4MWIA

Crystal structure of the human mlkl pseudokinase domain
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
278
structure length
266
Chain Sequence
IKEIKKEQLSGSPWILLRENEVSTLYKGEYHRAPVAIKVFKKLQAGSIAIVRQTFNKEIKTMKKFESPNILRIFGICIDETVTPPQFSIVMEYCELGTLRELLDREKDLTLGKRMVLVLGAARGLYRLHHSEAPELHGKIRSSNFLVTQGYQVKLAGFELRKTQDRVKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKIRKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mixed lineage kinase domain-like protein
publication title Insights into the evolution of divergent nucleotide-binding mechanisms among pseudokinases revealed by crystal structures of human and mouse MLKL.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 88
structure length 266
sequence length 278
ec nomenclature
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4mwiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4mwiA01
2B54A 2OJGA 4YBJA 3EHAA 2XYUA 4XX9A 4D2TA 2UW8A 4ANQA 3UQFA 2FO0A 3KMUA 3JY0A 3MFTA 4O82A 4I6HA 3C13A 2BTRA 4OTFA 2OWBA 4ZSJA 2JLDA 2JD5A 3ORKA 5C4LA 2F4JA 3QTXA 4HVHA 2ETMA 4RC2A 5CVGA 1J7IA 3PLAE 3HP2A 2OF2A 3HX4A 3GU6A 1UNLA 3MA3A 3Q6UA 3REPA 3FKNA 2QHMA 3ZC5A 2JDSA 3GI3A 1S9JA 3AQVA 4MQ2A 4FKOA 5CASA 3LM0A 4E4LA 1AD5A 3FI2A 4L52A 2ZAZA 3MPMA 4DGGA 3EYHA 2XEYA 4V05A 3R21A 2BCJA 4BKJA 2QOCA 3I6WA 4WBOA 2QO9A 5KMMA 5A4EA 3MY1A 3WYYA 2JITA 2FB8A 1ZYCA 2WQOA 2XIKA 1QMZA 3R9HA 4F1TA 3DBEA 4ENXA 3FE3A 3GC0A 3W2RA 1UNGA 1STCE 2R9SA 4XG3A 2WMQA 3QCXA 3TNQB 2W4KA 4L01A 3RM6A 1YOJA 5LVMA 2ZYBA 3QQJA 5JGAA 4FICA 3GXLA 5DIAA 5B2KA 4FGBA 4YTCA 3R2YA 2PUPA 3DBCA 3OWKA 4RJ6A 2XIXA 5CQWA 4YC3A 3R63A 5J1WA 1FINA 3DY7A 4MBLA 2QO2A 1V1KA 5C1QB 1PY5A 2HYYA 2R2PA 4NJDA 5BYYA 4Z3VA 4IM2A 3VJNA 4GFGA 3CS9A 4GEOA 4C8BA 4QQTA 2ACXA 3I60A 2VTPA 3Q9WA 3A7IA 2QQ7A 3R00A 5FXSA 5AWMA 3S2PA 4CFNA 2YM8A 4R5SA 4G3CA 5M4IA 3UO5A 4KIPA 3BI6A 4MXYA 3ZLYA 2Z7RA 4G3FA 2VWWA 4HCVA 2CN5A 3BV2A 5DT3A 1OGUA 3CEKA 5J5TA 3F2RA 4JIAA 4S33A 4BDAA 3DT1A 2IZRA 5H8EA 4RC3A 3U4UA 5KMIA 4TWOA 4CFVA 2VWVA 4YHTA 5M09A 5IA3A 4IXPA 2DWBA 3MVLA 4GG5A 1H08A 1Y8YA 4IW0A 3AT3A 3L8VA 5CQUA 2GMXA 5HEZA 2EXMA 4EL9A 4BKYA 2VTAA 3FV8A 1XHAA 4HJOA 4YLJA 2OH0E 3P08A 3QCQA 5GNKA 5AX9A 4MHAA 2J50A 4ZOGA 3V8WA 1OIQA 2UZOA 2W96B 3DBQA 1JVPP 4AU8A 4AW2A 2GS6A 3OT3A 3FMEA 4Q5HA 4G1WA 4BRXA 4Y85A 3KXZA 4A9YA 3VS5A 2E9OA 4BDBA 4XG8A 3NYVA 2JBOA 1H1RA 4FKPA 4R1YA 4O22A 2VGOA 3V3VA 3IG7A 1TQMA 2H8HA 3MH0A 3VBYA 5M56A 3U55A 5IQHA 4RFYA 4YC6A 5TOZA 4KBAA 3H9OA 4I5MA 4O0VA 1ZYJA 4E1ZA 5FBNC 5EDRA 1YI4A 3FY2A 3R04A 2OW3A 2CHLA 2E9PA 4DG2E 2VTIA 3QUDA 1OL2A 2ITUA 2B52A 2Y4PA 4RT7A 3SD0A 4D4VA 4B7TA 5AP5A 5L8JA 4IAYA 5AP1A 5K9IA 3UDBA 5A4LA 5HVJA 4ASDA 2PK9A 1Q4LA 3CPBA 4PL3A 3W2CA 3JY9A 3GQIA 1NY3A 4FEQA 3FMJA 3WZDA 3MTLA 3R73A 2HZNA 3KK8A 3DTCA 4YNOA 4ZJVA 2VTRA 5KZ0A 1R78A 4CT2A 4K9YA 2QO7A 3KULB 2XNNA 4J1RA 2CNUA 3OXTA 3COHA 1L3RE 3OUNB 4CFFA 1GNGA 3ULZA 4UX9A 2XYNA 2NP8A 3G33A 5IG1A 3MJ1A 4C3RA 2XK8A 5IA0A 4Y5QA 1UVRA 2Y6MA 1LEWA 3C0GA 2RIOA 3Q2MA 2QVSE 2J0LA 4MBJA 3ZUTA 4C61A 1HOWA 2PULA 1SZMA 4CEGA 4QMNA 2DQ7X 2H9VA 1OI9A 3Q53A 5IH5A 2PPQA 3QA0A 5EW9A 2YM7A 2QI8A 4IE9A 3UZTA 3AC3A 3MY5A 2X8IA 3QX4A 5JGBA 4W9WA 3GOPA 2A27A 5EHLA 1OB3A 1Q8UA 3HRCA 3ENHA 4WNOA 5LCKA 4KUJA 4O7RA 2BZJA 2VD5A 1ZMWA 4YLLA 5CAQA 4R78A 2X7FA 4HVGA 1RJBA 1YQJA 4ZEGA 3R30A 1E1VA 4FG8A 4MYGA 2VTNA 4CD0A 3R7EA 2EU9A 3VW8A 3UOJA 4E4MA 4G5JA 5CNNA 2QOHA 4PQNA 3RPYA 4YU2A 3BU5A 1B39A 3EWHA 4FA2A 4BHZA 3S00A 5EQEA 4G6OA 4ZTQA 3HV3A 1A9UA 3KF4A 5E8TA 3R1NA 5EDPA 4WRGA 1YXXA 2YJSA 2OSCA 4IM3A 3RVGA 4FIIA 3OBGA 3GU5A 5KNJA 5FM3A 5KMKA 5HCYA 4O7TA 1SVGA 2GS7A 3HNGA 2PMOX 4R6VA 2B9JA 1J7LA 3WZUA 5K3YA 4PNKA 4YHJA 3OWLA 5EI8A 2BPMA 3UVPA 3ZS5A 3FQHA 4QO9A 2XIYA 4O0WA 2HWPA 1APME 4G6NA 2F2UA 3PIZA 5DEYA 2YA9A 2LGCA 3BHHA 4L44A 3ORNA 4C2VA 4YSMA 3ID6C 1CKPA 3NMUF 3LFDA 3CQWA 2V22A 3GCVA 3PIXA 4FG7A 5F94A 3U51A 4CFMA 5CLPA 4D1XA 1U54A 2B55A 4RIOA 4WNPA 4IB3A 5D11A 2ITOA 4X3FC 4OTQA 1Y8GA 2WZJA 3TT0A 1PXOA 2QU6A 2W1ZA 2GNIA 3EOCA 4CTBA 5GIPE 4I92A 2I1MA 2PWLA 5EOBA 1XH9A 3FC1X 4RIXB 3A8WA 3IW7A 2PY3A 4U0IA 3HEGA 4GKHA 4FK6A 2WQNA 4JDIA 4MWIA 3AD5A 2B4SB 2HWOA 2J0JA 3DDPA 5FXQA 3FXXA 3R9DA 3HP5A 3HV5A 4XHKB 5HG5A 4FTUA 2JKMA 4EHZA 4LUEA 3VO3A 4EOOA 4AQCA 4NIFA 4AGUA 3ZTXA 4QMTA 4I93A 1M7NA 3LVPA 1S9IA 2BALA 4JJRA 4GT4A 2V0DA 1LP4A 4HCTA 3V5JA 4IDVA 4BDDA 1J1BA 5FP5A 4DAWA 4F7LA 4XOYA 2B0QA 4O84A 3SV0A 3K3IA 1URWA 4FZ6A 3DB8A 4C3PA 1W0XC 4AZEA 2R7IA 4XP2A 3QRUA 3PJ2A 4ZSGA 3S4QA 5A4TA 4GVAA 3OWPA 4FSWA 1OUYA 5KMNA 4QRCA 2BAQA 3BZ3A 1W84A 5FWKK 3PLSA 1GOLA 2GNFA 4LMNA 4ZY5A 1I44A 4PRJA 3QKMA 5EG3A 1WZYA 2X39A 1W8CA 5KZIA 3DZQA 5KO1A 2JIIA 1SMHA 2YN8A 4AZFA 3R8LA 2WMXA 4FYOA 4O6LA 3M11A 5IQEA 4GK2A 4DEIA 4Q9SA 3RAHA 4BDIA 3Q2JA 5AV1A 5E8YA 1H26A 5HBHA 3RK5A 4C0TA 4F70A 4QTDA 2QOIA 1GJOA 2EWAA 4HGTA 5I5ZA 3GCSA 2XNOA 3LE6A 5EYKA 4ZMEA 4LV8A 4TPTA 5IH4A 5EM6A 5LQFA 5EQYA 3OHTA 4QT1A 5K4JA 4OT6A 4P5ZA 2NPQA 4CV9A 5AP0A 3TZ9A 3QX2A 5FUTA 3RKBA 5H8GA 4MH7A 4EK6A 3ZDUA 3ZDIA 4BF2A 1KE6A 4F0GA 2R3JA 2X4ZA 2XIRA 3NS9A 3SGCA 2Y6OA 3TACA 