5KMJA

Trka jm-kinase with {n}-(2-pyridylmethyl)-2-[2-(2-thienyl)indol-1-yl]acetamide
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
310
structure length
300
Chain Sequence
LQGHIIENPQACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords High affinity nerve growth factor receptor
publication title Structural characterization of nonactive site, TrkA-selective kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 94
structure length 300
sequence length 310
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5kmjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5kmjA01
4DH7A 1RE8A 3OCTA 3ZRMA 1TVOA 1UU7A 4NM5A 4C38A 5AM7A 5CI6A 4D55A 2BAQA 2PHKA 3OCGA 4F09A 3ZHPC 3D83A 5BUIA 3BYVA 3FSKA 4RJ7A 4L3JA 4X2GA 4IB3A 4XOZA 3HMOA 2GTNA 4OBQA 4OLIA 4BKZA 5KBQA 4C3RA 2GS6A 1ZYCA 5HU9A 3FY0A 4KBAA 5HZNA 4GEOA 4FIGA 4NW6A 3UYTA 4L01A 2DWBA 2GHMA 3F3VA 4JR3A 4DH8A 4GKIA 2PMNX 3MBLA 3U54A 2OWBA 4X3FB 3DB6A 4I0TA 1QPEA 4LG4A 4CCUA 3W2QA 2WOTA 3IOPA 2YLFA 2BFXA 2W06A 1H00A 1GZ8A 4JXFA 4WUNA 5KHXA 3WE4A 3EQPA 3FXWA 2C3KA 4QMZA 3PY1A 3W18A 5DNRA 3E3PA 3IQ7A 4RX7A 4DEGA 2I1MA 4HGEA 4CD0A 4Y85A 5LVOA 1GZKA 1WVXA 4ZAUA 2R0UA 4FEXA 4GJ2A 3UVQA 5AEPA 2VWZA 2YDIA 5A14A 5KKRC 5HU3A 5HBHA 3UG2A 4ANMA 4QMTA 5K5NA 4CYIA 3A7GA 1J7LA 2HXQA 2WMQA 4QD6A 4RIWB 3T9TA 4MQ2A 3FMLA 4DLJA 3BGQA 5FGKA 2WPAA 4M84A 4Y73A 2CGUA 3DU8A 2XK6A 1ZYSA 5HOAA 4M12A 3TTJA 1M2RA 3OUNB 4FIIA 3COIA 4IVBA 3E63A 3LFAA 4QP3A 5A6NA 1V1KA 3R1YA 3UIMA 5A4TA 5EQEA 3F7WA 5JRSA 2XNPA 3CP9A 3ZLWA 5HHWA 3M2WA 1Q97A 3QWJA 3F5XA 5C4KA 2OJFE 2YIYA 3JY0A 4F1OA 4F9CA 2FSTX 4Y5HA 3V5PA 3PRFA 4UWYA 3GUBA 5K5XA 4M8TA 2QOBA 3VS4A 3KF7A 4DH1A 2WAJA 2X39A 5AAFA 4D4RA 5HTIA 3KMWA 4XJ0A 1XBAA 3UIBA 4OTRA 3FKNA 3GBZA 1CSNA 4FSRA 4RC2A 2BKZA 3SW7A 1ZY4A 2YM7A 4BDFA 4IM2A 4PL4A 4X2FA 1PXLA 4IHPA 3FLSA 3EJ1A 3DAEA 2XH5A 4K18A 4L53A 3KREA 4F99A 4FG9A 1KE5A 4K77A 3KY2A 3QC9A 3L9PA 4XLIA 4U97A 3ZOSA 4HZSA 2O8YA 5DT4A 5JZNA 4CT1A 4MWIA 2OG8A 3ZO1A 5CSXA 4K6ZA 4C7TA 1FMOE 2OIBA 4MYGA 1L3RE 2CJMA 3U51A 2QOKA 1I09A 2HENA 2HYYA 2XJ1A 3I5ZA 4MEDA 4NH1A 1W7HA 2UZDA 1KSWA 3VUHA 3UPZA 5C9CA 3F69A 4C3FA 1GJOA 4BGHA 3QZIA 4YC6A 3VHKA 4B0GA 4BDHA 4DINA 4D5HA 4ZTRA 1VYZA 2BTSA 2QU6A 3KRRA 3LHJA 4WSYA 4XCUA 3MYGA 3KGAA 3NAXA 4AW5A 2UZVA 4I24A 3CGOA 3R2BA 3UP7A 1L8TA 5BVEA 4CEGA 2C6OA 4OAVB 3FYKX 1G8AA 3N4VA 1APME 1YVJA 3FWQA 4NIFB 2IVTA 3OUKA 4O96A 2IVUA 3PIYA 2C47A 4QMSA 2XEZA 2YWVA 1ATPE 3U87A 4WIHA 5EG3A 4C35A 2QCSA 4NJDA 3R71A 4GUEA 1XH8A 4NJ3A 3HVCA 4RX8A 4EH6A 4F64A 3TG1A 4FA2A 5EYMA 3UZTA 2UVXA 2IPXA 4GCJA 4GT4A 2PUNA 4NKAA 5EDRA 4EHVA 2DQ7X 5LMKA 4L7SA 4I5MA 2YEXA 1XO2B 2QOFA 5J8IA 2YABA 4RWLA 1ZRZA 3W33A 4DFYA 3QXPA 1GAGA 2EXMA 1CKIA 2P4IA 3AD5A 2QU5A 2VAGA 4CFVA 4AQCA 3R9RA 3E8NA 3VS5A 4CSVA 4DT9A 2BZKB 3WZKA 5GINE 2ITUA 2V62A 3UGCA 1B6CB 3UNZA 4BCPA 3DQWA 4NEUA 3MH3A 4YTHA 2YAAA 4KINA 2J5EA 3OROA 4FKVA 3F5UA 4B7TA 4E26A 5GJFA 3ZFXA 1Q41A 4FIEA 2YCRA 2CN5A 5CXZA 3BYMA 2Q0NA 4EK8A 4KIOA 4E7WA 4FMQA 4PDPA 2R3FA 1GIIA 4MCVA 4G3EA 2C3IB 5AADA 3IO7A 5JFXA 2ZVAA 2BDWA 3ZFMA 4DFZE 1M14A 2QOHA 3MS9A 3QHWA 5DFPA 3JPVA 4JQ8A 3RNIA 2QO9A 5D7VA 5BUJA 1FGIA 5IEYA 3TDVA 3JYAA 4I22A 4DTBA 2JDOA 4R3PA 5C01A 5FBOA 3EN6A 4IFGA 3FPMA 3LMHA 3KULA 3ZYAA 4QMQA 1KE6A 4O22A 3BEAA 1WBWA 2FB8A 4RJ8A 2E2BA 4QRCA 4Y95A 3WZDA 3HAMA 1Q24A 2IJMA 4ITHA 3RZBA 4IZAA 5AAEA 2R3OA 5CAVA 3GT8A 5FQDC 3FMMA 3CQWA 3ORTA 4O6EA 5D10A 5E8XA 3RCDA 5HX8A 4AGCA 3TKIA 2UV2A 4QYGA 3T9IA 5A4QA 5HX6A 1PXIA 4IAFA 4IX3A 4XMOA 4G17A 2UW8A 3NUXA 5HVJA 3R22A 5ACBC 2F7XE 4IB1A 3V6RA 1REKA 2XBAA 3WZUA 3UNKA 3LCTA 4BRXA 1M52A 2FYSA 2WTIA 4G16A 3E8DA 4G5PA 4ZJJA 3ACKA 1Y57A 3P5KA 4FKTA 5F1ZA 4ZJIA 5M06A 1FVTA 2HCKA 4FL2A 4XG6A 4O7TA 2PULA 2VV9A 1YHWA 4OUCA 3DAKA 3VS3A 3BE2A 3Q60A 1BLXA 5JH6A 4MBJA 5CEQA 4FV3A 4DGNA 2G01A 4FTAA 3UOLA 4O0XA 2ITWA 3PJCA 5HTBA 5IG1A 3IW6A 4H3QA 1PF8A 3II5A 2YITA 2ZAZA 4KRDA 3E62A 2WEIA 3GCQA 3LJ2A 4WHZA 4X6RA 1YOJA 4BZOA 4H39A 4ZZNA 4AF3A 4E5AX 4QP7A 1JSVA 1H07A 4CZTA 2YM4A 3DNDA 3W16A 5A6OA 3BYOA 2JDVA 4FT5A 4CRLA 2CLXA 3H9OA 2XNBA 2XIZA 3I0QA 2JBOA 3A60A 2C5YA 2J9MA 3GOKA 4K2RA 4R6VA 4TWNA 2X8IA 1OMWA 2VTHA 3LW0A 4QP4A 5FD2A 4DH3A 3QZHA 3PWYA 3QCYA 1NVQA 2CN8A 3BELA 5H8GA 4YJOA 2OJIA 5BX0A 1M2PA 4OR5A 3BI6A 2Y4PA 3ORPA 3WYYA 4DEHA 2G2HA 2ZMCA 3PXRA 4YJUA 3HV7A 4XUFA 5M09A 4RFYA 3Q2JA 4XG9A 4BTJA 3G0EA 3CIKA 2J0KA 3TNPC 3W1FA 4HVGA 4AT3A 2QURA 4U9AA 3FMEA 4R5YA 4W9WA 2XKCA 3PDTA 3COKA 2WQOA 2PE0A 4IM3A 5KZ0A 4ZOGA 3WF6A 4CTCA 4KIKA 3DJ6A 4HW7A 4B4LA 3Q4ZA 5I9YA 3O8TA 2PZIA 3LFBA 5FLFA 5HGIA 1ZMWA 2A19B 3QX4A 1Q8TA 4W4YA 5D11A 4FICA 3ORZA 3SC1A 3W2OA 2ZV8A 3UC3A 5A4CA 3TN8A 4DE4A 3L1SA 3MDYA 2WD1A 3RP9A 4C4GA 3MA3A 3S00A 4LRJA 3NIEA 3VRZA 3N4UA 3WOWA 4BYJA 4JG7A 5HIEA 1ZYDA 5J7HA 5IQDA 4RWIA 3DBQA 3VJOA 2PUUA 4DT8A 2C6IA 2I0EA 5DR9A 2F2UA 4EHGA 2NNWB 4FKIA 3WYXA 4Z16A 3EOCA 5KMNA 4MKCA 4WBOA 5IUIA 5AR2A 4RX9A 4DCEA 3OOMA 3EQDA 3PWDA 2QG7A 2WEVA 1MQBA 2J4ZA 4PY1A 3UMWA 4CV9A 5BVOA 4J8NA 3F3TA 3BCEA 3DBDA 3IKAA 3D7TB 1XH4A 3C0GA 5JFWA 4FEUA 4WNMA 