3ZFMA

Crystal structure of ephb2
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
279
structure length
248
Chain Sequence
EIDISCVKIEQVIFGEVCSGHLKLPGKREIFVAIKTLTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EPHRIN TYPE-B RECEPTOR 2
publication title Completing the Structural Family Portrait of the Human Ephb Tyrosine Kinase Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 248
sequence length 279
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zfmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zfmA01
4EK3A 4FIJA 1APME 4MKCA 3VW8A 2X7OA 4EH3A 3DLSA 4BCPA 1OGUA 2J0KA 3BU6A 3E8EA 4FTQA 1PXMA 5DWRA 2BILB 2JEDA 4NFMA 3ROCA 4YUQA 1U46A 2B9FA 2HK5A 5DEWA 3T3VA 2UZLA 4DG3E 3KU2A 1GOLA 2QG5A 2ZV7A 1K2PA 2WTKC 3BYVA 2H8HA 3V6SA 2BTSA 2UZBA 2VZ6A 3Q6UA 4RVLA 4JS8A 4FTAA 3EFJA 3EJ1A 2IW8A 3QUDA 4NTSA 4CG8A 2HELA 2CJMA 3Q52A 4O6LA 4DH8A 1J91A 2QOLA 4D2PA 4WD5A 3ZDIA 4LGDA 4EK4A 4C37A 3IECA 3QKKA 2YERA 4Q9SA 4S2ZA 4NM5A 5D41A 3LPBA 1OUKA 4CZYB 1YWVA 4K11A 5KMNA 4IWQA 5CSWA 4EONA 4AT4A 5EW3A 4FTIA 4CTBA 3R8MA 2OJJA 3D2KA 3HX4A 1OB3A 4FT9A 2G9XA 3TZMA 4ANLA 3N4UA 4O91A 2O64A 4DH3A 5DR6A 4JQEA 4L53A 3MESA 3B8QA 2G15A 2UW8A 4D5KA 2G2HA 3OXTA 3QTRA 2Y9QA 3DTWA 4J53A 3A60A 4G6LA 1GJOA 1J7UA 3RWQA 4AN3A 4FTJA 3NUNA 3RK7A 2VTSA 3ZO2A 4D4SA 5I4NA 2OLCA 1ZAOA 2P2HA 4XS2A 5EG3A 4ANBA 3E8DA 3ZSHA 4L45A 5G1XA 4UYNA 4YTFA 4LGHA 4D9TA 3LXKA 4ITIA 4DFXE 3A7HA 3CD8A 3WF7A 4O0VA 1STCE 2CGVA 3Q3BA 2V0DA 3OWPA 2CGWA 1JNKA 4GYIA 4C57A 5LQFA 2O0UA 1P14A 5D1JA 2WU7A 4JDJA 5HESA 4F70A 2EB3A 4WG3A 1UWJA 4F09A 5EW8A 1WAKA 4G5JA 4KA3A 4BTFA 3K5UA 2YLFA 4GH2A 2VTRA 1R3CA 5HCYA 5AWMA 2G01A 5I9YA 4MNEB 1QPDA 3O17A 3NIEA 4BGGA 2BTRA 4X0MA 3GFWA 4H3QA 1W8CA 4IB0A 3S95A 5EHOA 5F4NA 1IR3A 2YCRA 4C4EA 1YI6A 3OG7A 4FIFA 2GSFA 3BHYA 4KIQA 4EOLA 3VHEA 2ITOA 1UU9A 2NO3A 3QTWA 3P5KA 3GU4A 5AIKA 5AP3A 3D5VA 3V5JA 4Z7HA 1VZOA 4D5HA 2QLQA 4S34A 2X81A 3M11A 5CVFA 5FDPA 4O83A 2WMSA 2VGOA 1H01A 3MS9A 1GIHA 4IXPA 4L67A 3R2YA 4TYGA 4BIDA 2WFYA 3HVCA 5B2MA 2XA4A 3FPQA 1W84A 2XIYA 1ZMWA 2ZM1A 3IGOA 4IZ5A 4JG6A 1M2QA 2XNBA 4FKSA 1KE7A 3IDCA 5DEYA 4DEHA 3U54A 3ITZA 2ERZE 3NCGA 1XH7A 4KAOA 2ZM4A 1ZYJA 3ZRKA 4CTCA 4OT5A 5B2LA 1SNUA 4QMQA 4KBAA 5E8WA 3BE9A 4FV3A 4IEBA 5L2WA 2YLEA 3AC3A 3B2WA 4UN0C 1CM8A 3BLHA 2R7IA 3E7VA 4KIKB 3ZO3A 2EWAA 4E5AX 1Q24A 2HZ0A 2XK8A 4GJ3A 1NVRA 4J1RA 4XRLA 2ZYBA 3K5VA 4O0RA 4Y5QA 3R7UA 3VIDA 2YDKA 2X7FA 2JD5A 4U5JA 4RIOA 3SKCA 4F9AA 3PY0A 3E8NA 4HJOA 3UQFA 2H34A 4K77A 3PXYA 3AT3A 3OY1A 2WOUA 3I6UA 4CLJA 2QD9A 3W33A 3PSBA 4CFFA 3MJ2A 3ORMA 1SVHA 3VRZA 4JQ8A 3EB0A 1WZYA 2G2FA 4CCUA 3GFEA 3UVQA 1PXIA 5B0XA 4EHZA 2WXVA 3EHAA 4FKIA 2WMVA 3RM6A 2RL5A 3DB6A 4MBIA 1PKDA 2GHMA 5FBNC 5A4LA 5A6NA 2Z2WA 2R4BA 5CSXA 4XV3A 3RVGA 4PNIA 1Q62A 2WMBA 3UDBA 2R7BA 4I6HA 4RIXB 4RLKA 5HNGA 1Q97A 3DJ5A 4WT6A 4KSQA 4GUEA 3Q9ZA 4X2GA 2FGIA 5L2SA 2PZRA 3LFAA 4L3LA 4ID7A 4TYHA 4DGGA 2OXDA 4QTEA 5IUHA 1XH8A 4BI0A 3FY0A 4IAAA 1JKLA 1JAMA 4AOIA 4UMPA 3Q2MA 4E5WA 4KWPA 2QOIA 5I9ZA 4A9RA 4AZWA 2OF2A 3NNWA 3FLYA 5J87A 4MD8E 4YSMA 2XVDA 5E91A 5KE0A 1GIJA 3AMBA 1WFCA 4JDKA 3VVHA 5E4HA 4WOVA 2C30A 1KV2A 3ALOA 4FV1A 1T46A 2BAQA 4TN6A 5L8LA 4NT4A 3TV7A 2R3KA 5JMSA 3IS5A 3LCSA 5FM3A 5HNBA 3VF9A 2R3JA 3R1QA 1YI3A 1YKRA 1M17A 2X4FA 1OUYA 4IX4A 3RZFA 4F6SA 3NMUF 5B2KA 4ACHA 3FZRA 4RX9A 2W1FA 5HE0A 4K33A 2HCKA 4N57A 4E4MA 3D7ZA 3LCKA 4M84A 5BUEA 3QQUA 3WOWA 3U55A 4FTRA 3IG7A 1OL6A 3F61A 3CIKA 1H1QA 3KKVA 2X2MA 2YJSA 3I0OA 4EKLA 3ORXA 1R78A 3S1HA 3R83A 5KZ0A 1WVXA 4JR7A 1CKPA 1H25A 1I44A 3MPTA 4ZEGA 1AGWA 1H28A 3MYGA 5LARA 3TNQB 1OMWA 3A8WA 3FQEA 3FMJA 3A61A 3ORTA 5CEQA 3WILA 3ETAA 1M2PA 4O6EA 2VTMA 3GC8A 3UIXA 4ZTNA 4PX6A 5AX3A 4BDHA 4E4LA 1TKIA 4O82A 2B4SB 3R21A 4BIEA 3P08A 4ZTHA 4FKQA 3VBYA 4JNWA 5IH4A 2CLQA 1YDSE 1K3AA 2OZAA 2QQ7A 2XK9A 4BCKA 4BYJA 4QO9A 4FIIA 3FI2A 2B9JA 3HMIA 4FSWA 4QRCA 4AW2A 4WNKA 3VJOA 3QQFA 3EQFA 2YM8A 3QXPA 2QOHA 4FV7A 2BKKA 2WPAA 2PMIA 1JPAA 3IW4A 5HLPA 3W2RA 3A8XA 4IB3A 2ZV2A 4KIOA 3L8PA 2EUFB 1UU7A 4O1OA 4CFVA 4EBWA 3R63A 1FGIA 5H3QA 2JIUA 4FSQA 4QP4A 5C01A 2QO2A 3DU8A 4C2WA 2ZV9A 2DYLA 2VTOA 3PUPA 5ANDA 5CSVA 4DGMA 5JK3A 2VWYA 4FZ7A 2FSOX 3ZTXA 2GTMA 4AGDA 4YPDA 4O96A 4RFMA 3R7IA 2W9ZB 5DHJA 4AWIA 5E8TA 2QU6A 3OMVA 4MXOA 5D9HA 4HCTA 4YP8A 4C61A 5EFQA 2H6DA 4GRBA 4D28A 3Q5IA 4R3RA 2XIZA 3ORPA 4TRLA 4C58A 3LJ2A 3BLRA 4JDIA 5CAOA 4KKHA 5GINE 3QBNA 3BYOA 4LM5A 4GV1A 4DEGA 5TO8A 2C6KA 2ONLC 3VC4A 2QOOA 2V5QA 4P4CA 1G8SA 1L3RE 2KTYA 5ETAA 3QYWA 3UOJA 3NUPA 4K2RA 4TWNA 5L2QA 4BVUA 4E4NA 4FL1A 4O38A 3ENHA 4ZSLA 1Z5MA 3SOCA 2IZSA 2IZRA 2JFMA 1O9UA 1ZMUA 1E9HA 2I7QA 4M12A 5JEBA 2HY81 4A06A 2BZKB 4FKOA 4EJ7A 3QHRA 4FG9A 4G3CA 4NW5A 3V3VA 4JI9A 3OUKA 4ENYA 1J3HA 1R0EA 3AC4A 4CGAA 3SC1A 4F7NA 1SYKA 4FV4A 3PLAE 4ANQA 4II5A 2XNNA 1BL6A 3IW5A 3QLFA 4FKJA 4FV8A 2E9VA 2IWIA 4MQ1A 2YZLA 4ZMEA 4IX6A 3KXZA 4RJ5A 3BQCA 4BDDA 5AV4A 4HGLA 3BWFA 4IJPA 4LGGA 3BKBA 1H07A 3QGYA 4QP1A 3I7CA 1O6YA 1TQMA 3BBWA 2FB8A 3ZM4A 2YAAA 4C35A 4Z16A 2QVSE 4B99A 3SX9A 3D2IA 4QYFA 1CMKE 3D7TA 3AQVA 3PRFA 