3ZFMA

Crystal structure of ephb2
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
279
structure length
248
Chain Sequence
b'EIDISCVKIEQVIFGEVCSGHLKLPGKREIFVAIKTLTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EPHRIN TYPE-B RECEPTOR 2
publication title Completing the Structural Family Portrait of the Human Ephb Tyrosine Kinase Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 248
sequence length 279
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zfmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zfmA01
2BVAA 4BCIA 3L8XA 4X6QC 3GU6A 4XOYA 4GK3A 1DI9A 4RVLA 3F5PA 2NNWB 3UOKA 2I7QA 1IAJA 4FV3A 4HCTA 3O50A 1Q4LA 3ZONA 4L67A 2ITZA 3WF6A 2X8IA 3HGKA 2G2IA 1Q24A 3IO7A 4GRBA 4YO6A 3U51A 3GC9A 3W16A 5KNJA 3GGFA 5LCKA 3TTIA 3R7OA 2BDFA 2OZAA 4EC9A 4Y85A 1JSVA 5IQIA 2J51A 4D1ZA 4D1SA 2CKQA 3A4OX 4FOBA 4IADA 4J53A 1XBAA 1PXOA 5C9CA 2A19B 4YJUA 2W1FA 4XP2A 4F09A 5IUGA 3TIZA 3AD4A 2YCSA 2WB8A 1S9JA 4J99A 4EOSA 1GY3A 3COIA 1YOJA 3FMMA 2GQSA 2ITYA 3FE3A 3ORLA 4GFGA 5I3OA 3CPCA 5HNIX 3WZDA 5EOLA 5DA3A 2PE0A 4O83A 4Q5EA 2VWIA 4MBLA 5CAVA 4U41A 5E8SA 5FLFA 2DQ7X 1FMKA 1U5RA 1Q8TA 3Q9XA 3QTWA 1JKKA 2NRYA 3K3JA 3LIJA 4O0SA 5BVOA 3F5UA 2XKCA 2UZDA 1PHKA 5JQ5A 3CD3A 5DIAA 3MPTA 5JRQA 3BLHA 1GAGA 2IZTA 2VV9A 3DJ7A 3RCJA 3UPXA 4D4RA 2PUIA 4ALVA 2H34A 4IMYA 4BIDA 4F6UA 5BPYA 5IEVA 4M66A 3WOWA 5J9ZA 3FZOA 2X1NA 3F5GA 3MJ2A 3BPRA 5BVWA 3RHXA 5JMSA 2J50A 2RKUA 4GK4A 4QPSA 3ROCA 5HO8A 3EYGA 3F9NA 5CZHA 3NNXA 5E7RA 3SOAA 2YACA 3ZSIA 4BCHA 4FSWA 3QFVA 3EZRA 4MVFA 5JKGA 3GC7A 3RK5A 1IG1A 4HJOA 4DC2A 5HX8A 4E5AX 3IDBA 4G6OA 1L3RE 1KE6A 3JY9A 3QD2B 2NPQA 2QKWB 4BHNA 3LCDA 4D2WA 4G9CA 4IZYA 1Y91A 4AFEA 5CSXA 4X3FC 5CVHA 4CFMA 1OUKA 3MVJA 4B9DA 4F4PA 5FDXA 3ZUTA 4H3PA 3RAWA 3F7WA 4B6LA 3DA6A 3PUPA 4AA5A 3Q96A 5DYJA 2HCKA 4RJ6A 2BKZA 2V22A 4F9BA 4DCAA 2F7XE 3LCOA 3H9OA 2X2MA 3NLBA 2W1DA 2XYNA 3UP7A 3VBXA 1PMNA 2VTPA 5AP3A 4QD6A 3ZU7A 3TZMA 5FP5A 4FV0A 2A4LA 3Q5ZA 2Q83A 4D4YA 2Y4PA 4A4XA 4DF3A 5E9EA 3ID6C 4APCA 5AADA 5ETCA 5HO7A 3EN6A 2JEDA 5F94A 4O84A 5L6PA 2YM6A 1QCFA 1YWVA 5K9IA 4TTHB 3F3WA 3GVUA 2UW3A 4FK6A 3C4WA 5FTOA 5A4LA 4MXAA 3R8MA 2YM4A 3SW7A 3SC1A 2WMUA 3P5KA 2JAMA 2XNMA 5HKMA 5FEQA 4AAAA 4Z55A 4E20A 2W9FB 4KKEA 3H0YA 4FIEA 3HZTA 3QQFA 1YWNA 3FEGA 3MN3A 2C3LA 5GJGA 3ZLXA 5HNBA 4ZSJA 3DBQA 2XEZA 5CTPA 3FL4A 5AJQA 2VTLA 4IM3A 5LCJA 2B7AA 3M2WA 4D1XA 3SGCA 1ZYLA 3D5VA 3IONA 2OLCA 3E8CA 3R7EA 3KMWA 3HA6A 3HV7A 4ASZA 4CQEA 4EYJA 4KUJA 4FX3A 2BAQA 3CEKA 4I0RA 3WIGA 4CRLA 4O7LA 1V0OA 3PWDA 2H8HA 1KE9A 3NNUA 5CI7A 4BZOA 4QMMA 1LPUA 2JITA 3C5UA 2BALA 5EM7A 4LOQA 2GFSA 5DBXA 3VUHA 5EM5A 4C4IA 4F7NA 5CF5A 2PVHA 4CD0A 2HWOA 1MQBA 3VW8A 3D5WA 3BHHA 4EOOA 4FZ6A 4ASDA 5CU2A 2J7TA 4YC6A 5G1XA 5AX9A 4C4FA 3TN8A 4F64A 3FYKX 4I5CA 2C6MA 4FTRA 3F2RA 3M1SA 1I44A 1YXTA 2GHLA 4FSZA 5LMAA 4JG6A 4CMTA 4FIJA 4YBJA 1IA8A 2R3OA 4HVSA 2CNVA 3CGFA 2R5TA 4EBVA 5CANA 2BRNA 4R3CA 3NDMA 1H08A 4I24A 4E26A 3PJ8A 4MTAA 4S30A 5A46A 4PPCA 1G8SA 4H58A 3E88A 4LRJA 4BI0A 1OB3A 4EH2A 1PXNA 2W1GA 3QQUA 3RKBA 3OXIA 3PA3A 2RF9A 3TJCA 4Q2AA 4HZSA 4BCFA 3GCUA 4XYFA 4MX9A 4D5HA 2FSOX 4PPAA 5I9ZA 3UODA 4EL9A 2F49A 5IA4A 3ALNA 1IRKA 2O63A 5CT7A 2IVUA 4FSRA 4W9XA 1NVQA 3F3ZA 3CP9A 4FTLA 4GFOA 4R78A 2OW3A 3IS5A 4JBOA 5EOBA 4DEGA 4ZY5A 3UZTA 2YIRA 2GCDA 4G3CA 4TWPA 2C6EA 3U54A 2UW9A 2PMIA 4UWBA 5DRBA 3PA5A 4IZ5A 4RGJA 3I4BA 3E8DA 5LVMA 1Q8ZA 1WFCA 3P7CA 4IANA 4JIKA 4JVGA 5F95A 3EKKA 2R0UA 4CFVA 4ZTMA 4XBRA 4FV8A 3G33A 3ACJA 2NRUA 3QYWA 3LQ3A 4F0GA 3KK8A 2VX1A 2PPQA 4MNEA 4TNBA 5CZIA 5BUIA 3I6WA 5A6NA 5GZAA 1FVRA 4KINA 4L43A 2UW5A 5EG3A 3VC4A 3NR9A 3NUYA 2X9FA 3HV3A 4FV1A 5KBQA 4APPA 1SYKA 4EHGA 2DWBA 2VTMA 3QQJA 2W0JA 5KHWA 5EW3A 3TZ8A 5A3XA 5FWKK 2JDSA 5CU0A 4DGNA 2WQNA 4RRVA 3TNIA 5DVRA 4EUTA 3ATTA 3C51A 3U4UA 1FGKA 1ZMUA 2CCHA 2C3KA 2IVTA 1AGWA 1ZXEA 2ITQA 4G3FA 3ZS5A 2BUJA 5AV0A 5CENA 1OL7A 4MCVA 4PL3A 4YGAA 4DFZE 5CEOA 2F2UA 4AF3A 4EZ3A 2XIZA 3DBEA 4L3PA 3CTHA 4PL5A 5JT2A 4X2KA 3MPMA 5LMKC 4G31A 2XH5A 4O21A 2FB8A 3D7TB 1M2PA 3IECA 2XK6A 4X2FA 3HRBA 4IC8A 4I5HA 4HPTE 4OT5A 2BHEA 3W55A 4J71A 5IISA 3ORTA 5GZ8A 4FEXA 5IQGA 2X81A 3MWUA 2QODA 4D55A 5AFVA 2XJ2A 3R9NA 4JDIA 2I0EA 1OMWA 2VWUA 4GV1A 4HNIA 4EQMA 3FI8A 3DDPA 3QC9A 3VF8A 1YRPA 2XIKA 4RFZA 4BDBA 5HD4A 1BX6A 4BRXA 4IVAA 4KS8A 3A62A 3TTJA 5HU3A 5DR9A 1JKLA 4O7YA 3FBVA 4OAUC 1JKTA 2WAJA 1E9HA 4O38A 3BQCA 4DGOA 1K9AA 5IUIA 4C34A 4MBJA 3ZEWA 1JSUA 3E7OA 3Q6WA 3KVWA 3LFSA 4MKCA 2WD1A 4F9YA 5E8WA 3U9CA 4AE6A 3HDNA 4BTKA 4OW8A 3OP5A 2Y6MA 1E1XA 5DOSA 4YHTA 1BI8A 4C02A 2VO0A 2C6IA 3I60A 3Q9ZA 3Q3BA 4JX3A 5H3QA 3FI2A 3PG3A 2H9VA 3GU5A 5L2WA 3C5IA 1F5QA 4HPUE 4MK0A 4AA4A 4FMQA 2WMVA 2YITA 2YIYA 5B0XA 2XIRA 2XBJA 2IWIA 4PPBA 3U6JA 4GFMA 4ZTHA 3PRIA 5DGZA 3K5UA 4F6WA 4QTAA 4JQEA 4FG7A 3QQHA 4AWIA 4EOIA 4DBXA 3E5AA 3TV7A 2HAKA 2WQEA 2ITTA 3EQBA 4FKUA 3TKUA 3NZ0A 2BPMA 4RQKA 5FP6A 1PY5A 3L9MA 4O7SA 3P86A 3DLZA 5IKWA 1GIJA 3A8WA 1L8TA 5IH6A 4I94A 2VWVA 3N4VA 3Q9YA 4H1MA 4L9IA 3GQLA 5AM6A 2ZB1A 1YXXA 4F63A 1QMZA 4I21A 5J7BA 2IZUA 3QAME 3VAPA 3Q5IA 