5KMJA

Trka jm-kinase with {n}-(2-pyridylmethyl)-2-[2-(2-thienyl)indol-1-yl]acetamide
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
310
structure length
300
Chain Sequence
LQGHIIENPQACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords High affinity nerve growth factor receptor
publication title Structural characterization of nonactive site, TrkA-selective kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 300
sequence length 310
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5kmjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5kmjA01
3QC9A 4USEA 2BFXA 2YJSA 3V8TA 2V0DA 2VO0A 4ZAUA 5HTCA 3LXLA 4I5MA 5DIAA 2XBAA 3P0MA 4MVFA 4A9RA 3R28A 3C4XA 3VS1A 2QOFA 3TV4A 5BYLA 4WNMA 2BZKB 1F5QA 3TKUA 4X6RA 3PXRA 3CLYA 3H0ZA 2OG8A 4QMWA 3JR1A 4S30A 2GDOA 4E1ZA 1Q99A 4OTPA 4GUBA 4XX9A 4CV8A 4WBBB 2V62A 1YI4A 1KV2A 2YDIA 4EOLA 4ZS0A 5CVFA 2IPXA 4DGMA 5JT2A 5LARA 4F7NA 2IZSA 3ZXZA 4N6ZA 5KZIA 1UVRA 2DUVA 5EHOA 2GPHA 1LP4A 5HCXA 3EN6A 3GB2A 3KVWA 4RJ3A 1YI3A 1JNKA 2YISA 3A99A 5K3YA 3H9RA 3VF8A 4C37A 2BDWA 3MY5A 3EJ1A 4BIDA 5DLSA 5IA0A 1BUHA 4DBXA 4GFMA 3CTHA 2PVFA 5D10A 3V5LA 3IW6A 4PL5A 3E93A 3OCTA 4WOVA 4GKHA 2WAJA 4PWNA 1U46A 3ULIA 3QGWA 3TIZA 4FSQA 4HVHA 3OWPA 3UGCA 3UO6A 3RNYA 3F3ZA 5CEQA 4IIRA 2P0CA 4RBLA 3DGKA 4K6ZA 2XBJA 4ZSJA 5HLPA 4B8MA 3HMNA 3UVQA 4F9YA 4R7HA 4RX9A 2CLQA 2UW4A 3ORTA 4BDBA 1WAKA 2XS0A 3MY1A 4KIKB 1OIQA 5KHWA 4APCA 3KEXA 3P9JA 3MPAA 3C4CA 3W18A 4AXAA 3QA0A 5HNIX 4YC6A 4DCAA 4YJOA 3GC9A 5CSXA 4Z7HA 3U9CA 2QLQA 4DH1A 5IEXA 4IX3A 4ID7A 4YJUA 3O51A 3VBWA 2RKUA 4ZIMA 1OKVA 2IZTA 5C9CA 2R3FA 2X2LA 3NUPA 3ULZA 4DHFA 4DT9A 4GJ2A 4FE2A 3D5VA 3QKLA 4ZSGA 3P23A 1LR4A 3WBLA 3NEWA 3FDNA 2CN5A 3LCDA 2GU8A 4F4PA 5LWMA 5KBQA 4J1RA 2XIYA 3BLRA 4MD7E 5LVOA 5DI1A 3CJGA 4JBVA 2B9FA 3DOGA 4IWPA 3ZC5A 2PWLA 2Y6OA 1Q8YA 3QUDA 4G1WA 3MFUA 2EXMA 4QNAA 3POZA 5FM2A 4C38A 4GH2A 5BVOA 3WF9A 4DFUA 3G0EA 2IN6A 2VTSA 2OF4A 3W16A 5HVYA 5BVFA 1QCFA 5KE0A 3FL5A 2C1AA 5FQDC 3QX4A 3UVRA 3VUHA 3FZOA 3TIYA 3LFDA 1BX6A 3F7WA 3VUDA 2PVYA 3JPVA 3PZEA 4FV7A 2ZDTA 4BKJA 4I24A 2X6DA 2CGXA 4WSYA 3C1XA 3GGFA 3OY1A 1ZRZA 4QPMA 3VS2A 4AA0A 3FZTA 4FKTA 2QKWB 5AFVA 4KA3A 2R3PA 5IQEA 1OBDA 4D4YA 5ICPA 4DC2A 4RC2A 3HRBA 4P7EA 2QVSE 2PUPA 1Q8UA 1Q4LA 1K2PA 3C4ZA 4K9YA 3L9NA 3RZFA 4MQ1A 3QU0A 2W1FA 5L2IA 4DG2E 3QRIA 4BY9E 3B8RA 4QNYA 3WZKA 3NNVA 2F4JA 4GK4A 3UO4A 3N4VA 3L8VA 2FA2A 1JAMA 2KULA 4WNKA 3DJ7A 4EBVA 3SQQA 1XO2B 4YJRA 3F5GA 3LFQA 2XCHA 4FTTA 2QG7A 1OI9A 4YLKA 4TW9A 3DZQA 3GC0A 4L9IA 3O0GA 3KFAA 2PTKA 2VWBA 1NVQA 4FV1A 5H2UA 4EOQA 1TQPA 5LXMA 3FMLA 3SOAA 4TTHB 4NCTA 2RFSA 3NIZA 4ASZA 5CT0A 3TTJA 2VWVA 4YHJA 2UW6A 3S4QA 4XLVA 3T3UA 4EH8A 1QMZA 1WVXA 2QHNA 2UV2A 4QMQA 1SNUA 3FBVA 3PJCA 1Q8ZA 2YM5A 4GT5A 4BBFA 3ZLXA 4GFGA 4DFLA 3DDQA 2G2FA 5GJDA 3SD0A 3HUBA 4EONA 4YHTA 3OROA 3KA0A 3CTQA 3QCSA 5L3AA 4BDCA 4DG0E 3RJCA 3SOCA 4L3JA 3FYJX 3IK3A 3LQ3A 3PZHA 1GZNA 5HIDA 5D41A 5AAEA 1PHKA 3U6JA 4BR3A 2Z7SA 2VTJA 4O7ZA 1JKSA 2R7BA 2ITTA 2UZTA 2REIA 1OPJA 2ZM4A 4TKSA 2B9HA 3KN6A 4ASEA 1SNXA 2C3IB 4QT1A 4D2RA 3BHHA 1LPUA 3GBZA 4D2VA 4XG2A 4XHKB 5FLFA 4BDEA 2RL5A 3COKA 5KKRC 2ACXA 4I23A 1M14A 2WMBA 1TVOA 5T6KA 2V55A 3ODYX 3OT8A 3QRUA 2QO2A 2Y4IC 4H3BA 3QUEA 4ENXA 4PUZA 4CG8A 4ANBA 3NNUA 4AN9A 3QYZA 2OSCA 3MTLA 1BYGA 4FX3A 3PXQA 4QYHA 4F1TA 2OBJA 4R8QA 5HD7A 2XM9A 2VTOA 4RIXB 1J7IA 1M2PA 3NAXA 3QZGA 3ZH8A 3AC5A 4JXFA 3RK9A 4N6YA 3I5ZA 5IQIA 5E8XA 5C26A 2R4BA 5J1VA 3OWJA 3SXRA 1XBCA 3NW7A 1P14A 3CXWA 3ZLSA 3DB6A 5IH6A 4KIKA 2QKRA 2O63A 3HV4A 3JVSA 1ZYJA 2GTNA 3IS5A 3Q04A 5DT0A 3V3VA 4O0SA 2ERKA 4QTAA 4RC3A 4RQKA 4BCPA 4ZLOA 5CEPA 1YW2A 2XKCA 3R73A 3R8VA 3IW5A 3HV3A 5AP2A 4YZ9A 5CAVA 4PX6A 3KULB 4LI5A 4K8AA 3BGZA 3UMXA 2I7QA 1RW8A 4FEVA 1K9AA 1PXIA 4PNIA 4XOYA 3OCSA 4AW2A 5FWKK 3O71A 1R0EA 4F6UA 5J5TA 5J95A 4O0UA 5AA9A 2GFCA 2YEXA 4HVIA 5AADA 4FG8A 3Q5ZA 3LCTA 5AUVA 3AXWA 4E8AA 3R22A 3VUTA 2WD1A 2YA9A 4GYGA 3KK8A 4X6QC 3PIXA 3FXXA 4FEWA 4I41A 3WE8A 3PIZA 2GS2A 4IAAA 3CPBA 3LM0A 2NNWB 1H8FA 2RFNA 2XKFA 2KTYA 3DNEA 4FK6A 3QRKA 4G3CA 4X3JA 4E6QA 5ANDA 1BI8A 3HMPA 3ORMA 1O6YA 5J8IA 4QMTA 2BIKB 3R71A 2Q83A 1Q24A 3UQGA 4FG9A 1E1XA 4EH9A 3SRVB 4A4LA 5CAQA 4P5QA 2BRBA 3O23A 1V0PA 3HUCA 4FSMA 4AN2A 3C5IA 3QHWA 4LQMA 4BI1A 3PJ1A 3AGLA 2W99B 4XUFA 5H3QA 2Y7JA 4B4LA 3PY1A 2GS6A 2XK9A 3A7HA 3DXNA 3FYKX 2PUNA 3UOKA 3RP9A 3MVLA 4RLLA 2QU6A 4X0MA 1H26A 4MNFA 5CY3A 3VW8A 3AT4A 2JDRA 2C3JA 4NKAA 4PMTA 3ZS5A 3WZEA 5BYYA 2J0MB 4WNOA 2EVAA 2WMAA 3GU5A 3NUYA 4NM7A 1G8AA 5LCJA 4RIWA 3C4WA 1O6LA 2YCQA 4RRVA 4EK8A 5C4LA 5HHWA 5L8LA 4OGRA 5EW3A 3ZU7A 5CZIA 4XP3A 5DN3A 4Z9LA 5FDXA 5AV2A 3LHJA 4E4MA 3CKWA 4FIIA 4EH4A 5JSMA 3LIJA 4FSYA 1YOLA 3DV3A 1REJA 1JSVA 1YDTE 3GC7A 1WBPA 2ZB0A 3WOWA 3MJ1A 4U81A 4QP9A 4WSQA 3R1NA 3TNPC 2YWPA 2W5HA 4IEBA 4QYYA 5AR3A 3FMDA 4XG3A 2FSMX 3MS9A 4NTTA 4TWPA 2QONA 3KU2A 4G3GA 3BGQA 3RTPA 5EI6A 4DEDA 4AGWA 4CTBA 2JD5A 5AUZA 3QQGA 3ZFMA 2BZIB 3OCGA 4AT4A 5J9YA 2HZ4A 5GNKA 3UVPA 5KMKA 3VBQA 5ETIA 4XG7A 3KL8A 2GQRA 3U4WA 3O17A 1IASA 4IW0A 1OUKA 1WBOA 3C4FA 2RGPA 4NFNA 