2J90A 2Y6OA 3CTJA 4F1MA 2J6MA 2W5AA 1UNHA 2C4GA 4RJ4A 1YW2A 5AM6A 1NW1A 1YHSA 2PYWA 4MTAA 5C8KA 3OCBA 4I4EA 3VQHA 5CZHA 4R8QA 2VWWA 4YGAA 4FUXA 3TIZA 2RFEA 4FIGA 3FMEA 5D7AA 1LPUA 2ITVA 4YC8A 2BZJA 3R8PA 4L68A 2R3IA 3GT8A 5AR3A 2WIPA 3ZLYA 3P0MA 5CQWA 5KHWA 5IQIA 3SW4A 5EHYA 2BHEA 4HPTE 1VEBA 3SXRA 1OIRA 3R1YA 3FI3A 2W1CA 3G2FA 4E73A 3GENA 4FT0A 4OTGA 4BTKA 4QPSA 4O7NA 1JSVA 4R6VA 3R1SA 3G6GA 1XQZA 4AT3A 1KUTA 3C4ZA 2FSMX 4CZUA 1BI8A 4DEIA 4NU1A 4FF8A 3R9RA 4RA5A 2HWOA 1SMHA 4D2WA 4BWXA 5FEEA 2BZIB 1E1XA 4YZBA 3LLAA 2VUWA 4TTHB 3KXHA 5L2TA 2ZDTA 5AEPA 4DFYA 3CQEA 4F1OA 5M08A 1IAHA 2VNWA 3H3CA 4PL5A 5CANA 5AX9A 5IISA 2HZNA 2YM3A 1ERKA 3UNZA 3FLZA 2R9SA 5FG8A 2C47A 2E9NA 4CRLA 1ZOEA 2VX0A 3K3JA 4YBJA 1PF8A 4EUUA 3D0EA 3AGLA 3ZC6A 4ZY6A 4TXCA 3KMMA 4EH8A 3SW7A 3AC5A 3MWUA 3BQRA 4PTEA 2C3IB 3AD4A 3CQWA 4XV9A 2PUNA 5KO1A 4D4YA 3ZZWA 5CAUA 4JG7A 3W8QA 4ZP5A 4TWOA 4HYIA 5EDRA 5CVGA 3CPCA 3S4QA 3BV3A 5E90A 5HTIA 3TACA 1A48A 3S3IA 3ZFYA 2GMXA 3O7LB 4K6ZA 3ZEPA 5BVDA 3ACKA 5EM7A 2WTWA 2OXYA 4ZTRA 3E8CA 3IGGA 5CLPA 3F2NA 2G1TA 5KHXA 4MBLA 3VS2A 4ZY4A 4CG9A 3OW4A 4O7VA 3L9MA 1UU3A 4V0GA 4ARKA 4F9BA 3O8UA 4R5SA 3FLSA 4QQJA 4BYIA 2RG5A 4DG2E 4QMTA 1FMKA 3DNDA 4I92A 3A99A 4FG8A 5HE1A 2QOFA 3G9NA 3F5XA 3BGQA 4L6QA 4ZSJA 3R30A 3ZUTA 4UMUA 4LRMA 2P0CA 1Y6BA 4E6CA 4LMNA 2CNQA 4BTJA 3O2MA 3MN3A 4O86A 3C4WA 3PSCA 3QTUA 4GUBA 5AUYA 4BDEA 4D0WA 4ANNA 4C34A 4FKLA 2F4JA 3G33A 3OS3A 3PA4A 2FH9A 4FNXA 4LOQA 3F7ZA 4AA5A 3BYSA 4NCTA 3LQ5A 4RJ7A 4ACDA 1IAJA 3F2RA 3I5ZA 4KIKA 1UNLA 3BI6A 5HE2A 4I6QA 4RIYB 4RVTA 4FZAB 4YJNA 3FEGA 3WIKA 5JFWA 5T3QA 4RJ3A 4EH2A 3FKOA 3MB6A 4W4WA 2W96B 4DT8A 4X3FB 4PUZA 5HZNA 4KSPA 4WRSA 3TNWA 1A06A 4DHFA 3TUDA 5BYLA 2RSVA 4JAJA 4WUAA 4IC8A 3TN8A 4GU6A 2B55A 3TWJA 3DKOA 3ZBXA 2ETKA 4HVHA 2IG7A 3U51A 3ATTA 4RA4A 3V5WA 1JKKA 4IWDA 3F5GA 4OTIA 1IEPA 1PXOA 3HUBA 4J96A 4YZCA 4D0XA 2LAVA 4YHJA 5A54A 3UO4A 4F7JA 4I24A 3MSSA 4IDVA 1UWHA 4L46A 4RIXA 1A9UA 2YZAA 3PG1A 3GQLA 2C1BA 4LRKA 2UVXA 2Y8OA 3LXNA 5AR2A 4EZ7A 5IEVA 2F2CB 5FRIA 2PSQA 2ITYA 3NW6A 3ZHPC 3FXZA 4A9UA 2GNLA 3FHRA 5EYMA 4EBVA 4J95A 2JDOA 3KVXA 4FT3A 3HMMA 1MP8A 4GFOA 3MTFA 4ONAA 4ANOA 1T45A 3LLTA 4IB1A 2V62A 3QRJA 4E6QA 4NW6A 2VO6A 1FINA 3UC3A 1SZMA 3DPKA 4NIFB 2GQGA 3ZFXA 4A4OA 4CFWA 3FPMA 4JDHA 4WG5A 5J9YA 1PKGA 3LKMA 2VTNA 5DVRA 3VRYA 3UYTA 5H8GA 3G0EA 3R8LA 1U5QA 3DZOA 3SXFA 4CT1A 2VWUA 5AIRA 4ASXA 2UVYA 2O2UA 3GBZA 4M0YA 4QPAA 3DA6A 3E87A 3OCSA 3OW3A 3G5DA 3G6HA 3Q4UA 4QTAA 5A3XA 4B9DA 5LJJA 3EQIA 2P3GX 4JL9A 3E5AA 3UBDA 4ZOGA 1IASA 1WVWA 2ZB1A 5KBRA 1NVSA 5E8VA 4LUEA 3WE4A 5CX9A 3R7GA 3ODYX 5I3OA 1U59A 3N9XA 2BALA 4OBPA 3WF9A 1H1RA 1KV1A 4AS0A 4GT4A 4C36A 5CEPA 3VS6A 2B54A 1ZWSA 4YZNA 1YDTE 5HTCA 2W9FB 2PULA 4BDCA 1QPCA 4IVDA 3D15A 4J52A 4BGHA 2QOQA 3GCQA 3TUBA 2E9OA 1Y91A 4R3PA 4IM3A 5FXSA 3FBVA 2PVHA 4F08A 1ZZ2A 4RFYA 4GMYA 4KINA 4BCQA 3TM0A 5I9UA 2IZTA 4I0RA 3HECA 3Q96A 2B0QA 5ITAA 1YRPA 2J0MB 4PTGA 2RIOA 4AGWA 3FYKX 4QYGA 3OD6X 3TNHA 3UTOA 3KQ7A 4CQEA 3DKCA 5CU4A 2XM8A 1PYXA 3QCYA 2Y0AA 1JKTA 3QRKA 4OTDA 3KRJA 3TT0A 1PXNA 3QQKA 3N4VA 1H1WA 4CMUA 5I9WA 1H1PA 4S33A 5EM5A 3BPRA 2XF0A 1FBNA 5E7RA 3DTCA 5IEXA 5HQ0A 4FKRA 4WBOA 3HUCA 2XP2A 2YIQA 3E63A 1KE6A 4JBPA 4U9AA 3ZCLA 1K9AA 3FKNA 3QZFA 5HI2A 4CRSA 1H00A 2X39A 3E7OA 1FVVA 3DBQA 3P9JA 5IQGA 2C5VA 4I5MA 4KB8A 3VUIA 5JZJA 4BR3A 4DH7A 3HP2A 5M57A 2JDRA 2VTPA 2WQOA 4L7SA 5J7BA 4DBXA 4YPSA 3C0IA 3A7GA 2UW9A 4MEDA 4ZZOA 3BWJA 3OCTA 3UIMA 4BTMA 3MY1A 4I5HA 4DFLA 3ACJA 4PY1A 2ITZA 5EYDA 3JYAA 4DITA 3UPZA 2UZOA 4I5PA 4FOCA 5HX6A 5M51A 3I4BA 1XH5A 3CXWA 5F94A 2YIRA 2HXQA 2JFLA 3FMNA 4NWMA 3T9TA 4QP7A 3B2TA 3RINA 5AAFA 3FZSA 5ANEA 4QP8A 3P7BA 5C27A 3R9OA 1MUOA 4BL1A 2PVMA 2I0YA 5IQHA 2OU7A 2BRBA 4S30A 5G6VA 4JBOA 3DAJA 4TYIA 2OFVA 3Q4CA 2GU8A 3R1NA 3HKOA 1W98A 3V8SA 3UODA 3HRCA 3RMFA 1JQHA 3W8LA 3E88A 2BCJA 4OAUC 3MFUA 3GEQA 2OI4X 4RSSA 5IQBA 4E1ZA 4GVAA 2C0IA 2WELA 4QNAA 2JKKA 3MVLA 3HL7A 3BYUA 4FGRA 2OBJA 4WRGA 2G2IA 1OL1A 4BDJA 3I5NA 3EQDA 3R04A 3H9OA 3R22A 3HMPA 2PHKA 4Y85A 4F1TA 5M07A 3DBEA 3DGKA 4AFJA 4TL0A 3UZTA 2ITNA 4N6ZA 4FEVA 5M56A 1REJA 1UVRA 2J5FA 3BRBA 3QYZA 2O65A 4XV2A 1DI9A 2A19B 1PMEA 2NRYA 3COIA 5A4TA 5KX8A 1M7QA 5E9EA 2GHLA 4UALA 4PQNA 2OH4A 2GNGA 4L42A 4GT3A 2CDZA 2QLUA 4RJ6A 5E8XA 2OSCA 2VTIA 2NRUA 3OROA 4BDKA 1RW8A 1J7LA 3Q53A 4CEGA 2W05A 2Z7SA 4H36A 4IE9A 3JY0A 1MQBA 3TKHA 4MXZA 4DH5A 1M7NA 4V01A 4UMRA 4U42A 4U40A 2V7OA 3DAKA 1Q99A 2WAJA 3OOMA 2ZVAA 4EOKA 3C5IA 1LEWA 3TL8A 1XBAA 2IW9A 1DAYA 4R1YA 5JFSA 3P78A 4RMZA 3IDPA 3P23A 1H27A 3UP7A 5LMKC 3VBWA 5D12A 3ODZX 1OIYA 5DRBA 1QMZA 3OEFX 2C5YA 2QU5A 5IQAA 4OR5A 1BI7A 2ITWA 4HYSA 2W99B 4PDSA 4QOXA 4EHVA 4TWCA 4PMMA 5L4QA 1MRYA 4JG8A 4GKHA 5BVWA 4RC2A 2F9GA 4FG7A 2X4ZA 3I7BA 1W0XC 1UV5A 3D4QA 3OP5A 3V5TA 5IKWA 4JR3A 2WQBA 4QP9A 4MWHA 3MDYA 5CEOA 2C1AA 2QC6A 4FNWA 2CN5A 4FBXA 5DFPA 5FEQA 3ZRLA 4ASZA 4USEA 4ZY5A 4ZSAA 2W1IA 4AZSA 2WMUA 5GHVA 5LVOA 4DFUA 3LM0A 1GZ8A 2EVAA 5ANOA 4D1ZA 4O7ZA 4DLJA 1XHAA 4WNMA 5AP4A 1OBDA 2ETRA 2XEZA 3MH3A 4V0GB 3JUHA 5EDPA 1OPLA 2R3PA 