3P7BA

P38 inhibitor-bound
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
348
structure length
332
Chain Sequence
b'RPTFYRQELNKTIWEVPERYQNLSPVGSGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Discovery of a novel class of non-ATP site DFG-out state p38 inhibitors utilizing computationally assisted virtual fragment-based drug design (vFBDD).
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 106
structure length 332
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3p7bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3p7bA01
3DK6A 4DGGA 4L43A 4IC8A 3FUPA 5DHJA 3VS5A 4YUQA 2ONLC 4LOOA 5EG3A 4EH5A 5JQ5A 1HOWA 4QP4A 4WNMA 3W2SA 1ATPE 4YZMA 2R3RA 4TNBA 4BCGA 2JFLA 4PMPA 1Q3DA 2OI4X 2NPQA 3CPBA 3NW7A 3FDNA 5E8XA 3OF0A 2CHLA 5LVOA 3PVWA 1Y8GA 2JDRA 1Q8WA 3V3VA 2OLCA 3QZFA 4P2KA 3DA6A 3RTPA 3IW6A 3CJFA 4TW9A 2VV9A 3R8PA 4BDFA 3NYVA 5CF4A 3PSBA 5BUJA 3GOKA 3UIUA 5IMEA 3S00A 2Z02A 3CS9A 4B8MA 4ZTHA 1SNXA 4EJNA 2B9FA 3KRXA 4E5WA 3LLTA 4JRNA 1YI6A 3RAIA 2GS2A 4C4FA 1ZWSA 4I3ZA 5L6PA 3Q96A 3R2YA 1M2RA 3GUBA 3K5VA 3RPVA 1E1VA 3R2BA 3UQCA 5HIDA 3LFFA 3P0MA 3QKKA 3EWHA 3W16A 4R3CA 4O83A 3VC4A 2IZSA 1BI7A 3C0GA 4FX3A 3GI3A 4FKLA 3GC0A 4BB4A 3WF5A 5CAOA 1M52A 4FIGA 4HYUA 5ACBC 3IW7A 2YWVA 3HZTA 3HECA 5A4TA 4RIWB 3ORMA 2PE2A 3OCBA 4FSQA 2GQRA 3ENMA 4PUZA 4AGUA 4GVAA 4G9CA 4ANOA 4FEUA 3R8ZA 1AGWA 2OZAA 3KKVA 2PL0A 4K8AA 4WG5A 4G3DA 2QONA 4JBQA 4PP7A 1J1CA 3DV3A 3R00A 4RC3A 2ZYBA 5CY3A 4QMWA 3OBJA 3VS3A 4AA5A 4B4LA 3OCGA 3QTUA 5CZHA 2BAJA 3HP5A 4X21A 4YTIA 3DLSA 1OMWA 1PYEA 4M0YA 5ICPA 5EK7A 3F88A 4J95A 4JDIA 3P9JA 1NY3A 2X8DA 3H30A 3QUEA 4CQEA 2PPQA 3MW1A 3R01A 3TM0A 2QHMA 3BGZA 3F3WA 3G9LX 2PUUA 2ETRA 3AD6A 3WOWA 1PXIA 5EM5A 3VRZA 5EW9A 4KABA 3CQEA 4U8ZA 4E20A 5A4CA 1V0BA 5KMOA 3I81A 4MBJA 2RFSA 3NW6A 1QCFA 4RGJA 4XH6A 5AV1A 2WMQA 5J9ZA 4FV4A 5CLPA 2CDZA 3MJ1A 3KK8A 4FSZA 3UO4A 3ZUUA 4FODA 2XP2A 3RJCA 2XIKA 4AX8A 3EFKA 3IONA 4IZAA 2F2CB 5BQ0A 3U9NA 3ZLYA 3O2MA 2UUEA 4FTKA 4NM7A 3RM6A 4F9BA 4ZLYA 4PPCA 1Q61A 5CEIA 3FYKX 3H9RA 3CTJA 3IOKA 3MTLA 5E92A 4ZY6A 3CD8A 4CFMA 3LXPA 3F61A 5IU2A 5LJJA 3EZVA 1H1RA 3R7GA 4FKSA 4CD0A 2QD9A 3ODYX 5M57A 2GSFA 5LMBA 4TPTA 4MTAA 3F7ZA 1U46A 5CVGA 5H3QA 4FV3A 3THBA 4FSYA 5FD2A 3UZRA 1GNGA 5IH6A 2WU6A 4G3EA 3EHAA 2C3KA 3PG1A 3F7WA 3I0QA 4JR3A 4ZOGA 4LI5A 4DH1A 4LV8A 3MB7A 4V01A 5FM3A 2OKRA 4JIKA 2WIHA 2WZJA 2OJFE 1JKTA 1UVRA 2UW6A 4UXQA 2W5AA 5FGKA 3V01A 3VS7A 1PYXA 4IFGA 1BI8A 3F5GA 4UY9A 3HDMA 3BQRA 3OY3A 2R7BA 4IAIA 3TUDA 4C3FA 3QBNA 5A4LA 3ULIA 4IJ9A 3B8RA 3QC9A 4OR5A 3CIKA 4BCHA 1JSVA 5ETCA 5CAQA 4K1BA 3R1SA 5IQEA 5AR7A 3QRIA 4P90A 3MY0A 3TCPA 4EHGA 3W18A 2X7GA 2BDFA 4BWPA 1IASA 2RIOA 1T46A 2H6DA 3ITZA 4PTCA 3TN8A 1L8TA 3V51A 3RNIA 5C27A 3ZZWA 5F9EA 2IJMA 4OGRA 4O7WA 2G9XA 4YC8A 2J51A 4AT4A 3WYYA 3PPKA 3VUGA 2RKUA 2W17A 5LXMA 4CFVA 3KREA 3BU5A 4A4LA 4AA4A 1M7NA 3GGFA 4LUEA 4M68A 5HG7A 5FXRA 5CQUA 5A4EA 3K3IA 3MY5A 4U5JA 3TWJA 2W5BA 3RALA 4ERWA 1VEBA 4MNEA 5AM7A 2GHMA 2CPKE 3LFNA 5AJQA 5AP0A 2OZOA 3MGYA 4XP0A 3CSVA 2PE0A 5FP6A 4KKEA 3VUIA 5LWNA 3WBLA 4RT7A 3SGCA 5J9LA 4QYGA 1YOJA 1UU9A 4JBVA 3R8LA 3LCDA 4IVAA 2WMTA 4RJ4A 1WFCA 2OO8X 2B9JA 4RJ6A 1XH7A 2VZ6A 4YU2A 3NIZA 4FV7A 3ID6C 4M14A 3QD2B 4AN2A 3LJ1A 3M2WA 3ORNA 2Z7LA 4NW6A 3BEAA 3UO5A 1H08A 4C33A 1YOMA 4I0RA 3S95A 1H01A 3ZS5A 2RL5A 5FTOA 4DN5A 4OAVB 4GL9A 2QOKA 3ACKA 1PKGA 1Q24A 2HXLA 3Q52A 4FG7A 4RPVA 3ANRA 4BI1A 3PJ1A 4RIYB 4FKRA 4FTMA 5J7BA 4F99A 3WZDA 4C02A 4F1TA 3AG9A 1L3RE 1GZ8A 4JG8A 1FVRA 2OXXA 3PY0A 2LGCA 1Q8UA 4IM2A 5AP6A 3BE2A 3EL7A 4QOXA 3FY2A 4FICA 2VGPA 4X0MA 1MQBA 4O7ZA 4EH2A 2CMWA 4ASDA 5KHWA 5BVWA 2YCRA 4MQ2A 4C3RA 5DT3A 4X2KA 4EQCA 3GU8A 2OJJA 2W1ZA 4CTCA 2HELA 3ENHA 4DEBA 4YNOA 3FZPA 4QMPA 4RBLA 5EW3A 2V55A 4AFJA 3MVMA 1XWSA 5E1SA 1OB3A 5LOHA 4BCKA 3DBCA 3RI1A 3KQ7A 4ZTSA 2XIRA 4DFLA 1YVJA 4E3CA 3QTIA 4O6LA 1ERKA 1KV1A 5HNGA 3PP1A 3C4XA 3FQSA 4MXAA 4DINA 3A62A 4M69A 2I0HA 3H3CA 1PMEA 4XG3A 4GU9A 3PDTA 5ETAA 5TO8A 3UP7A 4YSJA 3B8QA 5IUGA 1WBOA 3R1QA 2C6DA 2Z8CA 2WQBA 2YCFA 4RWJA 5M08A 5CSPA 2ZB0A 4NIFA 2P0CA 2Y4IB 3DBDA 3P79A 3DAJA 3M11A 3PVUA 5CAUA 2BVAA 4BCJA 4AGDA 1W82A 2EXMA 3FMNA 4BVUA 4EHZA 2GNFA 2WQMA 4FIIA 1F3MC 3VS4A 5HBJA 4XV9A 4F70A 3BQCA 5DT4A 2HOGA 3R6XA 3ZOSA 4TT7A 4RJ5A 4FSUA 4NSTA 5JSMA 5E8UA 4U40A 4F64A 2YDKA 4LGHA 3PE2A 4U80A 4EKLA 2PVLA 4HNIA 3BX5A 3D83A 3KXZA 3POOA 5DEYA 4NM0A 5I9VA 4GJ2A 2CSNA 3LOKA 4MNFA 5EHLA 4DBXA 3OP5A 5J95A 3VBQA 2OXDA 3LMHA 4I5MA 5LARA 4NKAA 3C51A 3QZHA 5LVPA 3QYWA 5IMXA 1V1KA 4RIXA 5CEQA 4D0XA 4APCA 4X3FA 2VTSA 4F09A 3ZDUA 4GK2A 4BZNA 1CTPE 4FSTA 3Q2JA 3UVRA 5GJDA 4J71A 4HOKA 3FE3A 1M7QA 2H34A 5CI6A 4FGBA 1VR2A 3V6RA 2XNOA 3PLAE 4FVPA 4M15A 4O0RA 4MYGA 4OTFA 3BBTB 4YC6A 4EH8A 2C5YA 3DBEA 3QHWA 2VWUA 4EORA 4YZDA 5L8LA 5AUYA 4I41A 4FTRA 3SRVA 1R3CA 4I21A 4UWBA 1YWNA 1JSUA 3POZA 4K33A 2UW0A 4Z9LA 2V7AA 3WIKA 3NYXA 4FKVA 3R8UA 4I4FA 3FXWA 4QYFA 3P4KA 2GFSA 2ITZA 1BL7A 2GNLA 3F2AA 3FQEA 3MH1A 3EQPA 3P08A 1H1PA 3R7UA 4A9SA 3OXZA 5IA1A 4UMRA 3G51A 4EZ5A 2V62A 4IDTA 4FC0A 2WD1A 