3ENHA 2C5YA 1DI8A 4G5PA 3CD3A 4JQ7A 1Y57A 3UOJA 2O65A 2RFDA 4BC6A 3VULA 3MVJA 2W9FB 3PVBA 4AW0A 4MKCA 4FEXA 1H0VA 1OL1A 5DE2A 4GT3A 4QYEA 3CGOA 1P5EA 3Q9YA 4F0IA 4L3PA 4KNBA 4C4EA 4FODA 4BDKA 1R3CA 2BHHA 2FUMA 1JKTA 4GVAA 4XV9A 4BCOA 4KRDA 4YLLA 5CEKA 3AC1A 3ZM9A 4DGOA 4GMYA 2VX0A 4LGGA 4U3YA 4TRLA 3A4PA 5ANKA 4UXLA 3SC1A 3T9IA 4B99A 2EU9A 1Y8GA 3UNZA 4RIXA 2C6DA 3PJ8A 4JBPA 4EC8A 5JFWA 3FLZA 4FICA 3SG9A 1ZWSA 4ZTRA 4O7NA 4EZ7A 4DFZE 3ZSGA 3OF0A 1BL7A 3DB8A 3PSBA 4F09A 2XNOA 1GOLA 2P55A 2R3HA 4IADA 2YJRA 3U54A 4F9CA 3WARA 3ZO3A 3E87A 3FHRA 1IA9A 2UW7A 5DHJA 4JIKA 2BZJA 2GNFA 5D1JA 1R0PA 3ORIA 5HKMA 3RZBA 3TV6A 5K5NA 1M2RA 4LGDA 5H9BA 3NX8A 5LOHA 4W4YA 3MESA 1YDRE 3B8QA 4MD8E 3BYUA 3LMHA 3EQBA 3ORLA 3PVWA 4H3QA 5BQ0A 3GCSA 4BN1A 3UIBA 4RWKA 2O64A 3R30A 2V5QA 2VX1A 3L9PA 1XH4A 4M3QA 5HBEA 3REPA 4Q9ZA 2WEIA 5E8UA 5IA1A 4FYNA 3GOKA 4MCVA 2XUUA 4RJ8A 2CKOA 2XCKA 4X21A 3EN7A 3RPYA 4FT3A 5GIPE 2XK6A 4C34A 4BDAA 2YERA 2WQMA 4YJPA 3UODA 3MB7A 3QTRA 4FTMA 2B0QA 1OL2A 4DTBA 4FIHA 4OBPA 4W9XA 2VTRA 3LPBA 1J7UA 1F3MC 2OH4A 2X8IA 4ANMA 5K4JA 4TWNA 4PMPA 3HV5A 4A9TA 2B9JA 3ALOA 5EM5A 3ZO4A 4FZDB 5KHXA 5EW8A 4E6DA 3MJ2A 3HYHA 2R0UA 3BHUA 3ATTA 2JKOA 2WU6A 4FKSA 3LOKA 5CF8A 1PMVA 2C3LA 4CCUA 5J5SA 5EYKA 4EYJA 3NRMA 4KAOA 3DAKA 3OTUA 3PWDA 4JG8A 4IDVA 4CEGA 1O6KA 4EZ5A 2YWVA 5TR6A 3DK7A 4YTCA 3OY3A 1QPJA 4KKHA 2JKQA 2VGPA 4IVCA 3G51A 2ITXA 4OUCA 5IEVA 5J7HA 1RJBA 2CHLA 4PTEA 1W8CA 5JRSA 1U54B 4USFA 2OFVA 2R3NA 5IUHA 4FV5A 1IAHA 1TKIA 2QHMA 4I6HA 3DAEA 4MWIA 5E92A 5E8TA 5CAUA 3D7TB 3E7VA 3IW7A 1EH4A 4U42A 5IPJA 4MXCA 4O22A 3A7IA 2J6MA 4Z55A 5IF1A 4OTIA 2CNVA 3E92A 1FQ1B 4O96A 3ORZA 2QD9A 3AC8A 2RIOA 4UB7A 3DQXA 5TT7A 4EWHA 5FP5A 2JC6A 3IG7A 4AU8A 5E4HA 3QKKA 2E2BA 4FNXA 5HU9A 5C27A 3M2WA 4YJTA 2VV9A 3UPZA 3DTCA 3VS0A 4C0TA 4UV0A 4ZSLA 4GT4A 2VWZA 4Y85A 4DAWA 1H4LA 3DBQA 5ACBC 4BHNA 4EJNA 4RQVA 4EH5A 5IQHA 4C3RA 4KS7A 1Y91A 3BKBA 2X9FA 1UWJA 3V6SA 3ZSHA 1YXXA 1BI7A 4IAZA 5EG3A 5CU2A 4BZOA 1JLUE 2PK9A 3DJ5A 2O5KA 3OUKA 3QD3A 5FRIA 1PXPA 3R9OA 4M84A 4IC7A 4EYMA 4G3EA 4R1YA 4BTJA 3D5UA 1FGKA 3BE2A 4XRLA 3HDMA 4ALVA 3HECA 4EQCA 2OJIA 4ZZMA 3I79A 2XIXA 4O27B 4CLJA 5B7VA 4J98A 1T46A 3HX4A 3R83A 2HXQA 3GFEA 4F1MA 2PVLA 4LMNA 1JBPE 3I7BA 4Y83A 3GXLA 1ZMVA 1OIUA 2ETMA 4QYGA 3VIDA 4EL9A 4DFNA 2W0JA 3LJ0A 4CKJA 3NYNA 2W4OA 2OWBA 2G2IA 4FK3A 3LW0A 4D55A 1ZLTA 1FBNA 3KXGA 3O8UA 3V5JA 4CFUA 4F6SA 3OEZA 4CNHA 4BYIA 3L9MA 2Y0AA 3CCNA 4IWDA 4RVMA 3HA6A 1RDQE 4ACGA 4N70A 5GJFA 4EK6A 3QQUA 1YWVA 5DG5A 4MF0A 3WYXA 5EKNA 3EQDA 5TE0A 4D9TA 2VO6A 4QMUA 3QWJA 1YRPA 4WRGA 5FG8A 4AE9A 2YIXA 3M42A 4AQCA 2E9OA 5BVNA 4FV0A 5HEZA 3KRRA 3PXZA 3R8PA 4D2PA 5T3QA 2XNBA 4FL2A 3CR0A 1Q62A 5CXZA 1OIRA 4QMPA 3QBNA 4U43A 5H8BA 2ERZE 3IW8A 3R9HA 4NH1A 5DPVA 4E5BA 3FSKA 4LM5A 4ITJA 4L68A 2Z8CA 1HCLA 3F3VA 3NYXA 4XOZA 4ALUA 2WTIA 4WG4A 4F7SA 3L1SA 4FF8A 5A4TA 4CTCA 2PVKA 4R5SA 3VS4A 4BCJA 1JQHA 4LMUA 3SVVA 3FSFA 4F1OA 4BCGA 3Q5IA 3R6XA 3CIKA 4ACHA 4E6CA 2VTTA 3A2CA 3CTJA 4FTUA 4M0YA 3ZBFA 4BTKA 2ITZA 5LVMA 3F5UA 2Z60A 3EFWA 4IM3A 4RX7A 2PMNX 2OO8X 3E64A 3IECA 3QA8A 3QQJA 4S33A 3IKAA 3VVHA 3UNJA 4U40A 4FKVA 4NW6A 4L44A 4XP2A 5J1WA 2WU7A 3OFMA 4X2JA 3RAWA 4YJQA 4F0GA 2OH0E 3W2PA 5DEYA 4RX8A 5GZAA 4MF1A 2BAJA 2IW8A 3FV8A 3WZDA 5ANJA 4V05A 1KE6A 3OOMA 1YDSE 4FV8A 5AV4A 1V0BA 4WNPA 3RPVA 5IH4A 1PKDA 4RFYA 1M2QA 4J8MA 4UEUA 4QTDA 1Y6AA 3VBTA 4WD5A 4FKJA 2Y4PA 3GU7A 3LZBA 3PXKA 4HYSA 1UU9A 4JAIA 5E8VA 4IFGA 3ZLYA 4BYJA 5IUGA 2UZWE 3UTOA 5M4IA 4PMSA 4E20A 2WQNA 5HIBA 5HLWA 3RI1A 2HZ0A 3O7LB 3PRFA 4O7RA 3CEKA 4QMSA 2J2IB 3DLZA 4D58A 4NU1A 3FLWA 5AV0A 3RPSA 1KE8A 2HW7A 2ZM1A 1YI6A 1WVYA 4M15A 4KBCA 4ACMA 4JL9A 3NAYA 4L7SA 4W8DA 4ASXA 3UQCA 4P4CA 3G15A 3D7TA 5TKDA 3GCUA 3TM0A 4MYGA 4U3ZA 5EW9A 3HA8A 4XH6A 1H25A 3EQCA 3W8LA 3C50A 3PG3A 5IZFA 4V04A 4RG0A 2PU8A 3UZPA 3NUXA 3WF8A 5GIOE 3BHTA 2AC3A 1NA7A 3TACA 4FZ6A 3Q6UA 4DGNA 2W4JA 3LAUA 4NKSA 5C8NA 4U0IA 4I5PA 2YCFA 2UZVA 3FI4A 4E5AX 2BTRA 4WUAA 3RPRA 3UQFA 3KF7A 4M0ZA 5DGZA 4C4GA 3CSVA 1MP8A 2XNEA 4ZJIA 4WBOA 4WA9A 4CYIA 1JKKA 3RM7A 5CS6A 2OLCA 2W1DA 2WQOA 2GQSA 3RKBA 4C33A 1W0XC 3W2SA 4DA5A 4D2WA 4C62A 3W1FA 5BYZA 4U79A 4DF3A 1VR2A 5HESA 4O6LA 4QYFA 4KKGA 2J0KA 2XB7A 2LAVA 4AWIA 4F63A 5IEYA 3VHKA 5EHLA 4BFMA 2X6EA 3CJFA 2XYUA 2ESMA 3FLQA 1KOBA 5L2SA 4E5WA 5IKWA 3AC3A 4WO5A 4MQ2A 4ZTLA 1Q3WA 4NM0A 4S32A 4AGDA 5AX9A 1CTPE 3QX2A 5CT7A 5AP4A 1E1VA 2W1CA 3TDVA 3UIXA 3E8EA 4CMUA 2YN8A 4I20A 4L01A 3ZZEA 1PKGA 4AP7A 3DA6A 4JRNA 5AUWA 4HGTA 2F2UA 2B52A 2UW9A 5FTQA 5AAGA 1XBAA 3SKCA 2BCJA 3A8XA 4YLJA 5HNBA 5LJJA 3ANRA 3MI9A 5IQGA 3FY2A 4L67A 5EOLA 1ZY5A 2R3GA 4V0GB 2R3IA 4ZTHA 3SDJA 3NPCA 5IG1A 4UXQA 4F9BA 2VNWA 2BRGA 2RG5A 3FE3A 4G6NA 3R8UA 3SLSA 2XIKA 1PW2A 2ZJWA 5AP3A 4XJ0A 4PL3A 3KB7A 1GJOA 2X39A 3E8DA 4O1PA 3NIEA 5E8SA 5DYJA 4QP1A 1E9HA 2NRUA 2PHKA 3MY0A 4HGEA 5H8EA 4Y8DA 4WUNA 4YTIA 4DT8A 3FUPA 3ORPA 2C68A 4FNWA 4ZY4A 5BVKA 3R8MA 4F7JA 3OBGA 4FV9A 3LLTA 5I9UA 2GNGA 3EQGA 3L8XA 4O7SA 4MXYA 2EWAA 3MH1A 2VWIA 2G15A 4C4HA 4E73A 4WKQA 2ONLA 2CCIA 4RWLA 5D7VA 3RWQA 1YWRA 