3P7BA

P38 inhibitor-bound
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
348
structure length
332
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Discovery of a novel class of non-ATP site DFG-out state p38 inhibitors utilizing computationally assisted virtual fragment-based drug design (vFBDD).
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 106
structure length 332
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3p7bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3p7bA01
2I1MA 2V22A 1ZZ2A 2GTMA 4WKQA 3DNDA 5L2IA 2OK1A 2A2AA 3D2IA 3RNYA 1UV5A 1Q8WA 4IHPA 5T6KA 3UYTA 5L2WA 3KK9A 3NSZA 1AQ1A 2XYNA 3P7CA 4USDA 2HW7A 4J98A 5F9EA 2UZWE 4JT3A 3GXLA 4IXPA 3RALA 3OC1A 3TJCA 4ZSJA 1F5QA 2C3LA 2QOLA 5AUXA 3GGFA 3COHA 4FTRA 4K1BA 4AW2A 3F7ZA 2ITTA 3OXTA 4YJUA 5CF8A 4USEA 2R3QA 4P7EA 4APCA 5T3QA 2ZB0A 4IADA 3TNWA 4CG8A 4KBAA 4ASZA 4BCOA 3ATTA 4FE2A 3IONA 4DINA 2Y4IB 5LWMA 4IZAA 3LXLA 3FLYA 3CD8A 4PPBA 5HOAA 4XX9A 3W2QA 4K6ZA 3QLFA 4FEQA 1JSUA 4PQNA 4IVAA 4Q5HA 5K5XA 1Y8GA 2IVUA 2W7XA 1OKVA 5IU2A 4L45A 2GQRA 2PMNX 2IZSA 3QFVA 4KSPA 4M3QA 4Y85A 5CSXA 5HKMA 2XIZA 3PXFA 4YLKA 3ZLXA 2XK9A 4Z16A 3DXPA 1YOLA 4AXAA 4DLJA 4FOCA 4NKAA 5M4CA 2V7AA 3MB6A 5HCYA 4JX7A 5ETCA 2HWOA 3V5WA 5FG8A 4EH7A 4CFFA 2WTVA 2EB2A 5HG5A 2OF2A 5G1XA 3VQUA 4UWYA 2C5OA 3VW8A 5BYYA 4HGEA 3TT0A 3BLRA 3TIZA 4IAZA 2WKMA 2YFXA 1H4LA 3LOKA 4RFZA 1M7QA 2DS1A 4HJOA 5HU9A 4CQGA 3R2YA 2PE1A 2W9FB 3BKBA 3QTWA 1OPLA 4FKUA 3RM7A 4K77A 3NW6A 2X0GA 4AACA 2QKRA 3R6XA 2O2UA 2XK3A 3PRIA 2P55A 2X1NA 5AX9A 3KXMA 3CP9A 4IWOA 4AA4A 4F1TA 3A7FA 2PU8A 4FKVA 1W0XC 5D10A 1QMZA 3CTJA 3DKFA 3M11A 4MNFA 5DR6A 2QURA 3CE3A 5KX8A 2ONLC 2JKMA 2QHNA 4TWPA 4F9AA 3V5JA 4MXCA 1XJDA 3D5VA 3HEGA 2WQEA 2OU7A 3UC4A 4FV7A 4UZHA 4PMTA 4O84A 3Q32A 3W2RA 1G5SA 4WUAA 5C26A 2UZTA 3UO4A 3BV2A 2H8HA 4FNZA 4D55A 4CVAA 3KULB 3I6WA 3LCOA 3OT3A 2HZNA 4YLJA 4TN6A 4WSYA 4EQUA 3BHUA 3QX2A 3UTOA 1KOBA 5E8SA 3R02A 4GW8A 2J2IB 3B8RA 1H1RA 4QMOA 4ACMA 2R3FA 4BBMA 2J4ZA 3F2AA 5LVOA 3NRMA 4RIXB 4C58A 3NDMA 2HIWA 4MXAA 3N51A 4JR7A 4G3DA 4NU1A 3PJCA 5E8YA 2YAAA 4E4MA 3RAHA 3R2BA 5TE0A 1XWSA 1URWA 2OH4A 3BYOA 5CU4A 3HLLA 3JVSA 4B6LA 3BHTA 3OS3A 1XH6A 2YJRA 3T9TA 4TYIA 3CQEA 4GYGA 5EW3A 3I81A 3DDPA 1YWNA 3LCDA 4M13A 2YM7A 3FYKX 3W8QA 3E8CA 4IE9A 3R28A 4AOJA 1PRYA 1GZOA 2UZUE 4JRVA 3ZLYA 5GINE 1JNKA 4ID7A 4F0FA 2C1AA 4UMTA 5EFQA 4QMLA 4EH5A 3FAAA 3NYNA 2XNEA 3G9LX 5E1SA 3UIUA 2WQNA 4O22A 3VS3A 3WARA 3WF5A 4W9XA 2UW6A 3P86A 5LCJA 2J0IA 3P5KA 3RAWA 2ITZA 4I0SA 3AC3A 3PLSA 5FQDC 4DH3A 3AD6A 4D4RA 2GS2A 1Q3WA 1O6YA 4MAOA 5EM7A 4AQCA 3O71A 3C5IA 4RC4A 4FKGA 4MK0A 4YHFA 3ALNA 4DEEA 2B9IA 2R3LA 4F7JA 3ANQA 1GOLA 3VN9A 4FKIA 3ZS5A 2X6EA 2G9XA 2QOBA 2ZYBA 2PSQA 4PV0A 5L8JA 1TQIA 4IANA 4C4EA 1WVXA 3ZMMA 4YTFA 4G17A 3H30A 2V7OA 4JBOA 4BI1A 2IZTA 4IWDA 1YXVA 5CEOA 5J9LA 4U7ZA 2PVJA 4ANQA 1Q61A 3OCBA 2F9GA 1JLUE 4R7BA 5D41A 4RZWA 1OL7A 2GPHA 4ZSGA 4FZFB 4ZS4A 4X3FA 1Q24A 1PYXA 4YMJA 3CLYA 5CLPA 5AUWA 2ITOA 3CPBA 2QG7A 4FSWA 4EHVA 3QRTA 2ZDUA 5GJDA 4BCGA 5K3YA 3KRJA 4JIAA 3SG8A 5IA3A 4W8DA 4QTBA 4TTHB 1A9UA 2R3GA 4FIFA 3CSVA 3NYXA 3QA0A 4L7SA 5I4NA 5IUIA 1XQZA 4G1WA 2CGWA 2QOCA 3PIZA 2Z2WA 3CCNA 2W1EA 3UIMA 3I7BA 3BWJA 3FQHA 3Q4TA 4AZEA 5HIEA 3QZHA 4A7CA 4C36A 5FRIA 1Q8TA 5A14A 2Y9QA 3UZRA 3UIXA 3TKHA 5GIPE 5HX6A 2C0TA 4BRXA 4ITJA 4KKHA 5J7HA 2C68A 3BU6A 4EHEA 5AFVA 2YIXA 2DWBA 4RX8A 1MP8A 2UZLA 4YHTA 4CKIA 3UP7A 5A9UA 4DBNA 3NNXA 4B9DA 5C1QB 2A27A 3VJOA 3M42A 2JAVA 5EI8A 2QOHA 5JSMA 2XRWA 1HOWA 1ZYJA 3ZBFA 1CM8A 2ITPA 3DGKA 3R73A 2B9HA 4OT6A 4E26A 3Q6UA 3PZEA 4FF8A 3RHKA 5LWNA 4ZMEA 3QRIA 4I0TA 5CI7A 5AV1A 4EOOA 1PMEA 1W84A 3VUIA 3PA5A 3AGLA 3E3BX 3H0ZA 5J9YA 1ZWSA 2GS7A 3IPHA 3EKNA 4TRLA 1GY3A 2PVNA 3VBXA 4EJNA 2ZVAA 2OI4X 3MH3A 2VGPA 4ITHA 4KIQA 2BRHA 4IIRA 3SXSA 4H3BA 3FUPA 4FTUA 2W1GA 5LARA 3R8ZA 4AW0A 3LKMA 4UY9A 2ITQA 3KVXA 3KA0A 2JDSA 3OY1A 3KF7A 4QNAA 3ZDIA 4JVGA 5ANOA 2ITXA 4EHGA 3FMLA 3P78A 3FXZA 3CY3A 3NR9A 4FICA 3QD4A 5IQEA 4FMQA 5HCXA 3FY0A 4FIIA 4OTHA 3OEZA 3KY2A 3NYOA 4DFNA 4O6LA 5DR2A 4AZFA 4HVIA 1W83A 4DH8A 4GL9A 4TKSA 1FOTA 2BAKA 5B7VA 1H8FA 2OBJA 4E5WA 1NA7A 2YN8A 3IGOA 3FHIA 4GG5A 4GJ3A 4DG0E 3DBDA 2DQ7X 3BEGA 2NRUA 5FTGA 3ZFYA 2HOGA 1OM1A 2XZSA 3V5PA 4F99A 5IPJA 3ZONA 2QO7A 4YR8A 1OL1A 4OTFA 3K5VA 1NVQA 5KE0A 3SQQA 3DA6A 4LRKA 3S2PA 4XCUA 3ZXZA 3RCJA 2CLQA 2VTJA 4F70A 4LL0A 5HHWA 4BWXA 4JNWA 3UOLA 4U80A 2YITA 2YM4A 3ETAA 4GV1A 5HVJA 5C8MA 4BDIA 1EH4A 1OVEA 4FL1A 3DTCA 2WQBA 2NRYA 1M7NA 3QXOA 4D2TA 4DF3A 2VWZA 1K3AA 4FA2A 1JSVA 2QHMA 1WVYA 4FIEA 4EK4A 2XK4A 1KOAA 2XRUA 1TQPA 2R2PA 4LI5A 2EUFB 3LXKA 2HY0A 1KUTA 4Q2AA 3O7LD 4AN2A 5CSPA 4JQEA 4L3PA 2VU3A 4MX9A 1MUOA 4RT7A 5KZ0A 4DEGA 2QOOA 2PL0A 1OB3A 3VUGA 4O82A 3CTQA 4I20A 4MBIA 2IVSA 2WOUA 1W8CA 2VTLA 4ZY6A 4TL0A 4EK5A 4EH3A 5L6WL 4BDBA 4GMYA 1MQ4A 3F66A 3TN8A 4LL5A 4OTGA 3AD4A 2VWXA 4HGTA 4BTMA 5J87A 3U54A 4Y8DA 4WOVA 3VQHA 1ZLTA 4BL1A 4UYAA 4S32A 4E1ZA 4J52A 3SX9A 4CCBA 3GP0A 4ANBA 4UXLA 4QP6A 4BWKA 4GIHA 2X9FA 4L52A 4WRSA 5AP5A 2PUPA 5E7RA 