3M42A 4MH7A 5HKMA 4C35A 1XH8A 1UWHA 2OBJA 5HCYA 2R3GA 3RNYA 2Y9QA 4BFMA 3RGFA 3ZONA 1H00A 2BRBA 1KE9A 4ACGA 3W2CA 4CG9A 1REKA 1OKWA 4FT7A 4QT1A 5EW8A 2JDSA 4FV5A 5DOSA 2XJ1A 4EOPA 4EQMA 2VRXA 3SVVA 4YNEA 4XHKB 5HE3A 4FT5A 1W7HA 3C50A 4X6RA 1UU8A 3VBYA 3BYSA 4W8DA 5IZFA 3QQLA 5EYKA 3KMUA 3OT8A 4RA4A 3EZRA 4HGEA 5CEKA 4DEHA 3NNUA 2C5OA 3EQCA 4BCPA 4BICA 3BU3A 4JR7A 3NAXA 2PWLA 3QQGA 5JZNA 2W96B 3COKA 1DAWA 5JFSA 4FV9A 5TOZA 1Q3WA 2CLQA 3QWJA 5AA8A 4W9XA 1TKIA 3BU6A 3EB0A 1KOBA 1B38A 2R2PA 5FG8A 5C9CA 3VJNA 4BGGA 4DBNA 4AXAA 2YIQA 4F7SA 2VN9A 1WAKA 3FL5A 4ASZA 2IVVA 3QU0A 4CMUA 3RK5A 4I0SA 5CAVA 4FZAB 4C2WA 5IH4A 5F95A 2HWOA 1LP4A 3FHIA 4WA9A 2O5KA 1PMVA 5JRSA 2CCIA 5K4IA 4TWCA 4O1OA 5HO8A 4FL1A 4QMLA 2VO0A 5CU6A 4D1SA 5J87A 5KNJA 3F2NA 3KGAA 4L53A 1I44A 1Q41A 3O7LB 2FH9A 3SDJA 5JH6A 4FTJA 2FSMX 4IAAA 4IEBA 4U97A 4AACA 5F94A 3QLFA 4L45A 3RP9A 4BKYA 2XH5A 3C7QA 3L9MA 3ORLA 3SG9A 5JEBA 3G0FA 1O6YA 3BRBA 2NRUA 2X8IA 3GFEA 4JAIA 2BZJA 2Z2WA 5K3YA 5D9HA 3V6SA 4YO4A 4G6LA 3FC2A 3VULA 2PE1A 2VX1A 3DNEA 2IVTA 1EH4A 3U54A 3QRKA 4QQJA 2BRHA 4E6AA 5CI7A 3R9HA 3TZMA 2UZVA 1JSTA 2G1TA 3GU7A 2CKQA 3QTZA 3ZBFA 4FEWA 3I7BA 4FZFB 3KN5A 3LCKA 3I6UA 3FZSA 3LFQA 2PMOX 1AD5A 5I9UA 4R8QA 4CRSA 4PV0A 4FNWA 4ZLZA 5BPYA 3SX9A 1A48A 4O0UA 3FXZA 2YACA 4AG8A 4FKTA 5HX8A 3U55A 2BFYA 3FSKA 4RX7A 3V04A 1ZYSA 3RVGA 1LEZA 4G9RA 4AOTA 5K9IA 3TUCA 3TEIA 2GMXA 4GVJA 4F9AA 4Z7GA 4I6BA 3UE4A 2XJ2A 5E4HA 3O8UA 4GRBA 4ZY5A 4CFNA 4YHFA 3QZGA 4J8NA 1BKXA 3MN3A 3QX4A 5CVFA 5AP3A 3RHKA 3L1SA 2JKOA 3KU2A 4GFMA 4M13A 4IX3A 4U79A 4WG3A 2XK6A 4GMYA 4PMMA 2Q0BA 4Y95A 4R77A 3Q9XA 3ZEWA 4ZLOA 2XIXA 3VW8A 2C30A 2E9OA 4G1WA 5IQBA 4DAWA 3G0EA 4GFOA 4AGWA 3KF7A 4XUFA 3UIXA 4YTFA 4O7RA 4DEEA 3OXTA 3PWYA 2X6EA 2GHLA 3AMBA 3Q4CA 4OTGA 3TJCA 4O7TA 4FL3A 2XCKA 2VD5A 4KS7A 5HLPA 3TDVA 3PXFA 1XJDA 4IZYA 4O2ZA 2IZRA 3JY0A 3IQ7A 3VAPA 3RPOA 3JUHA 3NSZA 4UZHA 5LVLA 5EQEA 4G16A 4E93A 4JRVA 4TWPA 4U3YA 4LRMA 2UW9A 2VO3A 5A3XA 4Y83A 3VQHA 4LOQA 4G3FA 3KRLA 4ITIA 4O1PA 4NCTC 2WFYA 3VW6A 5C01A 3SXSA 2XRUA 4R5YA 3TNWA 3OCTA 5H2UA 1ZAOA 3UBDA 3RINA 5E9EA 3R7VA 3QD4A 4JQEA 5KMNA 3BHVA 5CZIA 2XKFA 1NA7A 1KE7A 3CY2A 4X2GA 4CZTA 2VTAA 3DQWA 4NM5A 5FXQA 4DH3A 3RZFA 4ORKA 2BFXA 1CMKE 3II5A 3F66A 4AT3A 4RVTA 3QD3A 3TTIA 4OT6A 2HZ4A 2I0YA 4TYHA 4I94A 1X8BA 4JBPA 2F9GA 3I5ZA 3MB6A 4FK6A 4E4NA 2ZM3A 3NUYA 4P5QA 3Q2MA 4AN9A 4QRCA 3WARA 4ERKA 4FKQA 3Q04A 5EM8A 5B2KA 2ZMCA 3Q6UA 4IAKA 3UDBA 3UNZA 4Y5QA 5EDPA 5KCVA 5L2TA 4XP2A 4EONA 4YTHA 3NYNA 5K4JA 2JBPA 4DGNA 4ZMFA 1BX6A 4PNKA 4KBKA 4N0SA 2IW6A 4PDYA 3HGKA 4CKRA 4C58A 2XM8A 5CEMA 3FPMA 3UC3A 2XBAA 1QPDA 4HZRA 2IN6A 3Q9ZA 4JG6A 5AADA 2JBOA 1YI4A 5IUIA 3O51A 3PYYA 3I1AA 4QYYA 1ZARA 4MXCA 2WELA 2VWXA 3CJGA 5HBHA 5BYZA 4FEVA 2QG5A 1GJOA 4X3JA 5CT7A 3VUDA 4WUAA 3JVRA 3DQXA 4UB7A 2VUWA 3ZUTA 2X7FA 3IGOA 3EQRA 4XP3A 3DKFA 4IX6A 2RFNA 4JLCA 3QXOA 2G2IA 3DU8A 2QOOA 4UWYA 3E8EA 4GT5A 4I92A 1YHSA 3DLZA 3BLQA 3L8XA 2CN5A 3EQHA 4JIAA 2ETKA 4GU6A 4MKCA 2WMWA 1O6KA 1ZY4A 4O6EA 4A9TA 2ACXA 5M07A 3FLSA 4X3FC 1T45A 5C03A 3B2TA 3G6GA 1JNKA 4QMQA 3F6XA 4YPDA 3PRFA 3TDWA 4W4WA 5AR2A 3U51A 4CFWA 2CCHA 4C8BA 2XNGA 5CSVA 4II5A 4EK3A 4EWHA 3E8DA 4RFYA 3WZKA 3UVQA 4C2VA 4C59A 5CT0A 5M56A 1CM8A 3KRWA 4WIHA 5H8BA 4X2NA 3F9NA 3GU5A 3JXWA 4BC6A 5HU3A 3NWWA 1B39A 1GIJA 3T8OA 3A7IA 4J99A 3E87A 5CEOA 4DFNA 1KE6A 2QOHA 3NUSA 2EB2A 5C8KA 3N4UA 2PVJA 1P4FA 1G5SA 4DTBA 5HE1A 3IOPA 3RM7A 4I5HA 4R5SA 4XRJA 3PJ2A 2PUPA 2HZ0A 1VZOA 3QF9A 1ZOEA 5A14A 4J98A 4FTLA 4MQ1A 1H1QA 3QA0A 4L42A 3TACA 3HAVA 2P3GX 4E73A 2WMVA 3KXGA 2X6DA 3MPAA 5AM6A 4DH8A 3SQQA 4LYNA 4XV3A 1Y8YA 2OGVA 4JXFA 4S30A 3A2CA 3PZHA 2PZIA 1XR1A 4ONAA 4OUCA 5HG9A 4R1VA 3SOAA 4QMYA 1H0VA 3RWQA 3OBGA 3C5IA 2QOFA 2BHHA 1J1BA 2E9NA 2GNIA 2X9EA 3E64A 3G6HA 1PF8A 2XYNA 3KCFA 1O6LA 3OHTA 1R0PA 5EI8A 5AUWA 3TIZA 5AAFA 3R21A 3NGAA 3T3UA 5M4CA 3ZXTA 5M44A 5A46A 5BUIA 1U4DA 3VF9A 4NL0A 3QUPA 4ZXTA 5IUHA 2QCSA 4FKUA 2JGZA 4YJSA 4G3GA 3D7TB 4RSSA 4UZDA 4AGCA 2Y8OA 3MESA 4CLIA 3V8SA 3JS2A 2FYSA 2WEVA 1YOLA 3OZ6A 4FK3A 5AX3A 4OTQA 2V0DA 1PXJA 4FTQA 4ACCA 1MUOA 4HCVA 3C4ZA 2OF2A 5L8JA 4XG8A 2B54A 5ANGA 5HVKA 2PZYA 2WEIA 3UMWA 1SNUA 4FKPA 4NK9A 4C34A 4FV2A 4EH7A 3CTQA 4RLKA 4O0VA 3HRFA 5HD4A 1XO2B 2C5XA 3IG7A 5J7HA 4EOQA 5CSHA 4RLLA 1VJYA 4I0TA 1LPUA 4O96A 1V0PA 4IH8A 2JDTA 2C0OA 4MXXA 4TYEA 4C4HA 4XLIA 1OL2A 4IVDA 2ITWA 1PXLA 4J52A 4L8MA 3W1FA 5JGAA 3UPXA 2IPXA 1A06A 1U54A 2V5QA 3MH3A 3P1AA 4Y73A 3KB7A 5HD7A 3FMLA 5I9ZA 3UO6A 2WTKC 3VBVA 2J5EA 4BF2A 3ZM4A 3NUNA 3KVWA 4EH4A 3LVPA 4JG7A 4HVHA 3DXQA 2XEYA 3W2QA 4BRXA 1OI9A 2R3JA 3GP0A 3NNXA 3QQUA 4RG0A 4S32A 3T3VA 4BCFA 3DKGA 3I6WA 1G8AA 2PUIA 3UGCA 4EH3A 5A4QA 5BMSA 5E8YA 3QTXA 5AR3A 4RVKA 3FI2A 3G15A 3QTQA 4FSWA 2R7IA 3DB6A 4D5HA 4K0YA 5I9XA 4IB1A 3Q4ZA 4L68A 1J3HA 2Y7JA 4YJRA 2J0LA 5FDXA 3ATSA 3F2RA 3Q4UA 4BI0A 3IECA 3PP0A 4QP6A 4PX6A 5D10A 4DLJA 4PDOA 4M67A 2FSTX 4WG4A 5EHOA 2VTJA 3U8WA 1UKHA 4R7IA 3V5QA 2XA4A 2XNBA 3OEFX 3AT3A 3ORZA 5ANJA 3TV7A 1Z57A 3JY9A 4BCOA 5BVOA 5KMJA 3BHTA 3FI4A 2A0CX 4BY9E 3ELJA 