3F2AA 4DH5A 3DBDA 3F69A 4EH6A 3DBEA 5AP0A 4EOKA 1PMEA 5LMKC 2VO3A 2JIIA 1NT2A 4KIOA 4JNWA 4F08A 1W84A 4QP3A 3UOHA 3HV7A 3O50A 3UPXA 5JGBA 2C0OA 2X7GA 3E3BX 3VJOA 4E4NA 2W9ZB 1UNLA 3IONA 5EM8A 3QC4A 4IH8A 4L43A 4QTBA 5LVPA 4LL5A 4M7IA 4W4WA 3W32A 3R7UA 4NSTA 4FKGA 3QZHA 4IM0A 5FM3A 3QZFA 3MIAA 4Q2AA 4CRLA 4GS6A 2W1GA 4L7FA 3RWPA 2CN8A 5BVEA 3MH3A 2PYWA 4GU6A 2OJ9A 4OTRA 1U5RA 2W5AA 3E5AA 1ZMUA 4ANSA 5AEPA 4O7TA 3HKOA 3EKKA 4W8EA 2BR1A 1R1WA 5EM7A 5AR7A 4PV0A 5I3OA 3K5VA 5GZ9A 1ZARA 3GC8A 3MGYA 2UZLA 3BGPA 4W4XA 5E90A 1S9IA 3VS3A 3GOPA 2PMLX 3DQWA 3F5PA 3L8PA 4AACA 2EUFB 2F9GA 2RG6A 4DE4A 4BZDA 3AT3A 3NVMB 2J4ZA 2NO3A 2PL0A 3BHYA 3FLNC 4DINA 5EYMA 5EQPA 1PXNA 3KCKA 3NSZA 4JQEA 4GL9A 5HG8A 3BV3A 3NW5A 3MFTA 3QL8A 4RIWB 5KCVA 4X3FC 5KNJA 4CGAA 5JMSA 4CMTA 2QG5A 2XJ1A 1UU3A 5AV3A 4E7WA 5CANA 5E1SA 4EOSA 2PVJA 5AIRA 4KD1A 5HLNA 4FA2A 2C6LA 5B2MA 1KE7A 4LRKA 3FL4A 3VRZA 3WF6A 4O0YA 1PXOA 3FWQA 4IC8A 4RJ5A 4EHEA 3A4OX 3BE9A 4FIFA 3DLSA 2WOUA 4TL0A 5BVWA 3SXSA 3E88A 3OXTA 2G9XA 4FV4A 5KBRA 1J3HA 4BF2A 4R77A 2HW6A 4ZEGA 3JXWA 3PPKA 2C1BA 4DFYA 1M17A 4JG7A 5K0XA 2OIDA 4RFZA 4XV2A 3LFEA 2WKMA 3ZFYA 4ZLZA 1DM2A 5JH6A 3NWWA 3QHRA 2OZAB 3BEGA 3CY3A 3Q9XA 1PYXA 3OBJA 4AA4A 3ZUVA 3VS7A 4QTEA 4DH3A 4LL0A 3F82A 2WOTA 2J0IA 4G9CA 3ZO2A 4RJ7A 4HPTE 4CZUA 2C6TA 5HGIA 1ZAOA 4IJ9A 3ZUUA 3EH9A 3QWKA 4IBMA 3EWHA 4I5HA 4JBOA 3UG1A 3D2IA 4YZMA 5A46A 3DXPA 4ZY6A 3LM5A 3RM6A 3FLYA 1WZYA 2Y8OA 5HG5A 5AR2A 4CMOA 3DTWA 3HGKA 2FVDA 4EUUA 4BWPA 4TYIA 2ZAZA 4Y5HA 4V0GA 2YACA 3IDCA 3K2LA 4ZJJA 3UYSA 4FR4A 3CC6A 3BLQA 3KK9A 4FV3A 4QPAA 4FT7A 4JDKA 4F9AA 1XWSA 2FSLX 4JQ8A 2W4KA 4AAAA 2PVNA 3F3TA 5AR8A 4BTMA 4ZOGA 5DFPA 4BDIA 5IH5A 4KSPA 3UE4A 2XK4A 3QRJA 4XYFA 2F7ZE 2WMTA 2CDZA 3FZ1A 2WTKC 4GSBA 4IAFA 3ZSIA 4P2KA 1OM1A 2Y4IB 4G6LA 4JVGA 4ACCA 5CX9A 3R7GA 1FVRA 3P4KA 2VTHA 2WNTA 2QQ7A 4XEYA 4ZTNA 2W5BA 4ZZOA 2CGUA 3FZRA 4XLIA 3IW4A 3F66A 4C2VA 3TEIA 3EIDA 2A19B 1GAGA 3QD4A 4D4SA 3SA0A 1YXTA 1OECA 3UBDA 2JEDA 3DAJA 5CEIA 3TXOA 4R7IA 3QCQA 1RQQA 3BZ3A 5EK7A 5JZJA 2WTJA 3JS2A 4I4EA 4L00A 4ZY5A 1FVVA 4J97A 5J9LA 1Q61A 2C6OA 3Q4UA 5CAOA 3EZVA 4WT6A 3UZRA 3GU4A 3GI3A 3WF7A 4IX5A 1WBVA 1A9UA 5K0KA 4CFFA 5CF6A 5F9EA 5CQWA 3EMGA 4EBWA 3ETAA 3HMMA 2DQ7X 1UNGA 2H9VA 2J5EA 2C6EA 3TNIA 4U5JA 3W2OA 4C59A 3VS6A 2EXCX 4NUSA 3KY2A 1OL5A 4MNEA 5HE0A 4YURA 3A62A 4Q5HA 3ATSA 4BHZA 4RFMA 4RJ6A 3O2MA 3UOLA 5JRQA 3I0QA 2QOQA 3LJ1A 3LJ2A 2XRWA 4YPDA 3V04A 4ZMEA 3LXNA 4PF4A 3TZ9A 4AZFA 2HK5A 2R3MA 5HCZA 4FNYA 4EOMA 4BWXA 2CSNA 5DT4A 1Q3DA 2ITYA 5HOAA 5HBHA 4FTRA 2B54A 4IE9A 3ERKA 2AUHA 1LEZA 4FUXA 3U55A 1H07A 4YZBA 4GRBA 2XJ2A 4YR8A 2PY3A 3CQEA 3OTVA 2RSVA 4BBEA 2PMOX 3AOXA 4MBIA 1MUOA 3EFKA 3EL8A 2FB8A 4FT9A 3I81A 4GIHA 5BUJA 3MTFA 3BLHA 4FTNA 1CKPA 4UMQA 5CVGA 5EI2A 4IB0A 3AD5A 4CXAA 4ITIA 3F3UA 2A1AB 5F94A 5JZNA 5I9VA 3RAHA 2WMSA 2ZOQA 2B53A 4UWCA 3I1AA 3UC3A 1SVHA 3QQKA 2PSQA 4FKIA 5KZ0A 2Z2WA 2C5XA 4FG7A 3ALNA 2QOKA 3EKNA 2PZPA 2GFSA 3QGYA 4M69B 4A9YA 1J91A 2R3OA 3UJGA 3PY0A 4ZTMA 5A6OA 4FI1A 5LQFA 2ITPA 2WMUA 2PUIA 5I3RA 4FVRA 3D5WA 1SMHA 2ITQA 2B7AA 2BIYA 5A4EA 2E9NA 4Q5EA 1TQIA 2QO9A 5I9WA 2DS1A 2QOOA 3KVXA 3E8CA 5EKOA 3E63A 1OIYA 2YIYA 2HELA 2CPKE 4IB5A 4RLKA 2QR7A 4YC3A 1JWHA 1URCA 4YSMA 1S9JA 4FEQA 2VTPA 5FXRA 2XEZA 2OJJA 2VN9A 5GZ8A 3HAVA 1Q5KA 4KSQA 3RVGA 5IDNA 4Y72A 4FKWA 4LV8A 2OZAA 1WBSA 2R9SA 5A54A 4XG4A 5D9HA 3BI6A 3OD6X 5E91A 4CYJA 2WB8A 4I94A 4BDJA 3KC3A 4JT3A 3Q32A 1IR3A 1PMNA 3OT3A 3TJDA 2WQEA 5CSPA 4HVGA 4M8TA 4F7LA 2BILB 3TKHA 2XA4A 2R2PA 2WQBA 5ITAA 4R78A 4FSWA 4ASDA 4C2WA 1UKIA 5J87A 4PPAA 4BL1A 4GK2A 3G0FA 3H0YA 3A7FA 3QF9A 4I22A 5DH3A 5I9YA 5IQCA 2XKEA 3GU8A 3P7BA 3HAMA 4AF3A 3EYHA 4H58A 4FGRA 1F0QA 4FT5A 3DKGA 4OBQA 2SRCA 4Y46A 1XH9A 2CJMA 3K5UA 4J52A 4E3CA 3QCXA 4AOIA 2VTIA 4FIEA 3ROCA 2OJGA 4CFMA 1Y8YA 3T8OA 3R9RA 3D15A 3Q2JA 4IVBA 5BUIA 3ZDUA 5M53A 1APME 1H0WA 5AUXA 5CEOA 2PVHA 3GQIA 5M44A 2FO0A 4ONAA 3OG7A 4BCHA 5HX6A 4NEUA 3OW4A 5B0XA 4QP2A 4X2FA 2Q0BA 4AT5A 3WZUA 2OGVA 4IZYA 5CSWA 5F20A 2YCRA 4EH7A 4JDHA 2W06A 4EZ3A 1Q97A 2XNNA 3FKOA 5F4NA 3JY0A 2HXLA 5CWZA 5HX8A 5DA3A 5DR2A 4XBRA 3IDPA 4LOPA 2IVVA 3BU3A 1WVWA 4X2KA 3RINA 4K18A 3MDYA 3EYGA 4RZWA 1ZXEA 2V22A 4I1ZA 4EWQA 3IDBA 3OC1A 3QTZA 4D9UA 4ZK5A 4KBAA 4FTQA 4GK3A 3GEQA 4GCJA 4O2ZA 5CU3A 4AOTA 2R3RA 3KQ7A 3DU8A 3C51A 3V8WA 4R5YA 4PDSA 1FMKA 1MQ4A 4KABA 3P7CA 3V5TA 4FSUA 4FZFB 4W9WA 3R7EA 3R7IA 5M4UA 2W96B 5JQ5A 2IW9A 4IWOA 4IAIA 3QTWA 3QFVA 1NXKA 3BPRA 2BKZA 2R64A 3PYYA 1XQZA 4IAKA 1IA8A 3HLLA 4M14A 4S31A 3R2BA 3OWKA 4YJNA 1OL6A 1DAYA 2PVRA 5J9ZA 3U4UA 2BPMA 2BAKA 4EEVA 2YAAA 3BU6A 3GCVA 3EFLA 4ZTSA 3TUDA 3NLBA 4QMZA 1UNHA 2HY81 4G31A 3E3PA 2WXVA 4AUAA 1XBBA 3R01A 2BTSA 3A7JA 4FKPA 4L8MA 4TYEA 3VBXA 4HW7A 2R5TA 3KMUA 1H08A 2AYPA 4IZ7A 3WZJA 4D28A 1HOWA 4D1XA 2VAGA 2R3KA 3BYVA 4QO9A 5AV1A 4C4JA 4EQUA 4L45A 2IZRA 1WBWA 4L3LA 4RIYB 2ITOA 4O1OA 1WBTA 2CKQA 4I92A 1U4DA 3K54A 4IFCA 4MBJA 4NM5A 3G2FA 4EJ7A 2XVDA 2VWUA 3CS9A 2XIZA 3GP0A 3LCSA 4D5HA 5HVKA 1GIIA 1SYKA 3FC1X 2JDOA 2BZHB 1AD5A 4NZWB 4RSSA 3KKVA 1WCCA 5CASA 