2R7BA 1XH4A 3QRUA 1YQJA 4F7NA 2JDVA 3R1NA 5CAPA 3E8NA 1J7UA 4O0RA 4FSZA 4RVKA 4XV3A 4YLLA 1MRYA 3FPQA 3MS9A 4K2RA 4BKZA 1BL6A 1G8SA 4DEAA 3D5WA 3IK3A 3QU0A 1Q8ZA 2UZDA 3FKOA 3SOCA 4AOTA 5M4IA 3AMYA 3KMUA 4U3ZA 4ORKA 3GENA 3ZU7A 3RPSA 3LLTA 4RJ5A 2F57A 1OL6A 4ONAA 3A8XA 4I41A 1UU3A 3QQJA 1JSTA 1YXTA 4IC7A 1GZNA 3C9WA 1BI7A 3FXWA 4Z3VA 2VAGA 2YCQA 4LUDA 1PXPA 3D9VA 2WMSA 4QQCA 3W32A 4KA3A 4EK6A 4BWPA 4I23A 5A6OA 4HYIA 3VS7A 1RJBA 1PXOA 2XNNA 4D1SA 4RFMA 1OIRA 2QODA 4XP3A 1JKTA 4JBQA 4EH4A 4RQKA 3DJ5A 3MY0A 3EQFA 2J90A 4IB3A 4O7ZA 2IVVA 4GCJA 4E5BA 4E4XA 5I9XA 3MBLA 1V0PA 3OWKA 4O2PA 2PHKA 2XK7A 2O8YA 2P2HA 2R3RA 4JAIA 3R7EA 4F4PA 2F4JA 1IA9A 3P7BA 4HGLA 3KMMA 3SD0A 3QYWA 2Z60A 2WGJA 4PTCA 3C0HA 4KB8A 4R3CA 4BCJA 1ZMVA 4B4LA 2FYSA 2OXYA 3CXWA 1CMKE 4GS6A 2I40A 4BCQA 4FV3A 5L2QA 3MJ2A 3OWPA 3E8EA 3Q9XA 4IX6A 1Y6AA 5L2SA 3EZRA 5C27A 2P3GX 2X39A 5AMNA 4EQMA 5IMXA 3ZLWA 2Z02A 5KZIA 1UNLA 3HMPA 2BTRA 5CI6A 5AAFA 4BB4A 3TNQB 3PRFA 4RVMA 2UW7A 4O2ZA 5DWRA 4U40A 3ZC5A 5HCZA 2VTQA 3LVPA 2OFUA 3OFMA 4YNEA 1AD5A 2R3OA 5ICPA 3GI3A 3DBQA 3EN4A 4Q9SA 4FV4A 4UBAA 4XEYA 5HI2A 4BTJA 3H0YA 1UU7A 3MIAA 3CY2A 3KN6A 4FTJA 4D5HA 4E93A 3FI8A 4MKCA 2OJJA 3NWWA 4FT5A 5JRSA 4D5KA 2GNFA 3D5UA 3NNVA 1JBPE 2QD9A 3E63A 4M8TA 4P5QA 4WIHA 4A9YA 3PWYA 4CQEA 2XM8A 3JVRA 1A48A 4FTIA 1JKSA 1H08A 5AP4A 2F7XE 4EZ3A 3KULA 4O0VA 2WAJA 4D2RA 5CEKA 2BDJA 3UQFA 4H3PA 4J8MA 3E93A 4L6QA 3PVUA 3TJDA 3UQCA 4O0UA 4O7VA 3ENMA 3EYGA 4KIKB 3V04A 2UZVA 3UC3A 3T3UA 4XOZA 3F5GA 3NPCA 3FC2A 4RIXA 2BKZA 4LGDA 1H07A 2Q0BA 5EOLA 3WOWA 1IA8A 1ZAOA 4C35A 5K0XA 1UNGA 1ZY5A 1Q4LA 2H9VA 3I0OA 4WD5A 4H39A 5DRBA 5CALA 4FG7A 3RAKA 4U45A 4JJRA 3UOJA 1IASA 2E9PA 4XP0A 5AIRA 3TI1A 4OR5A 4A4OA 4M97A 3H9RA 4G6LA 5B2MA 5JZNA 2UVYA 3ZYAA 1H1PA 2BDFA 3RMFA 1NT2A 4FKSA 5E1EA 1VJYA 3RGFA 2BTSA 5CEIA 2C5NA 2J0KA 2E9VA 4K0YA 3Q2JA 3O23A 5CNOA 3COMA 4Z55A 3M2WA 1SMHA 3OG7A 5BVKA 4NIFB 2UV2A 1H0VA 4FBXA 4CKJA 4RJ4A 2GS6A 3NUUA 2J51A 3MA3A 3RINA 3PDTA 4PPAA 4PMSA 3IW4A 5LVLA 4RLKA 5I9YA 1H25A 2UZEA 4NJDA 1OITA 1OZ1A 2EU9A 5CF4A 4N70A 4DE4A 2ZV8A 1QPDA 4GYIA 2YWVA 4I6HA 4D2SA 5EKNA 5ETAA 3PPJA 3QHRA 5LQFA 2PPQA 3PLAE 5GJGA 2A4LA 2OZAB 3LXPA 4F6UA 5K4IA 4A9SA 4CG9A 3E62A 4JS8A 4XJ0A 4MHAA 4O7TA 3F7WA 4O0YA 4KRDA 4QP8A 5EYMA 5DRDA 3OEFX 4CYJA 2PVLA 3AD5A 5D12A 4F1MA 3BCEA 5A4QA 3A61A 5IQHA 1ZYDA 2XA4A 4QMXA 3FDNA 3PG3A 1XR1A 2X9EA 3SRVB 2WMTA 4R6VA 5BVWA 5K4JA 4Q5EA 2R9SA 4CRLA 4MBJA 3KK8A 4O91A 4V04A 2IJMA 1IEPA 4MXYA 3GEQA 5IZFA 3G90X 2GQSA 1AGWA 3QKKA 4M84A 5KMLA 2HENA 4QPAA 3WF8A 5IA4A 2PVRA 2PYWA 2R4BA 4L8MA 3VVHA 3Q4UA 4ALUA 1CSNA 1PXKA 3KVWA 1RW8A 1YWRA 2BHHA 4BDEA 1SYKA 3MPMA 5FDPA 4OTQA 4QYEA 4CT2A 2BPMA 4PDOA 1CDKA 4KS8A 5AEPA 3CPCA 2I0HA 3GU4A 5AA9A 2GFCA 2A19B 2WU7A 5AUYA 2BVAA 4QD6A 2X4FA 4O7NA 5KNJA 2F2CB 3HRBA 4XNEA 2C30A 1R1WA 2C4GA 4XG8A 2VX0A 4F0IA 4HNFA 1FMKA 3E87A 2ONLA 4YTHA 4FKJA 2WTDA 3A7IA 4QQJA 4RVTA 4ZSAA 4ENYA 1RQQA 5KMJA 4D9UA 4FODA 4M67A 5DBXA 4PX6A 3GC7A 4I5CA 3PXQA 3WYXA 3IW5A 4V05A 1PXLA 3BYVA 3FLNC 4DG2E 3ORPA 5K5NA 4W9WA 5FP6A 3T3VA 5H9BA 3GCQA 3DNEA 4AX8A 4CV8A 5CVHA 3EKKA 3F2RA 3NUSA 2WMBA 3BGQA 1DI9A 5IF1A 4UZDA 3ORNA 4XUFA 4AGUA 3UQGA 4P4CA 4FIHA 4FSUA 2PY3A 2VWYA 4QQ5A 2C6MA 1U4DA 3LFFA 4GFGA 3VJNA 3FZTA 3R1YA 5CNNA 4M14A 3VRYA 4JXFA 2JIIA 2BIKB 2OKRA 3FL4A 1YDTE 4JLCA 5DT4A 3TNIA 3R1QA 4I6FA 5M53A 3DY7A 5HLPA 2C47A 4FZDB 4D4SA 2OICA 2OXXA 4RJ8A 5TKDA 4O7LA 5E8XA 1QL6A 2O0UA 4L7FA 3ZRLA 3MH0A 3MVJA 3ALOA 2EVAA 2RG6A 3H3CA 4MD9E 4O0XA 3PY3A 4ZTSA 1Y91A 4II5A 1M14A 3RNIA 5JEBA 1YDRE 4HOKA 4GK3A 3VBVA 4D4VA 2QKWB 2FO0A 3LM5A 3GC9A 3QKLA 2WTCA 3P9JA 4F9BA 1M2QA 3EHAA 4L44A 3TZMA 4C0TA 2GQGA 4IZ7A 3VF8A 3SW4A 2W06A 3FI3A 1LPUA 3WZJA 2ZJWA 5HBJA 5HU3A 1YHSA 3DAKA 3ZEPA 5FDXA 4G3FA 3N4VA 3N9XA 3FZRA 3OZ6A 2XCHA 4FZ6A 3P79A 4AFEA 4Q9ZA 3DB6A 5HE3A 3FI2A 3PPZA 3PY0A 3MDYA 1BLXA 3W2SA 1SZMA 4O7RA 2VTHA 4YJNA 3F9NA 4BDAA 4RA4A 2ZDTA 1P5EA 2PVYA 3KXNA 3KXGA 4PPCA 5HBHA 4OT5A 4CCUA 3KREA 4I94A 2B1PA 1BL7A 4AW1A 5LVMA 5IMEA 4DH7A 3LIJA 4JAJA 4L01A 2VX3A 4MQ2A 3FV8A 4TY1A 3TKIA 5KMIA 3R7GA 3MIYA 3PA4A 4H1MA 3QZIA 1JQHA 3R1SA 4TYHB 1QCFA 2ERZE 2YM8A 4C02A 5J1WA 3G6HA 4GVAA 1H24A 4H05A 4AE9A 3ORIA 3W2PA 3BHYA 4IAFA 5HG9A 3NMUF 3ZCLA 1MQBA 3EIDA 4D0XA 2BAJA 3VC4A 3BLQA 3D4QA 3LXNA 2IN6A 3C4XA 2BRNA 3SLSA 4DGMA 3ORTA 3RPRA 4DFXE 3U9CA 3PY1A 4EI4A 3OUNB 3HMIA 5HIBA 1Y6BA 4YZBA 3QC4A 4BI0A 3LMIA 3EQPA 5AP3A 3LFQA 4XRJA 1H26A 5ANDA 3ZBXA 4DCEA 1JKLA 5EW9A 2ZMCA 3UO5A 2GNJA 2ETMA 3HV4A 3BQRA 2VTMA 5EYDA 3ITZA 1OPJA 4G34A 5BX0A 5LMKC 3NIZA 4RIYA 2OWBA 1V0OA 4QMYA 3KMWA 4A07A 4B0GA 4RJ7A 1CKPA 4N4SA 4YBJA 4D1XA 4DTKA 1DS5A 5M57A 4ZEGA 5FM3A 4U81A 1YXXA 4YTIA 3ZC6A 3MSSA 4HVHA 2VTRA 3DLSA 2GNGA 3TCPA 2YM5A 4CZUA 2R3HA 3LFSA 4DH1A 2BZIB 1V1KA 4IVBA 5M44A 1P4OA 1TKIA 4OTWA 4ITIA 3WE4A 3QTUA 1KV1A 4AF3A 2JFLA 2CPKE 4F9YA 3Q9ZA 2JIVA 2REIA 3FMMA 3I5NA 4L67A 4LOQA 2CKOA 2WQMA 2XIKA 2BHEA 5TR6A 4EL9A 1PKDA 3AT3A 2X7FA 4TXCA 3E7OA 5BUIA 3QTIA 5IQBA 4BICA 2PVKA 2PMOX 3LCSA 2W1CA 4R8QA 3HV5A 1PMNA 4BCFA 