4MWIA

Crystal structure of the human mlkl pseudokinase domain
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
278
structure length
266
Chain Sequence
IKEIKKEQLSGSPWILLRENEVSTLYKGEYHRAPVAIKVFKKLQAGSIAIVRQTFNKEIKTMKKFESPNILRIFGICIDETVTPPQFSIVMEYCELGTLRELLDREKDLTLGKRMVLVLGAARGLYRLHHSEAPELHGKIRSSNFLVTQGYQVKLAGFELRKTQDRVKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKIRKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mixed lineage kinase domain-like protein
publication title Insights into the evolution of divergent nucleotide-binding mechanisms among pseudokinases revealed by crystal structures of human and mouse MLKL.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 266
sequence length 278
ec nomenclature
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4mwiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4mwiA01
3P23A 4BTMA 3MFTA 4UYAA 2IVSA 4QMSA 4JRNA 2V7OA 3V5PA 3R9NA 2Z7RA 2WFYA 3DK6A 3I6UA 3OEFX 4ZSLA 2A2AA 2QKWB 3QA0A 4GJ2A 3POOA 4HOKA 4NH1A 5G1XA 5B2LA 3NUPA 4QYEA 4MXOA 4CCUA 1ZY4A 4MWHA 5E90A 3SW4A 2XNMA 3UVQA 4C61A 4CYJA 4DHFA 3DV3A 3CTQA 2F4JA 4AA5A 5BVDA 3DBFA 3H9OA 3PXKA 3KCKA 3WF5A 4QTAA 5EW9A 2ZM3A 5AR8A 4M0ZA 4G3DA 2VO3A 4FX3A 3FI2A 1URCA 1MUOA 3FZTA 2R0IA 2V55A 4GU6A 1V1KA 2FYSA 2R5TA 2BTRA 4I6HA 2BZJA 3MVHA 3ODZX 3OY1A 4AW2A 3DDQA 3LM5A 4X2FA 2ZJWA 3UNZA 3Q4TA 2P33A 4E20A 3P79A 5D1JA 3PE2A 3FPMA 5LMAA 4BKZA 5KO1A 2R3NA 2OJJA 5AP3A 4IB3A 4QMOA 3REPA 5BX0A 3WE8A 4ZZOA 3PJCA 3IS5A 5IH5A 3BE2A 4OTFA 3NNUA 3BCEA 3GB2A 4W4YA 4JG7A 5CU0A 4EWHA 4L43A 2YM7A 2VWWA 3FMJA 3NNXA 5JQ5A 4BHNA 5FG8A 2NRYA 2WTKB 1OKYA 2YDJA 2VTTA 3UTOA 4G5JA 2OLCA 5LWMA 4O86A 4IB1A 2YIQA 5DRDA 3GUBA 1UKHA 2QNJA 4D4VA 3VJNA 2DWBA 4W9XA 4CKRA 4OTDA 3F2RA 4BCGA 2VN9A 1ZMUA 1ZYJA 2RFEA 2WMVA 1H0WA 4U79A 3THBA 1P4FA 3ACJA 3KXNA 4HGEA 3NSZA 4QT1A 2WIHA 4OTWA 4P4CA 4EBVA 3DJ7A 4YJNA 4JG6A 1PXLA 4LL0A 5LVPA 4YZBA 4F9YA 4NM5A 3PG3A 4RFYA 3NW6A 3BHHA 2YIWA 2OFVA 2PMLX 4CT2A 1OIRA 4KD1A 4F9BA 4A7CA 4O0UA 2G1TA 5FUTA 1Z5MA 4ZTHA 3KQ7A 4QOXA 2CNQA 4EL9A 4JVGA 4ZEGA 4O7WA 4WSYA 5HQ0A 3PRFA 2F49A 1R3CA 4F7SA 3NYVA 2PSQA 3DAEA 3NW5A 4J7BA 5IA5A 5K3YA 4BCJA 2PVRA 3Q3BA 4BIBA 4EOKA 3IW5A 2YLFA 5EOBA 1M7NA 4BDGA 3TDWA 5EHOA 3KU2A 3BWFA 3HECA 4FIIA 4XP0A 4ANNA 3R04A 4L9IA 4R78A 2XNEA 1CM8A 2XIRA 4R3RA 4P2KA 3UVPA 4FNZA 4DGNA 3TKIA 2UZEA 1YVJA 3B2WA 4I5PA 2HAKA 4KAOA 2JGZA 4MVFA 5ETFA 4DH3A 1IASA 2WTKC 4RWLA 3KXXA 5ANIA 4A4LA 2WQMA 3NPCA 4FA2A 3NUYA 4IWPA 4RGJA 4RC4A 2RKUA 1F5QA 3VC4A 3RKBA 1O9UA 2GNLA 3IGGA 1FVRA 2CLQA 4IB0A 4AW0A 5C03A 2QO9A 2WTVA 5E8VA 4QD6A 3T9IA 3W1FA 2IVVA 4MX9A 5CVHA 4O7LA 4EBWA 3I1AA 1XJDA 4YO6A 3JXWA 4R7BA 4YJTA 1P2AA 4B8LA 3VS1A 1XH4A 4ZSGA 1ZYSA 4QRCA 4L6QA 4XV9A 2IO6A 4HGLA 3BU5A 2ZMDA 3R71A 4QMXA 3VO3A 2XKDA 2CLXA 4XRLA 4IACA 3RZFA 3PVUA 2IZUA 1Y6BA 2VRXA 5FTQA 3D7TB 3LJ0A 5DHJA 4BCNA 5E7RA 2ITVA 3CC6A 5GZ9A 3F7ZA 3N51A 4PWNA 3EYGA 3RNYA 2XS0A 3CCNA 2A0CX 4U3YA 5HHWA 1CSNA 3TUDA 2PMIA 4MXXA 4BR3A 3K2LA 5BMMA 3F88A 3UIXA 5IQDA 2VO6A 3EN7A 4GJ3A 3A4PA 4I22A 4CG8A 2YM4A 4QP9A 2RFSA 4XBUA 4D55A 1OL2A 4CG9A 4CQGA 4F0IA 1M17A 3ROCA 5E4HA 4AZTA 1Q62A 5DWRA 4FK6A 4O22A 5H9BA 2W1GA 1IRKA 1FQ1B 2XJ0A 4XJ0A 4AW5A 3DQXA 2WEVA 2JKKA 3HV4A 5AV2A 4QPMA 1PMNA 3P7AA 3H10A 1RE8A 4RQVA 2PVJA 3HP5A 4L44A 3VBXA 4JJRA 3D9VA 4BBMA 3BBTB 4M7IA 4L00A 4K0YA 2GHGA 4M12A 3TV4A 2PUUA 1PYEA 1W98A 1FMKA 3ZUVA 2BDJA 3ETAA 3Q96A 4EOLA 2XJ2A 4B4LA 3DJ5A 2IZTA 3CS9A 4JBPA 3UMWA 4N4SA 5TF9A 5B2KA 1UKIA 3K5UA 3PA4A 4G3GA 2Y7JA 3PLAE 3H9RA 1DI9A 2O64A 3BRBA 3EN5A 3KXMA 4YZDA 1MRUA 2JIIA 4L67A 1JKLA 1G3NA 1STCE 4ACHA 4I21A 4K77A 5FBNC 4ANOA 4Q2AA 4DEIA 2UZTA 3FLQA 2HZIA 4EK5A 4AACA 1ZOHA 4YTIA 3LCTA 1B38A 1PXNA 2XIXA 3KVXA 2YA9A 5IDNA 4FYOA 3NLBA 3G9NA 4RIOA 3QRUA 5HE1A 3MW1A 3QD0A 5LOHA 5HTBA 3IDCA 4J95A 3PPJA 4L3LA 2PK9A 4RX9A 1RW8A 3FI4A 3QWJA 4CFUA 2VWVA 1HOWA 4RJ8A 3ZSHA 4OW8A 3FLYA 3AD6A 1ZAOA 3EL7A 4FTKA 5E91A 2VWYA 3SLSA 4GKIA 3RPVA 2IWIA 2PWLA 3D14A 3FYKX 3TXOA 4FKGA 4UBAA 3R7UA 5CAQA 2IJMA 4RMZA 3EFWA 3RCJA 3ZLYA 5EDPA 4YBJA 3LMHA 3A62A 3FL5A 2VTLA 1BYGA 2WZJA 4ZJIA 3II5A 1B6CB 5CSWA 3E87A 2X7GA 2ZV7A 4JI9A 4JLCA 2B52A 3RAIA 3R01A 4C57A 5GJFA 3QLGA 5I9ZA 4EK4A 5KNJA 2W05A 4N0SA 3FWQA 5AP4A 2WMAA 1OIYA 4V0GA 1YWVA 2YM6A 4RFZA 1H1SA 2BZIB 3UIMA 3DQWA 3QUDA 3WZDA 4B7TA 4S2ZA 4JNWA 2VTRA 2JIUA 3UYSA 5JK3A 4KKHA 5D7AA 4N6YA 4QYGA 3Q2JA 4MAOA 4ACGA 5HICA 5EI8A 4ANLA 4Z7HA 4QQJA 5CAUA 4DGLC 4BICA 3ZYAA 5IQGA 3QD3A 4OT6A 1K2PA 4YJRA 4OTIA 3CPCA 4L68A 2DS1A 5CU2A 3RI1A 3VS5A 2PVLA 1FPUA 4EOMA 2XNPA 5CF4A 4FSRA 3EQFA 4AP7A 2OI4X 1Q24A 4I23A 3R1YA 4CFVA 2ZV2A 3C50A 2PZRA 4EHEA 2ACXA 3QTXA 5HU3A 4U5JA 4UXQA 2XM8A 2BDWA 3DKOA 3DKCA 4M97A 3U4UA 4W8EA 3U6HA 4I93A 3UG2A 3E7VA 1M7QA 1NW1A 4E6DA 3FYJX 2Z2WA 5EQEA 2R0UA 4CQEA 2R64A 3OXTA 4CXAA 2PVNA 2X4FA 3IKAA 4TYGA 4O82A 4LQMA 2HK5A 1UNGA 3LFNA 3QX4A 4M0YA 4ENXA 4O7RA 3TV6A 1H07A 3E92A 2OKRA 1VJYA 4MXYA 4I41A 4CNHA 3L8XA 3GP0A 4J96A 3HUBA 4HPUE 4LMNA 4HPTE 4APCA 5AJQA 3P08A 5J7BA 2GSFA 3JPVA 2O0UA 2BROA 4FSYA 4J53A 1ZMVA 1CKJA 4I0RA 4I5CA 