1OL5A 4DA5A 1MRUA 4XJ0A 3OUNB 4W9WA 4A4XA 2Q0NA 3HLLA 4UWCA 2VWIA 3DFAA 3U6JA 4O2ZA 4C4FA 2CNVA 4PDOA 3ZLWA 3D5UA 2X0GA 4GS6A 4L8MA 4MF1A 1Q61A 3E64A 4DGLC 2JBPA 2YM6A 4QMUA 3VJNA 5M4IA 4EYMA 4IADA 2FUMA 4LV5A 5AR8A 4QQTA 3TI1A 2CKOA 5JRSA 4XP2A 4FV5A 5I9XA 2VWXA 3BHUA 5AUUA 4NYEA 4IX5A 3GC0A 3DCVA 3EQBA 4FKVA 5AV0A 5HIEA 3JR1A 3I1AA 3KMWA 3R8UA 3DY7A 4HZRA 4Z7GA 4Y8DA 3PJ1A 3ZXZA 4R77A 1DI8A 2WOTA 2Y4IC 4FC0A 2PMNX 3DK7A 5M4UA 1YXUA 4QMLA 5H8BA 3MH1A 4W9XA 2QI8A 5DPVA 4E20A 2XMYA 1Y8YA 4NH1A 4NKAA 3DK6A 4AZTA 3QGWA 4QTDA 4F4PA 3BBTB 2XNMA 2VTHA 2AC3A 2VNYA 3QHWA 3RHXA 3WZDA 2R3HA 4FMQA 4D9UA 3P7AA 3C51A 2H9VA 1B39A 3PSDA 4RVKA 1URWA 1ZOHA 4IB5A 4FIEA 1ND4A 1WBTA 2YJRA 1OKWA 3PJ2A 1YOMA 3G0FA 4MXAA 3SRVB 4PMPA 5IQEA 1G3NA 3POZA 3RNYA 3UP2A 2WD1A 4UMTA 5I9VA 1PYEA 2WKMA 3PVWA 4PRJA 2GS6A 3D83A 4J8MA 4JOAA 1GIIA 5EHLA 4CMOA 4ERKA 5IA4A 3HAMA 4FEWA 4MHAA 5EM6A 4WKQA 1ZYSA 3N51A 2WIHA 4I23A 2VO7A 3MFRA 3MIYA 4RIYA 1IRKA 4QYEA 4X3JA 5CWZA 3ZXTA 4BKJA 4Q2AA 4PL3A 5AV3A 1QCFA 4O0YA 5DR2A 2Q0BA 2YHVA 4FIHA 3RI1A 2XEYA 3GU6A 4Y72A 3R9HA 4X3FA 4NTTA 3EFWA 1AQ1A 3DKFA 4RWLA 3TNPC 2ZDUA 3LXLA 4M0ZA 4BRXA 4PMTA 3DBCA 4UBAA 3W16A 2ERKA 2XBJA 3CCNA 3LOKA 3FLNC 2UZDA 5AP5A 4PDYA 2PZ5A 1GZOA 5EI8A 3EZRA 3OC1A 1W83A 3EN7A 3OOGA 4IZAA 5IEYA 3EL7A 2XNGA 4CKRA 1U5RA 2BROA 4WA9A 4YZ9A 1Q3WA 1VJYA 4BI1A 4CD0A 4XLIA 4NL0A 2R0IA 1Y8GA 5E8SA 4AG8A 5C4KA 3CC6A 3SG8A 4YZMA 5TR6A 3EIDA 3KC3A 4MF0A 2I40A 3BU3A 3VW6A 3FJQE 4YO4A 3QCQA 2RG6A 5J8IA 1J1CA 1ZZLA 4XBRA 4IW0A 4RT7A 3QD2B 1UA2A 5JQ8A 3C13A 1U4DA 4U7ZA 4O7YA 5BUIA 5FXRA 2GTNA 3ZRMA 2JAMA 5BQ0A 5J5TA 2ETMA 1OBGA 4D55A 3KXGA 4GSBA 5AFVA 4NUSA 4HVDA 3ZO1A 4BB4A 2JITA 2YWPA 4H1MA 4AXAA 1I09A 3QWJA 4BCIA 4IWOA 3PXKA 4EQMA 5TKDA 1FVRA 5AV1A 4Z3VA 1O6LA 3QUPA 4RC4A 4TYEA 2OK1A 5GJDA 4C4IA 3UOKA 4ALVA 3JVSA 4XRJA 4NIFA 2PPQA 2C69A 4FGBA 4XCUA 3R28A 3COHA 2BVAA 4DE4A 4O7LA 4I41A 2IJMA 3DDQA 1NVQA 3QX2A 3CJFA 2GNFA 3PRIA 4H3PA 1OKYA 2WTJA 2X7GA 4FKPA 5C4LA 2UW0A 3CLYA 3LAUA 3FL4A 2XUUA 5KNJA 3DB8A 4BWPA 2UW4A 2PE1A 3QD4A 4MAOA 2XK3A 5LMKA 5HU9A 5DA3A 1JSTA 4EOJA 4YLLA 1HCKA 5AP2A 5F9EA 1OL2A 5CVHA 3FQHA 5CEKA 3RZBA 3EL8A 3NX8A 1OVEA 2ESMA 3AC2A 2QKWB 4ZLZA 5DNRA 4C3PA 3QFVA 3D9VA 3FL5A 4YZDA 5DBXA 4B4LA 3OXIA 4V04A 4EHEA 1XBCA 4FL2A 4FSTA 4UB7A 5FQDC 2R3RA 1Y6AA 3HV5A 3KCKA 4FSYA 5IZFA 4FE2A 4Y83A 3GI3A 4M97A 2CKPA 2BRGA 5A4EA 3G51A 2X8IA 3KRXA 4L01A 2J50A 2YN8A 3G9LX 4ZTQA 2GHGA 5JRQA 4BZDA 3RP9A 1CTPE 3RAIA 4HPUE 3V5LA 4EL9A 5E8UA 3DXQA 3ALNA 2FSTX 4I6BA 2EXCX 3VULA 1YVJA 4MWIA 2ZOQA 3OY3A 4PP9A 2WMQA 3U9NA 4BC6A 3NIZA 5KKRB 2HYYA 4JRVA 4KRDA 4AN9A 4MH7A 2B7AA 1XBBA 4F65A 3FAAA 5ANKA 3FLWA 2GCDA 3Q4ZA 4NCTC 4KNBA 4OBQA 3UNKA 2QR8A 2C6IA 3KRWA 3O96A 4IVCA 4ZJJA 3R7VA 2AC5A 2YM5A 4XEYA 4DH1A 3O50A 3ENMA 5TF9A 3L9PA 3BEGA 2BKZA 4YHFA 4HW7A 4QQ5A 2I6LA 3BCEA 2OWBA 4YNOA 4QMNA 1QL6A 4QYYA 2XKDA 3FLQA 5KMJA 3Q5ZA 2CKEA 2PUPA 3ORNA 1H8FA 1E1VA 4RGJA 4KBCA 2ITXA 3H10A 1HCLA 4JBVA 4QPMA 4ACCA 4USFA 2VRXA 2R2PA 4KD1A 2F57A 4CCBA 2VO0A 1Q5KA 5CEIA 5BX0A 2C6TA 4HGTA 1YXXA 2PVKA 4YTIA 3ERKA 3MJ1A 3W10A 3CP9A 2UZTA 3NYNA 1ATPE 1GAGA 3RPOA 3VUTA 2C6EA 2HENA 2GDOA 5DT3A 2CGUA 5DG5A 4BCNA 2YISA 2GS2A 4XHKB 2XNPA 2C6OA 3EZVA 4PPAA 4E6DA 4RQVA 3O8TA 4K8AA 3VQUA 3PP1A 2Y4PA 3MY5A 3GB2A 5K3YA 2UUEA 3WF8A 4EOOA 2CNUA 5E8ZA 1YOJA 1Q3DA 2XYNA 3R73A 5CF8A 4APCA 1OIQA 4GL9A 2H96A 4J7BA 5FM2A 2PE0A 4L3PA 1YWRA 5EI2A 4CMTA 4AA4A 2WQNA 4B0GA 3SQQA 4IX3A 4FUYA 2QKRA 2WZJA 5CASA 1IG1A 4IANA 4YJTA 3AD5A 3JY9A 4OTFA 5AUWA 4MBJA 1J7IA 2C5XA 3K2LA 4GK4A 1B38A 4UYAA 2AUHA 3ZMMA 4BFMA 5CAPA 3A7JA 1PXJA 5FUTA 3PXFA 3UIBA 4HCVA 2F7EE 2YCSA 4U8ZA 3R7EA 4BDGA 4BBEA 5K5NA 3F5PA 4DTAA 3KF4A 4DFNA 1REKA 3A7IA 3H4JA 1FVTA 2BPMA 4IMYA 2XM9A 3PXZA 2VX1A 2WEIA 3UGCA 5I3RA 5M53A 2WHBA 4JIAA 4XBUA 1WBSA 2P55A 4G31A 2ZV8A 3NZ0A 4FEQA 3U6HA 4EH6A 3FHIA 4YR8A 4E26A 4U80A 1ZARA 4G17A 3F69A 4G2FA 4M67A 4U6RA 5F1ZA 4BGQA 4P90A 1MRVA 4EQCA 4FKTA 3UG2A 4CFMA 3P79A 3SOAA 5B7VA 3KCFA 2XIXA 2Y6MA 3QC9A 3FC1X 3IKAA 4YJVA 4AZVA 4BCGA 5AAEA 4FEUA 2WO6A 1OECA 2VD5A 4NZWB 4OW8A 4O7WA 5LOHA 3F82A 4C38A 2XCKA 3LJ0A 3HDNA 2CMWA 3KF7A 3MFSA 3ZFMA 2UW7A 2C3LA 4D2SA 3II5A 5EQYA 2JIIA 4I3ZA 4W4XA 3KULB 4FSMA 3Q32A 5K0XA 3S0OA 4MD9E 2WB8A 3AD6A 3BV2A 1PRYA 3V8TA 2CGXA 3SXSA 3QA0A 3R9DA 2LGCA 2R3GA 4CKIA 3H0YA 3UE4A 5TE0A 5EKNA 3KK9A 4V05A 3LCOA 3ULIA 1JBPE 3PYYA 4IFGA 4HCUA 5FLFA 5IA2A 5HVKA 4N70A 4WUNA 5ACKA 5CT7A 3FI4A 2RFNA 5BPYA 4E5BA 3JVRA 4IVBA 5C9CA 3TXOA 4I93A 2BDJA 2J2IB 4DAWA 4J97A 3UZPA 4YO6A 3RGFA 4RX5A 2R3OA 2A27A 4DYMA 5CNNA 2DQ7X 1NY3A 5DRDA 4DCAA 2XKFA 1YWNA 4FZ6A 4L3JA 2BRNA 4DFZE 2QCSA 4F0IA 3KN5A 3PE1A 3AG9A 4IFCA 5CYIA 5HG8A 3AT2A 5AM7A 1SNXA 4EOIA 1OPJA 4EORA 4R5YA 2YDIA 2CSNA 2W5HA 3ANRA 3VO3A 5LVMA 1PHKA 5K5XA 3WZJA 3ZO4A 4F63A 2BRHA 5AUXA 4HGEA 4ORKA 5J79A 3DJ7A 2J0LA 4EHGA 5CSPA 5M06A 2WTIA 2Z60A 3R02A 2ZB0A 4FNYA 3ZEWA 4RJ8A 2XNOA 3KN6A 4YJQA 3P1AA 2QR7A 2R3MA 3BYMA 4DEDA 4X2JA 2YITA 3NWWA 3F6XA 4U79A 2PTKA 4M7IA 3RTPA 4O7SA 2OJGA 4L52A 3EN5A 4OTQA 2ITPA 3H30A 