1OKYA 3OP5A 3EMGA 4YURA 2WQEA 4FR4A 1WBOA 3VC4A 3AGLA 4A4LA 1PHKA 3OCSA 2VTTA 2CPKE 3GC7A 5D1JA 4ACMA 1OL7A 4ASEA 3BV2A 3C4ZA 2YZAA 4JIAA 2W9FB 1P4FA 1O6KA 2XCHA 3SG8A 2GQGA 3ZC6A 2X8EA 3KXHA 3POOA 3GU8A 3PTGA 4BBEA 3I7CA 3PJ3A 4X3FA 1YQJA 5H2UA 5HNBA 3VQUA 4BGQA 4EBVA 4QNYA 4DG0E 5L4QA 3KCFA 1UU8A 4KABA 5DGZA 2ETKA 1MQ4A 3CD3A 4JDIA 2OZAB 3KK8A 2CKEA 2PZYA 3K3JA 5HD7A 2ZM4A 5F95A 4FV2A 4CTBA 3UOJA 3FZOA 3MB7A 3IDBA 1Q5KA 4PL5A 3WZEA 3ZRLA 5CEOA 3KB7A 4LRKA 2BDJA 5GZ9A 5FTGA 2ZM1A 5KMJA 4RWJA 2YCFA 1JVPP 3CGFA 2B1PA 3MSSA 3NNVA 3OXZA 4F9AA 1H27A 1R0EA 5M56A 3MY5A 2ZV2A 4NKSA 4EYJA 4OT6A 4XNEA 3AGMA 1OIYA 4FNXA 4RIWA 4S32A 5KX8A 3A7HA 4IWOA 2X9FA 2XIKA 4WT6A 3C9WA 2WQBA 5HO6A 4FG7A 2DS1A 5HO8A 5IISA 1ZLTA 3LFNA 5B0XA 4IC8A 2AUHA 1JPAA 4FF8A 1YHSA 4V04A 4O7SA 1ZYLA 4YO6A 2W4OA 5IH6A 4IM0A 2XRWA 4PQNA 1LEWA 2BAKA 4IWPA 5E4HA 3DK3A 2JKOA 1KE7A 5JGBA 4O84A 2FO0A 3S2PA 2P2HA 5FM3A 5CSPA 2BZHB 3EKNA 4HGSA 2PVMA 4JDJA 5EDQA 4FSYA 2OJ9A 3BIZA 4ONAA 5LXMA 3RVGA 4J8MA 4IWQA 5BNJA 4FKGA 3QTSA 4KD1A 4A4OA 4C61A 4D9TA 1XBCA 4M67A 1RQQA 5IA0A 4FE2A 3BU5A 4F7SA 3GNIB 3GGFA 5AMNA 4DH5A 2BPMA 4FZDB 4PMPA 4CKRA 3E8EA 3VBWA 1CKJA 4BTKA 3G0FA 2ITOA 2XJ0A 4X3JA 2QNJA 4J52A 3ID6C 5GNKA 4D4YA 2OIDA 3PYYA 5HIDA 3OT8A 2O63A 2P3GX 4CMTA 3QUPA 2ZM3A 4ANOA 1URCA 3HMIA 3RHXA 5IQCA 1TQMA 4BCMA 2ZOQA 3CC6A 3F66A 3G5DA 1V0BA 4ZK5A 4GIHA 4JX7A 4UEUA 2C4GA 4S30A 4G9RA 4EBWA 5M57A 1FPUA 2EXEA 3RPSA 5KMKA 5KE0A 4Q5EA 3CJGA 1R39A 4L46A 3V8TA 2IW6A 5IA1A 1IRKA 3MIYA 2UZTA 3A8WA 3FY2A 4RJ3A 5D12A 5G6VA 1Q3WA 3WF9A 3Q3BA 5BUEA 3FI4A 4GK2A 4F9YA 3DGKA 4NTTA 5CNOA 2W1HA 3PIXA 4JT3A 3T3VA 3H9FA 4DITA 2VWYA 4EONA 3M42A 2Y8OA 1HOWA 2IWIA 4FSTA 4UMRA 1W98A 3QRIA 4JDHA 4JQEA 4NIFA 3VULA 4PDYA 2PPQA 4O83A 4DA5A 5AP7A 3D2IA 3GVUA 2ZB0A 4M15A 4IB5A 3FL4A 2PMIA 2XCKA 2C0OA 5KMIA 4X2JA 5DEWA 4DEDA 4IX6A 4U3ZA 4Q9ZA 3I4BA 3GEQA 4QPSA 3JY9A 4ZS4A 1M7QA 1R1WA 3LIJA 3KN6A 5CENA 2WQMA 5CY3A 4CLIA 3O17A 3QGWA 3GU6A 3L8PA 4IJPA 3JS2A 4KKHA 4CFUA 1Q3DA 3QWKA 4RWKA 2B52A 3V3VA 4O82A 2XF0A 4K9YA 4AUAA 2ONLC 3Q9XA 4E6DA 4BY9E 2C6MA 3HYHA 3AMBA 2JDSA 4ZY6A 3TV7A 4ALVA 3ETAA 3BHVA 4AZWA 4RQKA 2C6EA 5LWMA 4FV6A 4E3CA 4XBUA 5DEYA 4UYAA 2CNQA 4K33A 3L9MA 1KWPA 3A62A 3DKFA 4O7YA 3DTWA 4G3DA 3E88A 5HCYA 3DFAA 4EH4A 5EM8A 4N0SA 4U5JA 2GNGA 4YJQA 4RIOA 5J9ZA 3FQHA 3QA0A 4GVAA 3QX2A 4UZDA 4Y72A 5T6KA 4TKSA 1OPKA 3WIKA 5K3YA 5HICA 3RAIA 4F9BA 4I4EA 2PVYA 4HPTE 4RBLA 5TKDA 2HWPA 1A06A 2YWPA 2V55A 3HUCA 4LYNA 4F6UA 3ZFYA 1BL6A 5J79A 3SX9A 5HBEA 4D58A 1SM2A 2R3JA 4O7VA 3HRFA 4U43A 4TRLA 1ZY5A 2UW7A 3IK3A 4KIQA 4KRCA 4FIHA 4W4VA 3Q04A 5IZFA 5J87A 5JRQA 2OU7A 4M69B 3NYVA 4APPA 4PPCA 3EFLA 5HLWA 1K9AA 3ZO2A 3VBYA 5ANIA 3ORKA 3MVHA 2AC3A 3GB2A 3QKLA 2UVZA 3AC1A 4EH7A 3SW4A 5H8EA 3LM0A 1J91A 2YDJA 3BHTA 5M4CA 4V05A 2R3IA 3I0OA 3R7GA 1Q8UA 3ZXZA 1S9IA 2XRUA 3ORNA 5FBNC 2PZRA 4FTNA 5E8WA 3RNYA 3CQUA 3TT0A 5AJQA 3V5QA 5JMSA 3DXNA 4QMMA 1FBNA 1OGUA 3LE6A 5EW9A 1V0OA 4IX5A 4K0YA 4BDAA 3PPKA 3KN5A 3ZM4A 4XP2A 2H8HA 1R3CA 4O1OA 4P7EA 4QP1A 2ITNA 2YISA 4PP7A 2G15A 5CAPA 4FV5A 3MWUA 3NNXA 4XG2A 4BTMA 4XG4A 3O0GA 4XV1A 4QP2A 4YZNA 1AGWA 4PTEA 5BVNA 3NUPA 4FNYA 5KZIA 1YRPA 3LFSA 4GMYA 2HY0A 4GJ3A 3EHAA 3F9NA 4RVMA 3ZZWA 2O3PA 4QTEA 3ELJA 3ZSHA 3LQ3A 3KKVA 2HOGA 3Q4UA 4Q5HA 4X0MA 1UU9A 2VO6A 4QTDA 4BCKA 3F88A 4ZTHA 3C51A 3QL8A 4D1ZA 3SRVA 4OGRA 2HIWA 3LFDA 4NZWB 1MP8A 2IVVA 2QHNA 2WHBA 3R7VA 3R8MA 2B54A 4I23A 5C8MA 4F0GA 3LXPA 4ID7A 2JITA 4KNBA 3DKGA 5HE3A 3U9NA 2OICA 5DHJA 5L6OA 3KCKA 3QTRA 3MN3A 4I3ZA 5C4LA 1PXNA 3P78A 2RGPA 3UP2A 3EQRA 1GZOA 5B7VA 2DYLA 5AX9A 3VAPA 4DGGA 4E4XA 3I5NA 4WBBB 2Y4IC 3U9CA 5BYYA 5JK3A 3HLLA 4R1VA 4MQ1A 5F20A 4ZTMA 5H9BA 5FP5A 2WO6A 4CV8A 5HEZA 3O50A 4O0SA 3QQFA 4FUYA 3I79A 4FG8A 2X2KA 3R2YA 4ANNA 3R63A 4JBVA 4YMJA 3LJ0A 4B6LA 4YLJA 1JAMA 2IZRA 4IAIA 2R3QA 1OIQA 2GSFA 1GZNA 2R7BA 5D7AA 5DT3A 4ZEGA 1JKSA 3C1XA 2VX3A 4WNOA 4ASDA 4L42A 4FEVA 5D9HA 2JEDA 2W1CA 3OXTA 2QR7A 1YXXA 5CVFA 4IANA 3QCQA 3MPAA 4MXYA 4ZTSA 3GI3A 1LPUA 4J1RA 4U7ZA 5DRBA 5EHYA 3L8XA 2WMAA 5HNIX 1BYGA 3NEWA 2BRNA 4MWHA 3L8VA 4UMQA 3C0HA 3D7TA 3DV3A 4FV1A 4GKHA 3NMUF 4RG0A 1G5SA 3R7IA 4ZTLA 4OTWA 2Q83A 4FT3A 1DI8A 2QOQA 3DTCA 4FEQA 4XG8A 3UODA 3TZ9A 4A9YA 4EH3A 4GK3A 4NT4A 3C4WA 5TO8A 4XHKB 3QCSA 4TYHB 2UZEA 4W9XA 2BZJA 3MIAA 3QKKA 2W5AA 2GS7A 4C02A 1UU3A 2JFLA 4HCVA 2A27A 4V0GB 1SVEA 4GU9A 1BX6A 2JKMA 4FZ6A 3LPBA 4ALWA 3REPA 3KA0A 3DKCA 3EZVA 1DI9A 5HVYA 1IR3A 1XWSA 3MVLA 5FTOA 4PF4A 4ZLZA 5HE0A 2E9VA 5L8LA 3MTLA 1G8SA 3LCKA 4X6QC 2VGPA 1PMEA 2OZAA 4BHNA 3EYHA 3V01A 4I4FA 3VBVA 3GOPA 4GV1A 4YZ9A 3DNEA 2PVJA 4IQ6A 4M66A 3TV4A 3IGOA 1UA2A 3UIXA 3TNHA 5HORA 2X8DA 3MESA 2J0IA 4CFXA 3RPRA 1Z57A 5CU4A 4EHEA 3BRBA 3U8WA 1U59A 1DS5A 1OM1A 4AZEA 3QTXA 3DJ5A 4AGUA 3F3WA 4O7WA 4IDVA 1Z5MA 3QGYA 4G6NA 5ETFA 4EQCA 3BBWA 1RW8A 3BLHA 5JN2A 4I6FA 3LQ8A 3QTQA 4I5PA 1CTPE 4KA3A 5AV1A 5IDPA 3QD3A 2C5OA 3ERKA 3NUUA 5FM2A 4K11A 5C8NA 2FSMX 2VUWA 5EQYA 3R30A 2BIKB 4ASXA 4FYNA 5KMLA 3H10A 4EJNA 2ITPA 2XIXA 3VS6A 3OHTA 4A9UA 3V8WA 3B2WA 2YACA 3W55A 2OXXA 2V5QA 