3ZFMA

Crystal structure of ephb2
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
279
structure length
248
Chain Sequence
EIDISCVKIEQVIFGEVCSGHLKLPGKREIFVAIKTLTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords EPHRIN TYPE-B RECEPTOR 2
publication title Completing the Structural Family Portrait of the Human Ephb Tyrosine Kinase Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 248
sequence length 279
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zfmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zfmA01
1JBPE 2ZAZA 2Y9QA 3ZZEA 3RINA 2DYLA 3V8SA 3FMDA 3M11A 3QQLA 1W7HA 1J3HA 3ZXZA 1TVOA 5HE2A 1ZYLA 2WTJA 3QXPA 4ANLA 4M66A 4FG9A 2R9SA 2QQ7A 3E8CA 3FKLA 5FD2A 4RJ6A 5DFPA 4CG9A 3GCUA 2ITYA 2C3LA 3PY0A 4C8BA 4YR8A 3TJDA 5AUTA 3P7AA 3BU6A 3CD8A 4EWQA 3NYVA 2ONLC 4H39A 3RHXA 3HAVA 2BIYA 5D10A 3EN9A 5HLNA 1H07A 3PPJA 2YAKA 3EN7A 2XIRA 2Z7LA 3SXSA 4Z7GA 4ANNA 5F94A 1Y57A 3BV2A 4OUCA 3WF5A 3ZLYA 5ITAA 4BWXA 4DFLA 3FUPA 1FINA 5LARA 4D4VA 3W10A 2RG6A 2YM5A 4K18A 4IB5A 3ZBFA 3ATSA 3OW3A 4ACHA 3Q6UA 2JGZA 4QMTA 4PPAA 4I4FA 5CU6A 2CGVA 4H3BA 4FNZA 1OIYA 2W1HA 1RQQA 1V0OA 4PL3A 3GEQA 4FSTA 5DE2A 2J6MA 4GUBA 3IW5A 1WBPA 2DS1A 3TZ8A 4O7ZA 2CN5A 3R8VA 3LFEA 1LPUA 2H9VA 2OH0E 3QZFA 4C62A 4C33A 5EKNA 1XO2B 3PDTA 3MH2A 3R01A 4DT8A 2OF2A 4PUZA 5K0XA 5EQPA 1FQ1B 2Z2WA 4JS8A 5KX8A 3QQFA 5FDXA 5TE0A 5CEOA 1OIQA 5IA0A 2O5KA 3VS1A 2JD5A 1PXLA 4NM5A 4PX6A 3VO3A 4X3FA 2J0LA 3DZOA 3HMNA 3RP9A 1PXIA 4E4NA 5F4NA 2PL0A 4ALUA 3R7YA 2RG5A 2WPAA 3QWKA 4QRCA 3ID6C 4PP9A 1XH9A 3NAYA 2PMOX 4X0MA 5H3QA 4CRLA 4B0GA 2OJ9A 3DLZA 3BEGA 5AM7A 3NNVA 4MXXA 5E4HA 2P2IA 4D2VA 3QLFA 4ORKA 4NCTA 3QTQA 1E1VA 2QKWB 3FLYA 4WO5A 4UXQA 1KOAA 1M14A 3MH1A 5A4LA 3BHVA 2B9JA 3DS6A 3HKOA 4BCKA 5GZ8A 5IU2A 3C50A 3VBQA 3NUYA 4PL4A 1OKVA 5FM2A 1NY3A 5HO8A 4FTCA 4DLJA 3RGFA 3DXPA 5FTGA 3G9NA 4AW0A 3FXZA 3TTJA 4L44A 3WE4A 3PXFA 4B6LA 2WELA 3U9CA 3VS6A 3H9RA 3LCKA 2JKMA 2JKOA 5CU3A 3W2QA 3BPRA 4AN9A 4G5JA 4KNBA 3QCXA 4L46A 1WBTA 3CKWA 3AMBA 4AUAA 4LOPA 3R6XA 4MD8E 4TWOA 5AJQA 2R3HA 5DT0A 4MBJA 5KE0A 2C6EA 3ZRKA 2W0JA 5LVOA 3A7IA 3IONA 3MA6A 4UXLA 2QOCA 2BDWA 2WEVA 3PYYA 4IX3A 1OL5A 4GW8A 4XCUA 4XS2A 3N4TA 4KRDA 3QGYA 3FC2A 1MQ4A 2OJGA 3GC0A 3E8NA 4M84A 2OXXA 4CTCA 3TM0A 4KIKB 3SOAA 3EH9A 4F7LA 3DFCB 4YBKA 4GU6A 4JAJA 4W4WA 3I6WA 5FUTA 2XK4A 3WF9A 3PPKA 4RBLA 2W9ZB 5BVKA 1A9UA 2BHHA 4EI4A 4EQCA 3ELJA 4QTCA 4HOKA 2EU9A 4R1VA 1FPUA 1H1RA 2PTKA 4D1SA 3M1SA 3C4EA 2PK9A 2X6DA 5ETIA 3ORNA 4YSJA 1PRYA 5CSVA 5HQ0A 4ALVA 3PP1A 3PVUA 4D2TA 2WIPA 1OPJA 3QUDA 2QHMA 3DY7A 3RBWA 2XEZA 3I0QA 4OR5A 3A4OX 3RPSA 4ZTMA 4FEVA 1WCCA 2HELA 2G9XA 4HCVA 1XH8A 2BVAA 4ACMA 3SLSA 3V04A 3Q4ZA 1XH4A 2WTKC 3QBNA 4FV6A 4FNWA 4X3JA 3OXTA 4YJSA 3LFNA 3OY3A 5FXQA 3RWPA 3SAYA 4ZLZA 3GCSA 4IAIA 1NXKA 4IACA 4R3RA 3FC1X 3TJCA 3UC4A 1VZOA 3KCKA 1GAGA 3RAWA 1UNLA 2YLFA 3FHIA 3L8PA 1KE7A 1M2PA 4MTAA 4U3ZA 2XCKA 1FOTA 4EH9A 4AE6A 4QMZA 3L9MA 4X7QA 3CXWA 4RX9A 4FKVA 5HBEA 4EORA 4BDGA 5LCJA 2PMNX 4L3JA 4FOBA 3EKKA 3P4KA 4WD5A 4GV1A 3LOKA 4MX9A 5BUEA 5DLSA 4QP7A 3VJNA 3U8WA 4DF3A 2V22A 3SX9A 4O0TA 4FUXA 5CASA 3CS9A 5DEYA 3R22A 4AOTA 5LOHA 4F70A 3FZ1A 5IEXA 4QOXA 5CI7A 4RX7A 4ASEA 2P4IA 3PUPA 1OM1A 2OZAA 4AT3A 1BI7A 2RFNA 1XR1A 4ZTLA 4WBBB 4A06A 3DAJA 4J96A 4GJ3A 4LGDA 4XRJA 4AN3A 2W1IA 3BI6A 1F5QA 1ZOGA 3O51A 4YHFA 3Q4UA 5BYZA 3UOHA 3WZUA 5CEPA 4UX9A 4LV8A 3HRFA 4I24A 3MESA 2C5XA 4IEBA 1W8CA 4DGLC 3PZHA 1L8TA 3ZEPA 4MXYA 4FKRA 4EK3A 3JXWA 5B0XA 3F66A 3ORMA 1WVYA 5HNBA 1HCKA 4GVAA 1RW8A 2XJ2A 5F95A 3RAHA 2RFSA 2XNMA 2HY0A 3WF6A 3ZUUA 2W4JA 4IM0A 3KULA 4WA9A 1BI8A 1YOLA 4EOIA 3NUNA 4M69B 5AP1A 1OBDA 2YAAA 2R3RA 5KKRC 1IASA 4G3EA 2B0QA 2IVUA 3D15A 4U7ZA 2OH4A 4ZZNA 1R0EA 3PIZA 4YJTA 3D9VA 2W5AA 1EH4A 4S34A 4XRLA 1SM2A 4DEAA 4EHEA 4F7JA 3PVBA 2J4ZA 3PXRA 4X21A 4UWBA 4F7SA 1CMKE 4C02A 4LMUA 3MSSA 1QL6A 2GS2A 4FUYA 2P0CA 3QUEA 5I9WA 2BRGA 4XOYA 4FTMA 4M3QA 2PVYA 2GS6A 3LXPA 3RWQA 2HK5A 3POOA 4TTHB 5HD7A 4YC8A 5AX3A 4CFNA 1IA9A 3BZ3A 2PUNA 4O0YA 3A99A 5HTIA 4DH3A 1ZXEA 2CNVA 3RI1A 5M56A 4HNFA 5E1EA 4AN2A 1OZ1A 3QHWA 3HRBA 2XKDA 1DAYA 2XKEA 4DH8A 3SDJA 4O7SA 2VTPA 4G3DA 5FTQA 4I0SA 3VW8A 3EMGA 3GOKA 4TYJA 3HL7A 1UU3A 4ITIA 5EM8A 2G2IA 4TRLA 1O6LA 2PVMA 1YHVA 4DEHA 3CTHA 4MNFA 3PVWA 4FTUA 2WGJA 2X7GA 4I4EA 5JQ8A 4EOJA 2EWAA 4UV0A 3GQIA 4BI2A 5E8SA 3EQIA 1HOWA 3R8MA 2VO6A 3G5DA 3F6XA 4APCA 4BTKA 3A7JA 3JY9A 4I5PA 4E20A 4YJRA 2C5YA 2OICA 5IEYA 2IO6A 5D9HA 3FMNA 1PXOA 2BHEA 4OTIA 5EM7A 4I1ZA 3KXNA 3EFKA 3NWWA 4AZSA 5D7AA 3O50A 3QX2A 3NUAA 2WMAA 1JAMA 3Q9WA 2GHLA 4JR3A 2WFYA 3QALE 5L4QA 3LFAA 4FR4A 4O7LA 1U4DA 1CKIA 1PXJA 5HCYA 4H1MA 4F6UA 2X8DA 4DCAA 5LMKC 5AUVA 1JKKA 2VX3A 4M13A 4EYJA 2NP8A 3FI2A 3E7OA 1URWA 3VBXA 4EUTA 3Q5ZA 5L6PA 5AP0A 1XBCA 3PXYA 1ZAOA 3LQ8A 2GNJA 5HZNA 5IQGA 2EXEA 4I0TA 3F3VA 3TIYA 2H96A 4FKJA 3PVGA 4FYOA 4R6VA 4BYJA 5KMIA 4JG7A 3SG9A 2I1MA 4RZWA 4YTFA 1JPAA 3NRMA 1XBAA 1P4OA 2BROA 4DLIA 1OMWA 5J5TA 5B2LA 4C35A 1OKYA 4MCVA 1ZARA 2BAJA 4MXZA 1YXSA 3LPBA 3VS4A 1FGKA 3LM5A 3KY2A 4IHPA 4OBPA 2BDJA 3W33A 3UP7A 5CVGA 