3ZFMA

Crystal structure of ephb2
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
279
structure length
248
Chain Sequence
EIDISCVKIEQVIFGEVCSGHLKLPGKREIFVAIKTLTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Completing the Structural Family Portrait of the Human Ephb Tyrosine Kinase Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords EPHRIN TYPE-B RECEPTOR 2
total genus 78
structure length 248
sequence length 279
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zfmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zfmA01
3EN7A 4D2WA 5BVKA 3QCYA 4O6EA 3U51A 3COHA 2I1MA 3D5VA 4BDIA 5DA3A 2VWIA 1U5QA 4FZFB 3OBJA 3QQFA 2QHNA 3SKCA 4F0IA 5IQIA 2Y0AA 3PTGA 5GINE 1XBAA 3MFTA 3NCGA 5LWNA 4QT1A 3DXQA 2YCQA 2YIXA 3FI4A 5IQGA 2EB2A 1PXIA 3PE2A 4FX3A 5EH0A 3MA3A 4G6NA 4BBMA 1WBPA 2ZV9A 1XHAA 4G5JA 4CV9A 3TZ8A 5CF5A 2YJSA 4FT7A 3V6SA 4CT2A 4FKUA 4QQCA 3W2PA 4AW1A 5IF1A 3CXWA 4KRDA 4FZDB 3VS7A 3R6XA 1OL2A 1ZARA 3BYSA 3F2NA 2J5EA 4J8NA 3VIDA 2E9PA 4HZRA 4BDAA 4M7IA 3RHKA 4ALWA 5FGKA 4QTEA 3U54A 3Q53A 3QLFA 2PMNX 5FP5A 5FM2A 4FTKA 3ZLXA 4E7WA 1XBBA 4BTJA 2GFCA 3E3PA 2WQBA 3I6WA 3DDQA 2EXEA 1QPDA 1PKDA 3IS5A 4O0VA 2UW0A 4QMWA 4D0XA 2GCDA 4RQVA 2OF2A 3GCSA 4TZRA 1Q8WA 2B1PA 3HMIA 3ORMA 4F1MA 5GZAA 2O0UA 3P79A 4OTDA 3BHYA 5A14A 3LFEA 3AC1A 1RDQE 4AN3A 4BIDA 4EJNA 2QO9A 5KUPA 3R9HA 4LQMA 1W8CA 1Q8YA 5ACKA 3KRJA 4G34A 3GCUA 3RGFA 4I24A 4LYNA 3L1SA 3W1FA 4G3EA 2C47A 4DH7A 3EKNA 3D2IA 3DZOA 4IH8A 2JIUA 4AN9A 3R7VA 1PXKA 4MXYA 4W4YA 3FYKX 3WF9A 1PHKA 4AT5A 2VTIA 5AP1A 2YM6A 2OZAB 3E3BX 4FR4A 2Y4PA 4EOMA 3NW5A 4FYOA 5FXSA 3VS0A 4DH1A 5HKMA 2B0QA 4FNYA 2CHLA 4ZEGA 5ETCA 5DE2A 4RRVA 3LQ8A 5CNNA 3OFMA 3LE6A 1JSTA 3A7IA 3QRJA 3SAYA 3A4OX 4JAIA 4P5ZA 3UOKA 1FMKA 3LFSA 4CMOA 2XRWA 3GC9A 3GI3A 4MWIA 4BKYA 4DLIA 5HG5A 1Y6AA 4U3YA 3BPRA 3QQUA 1WBTA 3ZZEA 3FKOA 4H1MA 4I3ZA 5M4FA 5FEQA 4FSRA 4FOBA 4R3CA 4YHFA 4LGGA 4M66A 5CVFA 3QQLA 5G6VA 3RHXA 2FSLX 4P2KA 2JGZA 3PLSA 4YJVA 2WQMA 1YOJA 4UALA 5ANIA 1SVHA 3AMYA 3F69A 4RFZA 4AZTA 3ZEWA 4IVBA 2X9EA 4DGGA 2XIKA 5KMKA 1JKTA 3BX5A 4L46A 4C61A 3TG1A 4CKIA 5CU0A 1MRYA 4HYHA 3MN3A 1GJOA 3S3IA 3FY0A 3ULIA 4RZVA 2X6DA 1L3RE 1PXJA 3BCEA 2YERA 3DKFA 4OTPA 4ZTMA 2YWPA 4LM5A 3P0MA 4EOIA 5GIPE 4ENYA 4IWQA 4NK9A 3QCQA 3ZDIA 2NRYA 3I0QA 4ITIA 4AAAA 4UEUA 3MJ2A 1FVTA 4FIFA 3F82A 4PL5A 1OBDA 4JIAA 3W2OA 5EHYA 3CY2A 3BV2A 4LFIA 3HKOA 3VQUA 4O81A 5HCYA 4XV9A 4E8AA 5C8NA 4EL9A 4A4XA 3C9WA 5GNKA 3LZBA 1JSVA 1OL5A 1UNHA 4U42A 4MCVA 4X6RA 4O7SA 3ZSHA 4UWYA 4CYJA 3EN6A 3G5DA 2CNVA 1YXSA 5L8KA 4EJ7A 3DK7A 2F7XE 2IO6A 5I9XA 4FUYA 1MUOA 5BMMA 4F99A 2UW9A 4V01A 2PVHA 3HRFA 2XK8A 4GFOA 5M56A 5IQFA 4E26A 5I4NA 2GTNA 2XNEA 2R0UA 4BDGA 3A60A 3PA4A 4QP9A 4BIBA 4R77A 4ZS4A 2YDIA 4S32A 4XV3A 4QYFA 4X2GA 2X0GA 5AV4A 4EH2A 2OFUA 3QALE 1XQZA 5GJFA 1JQHA 1NA7A 4RWJA 4YJSA 3G0EA 4TNBA 2RG6A 4ZZOA 3ZZWA 1DI9A 1LUFA 2WMQA 4EHEA 4EOJA 2OO8X 4G5PA 5HE2A 3MJ1A 4FTLA 4FKWA 3TT0A 3A7FA 3PXQA 2QOOA 3ZO2A 4E1ZA 1GAGA 2QG7A 2HWPA 3RPSA 2ZMDA 3JVRA 2W9ZB 4E6QA 1L8TA 3KQ7A 3LAUA 4CZYB 4KBKA 2GQGA 1GZ8A 4FSTA 2FUMA 3KGAA 5T3QA 4BGQA 2VTRA 5DI1A 4XX9A 2Z8CA 2B4SB 1R0PA 4OTHA 3HDNA 4FYNA 4D2VA 3N4VA 3PDTA 4FE2A 3LMGA 2A1AB 4O96A 4MHAA 4PRJA 4FKVA 3QX4A 5FXQA 1NT2A 4O86A 3ENMA 5BUJA 4RC2A 5C03A 5AM7A 3FZRA 3QD0A 5K4IA 4FG8A 4EBVA 4C4FA 2I40A 3EL8A 3HV5A 1XKKA 3LFAA 3MIYA 4QYEA 1IAJA 2RG5A 4AWIA 4IMYA 4EK3A 5BNJA 5EOLA 4YZDA 3ORKA 2V0DA 4XG9A 4KA3A 2CLXA 4OAUC 1AD5A 1WCCA 4Z3VA 1XR1A 1O6KA 3F5GA 1U4DA 4HGEA 5CQUA 3NW7A 4R78A 3JS2A 3NNVA 3R9DA 3R9NA 3FC1X 3KU2A 3BHHA 3JYAA 1YHWA 5FBNC 3SX9A 3BKBA 2B7AA 4Y85A 3ZLSA 4CEGA 3QZHA 4ZMFA 4QP4A 3ZHPC 2WEVA 3NNUA 3ATSA 4DCEA 2OXXA 2JDSA 4IXPA 2XKCA 1RQQA 4M0YA 4RC3A 4Z9LA 5A46A 5HTBA 3FMMA 3JUHA 1YHSA 2XKFA 1BUHA 4O27B 4R8QA 4AA5A 3VS5A 3ZEPA 4X3FA 3R01A 4TNDA 2UZEA 3SXRA 3RZBA 4EK8A 4D28A 3DGKA 3KVWA 5TR6A 3Q4ZA 4JBVA 3EQIA 3UIMA 4F9AA 2PL0A 4EKKA 5LQFA 4A4LA 3W2CA 5IMEA 4I21A 3TNIA 1BX6A 5EW8A 2E9NA 5A4LA 4QTAA 2WIPA 3LFCA 4W9XA 2C1AA 4FV0A 4C3RA 4CV8A 1KE5A 4FEVA 4EH3A 3DB6A 2FSMX 2Q0BA 4G17A 4YP8A 2PVLA 4FICA 3VUDA 2XM8A 4A4OA 4EONA 2PPQA 2XKEA 3SHEA 2X8EA 4O0RA 4IFCA 1I09A 3TNPC 5JFXA 2XA4A 3KFAA 3R7YA 5L2WA 3UQFA 3VBTA 3CQEA 3OWPA 3NNXA 4MVFA 2OJFE 4HGTA 4ZSAA 4RBLA 4ZTRA 3OUKA 2BR1A 4A9SA 4J53A 5J8IA 2EVAA 3WIKA 3Q5IA 4I20A 4BF2A 3QTRA 1DM2A 4CZTA 1U5RA 4IB1A 2HXQA 2HENA 3C4EA 2CJMA 4O21A 3ALOA 2OZOA 3HZTA 4NFMA 5A3XA 4LI5A 5LVOA 3NW6A 4JNWA 3OG7A 3QCSA 5FBOA 4Y5HA 1YXVA 3LFFA 5HNBA 3QHWA 1ZOGA 4AU8A 4RFYA 4MH7A 2BFXA 2VTJA 4OUCA 3ZRKA 4JR3A 4WNMA 4EEVA 4ANLA 3ZXTA 5HESA 5KNJA 1GNGA 2F9GA 3H0YA 3R0TA 3H30A 4EHVA 3AGMA 3UIBA 3MGYA 1DI8A 2VWXA 2VU3A 3ID6C 3QD3A 4WA9A 3A99A 5AP5A 4RVMA 3U55A 3CTHA 4KIKB 5D11A 3FHIA 3ZUUA 1E1XA 2FO0A 1YI4A 4RLKA 4EZ3A 3EFWA 3KULB 4AGDA 2IVSA 3KY2A 5C4LA 3EQHA 2VD5A 3FSFA 1Z57A 3GEQA 4D4YA 2XJ1A 3OOGA 3A4PA 2YIRA 3NUAA 4LOQA 4V0GA 3AG9A 4IAAA 4D55A 1UV5A 4CXAA 1XH5A 3MESA 4JDHA 4AGCA 2P2HA 1IRKA 4NKSA 5IH5A 4ZIMA 5HCZA 3H9FA 4M84A 3FDNA 3FZOA 2IZSA 3OW3A 2XIZA 1V0OA 3IDCA 4ZLOA 2Q0NA 