5D7VA 3GQIA 4FTKA 3CR0A 3UO6A 1NA7A 1R1WA 4MXXA 3LZBA 3GXLA 4BZOA 3ATSA 3LQ3A 5JGDA 3NNXA 4F6UA 3NCZA 4A9TA 1LR4A 3LQ8A 4UZHA 3MA6A 5IH5A 3PIXA 3R01A 3IW8A 3RAKA 4U45A 4QMPA 2W7XA 4FICA 3A4OX 3PJ8A 4D2VA 3HDMA 3MVMA 4TNBA 4F7SA 4BBFA 5GZAA 4L00A 4UZDA 3SRVA 4JJRA 5EH0A 5LWNA 4OLIA 4YURA 5FTGA 3FE3A 2OKRA 4RRVA 2JDTA 1WBVA 2F7ZE 5FGKA 3RAHA 4GFGA 4XG3A 4M14A 3HV6A 4AOTA 4AUAA 4CYIA 5TOZA 3WZUA 5HE3A 1IA9A 5KUPA 2OW3A 4L44A 4C0TA 1SVEA 3C4EA 1BKXA 2C6MA 2PE2A 4QMYA 4D2RA 4G3DA 2OJIA 5HCXA 4FTNA 5BVFA 1LUFA 2O63A 2XRUA 3V01A 1KE8A 5K4JA 3VF8A 3FMKA 2QOCA 1WBWA 4PTCA 1ZYDA 3QTXA 3QU0A 5EK7A 2GNHA 4JXFA 4R7HA 2I1MA 4DTBA 3V5PA 3WIGA 1BYGA 3T9IA 3C1XA 3NNVA 3CSVA 4ZLOA 4R3CA 3VBVA 2WTCA 3G15A 1KE5A 3W2CA 1XO2B 3RALA 3RPYA 2WEVA 3ANQA 2W06A 5FBOA 4X6QC 3RWPA 2P2IA 3FMLA 5IDPA 3OWLA 3HZTA 1GZNA 2GQRA 3GU7A 3NSZA 4FTMA 3NW5A 4ZJVA 2J51A 3KL8A 4YTCA 4H39A 2BDWA 3BHHA 3TEIA 3DJ6A 3FMDA 4I4FA 5FXQA 2IPXA 3OWJA 4FOBA 4YLKA 4CFUA 4F9YA 4DTKA 1Q8ZA 3VUMA 4FTOA 2XK6A 3LFSA 1WBPA 4GEOA 1U54B 4RWJA 4PV0A 1RQQA 4E7WA 5LMBA 5KZIA 5ANJA 1FGKA 3BHTA 2W5BA 3P4KA 2IN6A 2R5TA 4O27B 4OTPA 4YJSA 5DI1A 3U87A 4ZXTA 3DXPA 4AGUA 1Q8UA 4UX9A 4AZEA 3BELA 4ALUA 2X8EA 3EN6A 4U97A 4TKSA 2C5OA 5DT0A 5L3AA 3OCGA 5CEMA 2F7XE 2HIWA 4RX8A 4JT3A 3UOHA 2J4ZA 4C4HA 1WBNA 3F3TA 4YSJA 3F66A 5DE2A 5E8YA 4EOQA 4PP7A 5KMLA 3HYHA 2XKCA 3AT4A 1Q41A 5AUTA 2BR1A 3CEKA 2QO9A 4UXLA 3LFDA 4HGSA 3LFFA 3R00A 2YFXA 2UZEA 2WU6A 1B6CB 2BFXA 5AJQA 1KE9A 3PA3A 1DM2A 1XH9A 3ID6C 4WO5A 3O51A 4C4GA 1BLXA 3GC7A 2YAKA 5I0BA 1LEZA 3MB7A 3TJCA 4GG7A 3LVPA 5BMMA 3TG1A 3COKA 1PY5A 2WMWA 4YMJA 5GIOE 4QMXA 4DFBA 4AW1A 3NUAA 3RK9A 4CZTA 5M4CA 5L2IA 3EQGA 3TDVA 3MFTA 4EI4A 2XZSA 4W8EA 5FDXA 3DT1A 3NUYA 3CPBA 3DDPA 4CLIA 3AMYA 2C3JA 5J1WA 4TWPA 4I0TA 3ZLSA 2B52A 3NRMA 3L9NA 4LI5A 5A4QA 2OGVA 4APPA 2B9HA 3CKXA 1XH6A 3GOPA 1OL7A 3BLQA 2QO7A 5JH6A 4K9YA 5LWMA 2QOBA 3L8XA 2C6DA 2DWBA 3F3WA 3ZC5A 3UO5A 5BVOA 2ZMCA 2V22A 3FQSA 4HVIA 2QURA 4XG9A 3ZH8A 3IDBA 3W2OA 4O0UA 5IMEA 2WGJA 1OKZA 4IQ6A 3C4FA 3RPRA 3D14A 3OTUA 3UC4A 2RGPA 3HV7A 3DV3A 5LCKA 3I79A 2HW6A 2W1EA 4GCJA 3RK5A 4MXYA 5IA5A 4D1XA 3C4XA 2YEXA 2JBOA 3A4PA 4EQUA 2VWBA 5FTQA 4BDAA 2J0IA 4AX8A 4FSUA 4FTTA 2ITQA 2PL0A 5KMKA 2W4JA 3IQ7A 2ITUA 4WBBB 4ERWA 4NEUA 4CV9A 4X3FC 4A7CA 3PA5A 3MIAA 1R39A 5DN3A 4U43A 3TV6A 4DF3A 5HGIA 3NYOA 3TTIA 3HGKA 1WBOA 4P5ZA 2PZYA 4ASEA 4K18A 3F9NA 2PUIA 4O7TA 4OUCA 1V0BA 3V51A 3MW1A 3QQLA 3QTQA 4XG7A 4YTHA 3VN9A 3LM5A 5AR7A 1Z57A 4I6FA 1H0WA 2OF4A 4O0WA 3PP0A 4C59A 4AF3A 2Q83A 4NKSA 2GS7A 3PLSA 1FOTA 3RHKA 1TQIA 2IVUA 4MNFA 4BKYA 4ANSA 3OFMA 5L6OA 5JFXA 2HZ4A 3UNJA 3UYSA 3ZUUA 4J71A 3HNGA 3R8VA 5DH3A 4QMWA 4CXAA 3TZ7A 4NM3A 3QWKA 4N0SA 2V55A 4F99A 3SVVA 4JX7A 2PWLA 4LUDA 4M15A 3FWQA 3QD0A 5CT0A 5CXHA 3UPXA 5HBJA 5CF4A 3NUSA 4R7IA 3JPVA 3NAXA 1P4FA 5AUZA 4ASDA 4QMZA 2XNEA 2VAGA 4HNIA 3EFKA 3M2WA 2XIRA 4JQ7A 2VGPA 3C4CA 3TZ9A 1X8BA 5GIPE 3FSKA 4UEUA 5BNJA 4DEBA 2CHLA 1F0QA 2QHNA 4TT7A 3PDTA 5CY3A 3IW7A 4QP3A 2W1HA 2GQSA 4ZZMA 3GVUA 1QPJA 2IVTA 4BWKA 4DCEA 1YOLA 3C7QA 5HKMA 4ZTMA 5HBHA 2IVSA 3PWYA 4Q5EA 5AR4A 1YXTA 5A4CA 4CVAA 4MK0A 5L6PA 4U44A 3QXOA 3TKUA 5JFVA 3FZTA 3UVRA 3Q04A 4RQKA 3CGFA 3O71A 2WMXA 4B7TA 3BGZA 3R7OA 2UVZA 3KGAA 4NM7A 3TKIA 4BDBA 4JX3A 4BKZA 4U41A 3QX4A 4ZAUA 2WNTA 3DOGA 2JIVA 1XH4A 3DLZA 3NNUA 3PXRA 2QONA 3COMA 1P5EA 3RCJA 4IVAA 2CPKE 5AR5A 2BAKA 4F0FA 3REPA 3EQHA 1FMOE 5ICPA 3ZDUA 1NT2A 2OG8A 2GFSA 3KULA 3KXNA 4PL4A 5AP1A 3KFAA 2XJ2A 3RJCA 4NJ3A 3OBJA 1Q8WA 4ITHA 1V0PA 4OTRA 2VO3A 3E93A 3FMMA 4ZK5A 3KEXA 3GGFA 4ZZNA 4H58A 3FZ1A 2VTAA 3KK8A 1H26A 5KMOA 3EKKA 2XCHA 4JRNA 4BHNA 2YABA 3KY2A 4LQMA 4ACGA 3ORLA 2Z7QA 2YIWA 3FKLA 2W0JA 5CAVA 2GNIA 4AU8A 5C1QB 3QKMA 5C26A 3UMXA 3DQWA 3RBWA 3PIYA 1OKVA 4EOPA 3JS2A 5IA3A 3SG9A 3TDWA 2AYPA 5BUJA 4Z55A 4IZYA 4IM0A 4RWIA 2O5KA 3PY3A 2QODA 1CSNA 3ZU7A 4B8LA 4F9WA 3OWKA 3HRFA 4CYJA 2UZVA 5JQ5A 5EQEA 5ETIA 3HAVA 2XK4A 4G6NA 5A9UA 4Y95A 4FSRA 5DT4A 3GCUA 4M13A 3WE8A 1QPEA 1H1SA 1XKKA 1F3MC 2X9EA 3PPJA 5HBEA 4BCHA 2E9UA 4I0SA 5CS6A 4CFNA 3HEGA 3BU5A 4Q5HA 2R64A 2PVNA 3W55A 4OTHA 4TZRA 5EQPA 5FWKK 2OIBA 5KBQA 3CE3A 3UQCA 2P33A 4NFNA 3LMIA 2I0EA 3AXWA 1G5SA 4LRJA 3TZ8A 4RG0A 4AP7A 3AGMA 3ZONA 2UW3A 4I1ZA 4OTWA 3S00A 3ORZA 3SV0A 5IU2A 4IIRA 3M42A 3D94A 3I0QA 2YCQA 4U3ZA 4ALWA 5BVNA 4EOMA 2WTDA 1PMVA 1R0PA 5CF6A 3WF6A 2RKUA 4G34A 4IAYA 3CTHA 4IHPA 2YIYA 3UOLA 3LXPA 4QP6A 3QRIA 3FV8A 5EW9A 2ZAZA 4GT5A 5KMIA 3FYJX 1P2AA 5F95A 4QMOA 5EKOA 1SVGA 1IA8A 2A1AB 4G9RA 1PXKA 4L7FA 2IO6A 4C7TA 2PU8A 2NNWB 3NUUA 3FDNA 2VN9A 4AZFA 2VTJA 4TW9A 4FK6A 4BN1A 4C4JA 4P5QA 4W4VA 4EH9A 5J95A 5IDNA 3C50A 1Z9XA 2IW6A 3IW6A 2PVFA 5E1SA 3BZ3A 4WHZA 3ZBFA 3T8OA 5HHWA 3E3PA 3PTGA 4K0YA 1URCA 3KRRA 1M52A 3MVHA 4PMSA 2VX3A 3ZZEA 4E4XA 3GNIB 4YJUA 3PJCA 3NAYA 5HCZA 4RFZA 4USDA 2WMAA 4I22A 3ELJA 3FZPA 3U4WA 4F9CA 1VYWA 5HLNA 4M69B 3EQCA 4BCFA 1ZXEA 4OBOA 1YXVA 4XP3A 2JDVA 4BZNA 4TY1A 3Q9XA 2BAJA 3CY3A 3WYXA 1OITA 4JIKA 3EMGA 4M3QA 4NK9A 5CXZA 3SGCA 4XLVA 4I21A 1ZRZA 5FD2A 2YWVA 1PXLA 2ITTA 4X7QA 4D4VA 2OIQA 3LHJA 