1MUOA 2CGWA 3BQRA 5HG9A 4EOOA 1PMNA 4H1MA 4AA5A 3MFRA 5ANDA 5CU0A 4RMZA 5CT7A 4CFNA 1ZYJA 2CNUA 3HNGA 4PDOA 1YI3A 1XR1A 3O8UA 4JQ7A 4L9IA 4LOQA 4LQMA 3ODYX 4BGGA 5CALA 3F2RA 3BHHA 3NW6A 4OBOA 2JAMA 4ZY4A 3ITZA 4AE9A 3PA4A 2VTAA 1KE8A 3GP0A 4PNIA 3O23A 4XH6A 1VR2A 4A4XA 4YP8A 2RKUA 3A2CA 1WMKA 1K2PA 4JG8A 3RWQA 4FV8A 3MA6A 5AUWA 3UOHA 5FTQA 1U46A 2J0JA 3H0ZA 4PMTA 3AMAA 4BR3A 1QL6A 5A4EA 5E91A 3BE9A 2UW4A 1BKXA 3BU3A 5DE2A 4TWPA 4PP9A 3ZH8A 5IEVA 5KMMA 2EUFB 2VTQA 3OC1A 4QMVA 3BU6A 4AW0A 4GG5A 4I94A 4DTAA 3LLAA 4GYGA 5L8JA 4FNWA 4YNEA 3K3IA 3EQHA 4IVDA 4UX9A 2J6MA 3HAVA 3R7UA 3WF8A 4F6WA 2PVKA 4FIFA 3NS9A 4AU8A 4FSUA 2UUEA 3LM5A 5FRIA 3SAYA 5JGDA 4I41A 1H28A 4ERKA 2W9ZB 3OW3A 5TF9A 3RPYA 1KV2A 3Q2MA 3SA0A 2VTSA 1LEZA 3LFCA 1SNXA 3VUIA 3DXPA 4N6YA 5J95A 2OFVA 2X1NA 4JRNA 3VF8A 1Y8YA 2G1TA 4D28A 2XK8A 3GCUA 3E87A 5HE1A 2GHGA 4R1YA 4I5HA 4OAUC 4CQEA 3SRVB 3BEGA 1YXSA 3D5WA 3FMDA 1J3HA 1LP4A 5I9XA 3QZFA 5HG7A 2VWIA 3W8QA 1UNHA 2WMXA 4BDDA 4BI1A 2W1IA 5G1XA 4AA4A 3NYXA 3HV6A 4DLIA 3FZSA 5FEQA 1YWNA 1KOBA 3PP1A 3FZPA 4FTKA 3ZBXA 3FEGA 3E64A 5E8VA 3LZBA 4QTBA 2CGVA 2W17A 1JSUA 4L8MA 4ZSLA 5JFVA 1IEPA 4WG4A 3Q5ZA 4XV9A 2ZDUA 4RZWA 3QRJA 5K4IA 4B8LA 3I60A 3NRMA 3R28A 3R7OA 3R00A 4FTLA 5LQFA 4FC0A 5JT2A 2JDTA 2O0UA 3NVMB 5BYLA 5TOZA 4ZTNA 2YN8A 4FUXA 4EQMA 3SKCA 1STCE 4BWKA 4XLVA 4YR8A 2ETMA 3NAYA 4DGMA 2VO3A 1J7IA 1NT2A 3AXWA 4DEEA 3FI3A 4GFGA 5C8KA 3UO5A 4DBNA 1MRYA 4X21A 3LKMA 3OBGA 4CKIA 4YSJA 2BILB 3L9NA 4TW9A 1JNKA 4CZYB 3MJ2A 2X4ZA 4YLLA 3C5UA 4YBJA 5I0BA 3G9LX 4BIDA 2BHEA 2OLCA 5J1WA 3PY0A 1REJA 5EOBA 1V0PA 5I3RA 4WD5A 3OD6X 3DDQA 2CDZA 2HWOA 1U54B 1PMUA 2NO3A 2QOLA 3G2FA 1E1VA 3NYOA 3VRYA 2ITTA 3C7QA 3LCOA 4FZAB 5ANGA 1OL2A 3Q6WA 5CSWA 4D2WA 3P0MA 4GUBA 1F0QA 4IAAA 4ZZMA 4EH9A 2XNMA 2OJGA 5BVWA 2GFCA 3W2CA 4CLJA 1OL1A 2X2MA 5ANOA 4CT2A 3MH0A 4L3LA 3TACA 5M07A 4YBKA 1PKGA 1IA9A 5EOLA 4CKJA 3E7VA 4R5SA 2PVHA 2C0IA 2YCQA 2HZNA 2B55A 5CASA 2F7ZE 4FKJA 3DBEA 2JGZA 3MFUA 5F94A 4M69A 1J1CA 4Z7GA 4RVTA 2VTNA 4MF1A 4HNIA 4AW1A 1URWA 4NL0A 3D5XA 4DFUA 2YIRA 3R83A 3T3UA 1EH4A 2PZ5A 3EQGA 4FKLA 3UBDA 4IXPA 1ZMUA 4YJRA 4LV5A 3SHEA 1OITA 1SVGA 2O5KA 3L8SA 3FXZA 4BDIA 5CAUA 3BGPA 4I92A 3UC4A 3DLZA 1U4DA 4HGTA 4RGJA 4USEA 1OL5A 4C0TA 4NWMA 4I0RA 2RSVA 3P1AA 2XKDA 4ITJA 2C30A 4M7IA 3C0IA 4NM7A 4P5QA 4WSQA 3COMA 4APCA 5LOHA 4FKQA 4U0IA 2Y4IB 2OF4A 3W10A 5CANA 3E5AA 5IQIA 2VX1A 2XNEA 4FX3A 4I93A 2GHLA 2X7GA 4WOVA 4XX9A 4IDTA 3DAJA 4GFOA 4RVLA 3SGCA 1TQIA 4AN2A 3PLAE 2JAVA 2AYPA 1SZMA 2X6DA 4UZHA 4XBRA 5C03A 5J5SA 2J7TA 4UY9A 5EW3A 4CGAA 3LJ1A 3NUNA 4IFCA 2E9PA 3R7EA 2ITYA 3VNTA 1ZZLA 3FC2A 4F4PA 4AOIA 1S9JA 1SYKA 4U42A 4XP0A 4E73A 4HVDA 2PUPA 3IECA 3IG7A 2PE2A 4EH5A 4UWCA 3D9VA 2UW9A 4P5ZA 3PZHA 4Y8DA 3CE3A 3QFVA 4LUDA 2EVAA 2ITZA 1W84A 4MXXA 4I21A 2R64A 4U79A 4FTIA 5AA8A 2GNFA 3PA3A 4BDCA 1ND4A 4H1JA 4BN1A 1H25A 2Y7JA 3BYUA 4TY1A 2X7OA 4EUUA 3R8UA 2W1ZA 3N4TA 4BTFA 5AUZA 2B7AA 5LWNA 3TNQB 3SXSA 4FVPA 4O2PA 4ASZA 2PVRA 3ZUVA 3O96A 4RJ5A 5L2QA 4QMXA 1YXTA 2CCIA 3IONA 4LOPA 1YDSE 2OF2A 4LUEA 4PWNA 5TR6A 3QUEA 4MXAA 4WRSA 4ZSEA 4D1SA 4F70A 3HMNA 3D94A 4O86A 4C59A 3KMUA 4ENYA 3P7CA 4QMWA 4LV8A 4EC9A 3GU7A 4FOBA 5EM7A 4IAYA 4I0SA 1UNLA 2QO7A 3PSCA 3BHUA 4RPVA 1P4OA 3JR1A 3BQCA 4BCJA 3HV4A 2FVDA 5EKOA 3Q52A 3HMPA 3PVGA 3ATTA 2Z2WA 4O2ZA 1OKVA 3L9LA 2DUVA 3MPMA 5CVHA 2PE1A 2WIPA 3R8LA 4ANSA 4NW5A 1OECA 2PY3A 4CNHA 1JKTA 2ZB1A 3BGZA 3LQ5A 5HD4A 3QYZA 2YJSA 5CU6A 3RCJA 4FODA 5AA9A 2YDKA 4QPAA 3D0EA 3OZ6A 1P5EA 4BCIA 1GNGA 4D2PA 3TZ8A 4MH7A 5LCKA 3NCGA 5I3OA 4L6QA 4U40A 4BIBA 3Q96A 5GZAA 2FH9A 1Q4LA 3AMYA 2VWXA 3G6GA 3NUYA 4BCFA 2QC6A 2NPQA 2OH0E 3PRIA 2QG5A 4TYHA 3EB0A 3GC9A 2ITQA 3H0YA 3QC4A 4MVFA 5CVGA 4CMOA 1OKZA 3DOGA 2F7EE 3ROYA 4V0GA 4ZSAA 3IW4A 4ITIA 4IC7A 1WAKA 3NPCA 3GENA 3MVMA 4QMUA 3ZZEA 3IW8A 3QAME 4Z3VA 4O0RA 5ANEA 2XP2A 3N9XA 2W1FA 1OBGA 3ZU7A 4ZP5A 3Q5IA 4AN3A 4FZFB 1PYEA 5GJGA 4JJRA 4L68A 4CG9A 3Q53A 2CKOA 3N51A 1FMKA 2CMWA 5I9UA 3AC4A 2UW6A 3Q32A 2R3NA 3ZS5A 5A54A 4RIYB 2H96A 5I9ZA 3NCZA 3PVWA 3NDMA 4GG7A 5IQEA 4BWXA 3SLSA 2JC6A 3RI1A 1Z9XA 1ZOGA 1PRYA 3LCDA 3QRUA 3S1HA 3KXGA 4RA5A 5IA2A 3C4FA 5AV4A 4TXCA 2Z02A 3DS6A 3TXOA 3WZJA 2C1AA 3RMFA 3RK7A 2PZPA 3HKOA 4KSQA 3FQEA 3THBA 3PG1A 2WKMA 4YO4A 4JDKA 3FYJX 4ZSJA 3MV5A 1W8CA 3NNUA 3R9HA 2R0IA 1Y6BA 3V51A 3D5VA 4DG2E 4PMSA 3UO6A 4C3PA 4M13A 4ZY5A 2QLQA 5GIOE 4WRGA 2I0HA 4EH8A 5AR4A 1QPCA 1XH9A 3CJFA 2J0MB 2BKKA 2YERA 4W4XA 3ZUTA 4JBPA 3QZGA 1VYWA 5B2KA 5AUVA 4TZRA 3CCNA 3E8CA 3HX4A 4KIPA 2BALA 4D1XA 2JIIA 3RHKA 3VVHA 2YA9A 3MPTA 1OIRA 3QTUA 4FVQA 2BVAA 3OXIA 4C58A 4RX5A 4G3CA 3VIDA 2WTDA 3AC8A 4BDGA 4BDBA 5LMBA 4M97A 4A06A 1ZAOA 3KK9A 3KXNA 3OY1A 3PJ8A 3TEIA 3U55A 4TL0A 4MHAA 5CTPA 4FVRA 3EFWA 4R7HA 3ZDIA 4YJVA 3IW5A 3G6HA 3MY0A 3ORIA 3H3CA 4F1MA 3U6HA 4FKPA 3VHEA 5JQ8A 2ZV7A 2Z60A 4M0ZA 2XMYA 4WG3A 3TIZA 3T8OA 1H1QA 2BRMA 3GQLA 3EN5A 3HDMA 4D0WA 3TUBA 2BZIB 3AC2A 4YJNA 1YKRA 2YHVA 2ACXA 3H9RA 5IQAA 4PV0A 4F0FA 4DFXE 3P08A 4L3PA 2W5HA 3KU2A 4B99A 5A9UA 3GCPA 5BPYA 1ZWSA 2ONLA 2VTRA 4OTFA 3V04A 3ALOA 4C8BA 