4MNFA 4DG2E 5E4HA 3IKAA 4K8AA 4F65A 3F66A 2GFSA 3M11A 4F7JA 5C8KA 4QMTA 3C13A 3QU0A 4IAFA 2VO6A 3L9LA 1XH7A 4BDBA 3HMPA 5CZIA 3Q6WA 4YZ9A 2QKRA 4U3ZA 4QMNA 1OIUA 2HWOA 2QI8A 1IA9A 3JXWA 3FMLA 4LGDA 2PZPA 5A6OA 2XIRA 4FTRA 4U41A 3LQ3A 4YSJA 2JAMA 3BU3A 5DR9A 5JT2A 5CXHA 4ZSJA 2QOCA 3R7GA 4FV9A 4QTDA 4BBFA 3SVVA 4DINA 4BZOA 3QZFA 2IZRA 3KMMA 2XB7A 5L6WL 4C62A 4D2PA 4IC8A 3V04A 2W17A 4HW7A 4LUEA 4Q5EA 2HZIA 2G9XA 5HI2A 3RPYA 2PMIA 3Q5ZA 4CVAA 4I0TA 4YLKA 4ACHA 3D14A 3IONA 2I0VA 5ANDA 3L8XA 3EQFA 3I60A 2ZVAA 4ANOA 5H8GA 3FL4A 4TWPA 5IA4A 3MB6A 4K33A 2OZAA 4EWQA 4BCGA 3IOKA 1OBGA 4H36A 4O7WA 1Q8ZA 2VWZA 3OP5A 4R1YA 4AUAA 2JDOA 3UNZA 5AIKA 5D12A 1XBCA 3GU7A 5FD2A 3AMBA 4QP1A 2UZUE 2W05A 5LCKA 1GOLA 4BBEA 4MQ2A 3F3WA 5JRSA 2Y6OA 3TNQB 4X6QC 3D7TA 5BVDA 4CRLA 2B9JA 5DG5A 3DCVA 3NPCA 3ORTA 4EZ7A 1JAMA 1WAKA 3VBQA 3PPZA 1H0WA 2J7TA 2ZM1A 4D2TA 3EQDA 2C1BA 4XV2A 1CTPE 2QOQA 3UQCA 2XYNA 4YC8A 1P5EA 5DOSA 5DR6A 4O22A 4EORA 1J1CA 5ETIA 1KE7A 4K9YA 2YIWA 2GU8A 2JDVA 2VWYA 2P0CA 1Q62A 4TT7A 5AAFA 4BICA 4ZTLA 5T68A 2W1ZA 5E8YA 5FTQA 4J97A 4RIYB 4CFUA 3I4BA 1ZOHA 3UE4A 3ODYX 3KF4A 2BRMA 4QRCA 1PF8A 3VUGA 1QL6A 2WMRA 4PY1A 4X21A 2VWUA 3UGCA 1KV1A 4NUSA 4AX8A 4BCOA 2UVZA 1SYKA 2HELA 3GFEA 4V05A 3TN8A 4ASDA 4BCJA 4C4GA 2EXMA 3BI6A 4G3FA 5CT7A 3TI1A 3PSBA 3ZMMA 4D0WA 4QMUA 4IM3A 3MYGA 4IB3A 3CPCA 4L00A 2FH9A 5AADA 2ZYBA 2JAVA 3M2WA 4ONAA 3W2QA 4ORKA 4Z16A 3UG1A 4MBJA 4DFZE 4HVSA 3UPZA 1OPJA 3DB8A 3G15A 4LOPA 3DT1A 4QP2A 4QQ5A 4DA5A 4L44A 5M07A 2FSOX 2HZNA 1OPLA 3GU8A 4GJ2A 4QYYA 4UYNA 2BRGA 2QQ7A 5DR2A 5BVOA 3BQRA 1B39A 2YA9A 5T6KA 2WMBA 5EW9A 3KEXA 1WZYA 2J90A 3AC8A 1OKVA 4G16A 2LAVA 3LMHA 1Q99A 3ZXZA 4EK5A 4FKRA 2W1CA 4P7EA 5C1QB 3UMWA 3QTUA 3VRYA 4L53A 2OLCA 2CGVA 5BYYA 3OXZA 1P4OA 4GJ3A 5JFWA 1K3AA 3QXOA 4N4SA 4AGWA 3RMFA 3EIDA 3LXPA 1Q61A 5IG1A 3QX2A 2C68A 2CGUA 3GUBA 2O5KA 1LP4A 2VO3A 2W1IA 4KINA 4IJ9A 4IJPA 1H01A 3PXKA 2ZV2A 5DVRA 4ZY6A 4EC9A 5I9ZA 3UOJA 4AZWA 4OGRA 3DFAA 3QYZA 1OMWA 3FI8A 2XK7A 3QKLA 3AT4A 4YZNA 3RAIA 4F1TA 4MF0A 4EQMA 1W7HA 2BPMA 4CD0A 3II5A 4D2SA 3I7CA 3FAAA 4X7QA 2G1TA 3W10A 4XBUA 3RAWA 1ZLTA 5C27A 4RJ6A 2ERZE 1KV2A 4APCA 4FEXA 3NNWA 1JVPP 3ZRMA 1PJKA 3MFUA 3VHKA 3D83A 3DKGA 4DH3A 3F61A 3POZA 4JQEA 1XH4A 5AA8A 4RJ5A 5GJGA 5DYJA 4AA0A 4YJTA 2BIKB 3R1QA 4CLJA 1ZYDA 3BWFA 4BCMA 3RVGA 2JKOA 3I0OA 4A9UA 4FMQA 5M06A 1W82A 4D5HA 4RVKA 4UWBA 3U4UA 1J1BA 4G2FA 4I94A 1RJBA 3HV7A 2C0IA 4BVUA 3HNGA 4QQTA 4OBOA 5CSXA 4AQCA 3KVXA 1U54A 3PY0A 3R1NA 4G9RA 4U80A 3N4UA 2ETRA 4DT9A 3F6XA 3UC3A 3P7CA 2NO3A 3LM5A 3WIGA 1R39A 1YWVA 1HCLA 3UZTA 3UYSA 4NCTC 4NU1A 2X2KA 3EWHA 1W0XC 3ACKA 3ORZA 3HAVA 3D7ZA 4QP7A 4OTQA 4AN2A 1I44A 1H1SA 3PJ2A 3V5WA 4EC8A 4NIFA 2O65A 3LFQA 3TTJA 1PXOA 2QONA 3ODZX 3QAME 5IQHA 4CKRA 2QCSA 3MH1A 4JRVA 4RX7A 4APPA 4CFXA 4EUUA 3FQEA 2BZKB 2OH0E 2VZ6A 3F3UA 5ITAA 3W8LA 4BY9E 4EOPA 4RSSA 3F9NA 5CEPA 2J0IA 4IM0A 3RK9A 3DJ6A 4ENXA 5B2LA 2PVNA 5KBRA 1ZYJA 4KIKA 3ZFXA 3EFLA 4EOQA 3CTJA 2UZNA 3VRZA 2OI4X 4F63A 3BLRA 4TYJA 3EMGA 1ZZ2A 4M12A 4W4XA 2ITUA 3E7OA 3R73A 1QCFA 3QYWA 2RFNA 3KMWA 3VBYA 3WE4A 4NYEA 3FI3A 2WKMA 4FV7A 5D7AA 3TTIA 3QWKA 1RW8A 3O2MA 2WHBA 4I5CA 4KRCA 4QMVA 4YHTA 3W2SA 2XNGA 4U8ZA 2ITQA 5IEXA 4U40A 4FC0A 3ZONA 2B9HA 4WSQA 4AFJA 4GW8A 4Q9ZA 2OJJA 5BYZA 5K5NA 4CSVA 1H26A 1FMOE 4DGMA 3PIZA 1VYZA 2XNBA 3PJ1A 4E6CA 2WMTA 2BCJA 4L7FA 4TKSA 2C6TA 2V62A 2X2MA 4DFLA 5TKDA 4DF3A 3HDMA 3TV4A 4YZMA 4M8TA 5M4IA 4ZZMA 2GNHA 5K4JA 5J5SA 2GTMA 4K2RA 1VZOA 3CCNA 3ZM4A 2BALA 4ALUA 2J50A 4YJPA 4C34A 3UIUA 1FINA 1YWNA 3GC0A 3R63A 4MXCA 4JT3A 2Z60A 4I41A 3G90X 4DEIA 5CAPA 3RK7A 2ZOQA 3CSVA 3TEIA 3BLQA 4QNAA 3B2WA 3FZPA 5B0XA 4UBAA 2B52A 4FTAA 4M67A 4MQ1A 1OITA 5FUTA 1OKYA 4EOSA 3OVVA 4D1SA 2YIQA 2F7ZE 3OOMA 3FUPA 4HNFA 5F20A 3VF8A 3KXHA 3SW7A 3KMUA 2OIDA 3FZ1A 2YM5A 4D58A 5GIOE 2G15A 2X1NA 3EQGA 5HBHA 2DS1A 1DAWA 5CEIA 1Q97A 2W99B 2F57A 3KKVA 3DK3A 2IZUA 5J9ZA 2OK1A 2I6LA 1OB3A 2WTKB 3I6UA 4RIWA 4UMTA 5EDQA 5HICA 4BCFA 4C35A 3KULA 3A8XA 4M3QA 1OPKA 5HBJA 3E87A 3IW4A 4C2WA 3VW6A 3HEGA 4FV8A 4CQGA 1NVRA 3AXWA 4GKIA 5IUHA 2WTIA 1B6CB 2GNLA 2XCKA 4F7NA 2QO2A 3DBEA 4YR8A 4X2NA 5AIRA 5L2TA 3W55A 4IE9A 2C4GA 3FMDA 5ANGA 2ZV8A 5LVLA 4XYFA 3EHAA 2W4KA 4GSBA 3PY3A 4W8DA 4JDKA 2CNUA 2C0TA 4CTBA 3BGQA 4PX6A 3UP2A 5HHWA 5M44A 2VX1A 2Z7RA 3MPTA 2YDKA 3QXPA 5DH3A 4C4EA 5CENA 4GT3A 3C5UA 4DFYA 2CDZA 2IG7A 4LRJA 3TDWA 4YJUA 2C6LA 4UZHA 1KE6A 4GG5A 4HJOA 1KE8A 3BYMA 2XNOA 3QL8A 4FG9A 4U5JA 4FV1A 3RAHA 3ZDUA 3GXLA 3QC4A 5LXMA 3MY1A 4DEHA 4IACA 3WILA 1WFCA 4UN0C 5CSWA 2OICA 4XBRA 3Q60A 2JITA 2PUUA 4F9BA 3IDBA 2VTPA 3D15A 2XNMA 5E8TA 5DMZA 2R3MA 4FT9A 3RBWA 5M51A 2VGOA 4A9TA 2GS6A 4E20A 1STCE 4O0WA 4QPMA 4PMSA 5I3RA 2HW7A 1H00A 5JFSA 4QTBA 5EW3A 3WF6A 3AD5A 3G33A 3TUBA 4KKGA 2XS0A 4OTFA 3LLAA 3ZCLA 2YEXA 3DXNA 2ACXA 4FVRA 3QRKA 4J98A 4C38A 3ZRLA 3FEGA 1A06A 4PV0A 3R1YA 5AR7A 2E2BA 1CM8A 4L3JA 3PWDA 2CKPA 3DA6A 3WYXA 4O6LA 3ZFMA 4NTSA 4MK0A 4E73A 2GHGA 3P86A 4OTIA 5EDRA 2XJ0A 2A4LA 4C3FA 3POOA 4HYIA 4J71A 2J4ZA 5JSMA 1Y8GA 4O1OA 4RFMA 4N57A 4LL0A 4U79A 2IW9A 