4A07A 3EN7A 2P2HA 2GFSA 4TWCA 4TYJA 3UP2A 5CU2A 4M12A 3NYNA 3NYOA 2HXLA 4O2ZA 2PVLA 4ZLOA 2QC6A 1UKIA 4JG6A 2J4ZA 3VAPA 2X7GA 4G34A 2BAKA 4BI2A 3QBNA 2X9EA 1MQBA 3VUKA 2O64A 2QOOA 5GZ9A 4BCFA 2VTQA 3NNUA 1Z57A 2WEIA 4ASZA 3NUUA 4G17A 2CGWA 5GINE 1XWSA 2VZ6A 5E91A 4EJ7A 4I0RA 4A9TA 2YDIA 2XM8A 1QPCA 2BTSA 2WU6A 3L9NA 4AN2A 2WOTA 4FNXA 5IEVA 5EQPA 2W1DA 3FAAA 5CX9A 4CNHA 4JOAA 4JBOA 4FIHA 4C3FA 3QQFA 5DVRA 2YAKA 2QLUA 3H0YA 4M15A 4RIWA 4DYMA 4MXAA 4QP7A 5HLNA 3D5XA 4PY1A 4KS7A 2W99B 4FKTA 3DQWA 1JAMA 2EB3A 5FXRA 2OK1A 1FVTA 2QCSA 3T9IA 5BYLA 3HMPA 4BR3A 4EOJA 4GU9A 3QQUA 4TKSA 5ANIA 1PHKA 1SVEA 4LGGA 3P7BA 4FE2A 3GCQA 1BYGA 3PVGA 4TYHA 1WMKA 4Y5HA 4BDJA 1H27A 2YCSA 3O8PA 3ZO3A 4FEWA 3OW3A 2QURA 4WG3A 1XBBA 3CC6A 1VYZA 2W06A 4A7CA 5EM7A 1M52A 2J7TA 2OJFE 3IKAA 3RAIA 3FYKX 3CKWA 4OTWA 5ACBC 3VUMA 4EWHA 3CY3A 5T68A 3TKHA 3EZVA 4F4PA 4PNIA 3KN6A 4FV9A 1DS5A 4O86A 3ZM9A 3R8UA 5CU4A 1UU8A 3ZEWA 2Z7LA 4GK3A 1WBVA 3GBZA 3A4PA 3ZONA 2YJRA 1Y6BA 3Q9XA 1GIJA 2HENA 3D83A 3JPVA 2HY81 4BBMA 2RFNA 3QFVA 3QALE 4E3CA 3TTIA 3PXKA 4FTTA 4IBMA 4BWPA 3THBA 2BUJA 2X8DA 3KL8A 4EQUA 2ITPA 2ZM4A 2PE2A 3UOHA 4CGAA 3EQRA 3PYYA 5AAEA 1PJKA 3LCTA 2VRXA 1P4FA 2JFMA 2C6KA 4FSZA 5IDPA 2R3MA 2XBAA 1ZARA 3DJ7A 3NEWA 4AOIA 3E87A 4ACCA 3KA0A 4YZMA 2F7ZE 4X3FB 4PMSA 4O7NA 3AMYA 5HX8A 4O7LA 5GIOE 1MQ4A 5HE2A 3UPZA 3FC2A 3HGKA 3UZPA 3IGOA 2IVUA 4KKGA 2XJ1A 4M69A 3ZUUA 2VNYA 4OTDA 4WBBB 2BRNA 3SG8A 3R1YA 4RJ7A 1H8FA 5ANDA 4HVDA 4F63A 4LOPA 1ZXEA 1KOBA 3EQHA 3II5A 3IOPA 2WTIA 1H07A 1WFCA 2XNGA 3KVXA 4J8NA 5DNRA 4BB4A 4QQCA 3DK7A 4PDOA 4HZRA 3TJCA 4DTKA 2BZKB 3ORTA 4FT5A 2YIQA 3A4OX 5CF5A 5EHYA 5IQGA 4AGWA 1NVSA 3OEFX 3P4KA 3ZOSA 4YJRA 2XCHA 3IS5A 4I22A 2C1AA 2BR1A 2KTYA 2O3PA 3F9NA 4O2PA 3ORLA 2BKZA 3KRLA 4AF3A 4EHGA 3DAEA 4FV8A 4KNBA 3ATTA 1JPAA 4KBCA 3M1SA 4DGOA 3C5UA 3ZLWA 4FMQA 5IMXA 1ZZ2A 2GFCA 1DAWA 4UYAA 2VWYA 5LVLA 3DJ5A 3W10A 4H58A 5HI2A 3NIEA 1IG1A 2A19B 3GNIB 1IA9A 5JZNA 1OUKA 3VBXA 5KMJA 3RPRA 5DR2A 5FGKA 3OEZA 5KKRC 3ZM4A 3VJOA 2VUWA 3D5UA 4IX5A 4K0YA 4EH9A 4FKQA 3QD0A 2GHLA 2OKRA 3OOMA 4QMVA 5KMOA 2I7QA 1WBPA 4FKUA 4TZRA 3V5WA 2XA4A 5IA4A 3QTWA 3ACKA 4DC2A 5M44A 3G15A 4RX8A 3NUNA 4LOQA 3PE2A 2HCKA 4X2JA 3QYWA 3WZEA 2VX1A 3FQSA 4FT7A 4O27B 4YPSA 1WBNA 3VS2A 5BVOA 5I9ZA 2WQMA 4AW1A 2FGIA 5ICPA 3ZCLA 3PPZA 2GTMA 5ETIA 4DBNA 4QTEA 1QPDA 3VS7A 3BGQA 3H4JA 3EQPA 4GUEA 2FH9A 5HE0A 4BCMA 3V5TA 5BUIA 4F6SA 3FJQE 3QTIA 5AAFA 3U6IA 4FTAA 3U6JA 2W1EA 3RWQA 2PMIA 4IVBA 4E8AA 3ZZEA 3PP0A 4G3GA 4FOBA 5AUTA 3B8RA 4NIFB 4UXQA 4FTRA 4KD1A 5D12A 5T6KA 1VR2A 4A4XA 4FTKA 1UWJA 4ZTSA 4RJ5A 2RFSA 3LCSA 4H36A 5DEWA 4O7WA 2ETRA 3BYSA 3MFUA 4ACMA 3BHTA 4K6ZA 5CZIA 3KQ7A 1UU9A 4YO4A 3RK7A 2VTSA 3I5NA 2FYSA 2WEVA 3OBJA 5FLFA 3KVWA 5M4CA 4I41A 4DTBA 1Y6AA 3RBWA 4PTGA 3T8OA 4OTPA 3TIZA 2ZV7A 1WVYA 5ETAA 4PTEA 4DH5A 2WD1A 4NWMA 4AA5A 5BMMA 4QPMA 4W4VA 4YHFA 5E8ZA 3WZJA 4CZYB 3LQ8A 2J51A 3IQ7A 4U45A 4C58A 2I0EA 1WBSA 3NAYA 5CYIA 3U87A 4DF3A 3SKCA 1ATPE 4WUAA 3RK9A 3QQLA 5TT7A 3NIZA 3K5UA 1YHSA 4AS0A 4DN5A 5L8KA 4FSQA 3UVRA 4PDPA 3RZFA 1B6CB 1R1WA 3C7QA 3LAUA 4FUYA 2BRMA 4WSYA 1OL6A 3R7UA 4FZ7A 2VGPA 5E8VA 2V5QA 4M7IA 2PVYA 4IZ5A 4JG7A 5K4IA 5HCZA 1Q8WA 4GYGA 2HAKA 4D4SA 2XNBA 3E7OA 5HD7A 5CEPA 5AIKA 3TIYA 1CSNA 4CFWA 2A0CX 4MNFA 2YM3A 3UZRA 4O1OA 3FZTA 5A54A 2P55A 1KE8A 3LFNA 3IECA 4GT3A 2BDJA 2C5NA 3SXSA 3V8TA 3GCPA 5ACKA 2XEZA 3F3WA 4IMYA 5G6VA 3BE2A 3V5QA 4XMOA 4AA4A 3HAVA 4BTKA 3PXFA 3GT8A 3H10A 1HCKA 2CKEA 3I7BA 4TY1A 5DR6A 2R4BA 2C30A 3JS2A 2IZSA 2WIHA 3H9RA 4K18A 5DLSA 4D2PA 1XR1A 3QRJA 4FV4A 4FIEA 2B9HA 3F6XA 4P2KA 5DOSA 2O5KA 2ETKA 4IAIA 3LHJA 4CQEA 3MTFA 1H0WA 4L3LA 3PY0A 4NT4A 4OBQA 4EOIA 2F7XE 3WF9A 4FL2A 2YCRA 4U40A 5CU3A 4IWQA 3ZZWA 2UVXA 3DBDA 3OS3A 4QMMA 4BGHA 2UZEA 4ONAA 2OICA 4XG7A 5JFVA 4KIKA 4EH6A 3DDQA 2WELA 4AOTA 2YZLA 4HGEA 1J1CA 2PL0A 5IH6A 1YWNA 4TYHB 4YP8A 2EVAA 2OF4A 3RNYA 3GGFA 4EBWA 4F0FA 4QMWA 3QD3A 3A7GA 1ZOGA 2J2IB 3AT2A 3ZFYA 5AA9A 4A06A 4JR3A 5LMAA 4LOOA 4QTAA 3D2KA 4WD5A 4XRLA 3M2WA 5D9HA 4O96A 3DV3A 4FV1A 2V55A 3PWYA 1PKGA 3R1QA 4KWPA 3KB7A 3F2NA 3ELJA 3MFSA 2WPAA 2C6EA 1OPJA 4UV0A 4UMTA 3FHIA 3FPQA 4J71A 5AV2A 5JQ8A 4MNEB 5DG5A 5KBQA 4OAUC 3U8WA 3L1SA 3A99A 5LJJA 3HAMA 4EONA 4BTMA 4IDTA 4DFXE 3Q4ZA 3S3IA 3OP5A 4XV3A 2RF9A 3PXZA 5AR2A 1KSWA 3ROCA 4C4EA 5AAGA 3I6UA 4YLKA 3HLLA 5HBJA 5DGZA 3UTOA 3BCEA 5HICA 5TKDA 1V0BA 2PUUA 4HNFA 3HV4A 3ROYA 4D4YA 2QR7A 2IPXA 2WIPA 3OF0A 4P7EA 4FKGA 1YKRA 3AMBA 3FKOA 2UZWE 5I3OA 4O7ZA 4YSJA 3FZRA 2ZM3A 3PRFA 4MD8E 4EK8A 3G90X 5I4NA 5IQCA 3A7HA 3IDCA 4F9AA 3ZFXA 3UBDA 4PL4A 4ITHA 2I0HA 2QG7A 3PTGA 1XO2B 3MGYA 4IAZA 4S34A 2OIBA 1MRYA 2OFVA 3E3BX 2OH4A 1Q41A 1CKJA 3DKCA 3I5ZA 5AR4A 3UNJA 4D58A 3OTVA 4PDYA 3ZRKA 4IWDA 4U5JA 4G9CA 4YBKA 3HRFA 3MS9A 1FMKA 3F2AA 4B6LA 2WTKC 1DAYA 4AFEA 2JAVA 4U97A 2YIYA 4I23A 4D5KA 4DEEA 5IEXA 1F3MC 1DM2A 2VTOA 3DCVA 4UEUA 4FTLA 2B9FA 3AD4A 4S31A 1GZKA 2Z8CA 2HW7A 2WMUA 3KRXA 4TRLA 5DI1A 5HG7A 4AZVA 4BCHA 2PMNX 1Q8TA 3BYUA 4BDKA 1OITA 1JKLA 4B4LA 4LRKA 3OVVA 4RRVA 4M84A 3ENMA 4M0ZA 5H2UA 4O91A 1JNKA 3VC4A 4X7QA 2XB7A 1OMWA 4UN0C 4F99A 