4BWKA 4ERWA 2BPMA 5E92A 3ZLSA 1NVSA 4JJRA 2R2PA 1ZY4A 2A2AA 2UVYA 3PWYA 2YISA 3ORZA 2PMLX 4JBPA 3R63A 4N6YA 1UNGA 4O27B 1QMZA 2BZIB 2ZMDA 3NNWA 3U51A 2NRYA 1H0WA 2B4SB 3Q52A 3QQKA 3T9IA 2VTQA 5GJFA 2E9NA 3IGOA 3OHTA 4FV9A 4YC6A 1ZMVA 2X39A 4D1ZA 4CLJA 4PWNA 4TPTA 3BE2A 4XP3A 3A4PA 3OT3A 4EH7A 3KXXA 3ORIA 4BGHA 4DN5A 3E8EA 4QT1A 3AQVA 3PG3A 3ODZX 5EW9A 1YRPA 3F61A 2OI4X 5D12A 5BVEA 4C2WA 5J9YA 5DRBA 2BRHA 4PMPA 4UWYA 2XMYA 4ZSJA 5GINE 4XG6A 5HE3A 2CKOA 4CCBA 3RAKA 4YO4A 2OFVA 3MH3A 2PE0A 4BZNA 5JSMA 4RA4A 4FEWA 4FKWA 3QF9A 3DGKA 4A9RA 4F1MA 2SRCA 3MJ1A 4EUUA 3D94A 2YM6A 3CR0A 3DFAA 2IW8A 3RAIA 5I9XA 3PLAE 4AZTA 4RMZA 1XH6A 5C8NA 2F9GA 4D55A 4KSQA 5IQIA 3I79A 4XNEA 1PKGA 5D41A 2HXLA 4AQCA 3NW5A 4O82A 4H58A 4M67A 4QMPA 4ZSLA 5AR7A 1B38A 4WHZA 2GTMA 3SGCA 3VBVA 1B39A 2IVVA 4Z9LA 4FV3A 3FY2A 1BUHA 4O0VA 3L8SA 2YA9A 4CT2A 2VWYA 3LJ0A 3D5UA 5I9UA 5LXMA 1YXTA 3PLSA 4RLKA 3EQRA 4BDIA 4NJDA 1H0VA 3GC7A 5EW3A 4TNDA 3FMJA 2G15A 2YDKA 1YOJA 4C4FA 2Y4IB 4DFZE 4QQCA 4EOKA 3BX5A 5B2MA 5IDNA 4D2RA 4IVAA 5AP2A 4ANMA 2CJMA 3S4QA 3G0EA 5C4LA 5CYIA 3SRVA 1KV1A 1MRYA 4YZ9A 3RNIA 3NYOA 4FKLA 1SVEA 3D4QA 5KCVA 2PZRA 5I4NA 3FHRA 4QPMA 2AC5A 5BVDA 5CALA 4ASXA 3KXMA 4FV5A 4BDAA 2A27A 3QUPA 5IISA 2W1GA 2UZTA 5CEQA 4DG3E 4KIQA 5GZ9A 5DGZA 3BLRA 4HCTA 2ZDUA 4O91A 4RVKA 3RHKA 3ZXTA 2I6LA 3C13A 3HA6A 4CYIA 1KOBA 2VTOA 5A3XA 3W8LA 4ZK5A 3R00A 2KULA 3IOPA 4ENYA 5C4KA 4EH8A 5AA8A 4QMOA 3R8UA 1WBSA 4RFMA 4LRKA 3UPXA 2AC3A 2QO2A 3CGOA 4GT5A 2CGXA 4BBMA 3F7ZA 1UWHA 5J1VA 4EHZA 2VGPA 3KMUA 2CNQA 3A60A 2F7XE 3HUBA 3ZSGA 4FKQA 4O6LA 4TW9A 1H26A 3AT4A 4BN1A 2C6DA 4X3FB 3IS5A 4II5A 3KRXA 4D0XA 4J97A 2KTYA 3QLGA 2YWVA 4N57A 4QTBA 5KMLA 2REIA 1I44A 3RKBA 3M42A 3FSFA 3HGKA 1Q5KA 1WZYA 1GIHA 5DEWA 3WZKA 3Q4TA 4E5WA 4E4XA 4O96A 3A61A 4GFOA 4WG3A 2VWWA 5T68A 5M51A 4G3FA 1SVHA 2R3OA 4QMXA 5HO7A 3DT1A 2C30A 2DWBA 4CMOA 3DOGA 4FTRA 2C0TA 4R7HA 4RJ7A 3JUHA 3W2OA 1M7NA 2UUEA 3DKOA 2X7FA 4NIFB 3R9HA 1SZMA 3RPVA 4E26A 3PA4A 4GFMA 3ZO3A 3F7WA 3W55A 4FIEA 2QONA 2W5HA 4X2FA 2E9PA 3ETAA 3UC3A 1K3AA 4L43A 4CQEA 1KWPA 3ZBXA 3UOJA 3FV8A 4QTAA 3OEZA 5IQAA 3MTLA 3VC4A 2P3GX 3R73A 4ZJIA 4U42A 1XH5A 4A7CA 5I9ZA 2IG7A 3ACJA 4KKEA 3RK5A 1J7UA 4GEOA 1ZOHA 2BZKB 4AU8A 3FL4A 5J95A 5HX6A 3CCNA 4L68A 4L7FA 2A19B 4QP2A 3LMGA 4UEUA 5GNKA 3H30A 4BR3A 1E9HA 3HECA 2C6LA 4HGEA 1YKRA 3C5IA 1J1CA 3TT0A 2IVTA 3F88A 4O86A 4FZAB 4FX3A 2IN6A 4Q5EA 4GT4A 2ESMA 5HCXA 2ZV2A 3PY1A 3R7VA 5JZJA 2QNJA 4JBVA 2QR7A 2ZV8A 2X2KA 3P0MA 3FZSA 2QU5A 4HYSA 4MXCA 4ASDA 3AC2A 5K4JA 2XNGA 2C4GA 4GS6A 1G3NA 4K11A 3UMWA 5A4QA 5KMJA 3TUBA 4RWKA 2W99B 4YZCA 4HPTE 3BYVA 3OCTA 3PY3A 5C9CA 5JK3A 4YJNA 1ZWSA 4CKJA 1JSUA 3W32A 4JVGA 2WMVA 4QMWA 3FLQA 3RCDA 5HBJA 4CFVA 5E91A 5HE1A 2XYUA 2QU6A 4MWHA 3FMHA 4DEBA 2BDFA 4DGMA 4EHVA 1REKA 2F4JA 3PXZA 4JDIA 5TT7A 5HX8A 5KNJA 2YIWA 3MS9A 4BIDA 5CVFA 4QO9A 4AF3A 2CKQA 2J0JA 5DR9A 4WRGA 3MYGA 2CKEA 4R7IA 1VYZA 3HMMA 4V01A 4ACDA 3IPHA 4ITJA 1UKHA 4C38A 1DAWA 3FZOA 1KE9A 1OL6A 4I5CA 1H1PA 4DITA 3B8QA 4O7WA 3LIJA 2XNPA 5K0KA 3SW7A 5M06A 2HZIA 1XH7A 2DQ7X 2BZHB 4D5HA 5T6KA 1QPJA 4FTAA 4JDHA 4G1WA 4DA5A 4M15A 4S31A 4UMTA 2R3QA 2VX1A 1M52A 3AGLA 4U8ZA 3NAXA 3UDBA 5CSPA 5AIRA 1PHKA 1ZYCA 2UW7A 3PA3A 2CKPA 3R8PA 3T9TA 4AS0A 1H25A 1ZMWA 2C5VA 2C0IA 2W05A 4LGGA 2XZSA 3V3VA 3HV7A 1Q3DA 3P9JA 5AAGA 2YCQA 2B54A 2X8IA 2OO8X 3LCOA 2R3FA 4WOVA 4C37A 5HBHA 5DOSA 3U6HA 3W2CA 1WVWA 5IZFA 4TNBA 4GH2A 4IZAA 2VTTA 2ZDTA 1NA7A 4FSNA 2OZAB 5AUYA 4RVTA 4C58A 2PU8A 1PXKA 1WAKA 2UVZA 4V04A 2XK3A 3K3JA 5LMAA 3DLSA 4RQKA 3BYUA 2O2UA 3BWFA 3G51A 2PHKA 4F7NA 3LW0A 2YM3A 4XV2A 3K5VA 4Y85A 4XYFA 3LFDA 5DVRA 4F0IA 3TEIA 2YITA 2YM7A 5M44A 2VTJA 2QOQA 1ZYDA 1U46A 1AD5A 2C1AA 2IWIA 1JLUE 2WNTA 3A7GA 2W4KA 3CKXA 3MDYA 4FKPA 4FODA 4BFMA 3ALOA 2QC6A 1CTPE 3N9XA 1M17A 3UO4A 3D14A 3MN3A 4K33A 3W2RA 2FYSA 5AP7A 1J7LA 2YIYA 1H00A 4DTAA 3ZUTA 2X4ZA 4YLLA 4RWJA 2PULA 4BGGA 4ZTRA 3S1HA 3PJ8A 2YDJA 4LOOA 4XG3A 3RZBA 3R7EA 1J91A 2WMQA 2XH5A 4QMVA 4UYNA 1SMHA 3PXKA 3TUDA 3PJ3A 4JBQA 5ANJA 5HIBA 2C5NA 4QYYA 5AUZA 2BTRA 2XBJA 4FBXA 5FBNC 3V5PA 5IMXA 3NSZA 3WIKA 3ZYAA 3BHYA 1YHSA 4W4YA 1PXPA 2GTNA 3LAUA 3ZTXA 3OCGA 5E1SA 3LFFA 1UU9A 4KA3A 5CAOA 4A9SA 2YCSA 2CNUA 4M12A 4P5ZA 5FP6A 1KSWA 3Q3BA 5IDPA 2ZM3A 3WZJA 3EQHA 3P7CA 4EH3A 5HIEA 2ITPA 5LVLA 3E3PA 5IPJA 3ULIA 2XIXA 3KEXA 4AW5A 3FBVA 2JKQA 4KIOA 5IG1A 2RFEA 5IH5A 5JEBA 2VN9A 5HORA 4DG0E 4JQEA 2WOTA 2G1TA 3GXLA 2UW3A 3FPQA 2VTLA 3A8WA 4IZ7A 3U6JA 4I20A 2BUJA 2QKRA 2YLEA 3C1XA 5EH0A 2R0IA 3ZEWA 4B8LA 3FWQA 5CAQA 3AD4A 2C5OA 1J7IA 3MY0A 4U41A 3HVCA 4FK3A 1ZLTA 3HUCA 4S2ZA 1Y91A 4R77A 4LFIA 4OBOA 2WQBA 5EDQA 5F1ZA 2R3KA 4BTJA 5J7BA 2Q83A 1XJDA 3PFQA 2PSQA 4BCHA 4C61A 1DI9A 3GVUA 5LVMA 1F0QA 2VTHA 5M09A 4DHFA 1OUYA 2XA4A 4U6RA 2XIYA 4BCNA 3BBTB 1Q99A 2Y8OA 2ZM1A 3Q60A 3CBLA 4GUEA 2HWPA 2QO7A 5EQEA 2ERZE 2G2HA 4FIFA 2WKMA 5M53A 3NW6A 2BCJA 1YXXA 3NPCA 4QPSA 4IB3A 3BV3A 1NVRA 3G33A 4GK4A 5FM3A 4ERKA 5ANDA 3AC5A 3COKA 3FQHA 4D4SA 4UMPA 3KRLA 4ZS0A 3EHAA 4TT7A 4D9UA 1YDTE 3I81A 4I94A 4OAVB 4H3QA 1OBGA 3EYGA 4KABA 