3BHVA 3C0HA 2I0HA 4AT4A 3II5A 4R1YA 4RIYA 4FR4A 4DG0E 2VGPA 3CJGA 3PP0A 4JNWA 3FMEA 2QOFA 2WTKB 3MI9A 2GHGA 2R7BA 3I5ZA 4BKJA 3DAKA 2VX0A 2ERZE 4FG9A 2QURA 5HZNA 4AN2A 5I0BA 2WTJA 2DS1A 2A2AA 2ITPA 2UW6A 3JXWA 1CKPA 3QLGA 4JXFA 3UO5A 1PMVA 3OOGA 4E1ZA 3NMUF 4Y95A 1G5SA 2FSTX 4PP9A 3I81A 1EH4A 3R7VA 4UYAA 5CNOA 1OM1A 3QCXA 2YM5A 2JLDA 3OHTA 2QD9A 2JKMA 4LUDA 1X8BA 2VO3A 5DLSA 2C4GA 4FT0A 4YC3A 4P4CA 4G3EA 2YJSA 3VULA 4AOJA 3QCQA 4Q9ZA 3LQ5A 4FI1A 4L3LA 4IWQA 2G9XA 4O0UA 4OAVB 5EI2A 5AP0A 2C5YA 3S4QA 4QYFA 5L8KA 5IDNA 2GNHA 5T6KA 4YJVA 4FEUA 4K11A 1H1QA 5FBNC 3MA3A 2E9NA 3E8NA 3NYVA 3EQIA 4M84A 1OPKA 3EH9A 5HLPA 4EKKA 4UZHA 2JDTA 5GJDA 4Y72A 4FA2A 3RNIA 1P4OA 5EDQA 4GKIA 2EXMA 4AW1A 2OK1A 4ANSA 3R6XA 5JN2A 4H3QA 4ZJIA 4A06A 2ZM3A 3UOLA 4JAJA 3ZRMA 5HTBA 4QMYA 2ZYBA 4M0YA 5ANJA 4QPMA 3V5PA 4ZS4A 3DBFA 4DEAA 2G01A 3BKBA 3OF0A 4FT3A 2XK3A 3P7AA 3FYJX 3OWKA 3N4UA 1PKGA 3LJ1A 3ENMA 4OUCA 3G9NA 4QOXA 3RK7A 3TI1A 4NKAA 1NT2A 5H8EA 1R1WA 3TJDA 1DM2A 4F7LA 2ITNA 1CM8A 3SVVA 3CE3A 2KULA 2JFMA 3OWPA 2UZEA 2Y7JA 5AAEA 3ROYA 5TOZA 1WAKA 3BYMA 2CCIA 4ZTLA 1URCA 3IK3A 3QCYA 2VX3A 4F1TA 5A6OA 3PIYA 3LLAA 3PXKA 3M11A 1WVWA 3BGQA 5HORA 3F7ZA 4EONA 3N4TA 2R3PA 2WEVA 3CY2A 4BDJA 4CFFA 5BYLA 5JQ8A 3GC0A 3JR1A 2WMQA 4HVDA 2C30A 1UKIA 5AEPA 4CZTA 1W82A 4Y5QA 1OKWA 5M07A 2ONLA 4I4FA 4N70A 4XP3A 1MP8A 3MVMA 3BU5A 2VTHA 3F2AA 5HBJA 1GZKA 3UO6A 4LM5A 3IW6A 4DTAA 5DT4A 4HCUA 5AV1A 5L8LA 3NSZA 3U4WA 3FI3A 5EKOA 2XKEA 3E8EA 4W8DA 5EDPA 3K3IA 4TW9A 3AG9A 3BHUA 3AC2A 1BMKA 3LW0A 2C0TA 2C69A 2V0DA 5L2IA 1RQQA 3AGMA 3BE9A 5CEIA 4GVAA 1UU3A 2VU3A 2GNIA 3MVLA 4IAAA 3T8OA 4EH4A 3HUBA 4FV7A 5ACBC 4FZ7A 2OJJA 5JRSA 3VUKA 3PY3A 2XK4A 3QKMA 3QRKA 2EWAA 4AGWA 2G2FA 3FMHA 4AT3A 4TXCA 5AUXA 3SXRA 2XNGA 2CKPA 4EYMA 4FIHA 4EI4A 2E9UA 3NCZA 4ANOA 3QD3A 2WMXA 5D7AA 5AX3A 1ZMVA 2RIOA 4O2PA 3QLFA 4FKOA 2CGWA 2HYYA 1AQ1A 4K18A 4D4SA 2WO6A 3UPZA 2R3NA 1WBPA 4AFJA 3W33A 1FINA 2C3JA 3Q4ZA 1PW2A 2YIXA 1ZYDA 2ZV2A 3QXPA 2O65A 4GMYA 5AP6A 2X7OA 4R8QA 2QKRA 1OPLA 1W84A 4YJOA 2VRXA 2YCFA 3PPZA 3QRIA 4FL3A 3VNTA 4U5JA 4FKQA 1UNGA 5DEYA 3ZOSA 4CT1A 1OPJA 4QP2A 4BF2A 4FBXA 3JPVA 2QU5A 4QP4A 5KMIA 3W1FA 4HYSA 4RX7A 3P0MA 2QG7A 4C4JA 4U80A 2G1TA 3F2NA 4HYIA 3AOXA 4JRVA 4BHZA 4H36A 3WARA 3BWJA 2Y6OA 4FSTA 3W8QA 2JFLA 3BE2A 3CJFA 1Q5KA 2ZVAA 5CVGA 5DEWA 2Q0NA 5FXSA 1PMEA 4Y8DA 4MQ1A 3GQIA 4CKIA 1H4LA 4BY9E 3EJ1A 5CF6A 1IASA 1XH7A 4YTHA 2QOBA 4AZFA 3HP5A 1H07A 4I5PA 5E8ZA 2ERKA 5HIEA 3FZPA 3SOCA 4DEHA 4XG7A 2YABA 3U87A 4JBPA 1FBNA 3SW4A 3LJ2A 4DT8A 5JGDA 1ERKA 4M69B 3KFAA 2X6DA 5HVJA 1BKXA 4ZSGA 5ETIA 3AQVA 2VTNA 4ALUA 1XH8A 2BAJA 2R3MA 4FTNA 4NW5A 4RIYB 4CSVA 4I3ZA 2ZV9A 3E92A 4CYJA 4RX5A 3CTJA 3I0OA 3UE4A 3DXNA 4I41A 4N0SA 2HW7A 2J0MB 1Q8UA 1UU7A 1SNXA 3FZ1A 4I23A 3UIBA 3MFTA 2VWYA 4FIIA 4NT4A 4DH3A 4F7JA 2WTDA 4LUEA 3QWJA 2YIWA 3MH2A 2VTTA 2WU6A 3NX8A 3TEIA 1M14A 3ELJA 4BN1A 5IQHA 3GEQA 3NW7A 4J95A 2A1AB 3QCSA 4FTOA 4YHJA 3P9JA 3R7IA 3QTUA 4BWKA 1REJA 1H27A 1ZYSA 5TF9A 4GYGA 1P2AA 3F66A 3QYZA 3FAAA 1WCCA 3E7VA 3QZHA 1WBOA 2XIYA 4N6YA 4AUAA 1YOMA 4Q5HA 4XH6A 3UNKA 2UZUE 3TNWA 5KE0A 3LXPA 4ZEGA 2VWXA 2WZJA 1BI7A 2CNQA 3MFUA 3FI4A 4WT6A 2JIVA 4EJ7A 4X21A 4U42A 3DY7A 2RFEA 2B4SB 2XNNA 5FM2A 4HVHA 3HDMA 4Z7GA 2HENA 2BKKA 4O91A 1OI9A 3KRLA 5M44A 2BRMA 4G5PA 3RP9A 1R39A 3R04A 2PU8A 1O6KA 2XCHA 3FZRA 3HA8A 5BVKA 3FMLA 4GL9A 3PIZA 3KRRA 2UZBA 4XV2A 5M55A 5FRIA 3VF9A 2C1AA 3VS0A 4N6ZA 3UQCA 2B54A 5I9XA 2PWLA 1TKIA 1W98A 2G15A 3HV6A 4IH8A 5M57A 2CN8A 3R9RA 4YJSA 2IJMA 4ACCA 3ACKA 1JBPE 3VRZA 4YNOA 4YP8A 4IB0A 4BDHA 1P4FA 1Q62A 2BAKA 3ORXA 5M53A 5KBRA 1Z5MA 1GZ8A 3OTUA 2XNBA 3PG1A 4ZMEA 1OIYA 5HE3A 3ALOA 4PMMA 5D10A 5J9LA 4QMXA 3FHIA 3ZZWA 1CKIA 1DAYA 2OJ9A 2YAAA 2YISA 4WRGA 4XX9A 4E6DA 3R8ZA 4II5A 4DG3E 4WNOA 2ZMDA 4ZLOA 4K8AA 2ZJWA 3H9RA 4AS0A 4QP9A 2GS6A 1E1VA 5AM7A 5JZNA 4C57A 1CMKE 5AUWA 4E7WA 1WVXA 3GU7A 2BFXA 4L3JA 3OTVA 2E9PA 1IEPA 1KOBA 3FC1X 5AP5A 3ORNA 3EKNA 4TN6A 3V5JA 4F0FA 3QTXA 2QOIA 5CSPA 5HVKA 2PMNX 2XYUA 3O17A 3IGOA 1OKVA 5IEXA 3HMIA 4EOQA 3LFCA 3FV8A 3IW8A 4NZWB 4H39A 5IA2A 3PJ3A 3VHEA 4FKGA 5I9VA 5J5TA 3PSBA 2VNYA 3VS3A 3UG1A 1SM2A 5EFQA 4L68A 3K5VA 4R7HA 5C8MA 4A4LA 4FTCA 3BHTA 4FV4A 4A9TA 4L7SA 3I79A 4RJ5A 4JI9A 4XJ0A 5HESA 2GTNA 1DS5A 4WSQA 3CBLA 3DS6A 4X2GA 3SXSA 2P2HA 5TT7A 2X8DA 5IQBA 4X2JA 3G6HA 4XG8A 4PX6A 3TUDA 5E1EA 3IDCA 4ITHA 3KEXA 4QMPA 4KBCA 5I9UA 4TY1A 5K3YA 4M67A 2C6TA 3SV0A 3CD8A 2PVNA 3AC3A 4LOPA 4RG0A 2F7ZE 4DFBA 5GZ9A 4QQTA 3F5XA 1B38A 4NM0A 2PTKA 1BUHA 5AUZA 5IMXA 2B52A 4QMNA 3VUIA 5BQ0A 3W2QA 4CLJA 2W99B 3S0OA 4AOTA 4L01A 3GP0A 4I6FA 4ANLA 2A0CX 2WU7A 5J8IA 4JDHA 3HV5A 2CSNA 4NJ3A 1HCLA 3LXLA 2OICA 2O2UA 4WNPA 4RIXB 3ZLSA 2FO0A 4D4VA 4MYGA 2W1HA 5CEMA 4G6LA 3O0GA 3PWYA 1XBCA 3A99A 4O0TA 4AZWA 4F6SA 4AZVA 5AV4A 1QPJA 2FYSA 2Z7RA 5B2LA 4BGGA 3LPBA 4IX4A 3GUBA 3H10A 3SRVB 4RA5A 4CKJA 4U40A 4ZS0A 4AU8A 3EQFA 3ENHA 4ITJA 4LI5A 4D28A 4BCNA 3FKLA 4H05A 4RA4A 4DCEA 3GB2A 3ZUUA 2CPKE 4DN5A 3FSFA 1URWA 3HL7A 4AX8A 3KVXA 4ACMA 2YFXA 4XLIA 3UNZA 4DFLA 3RINA 5KKRC 5J87A 4HNFA 1PRYA 