5CX9A 5FRIA 1Q8TA 3VWAA 3EKKA 4AU8A 5HO6A 1OPKA 4KS8A 4XV1A 5F20A 1GZOA 3PXQA 3D7ZA 3WE4A 2XK3A 4BDAA 4EZ7A 5M53A 4ZK5A 3SW4A 3V5TA 3HA8A 3WYXA 5EHYA 2ZM4A 4MD9E 4GK3A 4IWDA 4BI2A 4F9WA 3REPA 2AC5A 3DS6A 4TN6A 4YJOA 3I60A 3ZLSA 1ZOHA 3MWUA 4O21A 3HL7A 1WZYA 3O17A 4IIRA 4JAJA 3D5UA 2ITXA 2QVSE 3KULB 1R78A 3ZO3A 4IVBA 2WNTA 1NT2A 3FQHA 2B7AA 4U7ZA 2FA2A 2E2BA 4BYJA 2UZTA 3D94A 3W33A 5FTGA 4G6NA 4W8EA 3H10A 4FTIA 5FBOA 4F7JA 3H9OA 3ZC6A 4CFUA 4ZSGA 1GIIA 4ZJIA 4DEIA 5I5ZA 3KA0A 3GBZA 4YSMA 2ITPA 2ZV2A 3R7YA 4BIEA 4BZDA 1F5QA 3OUKA 4XEYA 2EXEA 4YJPA 2UZDA 5HEZA 4EL9A 2CN8A 5ACKA 4P4CA 3U6JA 3LIJA 4FA2A 5JRQA 3QALE 4IBMA 4DGLC 4BDBA 4NJDA 3ACJA 5IA2A 4AAAA 4WOVA 3EN7A 2Z7SA 5HG5A 2E9UA 3NVKI 4X7QA 2FUMA 4QQTA 2HW7A 5AIKA 2QR7A 5HICA 4ARKA 5J5TA 4BCIA 2C1AA 2QODA 1K3AA 4S2ZA 3HKOA 5DT0A 4PPBA 2P33A 2WIPA 2QQ7A 3SXRA 3R9NA 4DG3E 3VUHA 4QMZA 3D5XA 4IADA 2EB3A 3MH0A 3I79A 2XNPA 4Z16A 3VBTA 5KE0A 4QPMA 2YM6A 2CGVA 4HCTA 3TZ7A 3NUAA 4CYIA 4KKGA 4C57A 4HJOA 5CF5A 4L7FA 2QURA 2GS6A 2RGPA 3BWJA 3PG3A 4D1ZA 1Y57A 4DFZE 1QPJA 3DTCA 5HO7A 5IEYA 4FVQA 5DG5A 3ZCLA 4A4OA 4EWQA 4RX8A 2C0TA 5KMLA 5DPVA 3P78A 4GUBA 4RJ7A 3NNWA 3PFQA 4TYGA 2G2HA 4RQKA 4MF0A 4DE4A 4AF3A 4E5AX 4F1OA 3JPVA 3GCUA 1YXTA 4AZVA 5FDPA 4FZ6A 4N70A 4FZDB 3UOLA 4A9RA 3PZEA 1AQ1A 2PZ5A 4FVRA 1SVEA 2O0UA 2QU6A 2YLFA 3E7OA 4I22A 4UYNA 3VO3A 3WIGA 4KINA 3VS1A 3T9IA 1KE5A 4IAYA 4BWXA 4AZFA 4JVGA 4EOOA 4FGRA 4KB8A 1NVRA 4YJNA 4D2SA 3NW5A 1JLUE 3CLYA 4ALVA 5B0XA 4CFFA 4DGOA 1PRYA 2QOQA 4NTTA 3E8CA 3FKOA 1FGIA 2C68A 3D5WA 5IPJA 1K2PA 3VRYA 4AOJA 4E8AA 1JVPP 3PA4A 4JL9A 4R78A 4QMOA 5LMAA 3ZFMA 2BROA 3I4BA 3AMYA 4F4PA 5BVNA 3EN9A 3MPMA 1U5QA 3GCQA 4E7WA 3OWPA 3VS6A 5HX6A 2KULA 4CMTA 4GKHA 2FSOX 3EIDA 5E91A 2YHVA 2E9PA 2IVSA 3ZUVA 2F7EE 3AOXA 5DR2A 3QRJA 4AN3A 4XBUA 3SOCA 3W55A 2I40A 4JQ8A 5IDNA 4QTDA 2ZVAA 4O84A 2PVRA 3C9WA 5K0XA 3UMXA 2PVFA 2UW7A 2WTJA 4RWIA 5AV3A 4WT6A 5E8SA 4ANLA 3EYGA 2BKKA 5IQIA 3QKMA 4KAOA 4AQCA 2ZDUA 3G33A 1IAJA 3BV3A 2C3JA 3SKCA 3VS2A 4OTPA 1ZXEA 5C8NA 5KX8A 4AWIA 2VWIA 4UV0A 4ENYA 1RW8A 5HI2A 4UMPA 1URWA 2ZMDA 2W5HA 3W2PA 3LFBA 4BGQA 3DKCA 4AW0A 2CGWA 5J79A 3QCSA 4CXAA 3F69A 3FBVA 4DH7A 4OTWA 5LVNA 3GC9A 1OVEA 2J90A 1E1XA 2YM5A 2JKMA 1UKIA 2VO6A 4F0FA 3LCOA 2WMAA 2ITQA 4ACMA 2DWBA 1H1WA 4U43A 4P5ZA 4QMSA 3HMIA 4ZJVA 1OBGA 3C4EA 2YWPA 3TIYA 3S2PA 5AP4A 3A99A 3CQUA 3COIA 2Y4PA 1BLXA 1IG1A 4FNZA 1IRKA 2YABA 4MAOA 3BLRA 3DZQA 4E5BA 4U6RA 3OG7A 4X3FB 2QOIA 4ITJA 2XIZA 4QP9A 3RAHA 5DIAA 3HMPA 2PHKA 2VTPA 3O50A 5KUPA 3BV2A 4F0GA 3AC2A 4H3BA 4LFIA 2J7TA 2FB8A 3H0YA 5F1ZA 5DH3A 2A1AB 3R83A 2CGUA 3GXLA 5AEPA 3O96A 4XMOA 2YAKA 5EDQA 2A19B 5AR8A 3AT2A 4C0TA 3PRIA 2QG7A 3EJ1A 3PVGA 3ZZEA 3NAYA 3Q32A 3CQWA 4MD8E 2XKCA 3K3JA 1SYKA 5I3OA 4MVFA 3KC3A 3JVSA 2PVMA 3LE6A 2BAKA 3SRVB 3QGWA 5AMNA 3S4QA 5IISA 4RQVA 3BYMA 3E62A 4WSQA 4KSPA 4B99A 2UVXA 4U0IA 3PY3A 1M14A 4XRLA 3ZXZA 5IA0A 3L9NA 5JGBA 4NH1A 4GW8A 5IDPA 1REJA 1I09A 2C0IA 2O64A 1Q4LA 2YEXA 4NJ3A 2QNJA 3RKBA 2H9VA 4RX5A 1GZNA 1OM1A 2EUFB 4EOJA 5DYJA 3GC8A 4Q5EA 4F7LA 4XOYA 4L44A 4RIYA 4GK4A 4ZTQA 2VWBA 5DRBA 3QLGA 3PVBA 3LHJA 4YGAA 3HVCA 5L2IA 5L6OA 3RMFA 5BYYA 5KMIA 4KWPA 2UZEA 1A9UA 1YWVA 4KIOA 2ESMA 4S33A 3BCEA 4N4SA 4GT3A 3LFSA 4ZSLA 3KFAA 3RWPA 3F5PA 1ND4A 2C6TA 3HV5A 3RAKA 1P4OA 4PMTA 5GNKA 3QKLA 3EQGA 4L3LA 3PE1A 5L3AA 2C6LA 3RPRA 3A4OX 2BAQA 2PZPA 3AGLA 5AP5A 2O8YA 4ZTRA 2VTHA 3LKMA 3FMKA 4W4XA 4E4LA 3DY7A 2ZJWA 4BCNA 3EN6A 2UZOA 4NUSA 4EH9A 5LMKA 2XB7A 5E8TA 1OKYA 3IGGA 4HYIA 3RPYA 5LQFA 3FAAA 4I93A 3NVMB 5AUTA 3DGKA 4D28A 4XCUA 3SV0A 4AUAA 1QPCA 4DFYA 5CXHA 2XJ0A 3PA3A 2UZWE 2YFXA 4P7EA 2HW6A 2YA9A 3C5UA 1KV2A 3ULZA 1S9JA 1Y91A 5ETIA 2IZUA 4CNHA 2ZV7A 1IR3A 4YPSA 3R7EA 4X2FA 1XBAA 2W7XA 2F57A 5IEXA 3D4QA 4DCAA 2BTRA 3HMOA 2YITA 5KBQA 3QD0A 2W4OA 3DDPA 5TKDA 1ZYDA 2BIYA 2NP8A 5AP2A 2OSCA 3MVJA 1IA9A 1RJBA 3RAWA 4YZNA 4BCMA 4BTKA 5I0BA 1DS5A 3FZOA 4F9CA 5B7VA 2HWPA 3FYJX 4OLIA 3HV3A 2X81A 4BIBA 2OW3A 2XKDA 3ZMMA 5HBEA 2XBJA 3E88A 3UJGA 3HDNA 2WAJA 4Y5HA 1PXNA 2SRCA 4AZTA 3JYAA 4H3PA 4F7NA 4FKWA 4EUUA 5IA4A 1LUFA 2WMBA 3QRUA 2YCQA 2WB8A 4IAZA 5G6VA 5EM7A 5LWMA 1DI8A 3P86A 5J1WA 4QMMA 4D5KA 3R9OA 3HYHA 5ANDA 3HP2A 2YM8A 3BI6A 3QUDA 1P5EA 4JT3A 1WMKA 4O86A 5HTCA 1H4LA 4DT9A 2R3QA 3OC1A 4QO9A 3ZDIA 3QZIA 5I4NA 3DFCB 4KIKB 5GINE 1Y6BA 1YQJA 3BWFA 1PKDA 4CZYB 5D7VA 4BYIA 3N4VA 1GIHA 5GZ8A 5IF1A 3VBWA 4C3PA 3FI8A 4KRDA 5E90A 4Q2AA 2F7ZE 3HV7A 2QHNA 4O7LA 3GB2A 5CU4A 3L8SA 3UTOA 4D2PA 2WTDA 5BVDA 4HVIA 3P7CA 3QRTA 1YXXA 2YM3A 2O2UA 2X2KA 3PIYA 4UBAA 4DH5A 1Q8YA 3R9RA 1KE8A 4CG8A 2ONLA 1UA2A 4IFCA 5F4NA 4IB5A 1QMZA 5LCJA 5AAGA 3ZRKA 5DR6A 2ZB1A 4WNOA 4B9DA 4Z7HA 1F0QA 1VYWA 3NEWA 4R7HA 2BUJA 3QTSA 4JBOA 4AW2A 4R1YA 4RWLA 3AMAA 4CGAA 3BKBA 3GCVA 4NTSA 2ITTA 2I6LA 4U44A 4ITHA 3HV4A 4XS2A 5J8IA 4D2WA 1P14A 4TTHB 5K0KA 2HZNA 3IPHA 1PJKA 4C4GA 3QYZA 4ID7A 4L6QA 1OZ1A 3AT4A 1V0OA 2IVUA 2B52A 3KRJA 4YBKA 3DB8A 4WSYA 1GZKA 4DLIA 2W1DA 5DRDA 3IKAA 4EQUA 4EOIA 3KMWA 3NIEA 4CVAA 4IB0A 4YP8A 3AC3A 3Q5ZA 4BBFA 5IEVA 1OL6A 3P5KA 1OUYA 2YM7A 