3QLGA 2HY0A 3HRBA 4BCMA 4M68A 5AA9A 5FTOA 3D5WA 3M1SA 4FKWA 4J98A 4UWBA 3DQXA 4FR4A 5FEDA 1MQ4A 4QP2A 4F0GA 1ZYLA 5ETCA 3QQJA 4O84A 1Y57A 2OH0E 5AP7A 1YI4A 2OJFE 5HG7A 4AQCA 4EWHA 2B1PA 4DGNA 3L8VA 4G3FA 2BZHB 4G9CA 4ITJA 3E62A 3V5QA 4D2TA 4I5CA 1SM2A 5GZ8A 4C8BA 4N6YA 4EH7A 3OF0A 4PNKA 1U54A 4H3BA 4X21A 3PVBA 4IJ9A 5E92A 5H2UA 4JAIA 3SAYA 3QRTA 3T3UA 2VTTA 4Y46A 1H24A 5IH6A 4FKGA 4MYGA 5DGZA 2B9IA 2OZOA 4XG8A 3W1FA 4EEVA 3WBLA 3OZ6A 3QCXA 2X2LA 4FSNA 3VS4A 3C5UA 3FSFA 3NLBA 2XJ0A 2Z7LA 3QQGA 3QAME 3QC4A 4FK3A 3VBTA 3ZOSA 4O0XA 4YNEA 4PDPA 5M4FA 4IWPA 2X8DA 4GJ2A 3G90X 3WF5A 4FL3A 5C8MA 4BIBA 1OIUA 2JLDA 3HMNA 1PMNA 4BHZA 3PJ3A 3F3UA 3HA8A 2XB7A 3DK3A 3E3BX 3WYYA 3FZOA 3NDMA 3AOXA 4AFEA 4E6AA 3LE6A 4KABA 3KMUA 5JKGA 4QYHA 3FXXA 5LCJA 1UU8A 3IOKA 3MH0A 5ACBC 4IACA 5M44A 2C0OA 3DXNA 5CAQA 3EFLA 3GUBA 5HO7A 4FA2A 2PY3A 2I0HA 5GJFA 5HVJA 3PWDA 3LFBA 3ZS5A 2V7AA 2UV2A 3LMHA 4J8NA 2PK9A 2W1ZA 4W8DA 4NJDA 4C3FA 3GP0A 3QA8A 3NVKI 3Q6WA 4RLLA 3WARA 5BVEA 2IVVA 4Y73A 5M09A 3TUCA 1XR1A 5GZ9A 4A9YA 3FXWA 5DIAA 3NVMB 4QMSA 3VUGA 4FYNA 4YJRA 2GFCA 3ET7A 5T6KA 3UG1A 3PVUA 3R6XA 5D11A 4XOYA 4UWYA 3W32A 4WIHA 1ZYCA 2W1GA 4U0IA 3VBXA 5CU2A 5IUGA 4LFIA 3EQRA 5HICA 4E3CA 3OTVA 4BCJA 4AA0A 1KWPA 5EOLA 5IF1A 2ZM3A 4G3GA 3O7LD 4UXQA 4FI1A 2JKQA 4LL5A 1ZLTA 5LMAA 1CKIA 2X6DA 2REIA 4X2NA 4XOZA 2HWPA 4BF2A 4EH4A 5K4IA 3QTIA 4G6OA 4LG4A 3KXXA 3JXWA 4WNPA 5HO6A 5HIBA 3ROYA 4FSZA 4Q9ZA 4GG5A 4KIPA 1PXPA 2EXEA 3Q4TA 1AD5A 4XX9A 3THBA 2QG7A 3GCSA 3UIUA 5CU0A 4BI2A 4FTUA 4RIWB 4XH6A 4GK3A 4O0SA 4OAVB 2W17A 1CKJA 3P86A 3LFQA 3LFEA 4O21A 3PE2A 5BYYA 5K0KA 1F5QA 4RPVA 2WMTA 3QF9A 4QD6A 2NPQA 1DAWA 4EOSA 2ZJWA 1V1KA 3EYGA 3DAEA 5DOSA 3VS7A 4F7LA 5T68A 1GZKA 2X6EA 4AGCA 4IC7A 3Q9WA 4O1PA 4YJOA 3R8ZA 4AT5A 2VTLA 4G5PA 3LIJA 4IDTA 2W1DA 5C8NA 3KA0A 4AW0A 2XIKA 3H0ZA 4IAZA 4CV8A 1VYZA 3V6RA 5LVNA 1OI9A 1GY3A 2A2AA 4JLCA 4DEEA 2XBAA 2HOGA 3QCSA 4CT2A 1YHWA 3UJGA 3B8RA 2FVDA 2RFSA 4EKKA 3GU5A 2WQMA 1BMKA 3EOCA 3L1SA 4XG6A 4DGOA 5HG5A 5A14A 1RE8A 3V8WA 1FPUA 1Q8TA 5AUVA 1KOBA 3EN4A 3EKNA 3LW0A 4RBLA 4YBKA 4QMVA 2ACXA 1H0VA 4P2KA 4H1JA 3I81A 3VUKA 3CS9A 4QNYA 3AMAA 3I6WA 4RZWA 4X6RA 3QKLA 4FVRA 1HOWA 5IMXA 2XYUA 2O8YA 2YDJA 3QUEA 4YJPA 3OT3A 3UVPA 3EH9A 4RC3A 3W2SA 3R7YA 5DR9A 4JVGA 3VNTA 1EH4A 3VUHA 2XS0A 3VUDA 1Q8YA 3PPZA 2BRMA 4FNZA 4OGRA 4MXCA 5HEZA 3RPSA 4EK8A 5J5SA 1J1BA 2CN8A 1BX6A 1PMUA 2FO0A 3H9FA 4P7EA 4QT1A 2WTVA 2UZWE 4KRCA 3QZHA 4LV8A 5BMSA 4YLJA 5DLSA 3OXZA 3QALE 4CKJA 2YACA 2PVLA 3K54A 3AC8A 3Q2JA 4FV9A 4KKGA 4CFXA 1XJDA 2NP8A 2WMRA 3NW7A 5E1EA 4C2VA 3ZSGA 3EYHA 4YC3A 2KULA 3C9WA 3KVWA 3QZGA 5CZIA 3DFCB 1P4OA 3F88A 3H9RA 2A4LA 3SA0A 5IQCA 1KSWA 3HP5A 2R3NA 4IAFA 2I0VA 2XH5A 3F7WA 3QZIA 5CU6A 3DNEA 1KOAA 3NGAA 5HLWA 4J99A 3DZQA 4CNHA 2YIXA 1RJBA 3U4UA 3LMGA 3HV4A 2JAVA 5A46A 4ENXA 1UNGA 3A7FA 4EC9A 5AAGA 2W4KA 4YU2A 4FV6A 4DEAA 2RFDA 1JWHA 3MTLA 2XKEA 4FV0A 4XYFA 4MD7E 4QMMA 3F5UA 5IUIA 3VS3A 3TJDA 4E93A 3ORKA 4TPTA 5AADA 5KKRC 3ZM9A 5TT7A 4R1VA 2BUJA 4XP0A 4EZ5A 2CKQA 3HV3A 2UZUE 1S9JA 5KCVA 3K3IA 2PZIA 4IZ7A 3CKWA 4FTLA 2UZNA 4X2FA 3MVJA 3F3VA 4Z9LA 4ACMA 1JVPP 1OZ1A 3MV5A 4XMOA 4ZTSA 3NPCA 3F2AA 1JKSA 3MI9A 3W18A 4YHTA 3LCTA 5IPJA 4S31A 3WZEA 4DC2A 4I94A 4PPCA 2C6LA 4C33A 5HTBA 2GPHA 4MNEA 3BHVA 4F64A 5AP0A 4XUFA 3U6IA 5DYJA 2F49A 3OBGA 4HYUA 5CTPA 3EQPA 1ZOGA 5JZNA 3U9CA 3VHKA 4HYHA 4F6WA 3SDJA 3Q9YA 4O81A 4DLIA 4BICA 2W4OA 4KBKA 3FI8A 4FEXA 3BEAA 4FV2A 4AW5A 5EOBA 5IA0A 3ZLXA 2EXMA 5L8KA 5GNKA 2FYSA 4FT7A 2Y7JA 3KRLA 3MH2A 4AACA 1YHVA 4FT5A 4BDIA 5IQFA 2XRWA 5CI6A 2JDSA 3QRUA 3PZEA 4HNFA 2OXXA 2PZPA 2VU3A 5CSHA 3LFCA 2OIDA 3CD3A 3FUPA 4ZSEA 5HO8A 5HORA 5LVPA 3DBFA 3A2CA 1WVYA 2R3QA 3S2PA 3IO7A 3E92A 4NSTA 4QQCA 4ANMA 5HX8A 4HVSA 2PMLX 2PMOX 3TTJA 4FZFB 4EK5A 2R3FA 5LVLA 2Z02A 1YDRE 2BFYA 1JOWB 3W2PA 4ZS0A 2P4IA 4U3YA 3ZYAA 2J0JA 2X2KA 3F3ZA 4ZSGA 1M2RA 1XWSA 3OVVA 5ANIA 2VTQA 5AP6A 2ONLA 3CGOA 4PWNA 4EWQA 5K9IA 3PVGA 3GOKA 3MPMA 3O0GA 3R0TA 3TIYA 2C0TA 4G3EA 2X1NA 4UV0A 4RVMA 3R71A 1TQPA 4AE9A 4EJNA 2A0CX 4D1SA 3MBLA 3VBQA 4KS7A 4R7BA 3R9NA 2JGZA 3Q60A 2JKMA 3I60A 4TYHB 4BBMA 4LOOA 3QTZA 4A07A 5M55A 5AMNA 5JN2A 1W7HA 5LXMA 4DBNA 3KB7A 3N4TA 2QHMA 2OO8X 3GCVA 3NUXA 4XV1A 3BIZA 3WI6A 4E8AA 5EM8A 4K1BA 4M69A 4RZVA 1VR2A 2J5EA 4GW8A 4C62A 1M14A 2EB2A 3CY2A 3FMHA 4ZS4A 3GU8A 3QD3A 3R2BA 1BL7A 1H08A 1TVOA 5CQUA 3V04A 4A9SA 5L8JA 2BHHA 2C68A 4LMUA 4S32A 4X2KA 4H05A 5IQDA 2R3LA 4FKUA 2WTKB 2YA9A 4A4LA 4CSVA 3TNIA 3BE2A 3PXQA 4PPBA 3LJ1A 1JSUA 3W2QA 5AA8A 4GVJA 5HVYA 3VAPA 4AE6A 4LYNA 1UKHA 4M66A 4GYGA 1NXKA 2IZUA 3BGPA 4NM0A 4FVQA 4HVGA 5J9ZA 2BMCA 4O2PA 4G16A 5JT2A 2E2BA 4GK2A 2UW5A 3O23A 3NEWA 3C0GA 4FODA 4KUJA 2X9FA 1OPKA 3FY2A 3IPHA 3VS5A 1CDKA 4WSQA 3QQHA 3DBDA 3OHTA 2RF9A 3ORIA 3IOPA 4TYJA 2HW7A 4Y5HA 4WNOA 5EI6A 2R0UA 5AV2A 3LCDA 2Z7RA 4I20A 1OM1A 3KXMA 4WG4A 3OEZA 2BIYA 5HNIX 5CNOA 1RDQE 2WQEA 5EDQA 4OT6A 5D10A 4B8MA 2J7TA 2XJ1A 3BX5A 5HD7A 3RNIA 3EWHA 4EK6A 1JLUE 3A62A 1H4LA 5EYKA 4IAKA 4EH5A 2HZIA 2OZAB 4L9IA 3EN9A 3AC1A 2FA2A 3CTQA 3HA6A 1UKIA 3IK3A 3O8PA 