4Z9LA 5HGIA 3A61A 3R7IA 3UODA 3DU8A 3FMKA 4QP4A 2JAMA 3ITZA 2XK9A 1M2PA 4JDIA 2UZNA 3GGFA 3LJ1A 4BCKA 5DBXA 4CFMA 3KVWA 2XK8A 4U42A 4PL5A 5CZHA 5HLWA 5CU4A 2UW5A 4RJ3A 3LMGA 4MBJA 3ZBFA 1FINA 3BV3A 4LV5A 3QCQA 4YC6A 3R9OA 1QPJA 3E5AA 2BUJA 3E63A 4F70A 5M57A 1ZARA 5CI7A 3TWJA 4D9TA 4H36A 3L9MA 4EQUA 2WGJA 3PXRA 1XHAA 4U8ZA 5EKNA 4FG9A 3EFJA 3T3VA 1GNGA 4O91A 2V7AA 2WTDA 1GJOA 4CRLA 4FOCA 3ORTA 4MCVA 4QMUA 4IM3A 2P4IA 2ITNA 2XCKA 3V04A 4X0MA 1YDTE 5A6OA 1J7LA 4TL0A 3K54A 2REIA 3V01A 4PP9A 2WQNA 1ZLTA 3E3BX 5BVKA 5J7HA 2CNVA 4PX6A 2PZPA 3HAVA 4FTNA 2F2UA 3V51A 3BE9A 5FTOA 4NWMA 5JRSA 2FUMA 4GIHA 3RPYA 5JSMA 2C5YA 1NVRA 1OI9A 2YM5A 3WBLA 3MH2A 3ODYX 3C51A 2X6DA 1W8CA 3M1SA 2C47A 2BMCA 3FI3A 4GK3A 1IR3A 4RLLA 3UGCA 3UP2A 5EQYA 4TW9A 4EI4A 1J7IA 5J1VA 3NAXA 4Y85A 2I0VA 3PPKA 4FKOA 1YOMA 2UW8A 1FMOE 3HMMA 3NS9A 3KF7A 4EORA 3QD2B 5FWKK 1IA8A 2WB8A 5EYMA 3RK9A 5DYJA 4WUNA 4IX5A 4YLLA 4KIKB 3RINA 3VBQA 4DFNA 1U59A 3AC8A 4EZ3A 3GU5A 5CAPA 5M4UA 2J50A 5E8YA 3W8LA 3C13A 2QKRA 3WF7A 3ALNA 2J4ZA 4AZSA 2PU8A 5E8ZA 4XMOA 2W1EA 4CTCA 2YJSA 1PJKA 3EN6A 4AT3A 3PA3A 3R6XA 1XBAA 4RIWA 3VUIA 3HV3A 4YLJA 3NIEA 3RNIA 3HL7A 5AP7A 1GZ8A 3NUUA 1JSUA 3MPTA 4KS8A 5ACKA 3SD0A 3UZTA 4G5PA 3ZFYA 4H58A 5CVFA 4DYMA 3COIA 4FNYA 4OLIA 4UWCA 2QOIA 3V6RA 5IU2A 2PULA 4UWBA 2PVHA 5A3XA 4BGGA 2EXMA 3LW0A 1VEBA 3DFAA 4HCTA 3E64A 2AC3A 4MNFA 4YHJA 3QTWA 5KMOA 2XB7A 3D83A 4DCAA 1XR1A 4PNKA 2BR1A 5HEZA 3QC9A 2G9XA 3RPSA 4C0TA 4R5YA 2H34A 2WOTA 2FSLX 1WBNA 1FGKA 2RL5A 2XK3A 4YJOA 5EM8A 1KOAA 3DLSA 3G9LX 2UV2A 3WZUA 3SRVB 2YM3A 2EXEA 3RPRA 4CFFA 5AIKA 2ZDTA 4GRBA 3HGKA 5J1WA 3FSKA 4FKUA 2P3GX 2YWVA 4IAAA 4QP8A 2CGVA 5FP6A 3VWAA 4L7SA 4EOSA 4C2WA 3FC1X 3C7QA 4FG7A 3FLWA 4HVDA 3VS7A 4O0VA 5AFVA 3WOWA 2YIRA 5EHLA 1YDSE 4E4LA 1BL6A 4IVDA 3EWHA 4I20A 1ZWSA 2JITA 4E5BA 2VTJA 2I0YA 3DNDA 2XRUA 4FIGA 1VYZA 4JBOA 4YO4A 4TT7A 2X6EA 5I9WA 4IAZA 3FSFA 3W2CA 4O0WA 2B9JA 3ZO2A 4ANMA 3EIDA 5AP0A 2O2UA 5FP5A 3LHJA 3F7WA 5LWNA 2W1IA 3E8CA 3Q9ZA 5ANEA 1AQ1A 2GS6A 3V3VA 1LR4A 5IA2A 3GU4A 4QTDA 3ZRLA 4YJSA 4C37A 3TTIA 3EN9A 4I92A 4PP7A 4TYHA 3FI8A 4Y83A 4CMTA 1MQBA 4HW7A 4XNEA 3HUCA 4D2VA 4M3QA 4FI1A 5DEWA 1YXVA 4ID7A 4ZTNA 2E9UA 5CZIA 4TWNA 1B39A 5EDQA 4A9TA 2C0TA 1UU7A 4C35A 1ZOGA 4TWCA 4AG8A 3GU8A 3A8WA 3QKKA 5EI6A 4CTBA 4IFGA 3OOGA 2ITOA 1Y91A 2XIYA 2J90A 4AA0A 3DGKA 4IAKA 3RK5A 5CEIA 1FBNA 1SNUA 3BWJA 1Q8UA 2I0EA 2WD1A 4YPSA 5J9LA 4PDSA 1S9IA 2BALA 2BTSA 5AV1A 4O6EA 5IA1A 4GT4A 3MDYA 4BTKA 4PTCA 1YI4A 4M67A 1CMKE 3RPOA 4TPTA 3DBCA 5F94A 3IW7A 1YW2A 4CMUA 3VHKA 1APME 4Y46A 4BZDA 3TUCA 2G15A 2RG6A 4USEA 4RVTA 3KCFA 5DNRA 1GIHA 3BYOA 2ZYBA 1JKSA 3MIAA 2XA4A 5HLPA 2J0IA 3N4UA 4BZNA 2JDVA 3W10A 5IA3A 3T3UA 2NP8A 3EN4A 4YC8A 4DEDA 3CP9A 3R1QA 4DAWA 4ZXTA 3VBWA 1YHWA 1G5SA 4JDHA 1WVXA 4HNIA 4FVQA 3BGQA 2C68A 4AA4A 4EUTA 3QQUA 1NVQA 2A1AB 3OXZA 4X3FA 2VWZA 5HG7A 2R3PA 4BGHA 2VTIA 4NEUA 4MTAA 3PJ8A 3D0EA 2PVFA 3FXZA 5J9YA 3SG8A 2OXXA 3F2AA 3ZC5A 5A4TA 3NVMB 4A06A 3PDTA 5D11A 3FQSA 5CT0A 2R3GA 2W1FA 1Q5KA 4Y95A 2HENA 5CEMA 5EM5A 1YWRA 3CQEA 2XJ1A 4FTOA 3ZLSA 4G9CA 3ZXZA 4PQNA 1OZ1A 1UVRA 4DEBA 3LFFA 3O50A 3P9JA 5I5ZA 5I4NA 5IMEA 2OH0E 3AGLA 2PVKA 4BDEA 3W2OA 5AV3A 4XLVA 4QYHA 2W5BA 2WEIA 2J6MA 2J51A 3O7LD 3ZS5A 3LCKA 2YITA 4HVHA 2WTIA 4RX5A 4I1ZA 2GU8A 5FRIA 4N57A 4PPCA 3U6IA 1U54A 3ORLA 4F1TA 3AG9A 4IQ6A 4KSPA 4MBLA 5FDXA 3OUNB 4BDHA 1XH5A 2ERKA 4H3QA 4DEGA 4IX4A 2CJMA 4QMMA 4ZY6A 4FSTA 3ZRKA 1OITA 4C4HA 4H05A 4Z55A 2XKFA 3OFMA 3NVKI 3MBLA 4O7ZA 2YIYA 2J5EA 3C4XA 1G8SA 3IDBA 4XOZA 4DINA 1XBCA 3PY3A 3Q32A 1H8FA 1WBOA 2XK6A 3SXFA 1FGIA 4M13A 2PYWA 4RG0A 4DGMA 4DH5A 2OH4A 4TTHB 5B0XA 4BCMA 4OTHA 4IFCA 3LFSA 3LLTA 3VUKA 5DE2A 5EKOA 4BTJA 3FE3A 5DFPA 4FTCA 1MRVA 1PYXA 3MY5A 4J71A 4M69A 1ZXEA 4U44A 4FV9A 3WZEA 5AR7A 2W4JA 3D5UA 1KE8A 4FEQA 5KE0A 2XMYA 2QOKA 2UZUE 3QTRA 5C9CA 3O8TA 4LGGA 4NIFA 4CFNA 4CFXA 3Q9YA 5HE3A 4YHFA 2X8EA 3HMOA 5IQFA 5CSHA 3LQ5A 4F4PA 2R3MA 5L2WA 4FZ7A 2VTPA 5DR6A 2R7BA 2C6KA 4DLIA 5JQ8A 4K18A 4CZUA 5KHWA 2PUIA 4DG0E 3Q4UA 3DB6A 4F6WA 4A07A 3VF9A 3UNKA 4FNXA 5HIEA 2HY81 3HYHA 4KNBA 3TV7A 4I94A 4YPDA 4QMYA 3RMFA 2J0KA 3AC5A 4P5ZA 4HCUA 3KMUA 4PTGA 4BCIA 1H1RA 4R7HA 5M06A 4BZOA 1PKDA 1TQPA 4EKKA 4ERWA 1KE5A 1GZNA 4EOQA 5JFXA 1Y57A 3BYSA 3QFVA 1MP8A 4Z16A 1GIJA 4O7NA 2QOCA 1CKPA 2OF2A 3WF8A 5A54A 5AA8A 3C0GA 2R9SA 3ZUTA 2WPAA 5FBOA 3A7IA 4IADA 1OUYA 4FKWA 1OUKA 4TZRA 4BL1A 4ZZNA 4CCBA 4RWIA 5DT4A 3NCGA 3VRZA 3QTZA 1PXOA 2R7IA 2WXVA 4CRSA 3EKNA 3CIKA 5D12A 4AOJA 4TN6A 1DAWA 3UP7A 2G2IA 3JYAA 5IISA 3GNIB 2E9OA 1Q3DA 5EK7A 2VX0A 3VS6A 1ZMWA 2UW3A 4MYGA 4EC9A 3TUBA 3O17A 3RM7A 5LCJA 4O0XA 2GQGA 3GC7A 4EK3A 5F9EA 5L2IA 1EH4A 5TOZA 5KMLA 2W7XA 3F69A 5CXHA 4FKPA 1U5QA 3PP0A 1QPDA 1BMKA 3I6WA 5T68A 3F3VA 1H1QA 3MPMA 4FZAB 3R30A 4R6VA 4XG9A 3W18A 4EH3A 3HAMA 4ZLOA 5BVWA 4L42A 3G15A 5BQ0A 2P0CA 4FKQA 4Q9SA 4NJDA 3TDVA 4EUUA 4AN9A 3HDNA 4WIHA 4FK3A 3HV7A 3BGPA 5H8EA 4MXAA 2QO2A 4CGAA 4UY9A 4F7LA 5DVRA 4TYEA 5C8KA 2OO8X 3IO7A 5LVLA 3KA0A 4XV1A 4QMNA 3R7GA 5HIDA 2C6TA 4LUEA 4U9AA 2PE1A 3OHTA 5IA4A 1MQ4A 3P78A 2ZDUA 3CGFA 5CU3A 1YXUA 