4DH5A 5KMLA 3SD0A 1LPUA 3TZ9A 3VUIA 4F6UA 2G2IA 3MPMA 3T8OA 2UZOA 5C01A 2H6DA 4C7TA 5JZJA 2VNYA 3HECA 4HVGA 4BGHA 2V22A 2ZMCA 4WNOA 2ZDTA 5LWMA 2CGWA 5HIEA 2WIHA 5HIDA 5E8SA 3O7LB 5DT3A 1M2RA 3E5AA 2GHLA 4QYHA 3VVHA 4ASXA 3BU5A 4CFMA 2W1EA 4QNYA 1Q8TA 3FLZA 2WOTA 5DIAA 4BYJA 4TW9A 1ZOEA 3FLQA 2QD9A 4BHZA 5AUXA 5LMKA 3EJ1A 2BDWA 2X2LA 3E8CA 4EZ5A 4PDOA 5CZHA 3R8PA 2WZJA 4EKLA 2F4JA 2XBJA 5KHXA 2YM8A 4RIYA 3WZUA 1Y57A 3ZLWA 1M7QA 4ASEA 3NDMA 1M14A 3OWJA 4RWLA 3E7VA 2VTNA 1IEPA 3JR1A 4DC2A 4ARKA 1YDRE 4GEOA 5JZNA 2Z7LA 2Y6MA 2HY81 3PG3A 2JBOA 5M4UA 4KSPA 3QF9A 5DBXA 5IA2A 3RCJA 5L4QA 1J7UA 1PXNA 3ZFYA 3VO3A 4MXAA 5CX9A 4YUQA 3QTZA 5CVGA 3NIZA 2PE0A 3ZH8A 5CXZA 4FKTA 2W1DA 5DEYA 4KIQA 1UU9A 2BRNA 3NIEA 2C6OA 1K2PA 5BQ0A 3HA8A 3O7LD 2P3GX 4FSYA 4XRLA 5ANOA 3ZO1A 4EH9A 4X2KA 2UW8A 3A7HA 4Y72A 3B8RA 5AP3A 5HG9A 5E9EA 2WO6A 4F7SA 3ZM9A 3FKNA 1BLXA 4NW5A 2BMCA 4NJDA 5FTGA 3ET7A 3EQPA 4QO9A 4C33A 3DK6A 4IDTA 3FMHA 4H05A 3C1XA 2R3HA 5E8UA 4W4VA 2X7GA 2QU6A 3QGYA 4TYEA 4F6SA 3ROCA 5HX6A 4NTTA 4I6QA 5BX0A 3VBXA 3NYXA 5CQWA 4I6FA 4CTCA 1UKHA 4TRLA 3ENHA 4G3DA 4D1ZA 3FE3A 4JS8A 5AR2A 2XK3A 1UU8A 3UO4A 5A6NA 3ORIA 3HRBA 4MNEB 4C59A 5HD4A 2PSQA 4OBPA 2PULA 1WBNA 5CSPA 5HQ0A 5I9YA 3K3IA 2ZM3A 2R7BA 4H3PA 5TT7A 2GQSA 3PVUA 1UA2A 5J79A 4YTIA 3ZO3A 2CN8A 3UYTA 1H08A 3BE9A 4B8LA 4BRXA 1F5QA 1QPEA 1WVYA 4Q2AA 5JK3A 3UOHA 3UIXA 3ZUVA 4O7YA 4MD7E 2Z7SA 4HYSA 1YXUA 1IAHA 4BKZA 4LMUA 4YHJA 3QRTA 4LGHA 4CMTA 3A7GA 2I0EA 4C58A 3O8UA 4QMZA 4EHZA 2UW6A 2PZYA 3CC6A 3OTVA 5CU2A 4RQKA 3W2RA 4FI1A 5I5ZA 2YZAA 3EN5A 2VWWA 5HE0A 2XRUA 4EI4A 4CFFA 2BIYA 2ITOA 3E93A 1KOAA 1YOLA 4KKHA 4KNBA 5EI6A 4C36A 2X6EA 3R83A 4D4VA 2VN9A 4XLIA 2C3LA 2AYPA 3GVUA 5EYMA 2C6DA 3B2TA 3C4WA 1GZNA 4GUEA 1WMKA 4TWNA 1J3HA 2UZTA 4RGJA 3R7IA 2QLQA 5J1WA 5AUZA 2LGCA 2OFVA 3UPXA 3COKA 3ULZA 1Q41A 4O7VA 2AUHA 5HVJA 3GBZA 5H2UA 3QD4A 3NUNA 1GIJA 4FT5A 4YJNA 5EQEA 2ZJWA 4I5PA 3CEKA 3SXFA 1R1WA 3PVGA 4FZAB 1R78A 2XYUA 3FI2A 3DLZA 3EOCA 3AC3A 3CLYA 2OF4A 1EH4A 1M2QA 3TJCA 1Q4LA 3LCSA 3V3VA 4AZFA 2UVXA 4ZOGA 3R28A 3IPHA 4YJOA 5IUIA 4FKLA 3LCTA 4HNIA 5EHOA 4C8BA 3Q2JA 2ZDUA 1ZXEA 5EM7A 3AT3A 2W5BA 3Q32A 3TKIA 5JKGA 1FOTA 5DT0A 3BRBA 1Q3WA 2IN6A 3DJ5A 5HO6A 1OIRA 4BCPA 5B2MA 5LARA 5HOAA 4ZZNA 2YCFA 2P55A 3NZ0A 5FRIA 1GIHA 2A2AA 2WPAA 3R30A 3C0HA 4BDCA 3HUBA 4P90A 3PJ8A 5AV0A 4XHKB 5F94A 4JR7A 4Q5HA 4LRMA 2JIVA 4EYMA 4ITHA 3CJFA 2RIOA 1UVRA 2O8YA 3HV6A 3NWWA 3OWLA 4XRJA 3Q6UA 4U7ZA 3ZYAA 4IDVA 4BDHA 4AT3A 4FKIA 4BYIA 2IJMA 4FL3A 3RJCA 3CGFA 4GKHA 4KS7A 3FMJA 2XK9A 3PY1A 2I0HA 1HOWA 2HXLA 2GNJA 2O2UA 3KF7A 3LCKA 3OXTA 4E5AX 2C6IA 2YLEA 3SXSA 2X39A 3UTOA 3PFQA 3P9JA 2QOLA 3FC2A 1BI8A 3RK5A 3TUCA 2YM3A 5M55A 3BGPA 1BL7A 5HTCA 3DY7A 3RALA 3QCXA 4XJ0A 2QOKA 2QOFA 3OF0A 2WD1A 4DCAA 1OL7A 5BVEA 4RIXB 4E5BA 3DNDA 3GU6A 3DBCA 5CLPA 4LOOA 5M57A 4CCBA 2ESMA 4O2ZA 3VULA 2IW6A 4JBOA 4QMOA 4E4NA 1LEZA 2OIQA 2PE1A 1BI7A 3QHRA 3R21A 5D1JA 4KS8A 5HGIA 3V5TA 3VAPA 4ACGA 4B0GA 2RFDA 4U97A 4QMPA 2OJIA 2CCIA 4A07A 2YAAA 3NS9A 2R3IA 2Z2WA 4OTRA 4G6LA 4AFEA 4YTCA 4I1ZA 4DTAA 2A19B 3KRXA 3T9TA 3V8TA 4DEDA 5ANKA 5EG3A 1P4FA 4XG7A 4F09A 3ERKA 5ETAA 5L6PA 2CGXA 2X9FA 5EKNA 4EBWA 1YOMA 4FZ7A 3R7OA 2WOUA 1PMVA 4U43A 4AT4A 2Z02A 3EQBA 4IWDA 5M08A 4Z7HA 1A48A 4M0ZA 4CMUA 3NLBA 4DEBA 1TQPA 5CAQA 3NX8A 3EKKA 5HLPA 3U9NA 3MDYA 1NVQA 2I0YA 4YZCA 3LXKA 4E4XA 3NEWA 3EQCA 5HD7A 4R6VA 5KMMA 3LFNA 4NW6A 1BKXA 3TL8A 4KUJA 2VO0A 5J1VA 4BWKA 4FSMA 2IWIA 2HW6A 2YITA 3SC1A 4D9TA 4AW2A 2F7EE 4Q9SA 2OSCA 2DWBA 4IANA 4B99A 4R5YA 4E6DA 3A8WA 1W98A 1PXLA 1V1KA 4O82A 3R8MA 2WQOA 1TQMA 2UVYA 4AACA 4D5KA 5AR4A 2BZHB 4WUNA 5E8ZA 4M97A 3F5PA 2PZ5A 4V0GB 5HE1A 4EH5A 3BIZA 1X8BA 1YXTA 4FIEA 3V5JA 2R2PA 4KABA 4O7LA 3RPVA 2X8IA 3D5WA 4L45A 1YWRA 1YW2A 1ATPE 2NP8A 3CD3A 3BE2A 3DOGA 5CSVA 3DNEA 1MQ4A 4O1PA 2WQNA 3RWPA 3UVQA 2YWVA 1SZMA 2ITXA 2IVVA 3QKMA 3BZ3A 4FSQA 4TYHB 2W1GA 5A4EA 1MP8A 4X3JA 2V5QA 3VS4A 4MD9E 3RNIA 2OGVA 4Y95A 3VNTA 4XP3A 5I9UA 3P5KA 4BTKA 4DE4A 2IW8A 3NUYA 5DFPA 1KWPA 3KXZA 3QD2B 3PE1A 1FBNA 4BDDA 4IM2A 5IEYA 4KSQA 3SRVB 2C5YA 2WU6A 4JDJA 4NZWB 5M4CA 3SLSA 3TV6A 4I0RA 5HG7A 4BIEA 3T3UA 2BKKA 3EYHA 4C2VA 5J7HA 4E4MA 1YDSE 2PK9A 3V01A 2C69A 3CD8A 4Y73A 5AV1A 4YPSA 5HTIA 5KE0A 4FIIA 3DZQA 4FKPA 5AR5A 2OU7A 3QUDA 5D9HA 3HV4A 5CSHA 3RKBA 2HYYA 3QQJA 4EOLA 3MWUA 4L42A 4BCQA 5C8MA 2YISA 3LPBA 5CWZA 2I7QA 3E64A 2E9VA 2G2FA 3R00A 1Q3DA 4FF8A 5IQDA 5CNOA 3ZC6A 1URWA 4OW8A 3E8EA 3OEFX 3SW4A 4DGOA 4UWCA 5TO8A 5AV2A 2B54A 5EM6A 3RINA 4GVAA 1Q8UA 1O9UA 2QOIA 4UZDA 2WMUA 4U45A 1SVGA 3EFKA 2W4OA 3G6GA 4ZSEA 4ZP5A 5H9BA 3NVKI 3VUHA 4EQCA 2QODA 3PPKA 3W32A 2PUNA 4NM7A 2BAQA 3DAEA 4L67A 5AX9A 3RNYA 3ZSIA 4O0TA 3CR0A 3D7TB 2B55A 5LOHA 3OUNB 3IDPA 3PA3A 5HU3A 3CGOA 5IQAA 4IVDA 1ZYCA 4J96A 4EUTA 2Y8OA 4KIOA 1SNUA 4ZJVA 2VTMA 1CMKE 3TWJA 3FSKA 4PMMA 4BTMA 2R7IA 4Y83A 2C6EA 3CPBA 2DQ7X 4H1JA 2OJ9A 4JBPA 4NSTA 3M1SA 2YACA 1V0PA 3SQQA 4MF1A 4DTKA 1WVWA 5IMXA 3DXPA 1JKSA 3O96A 3N51A 3EZRA 3KN5A 4HGLA 5FDXA 3R1SA 2BKZA 5JGBA 2PVKA 3A7JA 3DKCA 2FVDA 3CQUA 3LW0A 4USDA 1NVSA 4R1VA 