5D12A 4CQGA 3EQDA 4A07A 5DE2A 2KTYA 4TYIA 3T9TA 3UIBA 2YJSA 4QMTA 2XF0A 3L9LA 4AW1A 3ERKA 5IQCA 1FINA 2W05A 4KSQA 1FPUA 4OT5A 3RK9A 4HPUE 4F9YA 3BHHA 1XH6A 5L8KA 5BYLA 3R04A 4YLLA 2GTNA 3TL8A 4RVMA 4QP3A 1XH9A 4MK0A 4BL1A 4D58A 1DM2A 2R3FA 3QCQA 2ERKA 3GC7A 5BVEA 3EFWA 3FSFA 4WBOA 1FMOE 2IZTA 2I0EA 4FTNA 4Y8DA 4IHPA 3FZ1A 3C13A 4R6VA 3IO7A 2DS1A 4BKZA 4PNIA 4DTAA 1PXMA 4FT0A 4ANMA 4EK4A 1UU7A 2VTRA 4V0GB 5EI6A 4GEOA 4O91A 2QOCA 5AR4A 4EC8A 3UNKA 2W1IA 3D2KA 4PF4A 3DJ5A 2BILB 3GU4A 4JQ7A 3BE9A 4M84A 4FTUA 5IG1A 5J1VA 3A61A 3PTGA 4RVLA 2X2LA 2GTMA 2BRNA 1Q99A 4BIDA 4M66A 2J4ZA 3LMGA 4ACDA 4H3QA 1Z9XA 4BTMA 4NT4A 1Q5KA 5GIPE 1OIYA 3Q53A 3U87A 1H28A 4NM3A 4QP2A 3NLBA 3COMA 5DEWA 3CE3A 2ETMA 4EK8A 4M7IA 2XKEA 1OPJA 4LMNA 1FQ1B 2OF4A 2R64A 2Y0AA 2B1PA 3TXOA 5CF6A 5AA9A 5EKOA 4G31A 2EWAA 3Q9YA 3PJ8A 5IA5A 1P2AA 1YI3A 3OEZA 3ZSGA 4CYJA 5KMMA 4PDPA 4ANNA 3KVXA 5DVRA 4S31A 2OH0E 2VAGA 2YCSA 1LEWA 2J9MA 1NW1A 1FMKA 1CKJA 4LRJA 3EFJA 4QPAA 3WF9A 2YIXA 3MH2A 3CXWA 4MD7E 2W9ZB 2XNMA 3D2IA 2I0VA 4FOCA 4FG9A 5CSXA 3WZEA 4A9YA 1SZMA 5CANA 5KHXA 1YXUA 3BYVA 2FSLX 3D14A 2C6MA 4RC2A 3CR0A 3FLWA 4TYJA 2W1FA 4D4RA 4EK6A 2VX3A 4RZVA 2WQEA 3EH9A 3IDPA 4FTAA 2PVNA 3WE8A 2W0JA 3F3VA 4L00A 3R1YA 5HU9A 4IC7A 1TQMA 2DQ7X 2DUVA 2BZIB 2VNWA 5GJFA 2E9VA 4C38A 3A8WA 1XH5A 4ACHA 3OW4A 2WTIA 4FKIA 5J9YA 5ANEA 2AC3A 2OH4A 3ZH8A 1MRVA 3A7GA 4LG4A 4Y72A 3FPQA 4YZ9A 4IAFA 4RA5A 3PWDA 3Q5IA 4N6YA 3E8NA 4YHJA 5FXSA 2G01A 4F6UA 3SHEA 2WQOA 1FBNA 3NR9A 3VUTA 4ZY4A 2JAVA 3R02A 3UYTA 2ZV9A 4AZWA 4AZEA 4RMZA 5DN3A 1O9UA 3AXWA 4Y46A 5EQPA 2O65A 3Q3BA 3D15A 4WRSA 3PXKA 1H24A 2QC6A 4U45A 4NZWB 2BMCA 4EHVA 2F2UA 2ITVA 3W2OA 4IX5A 2YAAA 2J5FA 4XG4A 1BMKA 3TG1A 4USFA 3UPZA 5IQAA 3GNIB 4EOSA 2ITOA 5FLFA 4B8LA 5DA3A 2XK8A 4G34A 3MTFA 2AYPA 4EH6A 3SA0A 4Z55A 4AP7A 1M2PA 2WKMA 4PWNA 3HNGA 3K5UA 5KKRC 4EBWA 1WBWA 5HVYA 4XV2A 2W1HA 2W4KA 3TNQB 4DEAA 4OW8A 4E1ZA 1J7LA 1OBDA 3OOGA 5DI1A 2ZAZA 3BGQA 4UXLA 5HIBA 4RWKA 1ZMWA 2W99B 2Y4IC 3OMVA 4IJPA 5FP5A 4USEA 4QP8A 4QMNA 2UVYA 2R3LA 2VWYA 2WO6A 4YJVA 5E1EA 4U3ZA 3WILA 3NDMA 2ITYA 1FVVA 3RPSA 2RFDA 4QP7A 4DTKA 3MFTA 1RDQE 3AD4A 5JK3A 5AWMA 1YXSA 2R3KA 3C1XA 4BGHA 2XK7A 2BZKB 3A60A 5HESA 5TE0A 3G2FA 3NCGA 2FO0A 3F3TA 3UOJA 4NKSA 2QO7A 2R0UA 2HY81 2V7OA 2JEDA 3VHKA 2XZSA 2HK5A 3CBLA 4PTEA 4QTBA 4I20A 1RE8A 1WBVA 3IW8A 3CPCA 1DAYA 3DJ7A 4LGDA 4OAUC 1H1SA 1J91A 2PZRA 2OWBA 3FLYA 3G90X 4PL5A 2CKEA 4TZRA 2ITNA 1XH4A 2X9FA 4C4EA 4DHFA 5C4KA 3SC1A 4AFEA 3QQKA 3PXRA 3LJ0A 2A4LA 3MSSA 1OITA 4Z3VA 4KD1A 4O2PA 5AV0A 5HG8A 3QCXA 3RBWA 2X8EA 3Q60A 4H05A 4EJ7A 3VNTA 2W1CA 4FBXA 3A4PA 5EFQA 4LV5A 5M55A 2J0KA 2OZAB 4FIHA 2VO7A 5I9YA 2UZNA 3D9VA 3A8XA 4DEGA 3S0OA 4M0ZA 4IWOA 4QD6A 5HNIX 3ORPA 5E8WA 3BEGA 4CZUA 2P2IA 3F5XA 4WNKA 4L01A 3V5PA 2BHEA 2YM4A 4J53A 4D55A 4ZTLA 3R22A 4I6QA 4PQNA 3AC8A 3ZO2A 3ZTXA 1YW2A 4FEXA 4GV1A 1PY5A 1PMNA 1YRPA 1ZYJA 3MFUA 4FIFA 5HGIA 5JFWA 5FEQA 3TI1A 4GS6A 3R8MA 4ZSEA 3HLLA 3AC4A 3ZFXA 4UWCA 4CTBA 4AT5A 3TT0A 2CJMA 2JC6A 5EM6A 3D5VA 3UQGA 3HRCA 5EYMA 4BN1A 2C5NA 3NPCA 4L52A 4UMQA 5AP1A 2GNJA 2QOBA 4KBCA 4C36A 5EYCA 4BDJA 3WZUA 3ZO4A 4E6CA 2BPMA 4I23A 3KXNA 3ZLXA 2YJRA 3ZSHA 5FM2A 4ANBA 4BDKA 5KBRA 4MX9A 2HAKA 4YC3A 2JIVA 3IDCA 2NRYA 3L8VA 4H58A 2IW8A 2ZDTA 2X2MA 3R73A 5AUZA 5FTQA 2Z7RA 2VU3A 4HGSA 4ZTNA 3WI6A 3EKNA 5AUXA 4IM0A 3ZEPA 4BHNA 4DCEA 5A6OA 2H8HA 1NXKA 4WNPA 4DF3A 1SM2A 5HCXA 5JFVA 2XRWA 4D2VA 5C26A 2NNWB 3D7TA 3GCPA 3KXHA 3OY1A 3V5JA 4O82A 4EOLA 3F3ZA 3LFCA 4MBIA 3R8VA 4UMUA 1W0XC 4D4SA 4ZTMA 2B9HA 3CGFA 2IW9A 3U9CA 5T68A 3FZRA 3IDBA 3Q9WA 2ZM1A 1WBSA 1VYZA 5AUUA 4NEUA 1NVSA 4R3RA 1OKZA 2X4ZA 3FMDA 4K77A 4BBEA 4QMVA 4GFGA 1K9AA 3NNVA 4D4VA 4FT3A 4XYFA 3FLNC 3IS5A 3VQUA 3GENA 2W4JA 1YHVA 2YIWA 1UWJA 4IWPA 5AV4A 3UQFA 3QXPA 2GPHA 3MDYA 5AR5A 1OL7A 5CENA 4TY1A 3UNJA 1Y6AA 2WMSA 4F63A 2PULA 3UP2A 4DITA 4L3PA 4EKKA 4JDJA 4FIJA 5DBXA 3LXKA 1PXKA 4RZWA 4CT2A 4EZ3A 3HRBA 3IW4A 3LLAA 4ZZMA 3U4UA 1Z5MA 4CV8A 1H8FA 3S3IA 4EUTA 3MJ2A 2PMNX 3A7HA 3HV6A 4XJ0A 3O0GA 4AZSA 1JBPE 2PSQA 5JGDA 5K5NA 3RCJA 3V5LA 2JFMA 4OBPA 3R7OA 5CASA 5M09A 4YLJA 2OJGA 3QQHA 4IZ5A 5CALA 3DOGA 4DGMA 2BZHB 3OFMA 4USDA 5FUTA 2CLXA 4HVSA 3PJ3A 1GAGA 3U4WA 3W8QA 1NVQA 2XYUA 4FV6A 2R3MA 2GFCA 4BR3A 5ETFA 3A7JA 2R5TA 4RIWA 4PTGA 3QGYA 2GCDA 2HCKA 4LGGA 4PL4A 2WXVA 3O8PA 3BELA 4MNEB 2I1MA 4JDHA 1ZMVA 4IW0A 3BBWA 3VHEA 3W10A 4F1MA 4F6WA 3ROCA 3V8WA 1YDTE 3C0IA 3FMEA 1JWHA 2Z60A 3G5DA 4H1MA 2R3PA 4HGLA 2JIUA 2JLDA 4FYNA 4O0TA 5A54A 5EOLA 5CEPA 5M4FA 3CCNA 2WMRA 5HE0A 3PUPA 4YBJA 4YJQA 4EYJA 4IB3A 2B53A 2R0IA 3EN5A 5TR6A 4IM3A 3VBXA 3E7VA 4E6QA 3BYOA 1H07A 2C6KA 4YJUA 4K11A 3EQIA 4RJ8A 5M4IA 5HIEA 2YZLA 2C6OA 4G3CA 4IXPA 4BZOA 2YZAA 1M2QA 1XKKA 4FYOA 5H9BA 3BZ3A 4C61A 5AIRA 5FBNC 1RQQA 4FSRA 4AS0A 4HCUA 3KULA 4D0WA 3BLHA 1W8CA 5HE2A 2UZLA 5E8VA 4G6OA 4WHZA 4ZAUA 4S34A 2OG8A 2WGJA 3OXIA 2YISA 2BKZA 4CV9A 2BIKB 3FHRA 3LZBA 4BWKA 3ETAA 3VF8A 4AOIA 5EI2A 1MRYA 2X1NA 1TQIA 4HYHA 3ZBXA 4KA3A 4MCVA 5DLSA 4GYIA 2GNGA 3LQ3A 1SVGA 3F82A 4IQ6A 2Q0NA 5DNRA 4F08A 4X2JA 