2O8YA 4ITHA 1P4OA 4FTIA 3QRKA 4C02A 2B1PA 3BYUA 3KB7A 2ESMA 4DFUA 4G2FA 3KMWA 5TO8A 2J0LA 3PWDA 2B9HA 4ASEA 3OTVA 5B7VA 1YKRA 3MH0A 4LOOA 3ZM9A 2CGWA 2FVDA 3FL4A 5IH6A 3DXPA 2C5OA 4OT5A 2UZOA 2CGXA 2Q0BA 4ONAA 4AAAA 5LQFA 3UO5A 2FO0A 1KE9A 2IVUA 5E8TA 4NKSA 3F9NA 2YCSA 2X8IA 1GZKA 3PPZA 3TIZA 1S9JA 5CAVA 5JMSA 5KHXA 5CNNA 4O1OA 3E88A 4R5SA 1H0VA 2ONLC 4ZJVA 4NFNA 2WQEA 2VUWA 3DBQA 3A7FA 4HYSA 4LUDA 4X2NA 4X2KA 2V22A 4FKIA 3V8TA 3ELJA 3D2IA 4I0TA 4C36A 3EQGA 2YHVA 2O5KA 1OPLA 3GC9A 3QQFA 4FSUA 5M07A 3H9FA 4RIYA 1REJA 3IW8A 4X2GA 5DG5A 3PXQA 3S4QA 3DAKA 4FTQA 1JBPE 4FVPA 3H30A 3DT1A 1LUFA 3C0IA 2C0OA 4XLIA 5C1QB 3R02A 3W2RA 5E8SA 2WQOA 1OBGA 4NTTA 3FXWA 4NJ3A 4TWPA 4KRCA 1DAYA 4F6UA 4I6BA 1SNXA 2SRCA 3QQHA 4OGRA 5DEYA 1H27A 4G16A 3HMPA 3AC2A 4IWQA 1NA7A 5IQEA 4CKJA 5D7VA 3PYYA 2XRWA 3ZZEA 4XV3A 1W0XC 2OXYA 3ZSGA 4FT3A 3MN3A 4MWIA 2QU5A 2Z60A 5LMKA 1JKTA 4GU9A 5IQCA 3MA6A 3DCVA 3R1NA 4GT3A 2BCJA 5C01A 2GQSA 1X8BA 4I24A 4LI5A 5GZ8A 3RK7A 5H3QA 5C4KA 4BDFA 5ANOA 2BAKA 2I6LA 2JDOA 4MQ1A 4O0RA 4V0GB 4FV2A 3GT8A 1O6KA 2X9FA 2CSNA 2PPQA 3NUSA 4I4EA 3FHIA 4AGWA 1ZZ2A 4CV8A 5HE0A 1IAJA 3VQHA 2Q83A 1UWJA 2OU7A 3R73A 1J1CA 3ZC6A 3KF4A 2ITWA 3LXKA 4UYNA 3PXZA 2CGUA 3O7LB 1I09A 3UOJA 2C6DA 3BZ3A 4YBKA 3GCSA 4E4XA 5CAOA 3COKA 1Q8WA 4BWPA 2ZM4A 2VGPA 3R1SA 5LCKA 4RIXA 4OBQA 3VUHA 4RC2A 5DI1A 4P90A 2E9PA 4D2SA 5AM7A 5FLFA 5IEYA 1LEWA 4WKQA 4WT6A 1JOWB 3POZA 3UZPA 4ACCA 2YISA 1J7UA 4H1MA 4N6ZA 3JS2A 5M56A 3V5TA 3MB6A 4DGGA 5CWZA 4DFBA 4BKJA 3F82A 4TXCA 4MXZA 1OL5A 4FUXA 4R77A 4BC6A 3UZRA 1OPKA 2NPQA 4UV0A 4JXFA 3LMIA 2JD5A 5JT2A 3SV0A 3Q5ZA 3A7HA 3C5IA 5CT7A 4JIAA 5IA0A 1Z9XA 3O8UA 3ACKA 1OKZA 3HVCA 4FV3A 1Z57A 3OZ6A 4OTGA 4RRVA 2QR7A 4TYIA 5GHVA 5L8KA 2J2IB 3R9RA 1OVEA 5T6KA 4R3PA 1V0PA 2WMUA 3OF0A 2RIOA 5HG8A 5JGDA 5E9EA 5IQIA 4EOPA 3PSCA 5M53A 4QMQA 2JAVA 2HYYA 5DA3A 1DS5A 1SVHA 3U87A 3DPKA 4AZFA 3FMLA 4IWOA 3FV8A 2EVAA 3K3JA 5JGBA 3CQWA 2BRMA 1O6YA 4OAUC 4J99A 4CSVA 4F08A 2BIYA 4EH2A 4QTEA 5L2SA 2KULA 2QOQA 1ERKA 3R9DA 2F57A 2W4OA 4D1SA 2P2IA 1ZY5A 4AU8A 3FAAA 1YRPA 2YAAA 3VVHA 3G90X 4D4SA 4FV1A 3I0OA 1QPEA 3ID6C 4DBNA 3P86A 1H26A 3PJ2A 4DG3E 2H8HA 3RWPA 3AD5A 3F5UA 4BCPA 4LRKA 4A9YA 3OVVA 2OJFE 3KXZA 3MS9A 4IX6A 2OZAB 4JX3A 4W4WA 4G6OA 3GCUA 1XH6A 1WBTA 2YCQA 5HIBA 4E4MA 2RFDA 4EH6A 5FTGA 4RWJA 3GCPA 3OCGA 4V05A 3A8XA 4G3FA 5JFSA 2XKCA 2Y6OA 3AQVA 4IC7A 3P1AA 4L7FA 4NZWB 3SXRA 4Y5HA 3W55A 5EHYA 4XUFA 2QHNA 3FMDA 2QG7A 1XH8A 4YGAA 5LJJA 3LKMA 3TI1A 4O81A 4UXLA 2X2MA 3QCSA 2ITTA 3QCXA 5EW8A 5AWMA 4QMPA 3L8VA 5HESA 3ZXTA 3LCOA 5AR2A 4YZCA 1E1VA 3C4FA 4QTBA 2PE2A 5HI2A 5J5SA 5FD2A 4CKIA 4EZ5A 1E1XA 1UWHA 4MK0A 4QYFA 5J79A 4X6RA 1W7HA 4F6SA 4QQTA 5K4JA 2UZWE 4KS7A 3FY2A 3Q04A 1CKIA 3MIYA 1W82A 3MH3A 5CSVA 2VGOA 4WBBB 4EWQA 1OMWA 3C0HA 1P5EA 2XEYA 4KBAA 3OWLA 5J95A 2C30A 3IGOA 2BDFA 4DCEA 2HCKA 2R2PA 2RGPA 3ENMA 3DTCA 4YJQA 4ALUA 2WNTA 3JY9A 4RJ4A 1BI8A 4NTSA 1W83A 3NMUF 4TYJA 3U51A 4UWYA 4WG5A 2LGCA 3MJ1A 2GHLA 4JQEA 3G5DA 4U81A 3L9NA 5DIAA 5EDRA 3RGFA 2NRUA 2A19B 4J97A 3MY1A 5AM6A 2B9FA 4UB7A 3I60A 4RWKA 3OTUA 5C4LA 2EXCX 4WUAA 3NNWA 4GL9A 2UZBA 4ZSEA 4Z7GA 5A6NA 1A48A 2QLQA 4XP3A 5IDPA 2IW9A 2BHHA 5HKMA 3MGYA 4JIKA 2GNFA 1KV2A 5LARA 4IANA 3RAKA 3S1HA 1Q3WA 4RSSA 4QMWA 5E92A 1TVOA 2PHKA 4GK4A 1ZOEA 4G3CA 4AGUA 5JH6A 2ZV9A 4WRSA 1ZYCA 5GJDA 3S95A 2ZVAA 4O96A 1ATPE 1FVTA 1OL7A 2YCFA 3MSSA 5CNOA 5AUXA 4BBFA 2JBPA 3W2SA 4G31A 3TACA 1O6LA 4BGQA 2WQBA 3V8SA 4F0GA 1YHVA 3FXXA 4D28A 5J5TA 3QZIA 4N70A 1PMEA 2ETKA 1V0BA 4FEVA 2VNWA 3TJCA 3HLLA 3NDMA 4DT8A 4JQ8A 3C4EA 3CPBA 4XV2A 5HCXA 5ACBC 3RAWA 2CDZA 3ZHPC 1REKA 3WZKA 3UQFA 5IH4A 4B0GA 3G33A 2GPHA 2C6EA 5CU6A 4F64A 2R3IA 4LV8A 4DFZE 3QYZA 4G1WA 3CD8A 3CGOA 4E6QA 1OL1A 5CANA 4LRJA 5E1SA 3FHRA 3IECA 3PVGA 4FV0A 4Q9ZA 2WO6A 1Q97A 4G9RA 3MI9A 5HG5A 3COMA 3LXNA 4DA5A 3OBGA 1H4LA 3AMYA 1PXIA 4PV0A 3UIBA 4BDDA 3QX2A 3MH1A 4KBKA 5IKWA 4H1JA 3NAYA 5C27A 1IAHA 5M08A 3GQLA 4WNKA 2J0JA 2R3KA 3I81A 4U97A 3RCDA 4ALWA 3TNWA 4PDYA 2R3LA 2F2CB 5CQWA 4F09A 3EMGA 4G3EA 3UIUA 3FMMA 4BBEA 4PPAA 3CJGA 5AV4A 2BRBA 4GFMA 4AX8A 4C7TA 3BU3A 2WU7A 5K9IA 2IZRA 4HYHA 3G2FA 3GU6A 4AF3A 4BHZA 3VRYA 3G51A 4F9CA 2QONA 3LQ8A 5K0KA 3UJGA 2XIKA 4ZP5A 5AR5A 3GBZA 4FR4A 5FM2A 5CXZA 4WNOA 3KKVA 4LG4A 3FMEA 3IG7A 4IIRA 4GMYA 2HXLA 3TT0A 1U5RA 2I40A 4AQCA 4EKLA 2Y9QA 3GXLA 4IDVA 4QTCA 1Q41A 3NRMA 1Q8YA 4CMOA 4X3FB 1U4DA 4I5HA 4TNBA 3ATSA 4DEEA 3R2YA 4JAJA 5DLSA 4XP2A 2A4LA 4IXPA 4YJPA 4FEUA 3KRRA 4JT3A 4D2PA 2X7FA 4I5MA 4QP6A 4ARKA 3BEGA 2GCDA 3R8LA 4YTHA 4ASXA 3AGMA 3VS3A 3BHTA 4YHTA 4YJVA 2X0GA 4U40A 3OCTA 3MB7A 2ITQA 3BLQA 3BU6A 4XG2A 4RA4A 3TZ9A 4X2JA 5BUEA 5AR4A 4RVLA 3R7YA 3VJOA 4IBMA 4E4NA 5K5NA 3BPRA 5CEPA 2IW6A 4IAFA 3WIKA 3TL8A 4C59A 4C38A 3HX4A 4DH8A 1NT2A 4J8MA 4DTKA 2C1BA 3FMHA 5TT7A 1Q4LA 4AOTA 4IHPA 3FLZA 1U54B 1Q8ZA 3KRWA 3DB8A 1PRYA 5AP2A 3PUPA 1PXJA 3GFEA 3QHRA 4UMRA 3LFAA 4KSQA 4ZZMA 5HE2A 3FZSA 3EB0A 3IW4A 2PY3A 5CENA 4C4JA 2IW8A 3SDJA 1KWPA 3LJ2A 2R4BA 4PL4A 2B4SB 1PXMA 1TKIA 2P55A 4LRMA 5L8JA 1IA9A 4D0WA 3EQPA 2F7EE 2X1NA 4B9DA 3QTIA 4UMUA 2OSCA 4D58A 2Q0NA 5JEBA 