1ATPE 2XEYA 3GVUA 2ZV7A 3S95A 4DLJA 4FTJA 1M7NA 1W83A 4U41A 4CLIA 4M69A 4OR5A 3I4BA 2YFXA 3O96A 3S1HA 2WTDA 3G6GA 4IVAA 4GUEA 3EFJA 1ZY4A 5CAPA 2WTWA 2OKRA 4E4XA 5I4NA 2BAQA 2X81A 4IANA 4KIPA 4K0YA 4L53A 4UN0C 5CTPA 2I0HA 2YLFA 3PJ2A 4K11A 4YBKA 1QL6A 2UUEA 3GQLA 2YCSA 4CRSA 2PPQA 3R9DA 3PG1A 3KXXA 3S0OA 5CI6A 5F95A 3QYWA 5HO7A 3R0TA 2NPQA 4APPA 2CNUA 3CPCA 3HMIA 4O82A 4GJ3A 4LFIA 3V6RA 1SZMA 5LMBA 2C6KA 3ZBXA 5D12A 3KRLA 1Q41A 4UYAA 4Y73A 4BICA 5DOSA 3G90X 1CDKA 2ZVAA 5H8GA 5HG9A 2R3LA 3VBVA 4M12A 2BKKA 4CQGA 4ZLYA 5HE2A 1OL7A 5ETAA 1ZZ2A 2X9EA 2XF0A 3EN5A 4K77A 3PDTA 3DJ6A 5AWMA 3FZPA 5DR6A 2ITNA 3FKLA 4JR3A 1IRKA 4ZSEA 3DBFA 4FUYA 2Y6MA 3DFAA 4XBUA 4YJVA 3WIKA 4EH2A 5CEMA 2OIBA 2IJMA 4KKEA 4O6EA 4DEBA 4EOJA 3PFQA 3DZOA 1W7HA 3CKXA 1BL6A 2WIHA 3MFSA 2OW3A 1OUYA 4NIFA 3FQHA 3PWYA 4I5CA 4MX9A 2HYYA 2WO6A 3F9NA 4H05A 4MHAA 4BCMA 5JFSA 4CVAA 3NNWA 4CSVA 3HNGA 4IAYA 4GKIA 3D9VA 3UNKA 4YJSA 2WTCA 3KMMA 4HCVA 3Q4CA 4OT6A 4PPBA 3ROYA 3DKCA 2QU5A 2IVTA 2PVMA 3T9TA 4IXPA 1L3RE 5JFVA 1A06A 3ZDIA 4OAUC 4XG6A 2XK3A 3VBYA 5KMMA 3S00A 4S34A 2B4SB 3I0OA 4EQMA 5I5ZA 3UYTA 2GHMA 3VF9A 5LVNA 4ZMFA 1AQ1A 2J7TA 3BRBA 1REKA 4YTHA 2GNLA 4J71A 3ZTXA 5A6NA 4AFJA 5FUTA 2W05A 2IZUA 3KRWA 5IQAA 5FDPA 3BYMA 3VUKA 3BCEA 4M97A 4DFXE 4UALA 4U80A 4HCUA 5HE3A 1DI9A 3A7GA 2EB3A 3T3VA 4AOJA 4TYHB 3H4JA 5KX8A 3QQLA 4O7WA 2X2KA 4ITHA 2YM3A 4DTAA 3TCPA 3Q60A 2A0CX 2JAVA 3Q3BA 4FOCA 3FQEA 2E9UA 3LLAA 4NFMA 3MIYA 3LMIA 3S2PA 1M7QA 2J51A 3D5XA 3R1YA 4GYIA 1SVEA 3F61A 1B38A 4HYHA 1OMWA 3C0HA 2Z7LA 2V7OA 4B8LA 2A27A 2VTQA 5E9EA 2W1HA 3N4TA 3UG2A 2GMXA 3NW6A 2JIUA 4FTCA 5L8JA 1AGWA 1ZYSA 4JBQA 4O7VA 2BRHA 5DWRA 1OPLA 2W1ZA 5A9UA 5AM6A 4DYMA 5HO6A 1U5QA 3M11A 4FKRA 2XMYA 3F2RA 3KRJA 3SAYA 5JGAA 4FBXA 2CGVA 3NMUF 3AMAA 4NYEA 1JOWB 3Q4ZA 2FGIA 2HWOA 2BRNA 3IGOA 4RIYA 5AP6A 4DCEA 4WHZA 3BWJA 4QMLA 3UP7A 3DK3A 2WZJA 2GNHA 4CKRA 4ANQA 1H1RA 4M67A 4FOBA 4PNKA 1VEBA 4KINA 2NRYA 2B55A 3FPQA 4UZHA 4X7QA 4NK9A 4B9DA 3PRIA 4EORA 2VNYA 1Y6BA 3PA5A 4EC9A 1PXKA 4QTCA 3MW1A 3P86A 4CZYB 3FC2A 4O0VA 3NYVA 3PSCA 3PJ3A 3P78A 4EH3A 1GZOA 3NCZA 4OTWA 3KGAA 5E1EA 3FI8A 2YZLA 2XJ0A 2VUWA 4O81A 3FAAA 5L6OA 5HTIA 2H6DA 2YIWA 3RPOA 4KB8A 4X2GA 4IM2A 4NT4A 3D0EA 3RMFA 5M55A 2GSFA 4H1JA 2X4ZA 3AGMA 4P5ZA 5IA5A 4ACDA 1UWHA 3LQ8A 5HCYA 5I9ZA 3LMGA 4HNFA 2JKKA 4FKQA 3P1AA 3PXYA 5L2QA 5BVDA 2XYNA 2C69A 5M4CA 1H27A 4RX5A 4PDYA 1YHSA 3HP5A 4FNZA 2YM7A 3CD8A 4GG7A 3BBTB 4JG6A 2C5NA 3K3IA 5KO1A 5L6PA 3RCDA 3NUSA 1CM8A 2QO7A 3AMYA 2FSTX 4IWQA 3W2RA 3ZRKA 4H1MA 3S3IA 1O9UA 5BUEA 4XRJA 4AE6A 2WGJA 2X8DA 2R3QA 5EFQA 3N4UA 1CSNA 4LUEA 2YITA 4YPSA 2I0VA 5AUYA 4YZNA 2ZMDA 1ZYDA 4AA5A 5FP6A 5M09A 1HCKA 5AR5A 4LOQA 4LG4A 3QALE 5HU3A 3CP9A 1H24A 3OXZA 4TWOA 4TYGA 4O7YA 1H1PA 3EHAA 2PE2A 2QI8A 3PTGA 3ACJA 4TNBA 4D1ZA 1CKJA 5CSVA 4G17A 3ZUTA 2YM6A 1KV1A 4NCTC 4ZSAA 3GUBA 1VZOA 3PLAE 5FEEA 3R1QA 3BV2A 3OS3A 3MSSA 3JUHA 5FD2A 5FEDA 2I1MA 4IJPA 4MTAA 4CT1A 4LOOA 4C61A 5IQDA 3VAPA 3F6XA 4DEEA 4ORKA 1GZKA 2X8EA 1Z9XA 2IW6A 2V7AA 3OWLA 2BFYA 1I44A 4BVUA 4EKLA 4FV6A 2HZIA 3FPMA 4I0RA 2OIQA 3C4EA 2WMVA 4DBNA 3TG1A 2GNJA 3PY3A 2F57A 3ORNA 2VD5A 3ZO1A 4AN3A 3B2TA 2VX3A 3ITZA 5KKRB 2YZAA 3VWAA 4EUTA 4V01A 3WE4A 2PMIA 4LV5A 4QMYA 4PTCA 2H96A 5A14A 2YABA 4TYHA 5I0BA 1OKWA 3COMA 1OKZA 2O8YA 5B2KA 3SV0A 1GNGA 4FV2A 1ERKA 2C3KA 2J9MA 3HL7A 5L4QA 5M08A 4JDIA 3UO5A 3HZTA 3JVRA 4GG5A 1UV5A 4WRSA 2RFEA 5E8ZA 5HICA 5DT3A 4HVSA 5GINE 2ZV2A 4RVLA 2PZIA 5HG7A 1OITA 1VJYA 1NY3A 2P4IA 3HV6A 4K33A 5E8WA 4EHGA 2WFYA 3WI6A 4O86A 5KMJA 1IAJA 3ACKA 3PIYA 2PUUA 3AD4A 4LRMA 4ANNA 1XJDA 2O0UA 5GHVA 4XP0A 1MRYA 3AMBA 3GU6A 1Q8TA 4IQ6A 2PE0A 1T45A 4JDJA 3V01A 3VS5A 2CNQA 3KCFA 4R3CA 3MPTA 4OLIA 1STCE 4AS0A 3EQIA 3MV5A 4GVJA 2C0TA 3MB6A 4Z7GA 5M06A 2Y9QA 2HY0A 4A07A 3AG9A 4QMNA 1ZMWA 5IQBA 4YZDA 3Q2MA 4PPCA 2JKMA 1XH6A 2QNJA 3GNIB 3LFAA 4OT5A 5ANIA 2OZOA 5TF9A 4BCNA 2C5OA 5BX0A 2BDFA 4FIGA 2CGWA 4Y95A 1OGUA 4MNEB 2GNIA 2J5FA 4WG5A 4LRJA 3H30A 4C36A 5AM7A 1YXUA 1XH7A 4MXOA 4FTLA 1J1CA 4FYOA 3WILA 4EKKA 4YO4A 2ETKA 3FLSA 3WF5A 4BCKA 4BWKA 2QOCA 4C4IA 5FTGA 3H9OA 4GW8A 3TT0A 3ET7A 2XP2A 3F7ZA 1IEPA 4FSZA 4R3RA 5HNGA 5B2LA 3HDNA 3U51A 4HYUA 1SVGA 2G1TA 3Q96A 4HOKA 5M56A 2R7IA 5A3XA 1H1QA 3RHXA 2YIRA 3MA3A 5ACKA 4D2SA 2QOBA 4A7CA 3EQRA 3ZONA 2UVXA 3PE1A 3NZ0A 1OKYA 2XNMA 3DCVA 2XH5A 4PL4A 2BUJA 4A4XA 1URWA 2QCSA 3KREA 3E8NA 2ZMCA 2I40A 3EN4A 5AP7A 3QD0A 4FVQA 4HJOA 3EB0A 1YKRA 2X0GA 3E62A 4PY1A 3VHEA 4B6LA 5AA8A 3SW4A 3NUNA 2VWYA 3TZ8A 5L6WL 1TQMA 1FPUA 1H01A 4P90A 4X3FB 5IA2A 1VYZA 4QQJA 5BMSA 5C8KA 5HIEA 4G6OA 4QMOA 5E8YA 3PPJA 3KXNA 3QCYA 5CENA 4YMJA 4S2ZA 2H8HA 3QTQA 3RAKA 5HORA 3FI3A 3ZEWA 2BROA 3TDWA 3R04A 4UMUA 5TO8A 5A4QA 5C01A 3FQSA 4YHFA 4CKIA 1H1WA 1ND4A 5HZNA 4MD9E 1QPCA 1ZOEA 2XIRA 3AC2A 3EQHA 3PUPA 4FT0A 2OFUA 3OOGA 4KIQA 4ZP5A 4BZNA 5I9XA 4ZS4A 3FMHA 5CZHA 3NYOA 4F65A 1R78A 1JPAA 3DFCB 3OW3A 2J90A 1I09A 4RMZA 3D2KA 3IOPA 3L9LA 1ZOHA 3PSDA 3VC4A 4BDGA 1XHAA 4CZTA 2CLXA 2B9IA 5FXQA 2HOGA 5AAFA 4UMTA 4IB3A 3KXMA 4EK4A 3LFCA 1BLXA 2OXYA 4U97A 4H36A 3Q9ZA 3MVMA 