3FMDA 3R1NA 3NYNA 3D7TA 5HEZA 1CSNA 3BLRA 3UVPA 3MB6A 4HGSA 4ACDA 1KV2A 2REIA 4WNMA 3BGZA 2O8YA 4PDSA 4F1MA 2YN8A 4FL1A 4WOVA 4B8LA 5B7VA 5ANDA 3MYGA 5A54A 3UYTA 4TNDA 3O2MA 3V04A 3PZHA 3ZM4A 4L7FA 5IH5A 4DITA 2WQBA 3DKFA 1Y8YA 1H1RA 1QPDA 3QD0A 4F9WA 4UX9A 5GJFA 4LMNA 3KN6A 2OH4A 2PSQA 4NK9A 2FSLX 3FWQA 4S2ZA 3VS2A 5BVDA 3DU8A 4JLCA 5CLPA 5FG8A 4RX8A 4CG9A 4EH5A 2W5HA 4QMQA 2YM7A 3TT0A 3Q4UA 1A06A 2VD5A 3PXQA 4IJ9A 1LUFA 2W1IA 2J0KA 3DZOA 2PL0A 2J0IA 3DB8A 4L45A 3D0EA 2BDJA 3JYAA 1JKSA 5EQEA 3DKGA 2R3RA 3WF5A 1KSWA 3BBTB 3FXXA 4BBEA 3A7HA 4FE2A 2XIXA 4NL0A 3VS5A 3F3VA 3R22A 4AG8A 2BDWA 5DE2A 2PUPA 1QL6A 4QP7A 3RJCA 3A8XA 4WIHA 4DFUA 3HUCA 1B39A 2OWBA 2R3HA 3BELA 3PSDA 3SA0A 2JC6A 4FV2A 4OTQA 4YZNA 5KMMA 4FEVA 3PE1A 4A07A 2CLXA 4EEVA 1J91A 5LVNA 4UN0C 5D11A 2BCJA 4E6AA 3W8LA 3BZ3A 3SXFA 5C01A 2ZV8A 4LG4A 1WBSA 4IFCA 5LARA 3HYHA 2HWPA 4FKWA 2C68A 2QQ7A 3DAJA 4BDCA 2EVAA 2OXDA 2OF4A 2LGCA 4I6BA 4P90A 4KS7A 4YZMA 5ANKA 3KC3A 4NW6A 2W1ZA 3NAYA 4FVPA 3DGKA 4R1VA 3R01A 2J9MA 4GUEA 4EH7A 4D2VA 1CDKA 4ZZMA 2YJRA 2J90A 3HRFA 3R21A 3NYOA 4FV6A 5D1JA 4DTKA 1NW1A 2YZLA 5JK3A 5EH0A 3FHRA 4O0VA 5BX0A 2OFUA 5EW8A 3I1AA 4UWCA 4CMOA 2B53A 5HG5A 3RPYA 1YXSA 3FSKA 3QD4A 2C5XA 3FUPA 3NPCA 4BTFA 2YZAA 3FLSA 4X3FA 3DXPA 4YZ9A 5CSWA 4GSBA 3PPKA 5HBHA 3RNYA 3HX4A 2IZSA 3PRFA 2VWWA 4BICA 3DBCA 3NNVA 3C4ZA 4USFA 5AR2A 3F82A 2G2HA 3EQRA 5A4TA 4O0WA 4RC4A 3HEGA 3T3UA 2UW0A 3UO4A 2P33A 4IXPA 5M08A 3QALE 4YR8A 3AMBA 3HLLA 4O86A 5IQEA 4XEYA 1YKRA 4FZFB 3I0QA 3DAEA 4YZBA 2PULA 3LQ8A 3U55A 1OKYA 3RBWA 3PVWA 5HCZA 4ASXA 4DE4A 4R77A 4YZCA 3U9NA 4MF0A 4D0XA 5M4IA 4YMJA 1U54B 4I92A 5I4NA 4FTJA 5FEDA 2UW8A 3OEZA 4ANBA 2H6DA 5BMMA 4JG7A 4S31A 5DRDA 3CR0A 3OC1A 5CU4A 4U79A 4U9AA 2OXYA 3Q4TA 4KA3A 1P14A 3OBJA 4WHZA 3E3PA 4XLVA 3QXOA 4O1PA 1YOLA 3LFEA 1GIHA 3WBLA 2QLUA 4WUAA 4IX5A 4OTIA 3PP1A 3UOHA 2B55A 2Y8OA 2VO6A 5KZIA 4ZTSA 4FTTA 4OGRA 3NUSA 3ZSHA 3LKMA 3OVVA 3A60A 4G16A 1ZY5A 3GU4A 3MTFA 5CQUA 5L6WL 1K2PA 1QPCA 4FTIA 3RWPA 4O27B 5C03A 5CEKA 3QHRA 2PVRA 4PNIA 5L4QA 4QMLA 1U5QA 2RFNA 4D58A 4FSUA 3ZM9A 3EQGA 4NSTA 3O8PA 3TL8A 1O6YA 4KIKB 4UB7A 3BEGA 4TWNA 4BDGA 4FIFA 1J7IA 5CEQA 3RM7A 5D41A 5AP7A 3EN9A 3THBA 3V01A 4JG8A 2WNTA 4FKSA 4ZZOA 4FZDB 3AC4A 3QU0A 1A9UA 4ZTNA 4U44A 3I7BA 4GIHA 2RG6A 5BVEA 2JGZA 2BFYA 2GFCA 5EKNA 4K77A 4U0IA 3D15A 4M13A 4D9UA 4MXYA 3BYVA 3ZRKA 1O6LA 2ZMCA 3MIAA 4PDYA 2XKDA 4J96A 4DH8A 5HLNA 4BWPA 3EFJA 2VO7A 3RALA 4ASEA 2BIYA 3CPBA 3KULB 5KX8A 2PUNA 2DUVA 2I0VA 3L8VA 4RJ3A 4JT3A 1OL1A 3UGCA 2C5NA 5HU9A 3ANQA 2R3LA 1ZOGA 2X4ZA 3UTOA 1XBBA 4BCKA 5KCVA 4HZRA 4DGGA 4BCJA 3C1XA 4FGRA 4QMOA 5IPJA 3RPOA 4TWCA 5FM3A 3OW3A 4WUNA 3TZ9A 1R0PA 3MIYA 4C38A 3VBWA 2W1CA 4G17A 4F9CA 2RGPA 4GT4A 4FG8A 5CX9A 4EOJA 2C0OA 4R5YA 1I09A 3ULZA 1MRUA 3F69A 4JIAA 4QMZA 3ORPA 5E8TA 3KRWA 4NCTC 4F70A 2R0IA 1M7NA 2IPXA 1UV5A 3DT1A 1UU8A 3QUEA 1XH5A 5AWMA 3OROA 5EI8A 5ICPA 4ZLYA 3C4CA 3S3IA 2BIKB 5CEPA 1PYEA 2PZIA 2WTWA 1YDTE 3UIXA 2XKFA 4F7SA 2OKRA 4M7IA 4UBAA 1WBTA 4HYHA 4NKSA 4TPTA 3TG1A 4C2WA 4E6QA 3OBGA 3QGYA 2B9JA 3D14A 4FKLA 1T45A 3FC2A 1F3MC 3IW7A 3ZO2A 3WILA 5DMZA 5DWRA 2YIQA 4EH9A 1GOLA 1JVPP 4ZZNA 4BVUA 5FTGA 4DH1A 4TWOA 2VN9A 5IQDA 3G6GA 4WKQA 4EWHA 3WF9A 3OCGA 1YXUA 4PV0A 2W4OA 4UMPA 5CF4A 3EQPA 4YU2A 4ZAUA 1Q97A 1RE8A 4D5KA 4O7TA 3N9XA 4Y46A 1LP4A 5M09A 4ZJJA 4RWJA 4OLIA 4F1OA 4G5JA 2CJMA 4QPAA 4K2RA 4OTHA 2HIWA 2F4JA 3ZSGA 1TQMA 4IACA 4OBOA 3AMAA 4RWLA 2C6DA 1MRVA 5KKRB 3DNDA 3GFWA 3GOKA 3V6RA 2P0CA 3LMHA 2HELA 5LWNA 3ZZEA 1APME 4FKIA 4M69A 4IEBA 3DZQA 3Q32A 1PXIA 2FSMX 2ESMA 2HW6A 3W10A 2OFVA 2C0IA 2VAGA 3GENA 4I22A 4FT9A 4KIPA 5CF8A 3ZBFA 1OZ1A 2WIPA 3O8TA 4U3ZA 2Z7QA 3V5LA 3Q2JA 3Q9WA 3UNJA 1MUOA 4PDPA 3WIKA 4U81A 4A9SA 3RAKA 3GI3A 3MH3A 4C61A 5EQPA 4X3FB 3CS9A 4USDA 3NVKI 3PIXA 4RFMA 3F61A 4HVGA 1SVGA 2X8EA 5CI6A 4EUUA 4TYEA 4U7ZA 3QQGA 5I5ZA 3U8WA 2PK9A 4M14A 4BDKA 4XG6A 3HV4A 2UW4A 3WE4A 3ZYAA 3R00A 4YBKA 3VVHA 1JAMA 1M17A 4KSQA 3WZUA 2WIHA 4KIOA 4BWXA 2RG5A 4M97A 3TNHA 4EZ7A 3NW5A 4YJPA 5CASA 4EJNA 5LOHA 4DT9A 4QO9A 5CS6A 2JBOA 3UIUA 3S2PA 4CGAA 3H0ZA 5FUTA 2BHHA 3DK7A 3NYXA 4YSJA 4CKRA 2JKOA 4KNBA 5CAUA 3CLYA 4L42A 3EWHA 5B2KA 3WI6A 2BR1A 2DYLA 1PMUA 5AP4A 5HO6A 3VQHA 1U4DA 5BYZA 4OTPA 4R6VA 4W4XA 2HK5A 3KXXA 3R1QA 4MF1A 3IG7A 4U43A 5C4KA 3G15A 2VTAA 3U6HA 1WBWA 4IFGA 5K0KA 4RT7A 4CEGA 2WMBA 3BEAA 1Q61A 2OZOA 5AIRA 4MH7A 3NGAA 3HP2A 4C8BA 2GU8A 4PP7A 2CKOA 4TYIA 3DKCA 3R7GA 4FOCA 4TKSA 4EBWA 1KE8A 4TYJA 5IA5A 2J6MA 2V62A 2OSCA 1ZYCA 2ACXA 2IW6A 4JBQA 4GJ2A 3ZO1A 2GNGA 1PXPA 3CC6A 1YDRE 3EIDA 2JD5A 4QRCA 5T68A 1YXVA 4JBVA 4TRLA 4USEA 2GNLA 3HMMA 4L44A 4CMUA 4UXLA 4NFNA 2EXEA 1H0VA 2WKMA 3B8RA 3MBLA 3QHWA 1JPAA 4G3DA 2X9EA 1MQ4A 4WRSA 3VBTA 4DBNA 3FQEA 3E63A 3KB7A 3I5NA 5J7HA 5M51A 3ANRA 4AOIA 4CFWA 4RJ4A 4ORKA 3COMA 1YWRA 2XK7A 4H1JA 4NM5A 3O96A 2VUWA 3OS3A 2BILB 1JNKA 4R3PA 3LCTA 3IQ7A 3KXGA 2GS7A 3BYUA 4L00A 5LVPA 5E8VA 4EOKA 1LEZA 4LL5A 5BVFA 3KCFA 3EN4A 4P5QA 3PXYA 3ZDUA 3UQGA 1ZARA 2XCKA 3BWFA 5JSMA 3KMUA 4QNAA 4FTMA 5I9YA 3DK6A 5ETFA 4J7BA 3BYOA 3HKOA 3BU3A 