3MY1A 4F6SA 4ZZNA 2XIYA 3ZLWA 3UIMA 5L2QA 4JDKA 5DGZA 4YZBA 5L2WA 1OGUA 2RFEA 3W8LA 3I0OA 3IK3A 3UZPA 3C0HA 2HIWA 3QAME 5ANKA 2B0QA 4M69B 4IVCA 2YDJA 3ZRMA 4K9YA 2A2AA 1W98A 4GH2A 2JDOA 3FY0A 4E4XA 3MV5A 3R0TA 2F49A 3PIXA 3MIYA 3HUCA 3MFSA 3CKXA 4BDIA 5D41A 3UODA 3HA6A 1OECA 4I4EA 1KUTA 3QQFA 5CS6A 2QO2A 1G8SA 4NIFB 3U6IA 1PMUA 2XEZA 2OFUA 3OWLA 4BHZA 3JR1A 3Q6WA 3RK7A 5CF8A 1BL6A 4N57A 4EEVA 4TWNA 3R7IA 5D11A 1CKIA 4ASXA 5DR9A 1JOWB 3F5UA 4QMUA 4W4VA 2VTOA 1OUKA 4GYGA 2PYWA 4APPA 3GQLA 3PSCA 4K6ZA 2HZIA 3VVHA 2R3HA 3ZO1A 4EC9A 4LOPA 4N6ZA 5ANOA 4QNAA 3UYSA 3VIDA 3CGOA 1UV5A 4FEQA 3TV6A 4EI4A 3FEGA 2QO9A 4O81A 4LM5A 4AE6A 4D2TA 2H96A 1XBCA 5IQHA 4HZSA 5I9WA 1QL6A 4MF1A 2EU9A 3FZTA 5D7AA 3ZFYA 3ORKA 4GG7A 2UW5A 4QNYA 2G2FA 4NCTA 3KXMA 4Q9ZA 3H0ZA 2B9IA 4BTFA 2WTCA 3MBLA 3O23A 4QTCA 2WU7A 2YIYA 4PL3A 4CSVA 5TF9A 4RIXB 4YURA 1ZLTA 3LM0A 3RZBA 2X0GA 5BVKA 4O0YA 1ZOGA 4Q5HA 4O7YA 3KMMA 3GOPA 4NU1A 5IKWA 1LR4A 3RCDA 4O7SA 4L67A 5EQYA 4CEGA 2BDWA 5IH5A 3PSDA 3Q4TA 2A27A 2Z7QA 2PVHA 4C7TA 3DPKA 5HHWA 4NW5A 4AE9A 4FTTA 4ZSJA 3C4FA 3KL8A 4O7VA 3ZM9A 3IW5A 2YLEA 3VJOA 2CKOA 4NYEA 4MXZA 4OBOA 3GEQA 2CNVA 3S1HA 4HGTA 2R3NA 2PMIA 3MPTA 2QLUA 3E5AA 4ANQA 5B2MA 5KKRB 5H8GA 3E92A 3ZRLA 3E93A 2OK1A 3PLSA 2WMXA 4DYMA 3PJCA 2F7XE 3HAMA 1URCA 1OKVA 4M8TA 4O27B 4NFMA 4TRLA 4WUNA 3SW7A 5M51A 3FV8A 3DKOA 4I6FA 5C8MA 2W9FB 4FV8A 2EVAA 3LXLA 3AC5A 4HNFA 4A7CA 2YDIA 4XG2A 2NO3A 1IAHA 3DK7A 1FGKA 4YHTA 5KMKA 3KXXA 3LJ2A 4UX9A 3LFAA 1YKRA 1WVWA 4FMQA 5KZIA 1J7IA 3MVHA 4MEDA 4H39A 1BYGA 3QHRA 2W06A 3H4JA 4FSNA 4WRGA 5K5XA 5BNJA 5CSWA 2P55A 3NS9A 3NUPA 3LFDA 4DG2E 2JKKA 4BDGA 4PMSA 4DEDA 4RFZA 3P7BA 2UZUE 3LQ5A 3GU6A 3AQVA 4HVDA 3ATTA 4IMYA 2Y6OA 3COHA 3W2RA 4FT9A 2G15A 1GY3A 1JKKA 2XS0A 3PPJA 5G1XA 5DFPA 4A9UA 4E26A 5CXZA 3EL8A 3FKLA 5CTPA 1KOAA 2WTVA 3OWJA 2BDJA 5AV2A 3OWKA 5IA3A 4QYHA 3LAUA 2VWZA 4FI1A 3CC6A 1WVYA 5KZ0A 1SMHA 4DG0E 3MI9A 3KK9A 5DMZA 4J7BA 5BVFA 1XHAA 4MHAA 5JN2A 1TQPA 4I24A 1OPLA 5BX0A 3FKNA 3I5NA 3DBFA 4IACA 3LCTA 3ORTA 1Q62A 1FOTA 4I1ZA 5CU3A 5A6NA 5JKGA 4DC2A 4QQ5A 2DYLA 2RG6A 5GJGA 4KIQA 4O22A 5CU0A 5HLWA 4D9TA 1WVXA 4R3PA 1JQHA 3KCKA 4XOZA 4ALUA 4ZSAA 2XK4A 3DCVA 1PXPA 3DAEA 1CKPA 3G9NA 4R7BA 2GDOA 4FNXA 2HXQA 2ITUA 2PY3A 3ODZX 1JAMA 2GHGA 2WTKB 3R30A 4CCBA 5L4QA 4OTRA 5GHVA 3DFAA 3EQBA 3PXZA 1R1WA 2C47A 4UALA 1MP8A 4KNBA 2F4JA 2QKWB 4MWIA 4PP9A 4UMTA 2CKPA 2OIBA 4JNWA 4BDEA 1PHKA 4FZ7A 2R3OA 3PA5A 1M17A 4WBBB 5FQDC 2AUHA 3CTHA 3DJ6A 4WD5A 2C4GA 4O0SA 3CY3A 3GCSA 3QC4A 2VTLA 3E3BX 3L8PA 3OTVA 3NMUF 3FMHA 3R71A 4FTCA 1PW2A 4IDVA 2GS7A 4AA0A 3OOMA 2QKRA 3B2WA 1ZMUA 4J97A 4ZZOA 4I6HA 2RG5A 1STCE 4TNDA 5HTIA 2YN8A 3M1SA 4GCJA 5M06A 3DXNA 4ANSA 3BGPA 1W84A 5J5SA 4GT4A 4BDDA 2V22A 3C4CA 2VTTA 2C3IB 2IO6A 3R1NA 3OW3A 4A06A 2GU8A 3FLZA 3F3UA 3MIAA 4FF8A 1CDKA 4XBRA 1WBPA 3ZU7A 2BTSA 4RC4A 3DNDA 3R9DA 5AX9A 4DFXE 4JJRA 2RSVA 3OCSA 2YIRA 4GIHA 5A9UA 4BCQA 4FE2A 5JMSA 1ZZ2A 1H25A 2PK9A 2HY0A 2VTNA 4K18A 4BDCA 2CGXA 1HCLA 2C3LA 3GT8A 2BCJA 4M97A 1BUHA 5HTBA 4E6DA 3SXFA 4FOBA 3EQFA 4ZJJA 2FVDA 4MWHA 4KIPA 4U42A 5JFXA 2CNUA 2RF9A 4FV0A 1OL5A 2YERA 1YDRE 4EBVA 3UC4A 1GOLA 2PVYA 3OD6X 4MXYA 3UVPA 4G5JA 4U41A 4UYAA 1MQ4A 2J0MB 5HVJA 3FC1X 4MXOA 1OIQA 2VTIA 2OJIA 3KRRA 5EYDA 5B2LA 3U6HA 4IE9A 3K2LA 1R39A 4OBQA 4I5PA 5T3QA 3LPBA 1FVTA 4GIIA 3TTJA 3LXNA 2R3IA 4YTCA 4DT8A 2HYYA 1KSWA 1YXVA 2PTKA 3BIZA 4GJ3A 4TL0A 5AP7A 1H0WA 5LVMA 2VWWA 3AD5A 2IWIA 2QLQA 4LL5A 3BPRA 4RRVA 3PY1A 3QFVA 5CNNA 4KBAA 4CT1A 4DFBA 3ZHPC 3LFEA 3NX8A 3DAKA 4JX3A 2B55A 2VTMA 2PMLX 2J6MA 2CNQA 4V04A 4TYHB 3BYUA 4PPAA 4C37A 5HQ0A 5JQ8A 1APME 2W1GA 2XCHA 4L3JA 1ZY5A 3ORXA 3DXPA 1DI9A 2WQNA 2XM9A 3QA8A 4FNYA 3R28A 2X4FA 1UNHA 4K2RA 2JKQA 4KIKA 4O7NA 3OUNB 3EOCA 3FI3A 4D9UA 4JOAA 4LUDA 4KRCA 3SD0A 3VN9A 4CKJA 3SLSA 3ALOA 3MFRA 4G5PA 2Y6MA 4PY1A 1W83A 4O0XA 4FKOA 2C1BA 3NUUA 4LL0A 4F65A 5HZNA 3BHUA 2WTWA 5L6WL 4DFUA 3TV4A 3WF6A 2OU7A 3N9XA 2IG7A 4FR4A 2OXYA 1ZYCA 2OFVA 4RIOA 2JAMA 3NCZA 3QQJA 4U9AA 4B0GA 1HCKA 4FL2A 2HENA 4UEUA 3ROYA 4ENXA 3ZYAA 4GG5A 4RX9A 4B7TA 4KKHA 4FUXA 1B6CB 1IEPA 2C5VA 5LCKA 1KWPA 2X39A 4CFXA 1UNGA 5L2SA 4ZS4A 3ORIA 5AFVA 3AC1A 2JDVA 4TKSA 3HMMA 3SAYA 3GQIA 5GIOE 3ZC5A 3KEXA 1XQZA 4G2FA 4ALWA 5HLNA 5C1QB 2J0JA 1PXOA 2PVKA 2GQGA 2OJ9A 2QR8A 3DK3A 4QMXA 3OTUA 4O0WA 4TWOA 3UZTA 4FKJA 4L9IA 2WOUA 4A4XA 3O71A 4JS8A 3UG2A 4GUEA 1OIUA 4LQMA 4D4YA 4CCUA 1G3NA 2FGIA 4CKIA 5C4LA 4NWMA 2O3PA 2JITA 3PIZA 1H26A 4I5CA 1WBNA 4J96A 1UU3A 5TT7A 5EKNA 3AGMA 3WF8A 4EHEA 2BALA 4U81A 2VWVA 3CD3A 3OVVA 4CRLA 4ZIMA 4ZMEA 4M12A 3VUKA 4GSBA 4L46A 4C4JA 5JT2A 4RJ3A 5FWKK 3RHXA 3NUXA 3GVUA 2BR1A 2UVZA 4HVGA 5IQGA 3WZJA 3FLQA 3C4WA 3TNPC 3FWQA 4XG9A 2OIDA 2LAVA 1J7UA 3BHYA 5ITAA 2PUNA 3HMNA 1R0EA 3NZ0A 5KO1A 2X7OA 4HYSA 5M4UA 4G17A 3MA3A 4YMJA 3DDQA 3O8TA 3LCSA 5GZ9A 3UOHA 2O63A 3W32A 3QX2A 4LRKA 1CSNA 2OICA 3L9PA 4D2RA 4D1XA 2R9SA 5EH0A 3GFWA 3VUMA 5HORA 1TVOA 4XG6A 4C62A 4GKIA 2GNHA 2VX0A 3LMIA 5EOBA 4ASEA 1ZZLA 1U59A 4PDSA 3PPZA 4QTEA 4MBLA 1YDSE 2GQSA 4IWQA 4V0GA 4CMOA 4FSMA 4M3QA 1JPAA 