3TL8A 1GIHA 3OP5A 4PP7A 4RC4A 1PMUA 3B2WA 4PRJA 4RWIA 4FTIA 4TT7A 2IWIA 3R1SA 4J95A 5CU6A 3P7AA 4G9RA 4GEOA 3SHEA 4O2PA 5JK3A 5IMXA 5A4CA 4A06A 4KBKA 2C4GA 4I3ZA 4FSRA 4YGAA 5CLPA 5EM6A 2P2IA 3OHTA 4AX8A 4QP7A 2VTMA 4MH7A 1MQBA 5JQ8A 4ERWA 4C7TA 1CKIA 4JJRA 2QURA 4WG3A 2UZEA 2JIVA 2PZYA 3ANQA 4XG9A 4L6QA 1W82A 3AQVA 3C7QA 3COIA 3OEFX 2BVAA 4PTGA 3RGFA 4YO6A 5ETFA 3ZOSA 1Z5MA 5FBNC 1PXLA 2UW8A 3H9FA 4O38A 2VTAA 2WTKB 5ANGA 3C13A 3NVKI 4DG3E 4ALWA 3ZRMA 2YDJA 3BU5A 3QTIA 4TY1A 5LMAA 3V5PA 4B0GA 1PY5A 3LQ5A 4R1VA 3FMKA 4YP8A 2WPAA 4BGQA 5J7BA 4UY9A 3W55A 3EL7A 2IVUA 4KWPA 4DITA 3P08A 5FTOA 3THBA 3CQUA 4F99A 1KWPA 4H3PA 1PJKA 4QMXA 1QPDA 1PF8A 2UZOA 3ZZWA 2OJFE 3ZHPC 3V51A 3DBCA 1OZ1A 1ZYLA 5LMKA 2C47A 4BDDA 4I6BA 2O2UA 3R9NA 2C5VA 2HAKA 2J0LA 3G9NA 5BMMA 3LE6A 2FSOX 2QLUA 4FKOA 4F0FA 4JI9A 2XNGA 4N0SA 4O0WA 2AC5A 2ITUA 2VO7A 1WFCA 3TJCA 3II5A 2GHGA 3O8PA 4OTDA 4UWBA 2JFLA 4CV9A 4D2TA 4BGHA 5HI2A 4L42A 4YZCA 4BKYA 4OTFA 3ZLWA 5CU0A 3TNHA 5IMEA 5CSHA 4RGJA 4CFWA 2ZB1A 4NTSA 4YBJA 1OPKA 1XKKA 1FMOE 3GCQA 2C30A 4O21A 2G2HA 3QTSA 4E26A 4O7LA 4IVDA 3ZCLA 3IPHA 1MRUA 1YHWA 1FGIA 3WIGA 2P33A 4EHVA 2WEVA 3KXHA 3FMEA 3UIUA 1P4FA 3CBLA 4JIAA 4NL0A 3I6WA 2WMQA 2QC6A 2W1EA 3Q9WA 4FTAA 2JDVA 3IQ7A 4U44A 5T68A 3SG8A 4QMMA 3FXWA 3PP1A 1YXVA 1OBGA 3QTXA 5KMLA 2C0IA 1J7LA 3O8TA 3LXKA 4FKLA 4A9SA 3KN5A 4MXZA 4A9UA 3IOKA 3W8QA 2X7FA 4MAOA 5EQYA 5M51A 4MK0A 3C9WA 2JBPA 4N4SA 4C4FA 4DTKA 5K9IA 3GT8A 3G33A 3QQHA 3UDBA 2P3GX 4CFVA 3MYGA 4YNOA 4RVKA 3OXIA 3U9NA 4IX4A 1KOAA 5DNRA 4IX6A 3RALA 3CE3A 4F70A 5CYIA 5E7RA 4XS2A 1KSWA 2ITWA 1W98A 3EOCA 5IISA 4ENYA 3PVGA 4YSJA 5FBOA 4X3FA 4GIIA 1QPEA 2UW5A 3PPZA 4C35A 4FSNA 2W1IA 5DR9A 3VQHA 5HQ0A 3FY0A 4EK3A 5CALA 4AG8A 5G6VA 1LEWA 1RE8A 1ZOGA 2WIPA 4FTOA 3O7LD 4MXXA 4XMOA 5IDPA 4DGLC 3WYYA 4XCUA 1K3AA 2PZRA 4NJDA 1YXSA 3Q52A 1YHVA 4GFOA 4AW1A 4I6QA 3C5UA 5CF5A 3NUAA 2UZNA 3IGGA 3MA6A 4JAJA 3PVUA 5EYDA 3ZYAA 4D4VA 3QRTA 5CQUA 3VUIA 4F64A 4NW5A 4UMRA 5JGDA 3SGCA 2EB2A 2G01A 3FI2A 4YU2A 3DS6A 2Z02A 4PDOA 3FKNA 3G9LX 4L52A 4HYIA 4KS8A 3R21A 3UMWA 4BBMA 4DFBA 5M4FA 5KMOA 2QR8A 1UU7A 2XRUA 2GHLA 5LCKA 5HBJA 5L8KA 4BDHA 4QRCA 5ANEA 4FL1A 3AT2A 3QD2B 3ZRLA 3Q6WA 3K3JA 5AMNA 1H1SA 2UZUE 3BELA 3VJNA 1NVRA 4G3DA 1BMKA 3U6IA 1R39A 3F2NA 4HGLA 3HEGA 3CQWA 4BCQA 5EDPA 3EQFA 4TZRA 4NIFB 1UKHA 3D4QA 3TUCA 1X8BA 3HMOA 2OU7A 3QXPA 2VZ6A 3LVPA 2WMXA 5J79A 2EXEA 4KRCA 4MEDA 4PDPA 2F2CB 2OF2A 5DEWA 2VTLA 2YAKA 1KUTA 4W4VA 2PULA 2WTVA 3F88A 5L2WA 3PLSA 4E4LA 4RIOA 4JOAA 3COHA 1KE5A 1NVSA 1V1KA 1BKXA 2B1PA 2Z7RA 3D94A 3LFNA 4LUDA 2F49A 3R02A 4GU9A 2J50A 4Q9SA 3BX5A 4TPTA 3QLGA 3V8SA 3QXOA 3LKMA 5CNOA 5C4KA 2IG7A 3P5KA 4NJ3A 4XV3A 3RNIA 4K2RA 1OB3A 5JN2A 1YOMA 4QMVA 2XM8A 2OXXA 4G5JA 4D0XA 4IB1A 3SW7A 1JVPP 4HZSA 1DAWA 5EI8A 1XH5A 4UZDA 4F6WA 3VQUA 4CCBA 4DH7A 4D5KA 2R3JA 3FMNA 2JFMA 4RPVA 4MXAA 3D7ZA 4LGHA 4BB4A 4CQEA 5L2TA 2YIQA 5BPYA 4J53A 4JRVA 2X4FA 2UZDA 3MPMA 4C58A 2O3PA 5IU2A 3HVCA 3KMWA 3OVVA 4AFEA 5C1QB 3DXQA 4FL3A 2GQGA 2GCDA 4I93A 3W2CA 3HRCA 3FMMA 4U7ZA 3A8WA 3MFRA 1Q8WA 4B7TA 4FIJA 3RBWA 5HTBA 3BBWA 5CXHA 3MH0A 2ZDUA 3IO7A 4LYNA 3ZEPA 3N51A 4DEHA 1NW1A 3KULA 4AZSA 3FZSA 3NNXA 3F5XA 3JY9A 4C57A 4A4OA 5G1XA 3POOA 4DN5A 4MWHA 3R63A 3N9XA 5HO8A 2A2AA 1MRVA 2VWXA 4EOOA 3LXPA 5AP1A 2LGCA 2Z7QA 4TWCA 3G5DA 4ZJVA 4J99A 4I6FA 5D7AA 2JBOA 1P4OA 5EQEA 5FGKA 5LVLA 1GIJA 3A61A 1WBNA 2H34A 1FVTA 4RZVA 4I4FA 5DBXA 3HRFA 2JAMA 4EOPA 5BNJA 4YC8A 3TI1A 3FEGA 4O0TA 2WELA 1PRYA 3SXFA 4O91A 3DDPA 2E9PA 1WMKA 3BYOA 2VU3A 3I5NA 3OUNB 2W7XA 3QTUA 3VNTA 3KXZA 3TZ7A 3KF4A 1JKLA 2OXDA 3NR9A 4ANOA 4PP9A 3D14A 4DH8A 3SRVA 5CF4A 4IDTA 1OVEA 3TWJA 4D0WA 3GFWA 3C0GA 2HCKA 3DT1A 3TZMA 3MBLA 3C0IA 4OBOA 2JLDA 3ID6C 1KE9A 4O84A 4FVPA 1P2AA 5HE1A 1J1BA 4QP6A 5AR4A 5C03A 4CG9A 2PE1A 3ELJA 4IMYA 4BI2A 2JGZA 2YLEA 4J7BA 3R7OA 3MN3A 4Z16A 2CKEA 3CY2A 3I7CA 5F1ZA 1G5SA 2WMRA 3ORKA 1ZYCA 2VTNA 1V0OA 4M66A 3I60A 5A4LA 2ZV9A 3NUUA 4DEIA 2QOIA 3D83A 3AC4A 4RWJA 3SX9A 4XNEA 2HWPA 2IO6A 4R3PA 3V5WA 2YM8A 4OW8A 4M13A 3LCOA 4AZEA 3U8WA 4TYJA 4CFXA 4Y5QA 3VUMA 3LFBA 5DMZA 2J0JA 4GV1A 4UMPA 4UBAA 1H28A 3FMJA 4XG8A 4G34A 3RK7A 1H00A 5EYCA 4E93A 1L8TA 5KMIA 2ZYBA 4IZAA 2YM4A 3QZIA 1U59A 4Z3VA 3ZXTA 4CFNA 5C8MA 3W10A 4OTGA 4I21A 3LFFA 3TTIA 5JFXA 4AGCA 3PXFA 3QAME 4HPUE 5JEBA 3FXZA 4YNEA 4F9WA 4EHZA 4HZRA 3BWFA 3DKOA 1YQJA 1B6CB 3RCJA 4NWMA 3QKMA 2X7OA 4BCIA 4EOIA 5DVRA 1A48A 4TNDA 2CKPA 5IA3A 1B39A 3DKFA 2OICA 5HVJA 4UX9A 5DRDA 3U87A 4ARKA 4ANLA 2BMCA 5DRBA 3VN9A 1LUFA 3A60A 4JX7A 3R00A 2C6MA 4O83A 2P2HA 2QODA 3OZ6A 3P79A 4BI0A 4BTFA 4DGGA 1GY3A 3E7OA 4UYNA 2UW3A 4BDFA 2XNPA 2XK8A 5K5XA 2FYSA 1XH8A 3LFSA 4EK5A 4C8BA 5M57A 2HIWA 2E9VA 3EZRA 3TN8A 3PA3A 4QP4A 3BEAA 3RK5A 4AZWA 1SM2A 5IA4A 3Q4TA 4HCTA 1JSUA 1XR1A 2GS7A 4J96A 4BRXA 3W33A 5ANOA 4U45A 5HD4A 4X2NA 4N57A 4BIBA 2PZ5A 5K4IA 2JDSA 4ERKA 2HZNA 4FZAB 3TNQB 4YTFA 2NP8A 3CGFA 3G6HA 4XV1A 3FJQE 5AUTA 4CD0A 4DEAA 3DY7A 2VGOA 4AZTA 4BIEA 4QQTA 2WMWA 5GJGA 2I6LA 2CCHA 3BQRA 5EDQA 3VRYA 4BCFA 3R7VA 5KMNA 4FEUA 2VWWA 3ZM4A 3JYAA 2FH9A 3UIMA 