3QKLA 5AV3A 2BRMA 3UYSA 2PY3A 3O71A 5JH6A 3WBLA 4MQ1A 1STCE 5HG7A 2FGIA 3IW4A 4G31A 3FMEA 3R9OA 1UA2A 2B7AA 3ZO1A 4DTBA 5J9LA 4HCUA 2PMIA 4HGSA 3WZEA 3O17A 3R7GA 2P2HA 2F7ZE 2ZB1A 2VTIA 3ZRMA 3MGYA 4I23A 2WU7A 4GFGA 4FIGA 3IW7A 4F08A 1Q3WA 4FF8A 4O21A 3TKUA 4C4JA 3FYKX 2FSLX 3GCQA 2ONLA 3R71A 3H10A 1S9JA 5FDPA 1QPCA 4MD7E 3FE3A 2VNYA 3KMWA 3R1QA 3DXNA 3BYSA 2F49A 4D2WA 3PPZA 3EQFA 4FT0A 2XNBA 3T8OA 3ENHA 3O8TA 3EJ1A 2O3PA 4N4SA 3WYYA 2IJMA 3FZRA 3P79A 4BVUA 1O9UA 4FSUA 2YJSA 4HVIA 4L01A 2JC6A 1H8FA 4WNOA 3UP2A 3H3CA 5E90A 4MF0A 3CIKA 4TZRA 3VUTA 4BZDA 4WKQA 3S95A 3QCYA 4GSBA 2LGCA 1U54B 2Z7SA 3T3UA 4DFYA 4QMUA 4I3ZA 3SXRA 2GSFA 3NUPA 4MYGA 4GRBA 4MQ2A 4O0WA 5CI6A 4DCEA 4EK8A 5CAUA 3C9WA 4DG2E 4KSPA 3FEGA 3AC8A 3W1FA 4PY1A 5KUPA 2C6TA 5GIOE 3N4VA 3MVMA 3ZOSA 3QTSA 3OG7A 4QYFA 4AACA 4UN0C 3KL8A 3QRUA 3N4UA 5J79A 4XBUA 4Q5HA 4TN6A 3NEWA 4EHGA 4PTEA 4ZTHA 4ZTNA 3ZFMA 5M07A 2OXDA 4Z16A 3WI6A 3TZMA 3DK3A 4CT1A 3OS3A 4O0UA 2X9FA 3GFWA 2YN8A 4I6HA 5J87A 3TG1A 1T46A 4XV3A 5IMEA 4AGCA 4NWMA 3DK7A 3D7ZA 3M2WA 5I5ZA 4XUFA 3OVVA 5AP3A 4FG7A 2R7IA 3KCFA 1ZMUA 1GZOA 2HYYA 3UG1A 5BVFA 1WBOA 2PVRA 2W4OA 3EOCA 5E8WA 4EK6A 3DBDA 4L3LA 4O0SA 3OCBA 3THBA 2OBJA 3VWAA 2VO3A 4JDKA 4E3CA 4FNYA 5A54A 4I22A 3IKAA 2W1CA 3F5PA 4ZSGA 5EFQA 1XWSA 2UW5A 3Q9YA 3WYXA 5EW8A 3MH0A 2B9FA 2QOFA 3R1SA 4RGJA 3V5WA 4R5YA 4CRSA 2BMCA 3IK3A 4B99A 3P86A 3FKNA 4JBOA 3MWUA 4PPCA 4FKSA 5JFSA 4C3PA 3DU8A 4DGOA 4CYJA 2BFYA 4WNMA 4NKAA 1OITA 2JKKA 4BRXA 2YM8A 4FK6A 4QP4A 4BL1A 3I6UA 5E8XA 2DUVA 4W4VA 4DEGA 5JMSA 4FVQA 4P90A 1S9IA 4ZXTA 4LI5A 4ANQA 4C7TA 3I5NA 4BKJA 1MUOA 4IZ5A 5E7RA 2R3JA 3R83A 3KA0A 2BRNA 3GU8A 3R2BA 5M57A 3A7HA 4TL0A 3JY0A 4KB8A 2GNIA 4IX4A 1R39A 3ZO2A 5A6OA 5K5XA 4YTIA 2I0HA 2O63A 4HVDA 4CFXA 4CMTA 5ANKA 2JITA 2PVFA 3AMYA 4IM3A 4QMSA 5CENA 5AV4A 2UZLA 3H9OA 4DGNA 1FVTA 4FA2A 2VTNA 5FG8A 1OUKA 1UKIA 2PZPA 3QD2B 3FXXA 5CT0A 3ORXA 2XCHA 4BCFA 4UZHA 3HLLA 4BCIA 5CF5A 1H27A 2C3IB 4UYAA 4W9XA 5JGAA 5T3QA 4W8DA 4W4XA 4ZOGA 5LVPA 3I1AA 1JKTA 4TWCA 3ZSIA 5L2WA 2XK8A 4FGRA 3R1NA 4BDCA 4CTBA 3ZZWA 2VWIA 4RIWB 3QAME 5BVNA 5DR6A 4I5MA 1YI3A 4PTCA 1RDQE 4GKHA 3VS5A 1Y8YA 5HO6A 2GS7A 3C4FA 4CZUA 3PG1A 4FTOA 5HOAA 1PMVA 3VS2A 4PDOA 2G01A 5EI6A 2FSTX 4D4RA 3NZ0A 4EK5A 5CS6A 4IFGA 5JQ5A 4NH1A 5EHLA 4XBRA 3WIGA 1A48A 2E9VA 3R30A 4XJ0A 5H9BA 1M2QA 3BGPA 2C6MA 4O22A 2QCSA 2JFMA 3V8WA 2JFLA 2HENA 4F99A 1YI4A 5L2TA 4J71A 2XK6A 2XB7A 3ORTA 5ANOA 3TWJA 3PXQA 4MNEB 1BLXA 4XP2A 5H8BA 4BI1A 4DTKA 5AUUA 4EONA 2GHGA 2GQGA 4WG4A 1BYGA 3DKCA 3ORLA 4GYGA 4IC8A 3FI4A 1KV2A 4CXAA 2UZEA 4RIOA 3CQWA 1YXVA 3FLZA 1GZNA 4RFZA 2PE1A 4PMMA 4XLIA 4Y73A 3KGAA 4FG8A 4QYEA 2EB3A 3W18A 4AG8A 4BDHA 1YVJA 2XEYA 2JBPA 3EIDA 3LZBA 4ANSA 4O7NA 2J50A 3DB6A 4NFNA 5HEZA 2GMXA 4F0GA 3SG8A 4IVCA 1PXMA 3ULZA 4N70A 4JX7A 1Q8ZA 4TWNA 3OY1A 3NR9A 3HDNA 3U55A 4FV0A 4JQ8A 3RNYA 3IQ7A 1GJOA 3C51A 5BNJA 2WMXA 5CQUA 2Q0BA 4FSZA 3SA0A 1UNHA 3UGCA 4F9YA 3NGAA 3PRIA 4XLVA 2I0EA 4NW5A 4ZJJA 5DA3A 4FSMA 5L6WL 3ZC6A 3EQPA 3OXIA 4U45A 1F3MC 2CHLA 4HZRA 2OJJA 2YEXA 3IDBA 5LQFA 4CGAA 5D11A 3KVWA 4YJPA 3S00A 2OU7A 3NUSA 3MTFA 2QO9A 3G6GA 2CMWA 3ZRLA 5HVKA 5AUWA 3DB8A 4OTDA 4ANOA 2HZ4A 2UZDA 2OK1A 2WQNA 3CY2A 3BLHA 2GNFA 4LL0A 2P33A 3U4WA 3VS7A 3OUKA 3QA8A 4I6BA 2QOOA 3QYWA 2RFDA 5DT4A 4FV2A 5EG3A 3HV5A 2O8YA 2RGPA 5EOLA 3GFEA 4RVMA 3GOPA 5E8YA 1ZYJA 2B9IA 4PRJA 5ACBC 5M4IA 2W1FA 4ZZOA 3BKBA 3OT8A 3AD6A 2C6IA 3CE3A 5K4IA 2BIKB 4KBAA 2I0YA 4ZP5A 5F9EA 5HNGA 1BL6A 1QPDA 3SXFA 1M2RA 3CSVA 4D4YA 4U9AA 4CVAA 3BEAA 3H0YA 4HZSA 4ZMEA 1I09A 2QD9A 4MH7A 2XNNA 5IEVA 5KMNA 1MP8A 2PPQA 3UQGA 4UB7A 4L9IA 3A2CA 5K5NA 4TYHB 3FDNA 1CSNA 2Y6MA 2WTWA 5CU0A 1FVRA 1SNXA 3QD3A 3QX4A 4P5QA 5A4EA 1H01A 3OROA 1R1WA 2W1ZA 4BCMA 4DC2A 3GU7A 3WF7A 1Q62A 3JVSA 3QYZA 2YZAA 3NVKI 4LV5A 3ODYX 3HV6A 4BTMA 2EB2A 1FGIA 4F6WA 2X1NA 4J8MA 5CSXA 2ZMCA 3TL8A 2UZUE 4YHJA 5FWKK 3FQEA 4ITHA 4MXOA 2P55A 2V55A 2IZUA 4BICA 1VYWA 3E7VA 3TI1A 4IE9A 4HYHA 5LMKA 4FV4A 1H1WA 2UZVA 2J5FA 2O65A 2ITVA 4LUEA 3VS0A 3VUKA 5B7VA 4O0RA 5ETCA 2X9EA 3O7LB 2Z60A 4BKYA 4GMYA 1K9AA 5L3AA 1QCFA 4K9YA 3LMIA 5CF8A 4BHNA 2R4BA 3NX8A 3BLQA 2JDRA 2OIDA 1YDSE 3FXWA 4D28A 3NMUF 3SD0A 4C0TA 4E5AX 3F3TA 3MVHA 4RX8A 4MD9E 3ZCLA 3F2RA 4L45A 4ZY5A 2QLUA 3HEGA 5KMOA 4ONAA 5FTOA 3BGZA 3JYAA 3TZ7A 5CAPA 2PVKA 2W1EA 3HA8A 3D2KA 4BI0A 4TY1A 3IDPA 4OLIA 3KRJA 5IA3A 3QZIA 3FYJX 4AZWA 4LOQA 5M55A 2F57A 4EOSA 4F64A 4L52A 4D58A 4YGAA 4FZFB 1H24A 3NW7A 2J90A 4Q2AA 3VHEA 5EYKA 2R7BA 5AV0A 3DKGA 4E73A 5EYDA 4H3PA 5BYLA 3OOGA 3MPAA 5HU9A 2XS0A 3OP5A 4L67A 5C27A 4APPA 4P4CA 5BMMA 4MEDA 4YSMA 4F6SA 3I5ZA 4ARKA 4K1BA 4KIKA 4RZVA 3A62A 3VIDA 2QODA 5JN2A 3BGQA 1X8BA 2YIXA 5KHWA 5HVJA 3ZDIA 4FT3A 2RSVA 4XG7A 2EXCX 5IQFA 4FT9A 3GB2A 4MKCA 4HNIA 2FUMA 3JVRA 1JWHA 5L2SA 5L2QA 4EOQA 4CFFA 2R64A 2JDTA 3MV5A 3QCQA 4U0IA 3EQDA 3GUBA 3VF8A 1E1XA 2W1DA 5H8GA 2FSOX 4L00A 2X8EA 2WHBA 3AC1A 3B2WA 3NS9A 4YUQA 4O2ZA 1H4LA 4RRVA 5FGKA 1JSVA 4FEQA 5H2UA 4IZYA 4EZ5A 5AP5A 3V5TA 3SOCA 3VNTA 4D5KA 4DAWA 1GIIA 4X2NA 3W2SA 4OGRA 4ZLYA 5BUIA 2VO0A 4QP1A 