1PXJA 3S0OA 1IAHA 2PYWA 2C6LA 1KOAA 4J97A 4QP9A 4NCTC 3ZUUA 3UQGA 1WBVA 1P2AA 3FKOA 4EZ3A 5K9IA 2C0TA 3ULZA 5C1QB 4U8ZA 2XIYA 3EFKA 4EK4A 3PXQA 4KKEA 5LARA 3V5TA 3R04A 3VO3A 4EORA 3WF5A 4JL9A 5KMOA 2RFDA 5KNJA 1CMKE 2HXLA 1NY3A 4KUJA 4FTTA 4E6AA 3WF7A 2X2LA 4GU6A 4MXCA 4OTGA 4E93A 3EL7A 3CSVA 4Z55A 1M2QA 5HVKA 2E9OA 5KUPA 2HZ4A 2QO2A 5EQPA 4F6SA 2EU9A 2W1EA 3PJ1A 5HI2A 4BICA 4ZMEA 3ZLYA 4O7ZA 4G6LA 5E92A 2WMSA 5ITAA 4IX4A 3R8PA 1XKKA 3D2KA 5M4IA 3SG9A 4Y46A 2GNIA 5CF8A 1ZZ2A 2F57A 3MFSA 2W4KA 5AP5A 3DB8A 4LGHA 4GH2A 1Q62A 3UJGA 3ZCLA 1HCLA 1QCFA 5ETIA 4FK3A 4G5JA 1WVWA 2FSLX 2GFSA 2RG6A 4QYEA 3QRKA 5CU3A 4AX8A 5EH0A 4RJ4A 1Y6AA 4IACA 2WTVA 4FK6A 5CT0A 5FDXA 1TQPA 5FXSA 1M7NA 3ZDUA 3OS3A 2J90A 3ZEPA 2GQSA 3A7IA 5BVDA 1RDQE 5JQ5A 3ODZX 4QO9A 4RT7A 4O0TA 5HG8A 2VD5A 4Q9SA 3F61A 2QONA 5EK7A 3FHRA 4S33A 5BMMA 2FA2A 2R3RA 3QF9A 3NVKI 2X4FA 2UVYA 3TJCA 4MNEB 4EOKA 3BX5A 5DBXA 1YHVA 1OUYA 2WMBA 2GCDA 2XKEA 2KTYA 3NNWA 3R01A 4YHJA 4CCBA 4WO5A 5HG5A 5J9LA 4DC2A 1U54A 4AOJA 2VTPA 3OWLA 4H05A 4QMYA 3O8PA 4GVJA 3QUDA 4CFWA 1GIJA 4AGDA 5CXHA 5AIRA 3FKLA 5FXRA 4WG5A 4A07A 2YJRA 3KVWA 2IW8A 3ZLXA 1BI8A 3OMVA 2C6KA 3HP2A 3AD4A 5AWMA 3VS0A 3WARA 3FZ1A 5JFSA 2O65A 1NW1A 2P33A 3FBVA 4FSZA 2J50A 3PSBA 4D4VA 3UDBA 2EB2A 2J2IB 2X6EA 4Y5QA 1JQHA 5DRDA 5AP1A 3AG9A 1W0XC 3OVVA 4BCNA 3I81A 4R7BA 5CEKA 1O6YA 2HW6A 3PJ2A 3P7AA 5K0XA 4WA9A 1ERKA 2XK3A 3OCBA 2PVFA 4ORKA 4NK9A 3RAWA 3R7YA 3UO4A 4MD9E 4QTAA 3A99A 2WFYA 4BZNA 3TCPA 3GXLA 2BIYA 4J99A 2OSCA 5AR8A 5HESA 1PJKA 3LXLA 4AA0A 3NIZA 3HA8A 2VU3A 5CAQA 4GRBA 4FV4A 2YIWA 4LGGA 4LI5A 3RTPA 4FV7A 3OW4A 1H1WA 4CFFA 3BV3A 4QTCA 3EN7A 5AV3A 2YZLA 1H01A 4W4WA 4W8EA 4D2VA 5B2MA 1U5QA 2UZWE 5I4NA 2XA4A 4XS2A 3ORXA 4FTMA 1SNUA 3PXYA 2VTIA 4Z9LA 5LJJA 4E4LA 4DG3E 2BMCA 4UBAA 3AT3A 3A61A 5IUHA 3PG3A 5AAGA 5AP6A 3UYSA 4DBXA 3ALNA 3KQ7A 4F9WA 2BHHA 4BWPA 2OXYA 4A9TA 3RM7A 2O64A 4RRVA 3NSZA 4MK0A 2CHLA 4HNFA 3FL5A 2V7AA 3FC1X 5CS6A 4YHFA 1FOTA 3EQBA 3FZTA 4F7JA 5HQ0A 3OY3A 5FEEA 3W2PA 2Z7QA 2OI4X 3NW7A 3FAAA 3MH1A 3W2RA 4MTAA 4C62A 3DK7A 2QHMA 3VUGA 3POZA 2FSOX 3QXOA 3RAKA 2WMVA 1E9HA 4YJTA 3PE1A 2B9HA 3PZEA 5HNGA 1H8FA 1IAJA 3C5IA 3KXXA 4YTCA 4BDJA 3VBQA 3HZTA 2O2UA 4AFJA 2JIUA 2JD5A 1JLUE 5LVMA 1O6LA 3CY3A 4G3FA 3TWJA 3Q9YA 3E3BX 5ICPA 3VBTA 2W1GA 1WCCA 3GCVA 3V5WA 1NVSA 2WMWA 2YLEA 3FPQA 4ALUA 4IBMA 1ZOEA 4QT1A 3CBLA 2ZV9A 4ARKA 4ZXTA 1NA7A 4QMNA 1QPDA 4KBKA 2OBJA 2UZNA 4XOYA 5EW8A 1T45A 4N4SA 4DAWA 4NUSA 3DBFA 5FG8A 3MW1A 3C4XA 3ANRA 2IVSA 3Q4TA 3CTHA 4O38A 3TJDA 4AE6A 4C2WA 3GU4A 3HEGA 3H4JA 2G9XA 3SOAA 4O7RA 3BWJA 3HP5A 4IB0A 4P90A 4EHZA 4XG7A 4G9CA 3OTVA 4AOTA 2W7XA 4O7LA 5J9YA 4QQ5A 4JBOA 3UVPA 4BHZA 5DMZA 4GW8A 4BL1A 5ETCA 3R0TA 4LRMA 1HCKA 4PPAA 3Q6UA 5DPVA 5EHLA 4EK3A 4EOSA 2B53A 4GL9A 4HZRA 5AP4A 4GYIA 4NSTA 4BDEA 3NUAA 1KUTA 4MXOA 4AZVA 1F3MC 3F2NA 4I1ZA 5IQHA 3QBNA 1ZXEA 4TYIA 3NR9A 5KBRA 4GS6A 4EZ5A 2I40A 5E8ZA 1JWHA 3M11A 4QQCA 4FSWA 3SOCA 3DZOA 4RLKA 4AZTA 1Q8ZA 1KV1A 3DBCA 2OIQA 2H9VA 2QKRA 4UXQA 4YTFA 4KS7A 1CKPA 4M68A 3MH2A 3DY7A 2RIOA 3EQCA 5AV2A 2WIHA 5M4FA 4GIIA 3PPZA 4I5CA 3AT2A 3GCSA 3F3ZA 3GFWA 4RA4A 4EKLA 3EH9A 3G90X 4XYFA 4YZDA 2J5FA 4O1PA 4HCTA 4EZ7A 4KS8A 4FT7A 3R02A 3RK5A 3OF0A 2PMOX 2XEYA 1WVYA 3CPCA 2R3LA 2VWVA 3VS7A 3TL8A 3SXFA 4BYIA 1G3NA 2NRYA 3KF4A 1F5QA 4OTPA 4EQUA 1SMHA 5EI2A 3UZRA 2B9IA 3K5VA 4J71A 2GNHA 2WTWA 4IH8A 4U45A 4DTKA 5I9WA 4A9SA 1CM8A 4LM5A 3ZTXA 3UZPA 5AUTA 5E9EA 3TZ7A 4JS8A 5DOSA 3W8LA 2QVSE 2WU7A 2FUMA 3P7BA 2X81A 5M53A 3I7BA 3OWPA 5CNNA 3C4EA 2B9FA 4U3YA 2LGCA 3CLYA 2C5VA 3PVBA 5JGAA 4XP3A 4ANLA 3F82A 3R21A 4L45A 2CCHA 4FI1A 3VN9A 3O71A 3ZONA 3DQXA 3ORMA 4RIYA 4RIXB 4H3BA 4TN6A 4NM0A 5ANKA 4WNPA 2OZOA 4ACHA 2PK9A 2E9UA 3HDNA 3QRTA 5FEDA 4BI0A 5BMSA 5CSHA 3IGGA 4RC4A 2QODA 5M44A 1OB3A 4FIJA 4FTCA 3F7ZA 3BPRA 4L43A 1XBBA 1YWRA 3HMMA 4FV0A 4MXZA 1H1RA 2YIXA 2IZTA 5DN3A 5K4JA 5HLPA 4HVIA 4QYHA 1I44A 2WGJA 4UMTA 5AV0A 2Y6OA 1JBPE 3HUBA 3FI8A 1LR4A 3GFEA 5EKNA 3MFTA 4FEWA 4ZMFA 4OTHA 2VGOA 1UWJA 2WZJA 4KKGA 4XEYA 1OVEA 3WIGA 4BDKA 4MBLA 3NGAA 3Q4CA 3KFAA 4EKKA 4OBPA 4R8QA 5CU2A 4LL5A 4AACA 4CRSA 2RL5A 3OBJA 4E6QA 3QD2B 3MI9A 3R73A 4U41A 1YXUA 2EXCX 3G51A 3K5UA 5ANJA 4OTIA 1PXKA 2VRXA 4IZ7A 4USDA 3ZO4A 4G31A 4LOOA 4MAOA 4GK4A 3DT1A 3ZBFA 4DEIA 4FNZA 4G2FA 3NX8A 1Q8WA 2VWWA 4PPBA 4HVHA 3TM0A 1R78A 1PXPA 3WBLA 4EUTA 3QQHA 2VTOA 5I5ZA 3DKOA 2BCJA 4C34A 5A4LA 4CZUA 1TKIA 5T3QA 2V22A 3VUDA 2PVLA 3C13A 4FKSA 3ZRKA 4O0YA 4ACCA 2BROA 3VUKA 1H1SA 5E1EA 4TNDA 4BC6A 3R9NA 4C37A 3P79A 3QD0A 3UVRA 1A9UA 2YIQA 5BQ0A 3V5JA 4DFBA 3A4PA 4DHFA 4YC8A 2I6LA 3R9OA 3ZC5A 2JKQA 4PL3A 2CKPA 2HK5A 2XM9A 2XKFA 4USFA 4UXLA 5DT0A 3I1AA 4KBCA 4YPDA 1YWVA 4Q2AA 5HBJA 1XH5A 2R3HA 4ZJVA 5FWKK 4J95A 4RLLA 5E7RA 4BBMA 2X0GA 4KWPA 2XNNA 2OO8X 4FGBA 3ENMA 4D9UA 1BI7A 3DK6A 1XH6A 4HGLA 3FE3A 4P2KA 4NM3A 2QOIA 3FZRA 4V01A 5CF5A 4FT9A 4TTHB 5IKWA 3HV3A 3BWFA 4J53A 3TZMA 3CEKA 3MB6A 3BLRA 4FKUA 4NTSA 2WQNA 3RALA 4PX6A 4CQGA 4D2SA 2W99B 4A9RA 1OBDA 3MTFA 4F0IA 3AD6A 3FMHA 1AD5A 4RVKA 4IADA 5HCZA 3E7OA 4AZFA 4DCAA 3MJ1A 2XNOA 