4HNIA 3ENMA 1YOJA 2W17A 2ZV8A 4O0RA 3R7YA 4JS8A 4RT7A 5LWNA 2VRXA 2HENA 4G2FA 4RJ4A 3TV7A 3NGAA 3OCBA 3ZC6A 1IG1A 4ZZNA 1M52A 1Z57A 2ETRA 3NCGA 4G16A 3DK6A 5EDRA 2ONLC 2I0EA 5IUIA 4R7BA 2YDKA 4RA5A 2X2MA 1FINA 4D1SA 4KUJA 5M07A 4UWYA 5FEQA 2JITA 2ZM3A 5AJQA 3R2YA 5CNNA 5TOZA 1JSTA 2OK1A 5EHYA 1PYEA 2C6IA 3BYSA 4MBLA 4FSTA 4ZTQA 4CT2A 4DLIA 3H10A 4QP8A 2GTMA 4IACA 4PQNA 5AUUA 3W2QA 4U6RA 5AP5A 4JLCA 3GENA 3RAIA 4USDA 5KUPA 4AT3A 2R0IA 4C3PA 2DWBA 4D4RA 2F7EE 3MWUA 4DEGA 4QQCA 3QLFA 1UU8A 4TXCA 3U6HA 5FXSA 4R6VA 2QOLA 2BHEA 2XKDA 4YUQA 4NM3A 2IVSA 3LCKA 3NS9A 4JR7A 2UW0A 4FC0A 4AZVA 3MVHA 4I0TA 4OTHA 5CI7A 3QQFA 4U8ZA 1UA2A 4U9AA 1ZZLA 3NDMA 4QPSA 4FMQA 4WIHA 4E6AA 4BKZA 4OAVB 5ETCA 3ZMMA 3HP2A 4H39A 4I0SA 3L8SA 1U54A 5EOBA 1PXMA 1CMKE 3R8LA 2UVYA 1GZ8A 3VW6A 1PXJA 3V5QA 2X1NA 3EQPA 2RF9A 1G3NA 3PP0A 5D11A 3TNWA 3DNDA 4O0XA 4FKUA 2CMWA 5CVHA 2Q0NA 4AW5A 4TN6A 3TUBA 2XK7A 3R8ZA 2F7XE 4PMMA 4HVDA 3GCPA 1YWNA 2I0YA 4FTKA 1G8SA 4II5A 1VYWA 2JDTA 3ORXA 4ZXTA 4AGUA 4C02A 5JKGA 2UZBA 3RHKA 5AX3A 3UP2A 3OMVA 4FZ7A 3PA4A 4C3FA 2YHVA 3AD6A 3EN9A 1FOTA 3KRXA 3QUPA 5IQFA 2WHBA 4HGSA 3DPKA 3UZTA 3FHIA 2XZSA 3F3WA 5EH0A 3VUGA 2A4LA 3UC4A 3VO3A 4K1BA 4BGGA 1YVJA 4JX3A 4EI4A 4QOXA 4M68A 3TKIA 2UVZA 3M1SA 3I6UA 3ODZX 4RA4A 2QOHA 3ZFXA 4FGBA 2BALA 5AIKA 2OI4X 5CU4A 4G3FA 3H3CA 4QD6A 4RVTA 4QQ5A 3PE2A 4J8NA 1DS5A 2DYLA 4IHPA 4OTQA 2BRMA 2ITVA 3Q53A 4L46A 3BHVA 3BIZA 3BQCA 3MH2A 4IZ5A 2BDJA
chains in the Genus database with same CATH superfamily
3QC9A 4USEA 2BFXA 2YJSA 3V8TA 2V0DA 2VO0A 4ZAUA 5HTCA 3LXLA 4I5MA 5DIAA 2XBAA 3P0MA 4MVFA 4A9RA 3R28A 3C4XA 3VS1A 2QOFA 3TV4A 5BYLA 4WNMA 2BZKB 1F5QA 3TKUA 4X6RA 3PXRA 3CLYA 3H0ZA 2OG8A 4QMWA 3JR1A 4S30A 2GDOA 4E1ZA 1Q99A 4OTPA 4GUBA 4XX9A 4CV8A 4WBBB 2V62A 1YI4A 1KV2A 2YDIA 4EOLA 4ZS0A 5CVFA 2IPXA 4DGMA 5JT2A 5LARA 4F7NA 2IZSA 3ZXZA 4N6ZA 5KZIA 1UVRA 2DUVA 5EHOA 2GPHA 1LP4A 5HCXA 3EN6A 3GB2A 3KVWA 4RJ3A 1YI3A 1JNKA 2YISA 3A99A 5K3YA 3H9RA 3VF8A 4C37A 2BDWA 3MY5A 3EJ1A 4BIDA 5DLSA 5IA0A 1BUHA 4DBXA 4GFMA 3CTHA 2PVFA 5D10A 3V5LA 3IW6A 4PL5A 3E93A 3OCTA 4WOVA 4GKHA 2WAJA 4PWNA 1U46A 3ULIA 3QGWA 3TIZA 4FSQA 3W0MA 4HVHA 3OWPA 3UGCA 3UO6A 3RNYA 3F3ZA 5CEQA 4IIRA 2P0CA 4RBLA 3DGKA 4K6ZA 2XBJA 4ZSJA 5HLPA 4B8MA 3HMNA 3UVQA 4F9YA 4R7HA 4RX9A 4AQKA 2CLQA 2UW4A 3ORTA 4BDBA 1WAKA 2XS0A 3MY1A 4KIKB 1OIQA 4O4FA 4APCA 3KEXA 5KHWA 3P9JA 3MPAA 3C4CA 3W18A 4AXAA 3QA0A 5HNIX 4YC6A 4DCAA 4YJOA 3GC9A 5CSXA 4Z7HA 3U9CA 2QLQA 4DH1A 5IEXA 4IX3A 4ID7A 4YJUA 3O51A 3VBWA 2RKUA 4ZIMA 1OKVA 2IZTA 5C9CA 2R3FA 2X2LA 3NUPA 3ULZA 4DHFA 4DT9A 4GJ2A 2IF8A 4FE2A 3D5VA 3QKLA 4ZSGA 3P23A 1LR4A 3WBLA 3NEWA 3FDNA 2CN5A 3LCDA 1ST4A 2GU8A 4F4PA 5LWMA 5KBQA 4J1RA 2XIYA 3BLRA 4MD7E 5LVOA 5DI1A 3CJGA 4JBVA 2B9FA 3DOGA 4IWPA 3ZC5A 2PWLA 2Y6OA 1Q8YA 3QUDA 4G1WA 3MFUA 2EXMA 4QNAA 3POZA 5FM2A 4C38A 4GH2A 5BVOA 3WF9A 4DFUA 3G0EA 4DHJA 2IN6A 2VTSA 2OF4A 3W16A 5HVYA 5BVFA 1QCFA 5KE0A 3TMOA 3FL5A 2C1AA 5FQDC 2NYAA 3QX4A 3UVRA 3VUHA 3FZOA 3BLAA 3TIYA 3LFDA 1BX6A 3F7WA 3VUDA 2PVYA 3JPVA 3PZEA 4FV7A 2ZDTA 4BKJA 4I24A 2X6DA 2CGXA 4WSYA 3C1XA 3GGFA 3OY1A 1ZRZA 4QPMA 3VS2A 4AA0A 3FZTA 4FKTA 2QKWB 5AFVA 4KA3A 2R3PA 4AXCA 5IQEA 1OBDA 4D4YA 5ICPA 4DC2A 4RC2A 3HRBA 4P7EA 2QVSE 2PUPA 1Q8UA 1Q4LA 1K2PA 3C4ZA 4K9YA 3L9NA 3RZFA 4MQ1A 3QU0A 2W1FA 5L2IA 3NFGB 4DG2E 3QRIA 4BY9E 3B8RA 4QNYA 3WZKA 3NNVA 2F4JA 4GK4A 3UO4A 3N4VA 4BJJA 3L8VA 2FA2A 1JAMA 2KULA 4WNKA 3DJ7A 4EBVA 3SQQA 1XO2B 4YJRA 3F5GA 3LFQA 2XCHA 4FTTA 2QG7A 1OI9A 4YLKA 4TW9A 3DZQA 3GC0A 4L9IA 3O0GA 3KFAA 2PTKA 2VWBA 1NVQA 4FV1A 5H2UA 4EOQA 1TQPA 5LXMA 3FMLA 3SOAA 4TTHB 4NCTA 2RFSA 3NIZA 4ASZA 5CT0A 3TTJA 2VWVA 4YHJA 2UW6A 3S4QA 4XLVA 3T3UA 4EH8A 1QMZA 1WVXA 2QHNA 2UV2A 4QMQA 1SNUA 3FBVA 3PJCA 1Q8ZA 2YM5A 4GT5A 4BBFA 3ZLXA 4GFGA 4DFLA 3DDQA 2G2FA 5GJDA 3SD0A 3HUBA 4EONA 4YHTA 3OROA 3KA0A 3CTQA 3QCSA 5L3AA 4BDCA 4DG0E 3RJCA 3SOCA 4L3JA 3FYJX 3IK3A 3LQ3A 3PZHA 1GZNA 5HIDA 5D41A 5AAEA 1PHKA 3U6JA 4BR3A 2Z7SA 2VTJA 4O7ZA 1JKSA 2R7BA 2ITTA 2UZTA 2REIA 1OPJA 2ZM4A 4TKSA 2B9HA 3KN6A 4ASEA 1SNXA 2C3IB 4QT1A 4D2RA 3BHHA 1LPUA 3GBZA 4D2VA 4XG2A 4XHKB 5FLFA 4BDEA 2RL5A 3COKA 5KKRC 2ACXA 4I23A 1M14A 2WMBA 1TVOA 5T6KA 2V55A 3ODYX 3OT8A 3QRUA 2QO2A 2Y4IC 4H3BA 3QUEA 4ENXA 4PUZA 4CG8A 4ANBA 3NNUA 4AN9A 3QYZA 2OSCA 3MTLA 1BYGA 4FX3A 3PXQA 4QYHA 4F1TA 2OBJA 4R8QA 5HD7A 2XM9A 2VTOA 4RIXB 1J7IA 1M2PA 3NAXA 3QZGA 3ZH8A 3AC5A 4JXFA 3RK9A 4N6YA 3I5ZA 5IQIA 5E8XA 5C26A 2R4BA 5J1VA 3OWJA 3SXRA 1XBCA 3NW7A 1P14A 3CXWA 3ZLSA 3DB6A 5IH6A 4KIKA 2QKRA 2O63A 3HV4A 3JVSA 1ZYJA 2GTNA 3IS5A 3Q04A 5DT0A 3V3VA 4O0SA 2ERKA 4QTAA 4RC3A 4RQKA 4BCPA 4ZLOA 5CEPA 1YW2A 2XKCA 3R73A 3R8VA 3IW5A 3HV3A 5AP2A 4YZ9A 5CAVA 4PX6A 3KULB 4LI5A 4K8AA 3BGZA 3UMXA 2I7QA 1RW8A 4FEVA 1K9AA 1PXIA 4PNIA 4XOYA 3OCSA 2ZFYA 4AW2A 5FWKK 3O71A 1R0EA 4F6UA 5J5TA 5J95A 4O0UA 5AA9A 2GFCA 2YEXA 4HVIA 5AADA 4FG8A 3Q5ZA 3LCTA 5AUVA 3AXWA 4E8AA 3R22A 3VUTA 2WD1A 2YA9A 4GYGA 3KK8A 4X6QC 3PIXA 3FXXA 4FEWA 4I41A 3WE8A 3PIZA 2GS2A 4IAAA 3CPBA 3LM0A 2NNWB 1H8FA 2RFNA 2XKFA 2KTYA 3DNEA 4FK6A 3QRKA 