2JIIA 4X6QC 3NRMA 4YJTA 4EYMA 3FL4A 2BRGA 3FXXA 3ZSIA 3V5WA 4IZ7A 4OTHA 2QI8A 2C6IA 4FUYA 4OTDA 2UW3A 3TNIA 3KN6A 3TZ9A 3V8TA 3WF7A 3N4TA 1MRUA 1YHWA 4Y85A 2Q83A 3DT1A 5ANIA 5BUEA 4XNEA 5CYIA 2P4IA 4PRJA 3H9FA 2QOLA 5JZJA 4BBMA 4HW7A 5CNOA 1ZYLA 3TZ8A 4V05A 4ZS0A 3FMJA 4QYEA 2UZBA 3EYHA 5T6KA 1YWRA 4Q9SA 2ZOQA 5GZAA 2XMYA 2R4BA 1OL1A 2UW4A 3KY2A 3QL8A 5FEEA 4XG7A 2WPAA 5LMKC 5E8ZA 4CLJA 3NYOA 4L7SA 3K54A 4YR8A 3LW0A 4FV1A 5HNBA 3TNHA 4XX9A 4C4IA 3TUBA 4DA5A 3R63A 3EFLA 1S9IA 1U5RA 4RFMA 1WBTA 1ZRZA 4QTAA 3E3PA 1UNLA 5DWRA 4BDHA 3D0EA 2OIQA 3MA6A 3N51A 3TKUA 4FG8A 3P23A 4FIEA 4BKJA 2J0IA 3DTWA 3EMGA 3VS0A 4NFNA 4OTIA 4W4YA 3HX4A 1Q8ZA 4EOKA 1Q97A 4O38A 4E4MA 5E7RA 2J50A 3I7CA 2REIA 1OIRA 3MS9A 4JI9A 3MVLA 3TJDA 3UOKA 2XNNA 5CQWA 3A7FA 3HUBA 1H27A 4IX4A 4F0IA 2ERZE 3DZOA 3O7LD 4H36A 2VGOA 1U54B 3PXYA 3UG1A 5AUVA 1SVHA 4TXCA 3FMMA 4UN0C 3CKWA 4QP1A 1JKSA 4J8MA 4H1JA 2P2HA 1QPEA 4QQCA 1XBBA 2W1EA 3OROA 4EK5A 3OS3A 5EDRA 2JD5A 5IQFA 2QU5A 2VTQA 4YO6A 3QWKA 4YZCA 3DBQA 5FEDA 4B6LA 2XNEA 5CAPA 2PU8A 2WOTA 3EN4A 4ZP5A 3QCYA 3FJQE 4J1RA 3SG8A 2ZV8A 2WHBA 4JX7A 2UV2A 3CEKA 2XUUA 1WCCA 5H8EA 5AAEA 1E9HA 3QTRA 5CU2A 2XK9A 3ALNA 3LQ8A 4ZEGA 1JKLA 3QTWA 5I3RA 2B4SB 2I7QA 2J2IB 5CVHA 5BMMA 3E63A 3TKHA 4BTJA 4LMUA 3MYGA 3CP9A 4AW5A 3LM5A 4W9WA 5CWZA 4WO5A 2EXCX 1IA8A 4FTOA 3OT3A 4IANA 4XLVA 5D1JA 3TKIA 5IQDA 3KF4A 5HOAA 2C6EA 4QPSA 4HPTE 2BRMA 3HEGA 5HCZA 4KUJA 2XVDA 3ANQA 2VNYA 4FKGA 4YLKA 3ET7A 2C69A 2WMUA 2UW8A 4EOMA 3P7AA 4WKQA
chains in the Genus database with same CATH superfamily
3DK6A 4DGGA 4L43A 4IC8A 3FUPA 5DHJA 3VS5A 4YUQA 2ONLC 4LOOA 5EG3A 4EH5A 3UDTA 5JQ5A 1HOWA 4QP4A 4WNMA 3W2SA 1ATPE 4YZMA 2R3RA 4TNBA 4BCGA 2JFLA 4PMPA 1Q3DA 2OI4X 2NPQA 3CPBA 3NW7A 3FDNA 5E8XA 3OF0A 2CHLA 5LVOA 3PVWA 1Y8GA 2JDRA 1Q8WA 3V3VA 2OLCA 3QZFA 4P2KA 3DA6A 3RTPA 3IW6A 3CJFA 4TW9A 2VV9A 3R8PA 4BDFA 3NYVA 5CF4A 1ST4A 3PSBA 5BUJA 3GOKA 3UIUA 5IMEA 3S00A 2Z02A 3CS9A 4B8MA 4ZTHA 1SNXA 4EJNA 2B9FA 3KRXA 4E5WA 3LLTA 4JRNA 3ML1A 1YI6A 3RAIA 2GS2A 4C4FA 1ZWSA 4I3ZA 5L6PA 3Q96A 3R2YA 1M2RA 3GUBA 3K5VA 3RPVA 1E1VA 3R2BA 3UQCA 5HIDA 3LFFA 3P0MA 3QKKA 3EWHA 3W16A 4R3CA 4O83A 3VC4A 2IZSA 1BI7A 3C0GA 4FX3A 3GI3A 4FKLA 3GC0A 4BB4A 3WF5A 5CAOA 1M52A 4FIGA 4HYUA 5ACBC 3IW7A 2YWVA 3HZTA 3HECA 5A4TA 4RIWB 3ORMA 2PE2A 3OCBA 4FSQA 2GQRA 3ENMA 4PUZA 4AGUA 4GVAA 4G9CA 4ANOA 4FEUA 3R8ZA 1AGWA 2OZAA 3KKVA 2PL0A 4K8AA 4WG5A 4G3DA 2QONA 4JBQA 4PP7A 1J1CA 3DV3A 3R00A 4RC3A 2ZYBA 5CY3A 4QMWA 3OBJA 3VS3A 4AA5A 1TFFA 4B4LA 3OCGA 3QTUA 2A98A 2BAJA 3HP5A 4X21A 5CZHA 4YTIA 3DLSA 1OMWA 1PYEA 4M0YA 5ICPA 5EK7A 3F88A 4J95A 4JDIA 3P9JA 1NY3A 2X8DA 3H30A 3QUEA 4CQEA 2PPQA 3MW1A 3R01A 3TM0A 2QHMA 3BGZA 3F3WA 3G9LX 2PUUA 2ETRA 3AD6A 3WOWA 1PXIA 5EM5A 3VRZA 5EW9A 4KABA 3CQEA 4U8ZA 4E20A 5A4CA 1V0BA 5KMOA 3I81A 4MBJA 2RFSA 3NW6A 1QCFA 4RGJA 4XH6A 5AV1A 2WMQA 5J9ZA 4FV4A 5CLPA 2CDZA 3MJ1A 3KK8A 4FSZA 3UO4A 3ZUUA 4FODA 2XP2A 3RJCA 2XIKA 4AX8A 3EFKA 3IONA 4IZAA 2F2CB 5BQ0A 2NYAA 3U9NA 3ZLYA 3O2MA 2UUEA 4FTKA 4NM7A 3RM6A 4F9BA 4ZLYA 4PPCA 1Q61A 5CEIA 3FYKX 3H9RA 3CTJA 3IOKA 3MTLA 5E92A 4ZY6A 3CD8A 4CFMA 3LXPA 3F61A 5IU2A 5LJJA 3EZVA 1H1RA 3R7GA 4FKSA 4CD0A 2QD9A 3ODYX 5M57A 2GSFA 5LMBA 4TPTA 4MTAA 3F7ZA 1U46A 5CVGA 5H3QA 4FV3A 3THBA 4FSYA 5FD2A 3UZRA 1GNGA 5IH6A 2WU6A 4G3EA 3EHAA 2C3KA 3PG1A 3F7WA 3I0QA 4JR3A 4ZOGA 4LI5A 4DH1A 4LV8A 3MB7A 4V01A 5FM3A 2OKRA 4JIKA 2WIHA 2WZJA 2OJFE 1JKTA 1UVRA 2UW6A 4UXQA 2W5AA 5FGKA 3V01A 3VS7A 1PYXA 4IFGA 1BI8A 3F5GA 4UY9A 3HDMA 3BQRA 3OY3A 2R7BA 4IAIA 3TUDA 4C3FA 3QBNA 5A4LA 3ULIA 4IJ9A 3B8RA 3QC9A 4OR5A 3CIKA 4BCHA 1JSVA 5ETCA 5CAQA 4K1BA 3R1SA 5IQEA 2XAMA 5AR7A 3QRIA 4P90A 3MY0A 3TCPA 4EHGA 3W18A 2X7GA 2BDFA 4BWPA 1IASA 2RIOA 1T46A 2H6DA 3ITZA 4PTCA 3TN8A 1L8TA 4LV7A 3V51A 3RNIA 5C27A 3ZZWA 5F9EA 2IJMA 4OGRA 4O7WA 2G9XA 4YC8A 4AXEA 2J51A 4AT4A 3WYYA 3PPKA 3VUGA 2RKUA 2W17A 5LXMA 4CFVA 3KREA 3BU5A 4A4LA 4AA4A 1M7NA 3GGFA 4LUEA 4M68A 5HG7A 5FXRA 5CQUA 5A4EA 3K3IA 3MY5A 4O4CA 4U5JA 3TWJA 2W5BA 3RALA 4ERWA 1VEBA 4MNEA 5AM7A 2GHMA 2CPKE 3LFNA 5AJQA 5AP0A 2OZOA 3MGYA 4XP0A 3CSVA 2PE0A 5FP6A 4KKEA 3VUIA 5LWNA 3WBLA 4RT7A 3SGCA 5J9LA 4QYGA 1YOJA 1UU9A 4JBVA 3R8LA 3LCDA 4IVAA 2WMTA 1XMLA 4RJ4A 1WFCA 2OO8X 2B9JA 4RJ6A 1XH7A 2VZ6A 4YU2A 3NIZA 4FV7A 3ID6C 4M14A 3QD2B 4AN2A 3LJ1A 3M2WA 3ORNA 2Z7LA 4NW6A 3BEAA 3UO5A 1H08A 4C33A 1YOMA 4I0RA 3S95A 1H01A 3ZS5A 2RL5A 5FTOA 4DN5A 4OAVB 4GL9A 2QOKA 3ACKA 1PKGA 1Q24A 2HXLA 3Q52A 4FG7A 4RPVA 3ANRA 4BI1A 3PJ1A 4RIYB 4FKRA 4FTMA 5J7BA 4F99A 3WZDA 4C02A 4F1TA 3AG9A 1L3RE 1GZ8A 4JG8A 1FVRA 2OXXA 3PY0A 2LGCA 1Q8UA 4IM2A 5AP6A 3BE2A 3EL7A 4QOXA 3FY2A 4FICA 2VGPA 4X0MA 1MQBA 4I6LA 4O7ZA 4EH2A 2CMWA 4ASDA 5KHWA 5BVWA 2YCRA 4MQ2A 4C3RA 5DT3A 4X2KA 4EQCA 3GU8A 2OJJA 2W1ZA 4CTCA 2HELA 3ENHA 4DEBA 4YNOA 3FZPA 4QMPA 4RBLA 5EW3A 2V55A 4AFJA 3MVMA 1XWSA 5E1SA 1OB3A 5LOHA 4BCKA 3DBCA 3RI1A 3KQ7A 4ZTSA 2XIRA 4DFLA 1YVJA 4E3CA 3QTIA 4O6LA 1ERKA 1KV1A 5HNGA 3PP1A 3C4XA 3FQSA 4MXAA 4DINA 3A62A 4M69A 2I0HA 3H3CA 1PMEA 4XG3A 2IF8A 4GU9A 3PDTA 5ETAA 5TO8A 