3ZFMA

Crystal structure of ephb2
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
279
structure length
248
Chain Sequence
EIDISCVKIEQVIFGEVCSGHLKLPGKREIFVAIKTLTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EPHRIN TYPE-B RECEPTOR 2
publication title Completing the Structural Family Portrait of the Human Ephb Tyrosine Kinase Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 248
sequence length 279
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zfmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zfmA01
3ZDUA 4X2KA 2R2PA 5HCXA 1V0PA 1CSNA 3Q5IA 1H28A 2WTJA 3EFKA 3R73A 4M68A 5I5ZA 4O38A 4ACCA 3R8MA 3U6IA 2GNIA 4BDIA 1NXKA 1WFCA 2JKQA 5KBRA 3FLZA 2XA4A 4FODA 4B8LA 3RWPA 4MEDA 3FQEA 3ZSIA 4YJNA 2X9FA 4CSVA 4BI1A 3KFAA 3LFDA 5LXMA 4FZ7A 2WEIA 3D5WA 4OUCA 4EH9A 2GMXA 4IVBA 4FTIA 2FSOX 3L9MA 4HCTA 1DI8A 3I6UA 4IFCA 2OIDA 4YLKA 5ETIA 4BIBA 4CLJA 5L3AA 2YDIA 1P4OA 3D7ZA 1ZRZA 4YZ9A 4YTIA 1OPJA 4ANQA 3BGPA 4L53A 4RQKA 2YWPA 4QP6A 3F3VA 5E8YA 2VO3A 4AFJA 4B99A 5HX6A 4I94A 4BTMA 3V04A 4CRLA 1DAYA 3MYGA 3OS3A 4U0IA 3QZIA 2XJ0A 2C6MA 3ZRLA 5CF4A 4FKTA 1OM1A 4BDCA 2QU6A 1M2PA 2YEXA 1Y6BA 2F7ZE 2OK1A 3FLNC 3QD2B 4ZLYA 5KHWA 5TF9A 3GC0A 4EOIA 4Y5QA 3DXNA 4WG3A 3R6XA 3E3PA 4HVIA 5DT4A 5HIEA 3TZ7A 4FMQA 4GL9A 4A9UA 4IADA 4MNFA 3W2PA 4KIQA 3DAKA 4DCEA 4ZLOA 3IDCA 3LAUA 4O0WA 2PVMA 5K4JA 4DTBA 4UN0C 4WRSA 1H26A 1KE7A 3L8PA 4PL5A 4QTCA 5FRIA 1UKHA 4AW5A 3Q3BA 3RAWA 1BYGA 3GT8A 3ITZA 3EOCA 2OZAA 3QAME 3JY0A 3ZEPA 2BZIB 1Z5MA 3FWQA 3CD3A 4JDIA 1BKXA 5D11A 2BAJA 3GCQA 5AA9A 3NDMA 4X2GA 1KE6A 1UU9A 1MQBA 3PZHA 2PYWA 2W4KA 2FB8A 3I7CA 3L8XA 4BBMA 5DIAA 3BE2A 4FSZA 5HI2A 3I5NA 3DTWA 3M2WA 4D9TA 5DRBA 4RX8A 4RWKA 3NUXA 4G6OA 1GIHA 1WBSA 2XNPA 3CTJA 4BTKA 