3AG9A 4IFCA 1CKJA 4GK3A 4YTHA 3HV3A 3A8XA 4WNPA 4BDEA 3O8UA 4RJ3A 4PMSA 3I7CA 4GJ2A 1NW1A 1WBWA 1TKIA 4IXPA 4LMNA 4M68A 4O7VA 3R1YA 5C8MA 4FEUA 4YLKA 3CLYA 5AR8A 4A9UA 4YTCA 4RQVA 5DWRA 5LJJA 4JIAA 4CKRA 3C0GA 3GQLA 4AWIA 5DG5A 4QP9A 4AOJA 4D0WA 5E9EA 4FKOA 4J53A 4RJ4A 1GZKA 4YO6A 5G1XA 3FSKA 2RF9A 5HESA 5AAFA 4XV1A 3ZM9A 3SHEA 2B55A 2F2CB 2ITNA 1H1SA 2EUFB 2VTRA 1B6CB 3F9NA 3TNIA 4PMTA 4BIBA 5EDRA 2GQSA 3UZRA 4F1TA 1YOMA 1Q8UA 4KBKA 2R3NA 3OUNB 1H08A 1PMNA 2HAKA 4WG5A 3R04A 4ZIMA 4EKLA 3ZHPC 4E6AA 3MY5A 4KWPA 2YIQA 2OIQA 1XHAA 3F69A 4X6QC 4Y72A 1Q41A 4BTFA 4FIIA 3V5JA 3FLWA 4J99A 5BQ0A 4LRJA 3S2PA 4U97A 3VRZA 5IA4A 5IH6A 3KREA 1JKLA 3ROYA 3NYNA 4K6ZA 2C6OA 3MFTA 3DAEA 4JG8A 5HG8A 4YBJA 2UVXA 5HD4A 1Z57A 2WEIA 2QURA 4NJ3A 2X4FA 4HYIA 4IDVA 2OZOA 3KB7A 2GCDA 3C0HA 4IB1A 4PNKA 4MF1A 2YWPA 2FVDA 3P08A 3NNUA 4Y83A 4FSRA 5KO1A 5FQDC 4F1OA 4CZTA 5AAEA 2XIZA 4F63A 5I9YA 3TDWA 3DAKA 3CQEA 3LVPA 3DJ7A 3DNDA 4OBQA 1WMKA 4I93A 1DS5A 5L8JA 3TV7A 1Q8YA 4QMMA 3HMPA 2XYNA 3EQCA 4K77A 4NL0A 4EBWA 4U40A 2JIVA 1LP4A 3OF0A 2V0DA 2Y4PA 3DTCA 4C34A 2QOHA 3QKKA 4PDSA 3PRFA 3HRCA 5LWNA 4BKZA 1XKKA 5A9UA 1KE5A 4MBIA 2QR8A 4UWCA 3ERKA 1MQBA 4UMRA 4HYUA 5DMZA 3FI3A 3HYHA 1ERKA 3UPZA 3IW6A 4USEA 2H6DA 3FLNC 2XNOA 5DBXA 3C5UA 4NUSA 1TQMA 3MB6A 4TYEA 4QMNA 4OAUC 2AUHA 4AOIA 3QRIA 5L8LA 4O83A 1UU8A 3FY0A 3O0GA 4DT9A 3ZLWA 4YJUA 4D2PA 1LUFA 3QRTA 2J51A 5HI2A 4G6NA 4C3FA 5EHYA 2ZV7A 3LXNA 3F2AA 2GHMA 2WMSA 2E9UA 4XV9A 4JR7A 3MFRA 4Y5HA 4YZMA 5ANEA 5EKOA 5FEQA 3KQ7A 2ZJWA 2WAJA 3DBQA 4NTTA 2J0KA 4KRCA 5EQYA 2WIHA 4V0GA 1YI6A 2VGOA 1KUTA 2OIBA 4FV1A 3UVQA 4PL5A 1UU7A 4FKUA 3RJCA 2C68A 4G9RA 2A4LA 2FH9A 5LWMA 5JT2A 3TACA 3COHA 3NVMB 4U81A 4KUJA 4N0SA 3AGMA 4EOOA 3T3VA 3Q96A 1Q61A 2HIWA 2PVJA 3ACKA 3B8RA 4J1RA 1IAHA 4NTSA 4NM7A 2RL5A 3OFMA 3AXWA 4DEIA 4G9CA 4OTGA 4XHKB 2WTKB 3NYXA 1ND4A 3RZFA 2WMWA 1YWRA 3ZFYA 4RJ5A 4E5BA 4Z3VA 1HCLA 4GG7A 5HTBA 4G16A 2YACA 4CLIA 3Q32A 4IMYA 2GNHA 5JGDA 3LCDA 4K0YA 5AM6A 2ZM4A 1U59A 2OJIA 3E5AA 2XF0A 2QI8A 3GC8A 1W98A 2BAQA 4IX6A 4NYEA 4FTIA 5CT7A 3MJ2A 4ZSAA 3TCPA 3H4JA 4CZYB 2QG7A 3KULB 2WMBA 4IAAA 4RC2A 5CU4A 3R9DA 2BALA 3OTVA 4ACCA 1PKDA 1V1KA 2YDIA 4EC8A 5LVNA 5E8ZA 1OIUA 1G5SA 2OF4A 2WU6A 4QP3A 2X0GA 3VHKA 3TN8A 5G6VA 3KRWA 4G6OA 2YFXA 2V7OA 1CDKA 4JOAA 4C4HA 4EYMA 2OWBA 3QD4A 2OFUA 2VTAA 4J8NA 4TYIA 4U5JA 3ROCA 4BCJA 4XX9A 4AAAA 4FTNA 4AX8A 2OSCA 4CFWA 4PF4A 2CPKE 1GIJA 2HXQA 3CD3A 5CEMA 3GNIB 5TR6A 3PJCA 1PYEA 1NT2A 4D9TA 1WBNA 4AZFA 4UZDA 2GFCA 4U3YA 5DT3A 3QTZA 2XJ0A 2VWUA 3P5KA 2QOIA 3TTIA 3QKMA 4AGWA 4WSYA 3EWHA 3LXKA 4IWOA 2R3PA 3V5LA 4O0XA 4TWPA 3ZMMA 3GENA 3OWKA 5KBQA 4OTRA 5CWZA 4G3GA 4J7BA 1W82A 4ZEGA 5TO8A 4FEXA 2Y4IC 4AA0A 5CU2A 2PUIA 3EB0A 3AMAA 3OWLA 3NCZA 4FTTA 4QP6A 1OVEA 5JRQA 3DK6A 4WBOA 4ZS4A 5AR4A 4DFUA 3QWJA 2GNGA 3E92A 5KKRB 3C4WA 5M08A 3QQJA 3TZ9A 3E63A 1YW2A 1Y8GA 4FV7A 5ICPA 5J1WA 5IQBA 5HG5A 4CFMA 3JR1A 3VUIA 4RPVA 4HVHA 3CTJA 4IADA 5DNRA 4BWPA 2V7AA 2XK7A 5HICA 3SC1A 2OLCA 2X81A 3DDQA 4L3PA 4TXCA 4Y46A 1JKSA 4CKIA 5J5SA 2PZYA 2UZBA 3EFJA 4MXAA 5M4CA 5D7VA 3GT8A 5EI8A 1KE8A 2EXMA 3G0FA 4BHZA 3LMHA 3TNQB 3DKFA 2C1BA 2F2UA 3G90X 2Y7JA 3OXZA 4L8MA 4KBCA 2Q0NA 3O2MA 1P4FA 3L9PA 4ID7A 3NNXA 3QXOA 4X3FC 1ZYSA 4CSVA 1TQPA 3JS2A 2XUUA 1SVGA 1OPKA 4QYGA 1RJBA 4A9YA 3GBZA 1BL7A 3DTWA 4MK0A 5DI1A 5JRSA 3Q5IA 4I21A 2NO3A 2NPQA 3HP5A 4RIXA 2XJ1A 5CXZA 5EYCA 2FA2A 5L8KA 3QTRA 3R2YA 2XKFA 3CY3A 3BHUA 4CV8A 3BYOA 4R7BA 3FMLA 2IPXA 4JAIA 3SW4A 2BILB 4NCTC 4RC3A 3F3WA 3D5WA 3KVXA 2C3JA 3L8VA 1PMEA 5L6OA 4NSTA 5FBOA 5IQDA 1Q24A 4JDJA 4IM2A 5L2IA 3QZGA 2CGWA 1VJYA 5GIPE 1P14A 2WD1A 3BQCA 4FNXA 4DH5A 2J2IB 4UMUA 5GZAA 5GJDA 2VRXA 4NU1A 5FRIA 1W0XC 4BCOA 4EJNA 3UQCA 1PYXA 3SV0A 1OGUA 5IQCA 4R3PA 4BB4A 2ITOA 3ANRA 3II5A 4IAYA 4E4LA 4GYIA 3QTUA 1ZRZA 5AV1A 4AGUA 4ZY6A 2Y6OA 1UV5A 4RJ8A 4D1XA 2O0UA 4DEEA 3DPKA 3VUGA 4XOZA 4IDTA 5DH3A 3OWJA 4G6LA 3NUXA 2A0CX 4EOPA 5E8UA 1U5RA 2QOBA 3G2FA 5BMSA 4FKTA 4HVSA 3QHRA 5CVHA 3UJGA 3TXOA 1OL1A 2HW6A 4XG9A 2R3MA 3VAPA 4EWHA 3CGFA 3NIEA 4YP8A 3KK8A 2PE2A 4QPAA 2XNEA 4E1ZA 2BRBA 3LCTA 4S30A 5H8EA 3RCJA 2OW3A 4NIFA 4LL5A 3OWPA 3QRJA 4DBNA 1H28A 3ENMA 4LG4A 3W2PA 2CDZA 3AOXA 3I0OA 3LLTA 4BBEA 4CEGA 5I0BA 4ENXA 3OTUA 4HJOA 4CG8A 5KHXA 4RA5A 3RK9A 2QOKA 1OECA 5J8IA 4XG2A 5HU3A 4GIHA 3R7UA 4X6RA 1IAJA 4FZDB 4BDBA 2UW6A 5E8TA 2YERA 4DFNA 3LE6A 1O6YA 3FLSA 1PXNA 4YJVA 2H34A 3SVVA 1IA8A 3EN4A 1J1BA 3L8XA 2IZTA 4X2JA 4L42A 4BCGA 1NVQA 4FKIA 3VULA 1R3CA 4FVRA 3ATTA 1KE6A 2A1AB 2UV2A 3HAMA 5E8VA 1UVRA 3QQGA 3CQUA 2C6KA 4QYHA 4WUNA 2ITXA 1BX6A 3K2LA 4U43A 4LGHA 4AA5A 5AFVA 3PE2A 3LM0A 4YC3A 4DFXE 3SRVB 3BRBA 5C03A 2V62A 3PSCA 4FSWA 1P5EA 5KMMA 3UMXA 5BVOA 5DHJA 1FBNA 2YHVA 1CKPA 4GCJA 3TDVA 2WOUA 4BDDA 3DDPA 1PMUA 2AYPA 3ZFXA 2WTIA 3TV6A 3VF9A 4G2FA 4A4OA 4IAKA 1OPLA 4GKIA 2R0UA 2VV9A 3MW1A 3Q2MA 4ASZA 5DR2A 4JT3A 3VRYA 5BUJA 1YDRE 5CSWA 3PE1A 4EOLA 4RWIA 4ZY4A 3UVPA 5EOBA 3AT3A 1G8AA 4CD0A 2V5QA 3ZUVA 4ZAUA 3OMVA 5HLWA 2OJFE 4AE9A 3ALNA 1YWVA 3MA3A 4PNIA 4O81A 3LJ1A 3E3BX 3U87A 4BCQA 2VWBA 3P1AA 4IB0A 