4G3CA 4X3JA 4E6QA 5ANDA 1BI8A 3HMPA 3ORMA 1O6YA 5J8IA 4QMTA 2BIKB 3R71A 2Q83A 1Q24A 3UQGA 4FG9A 1E1XA 4EH9A 3SRVB 4A4LA 5CAQA 4P5QA 2BRBA 3O23A 1V0PA 3HUCA 4FSMA 4AN2A 3C5IA 3QHWA 4LQMA 4BI1A 3PJ1A 3AGLA 2W99B 4XUFA 5H3QA 2Y7JA 4B4LA 3PY1A 2GS6A 2XK9A 3A7HA 3DXNA 3FYKX 4O4EA 2PUNA 3UOKA 3RP9A 3MVLA 4RLLA 2QU6A 4X0MA 1H26A 2XARA 4MNFA 5CY3A 3VW8A 3AT4A 2JDRA 2C3JA 4NKAA 4PMTA 3ZS5A 3WZEA 5BYYA 2J0MB 4WNOA 2EVAA 2WMAA 3GU5A 3NUYA 4NM7A 1G8AA 5LCJA 4RIWA 3C4WA 1O6LA 2YCQA 4RRVA 4EK8A 5C4LA 5HHWA 5L8LA 4OGRA 5EW3A 3ZU7A 5CZIA 4XP3A 5DN3A 4Z9LA 5FDXA 5AV2A 3LHJA 4E4MA 3CKWA 4FIIA 4EH4A 5JSMA 3LIJA 4FSYA 1YOLA 3DV3A 1REJA 1JSVA 1YDTE 3GC7A 1WBPA 2ZB0A 3WOWA 3MJ1A 4U81A 4QP9A 4WSQA 3R1NA 3TNPC 2YWPA 2W5HA 4IEBA 4QYYA 5AR3A 3FMDA 4XG3A 3UDTA 2FSMX 3MS9A 4NTTA 4TWPA 2QONA 3KU2A 4G3GA 3BGQA 3RTPA 5EI6A 4DEDA 4AGWA 4QEBA 4CTBA 2JD5A 5AUZA 3QQGA 3ZFMA 2BZIB 3OCGA 4AT4A 5J9YA 2HZ4A 5GNKA 3UVPA 5KMKA 3VBQA 5ETIA 4XG7A 3KL8A 2GQRA 3U4WA 3O17A 1IASA 4IW0A 1OUKA 1WBOA 3C4FA 2RGPA 4NFNA 3ENHA 2C5YA 1DI8A 4G5PA 3CD3A 4JQ7A 1Y57A 3UOJA 2O65A 2RFDA 1OGYA 4BC6A 3VULA 3MVJA 2W9FB 3PVBA 4AW0A 4MKCA 3P5JC 1H0VA 4FEXA 1OL1A 5DE2A 4GT3A 4QYEA 3CGOA 1P5EA 3Q9YA 4F0IA 4L3PA 4KNBA 4C4EA 4FODA 4BDKA 1R3CA 2BHHA 2FUMA 1JKTA 4GVAA 4XV9A 4BCOA 4KRDA 4YLLA 5CEKA 3AC1A 3ZM9A 4DGOA 4GMYA 2VX0A 4LGGA 4U3YA 4TRLA 3A4PA 5ANKA 4UXLA 3SC1A 3T9IA 4B99A 2EU9A 1Y8GA 3UNZA 4RIXA 2C6DA 3PJ8A 4JBPA 4EC8A 5JFWA 3FLZA 4FICA 3SG9A 1ZWSA 4ZTRA 4O7NA 4EZ7A 4DFZE 3ZSGA 3OF0A 1BL7A 3DB8A 3PSBA 4F09A 2XNOA 1GOLA 2P55A 2R3HA 4O4DA 4IADA 2YJRA 3U54A 4F9CA 3WARA 3ZO3A 3E87A 3FHRA 1IA9A 2UW7A 5DHJA 4JIKA 2BZJA 3BL7A 2GNFA 5D1JA 1R0PA 3ORIA 5HKMA 3RZBA 3TV6A 5K5NA 1M2RA 4LGDA 5H9BA 3NX8A 5LOHA 4W4YA 3MESA 1YDRE 3B8QA 4MD8E 3BYUA 3LMHA 3EQBA 3ORLA 3PVWA 4H3QA 5BQ0A 3GCSA 4BN1A 3UIBA 4RWKA 2O64A 3R30A 2V5QA 2VX1A 3L9PA 1XH4A 4M3QA 5HBEA 3REPA 4Q9ZA 2WEIA 5E8UA 5IA1A 4FYNA 3GOKA 4MCVA 2XUUA 4RJ8A 2CKOA 2XCKA 4X21A 3EN7A 3RPYA 4FT3A 5GIPE 2XK6A 4C34A 4BDAA 2YERA 2WQMA 4YJPA 3UODA 3MB7A 3QTRA 4FTMA 2B0QA 1OL2A 4DTBA 1W2DA 4FIHA 4OBPA 4W9XA 2VTRA 3LPBA 1J7UA 1F3MC 2OH4A 2X8IA 4ANMA 5K4JA 4TWNA 4PMPA 3HV5A 4A9TA 2B9JA 3ALOA 5EM5A 3ZO4A 4FZDB 5KHXA 5EW8A 4E6DA 3MJ2A 3HYHA 2R0UA 3BHUA 3ATTA 2JKOA 2WU6A 4FKSA 3LOKA 5CF8A 1PMVA 2C3LA 4CCUA 3TYKA 5J5SA 5EYKA 4EYJA 3NRMA 4KAOA 3DAKA 3OTUA 3PWDA 4JG8A 4IDVA 4CEGA 1O6KA 4EZ5A 2YWVA 5TR6A 3DK7A 4YTCA 3OY3A 1QPJA 4KKHA 2JKQA 2VGPA 4IVCA 3G51A 2ITXA 4OUCA 5IEVA 5J7HA 1RJBA 2CHLA 4PTEA 1W8CA 5JRSA 1U54B 4USFA 2OFVA 2R3NA 5IUHA 4FV5A 1IAHA 3VONA 3W0NA 1TKIA 2QHMA 4I6HA 3DAEA 4MWIA 5E92A 5E8TA 5CAUA 3D7TB 4QDVA 3E7VA 3IW7A 1EH4A 4U42A 5IPJA 4MXCA 4O22A 3A7IA 2J6MA 4Z55A 5IF1A 3UDZA 4OTIA 2CNVA 3E92A 1FQ1B 4O96A 3ORZA 3AKJA 2QD9A 3AC8A 2RIOA 4UB7A 3DQXA 5TT7A 4EWHA 5FP5A 2JC6A 3IG7A 4AU8A 5E4HA 3QKKA 2E2BA 4FNXA 5HU9A 5C27A 3M2WA 4YJTA 2VV9A 3UPZA 3DTCA 3UDSA 3VS0A 4C0TA 4UV0A 4ZSLA 4GT4A 2VWZA 4Y85A 4DAWA 1H4LA 3DBQA 5ACBC 4BHNA 4EJNA 4RQVA 4EH5A 5IQHA 4C3RA 4KS7A 1Y91A 3BKBA 2X9FA 1UWJA 3V6SA 3ZSHA 1YXXA 1BI7A 4IAZA 5EG3A 5CU2A 4BZOA 1JLUE 2PK9A 3DJ5A 2O5KA 3OUKA 3QD3A 5FRIA 1PXPA 3R9OA 4M84A 4IC7A 4EYMA 4G3EA 4R1YA 4BTJA 3D5UA 1FGKA 3BE2A 4XRLA 3HDMA 4ALVA 3HECA 4EQCA 2OJIA 4ZZMA 3I79A 2XIXA 4O27B 4CLJA 5B7VA 4J98A 1T46A 3HX4A 3R83A 2HXQA 3GFEA 4F1MA 2PVLA 4LMNA 1JBPE 3I7BA 4Y83A 3GXLA 1ZMVA 1OIUA 2ETMA 4QYGA 3VIDA 4EL9A 4DFNA 2W0JA 3LJ0A 4CKJA 3NYNA 2W4OA 2OWBA 2G2IA 4FK3A 3LW0A 4D55A 1ZLTA 1FBNA 2X0QA 3KXGA 3O8UA 3V5JA 4CFUA 4F6SA 3OEZA 4CNHA 4BYIA 3L9MA 2Y0AA 3CCNA 4IWDA 4RVMA 3HA6A 1RDQE 4ACGA 4N70A 5GJFA 4EK6A 3QQUA 1YWVA 5DG5A 4MF0A 3WYXA 5EKNA 3EQDA 5TE0A 4D9TA 2VO6A 4QMUA 3QWJA 1YRPA 4WRGA 5FG8A 4AE9A 2YIXA 3M42A 4AQCA 2E9OA 5BVNA 4FV0A 5HEZA 3KRRA 3PXZA 3R8PA 4D2PA 5T3QA 2XNBA 4FL2A 3CR0A 1Q62A 5CXZA 1OIRA 4QMPA 3QBNA 2AQXA 4U43A 5H8BA 2ERZE 3IW8A 3R9HA 4NH1A 5DPVA 4E5BA 3FSKA 4LM5A 4ITJA 4L68A 2Z8CA 1HCLA 3F3VA 3NYXA 4XOZA 4ALUA 2WTIA 4WG4A 4F7SA 1TFFA 3L1SA 4FF8A 5A4TA 4CTCA 2PVKA 4R5SA 3VS4A 4BCJA 1JQHA 4LMUA 3SVVA 3FSFA 4F1OA 4BCGA 3Q5IA 3R6XA 3CIKA 4ACHA 4E6CA 2VTTA 3A2CA 3CTJA 4FTUA 4M0YA 3ZBFA 4BTKA 2ITZA 5LVMA 3F5UA 2Z60A 3EFWA 4IM3A 4RX7A 2PMNX 2OO8X 3E64A 3IECA 3QA8A 3QQJA 4S33A 1VLRA 2XAMA 3IKAA 3VVHA 3UNJA 4U40A 4FKVA 4NW6A 4L44A 4XP2A 5J1WA 2WU7A 3OFMA 4X2JA 3RAWA 4YJQA 4F0GA 2OH0E 3W2PA 5DEYA 4RX8A 5GZAA 4MF1A 2BAJA 2IW8A 3FV8A 3WZDA 5ANJA 4V05A 1KE6A 3OOMA 1YDSE 4FV8A 5AV4A 1V0BA 4WNPA 3RPVA 5IH4A 1PKDA 4RFYA 1M2QA 4J8MA 4UEUA 4QTDA 1Y6AA 3VBTA 4WD5A 4FKJA 2Y4PA 3GU7A 3LZBA 3PXKA 4HYSA 1UU9A 4JAIA 5E8VA 4IFGA 3ZLYA 4BYJA 5IUGA 2UZWE 3UTOA 5M4IA 4PMSA 4E20A 2WQNA 5HIBA 5HLWA 3RI1A 2HZ0A 3O7LB 3PRFA 4O7RA 3CEKA 4QMSA 3BL9A 2J2IB 3DLZA 4D58A 4NU1A 3FLWA 5AV0A 3RPSA 1KE8A 2HW7A 2ZM1A 1YI6A 1WVYA 4M15A 4KBCA 4ACMA 4JL9A 3NAYA 4L7SA 4W8DA 4ASXA 3UQCA 4P4CA 3G15A 3D7TA 5TKDA 3GCUA 3TM0A 4MYGA 4U3ZA 5EW9A 3HA8A 4XH6A 1H25A 3EQCA 3W8LA 3C50A 3PG3A 5IZFA 4V04A 4RG0A 2PU8A 3UZPA 3NUXA 3WF8A 5GIOE 3BHTA 2AC3A 1NA7A 3TACA 4FZ6A 3Q6UA 4DGNA 2W4JA 3LAUA 4NKSA 