4HGSA 2W06A 2IZSA 3CJGA 4CMOA 3BYVA 3PVBA 4G3DA 2DQ7X 3NR9A 3QTZA 3PVUA 2E9OA 3VS6A 4FZ6A 1WMKA 5AP1A 3FMEA 3UVQA 3LFCA 3E93A 4FUXA 4L3LA 1OL7A 3G0EA 4FC0A 2PZRA 3GU5A 3QTWA 4F70A 4L68A 3TTJA 3GCUA 4X3FA 4QPAA 4JG8A 4CV9A 2GHLA 4Y73A 3W8QA 1S9JA 3MB7A 5LVOA 3FEGA 3R30A 1UNLA 5EKOA 1KUTA 1U59A 4FVRA 4RX9A 5CT0A 3TDWA 3LCSA 2RL5A 4EHGA 1AD5A 1XWSA 5DI1A 4EKKA 1OL1A 4XBRA 5K9IA 2VUWA 1YKRA 3QU0A 4RT7A 2A0CX 1Q24A 5DWRA 4O0UA 4EH4A 2R3NA 4YMJA 5HG7A 5E8UA 4D58A 2BR1A 2X81A 3DDPA 5EK7A 2YFXA 3R9HA 4CZUA 5G6VA 5KZIA 3MW1A 2A2AA 2GFCA 1GZOA 4PY1A 4RJ6A 4XUFA 5J8IA 2Z7SA 4ASEA 3UNJA 4BCJA 4DITA 4EH5A 5IQDA 2QOLA 3CY3A 3CR0A 4NIFA 3BHTA 5D7AA 1LUFA 2ETKA 3ZSHA 3HKOA 4WRGA 4A7CA 3R83A 4AACA 1JKKA 1MUOA 3K3JA 5CVFA 1FINA 3MA6A 4ZZNA 2C0TA 2YLFA 3A4OX 4H1MA 1GIIA 5LMKC 4FZFB 4G3GA 3CKXA 2PZPA 5GINE 2F2CB 4FV8A 3WF8A 4XHKB 3BV3A 4IM3A 4RX5A 5HD7A 5IQEA 3QQKA 4NK9A 3ROCA 4YGAA 3H0YA 1O6LA 3F6XA 1H1PA 4RGJA 4WKQA 3MVLA 5DR2A 3TV4A 3UYTA 3DBCA 2XIRA 5BYZA 3N9XA 2VWXA 3E7OA 4BDBA 3HX4A 4GSBA 3MESA 1T46A 5HIDA 5BMSA 2R0IA 5D9HA 3C4FA 1YRPA 3RHXA 3I5ZA 3G6HA 1Q4LA 4OTHA 3DDQA 4XV3A 4RFMA 3FMLA 4M7IA 5AUTA 3E3BX 4IAIA 2BMCA 4UBAA 3R7VA 5AEPA 5M4IA 3NNVA 4JBVA 3UO6A 3SD0A 2E9PA 3LIJA 3HMIA 2WTCA 3FMNA 2GTNA 3HZTA 1WBPA 2C6LA 4RA5A 3RBWA 2C6OA 3UG2A 5L2IA 2FSMX 4MXYA 2R3IA 1OIRA 2C0IA 3BHVA 2CMWA 2PE0A 3HAMA 3CQEA 2OU7A 4G9RA 4QO9A 2X6EA 2C6IA 2C69A 2BDFA 3ZLYA 4JDHA 2JITA 3F5PA 3LFNA 4KIOA 1IAJA 3D5XA 3DB6A 3QUDA 4C4JA 3NSZA 3Q9WA 1JLUE 5EM5A 1P5EA 3H4JA 4V0GA 1Q8UA 2XIKA 4FKOA 4R5SA 3C4EA 4YO4A 2IJMA 4UZDA 1IRKA 4E8AA 4U6RA 2NRYA 4G3FA 3ODZX 3LM5A 3V5PA 3DA6A 2ERZE 4BCFA 1G8AA 2YACA 3SC1A 2VTPA 3F7ZA 4BFMA 5HNBA 1YW2A 2W5BA 2G01A 4GJ3A 1HCKA 3OD6X 3R8UA 2RFSA 4KSPA 