3MA3A 3MY0A 2FSLX 4GIHA 4QTCA 4QTBA 5KMMA 4IAIA 3DS6A 5CU3A 5FP6A 5H9BA 4BCOA 5GJGA 2JC6A 3QTSA 1PW2A 3OT8A 4WSYA 5C03A 3TCPA 4PF4A 3WZKA 5CALA 3VS0A 2XK7A 5HOAA 4EC8A 2YCFA 2VV9A 5JGBA 2O3PA 2UW6A 2VWVA 4FTCA 5BYZA 3RAWA 1S9IA 3CQUA 4JBQA 4IM2A 4ZTLA 4DINA 1GNGA 1LP4A 5CI7A 4B6LA 4CQGA 4FVPA 4D4RA 5DMZA 3P7CA 1ZMVA 3CBLA 4ZJIA 3UQGA 1DS5A 4XNEA 3UMWA 1BUHA 2OICA 3ULZA 3UZRA 5EYCA 2HAKA 5J9LA 1ZY5A 4M8TA 5L6WL 4LOPA 4DT9A 2EU9A 1FQ1B 4N4SA 2OJ9A 5HIDA 4GU9A 2DS1A 5HU3A 2CCHA 4U81A 5ETFA 4AN2A 1L8TA 2ZMDA 5FP5A 1YXSA 3CJGA 2PVYA 3L8SA 1G8AA 5F20A 3MPAA 1W82A 3L9LA 4MVFA 3FC2A 4GFMA 3RPVA 3GCPA 3SLSA 3TV4A 5JGAA 4O0TA 1PJKA 1Q4LA 2GNJA 5A6OA 3HMOA 4FX3A 3QL8A 4BY9E 4KKEA 2BIKB 2YM7A 3RKBA 5JSMA 4IBMA 4HZSA 5CENA 4D58A 2B53A 4FZDB 2Z8CA 2PVJA 5IG1A 4LL0A 2BDFA 1YQJA 3IONA 3MGYA 3U8WA 3RCDA 4GKIA 2PUUA 4KS8A 4R78A 2DUVA 4C3RA 3PG3A 4ZIMA 2JKOA 3ZSIA 4EYJA 4EZ3A 5J1VA 3ZUVA 1V0OA 3PZHA 4TNDA 4IH8A 5IA1A 4XG4A 2Y4IB 3D5XA 2HXLA 4HOKA 4UMQA 3PPKA 3LFNA 5H8EA 1O6KA 2CLXA 2YM4A 3C0HA 3NYXA 3NR9A 3NYVA 4G1WA 4DG0E 5HG9A 2QOKA 5CF5A 4AAAA 2E9PA 4XG2A 3NS9A 2C5NA 2QNJA 3POOA 4C02A 3VWAA 4RIWA 1WCCA 1WMKA 5HD4A 2C3KA 2SRCA 2CCIA 4EUTA 4ZLYA 3PY1A 3PFQA 4L43A 4MQ2A 3SHEA 4MCVA 3SD0A 4UY9A 4BDFA 4O7RA 4YC6A 3PIZA 2F2UA 1ZY4A 3VS1A 4RWKA 5ANGA 2J9MA 3GC9A 4DN5A 5J7HA 4MX9A 3RM7A 4AOJA 2PVRA 2VWZA 3KREA 4W4YA 4RX7A 3D7TB 4O22A 3DKGA 4ZMFA 4GIIA 2OFUA 4FYOA 5I5ZA 5BVKA
chains in the Genus database with same CATH superfamily
4EK3A 4FIJA 1APME 4MKCA 3VW8A 2X7OA 4EH3A 3DLSA 4BCPA 1OGUA 2J0KA 3BU6A 3E8EA 4FTQA 1PXMA 5DWRA 2BILB 2JEDA 4NFMA 3ROCA 4YUQA 1U46A 2B9FA 2HK5A 5DEWA 3T3VA 2UZLA 4DG3E 3KU2A 1GOLA 2QG5A 2ZV7A 1TZDA 1K2PA 2WTKC 3BYVA 2H8HA 3V6SA 2BTSA 2UZBA 2VZ6A 3Q6UA 4RVLA 4JS8A 4FTAA 3EFJA 3EJ1A 2IW8A 3QUDA 4NTSA 4CG8A 2HELA 2CJMA 3Q52A 4O6LA 4DH8A 1J91A 2QOLA 4D2PA 4WD5A 3ZDIA 4LGDA 4EK4A 4C37A 3IECA 3QKKA 2YERA 4Q9SA 4S2ZA 4NM5A 5D41A 3LPBA 1OUKA 4CZYB 1YWVA 4K11A 5KMNA 4IWQA 5CSWA 4EONA 4AT4A 5EW3A 4FTIA 2XAMA 4CTBA 3R8MA 2X0QA 2OJJA 3D2KA 3HX4A 1OB3A 4FT9A 2G9XA 4QEBA 3TZMA 4ANLA 3N4UA 4O91A 2O64A 4DH3A 5DR6A 4JQEA 4L53A 3MESA 3B8QA 2G15A 2UW8A 4D5KA 2G2HA 3OXTA 3QTRA 2Y9QA 3DTWA 4J53A 3A60A 4G6LA 1GJOA 1J7UA 3RWQA 4AN3A 4FTJA 3NUNA 3RK7A 2VTSA 3ZO2A 4D4SA 5I4NA 2OLCA 1ZAOA 2P2HA 4XS2A 5EG3A 4ANBA 3E8DA 3ZSHA 4L45A 5G1XA 4UYNA 4YTFA 4LGHA 4D9TA 3LXKA 4ITIA 4DFXE 3A7HA 3CD8A 3WF7A 4O0VA 1STCE 2CGVA 3Q3BA 2V0DA 3OWPA 2CGWA 1JNKA 4GYIA 4C57A 5LQFA 2O0UA 1P14A 5D1JA 2WU7A 4JDJA 5HESA 4F70A 2EB3A 4WG3A 1UWJA 4F09A 5EW8A 1WAKA 4G5JA 4KA3A 4BTFA 3K5UA 2YLFA 4GH2A 2VTRA 1R3CA 5HCYA 5AWMA 2G01A 5I9YA 4MNEB 1QPDA 3O17A 3NIEA 4BGGA 2BTRA 4X0MA 3GFWA 1G8KA 4H3QA 1W8CA 4IB0A 3S95A 5EHOA 5F4NA 1IR3A 2YCRA 4C4EA 1YI6A 3OG7A 4FIFA 2GSFA 3BHYA 4KIQA 4EOLA 3VHEA 2ITOA 1UU9A 2NO3A 3QTWA 3P5KA 3GU4A 5AIKA 5AP3A 3D5VA 3V5JA 4Z7HA 1VZOA 4D5HA 2QLQA 4S34A 2X81A 3M11A 5CVFA 5FDPA 4O83A 2WMSA 2VGOA 1H01A 3MS9A 1GIHA 4IXPA 4L67A 3R2YA 4TYGA 4BIDA 2WFYA 3HVCA 5B2MA 2XA4A 3FPQA 1W84A 2XIYA 1ZMWA 2ZM1A 3IGOA 4IZ5A 4JG6A 1M2QA 2XNBA 4FKSA 1KE7A 3IDCA 5DEYA 4DEHA 3U54A 3ITZA 2ERZE 3NCGA 1XH7A 4KAOA 2ZM4A 1ZYJA 3ZRKA 4CTCA 4OT5A 5B2LA 1SNUA 4QMQA 4KBAA 5E8WA 3BE9A 4FV3A 4IEBA 5L2WA 2YLEA 3AC3A 3B2WA 4UN0C 1CM8A 3BLHA 2R7IA 3E7VA 4KIKB 3ZO3A 2EWAA 4E5AX 4QDEA 1Q24A 2HZ0A 2XK8A 4GJ3A 1NVRA 4J1RA 4XRLA 2ZYBA 3K5VA 4O0RA 4Y5QA 3R7UA 3VIDA 2YDKA 2X7FA 2JD5A 4U5JA 4RIOA 3SKCA 4F9AA 3W0RA 3PY0A 3E8NA 4HJOA 3UQFA 2H34A 4K77A 3PXYA 3AT3A 3OY1A 2WOUA 3I6UA 4CLJA 2QD9A 3W33A 3PSBA 4CFFA 3MJ2A 3ORMA 1SVHA 3VRZA 4JQ8A 3EB0A 1WZYA 2G2FA 4CCUA 3W0OA 3GFEA 3UVQA 1PXIA 5B0XA 4EHZA 2WXVA 3EHAA 4FKIA 2WMVA 3RM6A 2RL5A 3DB6A 4MBIA 1PKDA 2GHMA 5FBNC 5A4LA 5A6NA 2Z2WA 2R4BA 5CSXA 4XV3A 3RVGA 4PNIA 1Q62A 2WMBA 3UDBA 2R7BA 4I6HA 4RIXB 4RLKA 5HNGA 1Q97A 3DJ5A 4WT6A 4KSQA 4GUEA 3Q9ZA 4X2GA 2FGIA 5L2SA 2PZRA 3LFAA 4L3LA 4ID7A 4TYHA 4DGGA 2OXDA 4QTEA 5IUHA 1XH8A 4BI0A 3FY0A 4IAAA 1JKLA 1JAMA 4AOIA 4UMPA 3Q2MA 4E5WA 4KWPA 2QOIA 5I9ZA 3UDTA 4A9RA 4AZWA 2OF2A 3NNWA 3FLYA 5J87A 4MD8E 4YSMA 2XVDA 5E91A 5KE0A 1GIJA 3AMBA 1WFCA 4JDKA 3VVHA 5E4HA 4WOVA 2C30A 1KV2A 3ALOA 4FV1A 2XALA 1T46A 2BAQA 4TN6A 5L8LA 4NT4A 3TV7A 2R3KA 5JMSA 3IS5A 3LCSA 5FM3A 5HNBA 3VF9A 2R3JA 3R1QA 1YI3A 1YKRA 1M17A 2X4FA 1OUYA 4IX4A 3RZFA 4F6SA 3NMUF 5B2KA 4ACHA 3FZRA 4RX9A 2W1FA 5HE0A 4K33A 2HCKA 3BLAA 4N57A 4E4MA 3D7ZA 3LCKA 4M84A 5BUEA 3QQUA 3WOWA 3U55A 4FTRA 3IG7A 1OL6A 3F61A 3CIKA 1H1QA 3KKVA 3W0PA 2X2MA 2YJSA 3I0OA 4EKLA 3ORXA 1R78A 3S1HA 3R83A 5KZ0A 1WVXA 4JR7A 1CKPA 1H25A 1I44A 3MPTA 4ZEGA 1AGWA 1H28A 3MYGA 5LARA 3TNQB 1OMWA 3A8WA 3FQEA 3FMJA 3A61A 3ORTA 5CEQA 3WILA 3ETAA 4DDGA 1M2PA 4O6EA 2VTMA 3GC8A 3UIXA 4ZTNA 4PX6A 5AX3A 4BDHA 4E4LA 1TKIA 4O82A 2B4SB 3R21A 4BIEA 3P08A 4ZTHA 4FKQA 3VBYA 4JNWA 5IH4A 2CLQA 1YDSE 1K3AA 2OZAA 2QQ7A 2XK9A 4BCKA 4BYJA 4QO9A 4FIIA 3FI2A 2B9JA 3HMIA 4FSWA 4QRCA 4AW2A 4WNKA 3VJOA 3QQFA 3EQFA 2YM8A 3QXPA 2QOHA 4FV7A 2BKKA 2WPAA 2PMIA 1JPAA 3IW4A 5HLPA 3W2RA 3A8XA 4IB3A 2ZV2A 4KIOA 3L8PA 2EUFB 1UU7A 4O1OA 