5DVRA 1FVRA 3UTOA 5AP3A 3DJ7A 3TKUA 3A7JA 5E90A 5AUXA 1JOWB 5EM6A 4DEAA 3PXKA 1T46A 4BIEA 4TYJA 5F4NA 4K1BA 4JX3A 1Q99A 4IWDA 2LAVA 4I6BA 3KEXA 2RFEA 3ROCA 3B8QA 4I20A 5DH3A 3JUHA 4D2TA 4G3GA 1OPJA 4EOMA 3RK9A 3C4CA 4KB8A 3QCXA 4PRJA 3NYNA 3AT4A 4BCQA 4MNEA 5CEIA 3VF9A 2BTRA 1WFCA 4PUZA 4D4SA 4CMUA 4PMMA 3CTJA 2BDFA 3TTIA 4BF2A 4EH2A 3S3IA 4BKYA 1WBSA 2BRGA 2IO6A 1H4LA 2OFUA 4EOQA 3TUCA 3D4QA 4F7NA 3PLSA 3UQCA 3P23A 2QQ7A 3SXRA 5FP6A 3RJCA 5AR5A 5LMKC 3IW7A 2VNWA 3ET7A 2XK7A 3BBTB 4HYSA 1CDKA 5CZHA 3LMGA 4DGOA 5IA4A 4BI2A 3CPBA 1E1XA 1KE9A 2OK1A 4FBXA 4QP6A 5LCJA 4NYEA 3EN4A 2XBJA 3W2SA 3HL7A 3HRBA 2BR1A 5EYKA 1PXOA 4FTQA 4QPMA 1R0PA 4U81A 4ERWA 2NP8A 2PSQA 4ZLOA 2VTJA 4O0WA 2I7QA 1LUFA 3M1SA 2WNTA 2BRBA 4IZYA 3P9JA 4HCUA 3UQFA 5GHVA 3ANQA 3LFEA 1YOMA 4FZ7A 5CQWA 3FLYA 1OL6A 1VEBA 4NFMA 2W1DA 3PVUA 5LVPA 1P14A 4OW8A 4AFEA 3JVSA 1PXMA 3F5GA 4N70A 1YXVA 3FLNC 3HGKA 4EOJA 4EEVA 2IZSA 4II5A 3TI1A 1IA8A 2XYNA 2BRHA 1W82A 2UZOA 4JRVA 1XJDA 4O21A 4O6LA 4QYFA 3UIUA 4E5BA 2UZLA 5CSVA 3G15A 4FSQA 4EOPA 2R3MA 3P4KA 1H24A 5FXQA 4M14A 2XS0A 2JKKA 3PY3A 4S34A 3FQSA 2P2IA 3QU0A 4GFMA 4AT4A 4QNAA 4R3RA 2AC5A 2R3GA 4NFNA 4TWCA 2WTKB 5IH5A 3LMIA 3RWPA 3QLFA 3RGFA 3LXNA 4DN5A 1UWHA 5CF4A 4F63A 4R3CA 4YZBA 2Z7SA 4JIKA 4UMUA 2UW0A 5E1SA 5IEXA 3LOKA 2XK9A 3KXMA 4QOXA 1BUHA 5AFVA 2OKRA 3UPXA 2GNJA 3GC0A 3Q9ZA 2B9JA 3PA5A 4YSMA 3SV0A 3QD4A 4UWBA 4C33A 4C4IA 1OUKA 3NLBA 1AQ1A 2PWLA 3IDCA 4RFZA 5HIBA 4FSMA 3FHIA 4O0UA 3KRLA 5A3XA 4C2VA 4F65A 5IH4A 5L8KA 2JIVA 2WMTA 1XQZA 2YCSA 3EZRA 5FUTA 3EIDA 5EYCA 3JVRA 5L6WL 3QTWA 4E6CA 3RKBA 1H26A 2FGIA 2QI8A 3UOKA 5E8TA 2Z7RA 5AR7A 4EWQA 1X8BA 3R9DA 3R6XA 1Y8GA 3EFJA 5KHWA 4O7NA 3VUTA 3QA8A 4RSSA 3F2AA 4TYGA 4YHTA 2XK4A 2QKWB 1Q8YA 3I6UA 2C68A 3B8RA 2Z8CA 3ATSA 5DR2A 4DFNA 5FDPA 4C4JA 3IDPA 4HYUA 2PUIA 3FXXA 1PYXA 4UALA 5AUUA 3KRWA 4U80A 2VO0A 4YPSA 4N6ZA 4ZZOA 2CGXA 2W4JA 2J0LA 1WBTA 3FMNA 3LVPA 3ZXTA 3FLQA 4X7QA 3TDWA 1PW2A 2UZUE 3PP0A 2BAJA 4EWHA 3D5UA 4FL1A 5H8BA 1JSTA 2B0QA 5IMXA 1OKWA 3R8VA 3O7LB 3BLQA 3QTIA 3B2TA 5IQFA 1BL7A 4YJSA 1U5RA 4ZSGA 4AWIA 4O27B 4I6HA 4EK6A 4G34A 4ENXA 2OJJA 2JFMA 3CR0A 4OT5A 2R5TA 3HRCA 3WE8A 2C6TA 4AZSA 2PVNA 3FMJA 5KO1A 5KKRB 5I9VA 3SD0A 1YOLA 3QALE 3CKXA 2A1AB 2PL0A 4L44A 3GU5A 4C4FA 4EOLA 3BZ3A 2E9NA 3TKHA 1PY5A 2B4SB 1M17A 5DI1A 4E8AA 3DXQA 4H36A 4JBQA 4AN9A 2EWAA 2H6DA 2BFYA 5HCXA 2F4JA 3S4QA 4YUQA 4PNKA 2R3PA 4CFMA 5J5TA 5BVKA 2ZDTA 5EDPA 4A7CA 5AUYA 2VWUA 4MD7E 5K0KA 3VW6A 2EB3A 2WB8A 4QP8A 4L7FA 5M4UA 2ERZE 4IE9A 2Q0BA 3R1NA 1IG1A 4ACGA 5C26A 4YJPA 5E8SA 3O51A 3FI2A 3EKKA 1NVRA 5J7BA 3FJQE 3I6WA 4FKRA 3RAHA 1WBPA 4JI9A 2V0DA 5CI7A 4HYIA 4PTGA 2I0YA 4YZCA 4PDSA 1JKLA 2VX0A 3LFQA 1SVHA 5EM5A 3KVXA 2IG7A 3IOKA 4IIRA 3LLTA 4U44A 3A8XA 1GY3A 3MGYA 1OIUA 5ACKA 2SRCA 3VBXA 2C6DA 5AM6A 3NWWA 4G1WA 4UV0A 4RIXA 4YTIA 3EN9A 2YFXA 4O81A 3VS1A 2Z7LA 1GIHA 1RJBA 2YM3A 4JNWA 2W0JA 3NZ0A 5IA5A 4ZIMA 2F9GA 4OTQA 3W32A 4YNOA 3DDPA 4CYJA 3FV8A 4J7BA 4BCOA 2P55A 1OPLA 2BUJA 3KMMA 3O2MA 4EK5A 4XRJA 3DCVA 4CXAA 4BZDA 4FTOA 1W83A 3EWHA 4XRLA 5JSMA 4JG6A 2F49A 4X3FC 3OOGA 3VJNA 3WI6A 4AXAA 5IMEA 4RQVA 4EC8A 4YLKA 3ORLA 3LXKA 5EI8A 3ZLSA 5IDNA 2HELA 3FSFA 2GNLA 2VN9A 3R1SA 4C4HA 4IJ9A 1UKIA 2C1BA 5IF1A 3QLGA 5DG5A 3U6IA 3CD8A 1A48A 2QD9A 5AP2A 3SQQA 4B9DA 4NCTA 2OH4A 2A2AA 4E5WA 1DAWA 4RZVA 5IA3A 2UW3A 3UNJA 1YDRE 2ZYBA 3BKBA 1YDTE 2G2IA 2QLUA 2W5BA 2V7OA 2ZMDA 3GQIA 3MVJA 3R8ZA 2R9SA 3VWAA 1OI9A 2A4LA 3KRXA 4FV9A 4EI4A 4CG8A 4O91A 3AOXA 2ITXA 4AAAA 4UMPA 3GC8A 4FKOA 4BCGA 4M0YA 3FDNA 2XZSA 3OEFX 3E92A 4WUAA 3QKMA 5IUGA 5DLSA 3SDJA 4QMOA 5ETAA 1J7UA 2GQRA 3ENHA 3K2LA 4XG3A 4EJ7A 1GOLA 3UE4A 1B39A 2HW7A 4TYEA 1MRVA 4MF0A 4FL3A 4NU1A 3VW8A 2ZJWA 2REIA 5CEMA 4FTJA 4FYOA 4IAZA 4IEBA 1IASA 2WOUA 5JKGA 4DFLA 1O9UA 4FTRA 3O7LD 4DEBA 4IMYA 3DFCB 5H3QA 2J51A 4ACDA 4BVUA 5CLPA 3F5PA 2IZUA 2HAKA 1FQ1B 4TPTA 5LVNA 4IVAA 3DZQA 4YC3A 2RFNA 5EI6A 4JLCA 1YI4A 3VQHA 5JZJA 1Q61A 1XHAA 4ANQA 4LMUA 4UB7A 4EL9A 1OZ1A 4J98A 3H30A 1K3AA 3RBWA 3VUMA 5L2IA 3UG1A 3PUPA 1VZOA 4MX9A 1BMKA 5GJDA 2Y9QA 1NXKA 3FLWA 3CXWA 3PPJA 3FMKA 3ULIA 3A7FA 2C5NA 4I6QA 4O0VA 3AC5A 4GT3A 4W8DA 5CZIA 4AW2A 3CQEA 4BFMA 3V8SA 3TUDA 2WU6A 3TNIA 5CEPA 3JXWA 2YM6A 2C3JA 3TNWA 4AG8A 4C57A 2JLDA 2G2FA 1JKKA 2IW9A 4C36A 4HVSA 2VZ6A 4JAJA 4YGAA 4N57A 2OW3A 4F1TA 3ZMMA 3A4OX 2ERKA 5CWZA 2Y6MA 2VTLA 5LVLA 3RZFA 5A46A 5DR6A 4PTCA 2WXVA 3KC3A 2F2CB 5J1VA 2CKQA 4H3PA 3EYGA 2NRUA 1FINA 4FOCA 1FGKA 3E93A 2HY81 3KL8A 1UV5A 3OG7A 1DAYA 3OFMA 3ZSIA 1J1BA 2XYUA 5DWRA 4BCHA 4RC3A 3U4WA 3QYWA 5M08A 3EQIA 1DM2A 4L52A 3R1QA 4UYNA 5F9EA 1UNGA 2H34A 4R78A 1PMVA 2VWBA 2XVDA 3K54A 5TE0A 3TIYA 3V6SA 3ZO3A 4E1ZA 5L2SA 3QTZA 5IPJA 3ZEWA 1FVVA 4FTUA 4C4EA 4AS0A 2X9EA 3HECA 4P4CA 4R77A 4Z7HA 4Y83A 2KULA 4TWOA 4LMNA 3ZM9A 1WBNA 4HOKA 5EYDA 5T68A 5DIAA 1XH7A 2QR8A 2XUUA 3KULB 4L67A 1Y91A 2VO7A 2C3LA 1ZOHA 2GS2A 2X7FA 1UVRA 2W05A 3EQFA 4XV3A 4QYYA 5E8YA 3AC3A 4HPUE 2CNVA 4X2NA 4DYMA 2PU8A 3C50A 4K8AA 2R2PA 3PXZA 4F7LA 2GPHA 2ETRA 3OTUA 4H58A 1YI6A 2ITVA 4KSPA 1ZMVA 3D15A 5AIKA 5B2LA 3QQUA 3PE2A 