3LA 4L42A 1OVEA 3LJ2A 5HU9A 3FQHA 2X9EA 3QFVA 3D5UA 3KCFA 4IB3A 1DI8A 4AS0A 3EQPA 5BMSA 4QP1A 3NPCA 2QKRA 5HIDA 4EBWA 2UW0A 2BCJA 3OTUA 4HNFA 5LCJA 3A99A 4WA9A 3NZ0A 4TTHB 4IAAA 1FVTA 3D83A 3G9LX 1R78A 2HELA 4U3YA 4PDOA 4ZMEA 2LGCA 4I1ZA 4L3PA 3FZPA 4FNYA 4I41A 5H3QA 5K0XA 5EI6A 4W4WA 4WSQA 3Q4TA 5A3XA 2GU8A 4IVCA 2ITWA 5EKNA 1KOBA 4RA4A 3IDPA 3LFBA 2GQGA 3RVGA 2XNMA 2HW6A 1WVWA 3G0FA 4G31A 4FV2A 3RGFA 1ZLTA 3O96A 5DH3A 4WNPA 5A4LA 5E90A 3OP5A 2WMXA 3EQFA 5IA2A 4KKEA 2UZLA 2YDIA 3Q96A 4GG5A 4U42A 2O5KA 5F1ZA 4NKSA 2BIKB 2C6LA 2CKPA 1IA9A 2JLDA 4X6RA 5A6NA 2J0IA 4AT5A 3THBA 2UZEA 4EK3A 1UU3A 2VWYA 1H4LA 4I6BA 4S32A 4CYJA 4F0FA 4ZEGA 3ULZA 1LPUA 4NIFB 2P33A 1W8CA 2GQRA 2AC3A 2ERKA 2YAAA 3BU3A 3IK3A 3WZDA 3FZOA 1Y57A 4FYNA 1XWSA 1IR3A 5E92A 5AP6A 3TUDA 4ANOA 3ODYX 4FIFA 5M44A 3CCNA 4PP7A 2PTKA 2QVSE 3HEGA 3PE1A 5IQBA 4IC8A 3EH9A 3I1AA 4YHFA 3R1QA 5CZHA 5C9CA 4WKQA 2FB8A 2WFYA 3F3TA 2JIVA 3PPZA 4FZ6A 3VJNA 1BMKA 4BDIA 1XH8A 4FSRA 5DT3A 4YURA 4E7WA 4QMMA 1OL7A 5CEIA 3UNJA 3VRZA 2ZDUA 4O6LA 5HEZA 5L8KA 4G17A 3E92A 3AC3A 4RJ5A 3PVBA 4FOBA 4C4EA 3E7VA 4KAOA 5CALA 5EYDA 4F70A 3KCKA 3KXZA 4WOVA 3BBTB 2IWIA 1CKJA 2PZYA 4RBLA 3COKA 2WU7A 4KRDA 4D2WA 5GZ8A 3KRRA 1STCE 3C9WA 2R4BA 3GOPA 4M69B 2JFMA 4EOIA 4USEA 4X6QC 3MA6A 3SV0A 5DN3A 4ZSLA 5J1VA 3QZGA 3CY2A 3Q5IA 4JQEA 4PRJA 4F9WA 4HVGA 2YZLA 2F57A 5IQEA 3F69A 2ZM1A 3DV3A 3QRIA 2W1DA 4OT6A 3K3JA 4BDGA 2GHMA 5JQ5A 4CV8A 4LGDA 4EH2A 4ZSEA 4NW5A 5IMEA 2UVZA 4A07A 2GTNA 5LVMA 4G1WA 3V04A 4FI1A 4MX9A 4Z9LA 4K0YA 2WTKC 3VBYA 3MB6A 3A62A 5CQUA 3QX4A 3N4UA 2QR8A 1KV2A 2J0MB 3V5QA 3QD2B 3CQUA 3BU6A 3DFAA 4F9BA 3S00A 3VBVA 4O7VA 3OC1A 4DG3E 3Q52A 3ZHPC 1OBDA 3BELA 3O2MA 4PNIA 1FVVA 4EQUA 3HV6A 2JAVA 5HKMA 5E1EA 1U59A 4EOKA 2XBJA 4ASEA 5AAGA 5CU0A 2EXEA 2XKEA 5KZ0A 2ONLC 1Y6AA 3UIXA 1L8TA 3GXLA 3QXPA 4QMYA 3QZIA 5J9LA 3FI8A 3FXXA 2JKKA 4RZVA 1CKPA 4TW9A 4E6QA 2X7FA 3MVJA 4C0TA 4HCVA 2JDVA 2YERA 1CSNA 4Y5QA 4NL0A 3TEIA 3ZRLA 5CXZA 4CFFA 4D58A 4I24A 2CN8A 4RFYA 4ZY6A 5HESA 3DK6A 1H08A 1KE6A 4F7LA 2J5FA 4HGEA 3K5UA 4IFGA 4MNEA 3UE4A 5IUHA 4QT1A 4GRBA 4RVLA 4TNBA 4HZRA 4G3GA 4DGOA 3Q6UA 3PPKA 1XR1A 4UMTA 2VU3A 4MD8E 3SXRA 3VUKA 