4HGTA 2C1AA 2P55A 4IB5A 4QTBA 5CEOA 5KMNA 1PRYA 2HIWA 3FLWA 4QPMA 2Y4IB 4NM5A 5FTQA 5AX3A 3GGFA 4D1XA 1OBDA 4Y72A 1JQHA 3PE1A 2B1PA 2V62A 4BYJA 3R9NA 4CEGA 3R7OA 4BDEA 4E4XA 5KUPA 2VGPA 3UOLA 3FXWA 3KK8A 4W9XA 4NKAA 5AP2A 5H3QA 3RZFA 4TKSA 4UMPA 2DS1A 3KULB 4S30A 4G16A 4FIEA 4KRDA 2GTMA 2QHNA 2XK8A 1YDTE 5DR9A 3AD5A 3OFMA 1JPAA 1LEZA 2WFYA 3A99A 4KIKA 3VAPA 1Z57A 3NUUA 1E1VA 5T68A 2C6TA 3LJ1A 4BDJA 1ND4A 4O82A 5M44A 5JEBA 4I0TA 3TIYA 3T8OA 4ENYA 3DLZA 5EM7A 3MSSA 5G1XA 3VS5A 4QP4A 5JFVA 1Q99A 5JFWA 4RZWA 4EBVA 3WF6A 4JG6A 3RALA 2BRBA 5L8LA 4QNYA 2JDRA 3PJCA 3LKMA 2OGVA 1KV1A 1OPKA 3R1SA 4ASXA 3HV6A 3IKAA 4FTOA 2X1NA 3OUNB 1UU7A 5HD4A 3DXQA 3FZ1A 1MRYA 1I44A 3E88A 3C4ZA 4BHZA 2VN9A 3AGLA 3GOPA 4JJRA 4BHNA 2VGOA 2OIQA 2XKEA 3D7TA 5EKNA 2HY0A 2OJFE 1ZYDA 4FR4A 3BRBA 3EQIA 3TCPA 4L8MA 4OAUC 4H36A 5IUIA 3L9NA 2CDZA 3DTCA 2Y6OA 3MGYA 4UMTA 3PP0A 4BCGA 2XRUA 4F9AA 3OOMA 4DFYA 1H1WA 2IVUA 2OH4A 4MF1A 4NKSA 1XO2B 4PDOA 3DNEA 3UIBA 4NSTA 1UU3A 4APPA 5E4HA 3PG3A 4BY9E 3Q4ZA 5BVKA 5BQ0A 3F5UA 4L01A 5GJGA 1W82A 3R71A 2RG6A 3NW6A 1OPLA 1MP8A 3FMJA 3SKCA 2R7BA 2C5XA 4F65A 3AC5A 4GJ2A 2Y7JA 3H3CA 5L4QA 5GJDA 5JQ5A 3GC8A 5HKMA 4OGRA 4EOPA 5IA1A 1QPEA 3E7VA 2C3JA 1YDSE 3LW0A 3CXWA 4GK2A 3OHTA 3SQQA 4E4LA 2G9XA 4KKEA 3OCGA 3SW7A 5AV3A 4FEVA 1BI8A 5HU3A 3FZPA 1TQIA 3OXTA 5IDPA 2LAVA 3S0OA 4DG3E 3NNUA 3QYWA 3FI8A 3F5XA 5D10A 5HG8A 1IASA 2WGJA 1BL6A 3O71A 3O8PA 3PTGA 2FUMA 3EQGA 3GCSA 1ZXEA 5CNOA 3C13A 4NT4A 4RG0A 5GZ9A 4X7QA 2WMQA 3N4VA 2RSVA 4C57A 4PQNA 1WBVA 4I5PA 2PMNX 4HCVA 2VRXA 2BIYA 2OXYA 3LXKA 4MXXA 2C5NA 2F2UA 2J7TA 2P33A 4HNFA 5CZIA 5ANDA 5FM3A 5CYIA 5B0XA 4DGMA 4M67A 3MH0A 4FK6A 1WVYA 2GQSA 2XKCA 2WQEA 3PSCA 4J99A 3NYXA 5TT7A 4C3PA 2W1HA 4FV7A 3FDNA 5KMJA 1V0OA 