3U9CA 4X3FC 4ANQA 5HBJA 4RX8A 4L53A 5CS6A 4CFWA 4CVAA 4BI1A 5KKRB 4ZS4A 5I9XA 3OOMA 4PMTA 3SOAA 1F3MC 1M2RA 5BMSA 4GK2A 4FKJA 3KC3A 4K8AA 3OC1A 4M69B 2VNYA 2X2KA 4FL2A 2VAGA 2AUHA 4W8DA 1UU8A 4KUJA 4NIFB 4ANSA 2WHBA 3LPBA 2WMQA 4FV5A 4E5WA 3FEGA 2VTQA 3FZPA 4AUAA 2V62A 3SC1A 4F1MA 2W96B 2O63A 2X81A 4PDPA 1HCKA 3O96A 3R7VA 1OL6A 2BIKB 4XH6A 2B53A 4ZLYA 3AXWA 1H24A 1J91A 4KIOA 4RVMA 4FSMA 4V01A 3D5VA 4XX9A 3EOCA 4YR8A 3OW3A 2BFYA 2EB3A 2WU6A 5M4FA 4XOYA 4FICA 3P0MA 3HRCA 4NT4A 3F3TA 2XK4A 4IZYA 2E9NA 5FEQA 3ZH8A 2P2HA 4LOQA 4JBQA 3R7EA 5ANKA 4IJPA 4FL1A 3DK7A 3QU0A 3UC4A 2WKMA 2YZAA 4OBPA 4JL9A 4FIJA 3ZDIA 4BRXA 4CZYB 2F7XE 2QOOA 3V5LA 4FSWA 2OFUA 3H3CA 3MESA 4IZ7A 4D5HA 1WCCA 3PIYA 5F1ZA 3I5ZA 5KKRC 3VS4A 2R3RA 3R9HA 3R63A 4GFOA 4IAYA 4EOJA 3CY3A 2PZYA 2UW9A 3L9LA 3H0YA 4FGRA 4AZVA 3JVRA 2IN6A 2W0JA 3Q53A 4EH8A 1YOJA 3AC4A 2WMBA 2BKZA 3VN9A 4DTBA 4ZLZA 4RT7A 5L8LA 3BBWA 3TJDA 3LOKA 3PWYA 4PMPA 3TNHA 2QG5A 4HCVA 4B6LA 4XG4A 4R3CA 4WA9A 4DT9A 1NXKA 3PG1A 3DOGA 1Q61A 2XP2A 3IK3A 4M68A 5HCZA 5CYIA 4YLKA 4APPA 3R8ZA 3ZCLA 3T9TA 4S32A 3EFKA 2PUNA 3P7BA 4MHAA 2PZIA 4IB5A 4LGDA 4YZNA 5JRQA 3DKFA 4FTUA 4PTEA 3P4KA 3I4BA 2ZAZA 3R7OA 3M11A 3S0OA 1Q99A 4NM0A 3MYGA 4I6FA 3GOKA 3QQJA 4FZFB 5CALA 4FE2A 3CKXA 2UW7A 1ZRZA 4JBVA 4MNEA 1TQMA 4A4XA 3HEGA 4ZSJA 3SAYA 2O65A 3OCSA 3TNQB 3SW7A 4KRDA 3F3WA 1WFCA 4RQKA 2JC6A 4I6QA 3OWJA 3EYHA 2YN8A 4UN0C 2XNNA 2C4GA 4M66A 3ZEWA 2W9FB 4E26A 4FT7A 3OXIA 4K2RA 3SXSA 3ZEPA 1VR2A 4HGTA 3ALOA 3ZUUA 2W4KA 2GNIA 4IW0A 5AX3A 4XYFA 2H96A 4FIFA 3QAME 1M14A 2QCSA 3B2TA 3OBJA 4IM2A 4L8MA 4MXCA 2PZ5A 4X21A 4OAVB 2I7QA 4RJ5A 2CPKE 3OW4A 3EQCA 3L9PA 4K1BA 3RWQA 2VWUA 3EQIA 1UA2A 5EYKA 3PSBA 2JEDA 1SMHA 3ET7A 5ICPA 3NYNA 2G2HA 2QVSE 4QP2A 3SX9A 4KKGA 4WNPA 5CASA 5DOSA 3UVRA 3NUAA 3I7BA 4EONA 2X9EA 3GEQA 3QRTA 4FTMA 4O27B 4KINA 5HTCA 1R78A 2ITUA 3B8RA 4UX9A 3ZZWA 4E3CA 4U6RA 1CTPE 4GEOA 4LGHA 4HYIA 2ITZA 3M42A 2OJGA 3LFDA 4RIYB 3TKUA 3EHAA 3UYTA 1W84A 1J1BA 2JDSA 4XG6A 2C5NA 3F66A 3DAJA 3Q2MA 5GJGA 5BVOA 3E8NA 4BN1A 4GUBA 3H4JA 3BQCA 3QZFA 4U43A 4CV9A 2GNJA 2C3IB 3F3UA 4H3PA 5BVFA 1YOLA 3LFCA 3BKBA 4Y5QA 3CSVA 3VUGA 2R3HA 4K11A 5LVNA 1BI7A 2VWIA 2Y0AA 3QBNA 5G6VA 1YXTA 2BRHA 1HCLA 4GV1A 4L46A 2HZNA 2VTNA 5M4CA 4FZDB 3R8PA 3HV5A 2Y8OA 3VBYA 1WMKA 5ETCA 3KREA 4FL3A 2YJRA 3GOPA 4ZK5A 5M4IA 4O7TA 4PL3A 4YZ9A 5AA9A 2BAQA 4L01A 4WD5A 4D4RA 2PTKA 5LVMA 4LFIA 5IQAA 2X4ZA 1VYWA 4USFA 3QKMA 3OMVA 4IX3A 4ZJJA 2WMSA 1OB3A 2BILB 2Y6MA 3ZSIA 4CEGA 3TM0A 3R21A 3FLNC 2RSVA 4PF4A 3CBLA 3WYXA 4C8BA 4UEUA 3NWWA 1PY5A 5HVJA 4RVKA 4FT5A 3UG1A 4D9UA 4WG4A 3KL8A 4AZWA 5AUUA 4OTPA 4EH4A 3Q6WA 1UV5A 2XNGA 3EZVA 2UUEA 1FOTA 4GG5A 4YJUA 3PTGA 1H08A 5A14A 4WHZA 4FVRA 4EC8A 4RIXB 1PXKA 3B8QA 4FSQA 4CZTA 3KULA 3QYWA 3HA8A 4CLJA 3Q60A 4FTLA 3AMAA 4BCFA 2VD5A 3D4QA 5AADA 4IM0A 2ITPA 3QUPA 3EFLA 4HVGA 1E9HA 2GMXA 5KMKA 4FTJA 4NYEA 2QOHA 5A4EA 3D7ZA 4EK6A 5ITAA 2QOBA 4IVCA 1T46A 2ZB0A 3MVMA 5KMMA 3FZ1A 4DFLA 2C3LA 1JPAA 4P7EA 3D2KA 3MPAA 4IJ9A 1M52A 3ZDUA 4LOPA 3TNPC 2XEZA 3A2CA 4EYMA 1MRYA 3BHVA 4USDA 2VTHA 4C34A 3E8EA 3FBVA 4S31A 2J7TA 3AC1A 3ZTXA 3QTQA 4NSTA 4RZVA 5CF5A 4QMZA 3OEZA 4EEVA 5TR6A 3ORXA 3PSDA 5FDPA 5L3AA 3QUEA 2JDRA 3QF9A 3TG1A 2I0HA 2B0QA 1YQJA 5M09A 3N9XA 5I9YA 3Q4ZA 5IG1A 5HO6A 1JAMA 2QC6A 2EB2A 3A60A 3FUPA 4O6LA 4C3PA 3NR9A 4D2TA 1V0OA 5GIOE 3QRJA 3RALA 4AT5A 4BB4A 5HLNA 2ETRA 3OY3A 3ORKA 1QPCA 4UALA 1U46A 3K5VA 3Q52A 4BIEA 4IE9A 3LXLA 3NX8A 4GW8A 4FKTA 2KTYA 2VO7A 4RX7A 5CEQA 4C33A 2HWOA 1Q8TA 4IVBA 4ZS0A 4WRGA 3LVPA 3CE3A 3DS6A 4NUSA 1WAKA 1K3AA 3PLSA 4O0YA 4XS2A 5EW3A 5AAEA 1PHKA 4BDIA 2ETMA 4EJNA 5DT3A 3UE4A 1ND4A 4QMVA 3CLYA 5HVKA 5L2QA 3MVLA 3VNTA 4X7QA 2WTWA 3O71A 4WSQA 2UZLA 4PRJA 4DG2E 4FYNA 4IEBA 4XG7A 5AP1A 1KOBA 4TY1A 4EQMA 3I79A 2H6DA 3NNVA 1KV1A 2C5VA 2C69A 1GIIA 5CVGA 3F6XA 2VWXA 3AT2A 4FBXA 3V6SA 4ERKA 5IF1A 3KK9A 2XIZA 2DQ7X 1SYKA 5TE0A 5IPJA 2C6LA 2XKEA 3EQBA 4AZEA 5EM7A 3T8OA 5DPVA 5CF6A 1IG1A 3ORPA 1H1PA 5IMXA 4FKVA 1CDKA 5ANJA 3KRJA 2WELA 3ANQA 1JSVA 1PMVA 1YI3A 2JKQA 2QD9A 4IMYA 3VBVA 2WMXA 4WO5A 4ALVA 2UVXA 1OM1A 5C8NA 1Y8GA 3BLRA 5A46A 5HX6A 4BY9E 4F9WA 2W1CA 4S34A 4NFMA 5EQPA 4UMQA 5L6WL 3UO4A 1ZZLA 1XO2B 4OUCA 1JSTA 3R8MA 3GCVA 4NCTA 3QALE 5I9UA 3O8PA 4F7NA 5HX8A 5BVNA 5JFVA 5IEXA 1URWA 3R28A 5EH0A 5HBHA 5KMJA 4XHKB 2W5AA 5KMIA 3D15A 3ENHA 3CEKA 4DBXA 1OKVA 2R3FA 3AOXA 4YNEA 4RPVA 4DLJA 1PW2A 3V5JA 4YU2A 2JFMA 2Z7SA 4GYIA 2QODA 1H00A 2JDTA 3WZJA 3HRBA 5D10A 3UOKA 1WBPA 2OICA 2JLDA 3QWKA 3EJ1A 4II5A 3ZLXA 2Z02A 5HZNA 3M2WA 4NW6A 4E6CA 1JWHA 1LEZA 5BYYA 2BFXA 4FV4A 3TEIA 2YAKA 4AWIA 2OG8A 4W9WA 3QGWA 1JLUE 4AN2A 4ENYA 4MEDA 3N4VA 4FTAA 3LQ3A 2OIDA 2RF9A 4GS6A 4HGSA 4JOAA 3QLFA 4MF1A 1UNHA 4EHVA 3SVVA 3VW8A 1AGWA 4BKYA 3KGAA 2QOFA 3PZEA 4O2PA 1L8TA 3KRLA 4FTRA 5FGKA 5IUIA 4V04A 3RVGA 4XG8A 1OGUA 4QPAA 4J52A 3PVWA 2HW6A 3BQRA 1OECA 1OKWA 2ZMCA 2W06A 4WOVA 3FKNA 3ORMA 4YC3A 3U4WA 4D5KA 1UNLA 1H01A 5L2TA 3C4WA 5BNJA 3SGCA 4GSBA 2ONLA 3Q9XA 5HNBA 4A4OA 2YZLA 5EYCA 4DE4A 2QR8A 3QZGA 4U80A 2YERA 4KBCA 5I3OA 4TNDA 3NIZA 3DK3A 4WBOA 3FKLA 4BDCA 4IVAA 2NNWB 