4E5WA 1OECA 1PXJA 4FKVA 3VS4A 4WUNA 4G16A 1YDSE 3HUBA 3FI4A 4XNEA 3TNWA 5LXMA 3G9LX 2WO6A 2Z7QA 3MH2A 5EKOA 4TW9A 3JVSA 5BVKA 3VUGA 4CYIA 3NNXA 3PUPA 4GL9A 2W1GA 3KKVA 3PA4A 4K1BA 4XS2A 3ETAA 4FKRA 3T3VA 4RFMA 4UMUA 4FTCA 3KXMA 5FRIA 3TDVA 4EH8A 2R3LA 4GFMA 4JVGA 2PYWA 4LUDA 4ALVA 4UB7A 3UYSA 1BI7A 4ANBA 4DEDA 4TL0A 4YZCA 3FMLA 3RINA 1UV5A 3FLZA 3QRIA 4XCUA 5IEYA 4FTMA 5BVWA 4FSNA 2JKKA 5DA3A 4CTCA 1KUTA 3RHXA 3QTQA 1GIIA 4FTNA 1W82A 5L6WL 1YVJA 3R0TA 3R7YA 3MJ2A 5A6NA 3GUBA 3TNPC 4C2WA 3HMIA 1WBOA 2PHKA 3P9JA 4U7ZA 4NTTA 3FDNA 3R8PA 4Y72A 4R7IA 2CSNA 2C0IA 4ANLA 3U9NA 4WRSA 2ITYA 1W98A 4NKAA 3RI1A 5JZJA 4KABA 3ZXZA 3KCFA 3U54A 4AZTA 4FIJA 1U4DA 4F09A 2YITA 2VX0A 4PMMA 4WHZA 5GJGA 4DEHA 4EZ7A 3SOAA 3QGYA 5IA5A 3GEQA 3ZO4A 4O6EA 1NVRA 3EQIA 4TNDA 3ZYAA 2R3OA 4ITJA 5F4NA 4AN9A 3U4WA 3RHKA 3NUXA 4BFMA 4G3DA 2PZ5A 1M2QA 2ERZE 3O23A 4AACA 3GC7A 4OAVB 5CSVA 1K9AA 3QQGA 3FLWA 3G6HA 5B2MA 4GS6A 4FSUA 3EFJA 2W7XA 4L3JA 4F9WA 4GG7A 3ALNA 4W8EA 3AGLA 2VTHA 4OTIA 1K2PA 1YI6A 5BYZA 4YNEA 2YZAA 4LYNA 1FGIA 1QPEA 2VWUA 2WFYA 3LMHA 4WOVA 4O0XA 4C4FA 4E20A 2BILB 4RWKA 4F9CA 4FYNA 2IVSA 3KC3A 3PPKA 4ANNA 4HCUA 2VTMA 4FKJA 4AUAA 2XUUA 4TWNA 5AMNA 4WT6A 4EJNA 5CAVA 3V51A 4EORA 2HIWA 2XM9A 3O17A 4AZSA 3WE4A 3EFKA 4EOQA 4IVAA 3LZBA 3MB6A 4RC4A 3C9WA 4DITA 3BIZA 3QZFA 4X0MA 2WMWA 3Q9ZA 3DOGA 5K0KA 3DXPA 4I94A 4JLCA 1NW1A 2BRHA 4O83A 2IZUA 3EYGA 4FK3A 1MP8A 3TL8A 4DH1A 4GMYA 3L8SA 2REIA 4PF4A 3K5VA 2ZB0A 5HHWA 3SOCA 3LJ0A 4AN3A 4ZTMA 3FLYA 4M14A 5CY3A 4JT3A 2C6TA 4EC8A 1WAKA 2P2IA 3OCGA 1CMKE 2E2BA 3OOGA 4F64A 2QR8A 4FX3A 3ZLSA 3TN8A 2C6OA 1XH8A 2XCKA 2X2MA 2ZV2A 1IASA 4KSQA 3HUCA 5M07A 4N6ZA 3KCKA 4EHEA 2C4GA 4XP3A 4MK0A 2Y7JA 4U3YA 3NSZA 2C3KA 5BUJA 1XH6A 2CGUA 4FIFA 4GK4A 5D7AA 3NUAA 4LGHA 1AGWA 3UNKA 4H3PA 3GENA 2BIYA 5CZHA 4ID7A 2OJJA 4E6DA 2IW9A 2UW5A 3EL7A 4ORKA 1T46A 3COKA 4DLJA 1V0PA 3P79A 4I6QA 4RA5A 2QNJA 2XBJA 4X2KA 2PVJA 2XIZA 4O38A 3TJDA 2EB2A 2YLEA 3PA5A 3PWDA 3W16A 4CT1A 4F7NA 2JGZA 3P7AA 3C51A 4JL9A 4ALUA 4YC8A 4U43A 5D1JA 4FT9A 1JSVA 3BU3A 4L67A 4AX8A 1WBTA 3E5AA 2C5VA 1XH7A 1YOMA 1JKSA 2VTTA 5FTOA 5CWZA 3UP7A 3R83A 4HW7A 2OO8X 3KRWA 3R9RA 2J5EA 4ZMFA 3I4BA 2V62A 3OMVA 5DR9A 5L3AA 4YJNA 5BQ0A 2QONA 5M06A 4BWKA 2WTKB 3MIYA 5DN3A 3R9OA 5E90A 4JBVA 3NAXA 2IVTA 1GZNA 4GJ2A 4ZZNA 1NVQA 4YJQA 4HYSA 5F95A 1YXSA 5EHOA 3CGFA 2XJ2A 4GW8A 4N0SA 5M57A 3BKBA 5AM6A 4R7BA 5G1XA 2G1TA 3DKFA 4OT5A 1YRPA 2XK3A 3IONA 1FVRA 3NRMA 5IQDA 3HL7A 3E8EA 2Q0NA 3ODYX 1UU7A 5KE0A 3MBLA 4WG4A 4NUSA 3GU7A 4Y8DA 3EN5A 4FOCA 5JRSA 4RZVA 4I5CA 4IHPA 4DCAA 1GZOA 4GRBA 4AG8A 3A62A 2R3KA 3P78A 4XUFA 2OG8A 4FV7A 4WA9A 4BCPA 5H8BA 3SG9A 1H00A 3LCKA 4FTIA 4OBOA 2HZIA 3NLBA 3ZUVA 3D7TA 4DCEA 4XG9A 5TE0A 1PMEA 3S95A 4QMOA 3RCJA 5BVEA 2G15A 2FSMX 4I6BA 4RZWA 5J7BA 3EQGA 5HU9A 1FGKA 5CF6A 3LFCA 5HBEA 2ZDTA 4W9XA 3SW7A 3CTHA 1H24A 1Q97A 3CGOA 5E8SA 5L2IA 3QA8A 3LPBA 3V04A 4X6QC 1BKXA 5HG9A 5ANGA 5CT0A 5EI6A 5HU3A 5TO8A 2XP2A 3PG1A 3QXOA 4FV0A 2G01A 4QTCA 3C0IA 3KFAA 2X4FA 3OROA 4DFZE 3ZHPC 2WTDA 4XOZA 4WSQA 5HO8A 3FLNC 3UMWA 2HXQA 2JBPA 5DHJA 2QD9A 5K5NA 2IJMA 5AUZA 5HTIA 4YO6A 5E4HA 4FKIA 3V01A 3O0GA 5AJQA 1UWHA 4EZ3A 4D4RA 2XRWA 3I79A 4LG4A 4C57A 5C8NA 4ZIMA 4HPUE 3KXNA 4FNYA 3CKXA 3E64A 3OWJA 5AFVA 1ZWSA 2A1AB 5IA1A 5JMSA 4FSTA 4FKSA 1U5RA 1YWRA 3QCSA 4O1PA 3F5GA 3PIYA 4A9SA 5J9ZA 1PMUA 4IH8A 1Q3DA 1YXTA 5DT4A 1OPLA 3QXPA 1P4OA 3HA8A 3ODZX 3UIMA 2WNTA 3LFQA 3JUHA 2ITVA 4HYUA 3PXYA 4RJ4A 1MRVA 4ERWA 5HOAA 3P0MA 4EKKA 4ENYA 4ASEA 3BQCA 3SXRA 1CDKA 5E7RA 3RJCA 2QG5A 3F3TA 5IUGA 2PZIA 4LFIA 2NNWB 2W4JA 1PXNA 2ZVAA 3MWUA 4I4EA 3TUBA 2P0CA 5CANA 4C4GA 3WILA 5JFXA 5EM8A 3BYVA 5IMEA 2F9GA 4Z55A 1M17A 2H6DA 1P5EA 4FVPA 4UWYA 4CCUA 5FTQA 1CM8A 5GHVA 3LMIA 3QL8A 3RWPA 2W05A 2HOGA 3H9FA 2ZOQA 1REJA 3C4ZA 5DRBA 5HO7A 4AE6A 1G8SA 1PXLA 5L6OA 2VO7A 2YM5A 4IANA 2ZMCA 3GC9A 4E6CA 2XKEA 4PTCA 3ZLXA 2J6MA 3D5VA 4C7TA 4CXAA 2BZIB 3N51A 3LFEA 4E6AA 5JSMA 1ZRZA 3F61A 3IDBA 2Z2WA 3C5IA 3QHRA 2W1FA 4QMPA 5C01A 3TUDA 5C03A 3Q6WA 5HIBA 3L8XA 1FVVA 3W2OA 2BAJA 2HELA 4AP7A 4FEUA 4AW0A 3VBVA 4EH7A 4J7BA 4GKIA 4W4XA 2ZV8A 3D0EA 3L8PA 3BGPA 2YWPA 4J98A 4U3ZA 2C6IA 4V04A 4ZAUA 2R0UA 3R8MA 4DGMA 2YCQA 5AUYA 3PSCA 4ZTHA 4JDHA 4AZWA 4UALA 4NCTA 3PJ1A 4DGNA 3L9LA 2B9IA 4H3BA 4U8ZA 2X0GA 3TV4A 4BDFA 3PY1A 3MA6A 2XKDA 4XEYA 3BEAA 5AP7A 4I21A 1PRYA 4XLIA 3H30A 2PVHA 3QRKA 1YDTE 3ZBXA 3P23A 3W55A 3DK3A 4YGAA 2X8EA 3DNDA 2CLXA 2XZSA 3CP9A 5L8LA 2AC3A 1M7QA 2IVVA 4HVSA 4KRCA 4EI4A 5CTPA 3DXQA 1Q24A 3KMWA 1TQPA 2CLQA 3W32A 5AEPA 2ITNA 5AP6A 3UOLA 4HZSA 5CF4A 2YDKA 3R02A 5M51A 4ITIA 4JQ8A 5AUXA 4CRLA 1UU3A 5ANOA 3SC1A 2XNPA 4RIYA 3BWFA 4QYGA 3JYAA 3LFFA 2G2HA 3BV3A 4E6QA 2E9NA 5HQ0A 4MXOA 2GNJA 3EKKA 4BCNA 5H3QA 2WMSA 2W17A 5AV0A 3Q52A 3H3CA 4MCVA 4MF1A 2PVKA 1LEZA 3KRJA 5HG8A 3VUDA 4F6UA 3P86A 5K5XA 2QOBA 3KXGA 5A6OA 3R6XA 4FZAB 3PG3A 3QUEA 3K54A 5I9UA 4BIBA 2E9VA 1OKWA 2JFLA 4WNMA 2PZPA 1NA7A 4MF0A 5CAOA 4C02A 2VO6A 3WARA 4MXXA 2WXVA 3AC2A 3DLZA 2OI4X 4GVJA 4XBRA 1IEPA 1PXMA 3TV7A 3TXOA 3LKMA 3MYGA 1OL1A 3NW6A 4RQVA 4UWCA 1ERKA 4O7VA 1XH4A 5JK3A 3HMMA 4B8MA 