4FKVA 5KHXA 2UW7A 1A48A 2BMCA 4DA5A 2O3PA 3FLNC 4NTTA 3L8PA 3OCTA 4ERWA 1PXLA 2PVYA 5DR6A 1T46A 5AMNA 5H9BA 1J7LA 1BLXA 5T3QA 3SD0A 3ZH8A 4R7BA 4XRJA 3AC8A 1Y6BA 4Z16A 3FMKA 2CGUA 2OJGA 2XM9A 5H8BA 4G3GA 4EK8A 1JWHA 2CGVA 4C4HA 3RAHA 3SDJA 1YHVA 1ZLTA 3E62A 4RIWB 4YUQA 1YI3A 5M56A 2OI4X 3G5DA 1ZZLA 4Y73A 4FL2A 3RMFA 3NCGA 1Z57A 2YCRA 3RI1A 4WA9A 5A4EA 4QP6A 5CWZA 5A4QA 3PE2A 2PMOX 3CY3A 3FLWA 4FKTA 5HGIA 1FVTA 5TR6A 1KE5A 3DTCA 3NUPA 4RIXA 3BX5A 4CZUA 4IDVA 4BYIA 3GU8A 4V0GB 2HXLA 4OTDA 2R64A 2BTRA 4HGLA 3LCSA 5HI2A 4CCUA 4C7TA 3W2PA 3SRVA 3CQUA 3ORIA 5CXHA 2JKQA 3PVBA 5HLWA 3DDQA 4A7CA 4FSMA 2JDOA 1XR1A 5EYKA 1Q3DA 4TL0A 3E64A 2UVXA 5HVYA 3DQXA 1PXKA 2XJ1A 1IAHA 4G6NA 3I7CA 4AA0A 2B9HA 1IR3A 1OVEA 3IKAA 4IB1A 3LFDA 3KREA 2R3KA 2RFDA 4IB3A 3DJ5A 5IA0A 2CKEA 4PL4A 4FYOA 5HTCA 5M4CA 3MW1A 4FKPA 4NYEA 3MVHA 3ORMA 1S9IA 5D7VA 5HE2A 1UWHA 3VUMA 3NWWA 4M8TA 4FK3A 5IZFA 3RCDA 4AN9A 3MV5A 4LMUA 2W05A 3GCQA 4NU1A 3PLAE 1PXJA 3AT3A 1YQJA 2UVZA 3EL7A 2PZYA 4QMWA 5ANIA 4PQNA 4PRJA 4FF8A 4ANNA 1NA7A 2PY3A 3VWAA 2Z2WA 3QA8A 2GSFA 3IOKA 4EOMA 1DI8A 4C3PA 1FOTA 1UWJA 4E6CA 4I20A 3D7ZA 1RDQE 2XK9A 5E8XA 2HZIA 3PLSA 4LRMA 3JVSA 3EMGA 2J4ZA 3GCPA 3HAVA 1ZY4A 4RC3A 3A7GA 5EYMA 4DEDA 5EHOA 1W7HA 2R9SA 4FNZA 4MBIA 4BKZA 3FLZA 3C9WA 3Q53A 3PTGA 2WELA 4IAIA 5K4JA 3TUCA 4PY1A 2X2KA 4QMUA 3ZXZA 3SAYA 2QONA 3VW6A 5J79A 4A4OA 1FMOE 5KMLA 4R3RA 1HCKA 2AC5A 2HZ4A 3HVCA 3KXZA 3QL8A 3U6IA 2PVFA 3DJ6A 3H4JA 2HZ0A 3KF4A 3OG7A 5EM6A 2P3GX 4UMQA 4DTBA 1TQIA 2XNPA 3NS9A 4YSMA 4RZVA 2QOHA 1VR2A 3R02A 3CGOA 4FTAA 4QYGA 3OD6X 4LRKA 5AV3A 3VS6A 4FKRA 3FDNA 5HX6A 4QT1A 4RVMA 5BMSA 5L3AA 3VBVA 4EQCA 4MD9E 4UXQA 1F0QA 3Q4CA 5GIOE 3EOCA 1OL6A 1Y57A 2YDKA 3A7IA 1CTPE 4P5ZA 3R9HA 2WMAA 3OEFX 5J95A 3R9DA 3QX2A 3ORZA 5EK7A 2BZKB 4DEBA 5ANOA 4RX9A 5BVNA 4FV5A 3OWLA 5HCYA 5IMEA 1OECA 5DT3A 1HOWA 1XQZA 1J1BA 2PZ5A 2Y9QA 4FYNA 3UC4A 2R3JA 3EFLA 3ET7A 4AW0A 2GQRA 1DAWA 4KKHA 5L6OA 4KRCA 3L1SA 2VTOA 5AAFA 5A9UA 1H28A 2W17A 4BCQA 2NP8A 1YVJA 1H1SA 1WMKA 4UV0A 4D2RA 3UQFA 1OBGA 2FA2A 1SMHA 5E91A 4M0ZA 2GHMA 2BTSA 3FPQA 3JY0A 4CRSA 4CG8A 1M2QA 2PVJA 3VUTA 3GXLA 2PUUA 3MSSA 5K4IA 2J0LA 3EYHA 3OY1A 4F99A 3KY2A 2EUFB 4GUBA 4QQ5A 3LFBA 3OW4A 3S00A 2C5VA 3RM6A 3OMVA 4BFMA 3P23A 4YTIA 2WMRA 5CAPA 1OBDA 5HG8A 5TO8A 3TCPA 4AACA 4EH6A 4DHFA 3PJCA 3LOKA 5DPVA 3LCKA 3K2LA 4OTWA 1LR4A 4RC2A 3TWJA 5K5NA 4N4SA 4XV3A 2R3IA 3GT8A 4FNXA 1U54A 5IQFA 2XB7A 4C37A 3G2FA 3UP2A 4LL0A 3FQHA 4RPVA 4RJ8A 4JDKA 4PTEA 3AMYA 4C4GA 4FEQA 3DB6A 3SLSA 4A9RA 3POZA 4AGCA 2YDJA 5HQ0A 2HY81 4IB5A 1OKZA 3D5UA 4U45A 3RAIA 5BUEA 4YLLA 3DFAA 3GNIB 4IWDA 4S34A 5CVFA 4GS6A 4H3BA 3VQUA 4X7QA 4AZTA 3SQQA 2QOCA 1BL7A 3OT8A 4EHZA 4K1BA 1WVYA 5CY3A 4IX6A 4V01A 4P2KA 3V8SA 5HG7A 2HOGA 4I93A 4ALWA 2EB3A 1TQPA 5EI6A 3CKWA 4M3QA 3EHAA 4U6RA 3UJGA 4CXAA 2WQOA 5H8GA 2GNFA 1H8FA 2X4FA 2OG8A 4W9WA 3DV3A 1RW8A 4EH3A 5HHWA 4KIKA 4FIGA 4PTCA 5TE0A 2XNEA 3VUDA 4EC8A 4O7NA 2X39A 3ZUVA 1FGIA 5KO1A 4QNYA 2F9GA 3GOPA 2Y4IC 2BZHB 4GIIA 2V7AA 4FVQA 4QYEA 4D2TA 4EKLA 4DEEA 2ZDTA 4X6RA 2C6LA 5CSVA 4I1ZA 3SG8A 4G1WA 2X2LA 3RPSA 2WHBA 4BI2A 1YI6A 4ZJVA 3MFRA 4V05A 4ZSLA 3WF7A 3KXMA 3PDTA 2ETKA 2GS2A 3NEWA 4KAOA 3TNPC 4DAWA 2B0QA 4KIQA 3EQHA 5ANGA 1Y6AA 5FBOA 4WBOA 2VTSA 2CDZA 2QO7A 3JUHA 3A61A 3RVGA 3MESA 3AD5A 3E87A 3TV6A 4DINA 4QTBA 4BYJA 1YW2A 2GMXA 3KULA 2GDOA 4FNYA 1VJYA 4PDOA 1H24A 4R7IA 2A27A 3A7JA 4ZXTA 4XNEA 3W2CA 3LAUA 3ZO3A 4GU6A 5IQCA 1BYGA 5AUTA 2O0UA 5AP2A 3LFNA 5CAOA 1K3AA 4UMRA 3ZFYA 1GIIA 1NXKA 5AIKA 4F9AA 2W7XA 5C8NA 3CXWA 3NUAA 1OUYA 3KXHA 2ZM4A 3L9PA 2ITWA 4O96A 4M68A 4ARKA 3CKXA 2QOLA 3KK9A 2BZIB 3O71A 4W4WA 5AUYA 3QZFA 4KRDA 2JIUA 5KMNA 3ITZA 4PUZA 4TT7A 2XM8A 3PXRA 4ZP5A 2V5QA 3R8VA 1PXMA 2X7FA 3TIYA 5JGAA 3IOPA 2VZ6A 5J1WA 4BIEA 3NUXA 4YZDA 2VTIA 4J97A 4YO4A 4YPSA 2QNJA 5F9EA 3QWKA 3QBNA 1IA9A 1YDSE 3TDWA 4Q9SA 2YEXA 4ZTRA 4Z3VA 3UZRA 4AGDA 4E4XA 3MY1A 3IW5A 3QUDA 1UKHA 5FXRA 3LMGA 4WO5A 4A9UA 3GCVA 4FEWA 5A14A 5HICA 1QPEA 2ZB0A 4D9TA 2IG7A 5FDPA 1ZMWA 3WYXA 1VYWA 2P55A 3EFKA 4IJPA 1OIRA 3W2SA 3L9LA 3QA0A 5IA1A 2WTKC 2Z7SA 3FQSA 3O8UA 5M4UA 4IDTA 3KRXA 3QGWA 3BHYA 4NIFB 3ZCLA 4LYNA 3A4PA 3BBWA 4YJNA 1UNHA 4EK4A 4FSNA 1LEWA 4UMTA 3FMNA 3PVUA 4KKGA 3ZXTA 4FUYA 1ZRZA 4QTEA 3ZFXA 1FPUA 1G8AA 4BZDA 4QP3A 3ZLWA 1TVOA 3AGLA 3LXKA 1MRYA 2WTVA 2XZSA 1KE7A 5E8YA 4DYMA 2PZPA 3F6XA 4IZ7A 4BI1A 5DT0A 1RJBA 3OCBA 2BZJA 4KBKA 3EN7A 4AE9A 2WMWA 4EH8A 1FVVA 5E4HA 3GFEA 4K33A 5G6VA 4OR5A 4RVKA 4C35A 2C1BA 1ZOEA 3R73A 4MXCA 3W2OA 3BYSA 3FLQA 4RFYA 3AXWA 3R8UA 2W5AA 4AXAA 2P4IA 5C4LA 1JLUE 3KRJA 4OBQA 2QOOA 4EZ5A 4G34A 3QQLA 4KABA 3WZEA 4IVDA 1ZYJA 4J98A 3H9FA 4IAZA 4L6QA 3P1AA 4K6ZA 4TYHB 5DR2A 2J2IB 3OUKA 5EW9A 2VWBA 4AN3A 2B9IA 3R8LA 3G0EA 2OJIA 5HCXA 1PF8A 3A2CA 4IVCA 4B0GA 3TZ7A 1OL2A 4OTGA 2P2IA 3R2YA 1CKJA 3FPMA 3MH1A 4ENXA 5LVOA 3SG9A 4AZSA 2Z02A 3HMNA 1YHSA 4IWPA 5LQFA 1Z9XA 3ZRLA 3LFFA 3C50A 4PMTA 4ZSEA 4CV9A 4RSSA 2YM3A 4XOZA 3TUBA 2QI8A 2R3QA 3KKVA 2CGXA 4A9YA 4GJ3A 5CAQA 3LMIA 1V0BA 3DOGA 4KB8A 3UVQA 4O6EA 3BU6A 2WTCA 3NIZA 3ODZX 3AD6A 1ATPE 