4FOBA 4O0TA 4RLKA 4ZOGA 4YZMA 2UW4A 4HJOA 4PPBA 3KN5A 5DGZA 4A9SA 1QMZA 2PL0A 3DNEA 2CCIA 4FGBA 4FV6A 2CKEA 4BFMA 2Z7LA 4RC3A 3VUMA 3ZONA 5K0XA 4O7SA 3TN8A 2B54A 3AC3A 2F7ZE 4Y8DA 2GTNA 2QQ7A 4FMQA 4O7VA 5HD4A 4AN3A 2C5XA 1XH9A 4DFYA 3DKGA 5J8IA 5AIRA 5I9VA 3LZBA 4BVUA 1H28A 4TWOA 2BRNA 3RAHA 3BIZA 4DH7A 4BDKA 3ROYA 4C58A 2C6MA 1PKGA 3NZ0A 3A7JA 3BV2A 2DYLA 3G0FA 3PJ3A 3KEXA 4NKAA 5EOLA 5C8MA 3UNJA 5FXRA 3QZHA 2VTOA 4JX7A 4GH2A 3IONA 4ACDA 5DN3A 2XYUA 2XH5A 4WG3A 1KE6A 3C1XA 4FC0A 2IPXA 4C62A 3CKWA 2GDOA 3HDMA 5CQUA 1K9AA 5BPYA 1RDQE 2W99B 4MKCA 3ZM4A 4G17A 4B8MA 1QL6A 1DM2A 2CN8A 3E8DA 5EM6A 3U9NA 4F1OA 5JZNA 4ZTMA 5H2UA 3VQUA 2BAJA 4FT0A 3P7CA 5KUPA 4A9RA 3E62A 4BWXA 1XWSA 3PE1A 2YDIA 4HZRA 4O38A 4PY1A 3VAPA 3HKOA 1SM2A 4G6NA 4GUEA 2WTJA 1YWNA 4FEXA 5CX9A 3WILA 1SVEA 3COHA 3OT3A 3MFUA 4IAIA 5DH3A 4NM7A 3BLHA 2UZVA 3KN6A 4BDAA 2VWBA 4Z3VA 2QI8A 1QCFA 4YP8A 5L6PA 3ZLWA 3W16A 3QQLA 3UOLA 3EKKA 3RZBA 2WTCA 4AW1A 2J9MA 3QTUA 4EJ7A 2HELA 4GVJA 4FODA 2CMWA 4RIWB 3UPXA 3ZOSA 3VIDA 2YACA 3G6GA 3L8SA 4BDJA 5DMZA 4Y73A 3FQHA 4MD8E 2VZ6A 4E93A 2QO7A 5HG9A 5IZFA 3EQHA 2W9ZB 2C3JA 2CN5A 2HW7A 4JDKA 5AUZA 3MTLA 2G2FA 3TNIA 4ZY4A 2OZOA 3MVJA 3AD4A 1UU9A 4DC2A 3LFQA 3BYVA 5AUWA 4GYGA 3CTHA 3KK8A 3PY0A 5HO8A 5AP6A 4IH8A 4RJ7A 3ATTA 3QD4A 3QGYA 3E3PA 4E5AX 2QURA 1T45A 4EH7A 5E8WA 2GS7A 4C3RA 3KRXA 5HOAA 2PMNX 4QQ5A 3SQQA 3ZRMA 5I3RA 4FKLA 3BYMA 2OW3A 3IW6A 4MD7E 3MFSA 5D9HA 3RHKA 2XZSA 3C5UA 1IEPA 2HWPA 2PVYA 2F9GA 2XBAA 5CSPA 4DN5A 1PMUA 4XG3A 1DI8A 2VTMA 4C4GA 3PIZA 4RBLA 3UQGA 4IZAA 5M44A 3QCYA 3ORIA 4FG8A 2OK1A 3WYYA 4QPSA 3MWUA 3QXOA 4FNWA 2W1ZA 4GCJA 5IQBA 4EOOA 2PMOX 5HTIA 3FZOA 1WBSA 2AC5A 3HNGA 4ZSAA 3S2PA 3D7TA 2XVDA 4JAIA 5KBQA 4BYIA 1BUHA 2OIQA 4J8NA 2BZHB 2DUVA 3BI6A 3WARA 5BUJA 2PUPA 5JKGA 5IQHA 3CR0A 4BCOA 4PUZA 3OP5A 3VBTA 5F95A 4D0XA 3Q6UA 4ZMEA 5M51A 2QOLA 3GQIA 4QP1A 4E7WA 2YLEA 3A4OX 3MY0A 4TYHB 3ZO3A 1RJBA 2JKOA 1R39A 4OTRA 1YDRE 3D5XA 3FLSA 1XKKA 4ITJA 3H0ZA 4YNOA 3D5WA 3KMMA 2OBJA 4IWDA 3JY0A 3NEWA 4KA3A 3UC3A 2YIXA 5HORA 4ZTRA 2HZ0A 3DZOA 2XYNA 3LCSA 3GVUA 4DFXE 3BEAA 3F5PA 3OCBA 4M14A 2CCHA 3JUHA 3OS3A 4M84A 2OF4A 4D1XA 1JKKA 3WI6A 4D4YA 4MBIA 2CNUA 1KSWA 3AT3A 3V5QA 3CY2A 4QQCA 3MA3A 2FA2A 3NCZA 4ZAUA 4QYYA 5DR9A 4HVSA 5LMBA 2Y4PA 3CXWA 1SZMA 3ZO1A 4EQCA 4AGDA 3GC0A 4C3FA 5KCVA 4XBRA 4S33A 1BL7A 1KUTA 3QRIA 3TKHA 5E8XA 2E2BA 4ZTQA 5EI2A 1YXSA 1OBDA 5HNIX 4OR5A 4DEHA 3ULZA 4BCQA 3DA6A 5A9UA 3PVBA 2OZAA 4UMTA 5EYDA 5AUVA 3Q5IA 4HYUA 2W1HA 1YI6A 2GS2A 2VTSA 3LFBA 5CSXA 3DXNA 5DR2A 4XEYA 1Y8YA 2G01A 4NK9A 2PVMA 4ZTSA 4JDJA 3W32A 3BELA 4U3ZA 3NUXA 5I0BA 4GT5A 1GAGA 3O23A 2IVTA 5FEDA 4JRVA 5HO7A 4DGOA 4O0SA 2Y4IB 4M8TA 5FEEA 1PF8A 2ERZE 1XQZA 4NU1A 3U55A 3PXFA 4GIIA 1XBBA 4D2WA 4O1PA 4RA5A 4FT9A 4D1ZA 2IG7A 2VU3A 1BLXA 2QLUA 1A9UA 5EFQA 3VHEA 3V8WA 4EK8A 3IQ7A 2YWPA 5KX8A 3D94A 4MNEB 4ANBA 2OJIA 2RG5A 5BUIA 4BIDA 3JVSA 3VUDA 4E6AA 2GNHA 5GINE 4DTAA 2GFCA 5CLPA 3CD3A 1GOLA 4MD9E 4R7IA 4CYIA 3KY2A 3OD6X 3R8VA 1R0EA 2BKKA 1NY3A 4FF8A 5AV0A 4BI0A 3PY1A 3QKLA 2WMWA 3C4ZA 4ZY5A 5J9ZA 2W5HA 4QNAA 3W33A 4C4IA 4L3PA 4AS0A 3G6HA 5F4NA 3LLAA 4RZWA 4K9YA 4DF3A 4J1RA 4FKRA 4KABA 4E1ZA 2WMRA 2XM9A 1WVWA 2BZKB 1OPJA 4FSNA 4CD0A 3IOKA 4GKHA 3DTWA 3HRFA 3QTSA 2XNOA 4XRJA 3JR1A 2R3OA 1JQHA 4BI2A 4F0FA 3BHYA 2HXQA 2XUUA 3ORNA 4E8AA 2YFXA 5HCYA 4EZ7A 4UMPA 1ZYLA 5C26A 3S3IA 1P14A 3VS2A 2Y4IC 2AYPA 4QP3A 5DRBA 5ANDA 3OROA 1SVGA 2Z8CA 5ANGA 2CHLA 3HP2A 5L4QA 3NYXA 5K5XA 4U7ZA 3HA6A 4YURA 3CJFA 3QHWA 4Q5EA 3HZTA 4R1YA 2O3PA 2XK7A 3TIYA 4AXAA 2QU6A 3QXPA 4BWKA 1R0PA 4U41A 5AMNA 2ZM1A 3PP1A 1XH7A 5BVEA 3ZU7A 4ACMA 4IC8A 2Z7QA 3SG9A 4RJ6A 3DLZA 2ZV8A 5FXSA 4GG7A 2OWBA 4JS8A 1UU3A 2WIPA 4L3JA 2YABA 4QP7A 3F3ZA 2FGIA 2C1AA 2JBOA 4AT4A 3DBEA 4I4FA 5JZJA 3ZBXA 2XCHA 3RHXA 2JFLA 4WNMA 1A06A 2GNGA 4ZMFA 4L45A 3E7OA 3R0TA 2BRGA 3EH9A 3RM6A 3WE4A 3SA0A 5GIPE 5F20A 1LPUA 5IUHA 5J87A 3KFAA 1YXXA 4KKEA 3VF8A 4AE6A 5CEOA 4PMMA 4IZ5A 4JQ7A 4MQ2A 5BYLA 3O2MA 2X39A 3FMNA 4NW5A 5LVOA 2GTMA 3UQCA 4K6ZA 3R22A 3VW6A 2ZOQA 3RJCA 4CLIA 3LXPA 4KWPA 2ITYA 3P5KA 4O2ZA 3C4CA 4FIEA 2BHEA 2XBJA 2X2LA 3QC4A 4ITIA 2H9VA 2UW6A 3A7GA 3EQRA 3TZ8A 1WVYA 3GU7A 5DT0A 2RFNA 3FJQE 5CI6A 3CTJA 2E9VA 4BCHA 1WBWA 3ERKA 4XCUA 3I0QA 5TKDA 2EWAA 3ANRA 3ORZA 4I3ZA 3LFEA 2FH9A 2V0DA 3GFWA 4O21A 3RBWA 4KIQA 4LMUA 4MF0A 3W2PA 4EHGA 1JNKA 2B55A 3KULB 5A4QA 5HBEA 4FKSA 1H25A 3G0EA 4PNIA 4H3BA 3ZO4A 3R83A 3HMIA 3L1SA 3NYOA 2HIWA 3HV6A 4FSZA 5AP5A 4AFJA 4YSJA 5KMNA 5AAFA 4AE9A 4C4EA 4FTTA 2HY0A 5EG3A 3R8UA 2C6OA 3EQDA 4YTCA 4FV8A 5ETAA 3MV5A 3HMNA 4W4VA 3WF9A 5IEVA 1L3RE 3FQEA 2YM8A 3I5NA 3DJ6A 4KIKA 4OBOA 4F9AA 3OWKA 5JGAA 4EH5A 3GENA 4TKSA 3MJ2A 4KIPA 3OG7A 5CTPA 5KBRA 3PFQA 4J98A 2WMTA 2JKMA 3EL8A 2GFSA 5AR3A 1TQIA 2NO3A 3PXYA 3Q4CA 5E1EA 4DITA 1RQQA 4YMJA 4FV7A 4PMSA 2HOGA 3DBDA 3V5WA 2YCRA 3PIXA 4HNFA 5K4IA 2CKQA 3AT4A 3FY0A 3PRIA 5H8GA 3SHEA 2ZB1A 4U45A 4F7JA 1F0QA 3BX5A 4BF2A 4H39A 4NL0A 1Y6AA 2UVZA 2FSTX 3NUNA 3FC2A 5GZAA 5AAGA 3W2QA 3LIJA 4G34A 4KB8A 1YHSA 4O83A 4E73A 3FPQA 2W17A 1KE7A 1NVSA 2R3QA 4TRLA 2EUFB 4A9UA 1BX6A 2W1DA 