4KKGA 1E1VA 1OGUA 2JD5A 5E90A 5E8WA 3U4WA 3KRXA 5IH5A 5L8LA 2BMCA 2E2BA 4FVRA 1ERKA 3ULZA 3C4WA 4CT1A 3C13A 4FUXA 4KIOA 4ANSA 4CFMA 3V5TA 5KO1A 3PUPA 1FVVA 2PVHA 2RFNA 2RKUA 3QGYA 1K9AA 5CF6A 1P2AA 3EFWA 2VRXA 2P4IA 4OBOA 4L68A 3C5UA 2B53A 3ET7A 4NL0A 1J91A 2ZAZA 3W10A 4FSRA 1VEBA 4PMPA 3R21A 4YNOA 3RPVA 5AP1A 4IX5A 3VRZA 5M4FA 3JYAA 3V8WA 4YC6A 4M68A 1CKJA 4FTMA 4S33A 5HBEA 3BE9A 2PZYA 2P33A 4FG8A 3GCSA 1XH7A 4FVQA 4E73A 3E3PA 4R5YA 2HELA 3G0EA 2RFSA 4RX9A 5CENA 3BGZA 5HLWA 5EK7A 2G01A 2C1BA 5HIDA 4B99A 5AM6A 2OG8A 3HYHA 4QMQA 5BVNA 4I6BA 1UNHA 4KBCA 2V55A 5GIOE 2Y4PA 3OOGA 1B39A 1W82A 3R7OA 4FSNA 5EM8A 2PZRA 5D9HA 4QMNA 4C3RA 4IH8A 3G15A 5AADA 2H6DA 3TUBA 4D9TA 4RWIA 4C33A 1VYWA 4RSSA 1PKGA 2IWIA 3HUCA 3R8PA 5AV3A 5A54A 1LEWA 2LGCA 4EH6A 2UZBA 3F5XA 4F63A 3VAPA 3KXZA 5EHYA 3OMVA 4DEHA 3ZM9A 3F3WA 3QA8A 1CKIA 4BTFA 3EQIA 3LJ0A 4FK6A 4FKLA 4ZTHA 3ZZWA 4YZ9A 4ERWA 3Q9YA 4BCIA 4WNKA 4NTSA 1PXJA 3AG9A 1S9IA 4TYGA 3O17A 5I9UA 3NUNA 3AC2A 2I6LA 5FWKK 4XHKB 5J9ZA 5M08A 3LFEA 4XG3A 5AV0A 3ZO1A 1GIJA 1YHWA 2GFSA 2QQ7A 3A4PA 5CSVA 4BHNA 4CLJA 3GCUA 3WZEA 4AW5A 4HYSA 3FEGA 3GFWA 1XH9A 3QX4A 1APME 3OWLA 4GT5A 4IM3A 4ZJVA 3HGKA 3M1SA 4GK4A 1E9HA 3EQHA 3HDMA 4FEVA 1JPAA 1WAKA 2XH5A 4BHZA 4L3JA 3R01A 1RE8A 3MW1A 3U87A 2HYYA 3K54A 5TO8A 2CDZA 3Q4ZA 4C4JA 4RJ3A 5ANEA 2FA2A 5TT7A 3V5LA 5IA1A 3GCVA 4TYEA 1PF8A 4EOPA 4FL2A 4AOIA 3D94A 2VUWA 2J0LA 3EJ1A 4MBLA 3WI6A 1M52A 2BRBA 2YLEA 3E7VA 3EL7A 5HEZA 2YCRA 4ZY5A 4RWJA 2QR7A 4Z7GA 1WZYA 2XB7A 4W8EA 4ZMFA 4NZWB 3GCPA 5HGIA 3NNWA 4F08A 4ZZOA 5FTOA 4A9UA 4ZLYA 4BY9E 2PUIA 3BYMA 4C62A 3ATSA 5CEQA 3W55A 3KXXA 3BHVA 4KBKA 4AU8A 3LM0A 4C38A 1SVHA 1PMUA 5L6OA 3VHEA 3UOHA 3CIKA 2C0IA 4O0TA 3CQWA 3EN7A 1BI8A 4UB7A 3DK7A 4LUEA 3G0FA 5A4CA 4O7YA 3KCFA 3GC0A 3UJGA 2C5VA 2IW8A 3MTLA 1SM2A 3NAXA 5GZ9A 3PA3A 3BI6A 4EOLA 5IEYA 4XG4A 1QPEA 1YOJA 3IS5A 2XIRA 3FMDA 4IB1A 4Z9LA 1H1QA 3ZUUA 5DEYA 2OW3A 3D0EA 3ZO4A 4BDCA 5BYLA 1ZY4A 3R8VA 1L3RE 4CRSA 4BDKA 3IW7A 4DGGA 5ANKA 5HO6A 5M09A 3CTHA 5HO8A 3CJFA 2XK6A 4RJ6A 5KMKA 2GNLA 1J7IA 5K9IA 3HA8A 3WIKA 3ENHA 1R0EA 4I22A 3TV6A 3PVGA 3PSCA 4HVDA 3ZHPC 5ANIA 4QYYA 3RM6A 1U54B 4NTTA 4R3RA 1M2PA 2VWWA 5HTIA 4J96A 1M17A 3DAJA 5C01A 3CJGA 4GU9A 3HV3A 5IA0A 4MYGA 3V6RA 4S34A 2O3PA 3ROYA 4MVFA 5FEQA 4IEBA 2RGPA 3NW5A 3DZOA 2XVDA 4PP9A 1KWPA 1SVGA 3BU3A 3LHJA 4QP7A 5HG8A 2QR8A 4RPVA 4C8BA 4D4YA 5I5ZA 4L00A 5AWMA 5JRQA 3A99A 3T8OA 4M7IA 3V8TA 3NW7A 4F0GA 4YU2A 1UWJA 1X8BA 1O6LA 5AA8A 2RIOA 3QZFA 4EKKA 2WB8A 2ITWA 1Z5MA 4U6RA 4J7BA 5FEDA 2YDJA 3QQLA 3VBWA 5IQAA 3FYJX 3LAUA 4V0GA 4H58A 3PIYA 2X8EA 4LYNA 2FSTX 4CMTA 2PE2A 4PY1A 5H2UA 3I5ZA 5B2LA 2I0YA 2C6LA 3ZFMA 2H34A 3GC8A 3GUBA 3LQ8A 2W4JA 1SNUA 4XV2A 1FINA 3R8MA 5C4KA 3NLBA 3MESA 3GU7A 2RF9A 5E91A 2XNPA 5BVFA 3KU2A 3QXPA 2HWPA 2VNWA 4D28A 5H8EA 4DFBA 1MRUA 3V3VA 5HORA 1REJA 4UWBA 4ARKA 1W7HA 3FZOA 3TTIA 2AYPA 3F3ZA 4DGLC 1BYGA 3IG7A 3JY0A 4O6EA 2I7QA 3UZPA 2BROA 1SVEA 3SV0A 3EWHA 1J1BA 2X2MA 4E6AA 4C61A 3DXQA 3F3TA 4L43A 4ZK5A 5CS6A 4RRVA 4PUZA 4U0IA 3Q6WA 5CT7A 5J79A 2W5AA 1O6KA 5LOHA 3O7LB 2ETRA 4E6CA 2HY81 4MQ1A 5J8IA 3GU6A 5DA3A 1RDQE 5EDQA 3F5PA 4G9CA 4L53A 5G6VA 3ZEWA 4D2PA 3OW4A 4F9CA 2Y7JA 4FC0A 3O96A 5HVKA 4GSBA 1URCA 4IDVA 2ZM1A 3UYSA 3Q53A 3QWJA 4GT3A 4CTCA 2W0JA 3MVMA 3I60A 1BUHA 4X6RA 3L1SA 3BWFA 3UDBA 4BZDA 4E20A 4KAOA 2WNTA 2EXMA 5B0XA 3A7JA 4CMUA 1ZZLA 4JBPA 5GZ8A 3QQUA 3I79A 5KBRA 5AIKA 5CXZA 3OXIA 3D7TB 4QTCA 1ZOHA 1OKZA 2BAQA 4ZZMA 3Q9WA 1LUFA 3HMNA 2R3IA 4G31A 4LG4A 4QTAA 4QP1A 4S2ZA 4TYHA 4AZSA 5HO7A 2J0JA 3VS5A 5E9EA 4FV9A 3SDJA 3QQHA 4BKJA 4GEOA 3TL8A 3TDWA 2A1AB 4USFA 2QOIA 4KS7A 3TM0A 3CGFA 3U6HA 2PE0A 4I5MA 5JMSA 1O9UA 5ANJA 1YKRA 3PWDA 3VIDA 1Q5KA 5EG3A 5CAQA 3C51A 3A60A 3F61A 4CLIA 4IX3A 4MNEB 2IW9A 3VULA 5FBOA 4FVPA 2CN5A 2R3JA 2R3NA 3AC8A 3PP0A 2JBPA 3R9NA 4CMOA 1PXIA 1QPCA 2E9UA 3EFJA 5DFPA 4BCPA 4QMPA 2RG5A 3DCVA 2YABA 4FTOA 4U79A 3R7UA 3ZXTA 4R7IA 5BVDA 4FTAA 5CQWA 3LJ1A 1OL5A 3FLWA 2YM6A 3JPVA 2Z7LA 4YSMA 4Y72A 3MYGA 4DC2A 5IG1A 4FGRA 5K0KA 4BN1A 5J1VA 2GHLA 2PK9A 3VUTA 4G2FA 3NNUA 5EYCA 4BYJA 3BELA 3QCQA 3O50A 3E5AA 3WYYA 5IEXA 4WRGA 1HCKA 1IAJA 5HVYA 3UG2A 5JQ5A 1K2PA 3IDPA 3PTGA 3UBDA 3NUXA 1WBWA 2C69A 3A7HA 1R78A 3HL7A 3Q96A 3T9IA 5C4LA 3HA6A 4FV0A 4FGBA 3THBA 4LQMA 3G51A 1G3NA 3PJ8A 2C5XA 2B7AA 3FI4A 3FQSA 4C59A 1UKHA 3FMNA 4X3FC 3DBFA 3FC1X 2W05A 3QQKA 5T68A 3G5DA 2C6IA 4GUBA 5HNBA 1ZMWA 3F3VA 5JGBA 1U59A 3E88A 4AZWA 2ZOQA 4FEUA 2WXVA 3LPBA 4ZSEA 2UVZA 2PUNA 5JGDA 3VUDA 4FSYA 4LM5A 4WBBB 2WHBA 1WBNA 3D5XA 1TVOA 3PJ3A 1PXNA 3V6SA 3V8SA 3MVHA 4MD7E 4O81A 4LOOA 2JFMA 5EM5A 4O1OA 4IAYA 2UW3A 4X2KA 5AR3A 4X2FA 3W8LA 2HZIA 3BX5A 3OOMA 4B8MA 1ZOGA 2WQOA 4I5HA 4RMZA 3LCTA 4W4XA 1WFCA 2YEXA 3I1AA 4AG8A 4KINA 5M55A 2UUEA 2PZ5A 2UW0A 1FVTA 2V0DA 4E7WA 3FE3A 3IDCA 4O7WA 2HZ0A 3JUHA 4L46A 3EZVA 3RP9A 1L8TA 5DH3A 4C2VA 3EN6A 1Z57A 4RZVA 4XV1A 4TWNA 2XNOA 4U42A 4YURA 4JDKA 4FNWA 4XS2A 3RBWA 3A8WA 4NEUA 1WMKA 3S0OA 1YOMA 5DT3A 4IZYA 5FXSA 4A4LA 2HXLA 4OAUC 4QO9A 3ACJA 4G6OA 4HZRA 4K11A 4RIWB 5FXQA 3UG1A 