4ONAA 4Z55A 3FPMA 3FBVA 4FTOA 4YZMA 4D4RA 5J7HA 2QD9A 3P23A 4FTTA 4LV8A 2I0YA 3R63A 3HMNA 3LQ8A 4Q5HA 4W9XA 3REPA 3MTLA 3EYHA 3MY0A 4NIFA 4HOKA 4FV6A 2ZMCA 5KE0A 4CEGA 5JSMA 5EDRA 3C0HA 5IDPA 1H1WA 2YCRA 1PXKA 3GC8A 4ZK5A 4BDJA 4F64A 2W1CA 2JKQA 1OKZA 3EN6A 3L8XA 5CSVA 1PRYA 4E6CA 4DTBA 1OKVA 2OZAB 3PRIA 3NGAA 3DFCB 2UZDA 4C57A 1V0BA 3FXZA 4U81A 2RG6A 2XZSA 3QGYA 2VWUA 1DAYA 4MBLA 3RTPA 4QP2A 5KHXA 3UVQA 3E87A 4QOXA 2VTNA 1UNHA 3C0GA 3U6HA 3KXNA 3LFNA 5CAOA 1Q3DA 4IJ9A 5M51A 3O0GA 3I6UA 4D5HA 2C1BA 2CCHA 2R3PA 4RZWA 3R71A 2VZ6A 5CT7A 3C4XA 5AUVA 4FKVA 2Y6OA 4IIRA 4RX7A 1PYEA 4D5KA 2OZOA 5LVOA 4FK6A 4PMPA 2FYSA 3QTUA 4YTCA 4GFMA 4H1JA 4OTQA 3V8WA 4F6SA 2VWIA 4R5SA 1ZYLA 5TF9A 3DNEA 4BCPA 2YJSA 3ACJA 1CTPE 2B9FA 3I7CA 3KN6A 4PNKA 2BRHA 3OXTA 5AV2A 2ITXA 4RVMA 4XG2A 1XBAA 3B8RA 5ANGA 4ZZMA 4YLKA 3LFSA 4F4PA 5L6PA 5JKGA 1BX6A 2RGPA 3D7TB 3COMA 2XJ1A 1AQ1A 1Q8ZA 2J6MA 5HIEA 2JEDA 2WEVA 4HYIA 3F66A 3NRMA 4BZDA 5D12A 3LFDA 3QC4A 1KOAA 3G90X 3TWJA 2VX3A 4I22A 4EK5A 4QTEA 3DXNA 3LFCA 4P5ZA 2IVTA 4DH3A 2BAKA 4XS2A 5DOSA 3R83A 2VTIA 3FE3A 3KU2A 4FVQA 1ERKA 4XG7A 3QHWA 1OB3A 3O23A 4FUYA 1XKKA 3DQWA 5FEQA 3RPSA 4CRSA 1SMHA 2GDOA 2JDRA 5EI8A 1WFCA 2GNIA 4UWBA 5DIAA 5HO8A 2UW4A 5IUGA 2CHLA 3SOCA 5H8EA 5HD7A 2VN9A 2PZRA 3DNDA 2RL5A 4GW8A 4RFZA 1S9JA 4GH2A 2J4ZA 4NM0A 2VWZA 5HVJA 1ZYCA 2X8DA 3TXOA 3CGOA 3W2PA 3ETAA 2IZUA 3LCKA 3UOKA 2GS2A 1VYWA 1WZYA 3C13A 4EH5A 4EYMA 4XG9A 3OS3A 4YBJA 4OAUC 3EB0A 4O2ZA 5HNIX 3ZS5A 4BCHA 2ZMDA 1PMNA 3UPZA 4GT3A 4BWXA 3UQGA 2GPHA 4G2FA 4X2KA 3KXGA
chains in the Genus database with same CATH superfamily
3DT1A 2JFLA 2R7BA 4H3QA 3BLHA 3LE6A 5HI2A 3ATTA 2X0QA 3AD4A 3FKLA 4UALA 3KREA 3A7HA 4PF4A 4ALWA 3HMMA 4YZCA 5DNRA 5D7AA 3RPVA 4BCNA 4IBMA 4RA5A 4V04A 3CXWA 3R21A 4CTCA 2WAJA 2YN8A 1URCA 5DMZA 4O0XA 2RFSA 4KWPA 2R3NA 4FJVA 3KMUA 4F9AA 4QDVA 4L8MA 3E5AA 3G0EA 4IVAA 5FM2A 5IA1A 3W0QA 1WMKA 2ZV8A 1BL7A 2I0EA 5KNJA 2WTDA 5CX9A 5BVFA 4D0WA 3TV7A 3UDZA 4USDA 4L45A 3I81A 1P14A 3FMMA 3R22A 3ZCLA 4NYEA 4MQ1A 2BRBA 4IW0A 5EW3A 3MWUA 5CI7A 2KTYA 3ATSA 3QWJA 1ZZLA 4BF2A 3UNZA 3R7GA 4B6LA 4CFMA 5JGDA 1G8AA 2W5HA 4O0RA 5FGKA 2UVXA 3T9TA 3TI1A 