2C0IA 3A99A 2XNBA 4Y72A 3F61A 3FKOA 2B9IA 4GVAA 3LAUA 2X8DA 4QO9A 4S30A 3UDBA 1WBVA 2VTAA 1J3HA 2UVYA 2PE0A 3MTFA 3SRVA 4ASZA 2J0MB 2FSMX 3L8PA 5FM3A 3QQGA 2C3KA 4YUQA 2HZ4A 4X3JA 2BPMA 2CKPA 3PJ1A 2UW0A 3KXGA 3KXHA 5HNGA 4DH1A 1GY3A 2EU9A 2XF0A 3TZ7A 3N4TA 4NM3A 3QL8A 4O84A 1JVPP 4FIHA 2GHMA 4ASDA 3W8QA 4BTFA 3CQUA 2VV9A 3EZRA 3O0GA 3K3IA 4GFGA 4P5QA 2LAVA 3ZFXA 5IUGA 3DXQA 2R3JA 3UMXA 4CT1A 2A27A 4IDTA 3UBDA 3IPHA 4EHZA 1ZYDA 3C9WA 2WOUA 4QNYA 3F2NA 5A4CA 1I44A 4R8QA 2VO0A 3DY7A 2QHMA 3MFRA 4F63A 5M55A 3UO6A 4YSMA 3TTJA 5HD7A 3OUKA 2OXDA 4EH9A 5KZ0A 5HVYA 4AFEA 1BKXA 3ZMMA 2J5FA 1OIQA 5T3QA 3E93A 5FQDC 1G8AA 4RFMA 5L6OA 4ZTLA 3OT8A 5KZIA 5CF8A 2OIBA 4FEWA 4EYJA 1LP4A 5BYZA 3IDPA 3VULA 5JN2A 5GNKA 3BHUA 2VX1A 3R00A 5ETIA 4UZDA 4U0IA 3VS0A 4BYJA 3QA8A 3DZQA 3GC8A 4FUYA 5B2MA 2B7AA 4AOIA 5E8UA 1PXPA 3LE6A 3GI3A 4LL5A 4QMLA 2X7OA 4Q5HA 4QMTA 2UZDA 3NW7A 1OIUA 3AMBA 3F5GA 4BDBA 5CEKA 5AUTA 3UOHA 1WZYA 3LM0A 4LM5A 3FDNA 4HZSA 2GQRA 5JFWA 3RP9A 4W4XA 3Q9WA 4AGCA 4DEAA 1R1WA 2JIVA 2OGVA 2IZSA 3U54A 2WAJA 2BVAA 1H1WA 5CY3A 4ZIMA 4ORKA 1M2QA 4G6LA 4X6QC 1AD5A 3WF6A 4UZHA 5AEPA 4YTFA 2CKOA 5A4LA 3R2BA 3SKCA 5AUYA 4JG8A 4F99A 4M15A 5HU9A 3GCQA 3O51A 5H8BA 5FXQA 3U8WA 1GZOA 3ZFMA 4O7YA 2VX3A 4HVIA 3BGZA 2FB8A 4PDOA 4MH7A 3WIGA 1FVVA 3IOPA 3S00A 3QQKA 4D2RA 3F5XA 2V5QA 3DDPA 3FZRA 4EOIA 5LMKC 5LXMA 4R1VA 4I0SA 4K33A 5D41A 3RTPA 3NGAA 2ITXA 4C2VA 4C4FA 5AX9A 3OWPA 2C6IA 4B99A 3PZHA 3I7CA 4LYNA 2YDKA 3UPZA 3SOCA 3ULIA 3LCDA 4NCTC 2OJ9A 4F65A 4JR3A 3VUTA 2I1MA 3TCPA 3U6JA 3PA5A 3DFCB 4JR7A 3TZMA 1VZOA 2YEXA 2FSOX 4FZ6A 4OTQA 4L52A
chains in the Genus database with same CATH superfamily
3P23A 4BTMA 3MFTA 4UYAA 2IVSA 4QMSA 4JRNA 2V7OA 3V5PA 3R9NA 2Z7RA 2WFYA 3DK6A 3I6UA 3OEFX 4ZSLA 2A2AA 2QKWB 3QA0A 4GJ2A 3POOA 4HOKA 4NH1A 5G1XA 5B2LA 3NUPA 4QYEA 4MXOA 4CCUA 1ZY4A 4MWHA 5E90A 3SW4A 2XNMA 3UVQA 4C61A 4CYJA 4DHFA 3DV3A 4LV7A 3CTQA 2F4JA 4AA5A 5BVDA 3DBFA 3H9OA 3PXKA 3KCKA 3WF5A 4QTAA 5EW9A 2ZM3A 5AR8A 4M0ZA 4G3DA 2VO3A 4FX3A 3FI2A 1URCA 1MUOA 3FZTA 2R0IA 2V55A 4GU6A 1V1KA 2FYSA 2R5TA 2BTRA 4I6HA 2BZJA 3MVHA 3ODZX 3OY1A 4AW2A 3DDQA 3LM5A 4X2FA 2ZJWA 3UNZA 3Q4TA 2P33A 4E20A 3P79A 5D1JA 3PE2A 3FPMA 5LMAA 4BKZA 5KO1A 2R3NA 2OJJA 3TMOA 5AP3A 4IB3A 4QMOA 3REPA 5BX0A 3WE8A 4ZZOA 3PJCA 3IS5A 5IH5A 3BE2A 3PFYA 4OTFA 3NNUA 3BCEA 3GB2A 4W4YA 4JG7A 5CU0A 4EWHA 4L43A 2YM7A 2VWWA 3FMJA 3NNXA 5JQ5A 4BHNA 5FG8A 4MUQA 2NRYA 2WTKB 1OKYA 2YDJA 2VTTA 3UTOA 4G5JA 2OLCA 5LWMA 4O86A 4IB1A 2YIQA 5DRDA 3GUBA 1UKHA 2QNJA 4D4VA 3W0SA 3VJNA 2DWBA 4W9XA 4CKRA 4OTDA 3F2RA 4BCGA 2VN9A 1ZMUA 1ZYJA 2RFEA 2WMVA 1H0WA 4U79A 3THBA 1P4FA 3ACJA 3KXNA 4HGEA 3NSZA 4QT1A 3UDTA 2WIHA 4OTWA 4P4CA 4EBVA 3DJ7A 4YJNA 4JG6A 1PXLA 4LL0A 5LVPA 4YZBA 4F9YA 4NM5A 3PG3A 4RFYA 3NW6A 3BHHA 2YIWA 2OFVA 2PMLX 4CT2A 1OIRA 4KD1A 4F9BA 4A7CA 4O0UA 2G1TA 5FUTA 1Z5MA 4ZTHA 3KQ7A 4QOXA 2CNQA 4EL9A 4JVGA 4ZEGA 4O7WA 4WSYA 5HQ0A 3PRFA 2F49A 1R3CA 4F7SA 3NYVA 2PSQA 3DAEA 1W2FA 3NW5A 4J7BA 5IA5A 5K3YA 2PVRA 4BCJA 3Q3BA 4BIBA 4EOKA 3IW5A 2YLFA 5EOBA 1M7NA 4BDGA 3TDWA 5EHOA 3KU2A 3BWFA 3HECA 4FIIA 4XP0A 4ANNA 3R04A 4L9IA 4R78A 2XNEA 1CM8A 2XIRA 4R3RA 4P2KA 3UVPA 4FNZA 4DGNA 3TKIA 2UZEA 1YVJA 3B2WA 4I5PA 2HAKA 4KAOA 2JGZA 4MVFA 5ETFA 4DH3A 1IASA 2WTKC 4RWLA 3KXXA 5ANIA 4A4LA 2WQMA 3NPCA 4FA2A 3NUYA 4IWPA 4RGJA 4RC4A 2RKUA 1F5QA 3VC4A 3RKBA 1O9UA 2GNLA 3IGGA 1FVRA 2CLQA 4IB0A 4AW0A 5C03A 2QO9A 2WTVA 5E8VA 4QD6A 3T9IA 3W1FA 2IVVA 4MX9A 5CVHA 4O7LA 4EBWA 3I1AA 1XJDA 4YO6A 3JXWA 4R7BA 4YJTA 1P2AA 4B8LA 3AKLA 3VS1A 1XH4A 4ZSGA 1ZYSA 4QRCA 4L6QA 4XV9A 2IO6A 4HGLA 3BU5A 2ZMDA 3R71A 4QMXA 3VO3A 2XKDA 2CLXA 4XRLA 4IACA 3RZFA 3PVUA 2IZUA 1Y6BA 2VRXA 5FTQA 3D7TB 3LJ0A 5DHJA 4BCNA 5E7RA 2ITVA 3CC6A 5GZ9A 3F7ZA 3N51A 4PWNA 3EYGA 3RNYA 4QDVA 2XS0A 3CCNA 2A0CX 4U3YA 5HHWA 1CSNA 3TUDA 2PMIA 4MXXA 4BR3A 3K2LA 5BMMA 3F88A 3UIXA 5IQDA 2VO6A 3EN7A 4GJ3A 3A4PA 4I22A 4CG8A 2YM4A 4QP9A 2RFSA 4XBUA 4D55A 1OL2A 4CG9A 1VLRA 4CQGA 4F0IA 1M17A 3ROCA 5E4HA 4AZTA 1Q62A 5DWRA 4FK6A 4O22A 5H9BA 2W1GA 1IRKA 1FQ1B 2XJ0A 4XJ0A 4AW5A 3DQXA 2WEVA 2JKKA 3HV4A 5AV2A 4QPMA 1PMNA 3P7AA 3H10A 1RE8A 4RQVA 2PVJA 3HP5A 4L44A 3VBXA 4JJRA 3D9VA 4BBMA 3BBTB 4M7IA 4L00A 4K0YA 2GHGA 4M12A 3TV4A 2PUUA 1PYEA 1W98A 1FMKA 3ZUVA 2BDJA 3ETAA 3Q96A 4EOLA 2XJ2A 4B4LA 3DJ5A 2IZTA 3CS9A 4JBPA 3UMWA 4N4SA 5TF9A 5B2KA 1UKIA 3K5UA 3PA4A 4G3GA 2Y7JA 3PLAE 3H9RA 1DI9A 2O64A 3BRBA 3EN5A 3KXMA 4YZDA 4DHJA 1MRUA 2JIIA 4L67A 1JKLA 1G3NA 1STCE 4ACHA 4I21A 4K77A 5FBNC 4ANOA 4Q2AA 4DEIA 2UZTA 3FLQA 2HZIA 4EK5A 4AACA 1ZOHA 4YTIA 3LCTA 1B38A 1PXNA 2XIXA 3KVXA 2YA9A 5IDNA 2NYAA 4FYOA 3NLBA 3G9NA 4RIOA 3QRUA 5HE1A 3MW1A 3QD0A 5LOHA 5HTBA 3IDCA 4J95A 3PPJA 4L3LA 2PK9A 4RX9A 1RW8A 3FI4A 3QWJA 4CFUA 2VWVA 1HOWA 4RJ8A 3ZSHA 4OW8A 3FLYA 3AD6A 1ZAOA 3EL7A 4FTKA 5E91A 2VWYA 3SLSA 4GKIA 3RPVA 2IWIA 2PWLA 3D14A 3FYKX 3TXOA 4FKGA 4UBAA 4AAYA 3R7UA 5CAQA 2IJMA 4RMZA 3EFWA 3RCJA 3ZLYA 5EDPA 4YBJA 3LMHA 3A62A 3FL5A 2VTLA 1BYGA 2WZJA 4ZJIA 3II5A 1B6CB 5CSWA 3E87A 2X7GA 2ZV7A 4JI9A 4JLCA 2B52A 3RAIA 3R01A 4C57A 5GJFA 3QLGA 5I9ZA 4EK4A 5KNJA 