3UP7A 4YSJA 3B8QA 5IUGA 1WBOA 3R1QA 2C6DA 2Z8CA 2WQBA 2YCFA 4RWJA 5M08A 5CSPA 2ZB0A 4NIFA 2P0CA 2Y4IB 3DBDA 3P79A 3DAJA 3M11A 3PVUA 5CAUA 2BVAA 4BCJA 4AGDA 1W82A 4FJVA 2EXMA 3FMNA 4BVUA 4EHZA 2GNFA 2WQMA 4FIIA 1F3MC 3VS4A 5HBJA 4XV9A 4F70A 3BQCA 5DT4A 2HOGA 3R6XA 3ZOSA 4TT7A 4RJ5A 4FSUA 4NSTA 5JSMA 5E8UA 4U40A 3PFYA 4F64A 2YDKA 4LGHA 3PE2A 4U80A 4EKLA 2PVLA 4HNIA 3BX5A 3D83A 3KXZA 3POOA 5DEYA 4NM0A 5I9VA 4GJ2A 2CSNA 3LOKA 4MNFA 5EHLA 4DBXA 3OP5A 5J95A 3VBQA 2OXDA 3LMHA 4I5MA 5LARA 4NKAA 3C51A 3QZHA 5LVPA 3QYWA 5IMXA 1V1KA 4RIXA 5CEQA 4D0XA 4APCA 4X3FA 2VTSA 4F09A 3ZDUA 4GK2A 4BZNA 1CTPE 4FSTA 3Q2JA 3UVRA 5GJDA 4J71A 4HOKA 3FE3A 1M7QA 2H34A 5CI6A 4FGBA 1VR2A 3V6RA 2XNOA 3PLAE 4FVPA 4M15A 4O0RA 4MYGA 4OTFA 3BBTB 4YC6A 4EH8A 2C5YA 3DBEA 3QHWA 2VWUA 4EORA 4YZDA 5L8LA 5AUYA 4I41A 4FTRA 3SRVA 1R3CA 4I21A 4UWBA 1YWNA 1JSUA 3POZA 4K33A 2UW0A 4Z9LA 2V7AA 3WIKA 3NYXA 4FKVA 3R8UA 4I4FA 3FXWA 4QYFA 3P4KA 2GFSA 2ITZA 1BL7A 2GNLA 3F2AA 3FQEA 3MH1A 3EQPA 3P08A 1H1PA 3R7UA 4A9SA 3OXZA 5IA1A 4UMRA 3G51A 4EZ5A 2V62A 4QDEA 4IDTA 4FC0A 2WD1A 3M42A 4MH7A 5HKMA 4C35A 1XH8A 1UWHA 2OBJA 5HCYA 2R3GA 3RNYA 2Y9QA 4BFMA 3RGFA 3ZONA 1H00A 2BRBA 1KE9A 4ACGA 3W2CA 4CG9A 1REKA 1OKWA 4FT7A 4QT1A 5EW8A 2JDSA 4FV5A 5DOSA 2XJ1A 4EOPA 4EQMA 2VRXA 3SVVA 4YNEA 4XHKB 5HE3A 4FT5A 1W7HA 3C50A 4X6RA 1UU8A 3VBYA 3BYSA 4W8DA 5IZFA 3QQLA 5EYKA 3KMUA 3OT8A 4RA4A 3AKKA 3EZRA 4HGEA 5CEKA 4DEHA 3NNUA 2C5OA 3EQCA 4BCPA 4BICA 3BU3A 4JR7A 3NAXA 2PWLA 3QQGA 5JZNA 2W96B 3COKA 1DAWA 5JFSA 4FV9A 5TOZA 1Q3WA 2CLQA 3QWJA 5AA8A 4W9XA 1TKIA 3BU6A 3EB0A 1KOBA 1B38A 2R2PA 5FG8A 5C9CA 3VJNA 4BGGA 4DBNA 4AXAA 2YIQA 4F7SA 2VN9A 1WAKA 3FL5A 4ASZA 2IVVA 3QU0A 4CMUA 3RK5A 4I0SA 5CAVA 4FZAB 4C2WA 5IH4A 5F95A 2HWOA 1LP4A 3FHIA 4WA9A 2O5KA 1PMVA 5JRSA 2CCIA 5K4IA 4TWCA 4O1OA 5HO8A 4FL1A 4QMLA 2VO0A 5CU6A 4D1SA 2XARA 5J87A 5KNJA 3F2NA 3KGAA 4L53A 1I44A 1Q41A 3O7LB 2FH9A 3SDJA 5JH6A 4FTJA 2FSMX 4IAAA 4IEBA 4U97A 4AACA 5F94A 3QLFA 4L45A 3RP9A 4BKYA 2XH5A 3C7QA 3L9MA 3ORLA 3SG9A 5JEBA 3G0FA 1O6YA 3BRBA 2NRUA 2X8IA 3GFEA 4JAIA 2BZJA 2Z2WA 5K3YA 5D9HA 3V6SA 4YO4A 4G6LA 3FC2A 3VULA 2PE1A 2XALA 2VX1A 3DNEA 2IVTA 1EH4A 3U54A 3QRKA 4QQJA 2BRHA 4E6AA 5CI7A 3R9HA 3TZMA 2UZVA 1JSTA 2G1TA 3GU7A 2CKQA 3QTZA 4AXFA 3ZBFA 4FEWA 3I7BA 4FZFB 3KN5A 3LCKA 3I6UA 3FZSA 3LFQA 2PMOX 1AD5A 5I9UA 4R8QA 4CRSA 4PV0A 4FNWA 4ZLZA 5BPYA 3SX9A 1A48A 4O0UA 3FXZA 2YACA 4AG8A 4FKTA 5HX8A 3U55A 2BFYA 3FSKA 4RX7A 3V04A 1ZYSA 3RVGA 1LEZA 4G9RA 4AOTA 5K9IA 3TUCA 3TEIA 2GMXA 4GVJA 4F9AA 4Z7GA 4I6BA 3UE4A 2XJ2A 5E4HA 3O8UA 4GRBA 4ZY5A 4CFNA 4YHFA 3QZGA 4J8NA 1BKXA 3MN3A 3QX4A 5CVFA 5AP3A 3RHKA 3L1SA 2JKOA 3KU2A 4GFMA 4M13A 4IX3A 4U79A 4WG3A 2XK6A 4GMYA 4PMMA 2Q0BA 4Y95A 4R77A 3Q9XA 3ZEWA 4ZLOA 2XIXA 3VW8A 2C30A 2E9OA 4G1WA 5IQBA 4DAWA 3G0EA 4GFOA 4AGWA 3KF7A 4XUFA 3UIXA 4YTFA 4O7RA 4DEEA 3OXTA 3PWYA 2X6EA 2GHLA 3AMBA 3Q4CA 4OTGA 3TJCA 4O7TA 4FL3A 2XCKA 2VD5A 4KS7A 5HLPA 3TDVA 3PXFA 1XJDA 4IZYA 4O2ZA 2IZRA 3JY0A 3IQ7A 3VAPA 3RPOA 3JUHA 3NSZA 4UZHA 5LVLA 5EQEA 3W0SA 4G16A 4E93A 4JRVA 4TWPA 4U3YA 4LRMA 2UW9A 2VO3A 5A3XA 4Y83A 3VQHA 4LOQA 4G3FA 3KRLA 4ITIA 4O1PA 4NCTC 2WFYA 3VW6A 5C01A 3SXSA 2XRUA 4R5YA 3TNWA 3OCTA 5H2UA 1ZAOA 3UBDA 3RINA 5E9EA 3R7VA 3QD4A 4JQEA 5KMNA 3BHVA 5CZIA 2XKFA 1NA7A 1KE7A 3CY2A 4X2GA 4CZTA 2VTAA 3DQWA 4NM5A 5FXQA 4DH3A 3RZFA 4ORKA 2BFXA 1CMKE 3II5A 3F66A 4AT3A 4RVTA 3QD3A 3TTIA 4OT6A 2HZ4A 2I0YA 4TYHA 4I94A 1X8BA 4JBPA 2F9GA 3I5ZA 3MB6A 4FK6A 4E4NA 2ZM3A 3NUYA 4P5QA 3Q2MA 4AN9A 4QRCA 3WARA 4ERKA 4FKQA 3Q04A 5EM8A 5B2KA 2ZMCA 3Q6UA 4IAKA 3UDBA 3UNZA 4Y5QA 5EDPA 5KCVA 4QDVA 5L2TA 4XP2A 4EONA 4YTHA 3NYNA 5K4JA 2JBPA 4DGNA 3W0OA 4ZMFA 1BX6A 4PNKA 4KBKA 4N0SA 2IW6A 4PDYA 3HGKA 4CKRA 4C58A 2XM8A 5CEMA 3FPMA 3UC3A 2XBAA 1QPDA 4HZRA 2IN6A 3Q9ZA 4JG6A 5AADA 2JBOA 1YI4A 5IUIA 3O51A 3PYYA 3I1AA 4QYYA 1ZARA 4MXCA 2WELA 2VWXA 3CJGA 5HBHA 5BYZA 4FEVA 2QG5A 1GJOA 4X3JA 5CT7A 3VUDA 4WUAA 3JVRA 3DQXA 4UB7A 2VUWA 3ZUTA 2X7FA 3IGOA 3EQRA 4XP3A 3DKFA 4IX6A 2RFNA 4JLCA 3QXOA 2G2IA 3DU8A 2QOOA 4UWYA 4FRFA 3E8EA 4GT5A 4I92A 1YHSA 3DLZA 3BLQA 3L8XA 2CN5A 3EQHA 4JIAA 2ETKA 4GU6A 4MKCA 2WMWA 1O6KA 1ZY4A 4O6EA 4A9TA 2ACXA 5M07A 3FLSA 3HAMA 4X3FC 1T45A 5C03A 3B2TA 3G6GA 1JNKA 4QMQA 3F6XA 4YPDA 3PRFA 3TDWA 4W4WA 5AR2A 3U51A 4CFWA 2CCHA 4C8BA 2XNGA 5CSVA 4II5A 4EK3A 4EWHA 3E8DA 4RFYA 3WZKA 3UVQA 4C2VA 4C59A 5CT0A 5M56A 1CM8A 3KRWA 4WIHA 5H8BA 4X2NA 3F9NA 3GU5A 3JXWA 4BC6A 5HU3A 3NWWA 1B39A 1GIJA 3T8OA 3A7IA 4J99A 3E87A 5CEOA 4DFNA 1KE6A 2QOHA 3NUSA 2EB2A 5C8KA 3N4UA 2PVJA 1P4FA 1G5SA 4DTBA 5HE1A 3IOPA 3RM7A 4I5HA 4R5SA 4XRJA 3PJ2A 2PUPA 2HZ0A 1VZOA 3QF9A 1ZOEA 5A14A 4J98A 4FTLA 4MQ1A 1H1QA 4DDGA 3QA0A 4L42A 3TACA 3HAVA 2P3GX 4E73A 2WMVA 3KXGA 2X6DA 3MPAA 5AM6A 4DH8A 3SQQA 4LYNA 4XV3A 1Y8YA 2OGVA 4JXFA 4S30A 3A2CA 3PZHA 2PZIA 1XR1A 4ONAA 4OUCA 5HG9A 4R1VA 3SOAA 4QMYA 1H0VA 3RWQA 3OBGA 3C5IA 2QOFA 2BHHA 1J1BA 2E9NA 2GNIA 2X9EA 3E64A 3G6HA 1PF8A 2XYNA 3KCFA 1O6LA 3OHTA 1R0PA 5EI8A 5AUWA 3TIZA 5AAFA 3R21A 3NGAA 3T3UA 5M4CA 3ZXTA 5M44A 5A46A 5BUIA 1U4DA 