3KMMA 3DFAA 4NSTA 3UOKA 1O6YA 3VHEA 4V01A 1NXKA 4D55A 2OGVA 5HLWA 2R5TA 5LMKA 2Y8OA 4LMUA 4BWXA 5I9XA 5LOHA 2YACA 4I0TA 3DKOA 2YWVA 5CAUA 5C27A 2W9FB 3LLAA 4E26A 4TXCA 3DNEA 5E9EA 4RWIA 4AGDA 1WCCA 5E1SA 4LL0A 1R0EA 4BDGA 4LL5A 4QP2A 3CQEA 3LIJA 4R3RA 3B2WA 3CD8A 3KN5A 3G0EA 3HRBA 2PTKA 3KREA 1GY3A 1IA8A 2C6MA 3LW0A 3P1AA 4MEDA 2I6LA 2W5BA 4ACGA 3LXLA 1J3HA 1BLXA 3FMKA 4H05A 2J9MA 4MVFA 4JIKA 4AT5A 2X7OA 4G31A 3OY1A 2WTJA 3E92A 4IJ9A 1VYWA 2JDVA 1H25A 2X2KA 2ZM1A 3GFWA 1ZLTA 2PSQA 4N70A 4TNBA 4S30A 1U54B 4M13A 4L42A 5CSPA 4UWBA 4LQMA 1A48A 3ZO2A 5A4QA 5I9WA 2V7OA 4QOXA 4ALWA 1PXIA 3NUSA 4DTAA 4BL1A 1QCFA 4L9IA 3ORPA 4DHFA 5J9LA 4MXZA 3WF6A 4EQCA 3UJGA 4M97A 3NWWA 3TKUA 5DMZA 4ACDA 4DFUA 2UZBA 1H1QA 3OG7A 4RGJA 4GT5A 2VWZA 4FZFB 4NKSA 4I0SA 4APCA 4EUTA 4UYNA 4CMOA 5D7VA 4FSRA 3QQKA 5J79A 1H1SA 1H4LA 4UY9A 1G8AA 2UW4A 3TNHA 5CVFA 3Q96A 3LXPA 3CTJA 5CEIA 2CJMA 5L2TA 1JLUE 3UQCA 4U44A 4O7YA 2BRBA 5IKWA 4M8TA 5C8MA 2RG5A 3E62A 2ONLA 1UA2A 4TN6A 3ZSIA 3UC4A 4E93A 2XNMA 3D14A 2ITZA 3QYZA 3GU4A 3GVUA 2P3GX 4MXCA 4DT8A 5I9YA 2GNLA 3CBLA 3EQBA 4IJPA 4UZDA 4RG0A 2R64A 4CG8A 2R0IA 1PMNA 4P4CA 5B7VA 3V5PA 1RDQE 3DS6A 3FZSA 3Q4CA 2UZVA 4CKIA 5HTBA 2BMCA 4GSBA 4ZP5A 1Q8YA 1F5QA 3E7VA 3PXQA 4DFNA 3BRBA 1KV2A 2H96A 3HMOA 5LVPA 3QD4A 4V0GA 4F6WA 1W83A 3MFRA 2X81A 3UG1A 3PXRA 2P33A 3W33A 3DFCB 4IB0A 5CSWA 1J91A 3RALA 4BI1A 4I5PA 4GJ3A 1PYEA 4KAOA 4EWQA 4A4LA 2I0VA 3MVMA 4KIQA 4CSVA 4UMPA 3EQDA 5A3XA 4FTOA 3RNIA 4F0IA 3B8QA 4K8AA 4Y73A 4YZDA 1SM2A 4FV5A 3VS6A 3Q5IA 4HOKA 4ANSA 2UW7A 5IQFA 4J95A 2GS2A 4XG4A 1OKVA 2YM4A 2UW3A 4XG2A 3AC5A 2W5HA 3VQHA 2J0IA 2O65A 3PP1A 4NH1A 4D28A 4RWLA 4QMQA 2WOUA 1VJYA 2JDRA 4FV6A 2EXCX 3KULA 5AP4A 4Q5EA 3DZOA 2C0TA 3PVUA 3RMFA 4FNWA 4C38A 4TYGA 3NPCA 2UZLA 4IB1A 2YEXA 4E4NA 5M08A 3R2BA 4NTSA 2PVFA 2F7EE 5ETCA 3DXNA 1ZZLA 3VS1A 3BYMA 3KRRA 3VF8A 2WQEA 1U46A 4IEBA 5EYMA 2R3NA 4EH4A 2CNVA 3D15A 4II5A 3F5XA 3LFSA 5BVDA 2ONLC 2IW8A 4ARKA 2JKQA 5I9VA 2JDOA 3NVKI 4OTRA 2OXXA 4KB8A 4WO5A 5B0XA 4QMZA 5AR8A 5A9UA 5BNJA 3FZOA 3MW1A 3TKIA 3MY0A 3QWKA 5AUUA 4RIWB 1OZ1A 2WU7A 4ZY4A 3OCSA 4FF8A 4KA3A 3E3PA 4R3PA 3VW6A 3EMGA 4GFOA 5J95A 2HK5A 3BGZA 4PMTA 3FL5A 3F82A 3E93A 3EKNA 4MKCA 4XLVA 2JAMA 4NFMA 5DFPA 4DH8A 5CALA 1KE7A 4C35A 5HVKA 4MWHA 5I0BA 3HECA 4BTJA 2C69A 1Y91A 1FPUA 2CDZA 2XMYA 3HKOA 4IB5A 1YOLA 4RX7A 3TZMA 3BBWA 3ZBFA 4GU6A 4D2RA 5HD4A 3V6RA 3GB2A 3C4EA 3RAWA 4FEXA 3NGAA 2PVMA 4LV5A 3EN9A 1OVEA 4LRMA 4PDSA 4NJ3A 3GCUA 4CKJA 5HNGA 3FYJX 3OCBA 2FSTX 3W2SA 3KU2A 4JX7A 3JR1A 3D4QA 4YJPA 4AT4A 5IA2A 4BCOA 1DI8A 3FI8A 4IAAA 5CSXA 5KCVA 4ZZMA 4IQ6A 4B9DA 4DFBA 4QP8A 2C68A 1P14A 4QQJA 4A9RA 5BPYA 2F2CB 2F57A 3FXZA 2C6LA 2OJ9A 1FOTA 3NDMA 2R3RA 3TEIA 4I24A 4GV1A 4ZSEA 3FMHA 3EN4A 3C4FA 5TF9A 3UGCA 4IACA 4RIYB 4FVQA 5J9YA 4QYYA 3VBWA 3CXWA 4QMSA 1RE8A 2BVAA 3CIKA 4E4XA 2R3IA 4RVMA 1XJDA 1LUFA 4GIHA 3F5UA 4Y46A 5L2QA 4JQEA 4ZSAA 1AQ1A 4MX9A 1CTPE 5HE1A 4RIXA 3Q4TA 1Z5MA 4IVDA 4M69B 1R3CA 5ANJA 2JIVA 3HA6A 3KXHA 5T3QA 3AMAA 3HV7A 1MUOA 4NM3A 5LARA 5LVOA 3COMA 2VWXA 3HZTA 4IADA 4XV2A 4CRSA 3GOKA 4IM0A 4C4IA 4CMUA 1G5SA 4DEBA 4OLIA 4FIGA 2XKCA 4KKEA 3MV5A 2AYPA 4JR7A 3VN9A 2G2FA 2QOLA 3UPXA 4BKZA 5ITAA 4EUUA 4Z16A 4L7SA 4IFCA 4IX3A 4L53A 4XRJA 4CLJA 2FA2A 3PJ3A 2CN8A 3ANQA 1W7HA 3CE3A 1H0VA 3W8LA 4AOJA 4AWIA 3AGMA 5LWMA 3Q04A 3DBFA 2YERA 3BU6A 2B53A 1WBWA 2PE0A 4EOKA 3E8CA 3Q3BA 2WAJA 2WMAA 4CV8A 4O0UA 5AP3A 5CEMA 2QODA 2BRGA 1YXVA 3F88A 4J53A 3R1SA 4QP3A 1YI3A 5D10A 3U9CA 3BHYA 4XG6A 4DA5A 3GP0A 4R3CA 2CCHA 1O9UA 3QLGA 4EYMA 3DAJA 4I3ZA 3DTWA 4IAKA 4MQ1A 3ZH8A 4O21A 1JSUA 4ANOA 5A46A 4D1SA 1E9HA 1M2PA 4LGDA 4YTHA 5DT0A 5FG8A 5IQAA 1KE9A 3LM5A 4ASXA 3WF5A 2UVYA 2YIRA 3K3JA 2Y0AA 3S0OA 4YPDA 3NNWA 4LRJA 3VQUA 4TTHB 2WGJA 1L8TA 2X2LA 3NCGA 3D7ZA 3AT4A 2RL5A 2YCFA 3B2TA 3IW5A 1XQZA 3A7JA 2ITWA 3IDPA 3MIAA 2BFYA 4CMTA 2C3JA 3E88A 4FV3A 4QP9A 3H0ZA 2W1HA 1FQ1B 4M0YA 2XF0A 2BZHB 4CZUA 3LFAA 3SRVA 1JOWB 4RBLA 5AR3A 1YWVA 3IO7A 3BHUA 2VO3A 1ZYSA 3R22A 3E8DA 3NYXA 4IC7A 2JKOA 3FZ1A 3I1AA 3EN6A 4BCKA 3TNIA 4QP1A 5CI7A 3FLSA 3D5WA 1Q5KA 5L2SA 4O0TA 4O7SA 3BX5A 3OZ6A 1ZMVA 4KSPA 3ZEPA 2Z60A 3UQGA 3PVBA 3SQQA 4BBFA 2CKQA 3N4UA 1Q61A 4EH5A 2UW0A 3EFLA 1M2RA 4APPA 2XNEA 3LCDA 4AFJA 1IR3A 3RM7A 3CSVA 4D2SA 4F08A 1JWHA 2OBJA 1G3NA 5IUHA 1I09A 2UV2A 2R3PA 2ITXA 4CFXA 3VWAA 2A2AA 4L45A 3OT8A 3SHEA 3CQUA 1O6KA 2W9ZB 2X1NA 3D94A 3GFEA 4AA0A 3QRTA 2WTCA 3R8VA 3C0HA 1Y57A 4WNKA 2R3QA 3NW5A 4FG9A 3VIDA 4CFUA 4XJ0A 5FDPA 4D9UA 4V0GB 3QAME 5HNIX 3UODA 2YHVA 4YJVA 3RPVA 3MESA 4F7JA 1J7UA 5L2WA 4CLIA 3TWJA 4QNYA 4PUZA 3VRYA 5A4CA 3VF9A 3FLQA 2PE1A 4FODA 5ANEA 3ZSHA 4L3PA 1X8BA 4X21A 4DINA 3SX9A 3EL8A 4N6YA 4GCJA 3VS0A 2YISA 5HCXA 3F3ZA 3I0OA 4J97A 3C1XA 3G0FA 1PXKA 1M14A 4O0SA 2UZDA 2BFXA 5AR5A 5HIDA 5HGIA 3ZC6A 4D2WA 4EOMA 2W0JA 2PZRA 3UYTA 4JS8A 3NUPA 2OZAA 1CKIA 4Z9LA 1BX6A 2GNHA 4U9AA 5KBRA 3ZSGA 2XS0A 4RX5A 3TZ7A 2GQRA 2DUVA 4GIIA 4QP6A 4BIEA 1ZYLA 5H9BA 3BQRA 3M42A 1EH4A 4JQ7A 4EC9A 4EK4A 5IPJA 3G51A 5C26A 2B1PA 3ZFMA 4JNWA 3Q5ZA 3DKGA 4CZTA 4WIHA 5LVNA 3BEGA 2QKWB 3O71A 4PP9A 3K2LA 4FEVA 