4D2VA 3O8UA 4KKEA 3ZFXA 1OPKA 2QO9A 2XNBA 5IEVA 2OLCA 3UVQA 4NH1A 3IOKA 2GHMA 3U4UA 4F7SA 3IO7A 2XKDA 4DFLA 5FM2A 3EN5A 4UN0C 3IECA 2XNMA 3FL5A 4FI1A 4AGWA 2WD1A 3GU8A 3MJ1A 4A4XA 4DBXA 4Z7HA 2X4ZA 3UPZA 1NY3A 3VUHA 3GOPA 3FKNA 4FSMA 4LRJA 1OMWA 3Q52A 5AR4A 4E6DA 2WIPA 3EN9A 5DE2A 4EJ7A 1JAMA 4BIDA 2QO2A 1Q99A 4FIGA 5HZNA 2QVSE 4LMUA 4NFNA 5FD2A 2R3KA 5HLNA 3O8PA 1Y8YA 3FMKA 4IM2A 3BE2A 4BZOA 3GOKA 2WELA 1KE7A 3WF7A 3OCSA 4QYHA 3N4TA 2XF0A 4U41A 4FKOA 4IAKA 2O5KA 2O64A 4IX4A 4RGJA 2G2IA 5CU6A 2J0MB 3MB7A 5ACKA 3K3JA 3UVPA 5LVPA 4HGSA 1ZMUA 3ZO2A 2FSLX 4QRCA 5IH4A 4Y5QA 3L8VA 3RK7A 3RWQA 3KRWA 3F69A 4P2KA 2NO3A 4EOIA 5LMKA 4N6ZA 5HG7A 4KIPA 3HZTA 4FZAB 1PMVA 2RSVA 2PUUA 2C5YA 4EBWA 4XH6A 4ZTLA 1YVJA 3MY5A 1U5RA 4NT4A 4YJTA 5C8NA 3BGPA 3QHWA 3BEAA 2QNJA 3QTXA 3EQBA 4RA5A 5CEPA 3ORKA 5IISA 4I6QA 1QPJA 4MXOA 3I4BA 4FEWA 1ND4A 2KTYA 2YZAA 1YI6A 2XIYA 2PZPA 1GJOA 1Q41A 3ORMA 3FWQA 3QGWA 4IACA 5EHOA 4RVLA 4A9TA 4XP2A 5J7BA 1BKXA 3H10A 1PJKA 3MWUA 4UX9A 4QPSA 5DLSA 2VZ6A 5EDPA 4C4IA 4R1VA 4EBVA 3QQFA 4X3FB 2YIRA 3RHXA 1YXSA 3PPKA 3ORXA 3E92A 4G5PA 3L9NA 4U5JA 4D0WA 3PVBA 4JDJA 3OCGA 3NGAA 1H27A 4ZTMA 3FHRA 3PJ1A 2W4KA 1XHAA 4FYOA 2WMQA 4FNXA 1KE9A 4AT4A 4BCNA 2ESMA 1Q8UA 2XIXA 5DR9A 3N4UA 4EOQA 2A0CX 1H0WA 4ZP5A 3GFEA 4E8AA 4EHZA 5HNGA 2OGVA 2ITUA 3SAYA 5D11A 1S9JA 5CU3A 3IW6A 2FSOX 3TKUA 1XBBA 4TWCA 3RKBA 4EK3A 2XBAA 4EK8A 2OH0E 5CZIA 4IQ6A 4J1RA 3RZBA 2YACA 2YIWA 3PSDA 4YZDA 1KV2A 2ZV7A 1Q8YA 1JKKA 3A62A 3KFAA 2VTSA 3B8QA 4CD0A 5DMZA 4DTAA 4UWCA 4AT3A 3C0GA 3K2LA 3MN3A 2JKQA 5E8ZA 3BYSA 1E1XA 3ZDUA 4I24A 5A4TA 4J99A 4YZNA 4ZTQA 4OTRA 4MF1A 2XNGA 4AA0A 3KF4A 2I0EA 5IDPA 4Y46A 4BTKA 3RK5A 1YW2A 4CEGA 5JFSA 3FLSA 2XMYA 3TNPC 4E5AX 4O0WA 4ZXTA 3LMGA 4PWNA 4OBQA 2WMUA 2WTWA 2CCIA 4E6QA 4FYNA 2R5TA 2QLUA 4WT6A 2EB3A 3SC1A 4BI2A 2CNQA 3KRRA 4ASEA 4U9AA 4XG2A 4NUSA 5EOBA 3LCKA 4ZJIA 3ZUTA 3PSBA 4W4WA 2WMWA 2CN8A 4YP8A 3DS6A 4CZYB 4LGGA 3F6XA 3O0GA 3MH2A 3WE8A 2WO6A 4YPSA 4CXAA 3JY9A 2C6DA 3KXHA 1U5QA 4GU6A 4AZTA 4XG7A 3QUPA 3NVMB 3LFBA 3FPMA 3EL8A 4HPTE 3TWJA 1T46A 1FGIA 5EQPA 3EQCA 3U55A 3U6IA 4EZ7A 3PIXA 5AUVA 2QU6A 4IDTA 3UVRA 3QCSA 3KKVA 4EYMA 3COKA 2J6MA 3EYHA 4N6YA 3UOKA 5DYJA 3HRFA 4G3EA 3TIYA 4C7TA 2FVDA 1WBSA 3II5A 4ANMA 3RCDA 2W1FA 4FTTA 3IGGA 3K5UA 3QLGA 1ZRZA 3NUYA 3HP5A 1FGKA 4R7HA 2YM3A 4ALVA 5AV4A 4DCAA 2SRCA 3DBCA 4R1YA 1UU9A 3A2CA 2GMXA 5EW8A 4JDHA 2X7GA 2HAKA 4CFWA 3KN5A 3P0MA 4HCTA 4ZOGA 1YI4A 4X2JA 5JK3A 4YC8A 4GFMA 2QU5A 3FZSA 5DOSA 4NK9A 3ZSHA 3MGYA 3KQ7A 3QZGA 5FP5A 4DEBA 2ZMDA 4ZJJA 2OJIA 3PE1A 3RJCA 3TACA 5IH6A 3NZ0A 5BYZA 3GVUA 4MD8E 5IQDA 2IZRA 2RL5A 1OIUA 3R00A 3C4ZA 4TZRA 3DTWA 2ITYA 2C3IB 2XKFA 4AUAA 2GCDA 4G5JA 3RVGA 4QMUA 2Y8OA 4FV1A 4HYUA 4BDGA 2YCSA 5JQ8A 3SVVA 2OZOA 3DQWA 3UNJA 3AT4A 4UMUA 1GZKA 3VUKA 4BF2A 1UKIA 4PRJA 4UEUA 5FLFA 2CNVA 4I92A 4J95A 3D7TA 3FMJA 4GJ2A 2VX1A 4QMWA 4J97A 5JT2A 4DA5A 4UALA 2HW6A 2YHVA 4DTBA 4KNBA 5A3XA 3DJ7A 5DPVA 1YRPA 2I0VA 4O27B 3RPOA 4D1ZA 5CF5A 4I4FA 3SW7A 3MVLA 3TDVA 4CGAA 1Z9XA 4YJQA 3F3UA 4LFIA 3NEWA 4UYNA 3OVVA 4QMTA 2C6KA 4ACDA 4F65A 1J1CA 2GDOA 2B4SB 5KHWA 5JFWA 2F7ZE 3PXZA 3F88A 4FEXA 3I6UA 3OWJA 4MNEA 4IJ9A 4MWHA 3QWKA 5HD4A 1H1SA 5L3AA 4QYGA 3LW0A 4YSJA 3C0IA 3L9MA 4FTKA 4EH8A 5HE0A 3ZRMA 1OIYA 3UO6A 2IPXA 3TXOA 3HV6A 2GU8A 3D15A 4WO5A 5L2TA 2BRGA 5C8KA 4IVCA 3GQIA 3FMHA 4LRMA 4PMMA 2Z7SA 3KEXA 3QTZA 3TZ8A 2Y0AA 3DKGA 3R0TA 5L4QA 3PG1A 4YZCA 3HV7A 4ACHA 2J9MA 2F49A 2BILB 2F2UA 4HZSA 4RWLA 2JLDA 4ZSLA 4HCUA 3WBLA 4MF0A 4DHFA 3KGAA 3QTQA 5IQFA 3QRJA 3EOCA 5DGZA 3LE6A 2YA9A 4AGDA 4P5ZA 3DU8A 3S4QA 1FMOE 3HDNA 4K33A 1NVRA 3HRCA 3R7YA 4R78A 3MFTA 4FL3A 4LGHA 3R71A 4PL4A 4C3FA 1YHVA 5AP7A 2G2HA 2XP2A 3W2CA 4OTPA 4QOXA 3QTRA 3ULIA 2BALA 3R7IA 2ZM4A 4C37A 3HKOA 2OF4A 4FTCA 5ETIA 4BFMA 2GNIA 2YDIA 3K3IA 4CFXA 3DQXA 5A6NA 2XEYA 5AAEA 4DFUA 4UMRA 1GZ8A 3RZFA 3W18A 3PVWA 3W16A 3S1HA 4V01A 3RI1A 4I4EA 3CR0A 4DFZE 3ID6C 4NFMA 3AC1A 5AP6A 3DT1A 2VWVA 3Q4CA 5JH6A 4WG5A 4EWHA 2FSMX 3PYYA 4C34A 3AMBA 5M4UA 3OF0A 4D58A 5E8VA 1GAGA 3BIZA 3OHTA 5EQYA 5KMNA 4YGAA 4WUNA 2Q83A 5AX3A 4BGHA 1WBPA 1PYEA 3FKLA 4XG6A 2EWAA 2J5EA 5ACBC 4FG9A 3DKOA 3Q2MA 4U43A 1T45A 4RC2A 2Z7QA 2C6TA 3GQLA 2ITVA 3QQGA 4F6WA 4M69B 4F09A 2Z7RA 4MXZA 1VYZA 4Y5HA 3ANRA 2JDRA 4TWOA 2ZB1A 3KCKA 5FUTA 2QOQA 3LFNA 3TUCA 3UZTA 3WF9A 5BNJA 4N57A 5A4EA 1YI3A 1FQ1B 4KIKA 3ERKA 2QOFA 3HX4A 3UNZA 2E9NA 4EYJA 4LV5A 2W17A 4RIWA 4XLVA 2W1ZA 1ATPE 4TNBA 4QTDA 2DUVA 3A4OX 5EKOA 3P23A 4H1JA 3UMXA 4XOYA 4CTBA 3DJ6A 3C4FA 4IM0A 2WTJA 3HAVA 2OO8X 4DFYA 5I9VA 1W98A 3DBEA 3R7VA 3VBQA 1FBNA 4BIBA 1XH8A 4XBRA 2YDKA 3UIBA 1G8AA 2C3JA 1Y57A 4K8AA 1YWVA 3AT2A 3Q5ZA 3RTPA 1LEZA 4FKTA 4UV0A 4NCTC 3MFSA 3BV3A 4O7SA 3UE4A 2VWBA 4RX5A 3F82A 5AUUA 4RFYA 5CT0A 4NIFA 5J5SA 5LMAA 1TQMA 4QQTA 1V0BA 4I0RA 3LLAA 4GFOA 4NKSA 1F0QA 4C2WA 4IBMA 5ITAA 3BQCA 5JGAA 2CGUA 4G3CA 4XBUA 3R9HA 4FT0A 2CGXA 4JQ7A 5EI6A 1P4FA 2IG7A 1WBVA 4JL9A 4TW9A 2RFEA 3PXKA 2JEDA 4WHZA 5IKWA 3FZPA 3HECA 5M56A 3Q3BA 3QD0A 2CKPA 1UU8A 4NJ3A 5LXMA 2BZJA 4DGOA 2OZAA 2B0QA 