3NUSA 3G9NA 3DLSA 4G6OA 3U4UA 5BYZA 4BB4A 3RPOA 3V5LA 2A0CX 2JDRA 4HJOA 3RINA 3BYSA 2VTMA 4JAIA 3F6XA 4ZS0A 5DYJA 2CLQA 3WILA 2C5XA 2WMUA 4M3QA 2I0VA 3QQLA 2RFSA 3OEZA 5D41A 3RPVA 2GDOA 2Y0AA 1QPJA 2XM8A 1WZYA 4YZMA 3EL8A 1H0VA 4B8MA 3BHYA 4OTDA 4TT7A 5KCVA 5IQBA 3LAUA 3QQGA 4JOAA 3HA6A 3QQKA 3RM6A 3FLZA 4R7IA 1H0WA 5E8UA 2GMXA 4IZ5A 5HLNA 5AR3A 2OXDA 4LFIA 5HE2A 3LCSA 2JBPA 5CAOA 3G33A 4AGWA 3CS9A 3MY1A 4D2RA 5L3AA 5L6PA 2P0CA 5BVFA 2W96B 4RFMA 2XB7A 2HZIA 3U6JA 2R7IA 4FGRA 4D5KA 2XNGA 2OGVA 2XIRA 4LL0A 3QQJA 4IVCA 2C69A 5EFQA 4E4NA 5GZ8A 4BKJA 4IAKA 5HO7A 4HYHA 1VJYA 2QOOA 5IQGA 3QHRA 5TT7A 1MRUA 2PTKA 3CY2A 2GTMA 5GIPE 2YM5A 3LFFA 5JEBA 4IW0A 5M55A 1YW2A 2R3KA 4FT0A 2RG5A 3AQVA 5CQUA 4YU2A 4JR7A 4XV2A 4S2ZA 4BBFA 3ACJA 3ZSGA 3IPHA 1H08A 4U6RA 3F3UA 5HTCA 2WTJA 4AT5A 5CYIA 2RF9A 4QMPA 5LMAA 3KRJA 5L2WA 3OT3A 3KXZA 4WKQA 3DA6A 3S95A 3TV6A 2YM8A 4LGDA 2ESMA 1UKHA 4WNKA 4FKWA 4DGLC 4F08A 4L00A 4EYMA 4EOIA 2CSNA 4FSNA 3DPKA 4QQJA 5CF6A 1ZARA 2GU8A 4KIKB 2WTKC 3PIZA 2IN6A 4X2KA 4UN0C 3PFQA 4JVGA 1QMZA 3VS2A 3NW5A 2PMLX 5CX9A 2WMRA 5DA3A 2VNYA 3Q9WA 1PKDA 3CKWA 4J96A 4KAOA 4MNFA 5AP0A 2QOCA 5C27A 4CVAA 4D0XA 4E4MA 3P86A 5IU2A 3D14A 4QMLA 4AP7A 2UZBA 3COHA 4GSBA 4MD8E 3OWKA 4ZTQA 2R4BA 3PSDA 4RJ6A 4S31A 3OWJA 2HZ0A 4TNBA 3UMXA 4QQTA 2WTCA 4ZLYA 4E20A 5HKMA 1H1PA 4GT5A 3IS5A 2WELA 5EHOA 3D7ZA 5AX3A 5L2TA 5M51A 2XJ2A 4ANBA 4DF3A 3HV5A 3PXFA 4MBIA 3FUPA 3SVVA 3CTQA 1B38A 2UW5A 2YAKA
chains in the Genus database with same CATH superfamily
4DH7A 1RE8A 3OCTA 3ZRMA 1TVOA 1UU7A 4NM5A 4C38A 5AM7A 5CI6A 4D55A 2BAQA 2PHKA 3OCGA 4F09A 3ZHPC 3D83A 5BUIA 3BYVA 3FSKA 4RJ7A 4L3JA 4X2GA 4IB3A 4XOZA 3HMOA 2GTNA 4OBQA 4OLIA 4BKZA 5KBQA 4C3RA 2GS6A 1ZYCA 5HU9A 3FY0A 4KBAA 4DHIB 5HZNA 4GEOA 4FIGA 4NW6A 3UYTA 4L01A 2DWBA 2GHMA 3F3VA 4JR3A 4DH8A 4GKIA 2PMNX 3MBLA 3U54A 2OWBA 4X3FB 3DB6A 4I0TA 1QPEA 4LG4A 4CCUA 3W2QA 2WOTA 3IOPA 2YLFA 2BFXA 2W06A 1H00A 1GZ8A 4JXFA 4WUNA 5KHXA 3WE4A 3EQPA 3FXWA 2C3KA 4QMZA 3PY1A 3W18A 5DNRA 3E3PA 3IQ7A 4RX7A 4DEGA 2I1MA 4HGEA 4CD0A 4Y85A 5LVOA 5BV3A 1GZKA 1WVXA 4ZAUA 4FRFA 2R0UA 4FEXA 4GJ2A 3UVQA 5AEPA 2VWZA 2YDIA 5A14A 5KKRC 5HU3A 5HBHA 3UG2A 4ANMA 4QMTA 5K5NA 4CYIA 3A7GA 1J7LA 2HXQA 2WMQA 4QD6A 4RIWB 3T9TA 4MQ2A 3FMLA 4DLJA 3BGQA 5FGKA 2WPAA 4M84A 4Y73A 2CGUA 3DU8A 2XK6A 1ZYSA 5HOAA 4M12A 3TTJA 1M2RA 3OUNB 4FIIA 3COIA 4IVBA 3E63A 3LFAA 4QP3A 5A6NA 1V1KA 3R1YA 3UIMA 5A4TA 5EQEA 3F7WA 5JRSA 2XNPA 3CP9A 3ZLWA 5HHWA 3M2WA 1Q97A 3QWJA 3F5XA 5C4KA 2OJFE 2YIYA 3JY0A 4F1OA 4F9CA 2FSTX 4Y5HA 3V5PA 3PRFA 4UWYA 3GUBA 5K5XA 4M8TA 2QOBA 3VS4A 3KF7A 4DH1A 2WAJA 2X39A 5AAFA 4D4RA 5HTIA 3KMWA 4XJ0A 1XBAA 3UIBA 4OTRA 3FKNA 3GBZA 1CSNA 4FSRA 4RC2A 2BKZA 3SW7A 1ZY4A 2YM7A 4BDFA 4IM2A 4PL4A 4X2FA 1PXLA 4IHPA 3FLSA 3EJ1A 3DAEA 2XH5A 4K18A 4L53A 3KREA 4F99A 4FG9A 1KE5A 4K77A 3KY2A 3QC9A 3L9PA 4XLIA 4U97A 3ZOSA 4HZSA 2O8YA 5DT4A 5JZNA 4CT1A 4MWIA 2OG8A 3ZO1A 5CSXA 4K6ZA 4C7TA 1FMOE 2OIBA 4MYGA 1L3RE 2CJMA 3U51A 2QOKA 1I09A 2HENA 2HYYA 2XJ1A 3I5ZA 4MEDA 4NH1A 1W7HA 2UZDA 1KSWA 3VUHA 3UPZA 5C9CA 3F69A 4C3FA 1GJOA 4BGHA 3QZIA 4YC6A 3VHKA 4B0GA 4BDHA 4DINA 4D5HA 4ZTRA 1VYZA 2BTSA 2QU6A 3KRRA 3LHJA 4WSYA 4XCUA 3MYGA 3KGAA 3NAXA 4AW5A 2UZVA 4I24A 3CGOA 3R2BA 3UP7A 1L8TA 5BVEA 4CEGA 2C6OA 4OAVB 3FYKX 1G8AA 3N4VA 1APME 1YVJA 3FWQA 4NIFB 2IVTA 3OUKA 4O96A 2IVUA 3PIYA 2C47A 3NFFB 4QMSA 2XEZA 2YWVA 1ATPE 3U87A 4WIHA 5EG3A 4C35A 2QCSA 4NJDA 3R71A 4GUEA 1XH8A 2IEWA 4NJ3A 3HVCA 4RX8A 4EH6A 4F64A 3P5JC 3TG1A 4FA2A 5EYMA 3UZTA 2UVXA 2IPXA 4GCJA 4GT4A 2PUNA 4NKAA 5EDRA 4EHVA 2DQ7X 5LMKA 4L7SA 4I5MA 2YEXA 1XO2B 2QOFA 5J8IA 2YABA 4RWLA 1ZRZA 3W33A 4DFYA 3QXPA 1GAGA 2EXMA 1CKIA 2P4IA 3AD5A 2QU5A 2VAGA 4CFVA 4AQCA 3R9RA 3E8NA 3VS5A 4CSVA 4DT9A 2BZKB 3WZKA 5GINE 2ITUA 2V62A 3UGCA 1B6CB 3UNZA 4BCPA 3DQWA 4NEUA 3MH3A 4YTHA 2YAAA 4KINA 2J5EA 3OROA 4FKVA 3F5UA 4B7TA 4E26A 5GJFA 3ZFXA 1Q41A 4FIEA 2YCRA 2CN5A 5CXZA 3BYMA 2Q0NA 4EK8A 4KIOA 4E7WA 4FMQA 4PDPA 2R3FA 1GIIA 4MCVA 4G3EA 2C3IB 5AADA 3IO7A 5JFXA 2ZVAA 2BDWA 3ZFMA 4DFZE 1M14A 2QOHA 3MS9A 3QHWA 5DFPA 3JPVA 4JQ8A 3RNIA 2QO9A 5D7VA 5BUJA 1FGIA 5IEYA 3AKJA 3TDVA 3JYAA 4I22A 4DTBA 1W2CA 2JDOA 4R3PA 5FBOA 5C01A 3EN6A 4IFGA 3FPMA 3LMHA 3KULA 3ZYAA 4QMQA 1KE6A 4O22A 3BEAA 1WBWA 2FB8A 4AXDA 4RJ8A 2E2BA 4QRCA 4Y95A 3WZDA 3HAMA 1Q24A 2IJMA 4ITHA 3RZBA 4IZAA 5AAEA 2R3OA 5CAVA 3GT8A 5FQDC 3FMMA 3CQWA 3ORTA 4O6EA 5D10A 1XMMA 5E8XA 3RCDA 5HX8A 4AGCA 3TKIA 2UV2A 4QYGA 3T9IA 4AQKA 5A4QA 5HX6A 1PXIA 4IAFA 4IX3A 4XMOA 4G17A 2UW8A 3NUXA 5HVJA 3R22A 5ACBC 2F7XE 4IB1A 3V6RA 1REKA 2XBAA 3WZUA 3UNKA 3LCTA 4BRXA 1M52A 2FYSA 2WTIA 4G16A 3E8DA 4G5PA 4ZJJA 3ACKA 1Y57A 3P5KA 4FKTA 5F1ZA 4ZJIA 3TYKA 5M06A 1FVTA 2HCKA 4FL2A 4XG6A 4O7TA 2PULA 2VV9A 1YHWA 4OUCA 3DAKA 3VS3A 3BE2A 3Q60A 1BLXA 5JH6A 4MBJA 5CEQA 4FV3A 4DGNA 2G01A 4FTAA 3UOLA 4O0XA 2ITWA 3PJCA 5HTBA 5IG1A 3IW6A 4H3QA 1PF8A 3II5A 2YITA 2ZAZA 4KRDA 3E62A 2WEIA 3GCQA 3LJ2A 4WHZA 4X6RA 1YOJA 4BZOA 4H39A 4ZZNA 4AF3A 4E5AX 4QP7A 1JSVA 1H07A 4CZTA 4O4EA 2YM4A 3DNDA 3W16A 5A6OA 3BYOA 2JDVA 4FT5A 4CRLA 