4ZLYA 2XKFA 3MH1A 4ZTLA 3FHRA 3QZHA 4EHVA 4X3FA 1ZYDA 2UVZA 3C50A 2ITQA 4IZAA 2WHBA 4QYFA 3CLYA 2QU5A 2GQGA 2ZJWA 5JQ5A 4ZY6A 4BCGA 5M4UA 4RFZA 4AGCA 1HCLA 3F69A 2EUFB 4X2GA 4CG9A 4Q9ZA 5CS6A 1TVOA 5EW3A 2UW9A 5HKMA 3VRZA 2FSLX 2UZTA 4MD7E 2XJ0A 5CSHA 4EBVA 4BYIA 4EH3A 3LXNA 2O8YA 3IW6A 4USDA 3FBVA 1OKZA 1JKKA 3MN3A 3OW4A 3FPMA 3O7LD 4OTHA 2VN9A 4FL1A 2J5FA 1R0PA 4FL3A 2YM6A 4KIKB 3LXKA 4PV0A 1OIRA 2C3LA 3QZIA 5F9EA 4USEA 3HMNA 3VBQA 2I0YA 5AX3A 4BDHA 3DPKA 1FBNA 3NVMB 3IOKA 4AAAA 4C59A 2JIUA 4I6FA 3UIBA 1T45A 3JXWA 1ZY5A 1E1XA 3O50A 2G2IA 3JVRA 1PF8A 4YTIA 1F0QA 2CGXA 3SDJA 2VWBA 5JKGA 3TUCA 4R77A 5AP2A 2BHHA 4NZWB 2QOKA 3NW7A 4IX4A 2IN6A 5CF8A 4YJSA 4JX3A 3ZRMA 3ACJA 4B8LA 1JQHA 5C9CA 4ERKA 2CKPA 4DG3E 3HVCA 3HYHA 2C47A 1Q3WA 4LM5A 4TYIA 3W18A 4EOSA 5JH6A 2BIKB 4RQKA 4AW5A 4JBPA 3RPSA 2RKUA 4DEAA 1XBAA 3GQLA 1ZOHA 3QC9A 5CU6A 3WOWA 4DBXA 2J0MB 4I4FA 5LWNA 2R3FA 2GPHA 4K33A 2CGVA 4CCBA 3EH9A 3OY3A 3PSDA 2JC6A 1O6LA 4A4OA 3LMGA 4RLKA 4M67A 5CEKA 3UE4A 4X2FA 5CXZA 4EYJA 3SVVA 3N4VA 4DLIA 2KULA 4MAOA 4IAFA 3QKKA 4I20A 4PPAA 4FGRA 5EYDA 5JFWA 4BDEA 3QTRA 4R1VA 3A7FA 3MI9A 4KKHA 5GJDA 3IW4A 4JDKA 5JN2A 4E7WA 5HX6A 3LLTA 3NR9A 2F49A 4J99A 4RVKA 5IQIA 2UZUE 3FY0A 5HO6A 4PPBA 3ALOA 2YFXA 3TI1A 1OBDA 5AV4A 4RA4A 1RQQA 5BVNA 2JDTA 4LI5A 5JFSA 4S2ZA 3LFBA 4QMUA 5EDQA 2J0KA 5CAPA 5EFQA 1H01A 4G6LA 5AM7A 5TR6A 2VWIA 5C4KA 2DYLA 3R01A 2I40A 2PZYA 5KHXA 2OLCA 3FL4A 3F7ZA 3MH3A 3OD6X 4NU1A 4YZ9A 2Y4IC 4IFGA 1XBCA 2WTWA 1WVXA 5AR7A 4NL0A 4FUXA 4D1ZA 4USFA 2IG7A 3EIDA 2VTJA 4YTFA 4DG0E 5J5SA 3AC8A 3DQXA 4QYEA 2O2UA 4QPAA 3BELA 5CXHA 1TKIA 3FWQA 5BUEA 4FI1A 3R9NA 2BDWA 5EM5A 1H28A 4L00A 4BGGA 3QU0A 3PPJA 4Z7HA 4FVRA 4C4JA 4BZNA 5EK7A 3VVHA 1XH5A 3ORXA 4L46A 4C33A 3T9TA 5EYCA 1R39A 4BTFA 3FKLA 3KEXA 5CI6A 4EH2A 2YDJA 3GC8A 5J7HA 5AV3A 2ZB1A 4Q2AA 4HGSA 1BL7A 3UIXA 2NRYA 4CQGA 3LOKA 4ANMA 3C4XA 5CVHA 3RGFA 3RPOA 3SW4A 2G9XA 2CKOA 4N4SA 2RG6A 2GCDA 4H3QA 2QKRA 5HNBA 4EOLA 5L4QA 3KY2A 5DYJA 4QMXA 5CEOA 2BHEA 4BDCA 4QP4A 3KK9A 3O7LB 4X2NA 1KWPA 4TT7A 3Q9YA 3SRVB 4BBEA 3FEGA 3QTUA 5GZ8A 2OIDA 3HDMA 3QC4A 3CTQA 5J1VA 1PMVA 2PUNA 4WKQA 4IWOA 4ZTNA 2BROA 3Q32A 2VTLA 3FMNA 2R3GA 4IX6A 5AUVA 3WE8A 2WMBA 2C5OA 4PL5A 4QNAA 4K2RA 3UIUA 5JEBA 3R71A 5HVYA 5KX8A 4MBIA 2V7AA 3FQEA 4MD9E 3MVHA 2UUEA 5DH3A 2XK9A 4R7HA 3TG1A 3VHKA 2WTVA 4G5PA 1VZOA 5HLPA 5B2LA 2IZTA 3EFWA 3TCPA 2GQSA 3MDYA 4KRDA 4EK5A 4J52A 4YJTA 3A60A 2C5XA 4ZS0A 4MTAA 3DK6A 4I5HA 3O8TA 4ZZOA 4G3EA 1OIYA 2GHMA 4QYHA 4OTGA 4KINA 4H39A 4E73A 5LCJA 5BVFA 1Q99A 4IVCA 5EH0A 2LAVA 3FMDA 2W4OA 3ERKA 2Z7SA 4E5AX 4Y83A 3HV6A 3F3VA 5HORA 4PWNA 5CENA 1YDRE 5A14A 5JRQA 4NM0A 3SA0A 3G9NA 4NEUA 3D2IA 3E8NA 3I7CA 4QPSA 2HW6A 3VUIA 5KHWA 1U59A 3W2PA 2SRCA 2CPKE 2B7AA 4FTQA 1LR4A 4FKLA 4ZS4A 3UC3A 4FBXA 3CR0A 2ZDUA 4FT3A 4YR8A 3O2MA 5C8KA 2QOQA 4F9YA 3AOXA 3U6HA 2PUIA 3EQFA 3VBTA 2C1BA 3FI3A 4W4YA 3RP9A 3TDWA 3ORMA 3NUYA 1SNXA 4AE9A 4N57A 3PZHA 4Y95A 4FT0A 4HGLA 4YUQA 2NRUA 1DI9A 4JI9A 3W1FA 1WVWA 2QOFA 4C37A 3V5LA 2OZAB 4F7SA 1A06A 1QPJA 2UZNA 2J90A 3BLHA 4FKWA 4MNEA 5CNOA 5FDXA 4ZJIA 3VUHA 3PY3A 4O0RA 1PKDA 2X6DA 2C6DA 4JG8A 3DLSA 4JXFA 2RSVA 5CEQA 4BCIA 3ZMMA 4ACHA 4JRNA 3IW8A 4K77A 1YHVA 2P4IA 3F3UA 4QQ5A 4D0XA 4BCQA 5AA8A 3A8XA 3QLFA 4DH3A 4O81A 4J8MA 4ZXTA 3SLSA 5AUWA 4KS8A 4XV1A 5IU2A 2GSFA 3R7OA 2C3IB 4PX6A 3OCTA 1OL7A 5J87A 1UKHA 4UMQA 4BZOA 2FSOX 2YABA 3QZGA 5E92A 5J8IA 4ZK5A 1BI8A 3OUKA 4HYIA 4QMLA 5JT2A 2IO6A 1TQIA 3P5KA 5FM2A 4O0YA 1FMOE 2E9UA 3POOA 2AC5A 4NM7A 1ZY4A 4NCTC 1OPKA 2VU3A 4RVLA 3CJFA 2OU7A 3WIGA 4DFYA 3MSSA 4IWPA 4U81A 3WBLA 5IZFA 3V6SA 1BMKA 2JEDA 3W2QA 3CD3A 4BYJA 4OW8A 3UNZA 1IAJA 3C4CA 4C34A 4KBKA 4JDJA 1H1PA 2ZMDA 3FXWA 3PE1A 3R7IA 5EW8A 3ZRLA 2AUHA 3TM0A 1PW2A 1ZAOA 2O63A 2XK7A 2IW6A 1B38A 1YHWA 3TZ8A 3ZO1A 4U42A 3QGWA 2CNQA 3DU8A 3ET7A 4XYFA 4YJOA 5HTCA 4J96A 3BLQA 1IAHA 3QD2B 2CMWA 2PU8A 4TYEA 2WB8A 4YURA 3PDTA 3CCNA 4U6RA 3R7VA 3SXFA 3VUTA 4EEVA 4F9BA 5HZNA 1OBGA 3EQCA 2WMTA 1SNUA 4FNZA 5IUIA 3L9PA 4OGRA 4NM5A 5IISA 2Y4IB 3PRIA 2GHGA 4C36A 4BZDA 3FSFA 2DS1A 2YIWA 4F1OA 5EKNA 5JGDA 5K0XA 3ANRA 3WF8A 3POZA 4Z7GA 1IRKA 2GU8A 3G5DA 4HYHA 4BN1A 1PYXA 5HESA 2FUMA 3UO4A 1KE5A 3BBTB 4RLLA 4WG5A 2YLFA 3AXWA 3A61A 4DFLA 4RX9A 3LQ3A 2IWIA 3O51A 1ZOEA 3ITZA 4D0WA 1OM1A 4YJUA 4YZNA 3ORIA 2PVNA 4DT9A 5CU0A 4C62A 1PXPA 1JKTA 1UNHA 3EJ1A 4G2FA 4UBAA 4FV2A 2XRUA 5E8WA 1JBPE 4M3QA 4U79A 3QTSA 5D41A 4P90A 4BI0A 5BMSA 4XBUA 3NNVA 2XK4A 3D7TB 4OBPA 4R8QA 3WF7A 3OXZA 5FEEA 3P7CA 4RMZA 4RJ8A 3QKLA 4FSMA 4B99A 5E8UA 1KOAA 3CJGA 5DPVA 4AXAA 2W1IA 3BWJA 4BC6A 3ATSA 4QMYA 2XK6A 4S32A 5F1ZA 4D5HA 5KUPA 4FC0A 5LMKC 2OFUA 3ORZA 2Z02A 4FTJA 2QLQA 3FUPA 2X9FA 1H1WA 4L68A 4F65A 2XVDA 3NCZA 5IDNA 2W5AA 4L8MA 4M66A 5DBXA 4YZBA 1ND4A 4RSSA 4UXLA 3Q4UA 2OZOA 4QTBA 5EOLA 3DB6A 3WZKA 4CVAA 3R7GA 4IZYA 5F20A 3BPRA 5M55A 1XKKA 2GTNA 2GDOA 4CYJA 5FTGA 2ESMA 3ZXTA 2QHNA 4W4WA 4FZDB 4P5QA 3I81A 3VULA 2UW6A 3QQHA 3OXIA 4GUBA 5EI2A 1Z9XA 4BCJA 3PJCA 3QUPA 2W1CA 2C5YA 2WQBA 2BDFA 4DGLC 3EB0A 1BUHA 3Q60A 1YW2A 4IZ7A 2OJIA 3WYXA 3WI6A 3QCYA 4JAIA 3BYOA 3I0QA 2BKKA 1V0OA 