1YHWA 2W4OA 4MCVA 4CFUA 4J52A 5AMNA 2GNFA 4FSZA 3II5A 4NTSA 1OITA 4QMWA 4YUQA 3MY5A 4DGMA 3QD3A 2XANA 3NAYA 4FEUA 3VF8A 3SD0A 1UKIA 1KV1A 2WXVA 3MN3A 3PJ8A 4HYSA 1R3CA 3MPMA 2P55A 4QQCA 2YCFA 3D0EA 3LJ0A 1HOWA 1V1KA 4JAJA 3TUCA 2A27A 2VGPA 5HBJA 3EN7A 4FSQA 4CTBA 2BUJA 4BRXA 4RGJA 2NPQA 4N57A 3DBCA 4BTFA 3LQ5A 3SRVB 5CZIA 1FQ1B 3U9CA 2GCDA 4F7JA 1PHKA 4ZLZA 4GKHA 3QWKA 1Q8TA 3D7TA 4LMNA 3QALE 2C68A 3R0TA 3P5JC 4C7TA 5JFWA 4IWQA 4Y46A 4YBKA 3R9RA 4XG6A 4JBOA 4M14A 5J5SA 2G1TA 4EOMA 1YQJA 4YHTA 5AR5A 4WSYA 2OLCA 2ZFYA 5EH0A 5A6OA 3OT3A 5JQ8A 2C69A 5CU3A 4BDHA 4CG9A 4XG4A 4S2ZA 2PVLA 4ANNA 4FT3A 4GYGA 2ZYBA 3ZUTA 4NM3A 4JX3A 5AWMA 5BYLA 2YM3A 4C38A 4AXFA 4J1RA 1J7LA 5IH4A 4ZJJA 2OI4X 2EXMA 2B9HA 2EB3A 3D4QA 4HZSA 3CQWA 5CEOA 1FINA 2CSNA 4M7IA 2XYNA 5IEYA 3NYNA 4DEDA 1VR2A 3U55A 2E9OA 4RJ7A 3W2RA 5CSXA 1RW8A 3JY0A 4I93A 3AC8A 4L67A 5G6VA 5IDNA 2YACA 3RM6A 2C6MA 3F3WA 3QQKA 4XBUA 2RFDA 5ANKA 4QPSA 3DB8A 5ACBC 3ZEPA 4LL0A 5A54A 3FV8A 5F4NA 4F65A 3GC7A 3B2WA 4AXCA 3MBLA 4BCFA 3PY0A 4IH8A 1WBSA 4ANLA 4E6DA 2XS0A 3IDCA 4XYFA 4YTFA 4FKIA 5IH5A 3BGZA 5M4FA 5E8WA 3KMWA 4PP9A 1XBBA 3LFFA 2WMUA 5C01A 5GJGA 4R3CA 3W8LA 4Z7GA 1GZ8A 3U4WA 1IAJA 1YHSA 2R3MA 3SW4A 1BI8A 2W1FA 1JOWB 4C2WA 5H2UA 4M67A 4WUNA 4O7LA 2X2MA 3MVLA 5IU2A 3VVHA 4M97A 3VF9A 2R2PA 1W2FA 3SDJA 3AGMA 3TZ8A 4O4DA 2YIWA 3DK3A 1MQBA 3EQGA 3R02A 4FNXA 3EJ1A 1NVSA 5K0KA 4ZZOA 2X81A 3KXMA 3QTSA 1OL5A 4IVBA 1Q99A 3MYGA 3WF5A 2PPQA 3F2NA 3LQ3A 3SVVA 4OTRA 2XARA 4J95A 5IQHA 2BHHA 2J5EA 3HKOA 4HVIA 4E20A 3F88A 1RE8A 4E5AX 2GNHA 3ZXTA 4CGAA 3A4OX 2V5QA 3HL7A 3UOHA 4NU1A 2UW5A 3KXHA 4ASZA 3H30A 4ACMA 4ZLOA 1NVRA 3UIMA 3VHEA 2OJGA 2YIYA 4TT7A 4FSWA 4YLJA 1FGKA 3QF9A 3NIZA 1J3HA 5DT4A 4AACA 2XF0A 2UUEA 4CLIA 4EK4A 3I4BA 4FTJA 3KRWA 4QTDA 3IW7A 2RF9A 5FG8A 4BVUA 4UX9A 3UJGA 4IQ6A 5IF1A 3AC1A 3RNYA 2XNEA 3FLZA 4OTDA 3NLBA 5AUUA 5F95A 2IW9A 3CKXA 1Q8YA 3EQHA 4BCOA 1MRVA 3R01A 2R5TA 3VUHA 2XEZA 2XRUA 1OL6A 4QTBA 3UPXA 4V0GA 3M1SA 3S95A 3K3IA 4O38A 5HTBA 4V05A 1JKTA 3C0IA 3ZFMA 4HPUE 4M15A 2UZBA 3EN5A 3PPJA 3SRVA 1YI6A 3UIBA 3ENMA 4AE6A 4Q9ZA 3OEFX 4TRLA 4YSMA 1UU9A 4BHNA 4M3QA 1GIJA 3IG7A 2ONLA 1FBNA 3T8OA 3C4ZA 3HP2A 