3QTQA 2JKKA 2QO2A 3VBQA 3NAXA 1XWSA 3UG2A 4CLIA 4GG5A 4ZOGA 3QRJA 1JQHA 3R30A 3FJQE 3ZBXA 5CQWA 4D2PA 2I6LA 3FMJA 4MWHA 4N57A 1UVRA 5GINE 2Z7LA 3VJNA 1ZAOA 4C4EA 3MS9A 5JEBA 2RFSA 3FY0A 3T3VA 1NY3A 3VO3A 3VS4A 4WNKA 3QUPA 4BKYA 4I5MA 5JFSA 2BRBA 2VTRA 3D2KA 4S33A 4FSYA 3WZKA 1R0EA 2R7IA 3VS1A 4O7ZA 4EK3A 3H3CA 3C0GA 3TACA 2IVSA 2LAVA 2VTQA 3QTRA 5KZ0A 5C27A 4JX7A 3MA6A 5AUVA 4F65A 2H96A 1W0XC 4X3JA 3CQWA 4QP8A 2OH0E 1Y8GA 5TKDA 5FGKA 4P7EA 1STCE 2YERA 3PY1A 3D2IA 4GU9A 4MQ2A 3LZBA 4XMOA 3WYYA 4EHEA 4IM2A 4HGEA 3GCSA 4S32A 4DLJA 3R71A 3G9LX 4QMVA 5AA8A 3C4FA 2O64A 3UYSA 4YLKA 3V5TA 4R5SA 3AT4A 3R83A 3V6SA 4BIBA 4OT6A 4U97A 3ZTXA 4PTGA 3VIDA 5JFXA 4G2FA 2YHVA 2PHKA 4Y5HA 3KL8A 4NEUA 5GIPE 1YHWA 2YDIA 3EQCA 4CT2A 2OZAB 5JH6A 2IN6A 5F20A 2WGJA 1PJKA 4RMZA 3WE8A 2ZAZA 4AW2A 3COKA 3H30A 2OU7A 2HY0A 1VZOA 1U46A 4YTCA 4FGBA 3KQ7A 3PA4A 2XMYA 5JGBA 3QKLA 5ANEA 4BR3A 5HNGA 4CZYB 3OXTA 4MWIA 3MY0A 4JL9A 3ZLYA 4I0SA 2VTJA 4IIRA 4QTCA 5DHJA 2NO3A 2Q0BA 4RLLA 4BDFA 5L8JA 3QTSA 2FUMA 3V3VA 2R3FA 1XJDA 3Q6UA 5HE0A 3R63A 2QU6A 3CCNA 3HNGA 2W96B 1H1PA 4AZEA 1H01A 3R0TA 4BBMA 5IEYA 4RIWA 2XBAA 1AD5A 2WTIA 3ORKA 3R28A 4ANQA 5B2MA 4WG3A 3WF8A 4BDIA 2E9OA 1O9UA 1SVHA 3E93A 4JR7A 2QLQA 4WG5A 3T9IA 4PMPA 4J8MA 4YPDA 3T9TA 3D4QA 4O6LA 3NIEA 1G3NA 2R4BA 1Q8YA 5K5XA 1H00A 2CHLA 3NUUA 4EWQA 4IZAA 3FL5A 4WD5A 4L46A 3P7BA 4EOPA 4YHFA 3DK3A 3Q04A 4V0GA 1XH9A 4CFXA 4MAOA 2YLFA 2UZWE 4QMSA 5LJJA 3BV2A 5HD7A 5DFPA 4YURA 2PYWA 4NUSA 4E4NA 5GNKA 5F1ZA 4HGTA 2WQMA 4YTFA 3ZMMA 2WXVA 3F3TA 2Y4IB 3QTZA 1Q41A 3OOMA 2WOTA 3NW6A 4K9YA 2XK8A 3G90X 3V51A 3ZC5A 1J7UA 3JVRA 2ITUA 3DXQA 4MXOA 2ZV7A 3RTPA 2B9FA 3TKIA 4IHPA 4UEUA 4FODA 4C3RA 2C6OA 3KMMA 1ZWSA 3REPA 3BI6A 3B2TA 3PVGA 4BTJA 4JQ8A 1KOAA 2QR8A 3VS7A 5C8KA 1VYZA 4LV8A 3SX9A 4E4MA 2FGIA 3I6UA 2OIBA 4EHVA 3PXFA 3P79A 3ZO4A 3AC1A 3PPJA 4XS2A 4ACHA 4OBPA 2BRGA 4FSQA 3ZHPC 1XH6A 4CTBA 3IW4A 5LMKA 2JDVA 4AT5A 3QKKA 4B4LA 4XRLA 2IW8A 4UALA 5LXMA 2V7OA 1FQ1B 1GZNA 1R3CA 3BV3A 1P5EA 4HW7A 4NWMA 3UDBA 3VN9A 4OTRA 5M06A 4JQ7A 3DLSA 2OBJA 4GYIA 4RWIA 3P78A 4FC0A 5EM8A 4F0IA 1ZOHA 2XEYA 4JRNA 4XV1A 1R78A 5IH4A 2J5FA 4PMSA 2YWPA 5A4CA 4PNKA 4I4EA 2R2PA 3PSCA 2VGOA 3DFCB 2Y0AA 4O7VA 5KUPA 4LV5A 3CIKA 4IC7A 4DG2E 3DQWA 3BQRA 4RBLA 4PF4A 4CVAA 1M52A 3JS2A 4GT3A 4NCTA 3V5WA 2UZLA 5D9HA 5F4NA 4WG4A 1OL5A 3PZEA 4CNHA 4XP0A 5AV2A 5AR3A 3SKCA 3A7FA 4DEIA 1H0WA 2GQGA 3KN5A 3B2WA 4BDDA 3QRUA 3UC3A 5KMKA 2W4KA 4IVBA 4O0XA 2ZM1A 3R1SA 4IX3A 4C0TA 2JDRA 4O1OA 2ZOQA 1JSTA 5DI1A 3DCVA 1VEBA 2XRUA 3KCKA 3S95A 4B99A 3NRMA 4DFXE 3RZBA 4BL1A 4LGHA 4C36A 4KWPA 2OIDA 4HOKA 4X2NA 3OT3A 4ANMA 3G51A 2BROA 4LQMA 5AR7A 2YAKA 4EK5A 5CYIA 1B6CB 1Q8WA 2IZRA 3O7LD 1GZOA 4O0RA 3VJOA 4C62A 3MDYA 4GVJA 5J9YA 4BDAA 5HG9A 2E2BA 4WSYA 3LHJA 5KMOA 3C13A 2V55A 4YJQA 5L2TA 1U59A 1WBVA 5C1QB 3NUNA 4BB4A 2YM8A 2ONLC 3FXZA 4XG4A 2UZTA 4FTUA 4L53A 4BCPA 2FVDA 2UUEA 2PVKA 3AC5A 2PVMA 2W9ZB 3KF7A 3EL8A 4PWNA 5E92A 3VBYA 4FICA 4M15A 4AW5A 3POOA 3QC4A 3W32A 4ACGA 5AAGA 2SRCA 4UWYA 4YJTA 4B8MA 4YJRA 4O82A 3COHA 4I6QA 4IQ6A 2RL5A 1ZZ2A 3C0IA 1W83A 4CFUA 4D2SA 4C58A 4RZWA 3RHKA 2WEIA 3MB7A 3L9NA 4C59A 5IF1A 2CNUA 3KA0A 3OWJA 3PJ2A 3UBDA 3FZSA 5CSHA 2QOKA 4BTMA 3UMWA 3RPRA 4NJDA 3O51A 3Q52A 4AQCA 4HCVA 5EYDA 3LE6A 3TNQB 4BGHA 3QQKA 2CN5A 3PJ1A 1UA2A 3MPAA 4JAIA 3TXOA 2GNJA 4EOLA 5FD2A 3UZPA 2PMLX 4QYYA 4Z7HA 4L8MA 5CNNA 2JAVA 2Z60A 3V8WA 4AP7A 3PY0A 3TDVA 2QC6A 4LGGA 2FH9A 5FQDC 2CLQA 1SNUA 4CYIA 4JDJA 4FVRA 4O7RA 4FZAB 3IDPA 1J3HA 2PVLA 3OY3A 4IAKA 4E93A 4HVIA 4E8AA 4FV9A 4MNEB 2UZVA 3BIZA 3GBZA 4B7TA 2QVSE 4I6HA 5ETAA 4CTCA 3UVRA 1REKA 2PE2A 3CTQA 3QF9A 4LOOA 4IM0A 3FKNA 5EYCA 3FXWA 1OIQA 3V8TA 2XP2A 4FTKA 4UZDA 4IBMA 5DNRA 2IO6A 4XG3A 5HOAA 4BC6A 3V5QA 3HMPA 4ERKA 4O22A 3G0FA 3B8QA 4E3CA 3EQDA 1YI4A 3NVMB 5BYYA 3K54A 4CFNA 2WMTA 4QYHA 3VRYA 1V1KA 3MH0A 2RSVA 5IUHA 2B1PA 3QZGA 4IW0A 4U8ZA 5CT0A 1M7QA 2F2CB 4BCGA 3HECA 4IE9A 4ZLZA 4E5WA 3KGAA 4GT5A 5ITAA 3NNWA 4TYGA 3UIMA 2WPAA 3UMXA 4AGUA 5EQYA 5E8UA 5FXQA 4ONAA 4X0MA 4XCUA 5DH3A 4RVTA 4UYNA 3KXNA 5KMJA 2AYPA 4MXZA 2I1MA 3MGYA 3OZ6A 4DGLC 5E90A 2VWZA 4E73A 3TV4A 4G9RA 3HAMA 2I40A 5C26A 2YWVA 3BRBA 3FZTA 3ATSA 1XKKA 5LWMA 2OJFE 4RIOA 2KTYA 2XRWA 3P08A 4C3FA 3VUGA 3QRTA 4EK6A 2IVVA 2XUUA 3LFQA 1SVEA 3DNEA 4ID7A 3O7LB 3ZEPA 1OITA 2QG5A 3CQEA 5BUJA 2GPHA 4GCJA 4YLJA 4BZNA 3OXZA 4EORA 1XH4A 3C7QA 4O0YA 4FT5A 4QTDA 4E5BA 3E3BX 3VHKA 3BGPA 5JFVA 2W06A 3PXZA 4JS8A 3MTLA 3R7YA 4DGMA 5BNJA 4J1RA 4BDEA 2JIIA 3R2BA 4C33A 3CSVA 5IG1A 4NM3A 2C3IB 1OGUA 4GEOA 4QQJA 3RWQA 4EQUA 4FKJA 2QHMA 2OO8X 2C6KA 5HIDA 3FY2A 2OGVA 3C4EA 3ODYX 1M2RA 4DLIA 3D83A 3D94A 1WZYA 5DG5A 4RLKA 1H26A 5EDRA 4GW8A 4MNFA 1J1CA 4IAFA 3LFAA 3Q2MA 5JZJA 2PE1A 5GHVA 4ZK5A 4YC8A 3MJ1A 4TZRA 4GH2A 1SZMA 4OTFA 2F57A 4DFYA 2YLEA 1WBNA 4JOAA 2IW9A 4XV9A 3F88A 5I9WA 4HYUA 3LXNA 4JJRA 4YNEA 3EZVA 4FNWA 3IPHA 2ITVA 4K0YA 4QMTA 4NIFA 5D12A 4DH7A 4XBUA 5CXZA 1XO2B 2ZDUA 4J8NA 4MHAA 2F7EE 2QO9A 3HRCA 2CMWA 4KSPA 4UMUA 3DKOA 5IDPA 3QX4A 3FLYA 3P4KA 2X7GA 4GK2A 4MEDA 5HBEA 5L2QA 3EFWA 4BCOA 