3KXZA 2VZ6A 4MVFA 4E7WA 5HNIX 3PTGA 1K2PA 3TKHA 3W8QA 4NKSA 2NNWB 3V5QA 4F4PA 4ZTQA 5GJGA 2VX0A 1IG1A 3MIYA 4QMQA 1QPEA 1Y6BA 3R21A 1PF8A 3TIZA 3CPCA 4OTFA 2QLQA 3GU4A 4EOMA 2GDOA 5CSHA 4YNOA 4H1JA 1PY5A 5FEEA 4ANBA 2BTSA 3V8TA 2J9MA 1PJKA 3NUUA 3OBGA 3GP0A 3Q9XA 2HZ0A 2XK9A 2PZIA 4ZSEA 2W17A 3HV4A 1OL2A 4QNAA 3W16A 3O7LD 3AD5A 2UW0A 3H9FA 3LFQA 2WTDA 4WUAA 5JFVA 4X2KA 5IQEA 3KXGA 3RTPA 3VBYA 2PWLA 4ALWA 4W9WA 4IAFA 1OL7A 4QTDA 1JQHA 4WRSA 4IW0A 4G34A 3UNJA 5EM5A 2VNWA 3DQWA 2X7OA 4K8AA 3OEFX 4RIYA 2JBOA 3R7OA 3G9LX 4BYIA 5TOZA 2VO7A 2VWXA 3CPBA 5F20A 1CM8A 2GFSA 5D1JA 1Q97A 2I0VA 2JEDA 2B1PA 3QD0A 4OTWA 1IEPA 4WSQA 4KIPA 4AXAA 5CZHA 5CANA 4NK9A 2IZRA 2J0IA 4TYGA 1FVVA 4K2RA 4OW8A 1WVXA 4CNHA 2Y0AA 3KF7A 3LQ5A 1LR4A 2JAMA 4L7SA 5CY3A 3Q4CA 4NEUA 4OTPA 5HIDA 4G5PA 5HLPA 4WT6A 4M7IA 3LKMA 3I7BA 5AP4A 3BHHA 3RVGA 4UY9A 3DV3A 3R28A 2QHNA 3D7TA 3IGGA 2B53A 2XKCA 3BYMA 4KS8A 4EKKA 5HTCA 4M0YA 3OZ6A 5TKDA 3DJ6A 5IA5A 2BZJA 4C3RA 3I4BA 4FIHA 3EKNA 2B52A 5CX9A 2PUUA 3GCPA 5FP5A 5CF6A 3F2NA 2ACXA 3K54A 3VBWA 1R78A 2ZB0A 2ITUA 4EBVA 3LFBA 4CMUA 2E2BA 3DBFA 4IC7A 4KKGA 2Z7QA 3RMFA 3VS3A 2R3IA 3FAAA 3KN6A 5A46A 4PV0A 2ETKA 1PW2A 4F9BA 2PYWA 5EM6A 2CLXA 2HOGA 5AIKA 3U9NA 1LEWA 2Z8CA 4NM3A 4KKHA 5CZIA 3KU2A 3E87A 4ACGA 4KAOA 1GY3A 5EDPA 1ZZLA 4JL9A 2GU8A 2Z7RA 3IDCA 4KD1A 1VR2A 2ITWA 3D0EA 3PSBA 4H05A 3HMOA 3WOWA 3UE4A 2HCKA 2ITTA 3PP0A 3LHJA 4ZLOA 5LMBA 1ZZ2A 3R8LA 4EQMA 4RX5A 3TNWA 4A4LA 1SNUA 2O64A 2BKZA 4W8EA 3ZS5A 3OCSA 4KS7A 4E8AA 4DEDA 2WB8A 2CSNA 3V6SA 2XRUA 3PZEA 4V0GB 4O1PA 4F9AA 4TKSA 5AUXA 3C4ZA 3QQUA 5IA2A 4OTQA 3FQSA 3A7FA 2OXYA 5A4TA 3FPMA 3C4XA 3RPYA 1OB3A 1YHWA 2BKKA 3HZTA 4RSSA 3KXHA 4ZMFA 1WBVA 3BBWA 1Q4LA 3QTXA 2PVHA 3COIA 3ITZA 4XMOA 4R8QA 4GK2A 4FT5A 3MB7A 3R02A 4FSQA 4FV8A 4B4LA 4E6CA 2XRWA 3ET7A 2YM4A 4OT6A 3ZO4A 4IVBA 2VWVA 3K3IA 4FL3A 5IUGA 5KZIA 4NM0A 2ZYBA 4KINA 2PVLA 3UIXA 3ZM4A 3LFSA 3EFLA 4U44A 4YLJA 5AR3A 3VQHA 2GNLA 3MPTA 3MY1A 4V05A 4GL9A 3QTIA 3QC4A 4PP7A 3BELA 4XG8A 2Z02A 3E93A 5TF9A 4FYNA 4F65A 4BIEA 3V51A 3COMA 4PQNA 4G3CA 5I3RA 3LQ3A 2HY81 2ERKA 3TV4A 2C47A 3SKCA 4QP8A 4AT5A 3EYHA 2WTVA 2H8HA 4RVLA 3ZH8A 4EH4A 3BWJA 3V01A 2HWOA 3UNZA 1P2AA 2XM8A 3UZPA 3QRKA 3ANQA 2XP2A 3FMMA 3ZSHA 1Y6AA 2CLQA 3DBCA 3QTWA 3I60A 4UBAA 5CEIA 4M97A 4O38A 2JDVA 2JLDA 2IW9A 4DH7A 3BIZA 3E88A 5CQWA 3P78A 3UO5A 3PJ1A 2YIRA 3UOKA 1AQ1A 3K5UA 4FICA 1JSTA 2IZSA 3BCEA 4C59A 5I9VA 2CGUA 2VWZA 5EK7A 4F0FA 5CLPA 5A14A 5KMKA 2J0MB 4AW2A 3VBTA 4JQ7A 5DRDA 4M0ZA 4B8MA 4OTHA 4RT7A 4ZJVA 2ZV9A 3EZVA 3OW4A 4JRVA 3ZDUA 1U54A 3PJ2A 1VEBA 1W84A 3UOLA 1SYKA 3AT2A 3MPMA 2GQRA 3F5GA 4IBMA 4IIRA 3EFWA 5IA1A 3KN5A 3G15A 3LXLA 3UVRA 4QQTA 4YJQA 3RPOA 3B2TA 3FI8A 2PUPA 3E64A 4YHTA 4YZBA 1DI8A 5JFXA 5JZNA 4CCUA 4QTEA 3CTQA 3QU0A 4F9WA 1Z5MA 3BU3A 3TUCA 1XQZA 2GPHA 5IF1A 5JKGA 3HX4A 1REJA 4EK4A 3U4UA 4M14A 4RWLA 4O7RA 3PIXA 1DM2A 2YABA 3CC6A 2E9OA 3GCVA 4X2GA 3V6RA 3R9NA 3UBDA 1JOWB 3R0TA 5AP6A 4FI1A 3QL8A 4IWQA 5IQHA 3KK9A 1LEZA 3REPA 5M4UA 4MHAA 3PA5A 4F9CA 5DIAA 3U6IA 3RPRA 4EJ7A 3G6HA 4C2VA 5CNOA 3D5XA 3E8DA 1O6KA 3ORKA 4XEYA 2OG8A 4FSYA 4J52A 5ANIA 5J7HA 4O1OA 3KFAA 2YJRA 3Q9ZA 4GIIA 4IAZA 3F3ZA 3R9RA 2VAGA 4BDFA 2HW7A 3EZRA 4IX5A 2JIUA 5CTPA 4BF2A 3Q53A 4M8TA 3EL8A 5ETAA 4RIXB 4U80A 4JX3A 1BKXA 2VU3A 2WTCA 3L9NA 3ZONA 2C3KA 4E93A 4NZWB 5HHWA 4B9DA 3LJ2A 5FLFA 1BMKA 5CF4A 3WARA 4O7TA 4DINA 4FGBA 4LUDA 5IH4A 2R5TA 3C4CA 3IO7A 3UNKA 4P7EA 2UZOA 2XVDA 3S3IA 4BDKA 3KF4A 5AEPA 4MWIA 2CCHA 3FZPA 4J95A 3BHTA 4DH1A 4U79A 3QA0A 3DQXA 5FXRA 4A07A 4BC6A 3IG7A 4I92A 1Q8WA 3QGWA 4HPUE 1M7QA 5DPVA 2NRUA 4O2PA 4I0RA 4ZZMA 3NCGA 2BR1A 5HE0A 2BAKA 4XH6A 4EL9A 3GC9A 3PSDA 4YNEA 4JIKA 5FEDA 2WMTA 4C4EA 2XBAA 3UODA 3DA6A 3FZTA 1V0BA 2ETRA 3LFCA 3D83A 2UW8A 4R78A 2QVSE 3GU6A 3ORPA 4FKGA 4FC0A 1JVPP 2ITQA 3FJQE 4Z55A 3DXQA 3OBJA 5ETFA 4GG5A 4PDYA 1L3RE 3JPVA 4FE2A 3D5VA 4YPSA 1IRKA 3UTOA 3QQHA 4GT3A 4Z7HA 1YXUA 4JLCA 3SQQA 4QMLA 5B2KA 2WXVA 2UZNA 2PZ5A 4QNYA 2JDSA 2RKUA 4FTKA 3DNEA 3F3UA 4Q9SA 4BGQA 3UZTA 3TKIA 4DGGA 4IJPA 2VTMA 3MIAA 3UQFA 1A06A 4RIWA 4N6ZA 5HKMA 2I7QA 4PPBA 2WQOA 2PVNA 4I41A 4Q9ZA 3BU5A 4PDPA 3BE9A 1IR3A 5IUIA 4F09A 4A4XA 3OD6X 4CFUA 3TNPC 1OKZA 3GU5A 1GNGA 3AC4A 1OIRA 3TNHA 3MI9A 1Q8TA 3EQGA 3C0IA 3EL7A 4AT4A 1AGWA 4FZ7A 4IH8A 4AGDA 1FMKA 3UYTA 2B9HA 4FTJA 1RE8A 4L6QA 4RG0A 5CXHA 4JNWA 4E4MA 1G8SA 4M69A 3KKVA 3BQRA 2FO0A 2OGVA 2QOLA 4EQUA 3DBEA 3O23A 1URCA 1OKWA 3KC3A 3KMMA 4FT7A 2YZLA 4MNEA 5CAVA 4FZ6A 3KRRA 4JI9A 3L9LA 4IWPA 4B7TA 3PIYA 4UMQA 2CN8A 5C1QB 3ZC5A 2HZNA 4RFYA 1XBBA 3EN5A 3RALA 1UWJA 5HGIA 3UO6A 1Z9XA 4C4GA 4JXFA 4LYNA 1GOLA 4FOCA 4HGLA 3WE8A 4AP7A 3IOKA 2IW6A 3VW6A 3D2IA 5FXSA 3QC9A 5M4FA 3NDMA 4I6QA 4IANA 2J5EA 3P23A 3NLBA 4G17A 4CV9A 2JAVA 2VUWA 4PTGA 4EEVA 5EHOA 2BFXA 4IWDA 5KBRA 1GZ8A 3WZDA 5A4CA 4GU9A 4UALA 4EH5A 3F82A 1U5QA 4LQMA 4JRNA 4I5HA 4IQ6A 4XP0A 5EI2A 3R8ZA 1V0PA 1MRVA 3Q04A 4P2KA 3S0OA 3O96A 1R0PA 2X2LA 3QCSA 4AZVA 2EVAA 2G2FA 2JDOA 3F5UA 1OI9A 3ZU7A 4C36A 4EZ7A 4HVGA 3MFSA 2W06A 3DZQA 2W9FB 4D2SA 2CCIA 5LCKA 4R5SA 2IVSA 2WZJA 3F5XA 