3V01A 5FXRA 2JGZA 3UYSA 4NJDA 4BN1A 3EOCA 4RT7A 2ITTA 1YXUA 5EM5A 4RX9A 4RJ6A 5AM7A 4O86A 4GYIA 2F7XE 2FVDA 2PULA 1WBVA 3AKLA 2WMBA 5ANEA 4DHFA 4O7YA 1JLUE 4OTIA 1GY3A 3PUPA 4FKPA 4QP7A 1TQIA 5KMIA 4IEBA 4QMVA 3JR1A 1TZDA 3QYZA 4J98A 2GHLA 4ZSGA 2ACXA 2CGUA 4JQ8A 4B0GA 4RC3A 3GCQA 5K9IA 1G8SA 4QRCA 5KMNA 1PXNA 2YM5A 4OGRA 4X0MA 2QHMA 4BBFA 5I0BA 1YW2A 5E8UA 5BVKA 5C03A 4U43A 5AAFA 4AOJA 4EYJA 4EZ3A 2JIUA 5JH6A 3OD6X 4U7ZA 2WB8A 2UZTA 4AW0A 4FKRA 5HTIA 4GFOA 5AP0A 3W1FA 2PZPA 5EW8A 4H05A 5K5XA 3CPCA 4IWOA 1A48A 4AP7A 4IAZA 2E9NA 4PWNA 4TY1A 3UVRA 3EQIA 3ZMMA 5G1XA 4C3FA 1PMUA 5E4HA 3W0RA 4W8DA 1PKGA 4FRFA 4FTQA 4AXEA 5FBNC 3G2FA 4RIOA 3E88A 3Q04A 3RAHA 3PLAE 4UEUA 2EXCX 3BI6A 4IX3A 4FTKA 2OXDA 3C50A 4GK4A 1XH5A 5IQCA 5JFXA 4RIYA 1BI7A 5EQPA 1H1SA 3R28A 2E9PA 4NCTC 4O0VA 2YCQA 2FUMA 3BKBA 4FGBA 3TDWA 2HWOA 2G01A 3Q5ZA 2JDOA 5JZNA 4JBQA 2CMWA 3GVUA 5FBOA 3ORIA 1TKIA 4Z16A 3I6WA 3ZO1A 3HECA 5FXQA 4CKJA 1KE8A 2HENA 5DWRA 3KULA 4BTKA 3V8SA 3T3UA 4DC2A 5CAPA 3DDQA 4AQCA 3BQCA 1ZXEA 3NW6A 1QPJA 3RINA 4EH9A 5LMBA 2PUIA 4DCEA 1GZKA 1W0XC 3N51A 2HOGA 4R77A 4UN0C 3BCEA 1LUFA 3KF7A 1IEPA 2I40A 4B7TA 5ETAA 1GNGA 2XEYA 3ORTA 4PL3A 4OAVB 5BVWA 2G2FA 3SLSA 3M11A 3MIYA 3G6GA 3LXLA 3NSZA 3P4KA 4TNDA 2PVFA 4ZLYA 2YZAA 3ZLSA 3PSBA 5E91A 3W10A 3DXQA 4OT5A 4JDKA 4O7WA 5CF6A 3SOAA 3F3VA 4JR3A 4P90A 3FLWA 3KMMA 5LMKC 4WRGA 2QOQA 2RFEA 3DJ5A 3NDMA 1WBNA 3F2AA 1U5RA 3MJ1A 5GHVA 2XBAA 3CP9A 4R7IA 4GK3A 3R9OA 2NRUA 4RPVA 4YJSA 3FMKA 3QQJA 4YNOA 4BC6A 1PMVA 3AT4A 5HTCA 2BRMA 2GNJA 4N6ZA 3NUPA 4R8QA 1E1XA 4S34A 4TWPA 2PL0A 2X7GA 3KFAA 2VO0A 4NTTA 2R0UA 1BLXA 3BLQA 3MH2A 3QTQA 4JRVA 4UXQA 4K11A 3RBWA 3CE3A 4CYIA 4FZ7A 3Q3BA 4QMXA 3FXWA 3NUNA 3TZ7A 3QQFA 5J95A 5L2QA 5FD2A 3BLRA 1IG1A 3DKCA 3P0MA 4JG7A 2WOTA 5DR9A 5AFVA 3W0NA 5EHLA 3O7LB 3EWHA 4C3RA 2JAMA 1YWNA 3GNIB 4JQ7A 4L3JA 4E26A 2HCKA 1MUOA 2PVJA 2JIIA 3R30A 2C6DA 1W2DA 2V62A 3HZTA 2R3RA 3AC5A 2XKCA 5HICA 3ZC6A 4FA2A 2WQMA 5EQEA 2VWWA 2XIKA 4P4CA 4HVHA 3NS9A 3FKOA 2PVMA 5BPYA 3QAME 5LARA 1F3MC 4FKGA 1BYGA 3NUXA 4GEOA 4YZDA 4JNWA 2QKWB 2FSMX 3EN9A 3UC4A 3FZ1A 4AQKA 3UNKA 2YABA 4GFGA 3V51A 3AQVA 4BHZA 3BGPA 3QTXA 5HU3A 2B54A 