3TUCA 3SA0A 4XMOA 3PPJA 2FA2A 2OF4A 2KULA 2OZAB 2C3KA 4JDJA 4ASZA 5FTOA 3CJFA 1QPJA 3FXXA 4FIFA 3CTQA 3DKCA 4B7TA 2HELA 5BMMA 4EWQA 3BLHA 2GQGA 4PL3A 2XK7A 1NW1A 4GRBA 4P7EA 4XJ0A 4CFFA 4N6YA 1W84A 5LOHA 5TOZA 4AG8A 5KHXA 3GQIA 4GKHA 2QCSA 4CMUA 5AP0A 4EC8A 4DH1A 4R7HA 1OMWA 4ZTMA 3VIDA 4L7SA 3R7EA 3ALOA 3CY2A 5FEQA 3NVKI 5AV4A 2PK9A 2Q0BA 1NVSA 2AYPA 2J5FA 4O1OA 5EYCA 4D4RA 4U3ZA 5FGKA 4EK6A 2Q83A 3KREA 2YM4A 3OF0A 4TWOA 4EZ3A 3WYXA 4EOSA 4BDAA 3U4UA 4EHEA 3T3VA 3DBDA 5EW9A 3KCFA 5LJJA 3P78A 4I6FA 4RLLA 2OKRA 1W8CA 3BCEA 3R8PA 4ZMFA 4X3FB 1XJDA 4U8ZA 5ICPA 4F1TA 4MKCA 2WKMA 4ZOGA 1REJA 4H58A 4ZTHA 4XV2A 5DEWA 3WIGA 2G2FA 4FG8A 3ANQA 5AUVA 4HZRA 4O7ZA 2OSCA 5EYDA 4AT5A 1J7LA 3IECA 3GU6A 4OBQA 5CENA 3QF9A 4IWPA 5ACBC 3G51A 5IU2A 5M07A 2YM3A 5DMZA 3Q4UA 3LVPA 4G34A 4ZK5A 4ANSA 4BKYA 4DG0E 1H07A 4PRJA 2CJMA 3EB0A 3VUKA 3R9DA 3BYUA 4BI0A 2IZTA 1YHSA 1WVWA 4ZIMA 4AGUA 5C8NA 2BZHB 5JSMA 2UZWE 4NIFB 4D4SA 4FYNA 1ZAOA 5CSWA 4WNPA 4ZTLA 4ANLA 2WD1A 2X7FA 1L3RE 3UYSA 4O0TA 4OTFA 3NCZA 4JNWA 2Z2WA 3QGYA 3CP9A 5M53A 3KXGA 4XRJA 1U5RA 2O63A 3PXZA 4O0SA 3PPKA 2V7OA 3PSBA 5CTPA 3HLLA 3ULIA 4ACHA 3UMXA 3BLRA 3GQLA 4ZTNA 4AUAA 4DGLC 4O6LA 2RGPA 4DEAA 4L9IA 2FSTX 3O8UA 4IWOA 1CKJA 5KE0A 2QI8A 4JIAA 4C3RA 4DLJA 3LXLA 4QP2A 4BL1A 4EOJA 3KK9A 2VTSA 4C02A 4EK8A 3PJ2A 4BTJA 4DBXA 2XCKA 4QYGA 4RJ3A 4ZY6A 3EN7A 4KRCA 3HEGA 3TZ8A 3UPZA 2ZVAA 3I4BA 3HV4A 4CYIA 2HENA 4LL5A 4EK4A 4ZLZA 5A9UA 1UNGA 1LP4A 4F9YA 5B2LA 5EOBA 2WMXA 4C4GA 4WG5A 3U87A 5I3OA 3M42A 5KMLA 4NCTA 3O96A 4BYIA 1VR2A 2EB2A 4IJPA 3BHHA 4IX4A 3OWPA 3GI3A 3DGKA 4GYIA 2YABA 2OJJA 3E8EA 2WTDA 3KMWA 3D4QA 2IO6A 3RPYA 5AADA 4FT3A 4B4LA 2A19B 3A8WA 4DTAA 5IQHA 1MRVA 4UYAA 5C4LA 3P7CA 1VYWA 5FBOA 3U9CA 3I6WA 5KMIA 