3C7QA 4MBLA 3UIBA 2UW9A 4AA4A 5AR2A 3RM6A 5AADA 5AR5A 4C4IA 4R3CA 5CEKA 5BX0A 1WFCA 3VUMA 3RM7A 5JFWA 1APME 1ATPE 1YWNA 2UZWE 3EN6A 3IECA 4AW1A 2VD5A 5HG9A 3UIUA 3VN9A 2ITZA 2YCFA 2R3GA 5K9IA 2XM9A 5C26A 2X6EA 1ZY5A 3AC3A 3HMIA 3WILA 2UW4A 4AFEA 2ZOQA 4H36A 4AZEA 2WMRA 3VVHA 4FVPA 2YCRA 4LRMA 5HCZA 3FKOA 2LAVA 4RLLA 3RK7A 2QG5A 3ZLXA 4QD6A 4S32A 3UG2A 3LCSA 3LLAA 4OT5A 3U54A 3OC1A 1ZOEA 4NFMA 4EC9A 3DJ5A 4FL2A 4USDA 3R7IA 5IKWA 3MBLA 5BPYA 4J98A 4YZDA 5BYYA 4C57A 2W96B 5HVYA 3FMKA 2ZVAA 4O6EA 2W7XA 4MAOA 4ZTSA 4FIJA 4BDJA 3VUDA 4YZNA 4GVJA 5A6NA 4WIHA 4BZOA 4YPDA 4A9TA 2WQEA 2FSMX 3PWDA 3CJGA 4NW6A 3CP9A 4RIYB 3FL5A 5ANGA 3O8PA 4O84A 4RC4A 2ETMA 4Y95A 3Q2JA 4FMQA 5C01A 4HGTA 3QFVA 2FB8A 3WF8A 4TYHA 3IW8A 3GI3A 2C0OA 5JGBA 3MVLA 1MRUA 4E6DA 2C69A 4DE4A 4YURA 2JIIA 4YU2A 4XG4A 4E6QA 1TQIA 2XIKA 3P7BA 1JNKA 2OKRA 2RIOA 3HP2A 3Q6WA 4I6FA 5AMNA 5C8KA 4O7YA 4Y5QA 4YMJA 4BCPA 4NT4A 4QQ5A 5CNNA 5I3OA 3D7TB 5K3YA 2WQMA 3VJOA 4HW7A 5AA9A 4DBXA 3E62A 2W5BA 4S33A 4QMYA 4FL1A 2X2MA 4WNKA 2I40A 4AFJA 3QZHA 3GGFA 4JG6A 4L53A 5J9ZA 4BY9E 5AV2A 4USFA 3HDMA 3L1SA 3EQBA 3POZA 2VTSA 4IVDA 3MVJA 4QQJA 3VUHA 4EH2A 4FTLA 4EZ3A 2R3LA 1FMOE 5EYMA 5BVWA 3CEKA 3UIMA 2J7TA 2WO6A 4DFBA 4R1YA 3MFUA 5AX9A 5DN3A 3VQUA 5ACKA 4Y8DA 1T45A 2F7EE 3H0ZA 1YQJA 4BBFA 3CJFA 3N51A 5DYJA 5GHVA 5KZ0A 4DYMA 4IJ9A 3OOMA 2WMUA 4EH6A 4YJOA 4LM5A 1H1QA 3HNGA 5AWMA 5IUHA 3DCVA 4FTQA 3NIZA 4CQGA 1W83A
chains in the Genus database with same CATH superfamily
1JBPE 2ZAZA 2Y9QA 3P5JC 3ZZEA 3RINA 2DYLA 3V8SA 3FMDA 3M11A 3QQLA 1W7HA 1J3HA 3ZXZA 1TVOA 5HE2A 1ZYLA 2WTJA 3QXPA 4ANLA 4M66A 4FG9A 2R9SA 2QQ7A 3E8CA 3FKLA 5FD2A 3W0QA 4RJ6A 5DFPA 4CG9A 3GCUA 2ITYA 2C3LA 3PY0A 4C8BA 4YR8A 3TJDA 5AUTA 3P7AA 3BU6A 3CD8A 4EWQA 3NYVA 2ONLC 4H39A 3RHXA 3HAVA 2BIYA 5D10A 3EN9A 5HLNA 1H07A 3PPJA 2YAKA 3EN7A 2XIRA 2Z7LA 3SXSA 4Z7GA 4ANNA 5F94A 1Y57A 3BV2A 4OUCA 3WF5A 3ZLYA 5ITAA 4BWXA 4DFLA 2X0QA 3FUPA 1FINA 5LARA 4D4VA 3W10A 2RG6A 2YM5A 4K18A 4IB5A 3ZBFA 3ATSA 3OW3A 4ACHA 3Q6UA 2JGZA 4QMTA 4PPAA 4I4FA 5CU6A 2CGVA 4H3BA 4FNZA 1OIYA 2W1HA 1RQQA 1V0OA 4PL3A 3GEQA 4FSTA 5DE2A 2J6MA 4GUBA 3IW5A 1WBPA 2DS1A 3TZ8A 4O7ZA 2CN5A 3R8VA 3LFEA 1LPUA 2H9VA 2OH0E 3QZFA 4C62A 4C33A 5EKNA 1XO2B 3PDTA 3MH2A 3R01A 4DT8A 2OF2A 4PUZA 5K0XA 5EQPA 1FQ1B 2Z2WA 4JS8A 5KX8A 3QQFA 5FDXA 5TE0A 5CEOA 1OIQA 5IA0A 1TZDA 2O5KA 3VS1A 2JD5A 1PXLA 4NM5A 4PX6A 3VO3A 4X3FA 2J0LA 3DZOA 3HMNA 3RP9A 1PXIA 4E4NA 5F4NA 2PL0A 4ALUA 3R7YA 2RG5A 2WPAA 3QWKA 4QRCA 3ID6C 4PP9A 1XH9A 3NAYA 2PMOX 4X0MA 5H3QA 4CRLA 4B0GA 2OJ9A 3DLZA 3BEGA 5AM7A 3NNVA 4MXXA 3NFGB 5E4HA 2P2IA 4D2VA 3QLFA 4ORKA 4NCTA 3QTQA 1E1VA 2QKWB 3FLYA 4WO5A 4UXQA 1KOAA 1M14A 3MH1A 5A4LA 3BHVA 2B9JA 3DS6A 3HKOA 4BCKA 5GZ8A 5IU2A 3C50A 3VBQA 3NUYA 4PL4A 1OKVA 5FM2A 1NY3A 5HO8A 4FTCA 4DLJA 3RGFA 3DXPA 5FTGA 3G9NA 4AW0A 3FXZA 3TTJA 4L44A 3WE4A 3PXFA 4B6LA 2WELA 3U9CA 3VS6A 3H9RA 3LCKA 2JKMA 2JKOA 5CU3A 3W2QA 3BPRA 4AN9A 4G5JA 4KNBA 3QCXA 4L46A 1WBTA 3CKWA 4DHJA 3AMBA 4AUAA 4LOPA 3R6XA 4MD8E 4TWOA 5AJQA 2R3HA 5DT0A 4MBJA 5KE0A 2C6EA 3ZRKA 2W0JA 5LVOA 3A7IA 3IONA 3MA6A 4UXLA 2QOCA 2BDWA 2WEVA 3PYYA 4IX3A 1OL5A 4GW8A 4XCUA 4XS2A 3N4TA 4KRDA 3QGYA 3FC2A 1MQ4A 2OJGA 3GC0A 3E8NA 4M84A 2OXXA 4CTCA 3TM0A 4KIKB 3SOAA 3EH9A 4F7LA 3DFCB 4YBKA 4GU6A 4JAJA 4W4WA 3I6WA 3BL7A 2XK4A 5FUTA 3WF9A 3PPKA 4RBLA 2W9ZB 5BVKA 1A9UA 2BHHA 4EI4A 4EQCA 3ELJA 4QTCA 4HOKA 2EU9A 4R1VA 1FPUA 1H1RA 2PTKA 4D1SA 3M1SA 3C4EA 2PK9A 2X6DA 5ETIA 3ORNA 4YSJA 1PRYA 5CSVA 5HQ0A 4ALVA 3PP1A 3PVUA 4D2TA 2WIPA 1OPJA 3QUDA 2QHMA 3DY7A 3RBWA 2XEZA 3I0QA 4OR5A 3A4OX 3RPSA 4ZTMA 4FEVA 1WCCA 2HELA 2G9XA 4HCVA 1XH8A 2BVAA 4ACMA 3SLSA 3V04A 3Q4ZA 1XH4A 2WTKC 3QBNA 4FV6A 4FNWA 4X3JA 3OXTA 4YJSA 3LFNA 3OY3A 5FXQA 3RWPA 3SAYA 4ZLZA 3GCSA 4IAIA 1NXKA 4IACA 4R3RA 3FC1X 3TJCA 3UC4A 1VZOA 3KCKA 1GAGA 3RAWA 1UNLA 2YLFA 3FHIA 3L8PA 1KE7A 1M2PA 4MTAA 4U3ZA 2XCKA 1FOTA 4EH9A 4AE6A 4QMZA 3L9MA 4X7QA 3CXWA 4RX9A 4FKVA 5HBEA 4EORA 4BDGA 5LCJA 2PMNX 4L3JA 4FOBA 3EKKA 3P4KA 4WD5A 4GV1A 3LOKA 4MX9A 5BUEA 5DLSA 4QP7A 3VJNA 2XAMA 3U8WA 4DF3A 2V22A 3SX9A 4O0TA 4FUXA 5CASA 3CS9A 5DEYA 3R22A 4AOTA 5LOHA 4F70A 3FZ1A 5IEXA 4QOXA 5CI7A 4RX7A 4ASEA 2P4IA 3PUPA 1OM1A 2OZAA 4AT3A 1BI7A 2RFNA 1XR1A 4ZTLA 4WBBB 4A06A 3DAJA 4J96A 4GJ3A 4LGDA 4XRJA 4AN3A 2W1IA 3BI6A 1F5QA 1ZOGA 3O51A 4YHFA 3Q4UA 5BYZA 3UOHA 3WZUA 5CEPA 4UX9A 4LV8A 3HRFA 4I24A 3MESA 2C5XA 4IEBA 1W8CA 4DGLC 3PZHA 1L8TA 3ZEPA 4MXYA 4FKRA 4EK3A 3JXWA 5B0XA 3F66A 3ORMA 1WVYA 5HNBA 1HCKA 4GVAA 1RW8A 2XJ2A 5F95A 3RAHA 2RFSA 2XNMA 2HY0A 3WF6A 3ZUUA 2W4JA 4IM0A 3KULA 4WA9A 1BI8A 1YOLA 4EOIA 3NUNA 4M69B 5AP1A 1OBDA 2YAAA 2R3RA 5KKRC 1IASA 4G3EA 2B0QA 2IVUA 3D15A 4U7ZA 2OH4A 4ZZNA 1R0EA 3PIZA 4YJTA 3D9VA 2W5AA 1EH4A 4S34A 4XRLA 1SM2A 4DEAA 4EHEA 4F7JA 3PVBA 2J4ZA 3PXRA 4X21A 4UWBA 4F7SA 1CMKE 4C02A 4LMUA 3MSSA 1QL6A 2GS2A 4FUYA 2P0CA 3QUEA 5I9WA 2BRGA 4XOYA 4FTMA 4M3QA 2PVYA 2GS6A 3LXPA 3RWQA 2HK5A 3POOA 4TTHB 5HD7A 4YC8A 5AX3A 4CFNA 1IA9A 3BZ3A 2PUNA 4O0YA 3A99A 5HTIA 4DH3A 1ZXEA 2CNVA 3RI1A 5M56A 4HNFA 5E1EA 