4X3FC 2XH5A 2OF4A 2OFVA 5KZIA 4FEXA 3NNVA 3F2RA 2G9XA 3T3VA 5L4QA 1JQHA 1JPAA 3GQLA 3PJCA 2JC6A 2QOHA 1IA8A 5DEWA 5EDQA 3RJCA 2QO7A 4XJ0A 3QU0A 4AZSA 3ANRA 3QQLA 3NEWA 3LIJA 4KBCA 4KIOA 4BZNA 5HORA 4FGRA 2YLFA 1JBPE 2X4ZA 4PX6A 3OBJA 3TACA 2XRWA 2R3OA 4J99A 3RP9A 4EOJA 3GI3A 2R3GA 2R3LA 2QO9A 3HP5A 4UZHA 5J9ZA 4IM3A 3N4TA 1OIQA 2HXLA 5A4EA 4MNEB 2Q0BA 2FGIA 3R6XA 5GNKA 4I3ZA 4XRLA 2OW3A 4XRJA 2X1NA 2XP2A 5BQ0A 2J9MA 4LGHA 5GZAA 4I6LA 1XH9A 5E8YA 3Q9WA 4F6WA 3NW5A 1F5QA 2BR1A 3QHRA 2ZB0A 4DGNA 5I4NA 5ANJA 4O81A 4FKJA 4NFNA 3ZZEA 3BWFA 3QCXA 5A4CA 3S0OA 5HO6A 1XH6A 5DRBA 1RQQA 4ZTHA 2QU5A 4YPSA 2GSFA 1OUYA 5BUIA 5CEMA 3CSVA 4S33A 3NAXA 3I79A 1Z5MA 5JT2A 1Y91A 1PY5A 2PZIA 4AW5A 4BKYA 3MI9A 5CY3A 4FKWA 4WRSA 5DI1A 3PFYA 2EVAA 3Q6WA 5EQYA 1OZ1A 4YTIA 5ETCA 4OW8A 2PMNX 4CXAA 1A9UA 2R9SA 4J7BA 3RK9A 4M0YA 1H07A 2IZTA 1Q3WA 3O7LD 3AMYA 1DS5A 3VNTA 3LMHA 3OY1A 5DHJA 4WBBB 4RIWB 1GJOA 1YKRA 1YOJA 3MV5A 5DVRA 5L2SA 3AMAA 4DLIA 2EB2A 5KX8A 5M57A 1APME 4BGHA 3ULIA 4JVGA 2PMIA 2NRYA 2VTJA 1G3NA 3C4EA 3EZVA 3PVUA 3R7YA 4FTRA 3R1SA 3W2OA 1UWJA 2OH0E 5FRIA 1OL1A 1ZAOA 3ALOA 4C8BA 4XOZA 4EONA 3CC6A 4L6QA 4BKZA 5I5ZA 3BBWA 1G5SA 3BYVA 4PTCA 5LWNA 2FSLX 3O17A 2BPMA 3FSFA 4HYHA 4DINA 4E5WA 2GFCA 1ZOHA 2OBJA 3S1HA 3TG1A 4BL1A 4GUEA 4D28A 3A7JA 3M42A 2W1IA 4Y5HA 4EQCA 3RCJA 4E4XA 3D5XA 3MS9A 3H10A 3TNQB 4LUDA 2RSVA 2WO6A 3LHJA 3PA3A 5TT7A 3EL7A 3NYXA 4NZWB 3S2PA 4ANSA 3EQDA 3QLGA 2PUNA 2BROA 2O64A 2NYAA 5I3OA 4CFVA 4CVAA 5L2IA 2AEGA 4QQJA 3UTOA 2R3HA 1CM8A 3BZ3A 4EHGA 5LWMA 4FZFB 2CLQA 3QTZA 1UU7A 3WE4A 2WMRA 3LMGA 4DTAA 2VTTA 4J96A 2A0CX 4MUQA 4EH4A 4A9UA 4W4XA 4XLIA 2P2IA 5AP7A 4B8LA 3NW7A 2BMCA 1WBTA 4Z3VA 3F7WA 1Q62A 1YWVA 2ITUA 3PJ1A 4CSVA 4BGQA 5IQDA 4FF8A 3QUPA 5M55A 4FV8A 2DUVA 3TIZA 4JG8A 4S30A 3VS1A 3A7FA 5JFSA 3UQCA 3GCSA 1H25A 4D9UA 3W0PA 1RDQE 2ITPA 3W0OA 3P7BA 4G6NA 3V5JA 3RMFA 4AA5A 3GFEA 4YZNA 2Y4IC 3L9PA 3OOGA 4E93A 3RPRA 3GC0A 2CGVA 2KULA 2C0IA 2W9FB 2IW6A 1K3AA 3WZUA 3EFLA 4U97A 5KMKA 5IA5A 3V5PA 4M68A 2WMQA 4BCGA 3SG8A 4KINA 4BKJA 4BBMA 4DEHA 4QNYA 2WKMA 1MQ4A 4HGLA 3WARA 4APCA 3R9DA 2J7TA 3ZUVA 4CRLA 4F0GA 3BHHA 1PXPA 3IW4A 3LFQA 5DA3A 4ANBA 4BIDA 