3PZEA 3VS3A 5I3RA 4ZTRA 1OKYA 3QTZA 2RFEA 4BICA 2Q83A 4PMPA 3PFQA 3V8SA 5ETFA 2HY0A 4GYIA 3N9XA 1QL6A 4W8DA 2VAGA 5DRDA 2R7BA 4D2VA 1GIHA 2YAAA 3CPCA 3LCOA 4H1JA 5FBOA 3AC4A 4NW6A 1Q62A 5L6PA 3DJ6A 3N4TA 5FEDA 3IK3A 4JAJA 5GJFA 2RFDA 1KV1A 2WMVA 4EQMA 2RGPA 1GZ8A 5M4FA 3PA3A 3GU8A 3ZU7A 1BL6A 3BHVA 3O96A 4HNIA 2YIXA 3NX8A 4R5YA 3BE9A 4L6QA 4EZ5A 2NO3A 3E63A 2H34A 4ZJJA 2XH5A 3RCDA 4BHNA 5AADA 4JRVA 5FEQA 2HZ4A 2PVRA 1MRUA 2VV9A 5DWRA 4PP7A 4PPCA 2WKMA 4I1ZA 2R3HA 4B0GA 3R28A 2Q0BA 5E8XA 3HDNA 4BY9E 5BX0A 3FZPA 1JSTA 3RTPA 5HIEA 3W8QA 1SVHA 4L43A 3AD6A 4QD6A 3F5PA 4DE4A 5FQDC 3DA6A 5ANKA 4F1MA 1REKA 3BLRA 1OL5A 1Q8ZA 2ERKA 4XV9A 2C0OA 1VEBA 4ZSLA 1NT2A 2O0UA 3DGKA 3D9VA 4NFNA 2OXYA 3PJ8A 3PSBA 5FD2A 2ZV9A 3S1HA 4X6RA 3MPTA 4KIOA 3OTUA 3F66A 3MVJA 3SAYA 4RVTA 5IQBA 4U80A 4EKLA 4JBQA 2VO0A 3DAKA 4EK3A 3UG2A 5AIRA 3QHWA 3IPHA 4EOPA 4X3JA 5E1EA 3RZBA 1K3AA 2OIQA 2GNGA 4AT3A 3F7WA 4HVIA 4H1MA 3KXXA 3G2FA 4TWPA 5IF1A 3KGAA 2X6EA 4L7FA 1U5QA 3UVQA 3T3UA 1ZMUA 4DH7A 4XH6A 4OUCA 3QWJA 2VNWA 2A4LA 4IC8A 3O8UA 3R8ZA 3FMMA 4BGQA 3CY2A 3WIKA 3PVWA 3A2CA 3OC1A 5M53A 4GH2A 4RPVA 3IGGA 3KF7A 3OFMA 4UZHA 1P2AA 5HE3A 5LMBA 4OR5A 4RWJA 1URCA 2FVDA 2HZ0A 4M68A 4FSYA 4U41A 3G6GA 1SYKA 3ULIA 4NW5A 2EXEA 2Y9QA 2CCIA 3AG9A 4DEGA 4E5BA 4ZLZA 3RAKA 3TTJA 3UO6A 4BVUA 1OIUA 4NYEA 4FR4A 3LJ2A 1GAGA 4NK9A 4K11A 3NZ0A 2OXDA 3MPAA 4A9UA 3COIA 1YXUA 3EZRA 4UMRA 2WMRA 4CKRA 5GZAA 5KMLA 1RW8A 3QF9A 4IIRA 2VX3A 4BIDA 1LPUA 4G9RA 5DE2A 5KKRB 5FP6A 4YMJA 3TV6A 3AC1A 2PMLX 4C4HA 5CT7A 3L9MA 4HPTE 4D9TA 4RJ3A 3C4WA 3FSKA 3UMXA 3LJ1A 4XP0A 3MB7A 3LQ5A 3VNTA 2ITTA
chains in the Genus database with same CATH superfamily
2B54A 2OJGA 4YBJA 3EHAA 2XYUA 4XX9A 4D2TA 2UW8A 4ANQA 3UQFA 2FO0A 3KMUA 3JY0A 3MFTA 4O82A 4I6HA 3C13A 2BTRA 4OTFA 2OWBA 4ZSJA 2JLDA 2JD5A 3ORKA 5C4LA 2F4JA 3QTXA 4HVHA 2ETMA 4RC2A 5CVGA 1J7IA 3PLAE 3HP2A 2OF2A 3HX4A 3GU6A 1UNLA 3MA3A 3Q6UA 3REPA 3FKNA 2QHMA 3ZC5A 2JDSA 3ML1A 3GI3A 1S9JA 3AQVA 4MQ2A 4FKOA 5CASA 3LM0A 4E4LA 1AD5A 3FI2A 4L52A 2ZAZA 3MPMA 4DGGA 3EYHA 2XEYA 4V05A 3R21A 2BCJA 4BKJA 2QOCA 3I6WA 4WBOA 2QO9A 5KMMA 5A4EA 3MY1A 3WYYA 2JITA 2FB8A 1ZYCA 2WQOA 2XIKA 1QMZA 3R9HA 4F1TA 3DBEA 4ENXA 3FE3A 3GC0A 3W2RA 1UNGA 1STCE 2R9SA 4XG3A 2WMQA 3QCXA 3TNQB 2W4KA 4L01A 3RM6A 1YOJA 5LVMA 2ZYBA 3QQJA 5JGAA 4FICA 3GXLA 5DIAA 5B2KA 4FGBA 4YTCA 3R2YA 2PUPA 3AKJA 3DBCA 3OWKA 4RJ6A 2XIXA 5CQWA 4YC3A 3R63A 5J1WA 1FINA 3DY7A 4MBLA 2QO2A 1V1KA 5C1QB 1PY5A 2HYYA 2R2PA 4NJDA 5BYYA 4Z3VA 4IM2A 3VJNA 4GFGA 3CS9A 4GEOA 4C8BA 4QQTA 2ACXA 3I60A 2VTPA 3Q9WA 3A7IA 2QQ7A 3R00A 5FXSA 5AWMA 3S2PA 4CFNA 2YM8A 4R5SA 4G3CA 5M4IA 3UO5A 4KIPA 3BI6A 4MXYA 3ZLYA 2Z7RA 3BL9A 4G3FA 2VWWA 4HCVA 2CN5A 3BV2A 5DT3A 1OGUA 3CEKA 5J5TA 3F2RA 4JIAA 4S33A 4BDAA 3DT1A 2IZRA 5H8EA 4RC3A 3U4UA 5KMIA 4TWOA 4CFVA 2VWVA 4YHTA 5M09A 5IA3A 4IXPA 2DWBA 3MVLA 4GG5A 1H08A 1Y8YA 4IW0A 3AT3A 3L8VA 5CQUA 2GMXA 5HEZA 2EXMA 4EL9A 4BKYA 2VTAA 3FV8A 1XHAA 4HJOA 4YLJA 2OH0E 3P08A 3QCQA 5GNKA 5AX9A 4MHAA 2J50A 4ZOGA 3V8WA 1OIQA 2UZOA 2W96B 3DBQA 1JVPP 4AU8A 4AW2A 2GS6A 3OT3A 3FMEA 4Q5HA 4G1WA 4BRXA 4Y85A 3KXZA 4A9YA 3VS5A 2E9OA 4BDBA 4XG8A 3NYVA 2JBOA 1H1RA 4FKPA 4R1YA 4O22A 2VGOA 3V3VA 3IG7A 1TQMA 2H8HA 3MH0A 3VBYA 5M56A 3U55A 5IQHA 4RFYA 4YC6A 5TOZA 4KBAA 3H9OA 4I5MA 4O0VA 1ZYJA 4E1ZA 5FBNC 5EDRA 1YI4A 3FY2A 3R04A 2OW3A 2CHLA 2E9PA 4DG2E 2VTIA 3QUDA 1OL2A 2ITUA 2B52A 2Y4PA 4RT7A 3SD0A 4D4VA 4B7TA 5AP5A 3AKLA 5L8JA 4IAYA 5AP1A 5K9IA 3UDBA 5A4LA 5HVJA 4ASDA 2PK9A 1Q4LA 3CPBA 4PL3A 3W2CA 3TYKA 3JY9A 3GQIA 1NY3A 4FEQA 3FMJA 3WZDA 3MTLA 3R73A 2HZNA 3KK8A 3DTCA 4YNOA 4ZJVA 1XMLA 2VTRA 5KZ0A 1R78A 4CT2A 4K9YA 2QO7A 3KULB 2XNNA 4J1RA 2CNUA 3OXTA 3COHA 1L3RE 3OUNB 4CFFA 1GNGA 3ULZA 4UX9A 2XYNA 2NP8A 3G33A 5IG1A 3MJ1A 4C3RA 2XK8A 5IA0A 4Y5QA 1UVRA 2Y6MA 1LEWA 3C0GA 2RIOA 3Q2MA 2QVSE 2J0LA 4MBJA 3ZUTA 4C61A 1HOWA 2PULA 1SZMA 4CEGA 4QMNA 2DQ7X 2H9VA 1OI9A 3Q53A 5IH5A 2PPQA 3QA0A 5EW9A 2YM7A 2QI8A 4IE9A 3UZTA 3AC3A 3MY5A 2X8IA 3QX4A 5JGBA 4W9WA 3GOPA 2A27A 5EHLA 1OB3A 1Q8UA 3HRCA 3ENHA 4WNOA 5LCKA 4KUJA 4O7RA 2BZJA 2VD5A 1ZMWA 4YLLA 5CAQA 4R78A 2X7FA 4HVGA 1RJBA 1YQJA 4ZEGA 3R30A 1E1VA 4FG8A 4MYGA 2VTNA 4CD0A 3R7EA 2EU9A 3VW8A 3UOJA 4E4MA 4G5JA 5CNNA 2QOHA 4PQNA 3RPYA 4YU2A 3BU5A 1B39A 3EWHA 4FA2A 4BHZA 3S00A 4QDVA 5EQEA 4G6OA 4ZTQA 3HV3A 1A9UA 3KF4A 5E8TA 3R1NA 5EDPA 4WRGA 1YXXA 2YJSA 2OSCA 4IM3A 3RVGA 4FIIA 3OBGA 3GU5A 5KNJA 5FM3A 5KMKA 5HCYA 4O7TA 1SVGA 2GS7A 3HNGA 2PMOX 4R6VA 2B9JA 1J7LA 3WZUA 5K3YA 4PNKA 4YHJA 3OWLA 5EI8A 2BPMA 3UVPA 3ZS5A 3FQHA 4QO9A 2XIYA 4O0WA 2HWPA 1APME 4G6NA 2F2UA 3PIZA 5DEYA 2YA9A 2LGCA 3BHHA 4L44A 3ORNA 4C2VA 4YSMA 3ID6C 1CKPA 3NMUF 3LFDA 3CQWA 2V22A 3GCVA 3PIXA 4FG7A 5F94A 3U51A 4CFMA 5CLPA 4D1XA 1U54A 2B55A 4RIOA 4WNPA 4IB3A 5D11A 2ITOA 4X3FC 4OTQA 1Y8GA 2WZJA 2NYAA 3TT0A 1PXOA 2QU6A 2W1ZA 2GNIA 3EOCA 4CTBA 5GIPE 4I92A 2I1MA 2PWLA 5EOBA 1XH9A 3FC1X 4RIXB 3A8WA 3IW7A 2PY3A 4U0IA 3HEGA 4GKHA 4FK6A 2WQNA 4JDIA 4MWIA 3AD5A 2B4SB 2HWOA 2J0JA 3DDPA 5FXQA 3FXXA 3R9DA 3HP5A 3HV5A 4XHKB 5HG5A 4FTUA 2JKMA 4EHZA 4LUEA 4MUQA 3VO3A 4EOOA 4AQCA 