2C3IB 2XIXA 3HRCA 3L8PA 3KRRA 1OL1A 3GOKA 3ORXA 4O0SA 1KUTA 5HU9A 4IBMA 4UYAA 3NR9A 4AXAA 4FIJA 3VS6A 5L2SA 4ASZA 2O63A 4MBLA 3U9CA 3QTIA 1P2AA 3AMAA 4IWOA 3FJQE 3OCBA 5J87A 5ACBC 5TE0A 4O0UA 4ZJIA 4RWIA 2C5XA 5DWRA 4EK4A 4YNEA 3KRWA 5BVFA 3V51A 3GU5A 4F0GA 4UXQA 5HEZA 4BDKA 3LFDA 3DTWA 4IAYA 2ZM4A 4FK3A 4NCTA 4F9WA 3S00A 5ANJA 4ZS0A 2PMLX 4FEWA 3WZKA 2J0MB 3TZMA 4GUBA 4DFXE 2CKOA 3PP0A 3OC1A 4TYIA 4F9CA 5JRQA 1XWSA 3W16A 3PVWA 5FG8A 4JX3A 4QPSA 3RAKA 1Q24A 2XP2A 3WF7A 1BMKA 3WYYA 3GFWA 4QP6A 3V5LA 1JKLA 5E90A 4A9YA 4CKJA 5J5TA 1AGWA 3BLHA 1UNLA 3CP9A 1QMZA 3DU8A 3NCZA 5CI6A 5AMNA 2OXDA 3NGAA 1YQJA 5EQPA 4AA4A 2BZIB 5IA1A 1PXMA 4FV5A 4MXXA 2C3KA 4YC3A 5FWKK 3RI1A 4N70A 2R4BA 4FT3A 4J52A 1J7LA 3DTCA 3IECA 4XP2A 1AQ1A 3MY0A 3CKXA 4GG7A 2C5OA 1NXKA 4AG8A 1F3MC 4PMTA 1U46A 5B7VA 3LKMA 2VTSA 4O7ZA 2WTVA 5DPVA 3PJ3A 3OWKA 4D4SA 1DAYA 2FYSA 2VTTA 5EI8A 4BWPA 1FVVA 4IX5A 5IQCA 4O0XA 4KBAA 2DUVA 4AW0A 4IB0A 1J91A 2WTJA 3FQHA 3OS3A 2PVRA 4FTCA 3DQXA 3G2FA 4JXFA 4XUFA 3T3VA 3G9NA 1P14A 5I0BA 3QA0A 4S33A 2VWBA 2PVJA 3GCQA 4XEYA 2J51A 5C26A 5CAUA 3IO7A 3KL8A 3WBLA 2QVSE 2XF0A 2BRBA 4OT5A 3F7WA 4KD1A 3MB7A 3MTLA 2W4JA 4FTNA 3ZO4A 3PUPA 4O7RA 2SRCA 3CTQA 3FLWA 4S2ZA 2JDTA 5DGZA 3ZLYA 4II5A 1OKWA 3MTFA 4FK6A 4N6YA 3TNHA 4FKSA 2PUIA 4V04A 5GHVA 3HMOA 3FMNA 4FTOA 5KHWA 5E1SA 4BTFA 4D4RA 3NAXA 4O84A 4FODA 4HYUA 2JDRA 4BZDA 4EH8A 4DN5A 3O17A 2W7XA 3AOXA 2PU8A 3MW1A 4CG9A 4U0IA 3TIZA 3BEGA 3PLAE 4EWHA 2P33A 5GJDA 5L3AA 2BTSA 2YHVA 2JC6A 2C6MA 2XZSA 1W84A 2IVUA 4FL1A 1WBVA 3PJCA 5BMSA 4ZTSA 2WNTA 4E4LA 3CJGA 4FV3A 3LXNA 5IISA 2BDFA 3BBWA 3BBTB 4D9UA 3D0EA 4DT8A 1R0EA 2CLQA 3RTPA 4U81A 5IDPA 3ORLA 2W9FB 4RLLA 1PYXA 1IR3A 2VV9A 3SGCA 2PE2A 2J0LA 5E8WA 3VF9A 4L3LA 5AUUA 4ZXTA 1UU3A 4K18A 2BTRA 5BYLA 4PTGA 4AOIA 1ZY4A 3CE3A 2EB3A 3ANQA 4BC6A 1G8AA 4O38A 3Q4UA 3BHVA 4IFGA 4WKQA 2WMWA 3EN9A 2WMVA 4I6BA 2RKUA 4DITA 1O6YA 3EH9A 5JQ5A 3TV7A 3E62A 2PVYA 3DBQA 3DFCB 1M17A 2CN5A 3KRLA 3HLLA 3OZ6A 3Q9WA 4KAOA 1TQIA 4GIIA 3PPJA 5EM5A 1OECA 4IAKA 4I4EA 2R3PA 1CKPA 4BCNA 3R8UA 5A9UA 5AP2A 5G1XA 3UZRA 2XMYA 3O50A 2VTLA 2YDJA 5D10A 4CT1A 3IK3A 1WVXA 2BRHA 2PHKA 2QG5A 3MSSA 3UZPA 1PXPA 4PP9A 3L9PA 3LQ5A 4L52A 4AE9A 3VQHA 4FZ6A 1ZMVA 3A62A 4WG3A 2VTQA 3V8SA 5AWMA 4IX6A 3VUKA 2H8HA 5CAVA 5J9LA 2B53A 3FZSA 3FHRA 3VUTA 5I9VA 3TM0A 2W0JA 4ZJJA 4AE6A 2OKRA 4ZMEA 1U54B 4H3QA 4JG8A 2C6KA 5JH6A 4MD8E 3IW5A 3Q52A 4FV2A 4IW0A 2QR8A 2YN8A 4BKJA 2H96A 2XKDA 4EOKA 3HX4A 5JGAA 4ERKA 3VC4A 3D5XA 4X2FA 2OWBA 5C4KA 1JSUA 4YLLA 5FTOA 3G0FA 3GOPA 3RCDA 2REIA 3FLYA 3WI6A 5DHJA 4USEA 4NIFB 3KK9A 2PUPA 2ERKA 4XCUA 3LVPA 4BZNA 5CU4A 4XNEA 4USFA 5J7BA 4TWCA 4RJ4A 2V55A 2RFSA 4K6ZA 5E7RA 3P1AA 4RMZA 4UMQA 2VTHA 5LMAA 2XNNA 5TOZA 5IEVA 4PPCA 3MBLA 2OIBA 4TTHB 3PXFA 1XJDA 3U87A 3DAKA 3LHJA 4YTFA 4FKOA 2VGPA 5KMJA 2W96B 4FTTA 3MVJA 5EM8A 3Q9YA 3I5NA 4XLVA 5JGDA 4FSNA 4FVPA 4NH1A 4EQUA 3IG7A 3GC7A 3VJNA 3P7AA 1OIQA 4E6AA 4GFMA 4ERWA 4RIOA 3QZIA 4H3BA 5TF9A 3F3ZA 4S30A 2PZRA 5A4CA 3CS9A 2KTYA 4JI9A 4DAWA 2W06A 1OVEA 3IW8A 2Z7QA 3I5ZA 1IA8A 5LJJA 2UZVA 5KX8A 3RM6A 4BCIA 3HYHA 3NSZA 5M09A 1TKIA 4BI1A 2OH4A 4F4PA 5DRDA 4PUZA 5K3YA 4FA2A 5EYDA 2FGIA 4WNPA 3TUDA 3VW8A 4PF4A 4R7HA 3LXLA 2YCSA 3LJ0A 4LV8A 3SRVA 3MIAA 3WZDA 3ZTXA 2BVAA 3TKHA 2PYWA 4NFNA 2HK5A 3H10A 3AC5A 2H9VA 3PXRA 5AP0A 2GMXA 4GVJA 3IGGA 3PP1A 3QFVA 3F88A 5CF8A 2ITNA 2R9SA 2NNWB 2R3OA 4GK4A 4IAZA 4NEUA 5K0KA 5JN2A 2UZDA 2ONLA 3C50A 3JY0A 3EYGA 3BYOA 3O23A 4XG2A 4W8EA 5HNGA 4I4FA 3V6RA 2R64A 4WSYA 3FZTA 4EH7A 3MVLA 1GY3A 4JIKA 4HCUA 2YFXA 4FEQA 4N0SA 3UNKA 3Q96A 4OTGA 5BPYA 4DBXA 5KKRB 4MTAA 2XEYA 5HCXA 3DBFA 4FUXA 4K11A 2HZ4A 3E92A 4GYGA 4F64A 3LM0A 4UY9A 1WBOA 2Y4IB 4EK6A 5L6OA 3R9OA 3H9OA 5GZ8A 4P5QA 3ROYA 1OGUA 5HZNA 4TPTA 2F49A 2UW5A 3O8TA 5JEBA 3BGZA 2RSVA 4AZVA 1JBPE 3AT2A 2W5AA 4I93A 1A9UA 2YABA 3AC4A 2J0JA 4IX3A 4JX7A 3ZU7A 4X3FC 5E91A 3PRIA 5F95A 3S2PA 3K5VA 3WF5A 2ITZA 4FSZA 3QQKA 3AGLA 1SM2A 1H1PA 3LCOA 3K5UA 5JFVA 3NVMB 4JLCA 3PXZA 2GQRA 1YVJA 2ZAZA 3NUXA 4XV1A 2C5NA 3VUMA 1H27A 3TCPA 4WOVA 3EL7A 1G5SA 3GC8A 3UVRA 4TL0A 1NW1A 4CLIA 3PSDA 4IAIA 3IQ7A 3WZJA 3LJ2A 5KMOA 1E1VA 3RWQA 5KCVA 1PYEA 5A4TA 4MX9A 4DFUA 4FTJA 3AD4A 1WBWA 5E8XA 3UODA 2VX0A 5IQBA 3Q9ZA 3TZ7A 5HLWA 5H8BA 3Q04A 1JKKA 2AC3A 4M69B 1VEBA 3KXNA 3VBWA 3O8PA 4W9WA 4CQEA 4ZTQA 4XG6A 5CU6A 4G3GA 2ITVA 4BR3A 4HVDA 3I7BA 2GNGA 1XO2B 3PRFA 4N6ZA 3R22A 3NAYA 4QTCA 1PMUA 4ZTNA 5HO7A 3I81A 5I9WA 3ZSGA 2GDOA 4L9IA 3ETAA 3VHEA 3MVMA 2EXCX 4IZAA 4W4WA 5KMIA 4WD5A 2BAKA 3ZOSA 3CBLA 3C0IA 4CG8A 4PTEA 3THBA 2PVMA 4I5HA 5AAGA 2GS7A 5AR3A 4DEGA 3E63A 5EI2A 2JKKA 4YMJA 2VAGA 2XH5A 3OCSA 4AOTA 3MFSA 4FGRA 1XH9A 2HY0A 3OW4A 2C30A 4L01A 4QMYA 4XP0A 4Y5QA 3QTQA 5AR8A 5FLFA 3BYVA 1YHVA 3HMNA 3LCDA 2UW7A 3E8NA 2ZB0A 4J1RA 4RIXA 5CVHA 5HORA 4DEEA 2QR7A 2YCRA 3KXMA 2YLFA 4R3PA 4C57A 2RGPA 4JBQA 3Q4TA 4ZSGA 5ICPA 2P4IA 4CFWA 2ZB1A 5DN3A 4C02A 2JFLA 4F0FA 4TY1A 3K3JA 2Q83A 5AX3A 4FV6A 4CFNA 2QOBA 5CF6A 5LMBA 4DHFA 5E1EA 4MAOA 1YRPA 4QMMA 4AOJA 4LG4A 4PNKA 3B8QA 5F9EA 1DS5A 3IGOA 2C0OA 3OD6X 5FM3A 