4CFVA 4EBWA 3R63A 1FGIA 5H3QA 2JIUA 4FSQA 4QP4A 5C01A 2QO2A 3DU8A 4C2WA 2ZV9A 2DYLA 2VTOA 3PUPA 5ANDA 5CSVA 4DGMA 5JK3A 2VWYA 4FZ7A 2FSOX 3ZTXA 2GTMA 4AGDA 4YPDA 4O96A 4RFMA 3R7IA 2W9ZB 5DHJA 4AWIA 5E8TA 2QU6A 3OMVA 4MXOA 5D9HA 4HCTA 4YP8A 4C61A 5EFQA 2H6DA 4GRBA 4D28A 3Q5IA 4R3RA 2XIZA 3ORPA 4TRLA 4C58A 3LJ2A 3BLRA 4JDIA 5CAOA 4KKHA 5GINE 3QBNA 3BYOA 4LM5A 4GV1A 4DEGA 5TO8A 2C6KA 2ONLC 3VC4A 2QOOA 3NFGB 2V5QA 4P4CA 1G8SA 1L3RE 2KTYA 5ETAA 3QYWA 3UOJA 3NUPA 4K2RA 4TWNA 5L2QA 4BVUA 4E4NA 4FL1A 4O38A 3ENHA 4ZSLA 1Z5MA 3SOCA 2IZSA 2IZRA 2JFMA 1O9UA 1ZMUA 1E9HA 2I7QA 4M12A 5JEBA 2HY81 4A06A 2BZKB 4FKOA 4EJ7A 3QHRA 4FG9A 4G3CA 4NW5A 3V3VA 4JI9A 3OUKA 4ENYA 3AC4A 1J3HA 1R0EA 4CGAA 1W2CA 3SC1A 4AQKA 4F7NA 1SYKA 4FV4A 3PLAE 4ANQA 4II5A 2XNNA 1BL6A 3IW5A 3QLFA 4FKJA 4FV8A 2E9VA 2IWIA 4MQ1A 2YZLA 4ZMEA 4IX6A 3KXZA 4RJ5A 3BQCA 4BDDA 5AV4A 4HGLA 3BWFA 4IJPA 4LGGA 3BKBA 1H07A 3QGYA 4QP1A 3I7CA 1O6YA 1TQMA 3BBWA 2FB8A 3ZM4A 2YAAA 4C35A 4Z16A 2QVSE 4B99A 3SX9A 3D2IA 4QYFA 1CMKE 3D7TA 3AQVA 3PRFA 2J90A 2Y6OA 3CTJA 4F1MA 2J6MA 2W5AA 1UNHA 2C4GA 4RJ4A 1YW2A 5AM6A 1NW1A 1YHSA 2PYWA 4MTAA 5C8KA 3OCBA 4I4EA 3VQHA 5CZHA 4R8QA 2VWWA 4YGAA 4FUXA 3TIZA 2RFEA 4FIGA 3FMEA 5D7AA 4LV7A 1LPUA 2ITVA 4YC8A 2BZJA 3R8PA 4L68A 2R3IA 3GT8A 5AR3A 2WIPA 3ZLYA 3P0MA 5CQWA 5KHWA 5IQIA 3SW4A 5EHYA 2BHEA 4HPTE 1VEBA 3SXRA 1OIRA 3R1YA 3FI3A 2W1CA 3G2FA 4FRFA 3GENA 4FT0A 4E73A 4OTGA 4BTKA 4QPSA 4O7NA 1JSVA 4R6VA 3R1SA 3G6GA 1XQZA 4AT3A 1KUTA 3C4ZA 2FSMX 4CZUA 1BI8A 4DEIA 4NU1A 4FF8A 3R9RA 4RA5A 2HWOA 1SMHA 4D2WA 4BWXA 5FEEA 2BZIB 1E1XA 4YZBA 3LLAA 2VUWA 4TTHB 3KXHA 5L2TA 2ZDTA 5AEPA 4DFYA 3CQEA 4F1OA 5M08A 1IAHA 2VNWA 3H3CA 4PL5A 5CANA 5AX9A 5IISA 2HZNA 2YM3A 1ERKA 3UNZA 3FLZA 2R9SA 5FG8A 2C47A 2E9NA 4CRLA 1ZOEA 2VX0A 3K3JA 4YBJA 1PF8A 4EUUA 3D0EA 3AGLA 3ZC6A 4ZY6A 4TXCA 3KMMA 4EH8A 3SW7A 3AC5A 3MWUA 3O5AA 3BQRA 4PTEA 2C3IB 3AD4A 3CQWA 4XV9A 2PUNA 5KO1A 4D4YA 3ZZWA 5CAUA 4JG7A 3W8QA 4ZP5A 4TWOA 4HYIA 5EDRA 5CVGA 3CPCA 3S4QA 3BV3A 5E90A 5HTIA 3TACA 1A48A 3S3IA 3ZFYA 2GMXA 3O7LB 4K6ZA 3ZEPA 5BVDA 3ACKA 5EM7A 2WTWA 2OXYA 4ZTRA 3E8CA 3IGGA 5CLPA 3F2NA 2G1TA 5KHXA 4MBLA 3VS2A 4ZY4A 4CG9A 3OW4A 4O7VA 3L9MA 1UU3A 4V0GA 4ARKA 4F9BA 3O8UA 4R5SA 3FLSA 4QQJA 4BYIA 2RG5A 4DG2E 4QMTA 1FMKA 3DNDA 4I92A 3A99A 4FG8A 5HE1A 2QOFA 3G9NA 3F5XA 3BGQA 4L6QA 4ZSJA 3R30A 3ZUTA 4UMUA 4LRMA 2P0CA 1Y6BA 4E6CA 4LMNA 2CNQA 4BTJA 3O2MA 3MN3A 4O86A 3C4WA 3PSCA 3QTUA 4GUBA 5AUYA 4BDEA 4D0WA 4ANNA 4C34A 4FKLA 2F4JA 3G33A 3OS3A 3PA4A 2FH9A 4FNXA 4LOQA 3F7ZA 4AA5A 3BYSA 4NCTA 3LQ5A 4RJ7A 4ACDA 1IAJA 3F2RA 3I5ZA 4KIKA 1UNLA 3BI6A 5HE2A 4I6QA 4RIYB 4RVTA 4FZAB 4YJNA 3FEGA 3WIKA 5JFWA 5T3QA 4RJ3A 4EH2A 3FKOA 3MB6A 4W4WA 2W96B 4DT8A 4X3FB 4PUZA 5HZNA 4KSPA 4WRSA 3TNWA 1A06A 4DHFA 3TUDA 5BYLA 2RSVA 4JAJA 4WUAA 4IC8A 3TN8A 4GU6A 2B55A 3TWJA 3DKOA 3ZBXA 2ETKA 4HVHA 2IG7A 3U51A 3ATTA 4RA4A 3V5WA 1JKKA 4IWDA 3F5GA 4OTIA 1IEPA 1PXOA 3HUBA 4J96A 4YZCA 4D0XA 2LAVA 4YHJA 5A54A 3UO4A 4F7JA 4I24A 3MSSA 4IDVA 1UWHA 4L46A 4RIXA 1A9UA 2YZAA 3PG1A 3GQLA 2C1BA 4LRKA 2UVXA 2Y8OA 3LXNA 5AR2A 4EZ7A 5IEVA 2F2CB 5FRIA 2PSQA 2ITYA 3NW6A 3ZHPC 3FXZA 4A9UA 2GNLA 3FHRA 5EYMA 4EBVA 4J95A 2JDOA 3KVXA 4FT3A 3HMMA 1MP8A 4GFOA 3MTFA 4ONAA 4ANOA 1T45A 3LLTA 4IB1A 2V62A 3QRJA 4E6QA 4NW6A 2VO6A 1FINA 3UC3A 1SZMA 3DPKA 4NIFB 2GQGA 3ZFXA 4A4OA 4CFWA 3FPMA 4JDHA 4WG5A 5J9YA 1PKGA 3LKMA 2VTNA 5DVRA 3VRYA 3UYTA 5H8GA 3G0EA 3R8LA 1U5QA 3DZOA 3SXFA 4CT1A 2VWUA 5AIRA 4ASXA 2UVYA 2O2UA 3GBZA 4M0YA 4QPAA 3DA6A 3E87A 3OCSA 3OW3A 3G5DA 3G6HA 3Q4UA 4QTAA 5A3XA 4B9DA 5LJJA 3EQIA 2P3GX 4JL9A 3E5AA 3UBDA 4ZOGA 1IASA 1WVWA 2ZB1A 5KBRA 1NVSA 5E8VA 4LUEA 3WE4A 5CX9A 3R7GA 3ODYX 5I3OA 1U59A 3N9XA 2BALA 4OBPA 3WF9A 1H1RA 1KV1A 4AS0A 4GT4A 4C36A 5CEPA 3VS6A 2B54A 1ZWSA 4YZNA 1YDTE 5HTCA 4LDTA 2W9FB 2PULA 4BDCA 1QPCA 4IVDA 1W2DA 3D15A 4J52A 4BGHA 2QOQA 3GCQA 3TUBA 2E9OA 1Y91A 4R3PA 4IM3A 5FXSA 3FBVA 2PVHA 4F08A 1ZZ2A 4RFYA 4GMYA 4KINA 4BCQA 3TM0A 5I9UA 2IZTA 4I0RA 3HECA 3Q96A 2B0QA 5ITAA 1YRPA 2J0MB 4PTGA 2RIOA 4AGWA 3FYKX 4QYGA 3OD6X 3TNHA 3UTOA 3KQ7A 4CQEA 3DKCA 5CU4A 2XM8A 1PYXA 3QCYA 2Y0AA 1JKTA 3QRKA 4OTDA 3KRJA 3TT0A 1PXNA 3QQKA 3N4VA 1H1WA 4CMUA 5I9WA 1H1PA 4S33A 5EM5A 3BPRA 2XF0A 1FBNA 5E7RA 1ST4A 3DTCA 5IEXA 5HQ0A 4FKRA 4WBOA 3HUCA 2XP2A 2YIQA 3E63A 1KE6A 4JBPA 4U9AA 3ZCLA 1K9AA 3FKNA 3QZFA 5HI2A 4CRSA 1H00A 2X39A 3E7OA 1FVVA 3DBQA 3P9JA 5IQGA 2C5VA 4I5MA 4KB8A 3VUIA 5JZJA 4BR3A 4DH7A 3HP2A 5M57A 2JDRA 2VTPA 2WQOA 4L7SA 5J7BA 4DBXA 4YPSA 3C0IA 3A7GA 2UW9A 4MEDA 4ZZOA 3BWJA 3OCTA 3UIMA 4BTMA 3MY1A 4I5HA 4DFLA 3ACJA 4PY1A 2ITZA 5EYDA 3JYAA 4DITA 3UPZA 2UZOA 4I5PA 4FOCA 5HX6A 5M51A 3I4BA 1XH5A 3PFYA 3CXWA 5F94A 2YIRA 2HXQA 2JFLA 3FMNA 4NWMA 3T9TA 4QP7A 3B2TA 3RINA 5AAFA 3FZSA 5ANEA 4QP8A 3P7BA 5C27A 3R9OA 1MUOA 4BL1A 2PVMA 2I0YA 5IQHA 2OU7A 2BRBA 4S30A 5G6VA 4JBOA 3DAJA 4TYIA 2OFVA 3Q4CA 2GU8A 3R1NA 3HKOA 1W98A 3V8SA 3UODA 3HRCA 3RMFA 1JQHA 3W8LA 4AXDA 3E88A 2BCJA 4OAUC 3MFUA 3GEQA 2OI4X 4RSSA 5IQBA 4E1ZA 4GVAA 2C0IA 2WELA 4QNAA 2JKKA 3MVLA 3HL7A 3W0QA 3BYUA 4FGRA 