3R01A 4ZSGA 4U7ZA 1MRUA 3NIZA 4QTEA 3AD6A 3VBWA 3IDPA 4I3ZA 4ZSJA 3VF9A 4V0GB 2X8IA 4L3PA 4ZZOA 2GHMA 1JBPE 1M7QA 2ITQA 3R2BA 1IR3A 4S31A 4BDFA 4BCQA 3WZJA 4A06A 2J0LA 2BDWA 3PG1A 5IA4A 5ANOA 3QRKA 3TV6A 2ITUA 4Z3VA 4IC7A 2YJRA 3W32A 5M55A 4XP0A 1UWJA 3LCOA 3QCQA 3QX4A 5LCJA 5EQYA 3E8DA 4O7WA 2CN8A 4L42A 4S34A 5A3XA 3MFTA 2OBJA 1JAMA 4K18A 4FVPA 4U40A 3HMNA 5IA2A 4UMUA 4S32A 3MN3A 3PJ3A 1QL6A 3WILA 4EH2A 4BKJA 5M57A 3HNGA 4EOOA 3AC8A 5DPVA 2W4JA 4J8NA 4YJPA 4OTPA 3ZH8A 3NX8A 4P2KA 4ZAUA 4MX9A 2HYYA 4TW9A 3VQUA 3P79A 4GFOA 4W4WA 4MNEA 3WE4A 3ZLXA 2C5VA 2O5KA 4MK0A 5A4EA 2XEYA 5IG1A 3ETAA 3QCYA 2WMVA 3V8WA 1YHWA 4B9DA 4FT9A 2OJ9A 3OBJA 4WT6A 1XBCA 4KIKB 2Y9QA 4MF0A 5B2KA 2R64A 1H0WA 4LI5A 4Y83A 2YITA 4JR7A 4DH5A 2UZLA 3U4WA 3RP9A 4XOYA 4L67A 4WSYA 5AP3A 2HZIA 3VW6A 2R4BA 3EQHA 3QA0A 4Z9LA 4GFMA 4E6AA 5J5SA 2PVJA 3MDYA 4HYIA 3QQLA 4FG9A 3O8TA 2RFEA 4RIYA 2IVVA 4RVLA 4ZJVA 3ORPA 3D7TB 3EQPA 3FPMA 5J7BA 3W8LA 2J5EA 2I0YA 3DJ5A 1JKSA 4FE2A 2W17A 3EN6A 3UVPA 4F64A 3NNXA 3N4TA 1RDQE 3KKVA 3RCDA 4HW7A 1H00A 2ITOA 3ORXA 4IAAA 5AIRA 5LVNA 4XP3A 3V5TA 3KVWA 5HTIA 2VWWA 1O6KA 3W55A 5HO7A 3D14A 4MQ1A 3GBZA 2NO3A 5TE0A 1ZY5A 4GW8A 5DT3A 1OVEA 4YC3A 4ALVA 4DGGA 4O81A 4FV2A 3R9RA 3SG8A 4O91A 2YZLA 4TT7A 2O2UA 1FMKA 3V5QA 4E5AX 5F4NA 4IZ7A 1XQZA 3D83A 3UQFA 3AGMA 4Q9ZA 4GCJA 3KGAA 3EYHA 4PF4A 5ANJA 4YU2A 4E73A 2I0HA 1ZYCA 5AP4A 2JDVA 1ZYLA 2WTVA 2YLEA 3TKHA 4KIPA 5DFPA 3G15A 2VTIA 3CPCA 4O83A 4I5HA 3LPBA 3UTOA 4DGNA 4QMLA 5I0BA 3KRLA 3FZOA 4HYHA 2W5HA 4M69A 4R1YA 1Q61A 2W9ZB 4G6NA 5HE1A 4YZCA 3DZOA 3HUBA 1Y6AA 2PZIA 5E8VA 5HOAA 3I1AA 3EN9A 3IW4A 3W33A 4FIJA 4XG9A 3O7LB 5CLPA 3H9OA 1PJKA 3QWKA 4CT1A 4EOQA 2HY81 4BGGA 2OIBA 3EHAA 4AW0A 4JL9A 1F5QA 3QKLA 3UO4A 1E9HA 5J9LA 