1BL6A 3DTWA 3O23A 5H2UA 4ZY6A 3ZC6A 2XVDA 3LVPA 4Y83A 2XA4A 2C47A 5AUUA 3LJ0A 5HTIA 2UV2A 4ZMFA 1JOWB 1OIUA 1H25A 4MD8E 4FT7A 4RQVA 3R7UA 5J5SA 4GKHA 3D5XA 2QR7A 2I0YA 4Z9LA 3RZFA 3R8PA 5AR5A 4ZY4A 2EXCX 2X0GA 4IAYA 4F08A 2W4JA 4QP1A 2AC3A 3ERKA 5L2SA 2OF2A 2OIQA 2HZNA 3ZFMA 4XG2A 3S1HA 2ITOA 5CU6A 3LM5A 3GC8A 4TYHA 2EU9A 2X6EA 5E1SA 1V0PA 1Q99A 4LGDA 3W2RA 3WZJA 4MXXA 2ETRA 3BLQA 4C2VA 4NH1A 3DBDA 1KV1A 5AA9A 4ZTQA 5AR4A 5CU3A 2WFYA 2QCSA 2W5BA 2YCQA 4KD1A 5DN3A 4ITIA 2E9VA 4RWKA 3UOJA 3EN5A 5FTQA 2XS0A 4O2ZA 4U3YA 4XUFA 2UZOA 4E4LA 3OUNB 5EHYA 3OFMA 4KBAA 3DPKA 3IGGA 2ITXA 3PFQA 4QQCA 4D0WA 4I0TA 1UU9A 3Q60A 1GNGA 3RK9A 4DH5A 5JFWA 3RGFA 2XNOA 1NVSA 5K0XA 5IQAA 4O81A 1KWPA 5M4FA 5ACKA 3LLTA 4IWOA 4ZSAA 3R1YA 1W8CA 2YA9A 1PKDA 4NFMA 5HE1A 3ZDIA 1KUTA 3QTIA 4W8EA 2C5OA 5FEEA 2J0JA 2GTMA 2QOQA 2J5EA 2AUHA 2UVYA 3MY5A 3N51A 4J52A 3FKOA 5EHLA 1NVRA 3HMOA 4XG9A 5HIBA 4CV8A 2WOUA 3KU2A 3RPVA 2UZNA 4WBBB 4W4VA 4M12A 3MFSA 3W18A 3LM0A 3EB0A 3ULIA 4UY9A 3TM0A 4V04A 2O5KA 2EB2A 3QZIA 3C4XA 3ETAA 3AT2A 3BCEA 4W4YA 4NM7A 5AP1A 5CALA 4FTQA 4MD7E 4CCBA 1Q3WA 3M42A 3SHEA 3TKHA 5J1VA 1GJOA 4JR3A 4LFIA 4BBFA 4NTSA 2PZRA 5AR8A 2Z8CA 4BGQA 5IA3A 1XHAA 5I3RA 2BRHA 1UNLA 2ETMA 5LVLA 4GG7A 2XJ0A 4XHKB 4FUXA 2OXXA 4RJ7A 2QHNA 4BCMA 5IU2A 3D9VA 3PYYA 4L52A 4O7WA 2R3GA 2JBPA 1ND4A 2HXQA 4ZIMA 2WMSA 1H1WA 3L8SA 1PYXA 2XF0A 5LMBA 3R9OA 4DFNA 2W1EA 3OCSA 4CQGA 4ENYA 2VNWA 3F3UA
chains in the Genus database with same CATH superfamily
2BVAA 4BCIA 3L8XA 4X6QC 3GU6A 4XOYA 4GK3A 3NFGB 1DI9A 3UDSA 4RVLA 3F5PA 2NNWB 3UOKA 2I7QA 1IAJA 4FV3A 4HCTA 3O50A 1Q4LA 3ZONA 4L67A 2ITZA 3WF6A 2X8IA 3HGKA 2G2IA 1Q24A 3IO7A 4GRBA 4YO6A 3U51A 3GC9A 3W16A 5KNJA 3GGFA 5LCKA 3TTIA 3R7OA 2BDFA 2OZAA 4EC9A 4Y85A 1W2CA 1JSVA 5IQIA 2J51A 4D1ZA 4D1SA 2CKQA 3A4OX 4FOBA 4IADA 4J53A 1XBAA 1PXOA 5C9CA 2A19B 4YJUA 2W1FA 4XP2A 4F09A 5IUGA 3TIZA 3AD4A 2YCSA 2WB8A 1S9JA 4J99A 4EOSA 1GY3A 3COIA 1YOJA 3FMMA 2GQSA 2ITYA 3FE3A 3ORLA 4GFGA 5I3OA 3CPCA 5HNIX 3WZDA 5EOLA 5DA3A 2PE0A 4O83A 4Q5EA 2VWIA 4MBLA 5CAVA 4U41A 5E8SA 5FLFA 2DQ7X 1FMKA 1U5RA 1Q8TA 3Q9XA 3QTWA 1JKKA 2NRYA 3K3JA 3LIJA 4O0SA 5BVOA 3F5UA 2XKCA 2UZDA 1PHKA 5JQ5A 3CD3A 5DIAA 3MPTA 5JRQA 3BLHA 1GAGA 2IZTA 2VV9A 3DJ7A 3RCJA 3UPXA 4D4RA 2PUIA 4ALVA 2H34A 4IMYA 4BIDA 4F6UA 5BPYA 5IEVA 4M66A 3WOWA 5J9ZA 3FZOA 2X1NA 3F5GA 3MJ2A 3BPRA 5BVWA 3RHXA 5JMSA 2J50A 2RKUA 4GK4A 4QPSA 3ROCA 5HO8A 3EYGA 3F9NA 5CZHA 3NNXA 5E7RA 3SOAA 2YACA 3ZSIA 4BCHA 4FSWA 3QFVA 3EZRA 4MVFA 5JKGA 3GC7A 3RK5A 1IG1A 4HJOA 4DC2A 5HX8A 4E5AX 3IDBA 4G6OA 1L3RE 1KE6A 3JY9A 3QD2B 2NPQA 2QKWB 4BHNA 3LCDA 4D2WA 4G9CA 4IZYA 1Y91A 4AFEA 5CSXA 4X3FC 5CVHA 4CFMA 1OUKA 3MVJA 4B9DA 4F4PA 5FDXA 3ZUTA 4H3PA 3RAWA 3F7WA 4B6LA 3DA6A 3PUPA 4AA5A 3Q96A 5DYJA 2HCKA 4RJ6A 2BKZA 2V22A 4F9BA 4DCAA 2F7XE 3LCOA 3H9OA 2X2MA 3NLBA 2W1DA 2XYNA 3UP7A 3VBXA 1PMNA 2VTPA 5AP3A 4QD6A 3ZU7A 3TZMA 5FP5A 4FV0A 2A4LA 3Q5ZA 2Q83A 4D4YA 2Y4PA 4A4XA 4DF3A 5E9EA 3ID6C 4APCA 5AADA 5ETCA 5HO7A 3EN6A 2JEDA 5F94A 4O84A 5L6PA 2YM6A 1QCFA 1YWVA 5K9IA 4TTHB 3F3WA 3GVUA 2UW3A 4FK6A 3C4WA 5FTOA 5A4LA 4MXAA 3R8MA 2YM4A 3SW7A 3SC1A 2WMUA 4AXEA 3P5KA 2JAMA 2XNMA 5HKMA 5FEQA 4AAAA 4Z55A 4E20A 2W9FB 4KKEA 3H0YA 4FIEA 4AXDA 3HZTA 3QQFA 1YWNA 3FEGA 3MN3A 2C3LA 5GJGA 3ZLXA 5HNBA 4ZSJA 3DBQA 2XEZA 5CTPA 3FL4A 5AJQA 2VTLA 4IM3A 5LCJA 2B7AA 3M2WA 4D1XA 3SGCA 1ZYLA 3D5VA 3IONA 2OLCA 3E8CA 3R7EA 3KMWA 3HA6A 3HV7A 4ASZA 4CQEA 4EYJA 4KUJA 4FX3A 2BAQA 3CEKA 4I0RA 3WIGA 4CRLA 4O7LA 1V0OA 3PWDA 2H8HA 1KE9A 3NNUA 5CI7A 4BZOA 4QMMA 1LPUA 2JITA 3C5UA 2BALA 5EM7A 4LOQA 2GFSA 5DBXA 3VUHA 5EM5A 4C4IA 4F7NA 5CF5A 2PVHA 4CD0A 2HWOA 1MQBA 3VW8A 3D5WA 3BHHA 4EOOA 4FZ6A 4ASDA 5CU2A 2J7TA 4YC6A 5G1XA 5AX9A 4C4FA 3TN8A 4F64A 3FYKX 4I5CA 2C6MA 4FTRA 3F2RA 3M1SA 1I44A 1YXTA 2GHLA 4FSZA 5LMAA 2IEWA 4JG6A 4CMTA 4FIJA 4YBJA 1IA8A 2R3OA 4HVSA 2CNVA 3CGFA 2R5TA 4EBVA 5CANA 2BRNA 4R3CA 3NDMA 1H08A 4I24A 4E26A 3PJ8A 4MTAA 3W0PA 4S30A 5A46A 4PPCA 1G8SA 4H58A 3E88A 4LRJA 4BI0A 1OB3A 4EH2A 1PXNA 2W1GA 3UDZA 3QQUA 3RKBA 3OXIA 3PA3A 2RF9A 3TJCA 4Q2AA 4HZSA 4BCFA 3GCUA 4XYFA 4MX9A 4D5HA 2FSOX 4PPAA 5I9ZA 3UODA 4EL9A 2F49A 3KIOC 5IA4A 3ALNA 1IRKA 2O63A 5CT7A 2IVUA 4FSRA 4W9XA 1NVQA 3F3ZA 3CP9A 4FTLA 4GFOA 4R78A 2OW3A 3IS5A 4JBOA 5EOBA 4DEGA 4ZY5A 3UZTA 1ST4A 2YIRA 2GCDA 4G3CA 4TWPA 2C6EA 3U54A 2UW9A 2PMIA 4UWBA 5DRBA 3PA5A 4IZ5A 4RGJA 3I4BA 3E8DA 1OGYA 5LVMA 1Q8ZA 1WFCA 3P7CA 4IANA 4JIKA 4JVGA 5F95A 3EKKA 2R0UA 4CFVA 4ZTMA 4XBRA 4FV8A 3G33A 3ACJA 2NRUA 3QYWA 3LQ3A 4F0GA 3KK8A 2VX1A 2PPQA 4MNEA 4TNBA 5CZIA 5BUIA 3I6WA 5A6NA 5GZAA 1FVRA 4KINA 4L43A 2UW5A 5EG3A 3VC4A 3NR9A 3NUYA 2X9FA 3HV3A 4FV1A 5KBQA 4APPA 1SYKA 4EHGA 2DWBA 2VTMA 3QQJA 2W0JA 5KHWA 5EW3A 3TZ8A 5A3XA 5FWKK 2JDSA 5CU0A 4DGNA 2WQNA 4RRVA 3TNIA 5DVRA 4EUTA 3ATTA 3C51A 3U4UA 1FGKA 1ZMUA 2CCHA 2C3KA 2IVTA 1AGWA 1ZXEA 2ITQA 4G3FA 3ZS5A 2BUJA 5AV0A 5CENA 1OL7A 4MCVA 4PL3A 4YGAA 4DFZE 5CEOA 2F2UA 4AF3A 4EZ3A 2XIZA 3DBEA 4L3PA 3CTHA 4PL5A 5JT2A 4X2KA 3MPMA 5LMKC 4G31A 2XH5A 4O21A 2FB8A 3D7TB 1M2PA 3IECA 2XK6A 4X2FA 