2OJGA 3B2TA 2X8IA 3MPTA 5LJJA 4M0YA 5JFVA 2GHGA 4GT4A 4FNYA 2QONA 4IJPA 1STCE 4HVSA 2VTTA 4AT5A 4L3LA 3CBLA 1REKA 3QC9A 5J95A 4BGQA 3EQGA 4ACGA 4JDIA 4M12A 5FTQA 2NP8A 3QALE 4TT7A 2IZUA 2E9OA 1ZYCA 3EH9A 5CQUA 3LMHA 4A9RA 4YO6A 1ZYSA 1A06A 2C6OA 2UVXA 4IFCA 1Q62A 4PTGA 3SRVA 2OSCA 4PDSA 4CFUA 5CAVA 2BFXA 3HAMA 3ROCA 3W1FA 4C4GA 4HCVA 5H3QA 2CSNA 2O63A 4BKYA 4DGNA 2X81A 4JI9A 2YLFA 2PMIA 3R30A 4TYJA 4BIEA 2FH9A 3ODYX 4E4LA 4YUQA 3AQVA 3CD3A 3R9OA 3Q60A 2WU6A 2XKEA 2FUMA 4U44A 5BUJA 3BPRA 5EI2A 3PXYA 4IVDA 3FBVA 4O21A 3MFRA 2G15A 4I5PA 5HE1A 3SKCA 4KUJA 5BQ0A 3PFQA 4GKIA 4G9RA 3P1AA 2JBOA 5AJQA 1IRKA 4KD1A 5I0BA 4RC3A 2R7IA 2JAMA 4M0ZA 5BMMA 5E8UA 4FSQA 3QD3A 4WG3A 3NUAA 2YIQA 4GIIA 2QI8A 3ODZX 4FTQA 4OLIA 4RG0A 1VR2A 2X2KA 4FZ7A 4YC3A 3WZDA 4CV9A 5CVGA 2R0UA 3D83A 4RWKA 4YTCA 2W96B 5DG5A 4MCVA 2OFVA 3LFDA 1WVWA 3DLZA 3AMAA 4OUCA 2R3PA 2X2LA 4ZLOA 4S30A 2YAKA 2VTOA 4W4VA 5E8TA 2P0CA 3ORZA 3TEIA 4BBEA 5HE2A 4DYMA 4GKHA 1XBAA 2R64A 2HXQA 4BCHA 5AUTA 2CHLA 5JFXA 5FEEA 1NXKA 4XMOA 5AR5A 2C3KA 3SHEA 3VWAA 5M06A 1LR4A 3G2FA 4NWMA 4U3YA 4ANOA 2HCKA 2UW8A 1YXUA 2ZM3A 3TZ7A 3U51A 4M66A 1PW2A 4F64A 4RBLA 2Y6OA 3BBWA 3F2NA 3ZZEA 4PF4A 1CTPE 4O83A 1H00A 3A7GA 3HVCA 4X2NA 5IA5A 5HTCA 5CSWA 4YBKA 4ASXA 3U8WA 3LQ3A 5I9WA 4AZVA 4PP7A 1DM2A 2VNYA 4BVUA 4L9IA 4R3PA 5DNRA 5KUPA 3DDQA 5CEMA 4MXXA 5TF9A 3ZUVA 4XLIA 2UW9A 3JR1A 3MPAA 1U46A 4G16A 3ZLSA 2BRMA 2WOTA 3CS9A 2NPQA 2JDOA 2ACXA 3E8DA 2B9JA 5EH0A 3R9DA 3UGCA 4BC6A 3FJQE 1H1WA 4CZTA 3R8UA 3KRLA 3P7AA 2PWLA 4PTEA 5I9ZA 5DVRA 2UW5A 3BYUA 2CLXA 4DT9A 3IW8A 5AM7A 3BHHA 4JG7A 3MFUA 4MWIA 3POZA 2BKKA 2XKCA 4KWPA 5DI1A 3GBZA 4F9WA 2XM9A 3TTJA 3CGOA 4E3CA 5FGKA 4O96A 2VWIA 3SGCA 3WIGA 2W4OA 4RQVA 4IWQA 3VBYA 4CKRA 4EC9A 3EMGA 3KL8A 2WEVA 2JGZA 5DHJA 4ACCA 2YERA 5F4NA 3ZSIA 4HNIA 3IQ7A 2WTIA 2VN9A 3QAME 5EHLA 3S3IA 3UP2A 1IR3A 3QBNA 2B54A 4FV8A 4BYIA 5BPYA 1P14A 5AV2A 2JKOA 3EQDA 4AP7A 3E64A 4EWQA 3PXRA 5IQIA 3AXWA 4EUUA 3BBTB 3NCGA 2HK5A 4WNMA 4X21A 3OBJA 3SOAA 3L9LA 3TV7A 1JVPP 4GUEA 4WG4A 1OKWA 1ZXEA 3HUBA 3DOGA 4FTNA 2R0IA 5H8GA 2PULA 2YIYA 4AAAA 3SXFA 4BCKA 3F5UA 4GRBA 5J5TA 2XUUA 4AN3A 4FUYA 4FV5A 5C9CA 2JC6A 4R77A 3FZ1A 4QYFA 3CQUA 4CYIA 4EQCA 3B2WA 2XJ0A 4KABA 5AUZA 4BDHA 3OY3A 5CAUA 2BCJA 5C03A 3FQEA 4PNIA 2Y6MA 1FPUA 4O0SA 3REPA 4HPUE 3MA6A 4EH9A 3QCYA 3VF9A 1DAWA 3MI9A 5AP0A 2Q0NA 3R9RA 1R39A 4XRLA 2YISA 4PNKA 3GT8A 3DK6A 4I1ZA 4CFVA 1NW1A 2G2FA 4RLLA 4IFGA 4IMYA 2WIHA 3C7QA 4GK2A 4C3PA 5CAOA 4H36A 5CVFA 5BUEA 5KKRC 5CX9A 4Y83A 2EXEA 1I09A 3EB0A 2JDTA 1PXMA 4TNDA 2H96A 4ZS0A 2RFDA 4DN5A 4RIYB 4LMNA 4JOAA 5TOZA 2PZIA 3NS9A 4ANLA 4W4YA 2CGVA 3AGMA 3ZOSA 4QNYA 5LCKA 3JXWA 1SNXA 3NUPA 3HP2A 3NCZA 2OIDA 4EOSA 3LQ5A 3QCXA 1XO2B 4OTDA 3CKWA 2AUHA 4FX3A 2W99B 3CC6A 2ETKA 4APPA 4FSTA 2BFYA 2CMWA 3ZTXA 4XYFA 3FY2A 5GJFA 3RAIA 3G9NA 5GNKA 4Y73A 3SXRA 4U97A 1BMKA 2C0OA 4EKLA 4E4NA 2QCSA 4J8NA 3DZQA 1H01A 3FLQA 5JZJA 5IQCA 4FV6A 5BMSA 3DK3A 3MTFA 3NAYA 2QG5A 4NM0A 5CU2A 5FBNC 2BR1A 2VO6A 1B38A 1OIQA 3AOXA 4GG7A 5GHVA 4EORA 4ZTNA 4NYEA 3BZ3A 4QP9A 4MEDA 5KMOA 3WILA 2B55A 1KE8A 2DYLA 2VO3A 1R3CA 3DPKA 3QD2B 4DLIA 3QKMA 2YJSA 3IKAA 4PDPA 4FV2A 4KSQA 5H8BA 2YWPA 5F20A 1B6CB 3R04A 1KE6A 2G1TA 1WCCA 1ZOEA 3MH1A 4IAAA 4L42A 2B52A 4QMZA 2YZLA 4FKPA 1XH5A 3I7CA 5A46A 4BR3A 3QUDA 3WF6A 3O51A 2AC3A 4AN9A 5IDNA 1WBTA 2UW4A 2X8DA 4CFNA 3FXXA 1NVSA 3NX8A 2PTKA 5AR2A 1LP4A 1KE5A 1WBOA 4IAIA 4NSTA 2B9FA 5FXRA 4DH5A 3GU5A 1IG1A 4ERKA 2W5BA 3RK9A 4YO4A 2BUJA 3BRBA 3V01A 3TZ9A 2GSFA 4ZIMA 1DI8A 2HZ4A 3EFLA 1J3HA 4HVGA 3ORLA 4M69A 3OXZA 1ZYLA 5F95A 4AS0A 4HYHA 3UPXA 5IUGA 5KBQA 4FK3A 4H3QA 2P2IA 3CKXA 2VV9A 4X0MA 1Q3DA 2QOKA 5DT0A 3TG1A 4YJPA 3QTSA 4FIJA 3EQRA 4QP3A 5DN3A 4K18A 3NVKI 3OD6X 4IB0A 5M07A 3DAEA 2QLQA 3ACKA 3R22A 4I3ZA 4EUTA 4DG3E 3ELJA 4X7QA 3NYVA 4ZZNA 2IW6A 4NW5A 2WTKC 2GNHA 3C4EA 3R8LA 5CASA 4DT8A 2WMAA 4I93A 3EFKA 3O2MA 2F7EE 4LOPA 3WZKA 5GZAA 2AC5A 3ZH8A 4O1PA 5D7VA 4ALWA 5IA2A 1OUKA 4NM7A 1F3MC 3Q5IA 4IB5A 4WNOA 1H28A 3FSFA 3PE2A 5KCVA 3OTVA 4YPDA 4QMMA 3VUMA 4F1OA 3H9FA 3DB8A 1BX6A 1UVRA 5HESA 2GTNA 4EOJA 2FB8A 3H4JA 4G6NA 1OBGA 3OCTA 2W1HA 3OT8A 2BIYA 4FKWA 5BVEA 5A4LA 1JOWB 5HQ0A 4HW7A 5AAGA 3TUDA 4S31A 4QP4A 5KKRB 3PJ2A 1UA2A 3U9NA 4YJRA 3UMWA 1FVRA 3VS4A 2CNUA 4C57A 1GIHA 4AGCA 3DFAA 2CJMA 2V5QA 3VS1A 1GIIA 3C50A 4JRNA 5BVOA 2LAVA 5ANGA 4BDFA 2OIBA 4OW8A 5AR7A 4AWIA 5I3RA 4YHJA 3ZSGA 4FTLA 1OECA 2IO6A 3S95A 2QC6A 2J50A 2BZKB 4X3JA 4AE6A 4O38A 4A06A 2J5FA 1OKYA 3VS2A 3AC5A 4AFJA 1I44A 4FT3A 4DEDA 4ENXA 2CKEA 4DITA 3P4KA 2BZHB 4EC8A 4F7LA 4BDDA 5JN2A 4PDYA 4BBFA 2XBJA 4M15A 4NW6A 4X6QC 4U8ZA 4B7TA 5CWZA 3VS0A 3S00A 3MV5A 1M2RA 3G6GA 2X7OA 4C4FA 4JIKA 4F6SA 4YJSA 4ZTRA 5F94A 1MRVA 5D1JA 2C6EA 4TPTA 2YCFA 5AP2A 3IDBA 3IOPA 4YJVA 5IQGA 3VBTA 4RX7A 4UMQA 3BLHA 2XJ1A 3P08A 3R83A 3DV3A 2V62A 3COIA 4MH7A 3L8SA 4QP2A 4XG9A 2VTAA 3GB2A 5EDRA 3FLZA 3TV4A 4BGGA 5CSHA 3DXNA 4G3GA 1Q97A 3D14A 2WMVA 2PVMA 3I0QA 3BU5A 4J71A 2VTIA 3MY1A 4CSVA 3UNKA 4YJOA 2Y4IC 2OXDA 2XCKA 5M51A 4UMPA 4EEVA 4GH2A 1DAYA 5HD7A 5KHXA 