4NIFA 4AGUA 3ZTXA 4QMTA 4I93A 1M7NA 3LVPA 1S9IA 2BALA 4JJRA 4GT4A 2V0DA 1LP4A 4HCTA 3V5JA 4IDVA 4BDDA 1J1BA 5FP5A 4DAWA 4F7LA 4XOYA 2B0QA 4O84A 3SV0A 3K3IA 1URWA 4FZ6A 3DB8A 4C3PA 1W0XC 4AZEA 2R7IA 4XP2A 3QRUA 3PJ2A 4ZSGA 3S4QA 5A4TA 4GVAA 3OWPA 4FSWA 1OUYA 5KMNA 4QRCA 2BAQA 3BZ3A 1W84A 5FWKK 3PLSA 1GOLA 2GNFA 4LMNA 4ZY5A 1I44A 4PRJA 3QKMA 5EG3A 1WZYA 2X39A 1W8CA 5KZIA 2X0OA 3DZQA 5KO1A 2JIIA 1SMHA 2YN8A 4AZFA 3R8LA 2WMXA 4FYOA 4O6LA 3M11A 5IQEA 4GK2A 4DEIA 4Q9SA 3RAHA 4BDIA 3Q2JA 5AV1A 5E8YA 1H26A 5HBHA 3RK5A 4C0TA 4F70A 4QTDA 2QOIA 1GJOA 2EWAA 4HGTA 5I5ZA 3PUFC 3GCSA 2XNOA 3LE6A 5EYKA 4ZMEA 4LV8A 4TPTA 5IH4A 5EM6A 5LQFA 5EQYA 3OHTA 4QT1A 5K4JA 4OT6A 4P5ZA 2NPQA 4CV9A 5AP0A 3TZ9A 3QX2A 5FUTA 3RKBA 5H8GA 4MH7A 4EK6A 3ZDUA 3ZDIA 4BF2A 1KE6A 4F0GA 2R3JA 2X4ZA 2XIRA 3NS9A 3SGCA 2Y6OA 3TACA 4A07A 3EN7A 2P2HA 2GFSA 4TWCA 4TYJA 3UP2A 4LDTA 5CU2A 4M12A 3NYNA 3NYOA 2HXLA 4O2ZA 2PVLA 4ZLOA 2QC6A 1UKIA 4JG6A 2J4ZA 3VAPA 2X7GA 4G34A 2BAKA 4BI2A 3QBNA 2X9EA 1MQBA 3VUKA 2O64A 2QOOA 5GZ9A 4BCFA 2VTQA 3NNUA 1Z57A 2WEIA 4ASZA 3NUUA 4G17A 2CGWA 5GINE 1XWSA 2VZ6A 5E91A 4EJ7A 4I0RA 4A9TA 2YDIA 2XM8A 1QPCA 2BTSA 2WU6A 3L9NA 4AN2A 2WOTA 4FNXA 5IEVA 5EQPA 2W1DA 3FAAA 5CX9A 4CNHA 4JOAA 4JBOA 4FIHA 4C3FA 3QQFA 5DVRA 2YAKA 2QLUA 3H0YA 4M15A 4RIWA 4DYMA 4MXAA 4QP7A 5HLNA 3D5XA 4PY1A 4KS7A 2W99B 4FKTA 3DQWA 1JAMA 2EB3A 5FXRA 2OK1A 1FVTA 2QCSA 3T9IA 5BYLA 3HMPA 3W0RA 4EOJA 4GU9A 4BR3A 3QQUA 4TKSA 5ANIA 1PHKA 1SVEA 4LGGA 3P7BA 4FE2A 3GCQA 1BYGA 3PVGA 4TYHA 1WMKA 4Y5HA 4BDJA 1H27A 2YCSA 3O8PA 3ZO3A 4FEWA 3OW3A 2QURA 4WG3A 1XBBA 3CC6A 1VYZA 2W06A 4A7CA 5EM7A 1M52A 1VLRA 2J7TA 2OJFE 3IKAA 3RAIA 3FYKX 3CKWA 4OTWA 5ACBC 3VUMA 4EWHA 3CY3A 5T68A 3TKHA 3EZVA 4F4PA 4PNIA 3KN6A 4FV9A 1DS5A 4O86A 3ZM9A 3R8UA 5CU4A 1UU8A 3ZEWA 2Z7LA 4GK3A 1WBVA 3GBZA 3A4PA 3ZONA 2YJRA 1Y6BA 3Q9XA 1GIJA 2HENA 3D83A 3JPVA 2HY81 4BBMA 2RFNA 3QFVA 3QALE 4E3CA 3TTIA 3PXKA 4FTTA 4IBMA 4BWPA 3THBA 2BUJA 2X8DA 3KL8A 4EQUA 2ITPA 2ZM4A 2PE2A 3UOHA 4CGAA 3EQRA 3PYYA 5AAEA 1PJKA 3LCTA 2VRXA 1P4FA 2JFMA 2C6KA 4FSZA 5IDPA 2R3MA 2XBAA 1ZARA 3DJ7A 3NEWA 4AOIA 3E87A 4ACCA 3KA0A 4YZMA 2F7ZE 4X3FB 4PMSA 4O7NA 3AMYA 5HX8A 4O7LA 5GIOE 1MQ4A 5HE2A 3UPZA 3FC2A 3HGKA 3UZPA 3IGOA 2IVUA 4KKGA 2XJ1A 4M69A 3ZUUA 2VNYA 4OTDA 4WBBB 2BRNA 3SG8A 3R1YA 4RJ7A 1H8FA 5ANDA 4HVDA 4F63A 4LOPA 1ZXEA 1KOBA 3EQHA 3II5A 3IOPA 2WTIA 1H07A 1WFCA 2XNGA 3KVXA 4J8NA 5DNRA 4BB4A 4QQCA 3DK7A 4PDOA 4HZRA 3TJCA 4DTKA 2BZKB 3ORTA 4FT5A 2YIQA 3A4OX 5CF5A 3BL7A 5EHYA 5IQGA 4AGWA 1NVSA 3OEFX 3P4KA 3ZOSA 4YJRA 2XCHA 3IS5A 4I22A 2C1AA 2BR1A 2KTYA 2O3PA 3F9NA 4O2PA 3ORLA 2BKZA 3KRLA 4AF3A 4EHGA 3W0NA 3DAEA 4FV8A 4KNBA 3ATTA 1JPAA 4KBCA 3M1SA 4DGOA 3C5UA 3ZLWA 4FMQA 5IMXA 1ZZ2A 2GFCA 1DAWA 4UYAA 2VWYA 5LVLA 3DJ5A 3W10A 4H58A 5HI2A 3NIEA 1IG1A 2A19B 3GNIB 1IA9A 5JZNA 1OUKA 3VBXA 5KMJA 3RPRA 3W0PA 5DR2A 5FGKA 3OEZA 5KKRC 3ZM4A 3VJOA 2VUWA 3D5UA 4IX5A 4K0YA 4EH9A 4FKQA 3QD0A 2GHLA 2OKRA 3OOMA 4QMVA 5KMOA 2I7QA 1WBPA 4FKUA 4TZRA 3V5WA 2XA4A 5IA4A 3QTWA 3ACKA 4DC2A 5M44A 3G15A 4RX8A 3NUNA 2IEWA 4LOQA 3PE2A 2HCKA 4X2JA 3QYWA 3WZEA 2VX1A 3FQSA 4FT7A 4O27B 4YPSA 1WBNA 3VS2A 5BVOA 5I9ZA 2WQMA 4AW1A 2FGIA 5ICPA 3ZCLA 3PPZA 2GTMA 5ETIA 4DBNA 4QTEA 1QPDA 3VS7A 3BGQA 3H4JA 3EQPA 4GUEA 2FH9A 5HE0A 4BCMA 3V5TA 5BUIA 4F6SA 4DDIA 3FJQE 3QTIA 5AAFA 3U6IA 4FTAA 3U6JA 2W1EA 3RWQA 2PMIA 4IVBA 4E8AA 3ZZEA 3PP0A 4G3GA 4FOBA 5AUTA 3B8RA 4NIFB 4UXQA 4FTRA 4KD1A 5D12A 5T6KA 1VR2A 4A4XA 4FTKA 1UWJA 4ZTSA 3UDSA 4RJ5A 2RFSA 3LCSA 4H36A 5DEWA 4O7WA 2ETRA 3BYSA 3MFUA 4ACMA 3BHTA 4K6ZA 5CZIA 3KQ7A 1UU9A 4YO4A 3RK7A 2VTSA 3I5NA 2FYSA 2WEVA 3OBJA 5FLFA 3KVWA 5M4CA 4I41A 4DTBA 1Y6AA 3RBWA 4PTGA 3T8OA 4OTPA 3TIZA 2ZV7A 1WVYA 5ETAA 4PTEA 4DH5A 2WD1A 4NWMA 4AA5A 5BMMA 4QPMA 4W4VA 4YHFA 5E8ZA 3WZJA 4CZYB 3LQ8A 2J51A 3IQ7A 4U45A 4C58A 2I0EA 1WBSA 3NAYA 5CYIA 3U87A 4DF3A 3SKCA 1ATPE 4WUAA 3RK9A 3QQLA 5TT7A 3NIZA 3K5UA 1YHSA 4AS0A 4DN5A 5L8KA 4FSQA 3UVRA 4PDPA 3RZFA 1B6CB 1R1WA 3C7QA 3LAUA 4FUYA 2BRMA 4WSYA 1OL6A 3R7UA 4FZ7A 2VGPA 5E8VA 2V5QA 4M7IA 2PVYA 4IZ5A 4JG7A 5K4IA 5HCZA 1Q8WA 4GYGA 2HAKA 4D4SA 2XNBA 3E7OA 5HD7A 5CEPA 5AIKA 3TIYA 3O5AA 1CSNA 4CFWA 2A0CX 4MNFA 2YM3A 3UZRA 4O1OA 3FZTA 5A54A 2P55A 1KE8A 3LFNA 3IECA 4GT3A 2BDJA 2C5NA 3SXSA 3V8TA 3GCPA 5ACKA 2XEZA 3F3WA 4IMYA 5G6VA 3BE2A 3V5QA 4XMOA 4AA4A 3HAVA 4BTKA 3PXFA 3GT8A 3H10A 1HCKA 2CKEA 3I7BA 2AQXA 4TY1A 5DR6A 2R4BA 2C30A 3JS2A 2IZSA 2WIHA 3H9RA 4K18A 5DLSA 4D2PA 1XR1A 3QRJA 4FV4A 4FIEA 2B9HA 3F6XA 4P2KA 5DOSA 2O5KA 2ETKA 4IAIA 3LHJA 4CQEA 3MTFA 1H0WA 4L3LA 3PY0A 4NT4A 4OBQA 4EOIA 2F7XE 3WF9A 4FL2A 2YCRA 4U40A 5CU3A 4IWQA 3ZZWA 2UVXA 3DBDA 3OS3A 4QMMA 4BGHA 2UZEA 4ONAA 2OICA 4XG7A 5JFVA 4KIKA 4EH6A 3DDQA 3BLAA 2WELA 4AOTA 2YZLA 4HGEA 1J1CA 2PL0A 5IH6A 1YWNA 4TYHB 4YP8A 2EVAA 2OF4A 3RNYA 3GGFA 4EBWA 4F0FA 4QMWA 3QD3A 3A7GA 4O4BB 1ZOGA 2J2IB 3AT2A 3ZFYA 5AA9A 4A06A 4JR3A 1G8KA 5LMAA 4LOOA 4QTAA 3D2KA 4WD5A 4XRLA 3M2WA 5D9HA 4O96A 3DV3A 4FV1A 3NFGB 2V55A 3PWYA 1PKGA 3R1QA 4KWPA 3KB7A 3F2NA 3ELJA 3MFSA 2WPAA 2C6EA 1OPJA 4UV0A 4UMTA 3FHIA 3FPQA 4J71A 5AV2A 5JQ8A 4MNEB 