2OBJA 4WRGA 2G2IA 1OL1A 4BDJA 3I5NA 3EQDA 3R04A 3H9OA 3R22A 3HMPA 2PHKA 4Y85A 4F1TA 5M07A 3DBEA 3DGKA 4AFJA 4TL0A 3UZTA 2ITNA 4N6ZA 4FEVA 5M56A 1REJA 1UVRA 2J5FA 3BRBA 3QYZA 2O65A 4XV2A 1DI9A 2A19B 1PMEA 2NRYA 3COIA 5A4TA 5KX8A 1M7QA 5E9EA 2GHLA 4UALA 4PQNA 2OH4A 2GNGA 4L42A 4GT3A 2CDZA 2QLUA 4RJ6A 5E8XA 2OSCA 2VTIA 2NRUA 3OROA 4BDKA 1RW8A 1J7LA 3Q53A 4CEGA 2W05A 2Z7SA 4H36A 4IE9A 4I6LA 3JY0A 1MQBA 3TKHA 4MXZA 4DH5A 1M7NA 4V01A 4UMRA 4U42A 4U40A 2V7OA 3DAKA 1Q99A 2WAJA 3OOMA 2ZVAA 4EOKA 3C5IA 1LEWA 3TL8A 1XBAA 2IW9A 1DAYA 4R1YA 5JFSA 3P78A 3TMOA 4RMZA 3IDPA 3P23A 1H27A 3UP7A 5LMKC 3VBWA 5D12A 3ODZX 1OIYA 5DRBA 1QMZA 3OEFX 2C5YA 2QU5A 5IQAA 4OR5A 1BI7A 2ITWA 4HYSA 2W99B 4PDSA 4QOXA 4EHVA 4TWCA 4PMMA 5L4QA 1MRYA 4JG8A 4GKHA 1G8JA 5BVWA 4RC2A 2F9GA 4FG7A 2X4ZA 3I7BA 1W0XC 1UV5A 3D4QA 3OP5A 3V5TA 5IKWA 4JR3A 2WQBA 4QP9A 4MWHA 3MDYA 5CEOA 2C1AA 2QC6A 4FNWA 2CN5A 4FBXA 5DFPA 5FEQA 3ZRLA 4ASZA 4USEA 4ZY5A 4ZSAA 2W1IA 4AZSA 2WMUA 5GHVA 5LVOA 4DFUA 3LM0A 1GZ8A 2EVAA 5ANOA 4QDVA 4D1ZA 4O7ZA 4DLJA 1XHAA 4WNMA 5AP4A 1OBDA 2ETRA 2XEZA 3MH3A 4V0GB 3JUHA 5EDPA 1OPLA 2R3PA 1OL5A 4DA5A 1MRUA 4XJ0A 3OUNB 4W9WA 4A4XA 2Q0NA 3HLLA 4UWCA 2VWIA 3DFAA 3U6JA 4O2ZA 4C4FA 2CNVA 4PDOA 3ZLWA 3D5UA 2X0GA 4GS6A 4L8MA 4MF1A 1Q61A 3E64A 4DGLC 2JBPA 2YM6A 4QMUA 3VJNA 5M4IA 4EYMA 4IADA 2FUMA 4LV5A 5AR8A 4QQTA 3TI1A 2CKOA 5JRSA 4XP2A 4FV5A 5I9XA 2VWXA 3BHUA 5AUUA 4NYEA 4IX5A 3GC0A 3DCVA 3EQBA 4FKVA 5AV0A 5HIEA 3JR1A 3I1AA 3KMWA 3R8UA 3DY7A 4HZRA 4Z7GA 3UDSA 4Y8DA 3PJ1A 3ZXZA 4R77A 1DI8A 2WOTA 2Y4IC 4FC0A 2PMNX 3DK7A 5M4UA 1YXUA 4QMLA 5H8BA 3MH1A 4W9XA 2QI8A 5DPVA 4E20A 2XMYA 1Y8YA 4NH1A 4NKAA 3DK6A 4AZTA 3QGWA 4QTDA 4F4PA 3BBTB 2XNMA 2VTHA 2AC3A 2VNYA 3QHWA 3RHXA 3WZDA 2R3HA 4FMQA 4D9UA 3P7AA 3C51A 2H9VA 1B39A 3PSDA 4RVKA 1URWA 1ZOHA 4IB5A 4FIEA 1ND4A 1WBTA 2YJRA 1OKWA 3PJ2A 1YOMA 3G0FA 4MXAA 3SRVB 4PMPA 5IQEA 1G3NA 2X0OA 3POZA 3RNYA 3UP2A 2WD1A 4UMTA 5I9VA 1PYEA 2WKMA 3PVWA 4PRJA 2GS6A 3D83A 4J8MA 4JOAA 1GIIA 5EHLA 4CMOA 4ERKA 5IA4A 3HAMA 4FEWA 4MHAA 5EM6A 4WKQA 1ZYSA 3N51A 2WIHA 4I23A 2VO7A 3MFRA 3MIYA 4RIYA 1IRKA 4QYEA 4X3JA 5CWZA 3ZXTA 4BKJA 4Q2AA 4PL3A 5AV3A 1QCFA 4O0YA 5DR2A 2Q0BA 2YHVA 4FIHA 1VLRA 3RI1A 2XEYA 3GU6A 4Y72A 3R9HA 4X3FA 4NTTA 3EFWA 1AQ1A 3DKFA 4RWLA 3TNPC 2ZDUA 3LXLA 4M0ZA 4BRXA 4PMTA 3DBCA 4UBAA 3W16A 2ERKA 2XBJA 3CCNA 3LOKA 3FLNC 2UZDA 5AP5A 4PDYA 2PZ5A 1GZOA 5EI8A 3EZRA 3OC1A 1W83A 3EN7A 3OOGA 4IZAA 5IEYA 3EL7A 2XNGA 4CKRA 1U5RA 2BROA 4WA9A 4YZ9A 1Q3WA 1VJYA 4BI1A 4CD0A 4XLIA 4NL0A 2R0IA 1Y8GA 5E8SA 4AG8A 5C4KA 3CC6A 3SG8A 4YZMA 5TR6A 3EIDA 3KC3A 4MF0A 2I40A 3BU3A 3VW6A 3FJQE 4YO4A 3QCQA 2RG6A 5J8IA 1J1CA 1ZZLA 4XBRA 4IW0A 1ST0A 4RT7A 3QD2B 1UA2A 5JQ8A 3C13A 1U4DA 4U7ZA 4O7YA 5BUIA 5FXRA 2GTNA 3ZRMA 2JAMA 5BQ0A 5J5TA 2ETMA 1OBGA 4D55A 3KXGA 4GSBA 5AFVA 4NUSA 4HVDA 3ZO1A 4BB4A 2JITA 2YWPA 4H1MA 4AXAA 1I09A 3QWJA 4BCIA 4IWOA 5BV3A 3PXKA 4EQMA 5TKDA 1FVRA 5AV1A 4Z3VA 1O6LA 3QUPA 4RC4A 4TYEA 2OK1A 5GJDA 4C4IA 3UOKA 4ALVA 3JVSA 4XRJA 4NIFA 2PPQA 2C69A 4FGBA 4XCUA 3R28A 3COHA 2BVAA 4DE4A 4O7LA 4I41A 2IJMA 3DDQA 1NVQA 3QX2A 3CJFA 2GNFA 3PRIA 4H3PA 1OKYA 2WTJA 2X7GA 4FKPA 5C4LA 2UW0A 3CLYA 3LAUA 3FL4A 2XUUA 5KNJA 3DB8A 5KMMA 4BWPA 2UW4A 2PE1A 3QD4A 4MAOA 2XK3A 5LMKA 5HU9A 5DA3A 1JSTA 4EOJA 4YLLA 1HCKA 5AP2A 5F9EA 1OL2A 5CVHA 3FQHA 5CEKA 3RZBA 3EL8A 3NX8A 1OVEA 2ESMA 3AC2A 2QKWB 4ZLZA 5DNRA 4C3PA 3QFVA 3D9VA 3FL5A 4YZDA 5DBXA 4B4LA 3OXIA 4V04A 4EHEA 1XBCA 4FL2A 4FSTA 4UB7A 5FQDC 2R3RA 1Y6AA 3HV5A 3KCKA 4FSYA 5IZFA 4FE2A 4Y83A 3GI3A 4M97A 2CKPA 2BRGA 5A4EA 3G51A 2X8IA 3KRXA 4L01A 2J50A 2YN8A 3G9LX 4ZTQA 2GHGA 5JRQA 4BZDA 3RP9A 1CTPE 3RAIA 4HPUE 3V5LA 4EL9A 5E8UA 3DXQA 3ALNA 2FSTX 4I6BA 2EXCX 3VULA 1YVJA 4MWIA 2ZOQA 3OY3A 4PP9A 2WMQA 3U9NA 4BC6A 3NIZA 5KKRB 2HYYA 4JRVA 4KRDA 4AN9A 4MH7A 2B7AA 1XBBA 4F65A 3FAAA 5ANKA 3FLWA 2GCDA 3Q4ZA 4NCTC 4KNBA 4OBQA 3UNKA 2QR8A 2C6IA 3KRWA 3O96A 4IVCA 4ZJJA 3R7VA 2AC5A 2YM5A 4XEYA 4DH1A 3O50A 3ENMA 5TF9A 3L9PA 3BEGA 2BKZA 4YHFA 4HW7A 4QQ5A 2I6LA 3BCEA 2OWBA 4YNOA 4QMNA 1QL6A 4QYYA 2XKDA 3FLQA 5KMJA 3Q5ZA 2CKEA 2PUPA 3ORNA 1H8FA 1E1VA 4RGJA 4KBCA 2ITXA 3H10A 1HCLA 4JBVA 4QPMA 4ACCA 3AKJA 4USFA 2VRXA 2R2PA 4KD1A 2F57A 4CCBA 2VO0A 1Q5KA 5CEIA 5BX0A 2C6TA 4HGTA 1YXXA 2PVKA 4YTIA 3ERKA 3MJ1A 3W10A 3CP9A 2UZTA 3NYNA 1ATPE 1GAGA 3RPOA 3VUTA 2C6EA 2HENA 2GDOA 5DT3A 2CGUA 5DG5A 4BCNA 2YISA 2GS2A 4XHKB 2XNPA 2C6OA 3EZVA 4PPAA 4E6DA 4RQVA 3O8TA 4K8AA 3VQUA 3PP1A 2Y4PA 3MY5A 3GB2A 5K3YA 2UUEA 3WF8A 4EOOA 2CNUA 5E8ZA 1YOJA 1Q3DA 2XYNA 3R73A 5CF8A 4APCA 1OIQA 4GL9A 2H96A 4J7BA 5FM2A 2PE0A 4L3PA 1YWRA 5EI2A 4CMTA 4AA4A 2WQNA 4B0GA 4JMQA 3SQQA 4IX3A 4FUYA 2QKRA 2WZJA 5CASA 1IG1A 4IANA 4YJTA 3AD5A 3JY9A 4OTFA 3UDZA 5AUWA 4MBJA 1J7IA 2C5XA 3K2LA 4GK4A 1B38A 4UYAA 2AUHA 3ZMMA 4BFMA 5CAPA 3A7JA 1PXJA 5FUTA 3PXFA 3UIBA 4HCVA 2F7EE 2YCSA 4U8ZA 3R7EA 4BDGA 4BBEA 5K5NA 3F5PA 3KIOC 4DTAA 3KF4A 4DFNA 1REKA 3A7IA 3H4JA 1FVTA 2BPMA 4IMYA 2XM9A 3PXZA 2VX1A 2WEIA 3UGCA 5I3RA 5M53A 2WHBA 4JIAA 4XBUA 1WBSA 2P55A 4G31A 2ZV8A 3NZ0A 4FEQA 3U6HA 4AXCA 4EH6A