1ZARA 1GNGA 4QT1A 4EZ5A 4ZLZA 3SA0A 3L9PA 1OL2A 4QTEA 3VO3A 3VW6A 4C4HA 2ITNA 2XYUA 2W9ZB 1HCLA 1U54A 2X6DA 4IZ5A 4WA9A 3VNTA 3U6JA 3G33A 3KC3A 4JR3A 3ZO3A 2VO0A 3L8PA 2UZNA 4OTIA 5LVNA 4JQ8A 5F1ZA 3RPYA 2UZOA 1J7LA 4KRCA 3PZHA 3V5QA 3POOA 4FT9A 2W1IA 3FSKA 2WMXA 3ZM4A 4B8LA 1VZOA 1YDSE 4WBOA 3V51A 3ZRKA 4AA5A 5CXHA 5JKGA 4P90A 2BDWA 2OIQA 3HNGA 2PMLX 5ETFA 1JWHA 5KMMA 2KULA 3OP5A 2W1DA 2VTPA 3WZUA 2WZJA 5D7AA 4DEIA 2WFYA 2IVTA 1PY5A 2ERKA 2O65A 1IAHA 1R0PA 3AC4A 4ZY4A 4JG8A 3QF9A 4IW0A 3W2OA 2WEIA 4EOKA 3C4CA 2VWUA 3VHKA 4BDJA 5L8KA 2JKKA 4WSQA 5I3OA 4OGRA 4FKRA 4XV9A 4BZNA 3L8XA 2VD5A 3QYZA 5HNIX 2VTNA 3KB7A 3R63A 1KSWA 4JX3A 4JG6A 2XS0A 3JS2A 4MTAA 2CCHA 3DFCB 2WMRA 1OI9A 4FT7A 3DKCA 3H9OA 4V0GB 3VS6A 2VGOA 4FKQA 5CTPA 5CZHA 5CYIA 4Y95A 3LFAA 3QUEA 4QMSA 3D7ZA 2WTKB 3QRKA 4IWPA 4YZMA 1XBCA 3CEKA 4NM3A 5DIAA 4OAVB 4ASDA 3SG9A 2NNWB 3NIEA 5AR8A 3D2KA 4PL3A 5IUHA 4PL5A 3TNHA 3LFCA 4D2WA 5L6PA 5B2KA 3O8TA 2OJ9A 3OROA 3OTUA 5CY3A 4NCTA 5HICA 1OBDA 4N0SA 5LMBA 1XKKA 2W5HA 4R5SA 5DEWA 4EOMA 3HMOA 2ZV9A 4NM5A 4X2GA 2J7TA 2PVFA 2FGIA 5EYKA 3UODA 5EM6A 1PHKA 4ANNA 2CKQA 3HMMA 3OUKA 4FR4A 4DAWA 4QMVA 5CANA 4QPMA 3W33A 4EH2A 4CNHA 2EXCX 2R3MA 3LZBA 4LV8A 5E92A 4GVJA 2ZV2A 4O86A 1OUYA 4WNPA 4BCMA 2JITA 3OBGA 5E4HA 2XK8A 5CU0A 5EQEA 3GNIB 1UWHA 4J53A 2JIUA 4FOBA 3OW3A 3RWPA 2XEZA 4K9YA 3LJ2A 2WPAA 3PP1A 4OBPA 4I21A 2VO7A 4IC8A 2XJ2A 3FMEA 4UXQA 3Q04A 3QL8A 5HTBA 5HX8A 2Z8CA 4ZAUA 4RIOA 3C1XA 4EONA 4JBVA 2OJFE
chains in the Genus database with same CATH superfamily
2I1MA 2V22A 1ZZ2A 2GTMA 4WKQA 3DNDA 5L2IA 2OK1A 2A2AA 3D2IA 3RNYA 1UV5A 1Q8WA 4IHPA 5T6KA 3UYTA 5L2WA 3KK9A 3NSZA 1AQ1A 2XYNA 3P7CA 4USDA 2HW7A 4J98A 5F9EA 2UZWE 4JT3A 3GXLA 4IXPA 3RALA 3OC1A 3TJCA 4ZSJA 1F5QA 2C3LA 2QOLA 5AUXA 3GGFA 3COHA 4FTRA 4K1BA 4AW2A 3F7ZA 2ITTA 3OXTA 4YJUA 5CF8A 4USEA 2R3QA 4P7EA 4APCA 5T3QA 2ZB0A 4IADA 3TNWA 4CG8A 4KBAA 4ASZA 4BCOA 3ATTA 4FE2A 3IONA 4DINA 2Y4IB 5LWMA 4IZAA 3LXLA 3FLYA 3CD8A 4PPBA 5HOAA 4XX9A 3W2QA 4K6ZA 3QLFA 4FEQA 1JSUA 4PQNA 4IVAA 4Q5HA 5K5XA 1Y8GA 2IVUA 2W7XA 1OKVA 5IU2A 4L45A 2GQRA 2PMNX 4JMQA 2IZSA 3QFVA 4KSPA 4M3QA 4Y85A 5CSXA 5HKMA 2XIZA 3PXFA 4YLKA 3ZLXA 2XK9A 4Z16A 3DXPA 1YOLA 4AXAA 4DLJA 4FOCA 4NKAA 5M4CA 2V7AA 3MB6A 5HCYA 4JX7A 5ETCA 2HWOA 4FRFA 3V5WA 5FG8A 4EH7A 4CFFA 2WTVA 2EB2A 5HG5A 2OF2A 5G1XA 3VQUA 4UWYA 4O4CA 2C5OA 3VW8A 5BYYA 4HGEA 3TT0A 3BLRA 3TIZA 4IAZA 2WKMA 2YFXA 1H4LA 3LOKA 4RFZA 1M7QA 2DS1A 4HJOA 5HU9A 4CQGA 3R2YA 2PE1A 2W9FB 3BKBA 3QTWA 1OPLA 4FKUA 3RM7A 4K77A 3NW6A 2X0GA 4AACA 2QKRA 4AXEA 3R6XA 2O2UA 2XK3A 3PRIA 2P55A 2X1NA 5AX9A 3KXMA 3CP9A 4IWOA 4AA4A 4F1TA 3A7FA 2PU8A 4FKVA 1W0XC 5D10A 1QMZA 3CTJA 3DKFA 3M11A 4MNFA 5DR6A 1VLRA 2QURA 3CE3A 5KX8A 2ONLC 2JKMA 2QHNA 4TWPA 4F9AA 3V5JA 4MXCA 1XJDA 3D5VA 3HEGA 2WQEA 2OU7A 3UC4A 4FV7A 4UZHA 4PMTA 4O84A 3Q32A 3W2RA 1G5SA 4WUAA 3W0PA 5C26A 2UZTA 3UO4A 3BV2A 2H8HA 4FNZA 4D55A 4CVAA 3KULB 3I6WA 3LCOA 3OT3A 2HZNA 4YLJA 4TN6A 4WSYA 4EQUA 3BHUA 3QX2A 3UTOA 2XAOA 1KOBA 5E8SA 3R02A 4GW8A 2J2IB 3B8RA 1H1RA 4QMOA 4ACMA 2R3FA 4BBMA 2J4ZA 3F2AA 5LVOA 3NRMA 4RIXB 4C58A 3NDMA 2HIWA 4MXAA 3N51A 4JR7A 4G3DA 4NU1A 3PJCA 5E8YA 2YAAA 4E4MA 3RAHA 3R2BA 5TE0A 1XWSA 1URWA 2OH4A 1TFFA 3BYOA 5CU4A 3HLLA 3JVSA 4B6LA 3BHTA 3OS3A 1XH6A 2YJRA 3T9TA 4TYIA 3CQEA 4GYGA 5EW3A 3I81A 3DDPA 1YWNA 3LCDA 4M13A 2YM7A 3FYKX 3W8QA 3E8CA 4IE9A 3R28A 4AOJA 1PRYA 1GZOA 2UZUE 4JRVA 3ZLYA 5GINE 1JNKA 4ID7A 4F0FA 2C1AA 4UMTA 5EFQA 4QMLA 4EH5A 3FAAA 3NYNA 2XNEA 3G9LX 5E1SA 3UIUA 2WQNA 4O22A 3VS3A 3WARA 3WF5A 4W9XA 2UW6A 3P86A 5LCJA 2J0IA 3P5KA 3RAWA 2ITZA 4I0SA 3AC3A 3PLSA 5FQDC 4DH3A 3W0SA 3AD6A 4D4RA 2GS2A 1Q3WA 1O6YA 4MAOA 5EM7A 4AQCA 3O71A 3C5IA 4RC4A 4FKGA 4MK0A 4YHFA 3ALNA 3ML1A 3NFFB 4DEEA 2B9IA 2R3LA 4F7JA 3ANQA 1GOLA 3VN9A 4FKIA 3ZS5A 2X6EA 2G9XA 2QOBA 2ZYBA 2PSQA 4PV0A 5L8JA 1TQIA 4IANA 4C4EA 1WVXA 3ZMMA 4YTFA 4G17A 3H30A 2V7OA 4JBOA 4BI1A 2IZTA 4IWDA 1YXVA 5CEOA 5J9LA 4U7ZA 2PVJA 4ANQA 1Q61A 3OCBA 2F9GA 1JLUE 4R7BA 5D41A 4RZWA 1OL7A 2GPHA 4ZSGA 4FZFB 4ZS4A 4X3FA 1Q24A 1PYXA 4YMJA 3CLYA 5CLPA 5AUWA 2ITOA 3CPBA 2QG7A 4FSWA 4EHVA 3QRTA 2ZDUA 5GJDA 4BCGA 5K3YA 3KRJA 4JIAA 3SG8A 5IA3A 4W8DA 4QTBA 4TTHB 1A9UA 2R3GA 4FIFA 3CSVA 3NYXA 3QA0A 4L7SA 5I4NA 5IUIA 1XQZA 4G1WA 2CGWA 2QOCA 3PIZA 2Z2WA 3CCNA 2W1EA 3UIMA 3I7BA 3BWJA 3FQHA 3Q4TA 4AZEA 5HIEA 3QZHA 4A7CA 4C36A 5FRIA 1Q8TA 5A14A 2Y9QA 3UZRA 3UIXA 3TKHA 5GIPE 5HX6A 2C0TA 4BRXA 4ITJA 4KKHA 5J7HA 2C68A 3BU6A 4EHEA 5AFVA 2YIXA 2DWBA 4RX8A 1MP8A 2UZLA 4YHTA 4CKIA 3UP7A 5A9UA 4DBNA 3NNXA 4B9DA 5C1QB 2A27A 3VJOA 3M42A 2JAVA 5EI8A 2QOHA 5JSMA 2XRWA 1HOWA 1ZYJA 3ZBFA 1CM8A 2ITPA 3DGKA 3R73A 2B9HA 4OT6A 4E26A 3Q6UA 3PZEA 4FF8A 3RHKA 5LWNA 4ZMEA 3QRIA 4I0TA 5CI7A 5AV1A 4EOOA 1PMEA 1W84A 3VUIA 3PA5A 3AGLA 3E3BX 3H0ZA 5J9YA 1ZWSA 2GS7A 3IPHA 3EKNA 4TRLA 1GY3A 2PVNA 3VBXA 4EJNA 2ZVAA 2OI4X 3MH3A 2VGPA 4ITHA 4KIQA 2BRHA 4IIRA 3SXSA 4H3BA 3FUPA 4FTUA 2W1GA 5LARA 3R8ZA 4AW0A 3LKMA 4UY9A 2ITQA 3KVXA 2ZFYA 3KA0A 2JDSA 3OY1A 3KF7A 4QNAA 3ZDIA 4JVGA 5ANOA 2ITXA 4EHGA 