4AN2A 1OZ1A 3QHWA 3HRBA 2XKDA 1DAYA 2XKEA 4DH8A 3SDJA 4O7SA 2VTPA 4G3DA 5FTQA 4I0SA 3VW8A 3EMGA 3GOKA 4TYJA 3HL7A 1UU3A 4ITIA 5EM8A 2G2IA 4TRLA 1O6LA 2PVMA 1YHVA 4DEHA 3CTHA 4MNFA 3PVWA 4FTUA 2WGJA 2X7GA 4I4EA 5JQ8A 4EOJA 2EWAA 4UV0A 3GQIA 4BI2A 5E8SA 3EQIA 1HOWA 3R8MA 2VO6A 3G5DA 3F6XA 4APCA 4BTKA 3A7JA 3JY9A 4I5PA 4E20A 4YJRA 2C5YA 2OICA 5IEYA 2IO6A 5D9HA 3FMNA 1PXOA 2BHEA 4OTIA 5EM7A 4I1ZA 3KXNA 3EFKA 3NWWA 4AZSA 5D7AA 3O50A 3QX2A 3NUAA 2WMAA 1JAMA 3Q9WA 2GHLA 4JR3A 2WFYA 3QALE 5L4QA 3LFAA 4FR4A 4O7LA 1U4DA 1CKIA 1PXJA 5HCYA 4H1MA 4F6UA 2X8DA 4DCAA 5LMKC 5AUVA 1JKKA 2VX3A 4M13A 4EYJA 2NP8A 3FI2A 2IF8A 3E7OA 1URWA 3VBXA 4EUTA 3Q5ZA 5L6PA 5AP0A 1XBCA 3PXYA 1ZAOA 3LQ8A 2GNJA 5HZNA 5IQGA 2EXEA 4I0TA 3F3VA 3TIYA 2H96A 4FKJA 3PVGA 4FYOA 4R6VA 4BYJA 5KMIA 4JG7A 3SG9A 2I1MA 4RZWA 4YTFA 1JPAA 3NRMA 1XBAA 1P4OA 2BROA 4DLIA 1OMWA 5J5TA 5B2LA 4C35A 1OKYA 4MCVA 1ZARA 2BAJA 4MXZA 1YXSA 3LPBA 3VS4A 1FGKA 3LM5A 3KY2A 4IHPA 4OBPA 2BDJA 3W33A 3UP7A 5CVGA 4BWKA 4ERWA 2BPMA 5E92A 3ZLSA 1NVSA 4JJRA 2R2PA 1ZY4A 2A2AA 2UVYA 3PWYA 2YISA 3ORZA 2PMLX 4JBPA 3R63A 4N6YA 1UNGA 4O27B 1QMZA 2BZIB 2ZMDA 3NNWA 3U51A 2NRYA 1H0WA 2B4SB 3Q52A 3QQKA 3T9IA 2VTQA 5GJFA 2E9NA 3IGOA 3OHTA 4FV9A 4YC6A 1ZMVA 2X39A 4D1ZA 4CLJA 4PWNA 4TPTA 3BE2A 4XP3A 3A4PA 3OT3A 4EH7A 3KXXA 3ORIA 4BGHA 4DN5A 3E8EA 4QT1A 3AQVA 3PG3A 3ODZX 5EW9A 1YRPA 3F61A 2OI4X 5D12A 5BVEA 4C2WA 5J9YA 5DRBA 2BRHA 4PMPA 4UWYA 2XMYA 4ZSJA 5GINE 4XG6A 5HE3A 2CKOA 4CCBA 3RAKA 4YO4A 2OFVA 3MH3A 2PE0A 4BZNA 5JSMA 4RA4A 4FEWA 4FKWA 3QF9A 3DGKA 4A9RA 4F1MA 2SRCA 3MJ1A 4EUUA 3D94A 2YM6A 3CR0A 3DFAA 2IW8A 3RAIA 5I9XA 3PLAE 4AZTA 4RMZA 1XH6A 5C8NA 2F9GA 4D55A 4KSQA 5IQIA 3I79A 4XNEA 1PKGA 5D41A 2HXLA 4AQCA 3NW5A 4O82A 4H58A 4M67A 4QMPA 4ZSLA 5AR7A 1B38A 4WHZA 2GTMA 3SGCA 3VBVA 1B39A 2IVVA 4Z9LA 4FV3A 3FY2A 1BUHA 4O0VA 3L8SA 2YA9A 4CT2A 2VWYA 3LJ0A 3D5UA 5I9UA 5LXMA 1YXTA 3PLSA 4RLKA 3EQRA 4BDIA 4NJDA 1H0VA 3GC7A 5EW3A 4TNDA 3FMJA 2G15A 2YDKA 1YOJA 4C4FA 2Y4IB 4DFZE 4QQCA 4EOKA 3BX5A 5B2MA 5IDNA 4D2RA 4IVAA 5AP2A 4ANMA 2CJMA 3S4QA 3G0EA 5C4LA 5CYIA 3SRVA 1KV1A 1MRYA 4YZ9A 3RNIA 3NYOA 4FKLA 1SVEA 3D4QA 5KCVA 2PZRA 5I4NA 3FHRA 4QPMA 2AC5A 5BVDA 5CALA 4ASXA 3KXMA 4FV5A 4BDAA 2A27A 3QUPA 5IISA 2W1GA 2UZTA 5CEQA 4DG3E 4KIQA 5GZ9A 5DGZA 3BLRA 4HCTA 2ZDUA 4O91A 4RVKA 3RHKA 3ZXTA 2I6LA 3C13A 3HA6A 4CYIA 1KOBA 2VTOA 5A3XA 3W8LA 4ZK5A 3R00A 2KULA 3IOPA 4ENYA 5C4KA 4EH8A 5AA8A 4QMOA 3R8UA 1WBSA 4RFMA 4LV7A 4LRKA 3UPXA 2AC3A 2QO2A 3CGOA 4GT5A 2CGXA 4BBMA 3F7ZA 1UWHA 5J1VA 4EHZA 2VGPA 3KMUA 2CNQA 3A60A 2F7XE 3HUBA 3ZSGA 4FKQA 4O6LA 4TW9A 1H26A 3AT4A 4BN1A 2C6DA 4X3FB 3IS5A 4II5A 3KRXA 4D0XA 4J97A 2KTYA 3QLGA 2YWVA 4N57A 4QTBA 5KMLA 2REIA 1I44A 3RKBA 3M42A 3FSFA 3HGKA 1Q5KA 1WZYA 1GIHA 5DEWA 3WZKA 3Q4TA 4E5WA 4F78A 4E4XA 4O96A 3A61A 4GFOA 4WG3A 2VWWA 5T68A 5M51A 4G3FA 1SVHA 2R3OA 4QMXA 5HO7A 3DT1A 2C30A 2DWBA 4CMOA 3DOGA 4FTRA 2C0TA 4R7HA 4RJ7A 3JUHA 3W2OA 1M7NA 2UUEA 3DKOA 2X7FA 4NIFB 3R9HA 1SZMA 3RPVA 4E26A 3PA4A 4GFMA 3ZO3A 3F7WA 3W55A 4FIEA 2QONA 2W5HA 4X2FA 2E9PA 3ETAA 3UC3A 1K3AA 4L43A 4CQEA 1KWPA 3ZBXA 3UOJA 3FV8A 4QTAA 3OEZA 5IQAA 3MTLA 3VC4A 2P3GX 3R73A 4ZJIA 4U42A 1XH5A 4A7CA 4AXDA 5I9ZA 2IG7A 3ACJA 4KKEA 4MUQA 3RK5A 1J7UA 4GEOA 1ZOHA 2BZKB 4AU8A 3FL4A 5J95A 5HX6A 3CCNA 4L68A 4L7FA 2A19B 4QP2A 3LMGA 4UEUA 5GNKA 3H30A 4BR3A 1E9HA 3HECA 2C6LA 4HGEA 1YKRA 3C5IA 1J1CA 3TT0A 2IVTA 3F88A 4O86A 4FZAB 4FX3A 2IN6A 4Q5EA 4GT4A 2ESMA 5HCXA 2ZV2A 3PY1A 3R7VA 5JZJA 2QNJA 4JBVA 2QR7A 2ZV8A 2X2KA 3P0MA 3FZSA 2QU5A 4HYSA 4MXCA 4ASDA 3AC2A 5K4JA 1W2DA 2XNGA 2C4GA 4GS6A 1G3NA 4K11A 3UMWA 5A4QA 5KMJA 3TUBA 4RWKA 2W99B 4YZCA 4HPTE 3BYVA 3OCTA 3PY3A 5C9CA 5JK3A 4YJNA 1ZWSA 4CKJA 1JSUA 3W32A 4JVGA 2WMVA 4QMWA 3FLQA 3RCDA 5HBJA 4CFVA 5E91A 4JMQA 5HE1A 2XYUA 2QU6A 4MWHA 3FMHA 4DEBA 2BDFA 4DGMA 4EHVA 1REKA 2F4JA 3PXZA 4JDIA 5TT7A 5HX8A 5KNJA 2YIWA 3MS9A 4BIDA 5CVFA 4QO9A 4AF3A 2CKQA 2J0JA 5DR9A 4WRGA 3MYGA 2CKEA 4R7IA 1VYZA 3HMMA 4V01A 4ACDA 3IPHA 4ITJA 1UKHA 4C38A 1DAWA 3FZOA 1KE9A 1OL6A 4I5CA 1H1PA 4DITA 3B8QA 4O7WA 3LIJA 2XNPA 5K0KA 3SW7A 5M06A 2HZIA 1XH7A 2DQ7X 2BZHB 4D5HA 5T6KA 1QPJA 4FTAA 4JDHA 4G1WA 4DA5A 4M15A 4S31A 4UMTA 2R3QA 2VX1A 1M52A 3AGLA 4U8ZA 3NAXA 3UDBA 5CSPA 5AIRA 1PHKA 1ZYCA 2UW7A 3PA3A 2CKPA 3R8PA 3T9TA 4AS0A 1H25A 1ZMWA 2C5VA 2C0IA 2W05A 4LGGA 2XZSA 3V3VA 3HV7A 1Q3DA 3P9JA 5AAGA 2YCQA 2B54A 2X8IA 2OO8X 3LCOA 2R3FA 4WOVA 4C37A 5HBHA 5DOSA 3U6HA 4O4DA 1WVWA 3W2CA 5IZFA 4TNBA 4GH2A 4IZAA 2VTTA 2ZDTA 1NA7A 4FSNA 2OZAB 5AUYA 4RVTA 4C58A 2PU8A 1PXKA 1WAKA 2UVZA 4V04A 2XK3A 3K3JA 5LMAA 3DLSA 4RQKA 3BYUA 2O2UA 3BWFA 3G51A 2PHKA 4F7NA 3LW0A 2YM3A 4XV2A 3K5VA 4Y85A 4XYFA 3LFDA 5DVRA 4F0IA 3TEIA 2YITA 2YM7A 5M44A 2VTJA 2QOQA 1ZYDA 1U46A 1AD5A 2C1AA 2IWIA 1JLUE 2WNTA 3A7GA 2W4KA 3CKXA 3MDYA 4FKPA 4FODA 4BFMA 3ALOA 2QC6A 1CTPE 3N9XA 1M17A 3UO4A 3D14A 3MN3A 4K33A 3W2RA 2FYSA 5AP7A 1J7LA 2YIYA 1H00A 4DTAA 3ZUTA 2X4ZA 4YLLA 4RWJA 2PULA 4BGGA 4ZTRA 3S1HA 3PJ8A 2YDJA 4LOOA 4XG3A 3RZBA 3R7EA 1J91A 2WMQA 2XH5A 4QMVA 4UYNA 1SMHA 3PXKA 3TUDA 3PJ3A 4JBQA 