4BZOA 2HW7A 1FOTA 3FL4A 5AUXA 5AEPA 5HLNA 4IDTA 3QGWA 1OKWA 2F7ZE 2PE0A 3BYMA 3QUDA 2B1PA 4GJ2A 4FTCA 4PV0A 4AA4A 5B2MA 4DH5A 4Z7HA 3UQFA 4YHJA 4MXOA 5CAUA 4GKIA 1W2CA 4F1MA 4UWCA 3ZRMA 5ICPA 2YCSA 2W4JA 5T68A 3SQQA 4GS6A 1BUHA 2Y0AA 3F5GA 4QYHA 2C5OA 2I0VA 2C0OA 3GB2A 3TJCA 2YAKA 4CFNA 4ZSJA 3FMEA 2Z2WA 3WYXA 2JITA 3ORPA 4PQNA 5AUWA 3LPBA 4I5CA 4L52A 3VBWA 2UW8A 4R78A 2WMSA 3OCSA 4GMYA 1YOLA 4PMSA 3PP0A 4ZTLA 4ZJVA 3O51A 5LVNA 1OIYA 3PJ3A 5CVHA 1YXVA 5BMMA 3UOJA 2GNGA 2QOCA 4RIWA 1JKKA 4FV9A 4U45A 5HG7A 1Q41A 2F4JA 1Q5KA 2UW6A 4UV0A 2C6EA 3DAJA 3OW4A 3GU8A 4NWMA 4IAIA 4LMUA 5C1QB 5JMSA 3GGFA 5HCZA 4MHAA 1YXSA 3ZXZA 4AT4A 4GIHA 4D1XA 3MH3A 5FTOA 4ANQA 1W83A 3HV5A 2QO2A 2WPAA 2X8EA 3LM0A 4IZAA 4RSSA 2VTMA 4AGCA 4F08A 5KBQA 2WELA 4ANMA 4EKKA 5AR2A 4F9YA 4PUZA 4ZXTA 2IVUA 2PMLX 4J71A 3VS0A 4O7RA 3EZRA 1SM2A 4MNFA 4DDGA 2CKEA 4QTCA 2A4LA 3VW8A 4E73A 4FSUA 2XNNA 4FBXA 4MWHA 4FSYA 5AR7A 3H9OA 3V5WA 5IPJA 4G3FA 1ZY5A 4K9YA 4LOOA 5BVEA 4KBAA 2WMVA 3EFKA 4DFNA 2AC5A 1P4OA 4L01A 5FP6A 2I7QA 2R3KA 4YU2A 4DFUA 5CEKA 4IDVA 4WG5A 4NCTA 3RHXA 5GIOE 3HYHA 5I9YA 2XIZA 4CNHA 4K2RA 4DH7A 2ZM4A 5KMMA 1YWRA 4KRCA 2VRXA 3LLTA 2X0OA 2BZHB 4AN2A 4RX8A 3RZFA 3VN9A 2BRNA 4FIEA 4FVPA 3ELJA 4G6LA 3EKNA 3FZTA 4JDIA 4NT4A 2ZAZA 5AUZA 4B8MA 5AV4A 1WVYA 4H3PA 3JY9A 3JYAA 5L6WL 1FVRA 4XCUA 3GEQA 4U79A 1KE7A 2XJ2A 4BIBA 3G9NA 3GUBA 4ZTRA 3L8VA 5HD4A 5HHWA 2C5YA 3IW5A 4LDTA 3RCDA 5BX0A 3WZKA 4ZSAA 3DU8A 1O6YA 3NUAA 4EZ7A 4MBJA 5EFQA 3UODA 5F20A 4FUXA 4HCUA 3LAUA 1DAWA 4QPMA 3QX2A 4EWQA 4JI9A 4A7CA 1FPUA 3ZU7A 1ZARA 4M0ZA 2YM4A 2QLUA 5LMKA 4KD1A 4C35A 1B6CB 1R0EA 4A4LA 1UVRA 2UZVA 4KS8A 3U6IA 1P2AA 3ZM9A 4FEWA 4NFMA 3I0OA 1ZWSA 5KMLA 4C4IA 3GU6A 4PTEA 4MBIA 3VS3A 1JSUA 2XK6A 3F3ZA 4O22A 4ACHA 2WMAA 1FMKA 2C5VA 2OK1A 3WE8A 4O83A 3BX5A 3WIKA 2J51A 3DCVA 3MSSA 5DEYA 4R6VA 5AV1A 3FYKX 4EOOA 4RX5A 3VWAA 5EYKA 3LKMA 3FMJA 2Z7QA 3PP1A 4BTJA 2PK9A 4C02A 4ZY5A 4CMUA 3CBLA 1U4DA 3POOA 1VLRA 2VTHA 5J87A 3BLAA 4I5HA 3EHAA 4JG6A 2CPKE 2C1AA 1W84A 3ZSGA 3V5TA 3OCTA 1OMWA 3WF7A 3ZH8A 4PPCA 4DE4A 3E62A 2OIDA 3BV2A 4IAKA 5DYJA 4MXXA 1ZOGA 3EL8A 4ZZNA 5E1SA 3PWDA 4ACGA 1X8BA 3HRCA 2UZWE 2E2BA 4UMRA 