3VF9A 4NL0A 3QUPA 2ZFYA 4ZXTA 5IUHA 2QCSA 4FKUA 2JGZA 4YJSA 4G3GA 3D7TB 4RSSA 4UZDA 4AGCA 2Y8OA 3MESA 4CLIA 3V8SA 3JS2A 2FYSA 2WEVA 1YOLA 3OZ6A 4FK3A 5AX3A 4OTQA 2V0DA 1PXJA 4FTQA 4ACCA 1MUOA 4HCVA 3C4ZA 3UDZA 2OF2A 5L8JA 4XG8A 2B54A 5ANGA 5HVKA 2PZYA 2WEIA 3UMWA 1SNUA 4FKPA 4NK9A 4C34A 4FV2A 4EH7A 4AXDA 3CTQA 4RLKA 4O4DA 4O0VA 3HRFA 5HD4A 1XO2B 2C5XA 3IG7A 5J7HA 4EOQA 5CSHA 4RLLA 1VJYA 4I0TA 1LPUA 4O96A 1V0PA 4IH8A 2JDTA 2C0OA 4MXXA 1W2FA 4TYEA 4C4HA 4XLIA 1OL2A 4IVDA 2ITWA 1PXLA 4J52A 4L8MA 3W1FA 5JGAA 3UPXA 2IPXA 1A06A 1U54A 2V5QA 3MH3A 3P1AA 4Y73A 3KB7A 3W0NA 5HD7A 3FMLA 5I9ZA 3UO6A 2WTKC 3VBVA 2J5EA 4BF2A 3ZM4A 3NUNA 3KVWA 4EH4A 3LVPA 4JG7A 4HVHA 3DXQA 2XEYA 3W2QA 4BRXA 1OI9A 2R3JA 3GP0A 3NNXA 3QQUA 4RG0A 4S32A 3T3VA 4BCFA 3DKGA 3I6WA 1G8AA 2PUIA 3UGCA 4EH3A 5A4QA 5BMSA 5E8YA 3QTXA 5AR3A 4RVKA 3FI2A 3G15A 3QTQA 4FSWA 2R7IA 3DB6A 4D5HA 4K0YA 5I9XA 3O5AA 4IB1A 3Q4ZA 4L68A 1J3HA 2Y7JA 4YJRA 2J0LA 5FDXA 3ATSA 3F2RA 3Q4UA 4BI0A 3IECA 3PP0A 4QP6A 4PX6A 5D10A 4DLJA 4PDOA 4M67A 2FSTX 4WG4A 5EHOA 2VTJA 3U8WA 1UKHA 4R7IA 3V5QA 2XA4A 2XNBA 3OEFX 3AT3A 3ORZA 5ANJA 3TV7A 1Z57A 3JY9A 4BCOA 5BVOA 5KMJA 3BHTA 3FI4A 2A0CX 4BY9E 3ELJA 5CX9A 5FRIA 1Q8TA 3VWAA 3EKKA 4AU8A 1G8KA 5HO6A 1OPKA 4KS8A 4XV1A 5F20A 1GZOA 3PXQA 3D7ZA 3WE4A 2XK3A 4BDAA 4EZ7A 5M53A 4ZK5A 3SW4A 3V5TA 3HA8A 3WYXA 4DHIB 5EHYA 2ZM4A 4MD9E 4GK3A 4IWDA 4BI2A 4F9WA 3REPA 2AC5A 3DS6A 4TN6A 4YJOA 3I60A 3ZLSA 1ZOHA 3MWUA 4O21A 3HL7A 1WZYA 3O17A 4IIRA 4JAJA 3D5UA 2ITXA 2QVSE 3KULB 1R78A 3ZO3A 4IVBA 2WNTA 1NT2A 3FQHA 2B7AA 4U7ZA 2FA2A 2E2BA 4BYJA 2UZTA 3D94A 3W33A 5FTGA 4G6NA 4W8EA 3H10A 4FTIA 5FBOA 4F7JA 3H9OA 3ZC6A 4CFUA 4ZSGA 1GIIA 4ZJIA 4DEIA 5I5ZA 3KA0A 3GBZA 4YSMA 2ITPA 2ZV2A 3R7YA 4BIEA 4BZDA 1F5QA 3OUKA 4XEYA 2EXEA 4YJPA 2UZDA 5HEZA 4EL9A 2CN8A 5ACKA 4P4CA 3U6JA 3LIJA 4FA2A 5JRQA 3QALE 4IBMA 4DGLC 4BDBA 4NJDA 3ACJA 5IA2A 4AAAA 4WOVA 3EN7A 2Z7SA 5HG5A 2E9UA 3NVKI 4X7QA 2FUMA 4QQTA 2HW7A 5AIKA 2QR7A 5HICA 4ARKA 5J5TA 4BCIA 2C1AA 2QODA 1K3AA 4S2ZA 3HKOA 5DT0A 3AKLA 4PPBA 2P33A 2WIPA 2QQ7A 3SXRA 3R9NA 4DG3E 3VUHA 4QMZA 3D5XA 4IADA 2EB3A 3MH0A 3I79A 2XNPA 4Z16A 3VBTA 5KE0A 4QPMA 2YM6A 2CGVA 4HCTA 3TZ7A 3NUAA 4CYIA 4KKGA 4C57A 4HJOA 5CF5A 4L7FA 2QURA 3BWJA 2GS6A 2RGPA 3PG3A 4D1ZA 1Y57A 4DFZE 1QPJA 3DTCA 5HO7A 5IEYA 4FVQA 5DG5A 3ZCLA 4A4OA 4EWQA 4RX8A 2C0TA 5KMLA 5DPVA 3P78A 4GUBA 4RJ7A 3NNWA 3PFQA 4TYGA 2G2HA 4RQKA 4MF0A 4DE4A 4AF3A 4E5AX 4F1OA 3JPVA 3GCUA 1YXTA 4AZVA 5FDPA 4FZ6A 3P5JC 4N70A 4FZDB 3UOLA 4A9RA 3PZEA 1AQ1A 2PZ5A 4FVRA 1SVEA 2O0UA 2QU6A 2YLFA 3E7OA 4I22A 4UYNA 3VO3A 3WIGA 4KINA 3VS1A 3T9IA 1KE5A 4IAYA 4BWXA 4AZFA 4JVGA 4EOOA 4FGRA 4KB8A 1NVRA 4YJNA 4D2SA 3NW5A 1JLUE 3CLYA 4ALVA 5B0XA 4CFFA 4DGOA 1PRYA 3NFGB 2QOQA 4NTTA 3E8CA 3FKOA 1FGIA 2C68A 3D5WA 5IPJA 1K2PA 3VRYA 4AOJA 4E8AA 1JVPP 3PA4A 4JL9A 4R78A 4QMOA 5LMAA 3ZFMA 3W0MA 2BROA 3I4BA 3AMYA 4F4PA 5BVNA 3EN9A 3MPMA 1U5QA 3GCQA 4E7WA 3OWPA 3VS6A 5HX6A 2KULA 4CMTA 4GKHA 2FSOX 3EIDA 5E91A 2YHVA 2E9PA 2IVSA 3ZUVA 2F7EE 3AOXA 5DR2A 3QRJA 4AN3A 4XBUA 3SOCA 3W55A 2I40A 4JQ8A 5IDNA 4QTDA 2ZVAA 4O84A 2PVRA 3C9WA 5K0XA 3UMXA 2PVFA 2UW7A 2WTJA 4RWIA 5AV3A 4WT6A 5E8SA 4ANLA 3EYGA 2BKKA 5IQIA 3QKMA 4KAOA 4AQCA 2ZDUA 3G33A 1IAJA 3BV3A 2C3JA 3SKCA 3VS2A 4OTPA 1ZXEA 5C8NA 5KX8A 4AWIA 2VWIA 4UV0A 4ENYA 1RW8A 5HI2A 4UMPA 1URWA 2ZMDA 2W5HA 3W2PA 3LFBA 4BGQA 3DKCA 4AW0A 2CGWA 5J79A 3QCSA 4CXAA 3F69A 3FBVA 4DH7A 4OTWA 5LVNA 3GC9A 1OVEA 2J90A 1E1XA 2YM5A 2JKMA 1UKIA 2VO6A 4F0FA 3LCOA 2WMAA 2ITQA 4ACMA 2DWBA 1H1WA 4U43A 4P5ZA 4QMSA 3HMIA 4ZJVA 1OBGA 3C4EA 2YWPA 3TIYA 3S2PA 5AP4A 3A99A 3CQUA 3COIA 2Y4PA 1BLXA 1IG1A 4FNZA 1IRKA 2YABA 4MAOA 3BLRA 5BV3A 3DZQA 4E5BA 4U6RA 3OG7A 4X3FB 2QOIA 4ITJA 2XIZA 4QP9A 3RAHA 5DIAA 3HMPA 2PHKA 2VTPA 3O50A 5KUPA 3BV2A 4F0GA 3AC2A 4H3BA 4LFIA 2J7TA 2FB8A 3H0YA 5F1ZA 5DH3A 2A1AB 3R83A 2CGUA 3GXLA 5AEPA 3O96A 4XMOA 2YAKA 5EDQA 2A19B 5AR8A 3AT2A 4C0TA 3PRIA 2QG7A 3EJ1A 3PVGA 3ZZEA 3NAYA 3Q32A 3CQWA 4MD8E 2XKCA 3K3JA 1SYKA 5I3OA 4MVFA 3KC3A 3JVSA 2PVMA 3LE6A 2BAKA 3SRVB 3QGWA 5AMNA 3S4QA 5IISA 3UDSA 4F78A 4RQVA 3BYMA 3E62A 4WSQA 3W0PA 4KSPA 4B99A 2UVXA 4U0IA 3PY3A 1M14A 4XRLA 3ZXZA 5IA0A 3L9NA 5JGBA 4NH1A 4GW8A 5IDPA 1REJA 1I09A 2C0IA 2O64A 1Q4LA 2YEXA 4NJ3A 2QNJA 3RKBA 2H9VA 4RX5A 1GZNA 1OM1A 2EUFB 4EOJA 5DYJA 3GC8A 4Q5EA 4F7LA 4XOYA 4L44A 4RIYA 4GK4A 4ZTQA 2VWBA 5DRBA 3QLGA 3PVBA 3LHJA 4YGAA 3HVCA 5L2IA 5L6OA 3RMFA 5BYYA 5KMIA 4KWPA 2UZEA 1A9UA 1YWVA 4KIOA 2ESMA 4S33A 3BCEA 4N4SA 4GT3A 3LFSA 4ZSLA 3KFAA 3RWPA 3F5PA 1ND4A 2C6TA 3HV5A 3RAKA 1P4OA 4PMTA 5GNKA 3QKLA 3EQGA 4L3LA 3PE1A 5L3AA 2C6LA 3W0RA 3RPRA 3A4OX 3TMOA 2BAQA 2PZPA 3AGLA 5AP5A 2O8YA 4ZTRA 2VTHA 3LKMA 3FMKA 4W4XA 4E4LA 3DY7A 2ZJWA 4BCNA 3EN6A 2UZOA 4NUSA 4EH9A 5LMKA 4BJJB 2XB7A 5E8TA 1OKYA 3IGGA 4HYIA 3RPYA 5LQFA 3FAAA 4I93A 3NVMB 5AUTA 3DGKA 4D28A 4XCUA 3SV0A 4AUAA 1QPCA 4DFYA 5CXHA 2XJ0A 3PA3A 2UZWE 2YFXA 4P7EA 2HW6A 2YA9A 3C5UA 1KV2A 3ULZA 1S9JA 1Y91A 5ETIA 2IZUA 4CNHA 2ZV7A 1IR3A 4YPSA 3R7EA 4X2FA 4AAYA 1XBAA 2W7XA 2F57A 5IEXA 3AKJA 3D4QA 4DCAA