5D7VA 4CNHA 5F4NA 4AZEA 5E8VA 3GENA 4WT6A 2UV2A 4PDYA 4FKQA 4WG5A 3RZFA 5K9IA 2YIYA 1E9HA 2W5HA 3W8QA 1H1QA 3SDJA 3O51A 1Z9XA 4FGBA 2PWLA 4FNZA 4GK2A 2X7OA 3E88A 4JOAA 5L2QA 4E93A 4M68A 3N4TA 5EQYA 1M52A 1UU7A 3D94A 3R02A 4PP7A 4DFNA 3U8WA 4ZLYA 5HLNA 4QMLA 4BDEA 3MV5A 5AP4A 1REJA 3FXZA 3FYJX 3DDPA 5EKOA 3TJDA 2WMAA 3PA5A 3QRIA 2WTCA 5H3QA 1UWHA 3D4QA 4FL2A 1GZOA 3UP7A 1JLUE 2CPKE 2QKWB 2WB8A 2YZLA 1FGKA 4M13A 3FPMA 5AA9A 4JL9A 3KXXA 5D41A 3SG9A 2OG8A 4IADA 4TWOA 4ALVA 5L8LA 4OLIA 4R5SA 3C4FA 1W83A 3REPA 3HP2A 4AGUA 3LJ1A 4PNIA 5AFVA 4JRNA 4YBKA 2R3FA 4HGSA 4WNKA 4OAVB 5HVYA 3FMKA 4FVQA 3ALNA 1TVOA 5IDNA 3HAMA 4NM5A 3TXOA 3Q2MA 3QZGA 3P4KA 2WMSA 2QU5A 4IQ6A 3Q4CA 5EK7A 4EYJA 1OUKA 4JDIA 2GHMA 4YBJA 4MKCA 5IUGA 3TDVA 2R3GA 2UZWE 2ITPA 1CDKA 3FV8A 5JQ8A 5IQEA 1F0QA 2F2UA 2OW3A 1ZY5A 3H3CA 3HA6A 4FKGA 4HPUE 2R3NA 4S31A 5IA3A 4LRKA 3PVBA 3VJOA 4TYGA 4WHZA 3G6HA 3HGKA 3QUPA 2FA2A 3FY2A 1ERKA 4IZ5A 3SV0A 2WGJA 4XOYA 4KIPA 3KA0A 4O0YA 2OJGA 4WUAA 1S9JA 2XK4A 4PPBA 5AEPA 1PMEA 1YXXA 3GNIB 4YPDA 2NPQA 4ACCA 5BVNA 3SA0A 3COIA 1T46A 1J7IA 1G8SA 3G9LX 5AUWA 4BGGA 2XNPA 3O0GA 3R7UA 5DNRA 3NUSA 1FGIA 5J95A 4RA5A 2FB8A 3QTSA 5AUTA 2VX3A 4QMXA 4RT7A 4FTMA 4QP8A 2JKQA 4ANBA 2BHHA 3FL5A 4O91A 4YJRA 3UQGA 2R3RA 2J6MA 4F9YA 4K0YA 5DLSA 2UZBA 1CSNA 3E8DA 3ORNA 3Q9XA 5KMNA 5LVPA 3MH2A 3F3TA 4WIHA 5HNIX 3GCPA 3VWAA 3D5UA 1VR2A 4BWXA 3C0GA 4RPVA 3R8ZA 2DYLA 5LVNA 3BELA 2JKMA 2XUUA 3JY9A 3OROA 4NM0A 3MVHA 4QYGA 4F08A 4HVHA 4J7BA 2VNWA 3PYYA 1VJYA 3FMEA 3ITZA 2B9FA 5CEOA 1BYGA 4QMQA 5FDPA 3DPKA 4HVIA 4IC7A 2HCKA 4QPAA 3DV3A 2BROA 2VTAA 2Y7JA 3PZHA 4RVTA 1Y6BA 4DBNA 5LCJA 3MH3A 3QLGA 2CCHA 4IZ7A 5IH4A 4GL9A 1JOWB 3P23A 4DTBA 4FTIA 2BUJA 2IVTA 3TACA 4PPAA 2BILB 4BI2A 4FNXA 4GU9A 4D1XA 3S0OA 3AD6A 4XH6A 3U6HA 4F6WA 1OI9A 3OCGA 3V8WA 2XM9A 1G3NA 4GT4A 3Q3BA 1KE9A 4QMSA 3MY5A 5AJQA 5KZ0A 2JBPA 3UNJA 4YC6A 2EWAA 4IEBA 4AS0A 2O64A 4XMOA 1PY5A 2GPHA 4ACMA 3KC3A 1B38A 4O2PA 3DS6A 2XCHA 5CYIA 5BUEA 3ELJA 2GNIA 4PDSA 1OL6A 3C4ZA 4LUDA 4F7LA 4HPTE 2G2HA 3A61A 5FEEA 2EUFB 4ACDA 4PMPA 3TKUA 1H1WA 3BHTA 5F1ZA 3V5PA 2HAKA 3OCTA 4IVCA 2KULA 3GP0A 5FQDC 5HBEA 4A06A 4YURA 4IIRA 2WAJA 1H28A 4PDPA 3UVPA 5CANA 2NRUA 3I79A 5AAEA 2F2CB 3D9VA 4IVAA 5HE3A 3C5IA 3PIXA 3HVCA 3WARA 3BQCA 4CRSA 4L8MA 4UB7A 5E92A 5IPJA 2J5FA 5HVKA 1SNXA 5HO8A 3FBVA 2WTKC 4KBCA 5AUVA 4C4JA 2ONLC 4ID7A 2C5VA 1Z5MA 4C4IA 4XG8A 3MH0A 3VS2A 3QTWA 2YJRA 5IA0A 1K9AA 1JWHA 3DBDA 3F2RA 2VO7A 3P08A 4YLJA 2QC6A 5CALA 4OBQA 3H4JA 3FQSA 3HP5A 4JG6A 4ITJA 5BVWA 3HV3A 5CASA 5IU2A 3L8VA 3NYNA 4KKEA 5CY3A 4C4HA 3PXYA 5FXRA 2WXVA 5KZIA 1UNGA 2YM7A 3ANRA 2X81A 2QLUA 4BFMA 4CGAA 2WU7A 4NKAA 3TIYA 1NY3A 4GK3A 3R9RA 2A27A 4O83A 4OT6A 4LMNA 4CYIA 4UX9A 5BUIA 1ZRZA 3LMIA 1H1RA 4TXCA 1PMNA 2P2IA 3C51A 4QQJA 5LVMA 4MBIA 4Z55A 4BDJA 2R3QA 4ZK5A 4C37A 3U6IA 3R71A 5CEQA 3T9IA 3ZBXA 4GIHA 4Z7GA 2VTOA 2GSFA 4F1OA 4YO4A 4RC4A 4GU6A 2EU9A 5CT0A 2GNFA 3RP9A 5CF4A 4JAJA 4G3CA 3MA6A 3OEZA 4GT5A 2J0KA 3AC2A 4RG0A 4EHGA 3F3VA 1LEWA 3JPVA 3QKKA 5A54A 3OY1A 3OMVA 3OT8A 3OY3A 2ZV7A 1M2PA 1YI6A 5J9YA 2FSTX 1SMHA 3FWQA 4L3PA 5EHLA 4DH8A 3F7ZA 3K54A 4YJQA 5DRBA 4R7BA 2G01A 4H39A 3W33A 3CQWA 4YU2A 2CKEA 3ZBFA 3L9NA 1H25A 3N9XA 4UXLA 4IWPA 4RJ7A 1H07A 4DGLC 3R2BA 4ANMA 5JMSA 4IHPA 2HZ0A 3O71A 3HUCA 4HCVA 3BU6A 3HMMA 2X4ZA 3R04A 3WF8A 4FG7A 5CEKA 4FBXA 1VYWA 3UG2A 1O6LA 3LOKA 3RPRA 4BCHA 2CKQA 4BCKA 3P7BA 2J9MA 4GMYA 3GCVA 4ANQA 4DG0E 4O7NA 2UW3A 5AM6A 4DFBA 5IKWA 3IW7A 4MNEA 1U59A 4BL1A 1CKIA 3MI9A 2IZTA 3FLNC 4D2RA 1ZAOA 1OUYA 2R3JA 2Y9QA 2W1HA 2XVDA 4L43A 4RX5A 4WBOA 4LV5A 4GV1A 4R7IA 1YKRA 1QPJA 3KN6A 3KXGA 3S95A 3KCKA 1MRVA 4JVGA 4M14A 4DGNA 2BFYA 4TYHA 2WFYA 2GS2A 3COMA 3FKLA 4I5MA 4NT4A 5L2IA 5M53A 1REKA 4WRGA 4I6HA 4XG3A 1FVRA 3EZVA 3GT8A 2QURA 3KCFA 3L8SA 3TNWA 4DYMA 2YAKA 4RJ3A 1V0BA 3ACJA 2PZIA 4ZY4A 5GZ9A 3R7EA 3DLSA 3LIJA 1Y8YA 3U4WA 2R0IA 4QD6A 5EDPA 4X0MA 5H8EA 5IH6A 3NRMA 5C9CA 4U9AA 1HCKA 2BDJA 2RL5A 5HX8A 1Y91A 3H9RA 5CI7A 3NYVA 4RWKA 3VN9A 1URCA 4CCUA 4GFGA 4FNWA 3FPQA 3QBNA 2HIWA 3DKOA 4IB5A 4L68A 3FLSA 5KO1A 4RX9A 3UDBA 3EQRA 1RE8A 2H34A 3QWJA 4YSMA 3FXWA 4DLJA 3HL7A 1XH8A 3QC9A 1BL6A 1T45A 3VBVA 5AV3A 4HZSA 3CKWA 1UKIA 1S9IA 3OXIA 4ZAUA 1M7NA 2IPXA 2WELA 3OBGA 5HIBA 2XIYA 1H8FA 3UMXA 1PRYA 4S34A 2JEDA 2VWVA 4YZBA 3ZUTA 3ZS5A 2QHMA 2JFMA 1YI3A 3QA8A 3FXXA 5IA5A 1Q5KA 2QOHA 4G9CA 3SOCA 2WTWA 4H58A 5AP6A 4E3CA 2OBJA 2JLDA 2R3KA 3BHUA 4FTQA 4FTUA 2R5TA 4K1BA 5CTPA 3C7QA 3V5QA 4J8MA 3QTXA 4MXZA 4FIHA 1MQBA 1CKJA 5FP6A 3IW6A 3GGFA 2UW4A 4FSUA 2ETMA 4WO5A 3ATTA 1QPCA 3GQLA 4OTWA 3C4XA 4JJRA 2WEIA 4KWPA 3CY3A 4XG4A 5L8JA 4EH4A 4U44A 4RX8A 2QO7A 3IOPA 3W18A 4O7TA 1YDTE 4QP3A 3P78A 4I22A 3K2LA 1WBSA 4DEAA 4A7CA 2AC5A 3GU4A 4PL3A 4GCJA 3UJGA 1KSWA 3UC4A 3F5UA 4GH2A 4J95A 1LR4A 2ITTA 3MPAA 5CU3A 5DT4A 2R3LA 1PKGA 3OT3A 5K5XA 4IZYA 4AP7A 3WE8A 3UO6A 1KOBA 4G31A 5HG8A 4EH6A 4NJ3A 3NUPA 3JVSA 4Y46A 4MYGA 4RVLA 4YO6A 3ZC5A 1H24A 3F2AA 2C3JA 5FEDA 5I3OA 3MS9A 4IX4A 3KK8A 4NL0A 3CIKA 2XK6A 3PIYA 3S1HA 3M42A 3UOLA 4C3PA 4ANSA 5A4QA 1ND4A 4OR5A 4ZY5A 1MRUA 