3FMLA 3P78A 3FXZA 3CY3A 3NR9A 4FICA 3QD4A 5IQEA 4FMQA 5HCXA 3FY0A 4FIIA 4OTHA 3OEZA 3KY2A 3NYOA 4DFNA 4O6LA 5DR2A 4AZFA 4HVIA 1W83A 4DH8A 4GL9A 4TKSA 1FOTA 2BAKA 5B7VA 1H8FA 2OBJA 4E5WA 1NA7A 2YN8A 3IGOA 3FHIA 4GG5A 4GJ3A 4DG0E 3DBDA 2DQ7X 3BEGA 2NRUA 5FTGA 3ZFYA 2HOGA 1OM1A 2XZSA 3V5PA 4F99A 5IPJA 3ZONA 2QO7A 4YR8A 1OL1A 4OTFA 3K5VA 1NVQA 5KE0A 3SQQA 3DA6A 4LRKA 3S2PA 4XCUA 3ZXZA 3BLAA 3RCJA 2CLQA 2VTJA 4F70A 4LL0A 5HHWA 4BWXA 4JNWA 3UOLA 4U80A 2YITA 2YM4A 3ETAA 4GV1A 5HVJA 5C8MA 4LDTA 4BDIA 1EH4A 1OVEA 4FL1A 3DTCA 2WQBA 2NRYA 1M7NA 3QXOA 4D2TA 4DF3A 2VWZA 1K3AA 4FA2A 1JSVA 2QHMA 1WVYA 4FIEA 4EK4A 2XK4A 1KOAA 2XRUA 1TQPA 2R2PA 4LI5A 2EUFB 3LXKA 1W2DA 2HY0A 1KUTA 4Q2AA 3O7LD 4AN2A 5CSPA 4JQEA 4L3PA 2VU3A 4MX9A 1MUOA 4RT7A 5KZ0A 4DEGA 2QOOA 2PL0A 1OB3A 3VUGA 4O82A 3CTQA 4I20A 4MBIA 2IVSA 2WOUA 1W8CA 2VTLA 4ZY6A 4TL0A 4EK5A 4EH3A 5L6WL 4BDBA 4GMYA 1MQ4A 3F66A 3TN8A 4LL5A 4OTGA 3AD4A 2VWXA 4HGTA 4BTMA 5J87A 3U54A 4Y8DA 4WOVA 3VQHA 1ZLTA 4BL1A 4UYAA 4S32A 4E1ZA 4J52A 3SX9A 4CCBA 3GP0A 4ANBA 4UXLA 4QP6A 4BWKA 4GIHA 2X9FA 4L52A 4WRSA 5AP5A 1W2FA 2PUPA 5E7RA 2R7BA 1XH4A 3QRUA 1YQJA 4F7NA 2JDVA 3R1NA 5CAPA 3E8NA 1J7UA 4O0RA 4FSZA 4RVKA 4XV3A 4YLLA 1MRYA 3FPQA 3MS9A 4K2RA 4BKZA 1BL6A 1G8SA 4DEAA 3D5WA 3IK3A 4FJVA 3QU0A 1Q8ZA 2UZDA 3FKOA 3SOCA 4AOTA 5M4IA 3AMYA 3KMUA 4U3ZA 4ORKA 3GENA 3ZU7A 3RPSA 3LLTA 4RJ5A 2F57A 1OL6A 4ONAA 3A8XA 4I41A 1UU3A 3QQJA 1JSTA 1YXTA 4IC7A 1GZNA 3C9WA 1BI7A 3FXWA 4Z3VA 2VAGA 2YCQA 4LUDA 1PXPA 3D9VA 2WMSA 4QQCA 3W32A 4KA3A 4EK6A 4BWPA 4I23A 5A6OA 4HYIA 3VS7A 1RJBA 1PXOA 2XNNA 4D1SA 4RFMA 1OIRA 2QODA 4XP3A 1JKTA 4JBQA 4EH4A 4RQKA 3DJ5A 3MY0A 3EQFA 2J90A 4IB3A 4O7ZA 2IVVA 4GCJA 4E5BA 4E4XA 5I9XA 3MBLA 4O4DA 1V0PA 3OWKA 4O2PA 2PHKA 2XK7A 2O8YA 2P2HA 2R3RA 4JAIA 3R7EA 4F4PA 2F4JA 1IA9A 3P7BA 4HGLA 3KMMA 3SD0A 3QYWA 2Z60A 2WGJA 4PTCA 3C0HA 4KB8A 4R3CA 4BCJA 1ZMVA 4B4LA 2FYSA 2OXYA 3CXWA 1CMKE 4GS6A 2I40A 4BCQA 4FV3A 5L2QA 3MJ2A 3OWPA 3E8EA 3Q9XA 4IX6A 1Y6AA 5L2SA 3EZRA 5C27A 2P3GX 2X39A 5AMNA 4EQMA 5IMXA 3ZLWA 2Z02A 5KZIA 1UNLA 3HMPA 2BTRA 5CI6A 5AAFA 4BB4A 3TNQB 3PRFA 4RVMA 2UW7A 4O2ZA 5DWRA 4U40A 4O4EA 3ZC5A 5HCZA 2VTQA 3LVPA 2OFUA 3OFMA 4YNEA 1AD5A 2R3OA 5ICPA 3GI3A 3DBQA 3EN4A 4Q9SA 4FV4A 4UBAA 4XEYA 5HI2A 4BTJA 3H0YA 1UU7A 3MIAA 3CY2A 3KN6A 4FTJA 4D5HA 4E93A 3FI8A 4MKCA 2OJJA 3NWWA 4FT5A 5JRSA 4D5KA 2GNFA 3D5UA 3NNVA 1JBPE 2QD9A 3E63A 4M8TA 4P5QA 4WIHA 4A9YA 3PWYA 4CQEA 2XM8A 3JVRA 1A48A 4FTIA 1JKSA 1H08A 5AP4A 2F7XE 4EZ3A 3KULA 4O0VA 2WAJA 4D2RA 5CEKA 2BDJA 3UQFA 4H3PA 4J8MA 3E93A 4L6QA 3PVUA 3TJDA 3UQCA 4O0UA 4O7VA 3ENMA 3EYGA 4KIKB 3V04A 2UZVA 3UC3A 3T3UA 4XOZA 3F5GA 3NPCA 3FC2A 4RIXA 2BKZA 4LGDA 1H07A 2Q0BA 5EOLA 3WOWA 1IA8A 1ZAOA 4C35A 5K0XA 1UNGA 1ZY5A 1Q4LA 2H9VA 3I0OA 4WD5A 4H39A 5DRBA 5CALA 4FG7A 3RAKA 4U45A 4JJRA 3UOJA 1IASA 2E9PA 4O4FA 4XP0A 5AIRA 3TI1A 4OR5A 4A4OA 4M97A 3H9RA 4G6LA 5B2MA 5JZNA 2UVYA 3ZYAA 1H1PA 2BDFA 3RMFA 1NT2A 4FKSA 5E1EA 1VJYA 3RGFA 2BTSA 5CEIA 2C5NA 2J0KA 2E9VA 4K0YA 3Q2JA 3O23A 5CNOA 3COMA 4Z55A 3M2WA 1SMHA 3OG7A 5BVKA 4NIFB 2UV2A 1H0VA 4FBXA 4CKJA 4RJ4A 2GS6A 3NUUA 2J51A 3MA3A 3RINA 3PDTA 4PPAA 4PMSA 3IW4A 5LVLA 4RLKA 5I9YA 1H25A 2UZEA 4NJDA 1OITA 1OZ1A 2EU9A 5CF4A 4N70A 4DE4A 2ZV8A 1QPDA 4GYIA 2YWVA 4I6HA 4D2SA 5EKNA 5ETAA 3PPJA 3QHRA 5LQFA 2PPQA 3PUFC 3PLAE 2XALA 5GJGA 2A4LA 2OZAB 3LXPA 4F6UA 5K4IA 4A9SA 4CG9A 3E62A 4JS8A 4XJ0A 4MHAA 4O7TA 3W0MA 3F7WA 4O0YA 4KRDA 4QP8A 5EYMA 5DRDA 3OEFX 4CYJA 2PVLA 3AD5A 5D12A 4F1MA 3BCEA 5A4QA 3A61A 5IQHA 1ZYDA 2XA4A 4QMXA 3FDNA 3PG3A 1XR1A 2X9EA 3SRVB 2WMTA 4R6VA 5BVWA 5K4JA 4Q5EA 2R9SA 4CRLA 4MBJA 3KK8A 4O91A 4V04A 2IJMA 1IEPA 4MXYA 3GEQA 5IZFA 3G90X 2GQSA 1AGWA 3QKKA 4M84A 2X0PA 5KMLA 2HENA 4QPAA 3WF8A 5IA4A 2PVRA 2PYWA 3UDTA 2R4BA 4L8MA 3VVHA 3Q4UA 4ALUA 1CSNA 1PXKA 3KVWA 1RW8A 1YWRA 2BHHA 4BDEA 1SYKA 3MPMA 5FDPA 4OTQA 4QYEA 4CT2A 2BPMA 4PDOA 1CDKA 4KS8A 5AEPA 3CPCA 2I0HA 3GU4A 5AA9A 2GFCA 2A19B 2WU7A 5AUYA 2BVAA 4QD6A 2X4FA 4O7NA 5KNJA 2F2CB 3HRBA 4XNEA 4F78A 2C30A 1R1WA 2C4GA 4XG8A 2VX0A 4F0IA 4HNFA 1FMKA 3E87A 2ONLA 4YTHA 4FKJA 2WTDA 3A7IA 4QQJA 4RVTA 4ZSAA 4ENYA 1RQQA 5KMJA 4D9UA 4FODA 4M67A 5DBXA 4PX6A 3GC7A 4I5CA 3PXQA 3WYXA 3IW5A 4V05A 1PXLA 3BYVA 3FLNC 4DG2E 3ORPA 5K5NA 4W9WA 5FP6A 3T3VA 5H9BA 3GCQA 3DNEA 4AX8A 4CV8A 5CVHA 3EKKA 3F2RA 3NUSA 2WMBA 3BGQA 1DI9A 5IF1A 4UZDA 3ORNA 4XUFA 4AGUA 3UQGA 4P4CA 4FIHA 4FSUA 2PY3A 2VWYA 4QQ5A 2C6MA 1U4DA 3LFFA 4GFGA 3VJNA 3FZTA 3W0NA 3R1YA 5CNNA 4M14A 3VRYA 4JXFA 2JIIA 2BIKB 2OKRA 3FL4A 1YDTE 4JLCA 5DT4A 3TNIA 3R1QA 4I6FA 5M53A 3DY7A 5HLPA 2C47A 4FZDB 4D4SA 2OICA 2OXXA 4RJ8A 5TKDA 4O7LA 5E8XA 1QL6A 2O0UA 4L7FA 3ZRLA 3MH0A 3MVJA 3ALOA 2EVAA 2RG6A 3H3CA 4MD9E 4O0XA 3PY3A 4ZTSA 1Y91A 4II5A 1M14A 3RNIA 5JEBA 1YDRE 4HOKA 4GK3A 4I6LA 3VBVA 4D4VA 2QKWB 2FO0A 3LM5A 3GC9A 3QKLA 2WTCA 3P9JA 4F9BA 1M2QA 3EHAA 4L44A 3TZMA 4C0TA 2GQGA 4IZ7A 3VF8A 3SW4A 2W06A 3FI3A 1LPUA 3WZJA 2ZJWA 5HBJA 5HU3A 1YHSA 3DAKA 3ZEPA 5FDXA 4G3FA 3N4VA 3N9XA 3FZRA 3OZ6A 2XCHA 4FZ6A 3P79A 4AFEA 4Q9ZA 1ST4A 3DB6A 5HE3A 3FI2A 