3UO5A 5CNOA 3OUKA 4DFLA 3AKKA 1I44A 4FT5A 3RPOA 2B53A 3QQUA 2W7XA 4UZDA 4O96A 1GAGA 3GCUA 4FTUA 3KB7A 1LR4A 3GFWA 1J1BA 4KABA 1GOLA 4JAIA 4QYGA 4RJ3A 1ST0A 2W1HA 3ZYAA 5CQWA 4M8TA 4AOIA 5KUPA 2WTKB 4FNWA 2HWPA 5M56A 2BZIB 3HAMA 3B8QA 3R7UA 3AT3A 2W99B 3EQBA 4JT3A 5CT0A 3SHEA 4ASDA 1SYKA 4B99A 1IAHA 2W0JA 4V0GB 1Y8GA 2BFXA 5A9UA 5FUTA 3WI6A 3G51A 4HCTA 4LI5A 4X3FA 3IW8A 3Q9YA 4FICA 5CENA 2VWBA 1OPLA 3R7OA 3WBLA 3DY7A 4PY1A 4C4HA 5LVLA 3Q32A 3S3IA 4IMYA 2E9UA 2XMYA 2WMWA 5D11A 5C26A 4F7NA 4AG8A 4RLKA 2X2KA 2WU6A 3QKMA 2XCHA 2PZ5A 5B2KA 3FDNA 3QTIA 2WTJA 2BZKB 4DLJA 4EOLA 2FSOX 4MKCA 3KQ7A 3RWPA 2QQ7A 2CKQA 4WT6A 3W55A 3H3CA 3U9NA 5M07A 2WQBA 1OM1A 4IB5A 4P7EA 5H8GA 2X8IA 4MD9E 4QYFA 1OIRA 3ZLXA 4F99A 2XALA 4KKHA 2ZV9A 4EOQA 1XMLA 1H27A 1PXLA 3GBZA 3FLNC 4U80A 4FG8A 3MH1A 3TDVA 3R2BA 4NSTA 5C8KA 4Y95A 4X7QA 1YDSE 3R7EA 2J50A 3CLYA 4HGTA 5AV3A 3TTIA 3L1SA 4C62A 3TZ9A 2YM6A 3UP7A 3KVWA 3RPYA 4P5QA 2OFUA 3TNIA 5HE0A 3VW6A 4CT2A 1K9AA 1M14A 3AXWA 4D2PA 2C3KA 3Q2MA 4D1SA 1V0OA 1PXOA 3VS7A 1S9IA 2QOIA 4LG4A 3BV3A 2HAKA 5HE3A 3GCPA 3NUSA 2QOFA 2OWBA 4TYEA 5FDPA 5JGBA 2OF2A 2X6EA 4CCUA 2HY81 4QMLA 4N70A 4F1TA 2PVHA 3P9JA 3R1NA 4YP8A 3SGCA 1NVQA 1JVPP 2BDWA 4RIYB 4MXZA 4KNBA 3DZOA 5CVGA 4BCQA 5CWZA 3WF8A 3GOKA 5LJJA 3WF6A 3C4FA 4YJTA 4HVSA 2BKKA 3FI3A 4C59A 3UDSA 3KULB 5LOHA 2OG8A 2V7AA 3MPAA 4FSTA 4L00A 4C36A 4R3RA 5KO1A 5KBRA 4QMQA 4DN5A 1ATPE 3CQEA 4GSBA 3W2QA 5CANA 5M4IA 5AJQA 3ML1A 4NM5A 2BZJA 4CMOA 4DBNA 4JRNA 5HZNA 3U6JA 3MIAA 4KA3A 2XUUA 4QP8A 4A06A 1GIHA 2OIBA 2OJ9A 2W17A 3D5VA 3DKGA 1WBOA 2W06A 1UKHA 3F5PA 3F61A 4RIXB 3ZFYA 3ODZX 3V3VA 2P2HA 3A60A 5LVPA 5M4CA 2A1AB 2VD5A 4MD7E 1YXTA 4IB1A 3NYOA 4IX4A 3UZPA 4KBKA 1OGUA 4U41A 3R8UA 3OUNB 4I6HA 4G9CA 3R9NA 4KSQA 3LFAA 4EH6A 3E3BX 4C33A 4XH6A 4QMOA 4X2NA 5DT0A 5JK3A 4K6ZA 3FWQA 5CEPA 2PWLA 2BHEA 2VO6A 3OWLA 4FKQA 2XM9A 3R8LA 5CF4A 4O82A 4KKGA 4RWKA 3OCGA 2R3IA 3TT0A 4WIHA 4O0WA 3LCSA 4RC4A 5HQ0A 2R0IA 5AP1A 4RVTA 4EORA 4QMNA 2V0DA 4IAFA 1UNGA 4HNIA 4AUAA 4DYMA 4R5YA 2ZVAA 3OXZA 2YJRA 5DE2A 3RK7A 4FEVA 4EUTA 2XKFA 3L9MA 3NWWA 4IANA 3A4PA 4QP3A 1H1QA 4ITIA 5FQDC 2OJIA 3WF9A 5CASA 3HNGA 4RC2A 3VJOA 1R1WA 3DZQA 