5DG5A 5KBQA 4OAUC 3U8WA 3L1SA 3A99A 4O4EA 5LJJA 3HAMA 4EONA 4BTMA 4IDTA 4DFXE 3Q4ZA 3S3IA 3OP5A 4XV3A 2RF9A 3PXZA 5AR2A 1KSWA 3ROCA 4C4EA 5AAGA 3I6UA 4YLKA 3HLLA 5HBJA 5DGZA 3UTOA 3BCEA 5HICA 5TKDA 1V0BA 2PUUA 4HNFA 3HV4A 3ROYA 4D4YA 2QR7A 2IPXA 2WIPA 3OF0A 4P7EA 4FKGA 1YKRA 3AMBA 3FKOA 2UZWE 5I3OA 4O7ZA 4YSJA 3FZRA 2ZM3A 3PRFA 4MD8E 4EK8A 3G90X 5I4NA 5IQCA 3A7HA 3IDCA 4F9AA 3ZFXA 3UBDA 4PL4A 4ITHA 2I0HA 2QG7A 3W0QA 3PTGA 1XO2B 3MGYA 4IAZA 4S34A 2OIBA 1MRYA 2OFVA 3E3BX 2OH4A 1Q41A 1CKJA 3DKCA 3I5ZA 5AR4A 3UNJA 4D58A 3OTVA 4PDYA 3ZRKA 4IWDA 4U5JA 4G9CA 4YBKA 3HRFA 3MS9A 1FMKA 3F2AA 4B6LA 2WTKC 1DAYA 4AFEA 2JAVA 4U97A 2YIYA 4I23A 4D5KA 4DEEA 5IEXA 1F3MC 1DM2A 2VTOA 3DCVA 4UEUA 4FTLA 2B9FA 3AD4A 4S31A 1GZKA 2Z8CA 2HW7A 2WMUA 3KRXA 4TRLA 5DI1A 5HG7A 4AZVA 4BCHA 2PMNX 1Q8TA 3BYUA 4BDKA 1OITA 1JKLA 4B4LA 4LRKA 3OVVA 4RRVA 4M84A 3ENMA 4M0ZA 5H2UA 4O91A 1JNKA 3VC4A 4X7QA 2XB7A 1OMWA 4UN0C 4F99A 4E5WA 1OECA 1PXJA 4FKVA 3VS4A 4WUNA 4G16A 1YDSE 2X0PA 3FI4A 3HUBA 4XNEA 3TNWA 5LXMA 3G9LX 2WO6A 2Z7QA 3MH2A 5EKOA 4TW9A 3JVSA 5BVKA 3VUGA 4CYIA 3NNXA 3PUPA 4GL9A 2W1GA 3KKVA 3PA4A 4K1BA 4XS2A 3ETAA 4FKRA 3T3VA 4RFMA 4UMUA 4FTCA 3KXMA 5FRIA 3PFYA 3TDVA 4EH8A 2R3LA 4GFMA 4JVGA 4QEBA 2PYWA 4LUDA 4ALVA 4UB7A 3UYSA 1BI7A 4ANBA 4DEDA 4TL0A 4YZCA 3FMLA 3RINA 1UV5A 3FLZA 3QRIA 4XCUA 5IEYA 4FTMA 5BVWA 4FSNA 2JKKA 5DA3A 4CTCA 1KUTA 4AXCA 3RHXA 3QTQA 1GIIA 4FTNA 1W82A 5L6WL 1YVJA 3R0TA 3R7YA 3MJ2A 5A6NA 3GUBA 3TNPC 4C2WA 3HMIA 1WBOA 2PHKA 3P9JA 4U7ZA 4NTTA 3FDNA 3R8PA 4Y72A 4R7IA 2CSNA 2C0IA 4ANLA 3U9NA 4WRSA 2ITYA 1W98A 4NKAA 3RI1A 5JZJA 4KABA 3ZXZA 3KCFA 3U54A 4AZTA 4FIJA 1U4DA 4F09A 2YITA 2VX0A 4PMMA 4WHZA 5GJGA 4DEHA 4EZ7A 3SOAA 3VONA 3QGYA 5IA5A 3AKKA 3GEQA 3ZO4A 4O6EA 1NVRA 3EQIA 4TNDA 3ZYAA 2R3OA 4ITJA 5F4NA 4AN9A 3U4WA 3RHKA 3NUXA 4BFMA 4G3DA 2PZ5A 1M2QA 2ERZE 3O23A 4AACA 3GC7A 4OAVB 5CSVA 1K9AA 3QQGA 3FLWA 3G6HA 5B2MA 4GS6A 4FSUA 3EFJA 2W7XA 4L3JA 4F9WA 4GG7A 3ALNA 4W8EA 3AGLA 2VTHA 4OTIA 4JMQA 1K2PA 1YI6A 5BYZA 4YNEA 2YZAA 4LYNA 1FGIA 1QPEA 2VWUA 2WFYA 3LMHA 4WOVA 4O0XA 4C4FA 4E20A 2BILB 4RWKA 4F9CA 4FYNA 2IVSA 3KC3A 3PPKA 4ANNA 4HCUA 2VTMA 4FKJA 4AUAA 2XUUA 4TWNA 5AMNA 4WT6A 4EJNA 5CAVA 3V51A 4EORA 2HIWA 2XM9A 3O17A 4AZSA 3WE4A 3EFKA 4EOQA 4IVAA 3LZBA 3MB6A 4RC4A 3C9WA 4DITA 3BIZA 3QZFA 4X0MA 2WMWA 3Q9ZA 3DOGA 5K0KA 3DXPA 4I94A 4JLCA 1NW1A 2BRHA 4O83A 2IZUA 3EYGA 4FK3A 1MP8A 3TL8A 4DH1A 4GMYA 3L8SA 2REIA 4PF4A 3K5VA 2ZB0A 5HHWA 3SOCA 3LJ0A 4AN3A 4ZTMA 3FLYA 4M14A 5CY3A 4JT3A 2C6TA 4EC8A 1WAKA 2P2IA 3OCGA 1CMKE 2E2BA 3OOGA 4F64A 2QR8A 4FX3A 3ZLSA 3TN8A 2C6OA 1XH8A 2XCKA 2X2MA 2ZV2A 1IASA 4KSQA 3HUCA 5M07A 4N6ZA 3KCKA 4EHEA 2C4GA 4XP3A 4MK0A 2Y7JA 4U3YA 3NSZA 2C3KA 5BUJA 1XH6A 2CGUA 4FIFA 4GK4A 5D7AA 3NUAA 4LGHA 1AGWA 3UNKA 4DDGA 4H3PA 3GENA 2BIYA 5CZHA 4ID7A 2OJJA 4E6DA 2IW9A 2UW5A 3EL7A 4ORKA 1T46A 3COKA 4DLJA 1V0PA 3P79A 4I6QA 4RA5A 2QNJA 2XBJA 4X2KA 2PVJA 2XIZA 4O38A 3TJDA 2EB2A 2YLEA 3PA5A 3PWDA 3W16A 4CT1A 4F7NA 2JGZA 3P7AA 3C51A 4JL9A 4ALUA 4YC8A 4U43A 5D1JA 4FT9A 1JSVA 3BU3A 4L67A 4AX8A 1WBTA 3E5AA 2C5VA 1XH7A 1YOMA 1JKSA 2VTTA 5FTOA 5CWZA 3UP7A 3R83A 4HW7A 2OO8X 3KRWA 3R9RA 2J5EA 4ZMFA 3I4BA 2V62A 3OMVA 5DR9A 5L3AA 4YJNA 5BQ0A 2QONA 5M06A 4BWKA 2WTKB 3MIYA 5DN3A 3R9OA 5E90A 4JBVA 3NAXA 2IVTA 1GZNA 4GJ2A 4ZZNA 1NVQA 4YJQA 4HYSA 5F95A 1YXSA 5EHOA 3CGFA 2XJ2A 4GW8A 4N0SA 5M57A 3BKBA 5AM6A 4R7BA 5G1XA 2G1TA 3DKFA 4OT5A 1YRPA 2XK3A 3IONA 1FVRA 3NRMA 5IQDA 3HL7A 3E8EA 2Q0NA 3ODYX 1UU7A 5KE0A 1XMMA 3MBLA 4WG4A 4NUSA 3GU7A 4Y8DA 3EN5A 4FOCA 5JRSA 4RZVA 4I5CA 4IHPA 4DCAA 1GZOA 4GRBA 4AG8A 3A62A 2R3KA 3P78A 4XUFA 2OG8A 4FV7A 4WA9A 4BCPA 5H8BA 3SG9A 1H00A 3LCKA 4FTIA 4OBOA 2HZIA 3NLBA 3ZUVA 3D7TA 4DCEA 4XG9A 5TE0A 1PMEA 3S95A 4QMOA 3RCJA 5BVEA 2G15A 2FSMX 4I6BA 4RZWA 5J7BA 3EQGA 5HU9A 1FGKA 5CF6A 3LFCA 5HBEA 2ZDTA 4W9XA 3SW7A 4BJJB 3CTHA 1H24A 1Q97A 3CGOA 5E8SA 5L2IA 3QA8A 3LPBA 4F78A 3V04A 2ZFYA 4X6QC 1BKXA 5HG9A 5ANGA 5CT0A 5EI6A 5HU3A 5TO8A 2XP2A 3PG1A 3QXOA 4FV0A 2G01A 4QTCA 4I6LA 3C0IA 3KFAA 2X4FA 3OROA 4DFZE 3ZHPC 2WTDA 4XOZA 4WSQA 5HO8A 3FLNC 3UMWA 2HXQA 2JBPA 3TMOA 5DHJA 2QD9A 5K5NA 2IJMA 5AUZA 5HTIA 4YO6A 5E4HA 4FKIA 3V01A 3O0GA 5AJQA 1UWHA 4EZ3A 4D4RA 2XRWA 3I79A 4LG4A 4C57A 5C8NA 4ZIMA 4HPUE 3KXNA 4FNYA 3CKXA 3E64A 3P5JC 3W0SA 3OWJA 5AFVA 1ZWSA 2A1AB 5IA1A 5JMSA 4FSTA 4FKSA 1U5RA 1YWRA 3QCSA 4O1PA 3F5GA 3PIYA 4A9SA 5J9ZA 1PMUA 4IH8A 1Q3DA 1YXTA 5DT4A 1OPLA 3QXPA 1P4OA 3HA8A 3ODZX 3UIMA 2WNTA 3LFQA 3JUHA 2ITVA 4HYUA 3PXYA 4RJ4A 1MRVA 4ERWA 5HOAA 3P0MA 4EKKA 4ENYA 4ASEA 3BQCA 3SXRA 1CDKA 5E7RA 3RJCA 2QG5A 3F3TA 5IUGA 2PZIA 4LFIA 2NNWB 2W4JA 1PXNA 2ZVAA 3MWUA 4I4EA 3TUBA 2P0CA 5CANA 4C4GA 3WILA 5JFXA 5EM8A 2XANA 3BYVA 5IMEA 2F9GA 4Z55A 1M17A 2H6DA 1P5EA 2X0QA 4FVPA 4UWYA 4CCUA 5FTQA 1CM8A 5GHVA 3LMIA 3QL8A 3RWPA 2W05A 2HOGA 3H9FA 4AXDA 2ZOQA 1REJA 3C4ZA 5DRBA 5HO7A 4AE6A 1G8SA 1PXLA 5L6OA 2VO7A 2YM5A 4IANA 2ZMCA 3GC9A 4E6CA 2XKEA 4PTCA 3ZLXA 2J6MA 3D5VA 4C7TA 4CXAA 2BZIB 3N51A 3LFEA 4E6AA 5JSMA 1ZRZA 3F61A 3IDBA 2Z2WA 3C5IA 3QHRA 2W1FA 4QMPA 5C01A 3TUDA 2XAMA 5C03A 3Q6WA 5HIBA 3L8XA