3U55A 2XNEA 3F2NA 3DCVA 3ERKA 4I93A 2QU5A 2QLQA 3NW7A 5E8ZA 3T9TA 3VUIA 4FA2A 5HQ0A 2UZNA 3VJOA 2ZM1A 2PMLX 5HLPA 4YC6A 3KRXA 2ITWA 5IUHA 3CC6A 4ARKA 3TN8A 2BILB 3JS2A 3VHEA 2YJSA 3RPRA 4C36A 3VS7A 1SYKA 3S00A 3H10A 5FWKK 2GPHA 5IISA 1XH9A 5HGIA 1LR4A 2Z7QA 2BAKA 3DOGA 3HMPA 5CU3A 5IEYA 1DAWA 4BICA 5DNRA 3NIEA 5BUEA 3ZMMA 3FKLA 4RX7A 4J98A 3CSVA 3HDMA 4F6UA 3TM0A 4U81A 3QD3A 3LMGA 5H2UA 3CCNA 3JY9A 3FYKX 4C8BA 4CCBA 3LMIA 4MWHA 2C6KA 3LE6A 4X2FA 4IDVA 4XBUA 5BNJA 3ORZA 4QQ5A 2X39A 5E1SA 2GS7A 3FKNA 4AA0A 3QRJA 2WMAA 3UIMA 4S33A 3BWJA 3PYYA 5EW8A 4QT1A 2GNJA 2WU6A 1NT2A 1ZMUA 3TI1A 3HAVA 5A6NA 2ESMA 3R8LA 2GS2A 2YCSA 3UIXA 3D15A 4Y8DA 2VTTA 5JGBA 2QG5A 5IQIA 2X4ZA 3FZSA 3ZO1A 2HK5A 3I60A 4IH8A 4XS2A 4RIWA 1OBGA 3IPHA 4K0YA 4MH7A 2WNTA 3AXWA 4JBQA 4TXCA 3EFJA 4TYIA 4ERKA 3IO7A 3AT4A 3MY0A 4C35A 5ITAA 5IF1A 1W83A 3ACJA 4A07A 1WVXA 3KVXA 3QQJA 4FV1A 3TEIA 2R3JA 4O0XA 1KWPA 3GCPA 3MJ1A 3Q04A 4DEGA 2VNYA 4AGCA 1H1SA 3TWJA 5EDQA 4RIXA 5DG5A 5BUIA 3MIYA 4RQVA 1NA7A 5DH3A 4G5JA 4KAOA 1R0EA 4IANA 2UW0A 4YR8A 1X8BA 2Y6MA 5AR3A 4OAVB 3I79A 3LFSA 4EK3A 2DYLA 3QC9A 5AP5A 4OTRA 2A27A 2JFLA 4R7BA 4XX9A 4FX3A 2VO6A 4EKLA 4Q2AA 2I6LA 5IZFA 5JH6A 1U5QA 4ZZMA 4FKVA 5EDRA 4BWXA 4OBPA 3DNDA 2PHKA 5CEQA 3R00A 2XK3A 4M0YA 4UMQA 5EW3A 5BVWA 5DHJA 5I4NA 5IQBA 3MFSA 3QRUA 3I7BA 3PY0A 3KMMA 4WA9A 2ZJWA 3II5A 4A9SA 3BZ3A 4KS8A 3AT3A 2VTLA 5FXRA 4DT8A 2GNHA 4JBPA 4W4VA 5E8TA 2B52A 4USDA 4DHFA 1H1QA 5CAOA 4GU6A 4RVTA 4I5MA 3GU4A 1CKIA 3LMHA 3UODA 5HU9A 4FNZA 2C6DA 3UOKA 4V05A 3ZONA 2P2IA 3HDNA 4QP3A 4UYNA 1GY3A 1JSUA 1ZMWA 4XG4A 1XBBA 2UW8A 1P2AA 4BC6A 4DFXE 4F63A 2PE1A 1U4DA 1JSTA 2RKUA 2QG7A 2VTMA 4ITHA 4QYFA 5LQFA 5M4CA 4FTUA 3TNHA 2IPXA 3BE9A 4KA3A 4YSJA 3UP2A 3NYNA 3R28A 