2CLXA 3H9OA 2XNBA 2XIZA 3I0QA 2JBOA 3A60A 2C5YA 2J9MA 3GOKA 4K2RA 4R6VA 4TWNA 2X8IA 1OMWA 2VTHA 3LW0A 4QP4A 5FD2A 4DH3A 3QZHA 3PWYA 3QCYA 1NVQA 2CN8A 3BELA 5H8GA 4YJOA 2OJIA 5BX0A 1M2PA 4OR5A 3BI6A 2Y4PA 3ORPA 3WYYA 4DEHA 2G2HA 2ZMCA 3PXRA 4YJUA 3HV7A 4XUFA 5M09A 4RFYA 3Q2JA 4XG9A 4BTJA 3G0EA 3CIKA 2J0KA 3TNPC 3W1FA 4HVGA 4AT3A 2QURA 4U9AA 3FMEA 4R5YA 4W9WA 2XKCA 3PDTA 3COKA 2WQOA 2PE0A 4IM3A 5KZ0A 4ZOGA 3WF6A 4CTCA 4KIKA 3DJ6A 4HW7A 4B4LA 3Q4ZA 5I9YA 3O8TA 2PZIA 3LFBA 5FLFA 5HGIA 1ZMWA 2A19B 3QX4A 1Q8TA 4W4YA 5D11A 4FICA 3ORZA 1ST0A 3SC1A 3W2OA 2ZV8A 3UC3A 5A4CA 3TN8A 4DE4A 3L1SA 3MDYA 2WD1A 3RP9A 4C4GA 3MA3A 3S00A 4LRJA 3NIEA 3VRZA 3N4UA 3WOWA 4BYJA 4JG7A 5HIEA 1ZYDA 5J7HA 5IQDA 4RWIA 3DBQA 3VJOA 2PUUA 4DT8A 2C6IA 2I0EA 5DR9A 2F2UA 4EHGA 2NNWB 3BLAA 4FKIA 3WYXA 4Z16A 3EOCA 5KMNA 4MKCA 4WBOA 5IUIA 5AR2A 4RX9A 4DCEA 3OOMA 3EQDA 3PWDA 2QG7A 2WEVA 1MQBA 2J4ZA 4PY1A 3UMWA 4CV9A 5BVOA 4J8NA 3F3TA 3BCEA 3DBDA 3IKAA 3D7TB 1XH4A 3C0GA 5JFWA 4FEUA 4WNMA 1OKYA 3OP5A 3EMGA 4YURA 2WQEA 4FR4A 1WBOA 3VC4A 3AGLA 4A4LA 1PHKA 3OCSA 2VTTA 2CPKE 3GC7A 5D1JA 4ACMA 1OL7A 4ASEA 3BV2A 3C4ZA 2YZAA 4JIAA 2W9FB 1P4FA 1O6KA 2XCHA 3SG8A 2GQGA 3ZC6A 2X8EA 3KXHA 3POOA 3GU8A 3PTGA 4BBEA 3I7CA 3PJ3A 4X3FA 1YQJA 5H2UA 5HNBA 3VQUA 4BGQA 4EBVA 4QNYA 4DG0E 5L4QA 3KCFA 1UU8A 4KABA 5DGZA 2ETKA 1MQ4A 3CD3A 4JDIA 2OZAB 3KK8A 2CKEA 2PZYA 3K3JA 5HD7A 2ZM4A 5F95A 4FV2A 4CTBA 3UOJA 3FZOA 3MB7A 3IDBA 1Q5KA 4PL5A 3WZEA 3ZRLA 5CEOA 3KB7A 4LRKA 2BDJA 5GZ9A 5FTGA 2ZM1A 5KMJA 4RWJA 2YCFA 1JVPP 3CGFA 2B1PA 3MSSA 3NNVA 3OXZA 4F9AA 1H27A 1R0EA 5M56A 3MY5A 2ZV2A 4NKSA 4EYJA 4OT6A 4XNEA 3AGMA 1OIYA 4FNXA 4RIWA 4S32A 5KX8A 3A7HA 4IWOA 2X9FA 2XIKA 4WT6A 3C9WA 2WQBA 5HO6A 4FG7A 2DS1A 5HO8A 5IISA 1ZLTA 3LFNA 5B0XA 4IC8A 2AUHA 1JPAA 4FF8A 1YHSA 4V04A 4O7SA 1ZYLA 4YO6A 2W4OA 5IH6A 4IM0A 2XRWA 4PQNA 1LEWA 2BAKA 4IWPA 5E4HA 3DK3A 2JKOA 1KE7A 5JGBA 4O84A 2FO0A 3S2PA 2P2HA 5FM3A 5CSPA 2BZHB 3EKNA 4HGSA 2PVMA 4JDJA 5EDQA 4FSYA 2OJ9A 3BIZA 4ONAA 5LXMA 3RVGA 4J8MA 4IWQA 5BNJA 4FKGA 3QTSA 4KD1A 4A4OA 4C61A 4D9TA 1XBCA 4M67A 1RQQA 5IA0A 4FE2A 3BU5A 4F7SA 3GNIB 3GGFA 5AMNA 4DH5A 2BPMA 4FZDB 4PMPA 4CKRA 3BL9A 3E8EA 3VBWA 1CKJA 4BTKA 4AXCA 3G0FA 2ITOA 2XJ0A 4X3JA 2QNJA 4J52A 3ID6C 5GNKA 4D4YA 2OIDA 3PYYA 5HIDA 3OT8A 2O63A 2P3GX 4CMTA 3QUPA 2ZM3A 4ANOA 1URCA 3HMIA 3RHXA 5IQCA 1TQMA 4BCMA 2ZOQA 3CC6A 3F66A 3G5DA 1V0BA 4ZK5A 4DDGA 4GIHA 4JX7A 4UEUA 2C4GA 4S30A 4G9RA 4EBWA 5M57A 1FPUA 2EXEA 3RPSA 5KMKA 5KE0A 4Q5EA 3CJGA 1R39A 4L46A 3V8TA 2IW6A 5IA1A 1IRKA 3MIYA 2UZTA 3A8WA 3FY2A 4RJ3A 5D12A 5G6VA 1Q3WA 3WF9A 3Q3BA 5BUEA 3FI4A 4GK2A 4F9YA 3DGKA 4NTTA 5CNOA 2W1HA 3PIXA 4JT3A 3T3VA 3H9FA 4DITA 2VWYA 4EONA 3M42A 2Y8OA 1HOWA 2IWIA 4FSTA 4UMRA 1W98A 3QRIA 4JDHA 4JQEA 4NIFA 3VULA 4PDYA 2PPQA 4O83A 4DA5A 5AP7A 3D2IA 3GVUA 2ZB0A 4M15A 4IB5A 3FL4A 2PMIA 2XCKA 2C0OA 5KMIA 4X2JA 5DEWA 4DEDA 4IX6A 4U3ZA 4Q9ZA 3I4BA 3GEQA 4QPSA 3JY9A 4ZS4A 1M7QA 1R1WA 3LIJA 3KN6A 5CENA 2WQMA 5CY3A 4CLIA 3O17A 3QGWA 3GU6A 3L8PA 4IJPA 3JS2A 4KKHA 4CFUA 1Q3DA 3QWKA 4RWKA 2B52A 3V3VA 4O82A 4AXFA 2XF0A 4K9YA 4AUAA 2ONLC 3Q9XA 4E6DA 4BY9E 2C6MA 3HYHA 3AMBA 2JDSA 4ZY6A 3TV7A 4ALVA 3ETAA 3BHVA 4AZWA 4RQKA 2C6EA 5LWMA 4FV6A 4E3CA 4XBUA 5DEYA 4UYAA 2CNQA 4K33A 3L9MA 1KWPA 3A62A 3DKFA 4O7YA 3DTWA 4G3DA 3E88A 5HCYA 3DFAA 4EH4A 5EM8A 4N0SA 2AEGA 4U5JA 2GNGA 4YJQA 4RIOA 5J9ZA 3FQHA 3QA0A 4GVAA 3QX2A 4UZDA 4Y72A 5T6KA 4TKSA 1OPKA 3WIKA 5K3YA 5HICA 3RAIA 4F9BA 4I4EA 2PVYA 4HPTE 4RBLA 5TKDA 2HWPA 1A06A 2YWPA 2V55A 3HUCA 4LYNA 4F6UA 3ZFYA 1BL6A 5J79A 3SX9A 5HBEA 4D58A 1SM2A 2R3JA 4O7VA 3HRFA 4U43A 4TRLA 1ZY5A 2UW7A 3IK3A 4KIQA 4KRCA 4FIHA 4W4VA 3Q04A 5IZFA 5J87A 5JRQA 2OU7A 4M69B 3NYVA 4APPA 4PPCA 3EFLA 5HLWA 1K9AA 3ZO2A 3VBYA 5ANIA 3ORKA 3MVHA 2AC3A 3GB2A 3QKLA 2UVZA 3AC1A 4EH7A 3SW4A 5H8EA 3LM0A 1J91A 2YDJA 3BHTA 5M4CA 4V05A 4QDVA 2R3IA 3I0OA 3R7GA 2XAOA 1Q8UA 3ZXZA 1S9IA 2XRUA 3ORNA 5FBNC 2PZRA 4FTNA 5E8WA 3RNYA 3CQUA 3TT0A 5AJQA 3V5QA 5JMSA 3DXNA 4QMMA 1FBNA 1OGUA 3LE6A 5EW9A 1V0OA 4IX5A 4K0YA 4BDAA 3PPKA 3KN5A 3ZM4A 4XP2A 2H8HA 1R3CA 4O1OA 4P7EA 4QP1A 2ITNA 2YISA 4PP7A 2G15A 5CAPA 4FV5A 3MWUA 3NNXA 4XG2A 4BTMA 4XG4A 3O0GA 4XV1A 4QP2A 4YZNA 1AGWA 4PTEA 5BVNA 3NUPA 4FNYA 5KZIA 1YRPA 3LFSA 4GMYA 2HY0A 4GJ3A 3EHAA 3F9NA 4RVMA 2X0OA 3ZZWA 2O3PA 4QTEA 3ELJA 3ZSHA 3LQ3A 3KKVA 2XANA 2HOGA 3Q4UA 4Q5HA 4X0MA 1UU9A 2VO6A 4QTDA 4BCKA 3F88A 4ZTHA 3C51A 3QL8A 4D1ZA 3SRVA 3ML1A 4OGRA 2HIWA 3LFDA 4NZWB 1MP8A 2IVVA 2QHNA 2WHBA 3R7VA 3R8MA 2B54A 4I23A 5C8MA 4F0GA 3LXPA 4ID7A 2JITA 4KNBA 3DKGA 5HE3A 3U9NA 2OICA 5DHJA 5L6OA 3KCKA 3QTRA 3MN3A 4I3ZA 5C4LA 1PXNA 3P78A 2RGPA 3UP2A 3EQRA 1GZOA 5B7VA 2DYLA 5AX9A 3VAPA 4DGGA 4E4XA 3I5NA 4WBBB 2Y4IC 3U9CA 5BYYA 5JK3A 3HLLA 4R1VA 4MQ1A 5F20A 4ZTMA 5H9BA 4DDIA 5FP5A 2WO6A 4CV8A 5HEZA 3O50A 4O0SA 3QQFA 4FUYA 3I79A 4FG8A 2X2KA 3R2YA 4ANNA 3R63A 4JBVA 4YMJA 3LJ0A 4B6LA 4YLJA 1JAMA 2IZRA 4IAIA 2R3QA 1OIQA 2GSFA 1GZNA 2R7BA 5D7AA 5DT3A 4ZEGA 1JKSA 3C1XA 2VX3A 4WNOA 4ASDA 4L42A 4FEVA 5D9HA 2JEDA 2W1CA 2NYAA 3OXTA 2QR7A 1YXXA 5CVFA 4IANA 3QCQA 3MPAA 