3PPZA 3PY0A 3MDYA 3W0OA 1BLXA 3W2SA 1SZMA 4O7RA 2VTHA 4YJNA 3F9NA 4BDAA 4RA4A 2ZDTA 1P5EA 2PVYA 3KXNA 3KXGA 4PPCA 5HBHA 4OT5A 4CCUA 3KREA 4I94A 2B1PA 1BL7A 4AW1A 5LVMA 5IMEA 4DH7A 3LIJA 4JAJA 4L01A 2VX3A 4MQ2A 3FV8A 4TY1A 3TKIA 5KMIA 3R7GA 3MIYA 3PA4A 4H1MA 3QZIA 1JQHA 3R1SA 4TYHB 1QCFA 2ERZE 2YM8A 4C02A 5J1WA 3G6HA 4GVAA 1H24A 4H05A 4AE9A 3ORIA 3W2PA 3BHYA 4IAFA 5HG9A 3NMUF 3ZCLA 1MQBA 3EIDA 4D0XA 2BAJA 3VC4A 3BLQA 3D4QA 3LXNA 2IN6A 3C4XA 2BRNA 3SLSA 4DGMA 3ORTA 3RPRA 4DFXE 3U9CA 3PY1A 4EI4A 4AAYA 3OUNB 3HMIA 5HIBA 1Y6BA 4YZBA 3QC4A 4BI0A 3LMIA 3EQPA 5AP3A 3LFQA 4XRJA 1H26A 5ANDA 3ZBXA 4DCEA 1JKLA 5EW9A 2ZMCA 3UO5A 2GNJA 2ETMA 3HV4A 3BQRA 2VTMA 5EYDA 3ITZA 1OPJA 4G34A 5BX0A 5LMKC 3NIZA 1XMMA 4RIYA 2OWBA 1V0OA 4QMYA 3KMWA 4A07A 4B0GA 4RJ7A 1CKPA 4N4SA 4YBJA 4D1XA 4DTKA 1DS5A 5M57A 4ZEGA 5FM3A 4U81A 1YXXA 4YTIA 3ZC6A 3MSSA 4HVHA 2VTRA 3DLSA 2GNGA 3TCPA 2YM5A 4CZUA 2R3HA 3LFSA 4DH1A 2BZIB 1V1KA 4IVBA 5M44A 1P4OA 1TKIA 4OTWA 4ITIA 3WE4A 5BV3A 3QTUA 4DHZA 1KV1A 4AF3A 2JFLA 2CPKE 4F9YA 3Q9ZA 2JIVA 2REIA 3FMMA 3I5NA 4L67A 4LOQA 2CKOA 2WQMA 2XIKA 2BHEA 5TR6A 4EL9A 1PKDA 3AT3A 2X7FA 4TXCA 3E7OA 5BUIA 3QTIA 4QDEA 5IQBA 4BICA 2PVKA 2PMOX 3LCSA 2W1CA 4R8QA 3HV5A 1PMNA 4BCFA 4KKGA 1E1VA 1OGUA 2JD5A 5E90A 5E8WA 3U4WA 3KRXA 5IH5A 5L8LA 2BMCA 2E2BA 4FVRA 1ERKA 3ULZA 3C4WA 4CT1A 3C13A 4FUXA 4KIOA 4ANSA 4CFMA 3V5TA 5KO1A 3PUPA 1FVVA 2PVHA 2RFNA 2RKUA 3QGYA 1K9AA 5CF6A 1P2AA 3EFWA 2VRXA 2P4IA 4OBOA 4L68A 1TZDA 3C5UA 2B53A 3ET7A 4NL0A 1J91A 2ZAZA 3W10A 4FSRA 1VEBA 4PMPA 3R21A 4YNOA 3RPVA 5AP1A 4IX5A 3VRZA 5M4FA 3JYAA 3V8WA 4YC6A 4M68A 1CKJA 4FTMA 4S33A 5HBEA 3BE9A 2PZYA 2P33A 4FG8A 3GCSA 1XH7A 4FVQA 4E73A 3E3PA 4R5YA 2HELA 3G0EA 2RFSA 4RX9A 5CENA 3BGZA 5HLWA 4DDIA 5EK7A 2G01A 2C1BA 5HIDA 4B99A 5AM6A 2OG8A 3HYHA 4QMQA 5BVNA 4I6BA 1UNHA 4KBCA 2V55A 5GIOE 2Y4PA 3OOGA 1B39A 1W82A 3R7OA 4FSNA 5EM8A 1XMLA 2PZRA 5D9HA 4QMNA 4C3RA 4IH8A 3G15A 5AADA 2H6DA 3TUBA 4D9TA 4RWIA 4C33A 1VYWA 4RSSA 1PKGA 2IWIA 3HUCA 3R8PA 5AV3A 5A54A 1LEWA 2LGCA 4EH6A 2UZBA 3F5XA 2A98A 4F63A 3VAPA 3KXZA 5EHYA 3OMVA 4DEHA 3ZM9A 3F3WA 2X0QA 3QA8A 1CKIA 4BTFA 3EQIA 3LJ0A 4FK6A 4FKLA 4ZTHA 3ZZWA 4YZ9A 4ERWA 3Q9YA 4BCIA 4WNKA 4NTSA 1PXJA 3AG9A 1S9IA 4TYGA 3O17A 5I9UA 3NUNA 3AC2A 2I6LA 5FWKK 2X0OA 4XHKB 5J9ZA 5M08A 3LFEA 4XG3A 5AV0A 3ZO1A 1GIJA 1YHWA 2GFSA 2QQ7A 3A4PA 5CSVA 4BHNA 4CLJA 3GCUA 3WZEA 4AW5A 4HYSA 3FEGA 3GFWA 1XH9A 3QX4A 1APME 3OWLA 4GT5A 4IM3A 4ZJVA 3HGKA 3M1SA 4GK4A 1E9HA 3EQHA 3HDMA 4FEVA 1JPAA 1WAKA 2XH5A 4BHZA 4L3JA 3R01A 1RE8A 3MW1A 3U87A 2HYYA 3TYKA 3K54A 5TO8A 2CDZA 3Q4ZA 4C4JA 4RJ3A 5ANEA 2FA2A 5TT7A 3V5LA 5IA1A 3O5AA 3GCVA 4TYEA 1PF8A 4EOPA 4FL2A 4AOIA 3D94A 2VUWA 2J0LA 3EJ1A 4MBLA 3WI6A 1M52A 2BRBA 2YLEA 3E7VA 3EL7A 5HEZA 2YCRA 4ZY5A 4RWJA 2QR7A 4Z7GA 1WZYA 2XB7A 4W8EA 4ZMFA 4NZWB 3GCPA 5HGIA 3NNWA 4F08A 4ZZOA 5FTOA 4A9UA 4ZLYA 4BY9E 2PUIA 3BYMA 4C62A 3ATSA 5CEQA 3W55A 3KXXA 3BHVA 4KBKA 4AU8A 3LM0A 4C38A 1SVHA 1PMUA 5L6OA 3VHEA 3UOHA 3CIKA 4BJJB 2C0IA 4O0TA 3CQWA 3EN7A 1BI8A 4UB7A 3DK7A 4LUEA 3G0FA 5A4CA 4O7YA 3KCFA 3GC0A 3UJGA 2C5VA 2IW8A 3MTLA 1SM2A 3NAXA 5GZ9A 3PA3A 3BI6A 4EOLA 5IEYA 4XG4A 1QPEA 1YOJA 3IS5A 2XIRA 3FMDA 4IB1A 4Z9LA 1H1QA 3ZUUA 5DEYA 2OW3A 3D0EA 3ZO4A 4BDCA 5BYLA 1ZY4A 3R8VA 3KIOC 1L3RE 4CRSA 4BDKA 3IW7A 4DGGA 5ANKA 5HO6A 5M09A 3CTHA 5HO8A 3CJFA 2XK6A 4RJ6A 5KMKA 2GNLA 1J7IA 5K9IA 3HA8A 3WIKA 3ENHA 1R0EA 4I22A 3TV6A 3PVGA 3AKKA 3PSCA 4HVDA 3ZHPC 5ANIA 4QYYA 3RM6A 1U54B 4NTTA 4R3RA 1M2PA 2VWWA 5HTIA 4J96A 1M17A 3DAJA 5C01A 3CJGA 4GU9A 3HV3A 5IA0A 4MYGA 3V6RA 4S34A 2O3PA 3ROYA 4MVFA 5FEQA 4IEBA 2RGPA 3NW5A 3DZOA 2XVDA 4PP9A 1KWPA 1SVGA 3BU3A 3LHJA 4QP7A 5HG8A 2QR8A 4RPVA 4C8BA 4D4YA 5I5ZA 4L00A 5AWMA 5JRQA 3A99A 3T8OA 4M7IA 3V8TA 3NW7A 4F0GA 4YU2A 1UWJA 1X8BA 4DHJA 1O6LA 5AA8A 2RIOA 3QZFA 4EKKA 2WB8A 2ITWA 1Z5MA 4U6RA 4J7BA 5FEDA 2YDJA 3QQLA 3VBWA 5IQAA 3FYJX 3LAUA 4V0GA 4H58A 3PIYA 2X8EA 4LYNA 2FSTX 4CMTA 2PE2A 4PY1A 5H2UA 3I5ZA 5B2LA 2I0YA 2C6LA 3ZFMA 2H34A 3GC8A 3GUBA 3LQ8A 2W4JA 1SNUA 4XV2A 1FINA 3R8MA 5C4KA 3NLBA 3MESA 3GU7A 2RF9A 5E91A 2XNPA 5BVFA 3KU2A 3QXPA 2HWPA 2VNWA 4D28A 5H8EA 4DFBA 1MRUA 3V3VA 5HORA 1REJA 4UWBA 4ARKA 1W7HA 3FZOA 3TTIA 4DDGA 2AYPA 3F3ZA 4DGLC 1BYGA 3IG7A 3JY0A 4O6EA 2I7QA 3UZPA 2BROA 1SVEA 3SV0A 3EWHA 1J1BA 2X2MA 4E6AA 4C61A 3DXQA 3F3TA 4L43A 4ZK5A 5CS6A 4RRVA 4PUZA 4U0IA 3Q6WA 5CT7A 5J79A 2W5AA 1O6KA 5LOHA 3O7LB 2ETRA 4E6CA 2HY81 4MQ1A 5J8IA 3GU6A 5DA3A 1RDQE 5EDQA 3F5PA 4G9CA 4L53A 5G6VA 3ZEWA 4D2PA 3OW4A 4F9CA 2Y7JA 4FC0A 3O96A 5HVKA 4GSBA 1URCA 4IDVA 2ZM1A 3UYSA 3Q53A 3QWJA 4GT3A 4CTCA 2W0JA 3MVMA 3I60A 1BUHA 4X6RA 3L1SA 3BWFA 3UDBA 4BZDA 4E20A 4KAOA 2WNTA 2EXMA 5B0XA 3A7JA 4CMUA 1ZZLA 4JBPA 5GZ8A 3QQUA 3I79A 5KBRA 5AIKA 5CXZA 3OXIA 3D7TB 4QTCA 1ZOHA 1OKZA 2BAQA 4ZZMA 3Q9WA 1LUFA 3HMNA 2R3IA 4G31A 4LG4A 4QTAA 4QP1A 4S2ZA 4TYHA 4AZSA 5HO7A 2J0JA 3VS5A 5E9EA 4FV9A 3SDJA 3QQHA 4BKJA 4GEOA 3VONA 3TL8A 3TDWA 2A1AB 4USFA 2QOIA 4KS7A 3TM0A 3CGFA 3U6HA 2PE0A 4I5MA 5JMSA 1O9UA 5ANJA 1YKRA 3PWDA 3VIDA 1Q5KA 5EG3A 5CAQA