4WG3A 2O2UA 2X6DA 3KRJA 4PDSA 4PMMA 3GT8A 4BDDA 1Q8WA 2ETMA 4K18A 4LV7A 2RKUA 4FTAA 3P78A 1AD5A 2J2IB 1HCLA 2CGWA 3R04A 2XIYA 4D9TA 5CI6A 2VTQA 4ALUA 5DLSA 2F49A 4FV1A 4W4YA 3R9HA 4FR4A 4BDBA 4X2GA 5CAVA 4KB8A 5J5TA 3UZRA 3MVHA 1U54A 5AA9A 3MVMA 1QMZA 2ZV7A 3P7CA 3OY3A 3UDBA 4ITJA 4O7NA 3C5IA 2GQSA 4U40A 1NY3A 4OBPA 5C8NA 4UY9A 2QHNA 3CS9A 3DAEA 5L2TA 4JL9A 4QMZA 2RIOA 3LZBA 4GCJA 1FGIA 2C6TA 3FL5A 5HNGA 3PXYA 1H00A 2P0CA 3GQIA 3QBNA 4V01A 3SKCA 3U4UA 4DFYA 2YWPA 3MGYA 4N0SA 2Z60A 2R3FA 2YIXA 3BWJA 4LQMA 4MWIA 4D0XA 4DEBA 4EL9A 3ORKA 4NKAA 1Q24A 1VJYA 4AW1A 2NO3A 3I60A 3SC1A 4JXFA 3NIEA 1JNKA 3ZDIA 4S31A 2G2IA 3LJ1A 5AR8A 4DFZE 5J8IA 4DH8A 4DEIA 5E7RA 4YSJA 2VNWA 5GJDA 3D94A 1YI4A 2W1ZA 2J0KA 3NUUA 3R7VA 3QL8A 5E8TA 3ITZA 3HDNA 3HX4A 5HOAA 5BUJA 2X0GA 3PY1A 2O0UA 4L9IA 4U44A 3CJFA 4H3BA 4ZIMA 4DEGA 4DG0E 4IM0A 4MTAA 3GC9A 4G34A 4OBQA 4D4VA 3PXRA 5FDXA 1NXKA 1REJA 2B55A 2YDJA 4DGLC 4U6RA 3JS2A 5AV0A 3P86A 4AX8A 5K4IA 5HLWA 1OBGA 2IO6A 2IPXA 2X7OA 4JR7A 4EK8A 4APPA 1ST4A 3FC1X 4GVJA 4YC3A 4A4XA 4AZEA 4FL1A 3RM7A 2WGJA 4YJRA 4BTMA 4R1VA 2EU9A 3SX9A 5FEEA 4G5JA 4EHEA 1ZZ2A 2IVVA 2XK8A 4QO9A 2CCIA 3PYYA 1M2QA 5HO7A 4G3DA 4I94A 4OR5A 3RWQA 5CSHA 4TN6A 2XAMA 4O0YA 1H26A 1LP4A 1OPJA 2G15A 4BCIA 2WNTA 5HVKA 2O8YA 4PPAA 5AIKA 4AWIA 4RIXA 4EK6A 4WD5A 4CZYB 4YJPA 3U51A 3Q4UA 2B0QA 4E4MA 4YGAA 1BL6A 3BL7A 5EDPA 4HPTE 3VRYA 3TKIA 3A7GA 1J7UA 3CJGA 1M7QA 5EI2A 4FIHA 3LCDA 3FAAA 3KK9A 3ACKA 3H4JA 5B7VA 2IJMA 1NA7A 3LM5A 3KA0A 2XK9A 4DT9A 2Z8CA 3CR0A 2A19B 3ANQA 3NNWA 2UZUE 4FT7A 2OSCA 4IX6A 4O21A 4LYNA 3ZO4A 4DTKA 5FLFA 2RFNA 2XIRA 4DG2E 2BTSA 4BBEA 3U54A 5C4LA 3FHRA 2VTSA 3ORXA 4U9AA 4ORKA 4I5MA 3C5UA 5HBEA 4BCMA 2IN6A 3UMWA 5C4KA 1RJBA 3O8PA 3DA6A 2IW8A 4HYUA 2VWXA 4QMSA 3GENA 4M12A 1CKIA 4E8AA 4DA5A 4HVDA 4MQ2A 4XHKB 3MDYA 2R64A 3JXWA 4G3CA 5TR6A 3VS4A 3CPBA 5BYYA 2Z02A 3GU5A 4HGSA 1SZMA 4MF1A 4I4EA 5LQFA 3VULA 4MVFA 3VUDA 3BEAA 3PWYA 4Y83A 3ZO3A 4DAWA 4M13A 5I3RA 4IM2A 4FSNA 3RNIA 2UW7A 3WYYA 1MRYA 3RAIA 2VAGA 4GK2A 3SA0A 4AA0A 3LXKA 4CD0A 2QOLA 5D1JA 2CNUA 4XV2A 4CZUA 4AGUA 2PY3A 5HVYA 3ZUUA 2ZM3A 3OFMA 5AIRA 3SG9A 4A9RA 3TTJA 3DLZA 2P3GX 2PVRA 4FV3A 4G16A