3HRBA 4IC8A 4I5HA 4HPTE 4OT5A 2BHEA 3W55A 4J71A 5IISA 3ORTA 5GZ8A 4FEXA 5IQGA 2X81A 3MWUA 2QODA 4D55A 5AFVA 2XJ2A 3R9NA 4JDIA 2I0EA 1OMWA 2VWUA 4GV1A 4HNIA 4EQMA 3FI8A 3DDPA 3QC9A 3VF8A 1YRPA 2XIKA 4RFZA 4BDBA 5HD4A 1BX6A 4BRXA 4IVAA 4KS8A 3A62A 3TTJA 5HU3A 5DR9A 1JKLA 4O7YA 3FBVA 4OAUC 1JKTA 2WAJA 1E9HA 4O38A 3BQCA 4DGOA 1K9AA 5IUIA 4C34A 4MBJA 3ZEWA 1JSUA 3E7OA 3Q6WA 3KVWA 3LFSA 4MKCA 2WD1A 4F9YA 5E8WA 3U9CA 4AE6A 3HDNA 4BTKA 4OW8A 3OP5A 2Y6MA 1E1XA 5DOSA 4YHTA 1BI8A 4C02A 2VO0A 2C6IA 3I60A 3Q9ZA 3Q3BA 4JX3A 5H3QA 3FI2A 3PG3A 2H9VA 3GU5A 5L2WA 3C5IA 1F5QA 4HPUE 4MK0A 4AA4A 4FMQA 2WMVA 2YITA 2YIYA 5B0XA 2XIRA 2XBJA 2IWIA 4PPBA 3U6JA 4GFMA 4ZTHA 3PRIA 5DGZA 3W0QA 3K5UA 4F6WA 4QTAA 4JQEA 4FG7A 3QQHA 4AWIA 4EOIA 4DBXA 3E5AA 3TV7A 2HAKA 2WQEA 2ITTA 3EQBA 4FKUA 3TKUA 3NZ0A 2BPMA 4RQKA 5FP6A 1PY5A 3L9MA 4O7SA 3P86A 3DLZA 5IKWA 1GIJA 3A8WA 1L8TA 5IH6A 4I94A 2VWVA 3N4VA 3Q9YA 4H1MA 4L9IA 3GQLA 5AM6A 2ZB1A 1YXXA 4F63A 1QMZA 4I21A 5J7BA 2IZUA 3QAME 3VAPA 3Q5IA 3BHVA 3C0HA 2I0HA 4AT4A 3II5A 4R1YA 4RIYA 4FR4A 4DG0E 2VGPA 3CJGA 3PP0A 4JNWA 3FMEA 2QOFA 2WTKB 3MI9A 2GHGA 2R7BA 3I5ZA 4BKJA 3DAKA 2VX0A 2ERZE 4FG9A 2QURA 5HZNA 4AN2A 5I0BA 2WTJA 2DS1A 2A2AA 2ITPA 2UW6A 3JXWA 1CKPA 3QLGA 4JXFA 3UO5A 1PMVA 3OOGA 4E1ZA 3NMUF 4Y95A 1G5SA 2FSTX 4PP9A 3I81A 1EH4A 3R7VA 4UYAA 5CNOA 1OM1A 3QCXA 2YM5A 4O4EA 2JLDA 3OHTA 2QD9A 2JKMA 4LUDA 1X8BA 2VO3A 5DLSA 2C4GA 4FT0A 4YC3A 4P4CA 4G3EA 2YJSA 4DHIB 3VULA 4AOJA 3QCQA 4Q9ZA 3LQ5A 4FI1A 4L3LA 4IWQA 2G9XA 4O0UA 4OAVB 5EI2A 5AP0A 2C5YA 3S4QA 4QYFA 5L8KA 3W0SA 5IDNA 2GNHA 5T6KA 4YJVA 4FEUA 4K11A 1H1QA 5FBNC 3MA3A 2E9NA 3E8NA 3NYVA 3EQIA 4M84A 1OPKA 3EH9A 5HLPA 4EKKA 4UZHA 2JDTA 5GJDA 4Y72A 4FA2A 3RNIA 1P4OA 5EDQA 4GKIA 2EXMA 4AW1A 2OK1A 4ANSA 3R6XA 5JN2A 4H3QA 4ZJIA 4A06A 2ZM3A 3UOLA 4JAJA 3ZRMA 5HTBA 4BJJA 4QMYA 2ZYBA 4M0YA 5ANJA 4QPMA 3V5PA 4ZS4A 3DBFA 4DEAA 2G01A 3BKBA 3OF0A 4FT3A 2XK3A 3P7AA 3FYJX 3OWKA 3N4UA 1PKGA 3LJ1A 3ENMA 4OUCA 3G9NA 4QOXA 3RK7A 3TI1A 4NKAA 1NT2A 5H8EA 1R1WA 3TJDA 1DM2A 4F7LA 2ITNA 1CM8A 3SVVA 3CE3A 2KULA 2JFMA 3OWPA 3TMOA 2UZEA 2Y7JA 5AAEA 3ROYA 5TOZA 1WAKA 3BYMA 2CCIA 4ZTLA 1URCA 3IK3A 3QCYA 2VX3A 4F1TA 5A6OA 3PIYA 3LLAA 3PXKA 3M11A 1WVWA 3BGQA 5HORA 3F7ZA 4EONA 3N4TA 2R3PA 2WEVA 3CY2A 4BDJA 4CFFA 5BYLA 5JQ8A 3GC0A 3JR1A 2WMQA 4HVDA 2C30A 1UKIA 5AEPA 4CZTA 1W82A 4Y5QA 1OKWA 5M07A 2ONLA 4I4FA 4N70A 4XP3A 1MP8A 3MVMA 4AXCA 3BU5A 2VTHA 3F2AA 5HBJA 1GZKA 3UO6A 4LM5A 3IW6A 4DTAA 5DT4A 4HCUA 5AV1A 5L8LA 3NSZA 3U4WA 3FI3A 5EKOA 2XKEA 3E8EA 4W8DA 5EDPA 3K3IA 4TW9A 3AG9A 3BHUA 3AC2A 1BMKA 3LW0A 2C0TA 2C69A 2V0DA 5L2IA 1RQQA 3AGMA 3BE9A 5CEIA 4GVAA 1UU3A 2VU3A 2GNIA 3MVLA 4IAAA 4O4CA 3T8OA 3HUBA 4EH4A 4FV7A 5ACBC 4FZ7A 2OJJA 5JRSA 3VUKA 3PY3A 2XK4A 3QKMA 3QRKA 2EWAA 4AGWA 2G2FA 3FMHA 4AT3A 4TXCA 5AUXA 3SXRA 2XNGA 2CKPA 4EYMA 4FIHA 4EI4A 2E9UA 3NCZA 4ANOA 3QD3A 2WMXA 5D7AA 5AX3A 5BV3A 1ZMVA 2RIOA 4O2PA 3QLFA 4FKOA 2CGWA 2HYYA 1AQ1A 4K18A 4D4SA 2WO6A 3UPZA 2R3NA 1WBPA 4AFJA 3W33A 1FINA 2C3JA 3Q4ZA 1PW2A 2YIXA 1ZYDA 2ZV2A 3QXPA 2O65A 4GMYA 5AP6A 2X7OA 4R8QA 2QKRA 1OPLA 1W84A 4YJOA 2VRXA 2YCFA 3PPZA 3QRIA 4FL3A 3VNTA 4U5JA 4FKQA 1UNGA 5DEYA 3ZOSA 4CT1A 1OPJA 4QP2A 4BF2A 4FBXA 3JPVA 2QU5A 4QP4A 5KMIA 3W1FA 4HYSA 3VONA 4RX7A 3P0MA 2QG7A 4C4JA 4U80A 2G1TA 3F2NA 4HYIA 3AOXA 4JRVA 4BHZA 4H36A 3WARA 3BWJA 2Y6OA 4FSTA 3W8QA 2JFLA 3BE2A 3CJFA 1Q5KA 2ZVAA 5CVGA 5DEWA 2Q0NA 5FXSA 1PMEA 4Y8DA 4MQ1A 3GQIA 4CKIA 1H4LA 4BY9E 3EJ1A 5CF6A 1IASA 1XH7A 4YTHA 2QOBA 4AZFA 3HP5A 1H07A 4I5PA 5E8ZA 2ERKA 5HIEA 3FZPA 3SOCA 4DEHA 4XG7A 2YABA 3U87A 4JBPA 1FBNA 3SW4A 3LJ2A 2NYAA 4DT8A 5JGDA 1ERKA 4M69B 3KFAA 2X6DA 5HVJA 1BKXA 4ZSGA 5ETIA 3AQVA 2VTNA 4ALUA 1XH8A 2BAJA 2R3MA 4FTNA 4NW5A 4RIYB 4CSVA 4I3ZA 2ZV9A 3E92A 4CYJA 4RX5A 3CTJA 3I0OA 3UE4A 3DXNA 3PFYA 4I41A 4N0SA 3BL9A 2HW7A 2J0MB 1Q8UA 1UU7A 1SNXA 3FZ1A 4I23A 3UIBA 3MFTA 2VWYA 4FIIA 4NT4A 4DH3A 4F7JA 2WTDA 4LUEA 3QWJA 2YIWA 3MH2A 3BLAA 2VTTA 2WU6A 3NX8A 2A98A 1M14A 3ELJA 3TEIA 4BN1A 5IQHA 3GEQA 3NW7A 4J95A 2A1AB 3QCSA 4FTOA 4YHJA 3P9JA 3R7IA 3QTUA 4BWKA 1REJA 1H27A 1ZYSA 5TF9A 4GYGA 1P2AA 3F66A 3QYZA 3FAAA 1WCCA 3E7VA 3QZHA 1WBOA 2XIYA 4N6YA 4AUAA 1YOMA 4Q5HA 4XH6A 3UNKA 2UZUE 3TNWA 5KE0A 3LXPA 4ZEGA 2VWXA 2WZJA 1BI7A 2CNQA 3MFUA 3FI4A 4WT6A 3UDTA 2JIVA 4EJ7A 4X21A 4U42A 3DY7A 2RFEA 2B4SB 2XNNA 5FM2A 4HVHA 3HDMA 4Z7GA 2HENA 2BKKA 4O91A 1OI9A 3KRLA 5M44A 2BRMA 4G5PA 3RP9A 1R39A 3R04A 2PU8A 1O6KA 2XCHA 3FZRA 3HA8A 5BVKA 3FMLA 4GL9A 3PIZA 3KRRA 2UZBA 4XV2A 5M55A 5FRIA 3VF9A 2C1AA 3VS0A 4N6ZA 3UQCA 2B54A 5I9XA 2PWLA 1TKIA 1W98A 2G15A 3HV6A 4IH8A 5M57A 2CN8A 3R9RA 4YJSA 2IJMA 4ACCA 1W2DA 3ACKA 1JBPE 3VRZA 4YNOA 4YP8A 4IB0A 4BDHA 1P4FA 1Q62A 2BAKA 3ORXA 5M53A 5KBRA 1Z5MA 1GZ8A 3OTUA 2XNBA 3PG1A 4ZMEA 1OIYA 5HE3A 3ALOA 4PMMA 5D10A 5J9LA 4QMXA 3FHIA 3ZZWA 1CKIA 1DAYA 2OJ9A 2YAAA 2YISA 4WRGA 4XX9A 4E6DA 3R8ZA 4II5A 4DG3E 4WNOA 2ZMDA 4ZLOA 4K8AA 2ZJWA 3H9RA 4AS0A 4QP9A 2GS6A 1E1VA 5AM7A 5JZNA 4C57A 1CMKE 5AUWA 4E7WA 4DDGA 1WVXA 3GU7A 2BFXA 4L3JA 3OTVA 2E9PA 1IEPA 1KOBA 3FC1X 5AP5A 3ORNA 