2CMWA 2ITWA 4K77A 2RFEA 3VS3A 3A2CA 4JQ8A 4UMUA 4MEDA 3QUEA 3SOAA 1FPUA 3R2YA 5EYKA 5EFQA 3S4QA 3EN4A 5CS6A 3QQGA 3H0ZA 4JG7A 4XOZA 4PQNA 4ZLZA 4UV0A 2ITYA 4EOOA 4J99A 3LLTA 1JPAA 4RIWB 4U6RA 3KB7A 1ZYLA 4FV4A 4PWNA 4I0SA 4X2JA 2X4FA 3I1AA 4M15A 4PTCA 5EYCA 4ZTHA 2OXYA 4BN1A 4C0TA 4RA4A 2WQEA 2UUEA 5EOBA 3RM7A 2VRXA 1ZYSA 4F70A 4YTHA 5KKRC 2PMOX 1IASA 4L6QA 4XS2A 5B2KA 4MWHA 2VUWA 4I92A 4R3RA 3C4CA 3KREA 4GRBA 3GQIA 2Y4IC 3UO5A 2O3PA 4CFVA 3RPOA 3QRUA 5CEMA 5DEWA 4M69A 4GS6A 2BAJA 4FKJA 1XH6A 4I23A 3WZEA 4AZSA 1OIYA 2W1FA 3PWYA 4X3FB 5ANEA 5AUYA 3OHTA 4UMRA 2E9OA 3BEAA 3DJ7A 5KBQA 3R8LA 2CSNA 1GIIA 1H4LA 4G1WA 3R8VA 1H0VA 4BI0A 4FIGA 3OTUA 4E5WA 4FEUA 4WG4A 4B4LA 4MXOA 3EFJA 1ZZLA 3NMUF 2BZJA 2X7FA 4RZWA 1ZMUA 3BWJA 4FSWA 1IG1A 1APME 1FQ1B 2B9IA 2UZLA 3G51A 4WRSA 4AF3A 4B7TA 4A9RA 3ORPA 2V7OA 3U6JA 4Y8DA 3DQWA 2XBAA 2JIIA 2CNQA 1R3CA 4KB8A 4ZSLA 3DAJA 4GYIA 2QNJA 2XEZA 2PTKA 3BV3A 4YNOA 4ANNA 4DG3E 4B8MA 3PSCA 4WBBB 2BHEA 2YM4A 2X8DA 2A0CX 2E9UA 4RJ8A 3BYUA 1PW2A 3MFRA 4FT0A 4NWMA 4B9DA 4BB4A 4CZUA 2HOGA 2PVFA 2WTDA 4UMPA 3AQVA 5LMKC 3UBDA 5CAOA 1OZ1A 1ZWSA 2XJ2A 3L9MA 4HCTA 4QOXA 3SG8A 4P4CA 4TN6A 2PY3A 4HOKA 2J2IB 4BDFA 4LL5A 1GZKA 3PZEA 1ZMWA 1OKZA 3EB0A 5AP7A 3F5XA 3D2KA 4PL4A 2ETKA 4YGAA 5ETFA 4B6LA 3LFBA 3QGWA 2JD5A 1JNKA 4NM3A 2WMXA 1OM1A 3QQHA 4AW5A 4BHNA 3VS1A 3NYOA 4JQ7A 3WOWA 2RF9A 3PG1A 2V7AA 4FOCA 4L7SA 5IZFA 4G6OA 5K0XA 3GB2A 1SVEA 3NUUA 1UWJA
chains in the Genus database with same CATH superfamily
3EN7A 4D2WA 5BVKA 3QCYA 4O6EA 3U51A 3COHA 2I1MA 3D5VA 4BDIA 5DA3A 2VWIA 1U5QA 4FZFB 3OBJA 3QQFA 2QHNA 3SKCA 4F0IA 5IQIA 2Y0AA 3PTGA 5GINE 1XBAA 3MFTA 3NCGA 5LWNA 4QT1A 3DXQA 2YCQA 2YIXA 3FI4A 5IQGA 2EB2A 1PXIA 3PE2A 4FX3A 5EH0A 3MA3A 4G6NA 4BBMA 1WBPA 2ZV9A 1XHAA 4G5JA 4CV9A 3TZ8A 5CF5A 2YJSA 4FT7A 3V6SA 4CT2A 4FKUA 4QQCA 3W2PA 4AW1A 5IF1A 3CXWA 4KRDA 4FZDB 3VS7A 3R6XA 1OL2A 1TZDA 1ZARA 3BYSA 3F2NA 2J5EA 4J8NA 3VIDA 2E9PA 4HZRA 4BDAA 4M7IA 4AXDA 3RHKA 4ALWA 5FGKA 4QTEA 3U54A 3Q53A 3QLFA 2PMNX 5FP5A 5FM2A 4FTKA 3ZLXA 4E7WA 1XBBA 4BTJA 2GFCA 3E3PA 2WQBA 3I6WA 1OGYA 3DDQA 2EXEA 1QPDA 1PKDA 3IS5A 4O0VA 2UW0A 4QMWA 4D0XA 2GCDA 4RQVA 2OF2A 3TMOA 3GCSA 4TZRA 1Q8WA 2B1PA 3HMIA 3ORMA 4F1MA 5GZAA 2O0UA 3P79A 4OTDA 3BHYA 5A14A 3LFEA 3AC1A 1RDQE 4AN3A 4BIDA 4EJNA 2QO9A 5KUPA 3R9HA 4LQMA 1W8CA 1Q8YA 5ACKA 3KRJA 4G34A 3GCUA 3RGFA 4I24A 4LYNA 3L1SA 3W1FA 4G3EA 2C47A 4DH7A 3EKNA 3D2IA 3DZOA 3UDZA 4IH8A 2JIUA 4AN9A 3R7VA 1PXKA 4MXYA 4W4YA 3FYKX 3WF9A 1PHKA 4AT5A 2VTIA 5AP1A 2YM6A 2OZAB 3E3BX 4FR4A 2Y4PA 4EOMA 3NW5A 4FYOA 5FXSA 3VS0A 4DH1A 5HKMA 2B0QA 4FNYA 2CHLA 4ZEGA 5ETCA 5DE2A 4RRVA 3LQ8A 5CNNA 3OFMA 3LE6A 1JSTA 3A7IA 3QRJA 3SAYA 3A4OX 4JAIA 4P5ZA 3UOKA 1FMKA 3LFSA 4CMOA 2XRWA 3GC9A 3GI3A 4MWIA 4BKYA 4DLIA 2AEGA 5HG5A 1Y6AA 4U3YA 3BPRA 3QQUA 1WBTA 3ZZEA 3FKOA 4H1MA 4I3ZA 5M4FA 5FEQA 4FSRA 4FOBA 4R3CA 4YHFA 4LGGA 4M66A 5CVFA 3QQLA 5G6VA 3RHXA 2FSLX 4P2KA 2JGZA 3PLSA 4YJVA 2WQMA 1YOJA 4UALA 5ANIA 1SVHA 3AMYA 3F69A 4RFZA 4AZTA 3ZEWA 4IVBA 2X9EA 4DGGA 2XIKA 5KMKA 1JKTA 3BX5A 4L46A 4C61A 3TG1A 4CKIA 5CU0A 1MRYA 4HYHA 3MN3A 1GJOA 3S3IA 3FY0A 3ULIA 4RZVA 2X6DA 1L3RE 1PXJA 3BCEA 2YERA 3DKFA 4OTPA 4ZTMA 2YWPA 4LM5A 3P0MA 4EOIA 5GIPE 4ENYA 4IWQA 4NK9A 3QCQA 3ZDIA 2NRYA 3I0QA 4ITIA 4AAAA 4UEUA 3MJ2A 1FVTA 4FIFA 3F82A 4PL5A 1OBDA 4JIAA 3W2OA 5EHYA 3CY2A 3BV2A 4LFIA 3HKOA 3VQUA 4O81A 5HCYA 4XV9A 4E8AA 5C8NA 4EL9A 4A4XA 3C9WA 5GNKA 3LZBA 1JSVA 1OL5A 1UNHA 4U42A 4MCVA 4X6RA 4O7SA 3ZSHA 4UWYA 4CYJA 3EN6A 3G5DA 2CNVA 1YXSA 5L8KA 4EJ7A 3DK7A 2F7XE 2IO6A 5I9XA 4FUYA 1MUOA 5BMMA 4F99A 2UW9A 4V01A 2PVHA 3HRFA 2XK8A 4GFOA 5M56A 5IQFA 4E26A 5I4NA 2GTNA 2XNEA 2R0UA 4BDGA 3A60A 3PA4A 4QP9A 4BIBA 4R77A 4ZS4A 2YDIA 4S32A 4O4FA 4XV3A 4QYFA 4X2GA 2X0GA 5AV4A 4EH2A 2OFUA 2A98A 3QALE 1XQZA 5GJFA 1JQHA 1NA7A 4RWJA 4YJSA 3G0EA 4TNBA 2RG6A 4ZZOA 3ZZWA 1DI9A 1LUFA 2WMQA 4EHEA 4EOJA 2OO8X 4G5PA 5HE2A 3MJ1A 4FTLA 4FKWA 3TT0A 3A7FA 3PXQA 2QOOA 3ZO2A 4E1ZA 1GAGA 2QG7A 2HWPA 3RPSA 2ZMDA 3JVRA 2W9ZB 4E6QA 1L8TA 3KQ7A 3LAUA 4CZYB 4KBKA 2GQGA 1GZ8A 4FSTA 2FUMA 3KGAA 5T3QA 4BGQA 2VTRA 5DI1A 4XX9A 2Z8CA 2B4SB 1R0PA 4OTHA 3HDNA 4FYNA 4D2VA 3N4VA 3PDTA 4FE2A 3LMGA 2A1AB 4O96A 4MHAA 4PRJA 4FKVA 3QX4A 5FXQA 1NT2A 3KIOC 4O86A 3ENMA 5BUJA 4RC2A 5C03A 5AM7A 3FZRA 3QD0A 5K4IA 4FG8A 4EBVA 4C4FA 2I40A 3EL8A 3HV5A 1XKKA 3LFAA 3MIYA 4QYEA 1IAJA 2RG5A 4AWIA 4IMYA 1W2FA 4EK3A 5BNJA 5EOLA 4YZDA 3ORKA 2V0DA 4XG9A 4KA3A 2CLXA 4OAUC 1AD5A 1WCCA 4Z3VA 1XR1A 1O6KA 3F5GA 1U4DA 4HGEA 5CQUA 3NW7A 4R78A 3JS2A 3NNVA 3R9DA 3R9NA 3FC1X 3KU2A 3BHHA 3JYAA 1YHWA 5FBNC 3SX9A 3BKBA 2B7AA 4Y85A 3ZLSA 4CEGA 3QZHA 4ZMFA 2X0OA 4QP4A 3ZHPC 2WEVA 3NNUA 3ATSA 4DCEA 2OXXA 2JDSA 4IXPA 2XKCA 1RQQA 4M0YA 4RC3A 4Z9LA 5A46A 5HTBA 3FMMA 3JUHA 1YHSA 2XKFA 1BUHA 4O27B 4R8QA 4AA5A 3VS5A 3ZEPA 4X3FA 3R01A 4TNDA 2UZEA 3SXRA 3RZBA 4EK8A 4D28A 3DGKA 3KVWA 5TR6A 3Q4ZA 4JBVA 3EQIA 3UIMA 4F9AA 2PL0A 4EKKA 5LQFA 4A4LA 3W2CA 5IMEA 4I21A 3TNIA 1BX6A 5EW8A 2E9NA 5A4LA 4QTAA 2WIPA 3LFCA 4W9XA 2C1AA 4FV0A 4C3RA 4CV8A 1KE5A 4FEVA 4EH3A 3DB6A 2FSMX 