5C8NA 4U0IA 4I5PA 2YCFA 2UZVA 3FI4A 4E5AX 2BTRA 4WUAA 3RPRA 3UQFA 3KF7A 4M0ZA 5DGZA 4C4GA 3CSVA 1MP8A 2XNEA 4ZJIA 4WBOA 4WA9A 4CYIA 1JKKA 3RM7A 5CS6A 2OLCA 2W1DA 2WQOA 2GQSA 3RKBA 3W0SA 4C33A 1W0XC 3W2SA 4DA5A 4D2WA 4C62A 3W1FA 5BYZA 4U79A 4DF3A 1VR2A 5HESA 4O6LA 4QYFA 4KKGA 2J0KA 2XB7A 2LAVA 4AWIA 4F63A 5IEYA 3VHKA 5EHLA 4BFMA 2X6EA 3CJFA 2XYUA 2ESMA 3FLQA 1KOBA 5L2SA 4E5WA 5IKWA 3AC3A 4WO5A 4MQ2A 4ZTLA 1Q3WA 4NM0A 4S32A 4AGDA 5AX9A 1CTPE 3QX2A 5CT7A 5AP4A 1E1VA 2W1CA 3TDVA 3UIXA 3E8EA 4CMUA 2YN8A 4I20A 4L01A 3ZZEA 1PKGA 4AP7A 3DA6A 4JRNA 5AUWA 4HGTA 2F2UA 2B52A 2UW9A 5FTQA 5AAGA 1XBAA 3SKCA 2BCJA 3A8XA 4YLJA 5HNBA 5LJJA 3ANRA 3MI9A 5IQGA 3FY2A 4L67A 5EOLA 1ZY5A 2R3GA 4V0GB 2R3IA 4ZTHA 3SDJA 3NPCA 5IG1A 4UXQA 4F9BA 2VNWA 2BRGA 2RG5A 3FE3A 4G6NA 3R8UA 3SLSA 2XIKA 1PW2A 2ZJWA 5AP3A 4XJ0A 4PL3A 3KB7A 1GJOA 2X39A 3E8DA 4O1PA 3NIEA 5E8SA 5DYJA 4QP1A 1E9HA 2NRUA 2PHKA 3MY0A 4HGEA 5H8EA 4Y8DA 4WUNA 4YTIA 4DT8A 3FUPA 3ORPA 2C68A 4FNWA 4ZY4A 5BVKA 3R8MA 4F7JA 3OBGA 4FV9A 3LLTA 5I9UA 2GNGA 3EQGA 3L8XA 4O7SA 4MXYA 2EWAA 3MH1A 2VWIA 2G15A 4C4HA 4E73A 4WKQA 2ONLA 2CCIA 4RWLA 5D7VA 3RWQA 1YWRA 3F2AA 4DH5A 3DBDA 3F69A 4EH6A 3DBEA 5AP0A 4EOKA 1PMEA 5LMKC 2VO3A 2JIIA 1NT2A 5BV3A 4KIOA 4JNWA 4F08A 1W84A 4QP3A 3UOHA 3HV7A 3O50A 3UPXA 5JGBA 2C0OA 2X7GA 3E3BX 3VJOA 4E4NA 2W9ZB 1UNLA 3IONA 5EM8A 3QC4A 4IH8A 4L43A 4QTBA 5LVPA 4LL5A 4M7IA 4W4WA 3W32A 3R7UA 4NSTA 4FKGA 3QZHA 4IM0A 5FM3A 3QZFA 3MIAA 4Q2AA 4CRLA 4GS6A 2W1GA 4L7FA 3RWPA 2CN8A 5BVEA 3MH3A 2PYWA 4GU6A 2OJ9A 4OTRA 1U5RA 2W5AA 3E5AA 1ZMUA 4ANSA 5AEPA 4O7TA 3HKOA 3EKKA 4W8EA 2BR1A 1R1WA 5EM7A 5AR7A 4PV0A 5I3OA 3K5VA 5GZ9A 1ZARA 3GC8A 3MGYA 2UZLA 3BGPA 4W4XA 5E90A 1S9IA 3VS3A 1G8KA 3GOPA 2PMLX 3DQWA 3F5PA 3L8PA 2XANA 4AACA 2EUFB 2F9GA 2RG6A 4DE4A 4BZDA 3AT3A 3NVMB 2J4ZA 2NO3A 2PL0A 3BHYA 3FLNC 4DINA 5EYMA 5EQPA 1PXNA 3KCKA 4DHZA 3NSZA 4JQEA 4GL9A 5HG8A 3BV3A 3NW5A 3MFTA 3QL8A 4RIWB 5KCVA 4X3FC 5KNJA 4CGAA 5JMSA 4CMTA 2QG5A 2XJ1A 1UU3A 5AV3A 4E7WA 5CANA 5E1SA 4EOSA 2PVJA 5AIRA 4KD1A 5HLNA 4FA2A 3NFFB 2C6LA 5B2MA 1KE7A 4LRKA 3FL4A 3VRZA 3WF6A 4O0YA 1PXOA 3FWQA 4IC8A 4RJ5A 4EHEA 3A4OX 3BE9A 1G8JA 4FIFA 3DLSA 2WOUA 4TL0A 5BVWA 3SXSA 3E88A 3OXTA 2G9XA 4FV4A 5KBRA 1J3HA 4BF2A 4R77A 2HW6A 4ZEGA 3JXWA 3PPKA 2C1BA 4DFYA 1M17A 4JG7A 5K0XA 2OIDA 4RFZA 4XV2A 3LFEA 2WKMA 3ZFYA 4ZLZA 1DM2A 5JH6A 3NWWA 3QHRA 2OZAB 3BEGA 3CY3A 3Q9XA 1PYXA 3OBJA 4O4BB 4AA4A 3ZUVA 3VS7A 4QTEA 4DH3A 4LL0A 3F82A 2WOTA 2J0IA 4G9CA 3ZO2A 4RJ7A 4HPTE 4CZUA 2C6TA 5HGIA 1ZAOA 4IJ9A 3ZUUA 3EH9A 3QWKA 4IBMA 3EWHA 4I5HA 4JBOA 3UG1A 3D2IA 4YZMA 5A46A 3DXPA 4ZY6A 3LM5A 3RM6A 3FLYA 1WZYA 2Y8OA 5HG5A 5AR2A 4CMOA 3DTWA 3HGKA 2FVDA 4EUUA 4BWPA 4TYIA 2ZAZA 4Y5HA 4V0GA 2YACA 3IDCA 3K2LA 4ZJJA 3UYSA 2AEGA 4FR4A 3CC6A 3BLQA 3KK9A 4FV3A 4QPAA 4FT7A 4JDKA 4F9AA 1XWSA 2FSLX 4JQ8A 2W4KA 4AAAA 2PVNA 3F3TA 5AR8A 4BTMA 4ZOGA 5DFPA 4BDIA 5IH5A 4KSPA 3UE4A 2XK4A 3QRJA 4XYFA 2F7ZE 2WMTA 2CDZA 3FZ1A 2WTKC 4GSBA 4IAFA 3ZSIA 4P2KA 1OM1A 2Y4IB 4G6LA 4JVGA 4ACCA 5CX9A 3R7GA 1FVRA 3P4KA 2VTHA 2WNTA 2QQ7A 4XEYA 4ZTNA 2W5BA 4ZZOA 2CGUA 3FZRA 4XLIA 3IW4A 3F66A 4C2VA 3TEIA 3EIDA 2A19B 1GAGA 3QD4A 4D4SA 3SA0A 1YXTA 1OECA 3UBDA 2JEDA 3DAJA 5CEIA 3TXOA 4R7IA 3QCQA 1RQQA 3BZ3A 5EK7A 5JZJA 2WTJA 3JS2A 4I4EA 4L00A 4ZY5A 1FVVA 4J97A 5J9LA 1Q61A 2C6OA 3Q4UA 5CAOA 3EZVA 4WT6A 3UZRA 3GU4A 3GI3A 3WF7A 4IX5A 1WBVA 1A9UA 5K0KA 4CFFA 5CF6A 5F9EA 5CQWA 3EMGA 4EBWA 4O4CA 3ETAA 3HMMA 2DQ7X 1UNGA 2H9VA 2J5EA 2C6EA 3TNIA 4U5JA 3W2OA 4C59A 3VS6A 2EXCX 4NUSA 3KY2A 1OL5A 4MNEA 5HE0A 4YURA 3A62A 4Q5HA 3ATSA 4BHZA 4RFMA 4RJ6A 3O2MA 3UOLA 5JRQA 3I0QA 2QOQA 3LJ1A 3LJ2A 2XRWA 4YPDA 3V04A 4ZMEA 3LXNA 4PF4A 3TZ9A 4AZFA 2HK5A 2R3MA 5HCZA 4FNYA 4EOMA 4BWXA 2CSNA 5DT4A 1Q3DA 2ITYA 5HOAA 5HBHA 4FTRA 2B54A 4IE9A 3ERKA 2AUHA 1LEZA 4FUXA 3U55A 1H07A 4YZBA 4GRBA 2XJ2A 4YR8A 2PY3A 3CQEA 3OTVA 2RSVA 4BBEA 2PMOX 3AOXA 4MBIA 1MUOA 3EFKA 3EL8A 2FB8A 4FT9A 3I81A 4GIHA 5BUJA 3MTFA 3BLHA 4FTNA 1CKPA 4UMQA 5CVGA 5EI2A 4IB0A 3AD5A 4CXAA 4ITIA 3F3UA 2A1AB 5F94A 5JZNA 5I9VA 3RAHA 2WMSA 2ZOQA 2B53A 4UWCA 3I1AA 3UC3A 1SVHA 3QQKA 2PSQA 4FKIA 5KZ0A 2Z2WA 2C5XA 4FG7A 3ALNA 2QOKA 3EKNA 2PZPA 2GFSA 3QGYA 4M69B 4A9YA 1J91A 2R3OA 3UJGA 3PY0A 4ZTMA 5A6OA 4FI1A 5LQFA 2ITPA 2WMUA 2PUIA 5I3RA 4FVRA 3D5WA 1SMHA 2ITQA 4JMQA 2B7AA 2BIYA 5A4EA 2E9NA 4Q5EA 1TQIA 2QO9A 5I9WA 2DS1A 2QOOA 3KVXA 3E8CA 5EKOA 3E63A 1OIYA 2YIYA 2HELA 2CPKE 4IB5A 4RLKA 2QR7A 4YC3A 1JWHA 1URCA 4YSMA 1S9JA 4FEQA 2VTPA 5FXRA 2XEZA 2OJJA 2VN9A 5GZ8A 3HAVA 1Q5KA 4KSQA 3RVGA 5IDNA 4Y72A 4FKWA 4LV8A 2OZAA 1WBSA 2R9SA 5A54A 4XG4A 5D9HA 3BI6A 3OD6X 5E91A 4CYJA 2WB8A 4I94A 4BDJA 3KC3A 4JT3A 3Q32A 1IR3A 1PMNA 3OT3A 3TJDA 2WQEA 5CSPA 4HVGA 4M8TA 4F7LA 2BILB 3TKHA 2XA4A 2R2PA 2WQBA 5ITAA 4R78A 4FSWA 4ASDA 4C2WA 1UKIA 5J87A 4PPAA 4MUQA 4BL1A 4GK2A 3G0FA 3H0YA 3A7FA 3QF9A 4I22A 5DH3A 5I9YA 5IQCA 2XKEA 3GU8A 3P7BA 1XMMA 3HAMA 4AF3A 3EYHA 4H58A 4FGRA 1F0QA 4FT5A 3DKGA 4OBQA 2SRCA 4Y46A 1XH9A 2CJMA 3K5UA 4J52A 4E3CA 3QCXA 4AOIA 2VTIA 4FIEA 3ROCA 2OJGA 4CFMA 1Y8YA 3T8OA 3R9RA 3D15A 3Q2JA