3EKNA 4TN6A 3V5JA 4F0FA 3QTXA 2QOIA 5CSPA 5HVKA 2PMNX 2XYUA 3O17A 3IGOA 1OKVA 5IEXA 3HMIA 4EOQA 3LFCA 3FV8A 3IW8A 4NZWB 4H39A 5IA2A 3PJ3A 3VHEA 4FKGA 5I9VA 5J5TA 3PSBA 4FRFA 2VNYA 3VS3A 3UG1A 1SM2A 5EFQA 4L68A 3K5VA 4R7HA 5C8MA 4A4LA 4FTCA 3BHTA 4FV4A 4A9TA 4L7SA 3I79A 4RJ5A 4JI9A 4XJ0A 5HESA 2GTNA 1DS5A 4WSQA 3CBLA 3DS6A 4X2GA 3SXSA 2P2HA 5TT7A 2X8DA 5IQBA 4X2JA 3G6HA 4XG8A 4PX6A 3TUDA 5E1EA 3IDCA 4ITHA 3KEXA 4QMPA 4KBCA 5I9UA 4TY1A 5K3YA 4M67A 2C6TA 3SV0A 3CD8A 2PVNA 3AC3A 4LOPA 4RG0A 2F7ZE 4DFBA 5GZ9A 4QQTA 3F5XA 1B38A 4NM0A 2PTKA 1BUHA 5AUZA 5IMXA 2B52A 4QMNA 3VUIA 5BQ0A 3W2QA 4CLJA 2W99B 3S0OA 4AOTA 4L01A 3GP0A 4I6FA 4ANLA 2A0CX 2WU7A 5J8IA 4JDHA 3HV5A 2CSNA 4NJ3A 1HCLA 3LXLA 2OICA 2O2UA 4WNPA 4RIXB 3ZLSA 2FO0A 4D4VA 4MYGA 2W1HA 5CEMA 2XALA 4G6LA 3O0GA 3PWYA 1XBCA 3A99A 4O0TA 4AZWA 4F6SA 4AZVA 5AV4A 1QPJA 2FYSA 2Z7RA 5B2LA 4BGGA 3LPBA 4IX4A 3GUBA 3H10A 3SRVB 4RA5A 4CKJA 4U40A 4ZS0A 4AU8A 3EQFA 3ENHA 4ITJA 4LI5A 4D28A 4BCNA 3FKLA 4H05A 4RA4A 4DCEA 3GB2A 3ZUUA 2CPKE 4DN5A 3FSFA 1URWA 3HL7A 4AX8A 3KVXA 4ACMA 2YFXA 4XLIA 3UNZA 4DFLA 3RINA 5KKRC 5J87A 4HNFA 1PRYA 3FMDA 3R1NA 3NYNA 3D7TA 5HEZA 1CSNA 3BLRA 3UVPA 3MB6A 4HGSA 4ACDA 1KV2A 2REIA 4WNMA 3BGZA 2O8YA 4PDSA 4F1MA 2YN8A 4FL1A 4WOVA 4B8LA 5B7VA 5ANDA 3MYGA 5A54A 3UYTA 4TNDA 3O2MA 3V04A 3PZHA 3ZM4A 4L7FA 5IH5A 1TZDA 4DITA 2WQBA 3DKFA 1Y8YA 1H1RA 1QPDA 3QD0A 4F9WA 4UX9A 5GJFA 4LMNA 3KN6A 2OH4A 2PSQA 4NK9A 2FSLX 3FWQA 4S2ZA 3VS2A 5BVDA 3DU8A 4JLCA 5CLPA 5FG8A 4RX8A 4CG9A 4EH5A 2W5HA 4QMQA 2YM7A 3TT0A 3Q4UA 1A06A 2VD5A 3PXQA 4IJ9A 1LUFA 2W1IA 2J0KA 3DZOA 2PL0A 2J0IA 3DB8A 4L45A 3D0EA 2BDJA 3JYAA 1JKSA 5EQEA 3DKGA 2R3RA 3WF5A 1KSWA 3BBTB 3FXXA 4BBEA 3A7HA 4FE2A 2XIXA 4NL0A 3VS5A 3F3VA 3R22A 4AG8A 2BDWA 5DE2A 2PUPA 1QL6A 4QP7A 3RJCA 3A8XA 4WIHA 4DFUA 3HUCA 1B39A 2OWBA 2R3HA 3BELA 3PSDA 3SA0A 2JC6A 4FV2A 4OTQA 4YZNA 5KMMA 4FEVA 3PE1A 4A07A 2CLXA 4EEVA 1J91A 5LVNA 4UN0C 5D11A 2BCJA 4E6AA 3W8LA 3BZ3A 3SXFA 5C01A 2ZV8A 4LG4A 1WBSA 4IFCA 2IF8A 5LARA 3HYHA 2HWPA 4FKWA 2C68A 2QQ7A 3DAJA 4BDCA 2EVAA 2OXDA 2OF4A 2LGCA 4I6BA 4P90A 4KS7A 4YZMA 5ANKA 3KC3A 4NW6A 2W1ZA 3NAYA 4FVPA 3DGKA 4R1VA 3R01A 2J9MA 4GUEA 4EH7A 4D2VA 1CDKA 4ZZMA 3W0RA 2YJRA 2J90A 3HRFA 3R21A 3NYOA 4FV6A 5D1JA 4DTKA 1NW1A 2YZLA 5JK3A 5EH0A 3FHRA 4O0VA 5BX0A 2OFUA 5EW8A 3I1AA 4UWCA 4CMOA 2B53A 5HG5A 3RPYA 1YXSA 3FSKA 3QD4A 2C5XA 3FUPA 3NPCA 4BTFA 2YZAA 3FLSA 4X3FA 3DXPA 4YZ9A 5CSWA 4GSBA 3PPKA 5HBHA 3RNYA 3HX4A 2IZSA 3PRFA 2VWWA 4BICA 3DBCA 3NNVA 3C4ZA 4USFA 5AR2A 3F82A 2G2HA 3EQRA 5A4TA 4O0WA 4RC4A 3HEGA 3T3UA 2UW0A 3UO4A 2P33A 4IXPA 5M08A 3QALE 4YR8A 3AMBA 3HLLA 4O86A 5IQEA 4XEYA 1YKRA 4FZFB 3I0QA 3DAEA 4YZBA 2PULA 3LQ8A 3U55A 1OKYA 3RBWA 3PVWA 5HCZA 4ASXA 4DE4A 4I6LA 4R77A 4YZCA 3U9NA 4MF0A 4D0XA 5M4IA 4YMJA 1U54B 4I92A 5I4NA 4FTJA 5FEDA 2ZFYA 2UW8A 3OEZA 4ANBA 2H6DA 5BMMA 4JG7A 4S31A 5DRDA 3CR0A 3OC1A 5CU4A 4U79A 4U9AA 2OXYA 3Q4TA 4KA3A 1P14A 3OBJA 4WHZA 3E3PA 4XLVA 3QXOA 4O1PA 1YOLA 3LFEA 1GIHA 3WBLA 2QLUA 4WUAA 4IX5A 4OTIA 3PP1A 3UOHA 2B55A 2Y8OA 2VO6A 5KZIA 4ZTSA 4FTTA 4OGRA 3NUSA 3ZSHA 3LKMA 3OVVA 3A60A 4G16A 1ZY5A 3GU4A 3MTFA 5CQUA 5L6WL 1K2PA 1QPCA 4FTIA 3RWPA 4O27B 5C03A 5CEKA 1G8KA 3QHRA 2PVRA 4PNIA 5L4QA 4QMLA 1U5QA 2RFNA 4D58A 4FSUA 3ZM9A 3EQGA 4NSTA 3O8PA 3TL8A 1O6YA 4KIKB 4UB7A 3BEGA 4TWNA 4BDGA 4FIFA 1J7IA 5CEQA 3RM7A 5D41A 3AKKA 5AP7A 3EN9A 3THBA 3V01A 4JG8A 2WNTA 4FKSA 4ZZOA 4FZDB 3AC4A 3QU0A 1A9UA 4ZTNA 4U44A 3I7BA 4GIHA 2RG6A 5BVEA 2JGZA 2BFYA 2GFCA 5EKNA 4K77A 4U0IA 3D15A 4M13A 4D9UA 4MXYA 3BYVA 3ZRKA 1O6LA 2ZMCA 3MIAA 4PDYA 2XKDA 4J96A 4DH8A 5HLNA 4BWPA 3EFJA 2VO7A 3RALA 4ASEA 2BIYA 3CPBA 3KULB 5KX8A 2PUNA 2DUVA 2I0VA 3L8VA 4RJ3A 4JT3A 1OL1A 3UGCA 2C5NA 5HU9A 3ANQA 2R3LA 1ZOGA 2X4ZA 3UTOA 1XBBA 4BCKA 5KCVA 4HZRA 4DGGA 4BCJA 3C1XA 4FGRA 4QMOA 5IPJA 3RPOA 4TWCA 5FM3A 3OW3A 4WUNA 3TZ9A 1R0PA 3MIYA 4C38A 3VBWA 2W1CA 4G17A 4F9CA 2RGPA 4GT4A 4FG8A 5CX9A 4EOJA 2C0OA 4R5YA 1I09A 3ULZA 1MRUA 3F69A 4JIAA 4QMZA 3ORPA 5E8TA 3KRWA 4NCTC 4F70A 2R0IA 1M7NA 2IPXA 1UV5A 3DT1A 1UU8A 3QUEA 1XH5A 5AWMA 3OROA 5EI8A 5ICPA 4ZLYA 3C4CA 3S3IA 2BIKB 5CEPA 1PYEA 2PZIA 2WTWA 1YDTE 3UIXA 2XKFA 4F7SA 2OKRA 4M7IA 4UBAA 1WBTA 4HYHA 4NKSA 4TPTA 3TG1A 4C2WA 4E6QA 3OBGA 3QGYA 2B9JA 3D14A 4FKLA 1T45A 3FC2A 1F3MC 3IW7A 3ZO2A 3WILA 5DMZA 5DWRA 2YIQA 4EH9A 1GOLA 1JVPP 4ZZNA 4BVUA 5FTGA 4DH1A 4TWOA 2VN9A 5IQDA 3G6GA 4WKQA 4EWHA 3WF9A 3OCGA 1YXUA 4PV0A 2W4OA 4UMPA 5CF4A 3EQPA 4YU2A 4ZAUA 1Q97A 1RE8A 4D5KA 4O7TA 3N9XA 4Y46A 1LP4A 5M09A 4ZJJA 4RWJA 4OLIA 4F1OA 4G5JA 2CJMA 4QPAA 4K2RA 4OTHA 2HIWA 2F4JA 3ZSGA 1TQMA 4IACA 4OBOA 3AMAA 4RWLA 2C6DA 1MRVA 5KKRB 3DNDA 3GFWA 3GOKA 3V6RA 2P0CA 3LMHA 2HELA 5LWNA 3ZZEA 1APME 4FKIA 4M69A 4IEBA 3DZQA 3Q32A 1PXIA 2FSMX 2ESMA 2HW6A 3W10A 2OFVA 2C0IA 2VAGA 3GENA 4I22A 4FT9A 4KIPA 5CF8A 3ZBFA 1OZ1A 2WIPA 3O8TA 4U3ZA 2Z7QA 3V5LA 3Q2JA 3W0NA 3Q9WA 3UNJA 1MUOA 4PDPA 3WIKA 4U81A 4A9SA 3RAKA 3GI3A 3MH3A 4C61A 5EQPA 4X3FB 3CS9A 4DHZA 4USDA 3NVKI 3PIXA 4RFMA 3F61A 4HVGA 1SVGA 2X8EA 5CI6A 4EUUA 4TYEA 4U7ZA 3QQGA 5I5ZA 3U8WA