5ANJA 5HIBA 2C5NA 4QYYA 5AUZA 2BTRA 2XBJA 4FBXA 5FBNC 3V5PA 5IMXA 3NSZA 3WIKA 3ZYAA 3BHYA 1YHSA 4W4YA 1PXPA 2GTNA 3LAUA 3ZTXA 3OCGA 5E1SA 3LFFA 1UU9A 4KA3A 5CAOA 4A9SA 2YCSA 2CNUA 4M12A 4P5ZA 5FP6A 1KSWA 3Q3BA 5IDPA 2ZM3A 3WZJA 3EQHA 3P7CA 4EH3A 5HIEA 2ITPA 5LVLA 3E3PA 5IPJA 3ULIA 2XIXA 3KEXA 4AW5A 3FBVA 2JKQA 4KIOA 5IG1A 2RFEA 5IH5A 5JEBA 2VN9A 5HORA 4DG0E 4JQEA 2WOTA 2G1TA 3GXLA 2UW3A 3FPQA 2VTLA 3A8WA 4IZ7A 3U6JA 4I20A 2BUJA 2QKRA 2YLEA 3C1XA 5EH0A 2R0IA 3ZEWA 4B8LA 3FWQA 5CAQA 3AD4A 2C5OA 1J7IA 3MY0A 4U41A 3HVCA 4FK3A 1ZLTA 3HUCA 4S2ZA 1Y91A 4R77A 4LFIA 4OBOA 2WQBA 5EDQA 5F1ZA 2R3KA 4BTJA 5J7BA 2Q83A 1XJDA 3PFQA 2PSQA 4BCHA 4C61A 1DI9A 3UDSA 3GVUA 5LVMA 1F0QA 2VTHA 5M09A 4DHFA 1OUYA 2XA4A 4U6RA 2XIYA 4BCNA 3BBTB 1Q99A 2Y8OA 2ZM1A 3Q60A 3CBLA 4GUEA 2HWPA 2QO7A 5EQEA 2ERZE 2G2HA 4FIFA 2WKMA 5M53A 3NW6A 2BCJA 1YXXA 3NPCA 4QPSA 4IB3A 3BV3A 1NVRA 3G33A 4GK4A 5FM3A 4ERKA 5ANDA 3AC5A 3COKA 3FQHA 4D4SA 4UMPA 3KRLA 4ZS0A 3EHAA 4TT7A 4D9UA 1YDTE 3I81A 4I94A 4OAVB 4H3QA 1OBGA 3EYGA 4KABA 3QKLA 5AV3A 2BRMA 3UYSA 2PY3A 3O71A 5JH6A 3WBLA 4MQ1A 1STCE 5HG7A 2FGIA 3IW4A 4G31A 3FMEA 3R9OA 1UA2A 2B7AA 3ZO1A 4DTBA 5J9LA 4HCUA 2PMIA 4HGSA 3WZEA 3O17A 3R7GA 2P2HA 2F7ZE 2ZB1A 2VTIA 3ZRMA 3MGYA 4I23A 2WU7A 4GFGA 4FIGA 3IW7A 4F08A 1Q3WA 4FF8A 4O21A 3TKUA 4C4JA 3FYKX 2FSLX 3GCQA 2ONLA 3R71A 3H10A 1S9JA 5FDPA 1QPCA 4MD7E 3FE3A 2VNYA 3KMWA 3R1QA 3DXNA 3BYSA 2F49A 4D2WA 3PPZA 3EQFA 4FT0A 2XNBA 4FRFA 3T8OA 3ENHA 3O8TA 3EJ1A 2O3PA 4N4SA 3WYYA 2IJMA 3FZRA 3P79A 4BVUA 1O9UA 4FSUA 2YJSA 4HVIA 4L01A 2JC6A 1H8FA 4WNOA 3UP2A 3NFFB 3H3CA 5E90A 4MF0A 3CIKA 4TZRA 3VUTA 4BZDA 4WKQA 3S95A 3QCYA 4GSBA 2LGCA 1U54B 2Z7SA 3T3UA 4DFYA 4QMUA 4I3ZA 3SXRA 2GSFA 3NUPA 4MYGA 4GRBA 4MQ2A 4O0WA 5CI6A 4DCEA 4EK8A 5CAUA 3AKKA 3C9WA 4DG2E 4KSPA 3FEGA 3AC8A 3W1FA 4PY1A 5KUPA 2C6TA 5GIOE 3N4VA 3MVMA 3ZOSA 3QTSA 3OG7A 4QYFA 4AACA 4UN0C 3KL8A 3QRUA 3N4UA 5J79A 4XBUA 4Q5HA 4TN6A 3NEWA 4EHGA 4PTEA 4ZTHA 4ZTNA 3ZFMA 5M07A 2OXDA 4Z16A 3WI6A 3TZMA 3DK3A 4CT1A 3OS3A 4O0UA 2X9FA 3GFWA 2YN8A 4I6HA 5J87A 3TG1A 1T46A 4XV3A 5IMEA 4AGCA 4NWMA 3DK7A 3D7ZA 3M2WA 5I5ZA 4XUFA 3OVVA 5AP3A 4FG7A 2R7IA 3KCFA 1ZMUA 1GZOA 2HYYA 3UG1A 5BVFA 1WBOA 2PVRA 2W4OA 3EOCA 5E8WA 4EK6A 3DBDA 4L3LA 4O0SA 3OCBA 3THBA 2OBJA 3VWAA 2VO3A 4JDKA 4E3CA 4FNYA 5A54A 4I22A 3IKAA 2W1CA 3F5PA 4ZSGA 5EFQA 1XWSA 2UW5A 3Q9YA 3WYXA 5EW8A 3MH0A 2B9FA 2QOFA 3R1SA 4RGJA 3V5WA 4R5YA 4CRSA 2BMCA 3IK3A 4B99A 3P86A 3FKNA 4JBOA 3MWUA 4PPCA 4FKSA 5JFSA 4C3PA 3DU8A 4DGOA 4CYJA 2BFYA 4WNMA 4NKAA 1OITA 2JKKA 4BRXA 2YM8A 4FK6A 4QP4A 4BL1A 3I6UA 5E8XA 2DUVA 4W4VA 4DEGA 5JMSA 4FVQA 4P90A 1S9IA 4ZXTA 4LI5A 4ANQA 4C7TA 3I5NA 4BKJA 1MUOA 4IZ5A 5E7RA 2R3JA 3R83A 3KA0A 2BRNA 3GU8A 3R2BA 5M57A 3A7HA 4TL0A 3JY0A 4KB8A 2GNIA 4IX4A 1R39A 3ZO2A 5A6OA 5K5XA 4YTIA 2I0HA 2O63A 4HVDA 4CFXA 4CMTA 5ANKA 2JITA 2PVFA 3AMYA 4IM3A 4QMSA 5CENA 5AV4A 2UZLA 3H9OA 4DGNA 1FVTA 4FA2A 2VTNA 5FG8A 1OUKA 1UKIA 2PZPA 3QD2B 3FXXA 5CT0A 3ORXA 2XCHA 4BCFA 4UZHA 3HLLA 4BCIA 5CF5A 1H27A 2C3IB 4UYAA 4W9XA 5JGAA 5T3QA 4W8DA 4W4XA 4ZOGA 5LVPA 3I1AA 1JKTA 4TWCA 3ZSIA 5L2WA 2XK8A 4FGRA 2AQXA 3R1NA 4BDCA 4CTBA 3ZZWA 2VWIA 4RIWB 3QAME 5BVNA 5DR6A 4I5MA 1YI3A 4PTCA 1RDQE 4GKHA 3VS5A 1Y8YA 5HO6A 2GS7A 3C4FA 4CZUA 3PG1A 4FTOA 5HOAA 1PMVA 3VS2A 4PDOA 2G01A 5EI6A 2FSTX 4D4RA 3NZ0A 4EK5A 5CS6A 4IFGA 5JQ5A 4NH1A 5EHLA 4XBRA 3WIGA 1A48A 2E9VA 3R30A 4XJ0A 5H9BA 1M2QA 3BGPA 2C6MA 4O22A 2QCSA 2JFMA 3V8WA 2JFLA 2HENA 4F99A 1YI4A 5L2TA 4J71A 2XK6A 2XB7A 3ORTA 5ANOA 3TWJA 3PXQA 4MNEB 1BLXA 4XP2A 5H8BA 4BI1A 4DTKA 5AUUA 4EONA 2GHGA 2GQGA 4WG4A 1BYGA 3DKCA 3ORLA 4GYGA 4IC8A 3FI4A 1KV2A 4CXAA 2UZEA 4RIOA 3CQWA 1YXVA 3FLZA 1GZNA 4RFZA 2PE1A 4PMMA 4XLIA 4Y73A 3KGAA 4FG8A 4QYEA 2EB3A 3W18A 4AG8A 4BDHA 1YVJA 2XEYA 2JBPA 3EIDA 3LZBA 4ANSA 4O7NA 2J50A 3DB6A 4NFNA 5HEZA 2GMXA 4F0GA 3SG8A 4IVCA 1PXMA 3ULZA 4N70A 4JX7A 1Q8ZA 4TWNA 3OY1A 3NR9A 3HDNA 3U55A 4FV0A 4JQ8A 3RNYA 3IQ7A 1GJOA 3C51A 5BNJA 2WMXA 5CQUA 2Q0BA 4FSZA 3SA0A 1UNHA 3UGCA 4F9YA 3NGAA 3PRIA 4XLVA 2I0EA 4NW5A 4ZJJA 5DA3A 4FSMA 5L6WL 3ZC6A 3EQPA 3OXIA 4U45A 1F3MC 2CHLA 4HZRA 2OJJA 2YEXA 3IDBA 5LQFA 4CGAA 5D11A 3KVWA 4YJPA 3S00A 2OU7A 3NUSA 3MTFA 2QO9A 3G6GA 2CMWA 3ZRLA 5HVKA 5AUWA 3DB8A 4OTDA 4ANOA 2HZ4A 2UZDA 2OK1A 2WQNA 3CY2A 3BLHA 2GNFA 4LL0A 2P33A 3U4WA 3VS7A 3OUKA 3QA8A 4I6BA 2QOOA 3QYWA 2RFDA 5DT4A 4FV2A 5EG3A 3HV5A 2O8YA 2RGPA 5EOLA 3GFEA 4RVMA 3GOPA 4DDGA 5E8YA 1ZYJA 2B9IA 4PRJA 5ACBC 5M4IA 2W1FA 4ZZOA 3BKBA 3OT8A 3AD6A 2C6IA 3CE3A 5K4IA 2BIKB 4KBAA 2I0YA 4ZP5A 5F9EA 5HNGA 1BL6A 1QPDA 3SXFA 1XMMA 1M2RA 3CSVA 4D4YA 4U9AA 4CVAA 3O5AA 3BEAA 3H0YA 4HZSA 4ZMEA 1I09A 2QD9A 4MH7A 2XNNA 5IEVA 5KMNA 1MP8A 2PPQA 3UQGA 4UB7A 4L9IA 3A2CA 5K5NA 4TYHB 3FDNA 1CSNA 2Y6MA 2WTWA 5CU0A 1FVRA 1SNXA 3QD3A 3QX4A 4P5QA 5A4EA 1H01A 3OROA 1R1WA 2W1ZA 4BCMA 4DC2A 3GU7A 3WF7A 1Q62A 3JVSA 3QYZA 2YZAA 3NVKI 4LV5A 3ODYX 3HV6A 4BTMA 2EB2A 1FGIA 4F6WA 2X1NA 4J8MA 5CSXA 2ZMCA 3TL8A 2UZUE 4YHJA 5FWKK 3FQEA 4ITHA 4MXOA 2P55A 2V55A 2IZUA 4BICA 1VYWA 3E7VA 3TI1A 4IE9A 4HYHA 5LMKA 4FV4A