4MXYA 4ZTSA 3GI3A 1LPUA 4J1RA 4U7ZA 5DRBA 5EHYA 3L8XA 2WMAA 5HNIX 1BYGA 3NEWA 2BRNA 4MWHA 3L8VA 4UMQA 3C0HA 3D7TA 3DV3A 4FV1A 4GKHA 3NMUF 4RG0A 1G5SA 3R7IA 4ZTLA 4OTWA 2Q83A 4FT3A 1DI8A 2QOQA 3DTCA 4FEQA 4XG8A 3UODA 3TZ9A 4A9YA 4EH3A 4GK3A 4NT4A 3C4WA 5TO8A 4XHKB 3QCSA 4TYHB 2UZEA 4W9XA 2BZJA 3MIAA 3QKKA 2W5AA 2GS7A 4C02A 1UU3A 2JFLA 4HCVA 2A27A 4V0GB 1SVEA 4GU9A 1BX6A 2JKMA 4FZ6A 3LPBA 4ALWA 3REPA 3KA0A 3DKCA 3EZVA 1DI9A 5HVYA 1IR3A 1XWSA 3MVLA 5FTOA 4PF4A 4ZLZA 5HE0A 2E9VA 5L8LA 3MTLA 1G8SA 3LCKA 4X6QC 2VGPA 1PMEA 2OZAA 4BHNA 3EYHA 3V01A 4I4FA 3VBVA 3GOPA 4GV1A 4YZ9A 3DNEA 2PVJA 4IQ6A 4M66A 3TV4A 3IGOA 1UA2A 3UIXA 3TNHA 5HORA 2X8DA 3MESA 2J0IA 4CFXA 3RPRA 1Z57A 5CU4A 4EHEA 3BRBA 3U8WA 1XMLA 1U59A 1DS5A 1OM1A 4AZEA 3QTXA 3DJ5A 4AGUA 3F3WA 4O7WA 4IDVA 1Z5MA 3QGYA 4G6NA 5ETFA 4EQCA 3BBWA 1RW8A 3BLHA 5JN2A 4I6FA 3LQ8A 3QTQA 4I5PA 1CTPE 4KA3A 5AV1A 5IDPA 3QD3A 2C5OA 3W0QA 3ERKA 3NUUA 5FM2A 4K11A 5C8NA 2FSMX 2VUWA 5EQYA 3R30A 2BIKB 4ASXA 4FYNA 5KMLA 3H10A 4EJNA 2ITPA 2XIXA 3VS6A 3OHTA 4A9UA 3V8WA 3B2WA 2YACA 3W55A 2OXXA 2V5QA 1MUOA 2CGWA 3BQRA 5HG9A 4EOOA 1PMNA 4H1MA 4AA5A 3MFRA 5ANDA 5CU0A 4RMZA 5CT7A 4CFNA 1ZYJA 2CNUA 3HNGA 4PDOA 1YI3A 1XR1A 3O8UA 4JQ7A 4L9IA 4LOQA 4LQMA 3ODYX 4BGGA 5CALA 4QDEA 3F2RA 3BHHA 3NW6A 4OBOA 2JAMA 4ZY4A 3ITZA 4AE9A 3PA4A 2VTAA 1KE8A 3GP0A 4PNIA 3O23A 4XH6A 1VR2A 4A4XA 4YP8A 2RKUA 3A2CA 1WMKA 1K2PA 4JG8A 3RWQA 4FV8A 3MA6A 5AUWA 3UOHA 5FTQA 1U46A 2J0JA 3H0ZA 4PMTA 3AMAA 4BR3A 1QL6A 5A4EA 5E91A 3BE9A 2UW4A 1BKXA 3BU3A 5DE2A 4TWPA 4PP9A 3ZH8A 5IEVA 5KMMA 2EUFB 2VTQA 3OC1A 4QMVA 3BU6A 4AW0A 4GG5A 4I94A 4DTAA 3LLAA 4GYGA 5L8JA 4FNWA 4YNEA 3K3IA 3EQHA 4IVDA 4UX9A 2J6MA 3HAVA 3R7UA 3WF8A 4F6WA 2PVKA 4FIFA 3NS9A 4AU8A 4FSUA 2UUEA 3LM5A 5FRIA 3SAYA 5JGDA 4I41A 1H28A 4ERKA 2W9ZB 3OW3A 5TF9A 3RPYA 1KV2A 3Q2MA 3SA0A 2VTSA 1LEZA 3LFCA 1SNXA 3VUIA 3DXPA 4N6YA 5J95A 2OFVA 2X1NA 4JRNA 3VF8A 1Y8YA 2G1TA 4D28A 2XK8A 3GCUA 3E87A 5HE1A 2GHGA 4R1YA 4I5HA 4OAUC 4CQEA 3SRVB 3BEGA 1YXSA 3D5WA 3FMDA 1J3HA 1LP4A 5I9XA 3QZFA 5HG7A 2VWIA 3W8QA 1UNHA 2WMXA 4BDDA 4BI1A 3W0RA 2W1IA 5G1XA 4AA4A 3NYXA 3HV6A 4DLIA 3FZSA 5FEQA 1YWNA 1KOBA 3PP1A 3FZPA 4FTKA 3ZBXA 3FEGA 3E64A 5E8VA 3LZBA 4QTBA 2CGVA 2W17A 1JSUA 4L8MA 4ZSLA 5JFVA 1IEPA 4WG4A 3Q5ZA 4XV9A 2ZDUA 4RZWA 3QRJA 5K4IA 4B8LA 3I60A 3NRMA 3R28A 3R7OA 3R00A 4FTLA 5LQFA 4FC0A 5JT2A 2JDTA 2O0UA 3NVMB 5BYLA 5TOZA 4ZTNA 2YN8A 4FUXA 4EQMA 3SKCA 1STCE 4BWKA 4XLVA 4YR8A 2ETMA 3NAYA 4DGMA 2VO3A 1J7IA 1NT2A 3AXWA 4DEEA 3FI3A 4GFGA 5C8KA 3UO5A 4DBNA 1MRYA 4X21A 3LKMA 3OBGA 4CKIA 4YSJA 2BILB 3L9NA 4TW9A 1JNKA 4CZYB 3MJ2A 2X4ZA 4YLLA 3C5UA 4YBJA 5I0BA 3G9LX 4BIDA 2BHEA 2OLCA 5J1WA 3PY0A 1REJA 5EOBA 1V0PA 5I3RA 4WD5A 3OD6X 3DDQA 2CDZA 2HWOA 1U54B 1PMUA 2NO3A 2QOLA 3G2FA 1E1VA 3NYOA 3VRYA 2ITTA 3C7QA 3LCOA 4FZAB 5ANGA 1OL2A 3Q6WA 5CSWA 4D2WA 3P0MA 4GUBA 1F0QA 4IAAA 4ZZMA 4EH9A 2XNMA 2OJGA 5BVWA 2GFCA 3W2CA 4CLJA 1OL1A 2X2MA 5ANOA 4CT2A 3MH0A 4L3LA 3TACA 5M07A 4YBKA 1PKGA 1IA9A 5EOLA 4CKJA 3E7VA 4R5SA 2PVHA 2C0IA 2YCQA 2HZNA 2B55A 5CASA 2F7ZE 4FKJA 3DBEA 2IF8A 2JGZA 3MFUA 5F94A 4M69A 1J1CA 4Z7GA 4RVTA 2VTNA 4MF1A 4HNIA 4AW1A 1URWA 4NL0A 3D5XA 4DFUA 2YIRA 3R83A 3T3UA 1EH4A 2PZ5A 3EQGA 4FKLA 3UBDA 4IXPA 1ZMUA 4YJRA 4LV5A 3SHEA 3TMOA 1OITA 1SVGA 2O5KA 3L8SA 3FXZA 4BDIA 5CAUA 3BGPA 4I92A 3UC4A 3DLZA 1U4DA 4HGTA 4RGJA 4USEA 1OL5A 2AQXA 4C0TA 4NWMA 4I0RA 2RSVA 3P1AA 2XKDA 4ITJA 2C30A 4M7IA 3C0IA 4NM7A 4P5QA 4WSQA 3COMA 4APCA 5LOHA 4FKQA 1W2DA 4U0IA 2Y4IB 2OF4A 3W10A 5CANA 3E5AA 5IQIA 2VX1A 2XNEA 4FX3A 4I93A 2GHLA 2X7GA 4WOVA 4XX9A 4IDTA 3DAJA 4GFOA 4RVLA 3SGCA 1TQIA 4AN2A 3PLAE 2JAVA 2AYPA 1SZMA 2X6DA 4UZHA 4XBRA 5C03A 5J5SA 2J7TA 4UY9A 5EW3A 4CGAA 3LJ1A 3NUNA 4IFCA 2E9PA 3R7EA 2ITYA 3VNTA 2A98A 1ZZLA 3FC2A 4F4PA 4AOIA 1S9JA 1SYKA 4U42A 4XP0A 4E73A 4HVDA 2PUPA 3IECA 3IG7A 2PE2A 4EH5A 4UWCA 3D9VA 2UW9A 4P5ZA 3PZHA 4Y8DA 3CE3A 3QFVA 4LUDA 2EVAA 2ITZA 1W84A 4MXXA 4I21A 2R64A 4U79A 4FTIA 5AA8A 2GNFA 3PA3A 4BDCA 1ND4A 4H1JA 4BN1A 1H25A 2Y7JA 3BYUA 4TY1A 3UDZA 2X7OA 4EUUA 3R8UA 2W1ZA 3N4TA 4BTFA 5AUZA 2B7AA 5LWNA 3TNQB 3SXSA 4FVPA 4O2PA 4ASZA 2PVRA 3ZUVA 3O96A 4RJ5A 5L2QA 4QMXA 1YXTA 2CCIA 3IONA 4LOPA 1YDSE 2OF2A 4LUEA 4PWNA 5TR6A 3QUEA 4MXAA 4WRSA 4ZSEA 4D1SA 4F70A 3HMNA 3D94A 4O86A 4C59A 3KMUA 4ENYA 3P7CA 4QMWA 4LV8A 4EC9A 3GU7A 4FOBA 5EM7A 4IAYA 4I0SA 1UNLA 2QO7A 3PSCA 3BHUA 4RPVA 1P4OA 3JR1A 3BQCA 4BCJA 3HV4A 4JMQA 2FVDA 5EKOA 3Q52A 3HMPA 3PVGA 3ATTA 2Z2WA 4O2ZA 1OKVA 3L9LA 2DUVA 3MPMA 5CVHA 1G8JA 2PE1A 2WIPA 3R8LA 4ANSA 4NW5A 1OECA 2PY3A 4CNHA 1JKTA 2ZB1A 3BGZA 3LQ5A 5HD4A 3QYZA 2YJSA 5CU6A 3RCJA 4FODA 5AA9A 2YDKA 4QPAA 3D0EA 3OZ6A 1P5EA 4BCIA 1GNGA 4D2PA 3TZ8A 4MH7A 5LCKA 3NCGA 5I3OA 4L6QA 4U40A 4BIBA 3Q96A 5GZAA 2FH9A 1Q4LA 3AMYA 2VWXA 3G6GA 3NUYA 4BCFA 2QC6A 2NPQA 2OH0E 3PRIA 2QG5A 4TYHA 3EB0A 3GC9A 2ITQA 3H0YA 3QC4A 4MVFA 5CVGA 4CMOA 1OKZA 3DOGA 2F7EE 3ROYA 4O4CA 4V0GA 4ZSAA 3IW4A 4ITIA 4IC7A 1WAKA 3NPCA 3GENA 3MVMA 4QMUA 3ZZEA 3IW8A 3O5AA 3QAME 4Z3VA 4O0RA 5ANEA 2XP2A 3N9XA 2W1FA 1OBGA 3ZU7A 4ZP5A 3Q5IA 4AN3A 4FZFB