2Q0BA 4G17A 4YP8A 2PVLA 4FICA 3VUDA 2XM8A 4A4OA 4EONA 2PPQA 2XKEA 3SHEA 2X8EA 4O0RA 4IFCA 1I09A 3TNPC 5JFXA 2XA4A 3KFAA 3R7YA 5L2WA 3UQFA 3VBTA 3CQEA 3OWPA 3NNXA 4MVFA 2OJFE 4HGTA 4ZSAA 3AKKA 4RBLA 4ZTRA 3OUKA 2BR1A 4A9SA 4J53A 5J8IA 1G8KA 2EVAA 3WIKA 3Q5IA 4I20A 4BF2A 3QTRA 1DM2A 4CZTA 1U5RA 4IB1A 2HXQA 2HENA 3C4EA 2CJMA 4O21A 3ALOA 2OZOA 3HZTA 4NFMA 5A3XA 4LI5A 5LVOA 3NW6A 4JNWA 3OG7A 3QCSA 5FBOA 4Y5HA 1YXVA 3LFFA 5HNBA 3QHWA 1ZOGA 4AU8A 4RFYA 4MH7A 2BFXA 2VTJA 4OUCA 3ZRKA 4JR3A 4WNMA 4EEVA 4ANLA 3ZXTA 5HESA 5KNJA 1GNGA 2F9GA 3H0YA 3R0TA 3H30A 4EHVA 3AGMA 3UIBA 3MGYA 1DI8A 2VWXA 2VU3A 3ID6C 3QD3A 4WA9A 3BL7A 3A99A 5AP5A 4RVMA 3U55A 3CTHA 4KIKB 5D11A 3FHIA 4O4EA 1E1XA 3ZUUA 2FO0A 1YI4A 4RLKA 4EZ3A 3EFWA 3KULB 4AGDA 2IVSA 3KY2A 5C4LA 3EQHA 2VD5A 3FSFA 1Z57A 3GEQA 4D4YA 2XJ1A 3OOGA 3A4PA 2YIRA 3NUAA 4LOQA 4V0GA 3AG9A 4IAAA 4D55A 1UV5A 4CXAA 1XH5A 3MESA 4JDHA 4AGCA 2P2HA 1IRKA 4NKSA 5IH5A 4ZIMA 5HCZA 3H9FA 4M84A 3FDNA 3FZOA 2IZSA 3OW3A 2XIZA 1V0OA 3IDCA 4ZLOA 2Q0NA 4MNFA 4DG2E 5E4HA 3IKAA 4K8AA 4F65A 3F66A 2GFSA 3M11A 3O5AA 4F7JA 5C8KA 4FRFA 4QMTA 3C13A 3QU0A 4IAFA 2VO6A 3L9LA 1XH7A 4BDBA 3HMPA 5CZIA 3Q6WA 4YZ9A 2QKRA 4U3ZA 4QMNA 1OIUA 2HWOA 2QI8A 1IA9A 3JXWA 3FMLA 4LGDA 2PZPA 5A6OA 2XIRA 4FTRA 4U41A 3LQ3A 4YSJA 2JAMA 3BU3A 5DR9A 5JT2A 5CXHA 4ZSJA 2QOCA 3R7GA 4FV9A 4QTDA 4BBFA 3SVVA 3W0MA 4DINA 4BZOA 3QZFA 2IZRA 3KMMA 2XB7A 5L6WL 4C62A 4D2PA 4IC8A 3V04A 2W17A 4HW7A 4LUEA 4Q5EA 2HZIA 2G9XA 5HI2A 3RPYA 2PMIA 3Q5ZA 4CVAA 4I0TA 4YLKA 4ACHA 3D14A 3IONA 2I0VA 5ANDA 3L8XA 3UDTA 3EQFA 3I60A 2X0QA 2ZVAA 5H8GA 4ANOA 3FL4A 4TWPA 5IA4A 3MB6A 4K33A 2OZAA 4EWQA 4BCGA 3IOKA 1OBGA 4H36A 4O7WA 1Q8ZA 2VWZA 3OP5A 4R1YA 4AUAA 2JDOA 3UNZA 5AIKA 5D12A 1XBCA 3GU7A 5FD2A 3AMBA 4QP1A 2UZUE 2W05A 5LCKA 1GOLA 4BBEA 4MQ2A 3F3WA 5JRSA 2Y6OA 3TNQB 4X6QC 3D7TA 5BVDA 4CRLA 2B9JA 5DG5A 3DCVA 3NPCA 3ORTA 4EZ7A 1JAMA 1WAKA 3VBQA 4F78A 3PPZA 1H0WA 2J7TA 2ZM1A 4D2TA 3EQDA 2C1BA 4XV2A 1CTPE 2QOQA 3UQCA 2XYNA 4YC8A 1P5EA 5DOSA 5DR6A 4O22A 4EORA 1J1CA 5ETIA 1KE7A 4K9YA 2YIWA 2GU8A 2JDVA 2VWYA 2P0CA 1Q62A 4TT7A 5AAFA 4BICA 4ZTLA 5T68A 2W1ZA 5E8YA 5FTQA 4J97A 4RIYB 4CFUA 3I4BA 1ZOHA 3UE4A 3ODYX 3KF4A 2BRMA 4QRCA 1PF8A 3VUGA 1QL6A 2WMRA 4PY1A 4X21A 2VWUA 3UGCA 1KV1A 4NUSA 4AX8A 4BCOA 2UVZA 1SYKA 2HELA 3GFEA 4V05A 3TN8A 4ASDA 4BCJA 4C4GA 2EXMA 3BI6A 4G3FA 5CT7A 3TI1A 3PSBA 3ZMMA 4D0WA 4QMUA 4IM3A 3MYGA 4IB3A 3CPCA 4L00A 2FH9A 5AADA 2ZYBA 2JAVA 3M2WA 4ONAA 3W2QA 4ORKA 4Z16A 3UG1A 4MBJA 4DFZE 4HVSA 3UPZA 1OPJA 3DB8A 3G15A 4LOPA 3DT1A 4QP2A 4QQ5A 4DA5A 4L44A 5M07A 2FSOX 2HZNA 1OPLA 3GU8A 4GJ2A 4QYYA 4UYNA 2BRGA 2QQ7A 5DR2A 5BVOA 3BQRA 1B39A 2YA9A 1XMMA 5T6KA 2WMBA 5EW9A 3KEXA 1WZYA 2J90A 3AC8A 1OKVA 4G16A 2LAVA 3LMHA 1Q99A 3ZXZA 4EK5A 4FKRA 2W1CA 4P7EA 5C1QB 3UMWA 3QTUA 3VRYA 4L53A 2OLCA 2CGVA 5BYYA 3OXZA 1P4OA 4GJ3A 5JFWA 1K3AA 3QXOA 4N4SA 4AGWA 3RMFA 3EIDA 3LXPA 1Q61A 5IG1A 3QX2A 2C68A 2CGUA 3GUBA 2O5KA 1LP4A 2VO3A 2W1IA 4KINA 4IJ9A 4IJPA 1H01A 3PXKA 2ZV2A 5DVRA 4ZY6A 4EC9A 5I9ZA 3UOJA 4AZWA 1ST4A 4OGRA 3DFAA 3QYZA 1OMWA 3FI8A 2XK7A 3QKLA 3AT4A 4YZNA 3RAIA 4F1TA 4MF0A 4EQMA 1W7HA 2BPMA 4CD0A 3II5A 4D2SA 3I7CA 3FAAA 4X7QA 2G1TA 1W2DA 4XBUA 3W10A 3RAWA 1ZLTA 5C27A 4RJ6A 2ERZE 1KV2A 4APCA 4FEXA 3NNWA 1JVPP 3ZRMA 1PJKA 3MFUA 3VHKA 3D83A 3DKGA 4DH3A 3F61A 3POZA 4JQEA 1XH4A 5AA8A 4RJ5A 5GJGA 5DYJA 4AA0A 4YJTA 2BIKB 3R1QA 4CLJA 1ZYDA 3BWFA 4BCMA 3RVGA 2JKOA 3I0OA 4A9UA 4FMQA 5M06A 1W82A 4D5HA 4RVKA 4UWBA 3U4UA 1J1BA 4G2FA 4I94A 1RJBA 3HV7A 2C0IA 4BVUA 3HNGA 4QQTA 4OBOA 5CSXA 4AQCA 3KVXA 1U54A 3PY0A 3R1NA 4G9RA 4U80A 3N4UA 2ETRA 4DT9A 3F6XA 3UC3A 3P7CA 2NO3A 3LM5A 3WIGA 1R39A 1YWVA 1HCLA 3UZTA 3UYSA 4NCTC 4NU1A 2X2KA 3EWHA 1W0XC 3ACKA 3ORZA 3HAVA 3D7ZA 4QP7A 4OTQA 4AN2A 1I44A 1H1SA 3PJ2A 3V5WA 4EC8A 4NIFA 2O65A 3LFQA 3TTJA 1PXOA 2QONA 3ODZX 3QAME 5IQHA 4CKRA 2QCSA 3MH1A 4JRVA 4RX7A 4APPA 4CFXA 4EUUA 3FQEA 2BZKB 2OH0E 2VZ6A 3F3UA 5ITAA 3W8LA 4BY9E 4EOPA 4RSSA 3F9NA 5CEPA 2J0IA 4IM0A 3RK9A 3DJ6A 4ENXA 5B2LA 2PVNA 5KBRA 1ZYJA 4KIKA 3ZFXA 3EFLA 4EOQA 3CTJA 2UZNA 3VRZA 2OI4X 4F63A 3BLRA 4TYJA 3EMGA 1ZZ2A 4M12A 4W4XA 2ITUA 3E7OA 3R73A 1QCFA 3QYWA 2RFNA 3KMWA 3VBYA 3WE4A 4NYEA 3FI3A 2WKMA 4FV7A 5D7AA 3TTIA 3QWKA 1RW8A 3O2MA 2WHBA 4I5CA 4KRCA 4QMVA 4YHTA 3W2SA 2XNGA 4U8ZA 2ITQA 5IEXA 4U40A 4FC0A 3ZONA 2B9HA 4WSQA 4AFJA 4GW8A 4Q9ZA 2OJJA 5BYZA 5K5NA 4CSVA 1H26A 1FMOE 4DGMA 3PIZA 1VYZA 2XNBA 3PJ1A 4E6CA 2WMTA 2BCJA 4L7FA 4TKSA 2C6TA 2V62A 2X2MA 4DFLA 5TKDA 4DF3A 3BL9A 3HDMA 3TV4A 4YZMA 4M8TA 5M4IA 4ZZMA 2GNHA 5K4JA 5J5SA 2GTMA 3PUFC 4K2RA 1VZOA 3CCNA 3ZM4A 2BALA 4ALUA 2J50A 4YJPA 4C34A 3UIUA 1FINA 1YWNA 3GC0A 3R63A 4MXCA 4JT3A 2Z60A 4I41A 3G90X 4DEIA 5CAPA 3RK7A 2ZOQA 3CSVA 3TEIA 3BLQA 4QNAA 3B2WA 3FZPA 5B0XA 4UBAA 2B52A 4FTAA 4M67A 4MQ1A 1OITA 5FUTA 1OKYA 4EOSA 3OVVA 4D1SA 2YIQA 2F7ZE 3OOMA 3FUPA 4HNFA 5F20A 3VF8A 3KXHA 3SW7A 3KMUA 2OIDA 3FZ1A 2YM5A 4D58A 5GIOE 2G15A 2X1NA 3EQGA 5HBHA 2DS1A 1DAWA 5CEIA 1Q97A 2W99B 2F57A 3KKVA 3DK3A 2IZUA 5J9ZA 2OK1A 2I6LA 1OB3A 2WTKB 3I6UA 4RIWA 4UMTA 5EDQA 5HICA 