2W05A 4N0SA 3FWQA 5AP4A 2WMAA 1OIYA 4V0GA 1YWVA 2YM6A 4RFZA 1H1SA 2BZIB 3UIMA 3DQWA 3QUDA 3WZDA 4B7TA 4S2ZA 4JNWA 2VTRA 2JIUA 3UYSA 5JK3A 4KKHA 5D7AA 4N6YA 4QYGA 3Q2JA 4MAOA 4ACGA 5HICA 5EI8A 4ANLA 4Z7HA 4QQJA 5CAUA 4DGLC 4BICA 3ZYAA 5IQGA 3QD3A 4OT6A 1K2PA 4YJRA 4OTIA 3CPCA 4L68A 2DS1A 5CU2A 3RI1A 3VS5A 2PVLA 1FPUA 4EOMA 2XNPA 5CF4A 4FSRA 3EQFA 4AP7A 2OI4X 1Q24A 4I23A 3R1YA 4CFVA 2ZV2A 3C50A 2PZRA 4EHEA 2ACXA 3QTXA 5HU3A 4U5JA 4UXQA 2XM8A 2BDWA 3DKOA 3DKCA 4M97A 3U4UA 4W8EA 3U6HA 4I93A 3UG2A 3E7VA 1M7QA 1NW1A 4E6DA 3FYJX 2Z2WA 5EQEA 2R0UA 4CQEA 2R64A 3OXTA 4CXAA 2PVNA 2X4FA 3IKAA 4TYGA 4O82A 4LQMA 2HK5A 1UNGA 3LFNA 3QX4A 4M0YA 4ENXA 4O7RA 3TV6A 1H07A 3E92A 2OKRA 1VJYA 4MXYA 4I41A 4CNHA 4AXFA 3L8XA 3GP0A 4J96A 3HUBA 4HPUE 4LMNA 4HPTE 4APCA 5AJQA 3P08A 5J7BA 2GSFA 3JPVA 2O0UA 2BROA 4FSYA 4J53A 1ZMVA 1CKJA 4I0RA 4I5CA 4Z9LA 5HGIA 3A61A 3R7IA 3UODA 3DU8A 3FMKA 4QP4A 2JAMA 3ITZA 2XK9A 1M2PA 4JDIA 2UZNA 3GGFA 3LJ1A 4BCKA 5DBXA 4CFMA 3KVWA 2XK8A 4U42A 4PL5A 5CZHA 5HLWA 5CU4A 2UW5A 4RJ3A 3LMGA 4MBJA 3ZBFA 1FINA 3BV3A 4LV5A 3QCQA 4YC6A 3R9OA 1QPJA 3E5AA 2BUJA 3E63A 4F70A 5M57A 2XAMA 1ZARA 5CI7A 3TWJA 4D9TA 4H36A 3L9MA 4EQUA 2WGJA 3PXRA 1XHAA 4U8ZA 5EKNA 4FG9A 3EFJA 3T3VA 1GNGA 4O91A 2V7AA 2WTDA 1GJOA 4CRLA 4FOCA 3ORTA 4MCVA 4QMUA 4IM3A 2P4IA 2ITNA 2XCKA 3V04A 4X0MA 1YDTE 5A6OA 1J7LA 4TL0A 3K54A 2REIA 3V01A 4PP9A 2WQNA 1ZLTA 3E3BX 5BVKA 5J7HA 2CNVA 4PX6A 2PZPA 3HAVA 4FTNA 2F2UA 3V51A 3BE9A 5FTOA 4NWMA 5JRSA 2FUMA 4GIHA 3RPYA 5JSMA 2C5YA 1NVRA 1OI9A 2YM5A 3WBLA 3MH2A 3ODYX 3C51A 2X6DA 1W8CA 3PUFC 3M1SA 2C47A 2BMCA 3FI3A 4GK3A 1IR3A 4RLLA 3UGCA 3UP2A 5EQYA 4TW9A 4EI4A 1J7IA 5J1VA 3NAXA 4Y85A 2I0VA 3PPKA 4FKOA 4AQKA 1YOMA 2UW8A 1FMOE 3HMMA 3NS9A 3KF7A 4EORA 3QD2B 5FWKK 1IA8A 2WB8A 5EYMA 3RK9A 5DYJA 4WUNA 4IX5A 4YLLA 4KIKB 3RINA 3VBQA 4DFNA 1U59A 3AC8A 4EZ3A 3GU5A 5CAPA 5M4UA 2J50A 5E8YA 3W8LA 3C13A 2QKRA 3WF7A 3ALNA 2J4ZA 4AZSA 2PU8A 5E8ZA 4XMOA 2W1EA 4CTCA 2YJSA 1PJKA 3EN6A 4AT3A 3PA3A 3R6XA 1XBAA 4RIWA 3VUIA 3HV3A 4YLJA 3NIEA 3RNIA 3HL7A 5AP7A 1GZ8A 3NUUA 1JSUA 3MPTA 4KS8A 5ACKA 4O4BB 3SD0A 3UZTA 4G5PA 3ZFYA 4H58A 5CVFA 4DYMA 3COIA 4FNYA 4OLIA 4UWCA 2QOIA 3V6RA 5IU2A 2PULA 4UWBA 2PVHA 5A3XA 4BGGA 2EXMA 3LW0A 1VEBA 3DFAA 4HCTA 3E64A 2AC3A 4MNFA 4YHJA 3QTWA 5KMOA 2XB7A 3D83A 4DCAA 1XR1A 4PNKA 2BR1A 5HEZA 3TYKA 3QC9A 2G9XA 3RPSA 4C0TA 4R5YA 2H34A 2WOTA 2FSLX 1WBNA 1FGKA 2RL5A 2XK3A 4YJOA 5EM8A 1KOAA 3DLSA 3G9LX 2UV2A 3WZUA 3SRVB 2YM3A 2EXEA 3RPRA 4CFFA 5AIKA 2ZDTA 4GRBA 3HGKA 5J1WA 3FSKA 4FKUA 2P3GX 2YWVA 4IAAA 4QP8A 2CGVA 5FP6A 3VWAA 4L7SA 4EOSA 4C2WA 3FC1X 3C7QA 4FG7A 3FLWA 4HVDA 3VS7A 4O0VA 5AFVA 3WOWA 2YIRA 5EHLA 1YDSE 4E4LA 1BL6A 4IVDA 3EWHA 4I20A 1ZWSA 2JITA 4E5BA 2VTJA 2I0YA 3DNDA 2XRUA 4FIGA 1VYZA 4JBOA 4YO4A 4TT7A 2X6EA 5I9WA 4IAZA 3FSFA 3W2CA 4O0WA 2B9JA 3ZO2A 4ANMA 3EIDA 5AP0A 2O2UA 5FP5A 3LHJA 3F7WA 5LWNA 2W1IA 3E8CA 3Q9ZA 5ANEA 1AQ1A 2GS6A 3V3VA 1LR4A 5IA2A 3GU4A 4QTDA 3ZRLA 4YJSA 4C37A 3TTIA 3EN9A 4I92A 4PP7A 4TYHA 3FI8A 4QEBA 4Y83A 4CMTA 1MQBA 4HW7A 4XNEA 3HUCA 4D2VA 4M3QA 4FI1A 5DEWA 1YXVA 4ID7A 4ZTNA 2E9UA 5CZIA 4TWNA 1B39A 5EDQA 4A9TA 2C0TA 1UU7A 4C35A 1ZOGA 4TWCA 4AG8A 3GU8A 3A8WA 3QKKA 5EI6A 4CTBA 4IFGA 3OOGA 2ITOA 1Y91A 2XIYA 2J90A 4AA0A 3DGKA 4IAKA 3RK5A 5CEIA 1FBNA 1SNUA 3BWJA 1Q8UA 2I0EA 2WD1A 4O4CA 4YPSA 5J9LA 4PDSA 1S9IA 2BALA 2BTSA 5AV1A 4O6EA 5IA1A 4GT4A 3MDYA 4BTKA 4PTCA 1YI4A 4M67A 1CMKE 3RPOA 4TPTA 3DBCA 5F94A 3IW7A 1YW2A 4CMUA 3VHKA 1APME 4Y46A 4BZDA 3TUCA 2G15A 2RG6A 4USEA 4RVTA 3KCFA 5DNRA 1GIHA 3BYOA 2ZYBA 1JKSA 3MIAA 2XA4A 2X0PA 5HLPA 2J0IA 3N4UA 4BZNA 2JDVA 3W10A 5IA3A 3T3UA 2NP8A 3EN4A 4YC8A 4DEDA 3CP9A 3R1QA 4DAWA 4ZXTA 3VBWA 1YHWA 1G5SA 4JDHA 1WVXA 4HNIA 4FVQA 3BGQA 2C68A 4AA4A 4EUTA 3QQUA 1NVQA 2A1AB 3OXZA 4X3FA 2VWZA 5HG7A 2R3PA 4BGHA 2VTIA 4NEUA 4MTAA 3PJ8A 3D0EA 2PVFA 3FXZA 5J9YA 3SG8A 2OXXA 3F2AA 3ZC5A 5A4TA 3NVMB 4A06A 3PDTA 5D11A 3FQSA 5CT0A 2R3GA 2W1FA 1Q5KA 4Y95A 2HENA 5CEMA 5EM5A 1YWRA 3CQEA 2XJ1A 4FTOA 3ZLSA 4G9CA 3ZXZA 4PQNA 1OZ1A 1UVRA 4DEBA 3LFFA 3O50A 3P9JA 5I5ZA 5I4NA 5IMEA 2OH0E 3AGLA 2PVKA 4BDEA 3W2OA 5AV3A 4XLVA 4QYHA 2W5BA 2WEIA 2IF8A 1ST0A 2J6MA 2J51A 3O7LD 3ZS5A 3LCKA 2YITA 4HVHA 2WTIA 4RX5A 4I1ZA 2GU8A 5FRIA 4N57A 4PPCA 3U6IA 1U54A 3ORLA 4F1TA 3AG9A 4IQ6A 4KSPA 4MBLA 5FDXA 3OUNB 4BDHA 1XH5A 2ERKA 4H3QA 4DEGA 4IX4A 2CJMA 4QMMA 4ZY6A 4FSTA 3ZRKA 1OITA 4C4HA 4H05A 4Z55A 2XKFA 3OFMA 3NVKI 3MBLA 4O7ZA 2YIYA 2J5EA 3C4XA 1G8SA 3IDBA 4XOZA 4DINA 1XBCA 3PY3A 3Q32A 1H8FA 1WBOA 2XK6A 3SXFA 1FGIA 4M13A 2PYWA 4RG0A 4DGMA 4DH5A 2OH4A 4TTHB 5B0XA 4BCMA 4GKHA 4OTHA 4IFCA 3LFSA 3LLTA 3VUKA 5DE2A 5EKOA 4BTJA 3FE3A 5DFPA 4FTCA 1MRVA 1PYXA 3MY5A 4J71A 4M69A 1ZXEA 4U44A 4FV9A 3WZEA 5AR7A 2W4JA 3D5UA 1KE8A 4FEQA 5KE0A 2XMYA 2QOKA 2UZUE 3QTRA 5C9CA 3O8TA 4LGGA 4NIFA 4CFNA 4CFXA 2X0QA 3Q9YA 5HE3A 4YHFA 2X8EA 3HMOA 5IQFA 5CSHA 3LQ5A 4F4PA 2R3MA 5L2WA 4FZ7A 2VTPA 5DR6A 2R7BA 2C6KA 4DLIA 5JQ8A 4K18A 4CZUA 5KHWA 2PUIA 4DG0E 4FJVA 3Q4UA 3DB6A 4F6WA 4A07A 3VF9A 3UNKA 4FNXA 5HIEA 2HY81 3HYHA 4KNBA 3TV7A 4DDGA 4I94A 4YPDA 4QMYA 3RMFA 2J0KA 3AC5A 