4BCFA 4C35A 3KULA 3A8XA 4M3QA 1OPKA 5HBJA 3E87A 3IW4A 4C2WA 1VLRA 3VW6A 3HEGA 4FV8A 4CQGA 1NVRA 3AXWA 4GKIA 5IUHA 2WTIA 1B6CB 2GNLA 2XCKA 4F7NA 2QO2A 3DBEA 4YR8A 4X2NA 5AIRA 5L2TA 3W55A 4IE9A 2C4GA 3FMDA 5ANGA 2ZV8A 5LVLA 4XYFA 3EHAA 2W4KA 4GSBA 3PY3A 4W8DA 4JDKA 2CNUA 2C0TA 4CTBA 3BGQA 4PX6A 3UP2A 5HHWA 5M44A 2VX1A 2Z7RA 3MPTA 2YDKA 3QXPA 5DH3A 4C4EA 5CENA 4GT3A 3C5UA 4DFYA 2CDZA 2IG7A 4LRJA 3TDWA 4YJUA 2C6LA 4UZHA 1KE6A 4GG5A 4HJOA 1KE8A 3BYMA 2XNOA 3QL8A 4FG9A 4U5JA 4FV1A 3RAHA 3ZDUA 3GXLA 3QC4A 5LXMA 3MY1A 4DEHA 4IACA 3WILA 1WFCA 4UN0C 5CSWA 2OICA 4XBRA 3Q60A 2JITA 2PUUA 4F9BA 3IDBA 2VTPA 3D15A 2XNMA 5E8TA 5DMZA 2R3MA 4FT9A 3RBWA 5M51A 2VGOA 4A9TA 2GS6A 4E20A 1STCE 4O0WA 4QPMA 4PMSA 1W2CA 5I3RA 2HW7A 1H00A 5JFSA 4QTBA 5EW3A 3WF6A 3AD5A 3G33A 3TUBA 4KKGA 2XS0A 4OTFA 3LLAA 3W0SA 3ZCLA 2YEXA 3DXNA 2ACXA 4FVRA 3QRKA 4J98A 4C38A 3ZRLA 3FEGA 1A06A 4PV0A 3R1YA 5AR7A 2E2BA 1CM8A 4L3JA 3PWDA 2CKPA 3DA6A 3WYXA 4O6LA 3ZFMA 5BV3A 4NTSA 4MK0A 4E73A 1G8JA 2GHGA 3P86A 4OTIA 5EDRA 2XJ0A 2A4LA 4C3FA 3POOA 4HYIA 4J71A 2J4ZA 5JSMA 1Y8GA 4O1OA 4RFMA 4N57A 4LL0A 4U79A 2IW9A 4DH5A 5KMLA 3SD0A 1LPUA 3TZ9A 3VUIA 4F6UA 2G2IA 3MPMA 3T8OA 2UZOA 5C01A 2H6DA 4C7TA 5JZJA 2VNYA 3HECA 4HVGA 4BGHA 2V22A 2ZMCA 4WNOA 2ZDTA 4BJJB 5LWMA 2CGWA 5HIEA 2WIHA 5HIDA 5E8SA 3O7LB 5DT3A 1M2RA 3E5AA 2GHLA 4QYHA 3VVHA 4ASXA 3BU5A 4CFMA 2W1EA 4QNYA 1Q8TA 3FLZA 2WOTA 5DIAA 4BYJA 4TW9A 1ZOEA 3FLQA 2QD9A 4BHZA 5AUXA 5LMKA 3EJ1A 2BDWA 2X2LA 3E8CA 4EZ5A 4PDOA 5CZHA 3R8PA 2WZJA 4EKLA 2F4JA 2XBJA 5KHXA 2YM8A 4RIYA 3WZUA 1Y57A 3ZLWA 1M7QA 4ASEA 3NDMA 1M14A 3OWJA 4RWLA 3E7VA 2VTNA 1IEPA 3JR1A 4DC2A 4ARKA 1YDRE 4GEOA 5JZNA 2Z7LA 2Y6MA 2HY81 3PG3A 2JBOA 5M4UA 4KSPA 3QF9A 5DBXA 5IA2A 3RCJA 5L4QA 1J7UA 1PXNA 3ZFYA 3VO3A 1XMLA 4MXAA 5CX9A 4YUQA 3QTZA 5CVGA 3NIZA 2PE0A 3ZH8A 5CXZA 4FKTA 2W1DA 5DEYA 4KIQA 1UU9A 2BRNA 3NIEA 2C6OA 1K2PA 5BQ0A 3HA8A 3O7LD 2P3GX 4FSYA 4XRLA 5ANOA 3ZO1A 4EH9A 4X2KA 2UW8A 3A7HA 4Y72A 3B8RA 4O4DA 5AP3A 5HG9A 5E9EA 2WO6A 4F7SA 3ZM9A 3FKNA 1BLXA 4NW5A 2BMCA 4NJDA 5FTGA 3ET7A 3EQPA 4QO9A 4C33A 3DK6A 4IDTA 3FMHA 4H05A 3C1XA 2R3HA 5E8UA 4W4VA 2X7GA 2QU6A 3QGYA 4TYEA 4F6SA 3ROCA 5HX6A 4NTTA 4I6QA 5BX0A 3VBXA 3NYXA 5CQWA 4I6FA 4CTCA 1UKHA 4TRLA 3ENHA 4G3DA 4D1ZA 3FE3A 4JS8A 5AR2A 2XK3A 1UU8A 3UO4A 5A6NA 3ORIA 3HRBA 4MNEB 4C59A 5HD4A 2PSQA 4OBPA 2PULA 1WBNA 5CSPA 5HQ0A 4AAYA 5I9YA 3K3IA 2ZM3A 2R7BA 4H3PA 5TT7A 2GQSA 3PVUA 1UA2A 5J79A 4YTIA 3ZO3A 2CN8A 3UYTA 1H08A 3BE9A 4B8LA 4BRXA 1F5QA 1QPEA 1WVYA 4Q2AA 5JK3A 3UOHA 3UIXA 3ZUVA 4O7YA 4MD7E 2Z7SA 4HYSA 1YXUA 1IAHA 4BKZA 4LMUA 4YHJA 3QRTA 4LGHA 4CMTA 3A7GA 2I0EA 4C58A 3O8UA 4QMZA 4EHZA 2UW6A 2PZYA 3CC6A 3OTVA 5CU2A 4RQKA 3W2RA 4FI1A 5I5ZA 2YZAA 3EN5A 2VWWA 5HE0A 2XRUA 4EI4A 4CFFA 2BIYA 2ITOA 3E93A 1KOAA 1YOLA 4KKHA 4KNBA 5EI6A 4C36A 2X6EA 3R83A 4D4VA 2VN9A 4XLIA 2C3LA 2AYPA 3GVUA 5EYMA 2C6DA 3B2TA 3C4WA 1GZNA 4GUEA 1WMKA 4TWNA 1J3HA 2UZTA 4RGJA 3R7IA 2QLQA 5J1WA 5AUZA 2LGCA 2OFVA 3UPXA 3COKA 3ULZA 1Q41A 4O7VA 2AUHA 5HVJA 3GBZA 5H2UA 3QD4A 3NUNA 1GIJA 4FT5A 4YJNA 5EQEA 2ZJWA 4I5PA 3CEKA 3SXFA 1R1WA 3PVGA 4FZAB 1R78A 2XYUA 3FI2A 3DLZA 3EOCA 3AC3A 3CLYA 2OF4A 1EH4A 1M2QA 3TJCA 1Q4LA 3LCSA 3V3VA 4AZFA 2UVXA 4ZOGA 3R28A 3IPHA 4YJOA 5IUIA 4FKLA 3LCTA 4HNIA 5EHOA 4C8BA 3Q2JA 2ZDUA 1ZXEA 5EM7A 3AT3A 2W5BA 3Q32A 3TKIA 5JKGA 1FOTA 5DT0A 3BRBA 1Q3WA 2IN6A 3DJ5A 5HO6A 1OIRA 4BCPA 5B2MA 5LARA 5HOAA 4ZZNA 2YCFA 2P55A 3NZ0A 5FRIA 1GIHA 2A2AA 2WPAA 3R30A 3C0HA 4BDCA 3HUBA 4P90A 3PJ8A 5AV0A 4XHKB 5F94A 4JR7A 4Q5HA 4LRMA 3BLAA 2JIVA 4EYMA 4ITHA 3CJFA 2RIOA 1UVRA 2O8YA 3HV6A 3NWWA 3OWLA 4XRJA 3Q6UA 4U7ZA 3ZYAA 4IDVA 4BDHA 4AT3A 4FKIA 4BYIA 2IJMA 4FL3A 3RJCA 3CGFA 4GKHA 4KS7A 3FMJA 2XK9A 3PY1A 2I0HA 1HOWA 2HXLA 2GNJA 2O2UA 3KF7A 3LCKA 3OXTA 4E5AX 2C6IA 3W0PA 2YLEA 3SXSA 2X39A 3UTOA 3PFQA 3P9JA 2QOLA 4DHIB 3FC2A 1BI8A 3RK5A 3TUCA 2YM3A 5M55A 3BGPA 1BL7A 5HTCA 3DY7A 3RALA 3QCXA 4XJ0A 2QOKA 2QOFA 3OF0A 2WD1A 4DCAA 1OL7A 5BVEA 4RIXB 4E5BA 3DNDA 3GU6A 3DBCA 5CLPA 4LOOA 5M57A 4CCBA 2ESMA 4O2ZA 3VULA 2IW6A 4JBOA 4QMOA 4E4NA 1LEZA 2OIQA 2PE1A 1BI7A 3QHRA 3R21A 5D1JA 4KS8A 5HGIA 3V5TA 3VAPA 4ACGA 4B0GA 2RFDA 4U97A 4QMPA 2OJIA 2CCIA 4A07A 2YAAA 3NS9A 2R3IA 2Z2WA 4OTRA 4G6LA 4AFEA 4YTCA 4I1ZA 4DTAA 2A19B 3KRXA 3T9TA 3V8TA 4DEDA 5ANKA 5EG3A 1P4FA 4XG7A 4F09A 3ERKA 5ETAA 5L6PA 2CGXA 2X9FA 5EKNA 4EBWA 1YOMA 4FZ7A 3R7OA 2WOUA 1PMVA 4U43A 4AT4A 2Z02A 3EQBA 4IWDA 5M08A 4Z7HA 1A48A 4M0ZA 4CMUA 3NLBA 4DEBA 1TQPA 5CAQA 3NX8A 3EKKA 5HLPA 3U9NA 3MDYA 1NVQA 2I0YA 4YZCA 3LXKA 4E4XA 3NEWA 3EQCA 5HD7A 4R6VA 5KMMA 3LFNA 4NW6A 1BKXA 3TL8A 4KUJA 2VO0A 5J1VA 4BWKA 4FSMA 2IWIA 2HW6A 2YITA 3SC1A 4D9TA 4MUQA 4AW2A 2F7EE 4Q9SA 2OSCA 2DWBA 4IANA 4B99A 4R5YA 4E6DA 3A8WA 1W98A 1PXLA 1V1KA 4O82A 3R8MA 2WQOA 1TQMA 2UVYA 4AACA 4D5KA 5AR4A 2BZHB 4WUNA 5E8ZA 4M97A 3F5PA 2PZ5A 4V0GB 5HE1A 3P5JC 4EH5A 3BIZA 1X8BA 1YXTA 4FIEA 3V5JA 2R2PA 4KABA 4O7LA 3RPVA 2X8IA 3D5WA 4L45A 1YWRA 1YW2A 1ATPE 2NP8A 3DOGA 3CD3A 3BE2A 5CSVA 3DNEA 1MQ4A 4O1PA 2WQNA 3RWPA 3UVQA 2YWVA 1SZMA 2ITXA 2IVVA 3QKMA 3BZ3A 4FSQA