4P5ZA 4HCUA 3KMUA 4PTGA 4BCIA 1H1RA 4R7HA 5M06A 4BZOA 1PKDA 1TQPA 4EKKA 4ERWA 1KE5A 1GZNA 4EOQA 5JFXA 1Y57A 3BYSA 3QFVA 1MP8A 4Z16A 1GIJA 4O7NA 2QOCA 1CKPA 2OF2A 3WF8A 5A54A 5AA8A 3C0GA 2R9SA 3ZUTA 2WPAA 5FBOA 3A7IA 4IADA 1OUYA 4FKWA 1OUKA 4TZRA 4BL1A 4ZZNA 4CCBA 4RWIA 5DT4A 3NCGA 3VRZA 3QTZA 1PXOA 2R7IA 2WXVA 4CRSA 3EKNA 3CIKA 5D12A 4AOJA 4TN6A 1DAWA 3UP7A 2G2IA 3JYAA 5IISA 3GNIB 2E9OA 1Q3DA 5EK7A 2VX0A 3VS6A 1ZMWA 2UW3A 4MYGA 4EC9A 3TUBA 3O17A 3RM7A 5LCJA 4O0XA 2GQGA 3GC7A 4EK3A 5F9EA 5L2IA 1EH4A 5TOZA 5KMLA 2W7XA 3F69A 5CXHA 4FKPA 1U5QA 3PP0A 1QPDA 1BMKA 3I6WA 5T68A 3F3VA 1H1QA 3MPMA 4FZAB 3R30A 4R6VA 4XG9A 3W18A 4EH3A 1TFFA 3HAMA 4ZLOA 5BVWA 4L42A 3G15A 5BQ0A 2P0CA 4FKQA 4Q9SA 4NJDA 3TDVA 4EUUA 4AN9A 3HDNA 4WIHA 4FK3A 3HV7A 3BGPA 5H8EA 4MXAA 2QO2A 4CGAA 4UY9A 4F7LA 5DVRA 4TYEA 5C8KA 3P5JC 2OO8X 3IO7A 5LVLA 3KA0A 4XV1A 4QMNA 3R7GA 5HIDA 2C6TA 4LUEA 4U9AA 2PE1A 3OHTA 5IA4A 1MQ4A 3P78A 2ZDUA 3CGFA 5CU3A 1YXUA 2O8YA 4ITHA 1P4OA 4FTIA 3QRKA 4C02A 2B1PA 3BYUA 3KB7A 2ESMA 4DFUA 4G2FA 3KMWA 5TO8A 2J0LA 3PWDA 2B9HA 3BL7A 4ASEA 3OTVA 5B7VA 1YKRA 3MH0A 4LOOA 3ZM9A 2CGWA 2FVDA 3FL4A 5IH6A 3DXPA 2C5OA 4OT5A 2UZOA 2CGXA 2Q0BA 4ONAA 4AAAA 5LQFA 3UO5A 2FO0A 1KE9A 2IVUA 5E8TA 4NKSA 3F9NA 2YCSA 2X8IA 1GZKA 3PPZA 3TIZA 1S9JA 5CAVA 5JMSA 5KHXA 5CNNA 4O1OA 3E88A 4R5SA 1H0VA 1XMLA 2ONLC 4ZJVA 4NFNA 2WQEA 2VUWA 3DBQA 3A7FA 4HYSA 4LUDA 4X2NA 4X2KA 2V22A 4FKIA 3V8TA 3ELJA 3D2IA 4I0TA 4C36A 3EQGA 2YHVA 2O5KA 1OPLA 3GC9A 3QQFA 4FSUA 5M07A 3H9FA 4RIYA 1REJA 3IW8A 4X2GA 5DG5A 3PXQA 3S4QA 3DAKA 4FTQA 1JBPE 4FVPA 3H30A 3DT1A 1LUFA 3C0IA 2C0OA 4XLIA 5C1QB 3R02A 3W2RA 5E8SA 2WQOA 1OBGA 4NTTA 3FXWA 4NJ3A 4TWPA 4KRCA 1DAYA 4F6UA 4I6BA 1SNXA 2SRCA 3QQHA 4OGRA 5DEYA 1H27A 4G16A 3HMPA 3AC2A 4IWQA 1NA7A 5IQEA 4CKJA 5D7VA 3PYYA 2XRWA 3ZZEA 4XV3A 1W0XC 2OXYA 3ZSGA 4FT3A 3MN3A 4MWIA 2QU5A 2Z60A 5LMKA 1JKTA 4GU9A 5IQCA 3MA6A 3DCVA 3R1NA 4GT3A 2BCJA 5C01A 2GQSA 1X8BA 4I24A 4LI5A 5GZ8A 3RK7A 5H3QA 5C4KA 4BDFA 5ANOA 2BAKA 2I6LA 2JDOA 4MQ1A 4O0RA 4V0GB 4FV2A 3GT8A 1O6KA 2X9FA 2CSNA 2PPQA 3NUSA 4I4EA 3FHIA 4AGWA 1ZZ2A 4CV8A 5HE0A 4I6LA 1IAJA 3VQHA 2Q83A 1UWJA 2OU7A 3R73A 1J1CA 3ZC6A 3KF4A 2ITWA 3LXKA 4UYNA 3PXZA 2CGUA 3O7LB 1I09A 3UOJA 2C6DA 3BZ3A 4YBKA 4LDTA 3GCSA 4E4XA 5CAOA 3COKA 1Q8WA 4BWPA 2ZM4A 2VGPA 3R1SA 5LCKA 4RIXA 4OBQA 3VUHA 4RC2A 5DI1A 4P90A 2E9PA 4D2SA 5AM7A 5FLFA 5IEYA 1LEWA 4WKQA 4WT6A 1JOWB 3POZA 3UZPA 4ACCA 3BL9A 2YISA 1J7UA 4H1MA 4N6ZA 3JS2A 5M56A 3V5TA 3MB6A 4DGGA 5CWZA 4DFBA 4BKJA 3F82A 4TXCA 4MXZA 1OL5A 4FUXA 4R77A 4BC6A 3UZRA 1TZDA 1OPKA 2NPQA 4UV0A 4JXFA 3LMIA 2JD5A 5JT2A 3SV0A 3Q5ZA 3A7HA 3C5IA 5CT7A 4JIAA 5IA0A 1Z9XA 3O8UA 3ACKA 1OKZA 3HVCA 4FV3A 1Z57A 3OZ6A 4OTGA 4RRVA 2QR7A 4TYIA 5GHVA 5L8KA 2J2IB 3R9RA 1OVEA 5T6KA 4R3PA 1V0PA 2WMUA 3OF0A 2RIOA 5HG8A 5JGDA 5E9EA 5IQIA 4EOPA 3PSCA 5M53A 4QMQA 2JAVA 2HYYA 5DA3A 1DS5A 1SVHA 4O4EA 1W2DA 3U87A 3DPKA 4AZFA 3FMLA 4IWOA 3FV8A 2EVAA 3K3JA 5JGBA 3CQWA 2BRMA 1O6YA 4OAUC 4J99A 4CSVA 4F08A 2BIYA 4EH2A 4QTEA 5L2SA 2KULA 2QOQA 1ERKA 3R9DA 2F57A 2W4OA 4D1SA 2P2IA 1ZY5A 4AU8A 3FAAA 1YRPA 2YAAA 3VVHA 3G90X 4D4SA 4FV1A 3I0OA 1QPEA 3ID6C 4DBNA 3P86A 1H26A 3PJ2A 4DG3E 2H8HA 3RWPA 3AD5A 3F5UA 4BCPA 4LRKA 4A9YA 3OVVA 2OJFE 3KXZA 3MS9A 4IX6A 2OZAB 4JX3A 4W4WA 4G6OA 3GCUA 1XH6A 1WBTA 2YCQA 5HIBA 4E4MA 2RFDA 4EH6A 5FTGA 4RWJA 3GCPA 3OCGA 4V05A 3A8XA 4G3FA 5JFSA 2XKCA 2Y6OA 3AQVA 4IC7A 3P1AA 4L7FA 4NZWB 3SXRA 4Y5HA 3W55A 5EHYA 4XUFA 2QHNA 3FMDA 2QG7A 1XH8A 4YGAA 5LJJA 3LKMA 3TI1A 4O81A 4UXLA 2X2MA 3QCSA 2ITTA 3QCXA 5EW8A 5AWMA 4QMPA 3L8VA 5HESA 3ZXTA 3LCOA 5AR2A 4YZCA 1E1VA 3C4FA 4QTBA 2PE2A 5HI2A 5J5SA 5FD2A 4CKIA 4EZ5A 1E1XA 1UWHA 4MK0A 4QYFA 5J79A 4X6RA 1W7HA 4F6SA 4QQTA 5K4JA 2UZWE 4KS7A 3FY2A 3Q04A 1CKIA 3MIYA 1W82A 3MH3A 5CSVA 2VGOA 4WBBB 4EWQA 1OMWA 3C0HA 1P5EA 2XEYA 4KBAA 3OWLA 5J95A 2C30A 3IGOA 2BDFA 4DCEA 2HCKA 2R2PA 2RGPA 3ENMA 3DTCA 4YJQA 4ALUA 2WNTA 3JY9A 4RJ4A 1BI8A 4NTSA 1W83A 3NMUF 4TYJA 3U51A 4UWYA 4WG5A 2LGCA 3MJ1A 2GHLA 4JQEA 3G5DA 4U81A 3L9NA 5DIAA 5EDRA 3RGFA 2NRUA 2A19B 4J97A 3MY1A 5AM6A 2B9FA 4UB7A 3I60A 4RWKA 3OTUA 5C4LA 2EXCX 4WUAA 3NNWA 4GL9A 2UZBA 4ZSEA 4Z7GA 5A6NA 1A48A 2QLQA 4XP3A 5IDPA 2IW9A 2BHHA 5HKMA 3MGYA 4JIKA 2GNFA 1KV2A 5LARA 4IANA 3RAKA 3S1HA 1Q3WA 4RSSA 4QMWA 5E92A 1TVOA 2PHKA 4GK4A 1ZOEA 4G3CA 4AGUA 5JH6A 2ZV9A 4WRSA 1ZYCA 5GJDA 2XARA 3S95A 2ZVAA 4O96A 1ATPE 1FVTA 1OL7A 2YCFA 3MSSA 5CNOA 5AUXA 4BBFA 2JBPA 3W2SA 4G31A 3TACA 1O6LA 4BGQA 2WQBA 3V8SA 4F0GA 1YHVA 3FXXA 4D28A 5J5TA 3QZIA 4N70A 1PMEA 2ETKA 1V0BA 4FEVA 2VNWA 3TJCA 3HLLA 3NDMA 4DT8A 4JQ8A 3C4EA 3CPBA 4XV2A 5HCXA 5ACBC 3RAWA 2CDZA 3ZHPC 1REKA 3WZKA 3UQFA 5IH4A 4B0GA 3G33A 2GPHA 2C6EA 5CU6A 4F64A 2R3IA 4LV8A 4DFZE 3QYZA 4G1WA 3CD8A 3CGOA 4E6QA 1OL1A 5CANA 4LRJA 5E1SA 3FHRA 3IECA 3PVGA 4FV0A 4Q9ZA 2WO6A 1Q97A 4G9RA 3MI9A 5HG5A 3COMA 3LXNA 4DA5A 3OBGA 1H4LA 3AMYA 1PXIA 4PV0A 3UIBA 4BDDA 3QX2A 3MH1A 4KBKA 5IKWA 4H1JA 3NAYA 5C27A 1IAHA 5M08A 3GQLA 4WNKA 2J0JA 2R3KA 3I81A 4U97A 3RCDA 4ALWA 3TNWA 4PDYA 2R3LA 2F2CB 5CQWA 4F09A 3EMGA 4G3EA 3UIUA 3FMMA 4BBEA 4PPAA 3CJGA 5AV4