3HECA 2QOFA 5AR7A 2XIXA 4QMXA 3QHRA 3A7FA 4TN6A 5HG5A 2ZV9A 3EQDA 3MY1A 4PPCA 3U9NA 4RWJA 5H8BA 1KE5A 3ZOSA 1HCLA 5EQPA 2CGWA 3KL8A 3ZBXA 4F99A 2XK9A 4OTIA 3PY3A 1SVEA 3B8QA 3K3IA 3JPVA 3L9LA 2XJ1A 3DFAA 3GB2A 3QZFA 4W4XA 3F2RA 4IE9A 4K2RA 3ZUTA 3QWJA 4CFMA 1ZYSA 5DRDA 3FZTA 4MNEB 4OTGA 1CDKA 2X4FA 4IAFA 4MCVA 4OT5A 4WNOA 3RTPA 4AZWA 4FVQA 5AV1A 2PVKA 2WIPA 4FI1A 3OCSA 4X3JA 3BLQA 3QTQA 3FY0A 2CCIA 2B53A 4MD9E 4ZJJA 4EC9A 1YXTA 4EBWA 1B39A 5IH5A 2O8YA 3ROYA 4EYMA 5LVPA 5E9EA 4IX3A 2WTKC 2W5AA 5EI6A 1OITA 3V8TA 4X2JA 4FT0A 2PPQA 3MTFA 4ACDA 3KB7A 5KMMA 5HBHA 4PX6A 5F9EA 2CN5A 1P4FA 4QNAA 3OW3A 1G8SA 3DBEA 3N51A 2VWUA 5CF5A 3QA8A 4J1RA 3NNWA 5E90A 2W4OA 2RIOA 3DK3A 3WZKA 4RIYB 4AW2A 3C0GA 1YWVA 4YNEA 2WAJA 4AF3A 3EKKA 4NFNA 4P5ZA 3QXOA 1A48A 4O7NA 2XKFA 4PDYA 3COHA 5J9ZA 4U43A 4N6ZA 2ZOQA 5LCKA 4BIDA 2QO9A 4JLCA 1F0QA 5C1QB 4LRKA 3A4PA 5CVGA 1G5SA 3REPA 4EUUA 4QMTA 1Y91A 2IVSA 4U42A 3ZHPC 4BKZA 2OLCA 4F0IA 2XKDA 4XG8A 1XHAA 4QMVA 4I0RA 1M52A 5HVJA 4FSQA 3DK6A 3F88A 4PMSA 5LVLA 4C2VA 4CTBA 1UA2A 5KKRC 4RSSA 4FSMA 3TKIA 3BGQA 3KXNA 4M0ZA 3HMOA 4FF8A 4FTQA 2XK4A 4L52A 1ERKA 3RHKA 3ZO3A 5HNIX 3DJ6A 1URCA 4BVUA 2QC6A 4WUNA 4ZTRA 4XG3A 2JKOA 4FEQA 2CCHA 5HE2A 3RI1A 2UW7A 5LMAA 2ZDTA 3LQ3A 4PPBA 4I0SA 4IZ5A 4LM5A 1RQQA 3P9JA 5DBXA 1IA9A 4PUZA 2C0OA 4IB0A 3VBTA 5ANIA 3Q6UA 2ITZA 2J90A 4Y5HA 3KXHA 3PA3A 4QTDA 1QCFA 2EVAA 5HCZA 2QKRA 4C59A 3I0OA 4CFUA 4DCAA 1PXOA 1XKKA 4QQCA 3W2QA 5HNGA 3C5UA 4M69B 2CPKE 3NUSA 4AN2A 4ITJA 1VYZA 2V55A 4G6LA 5K0KA 4DEBA 3AQVA 4N4SA 4AZVA 4K9YA 4AGDA 1IEPA 3ORTA 4DFNA 4GUEA 4ZS4A 2Y8OA 5T3QA 4EZ5A 1WCCA 3SXRA 5IMXA 1YI4A 3NAXA 4O86A 2UW3A 3ELJA 2W1DA 3H9FA 4G17A 3UC3A 3ZO4A 3WBLA 4EH3A 3SXFA 4YZMA 5BVNA 1UVRA 3EH9A 4LMNA 4PMMA 3S2PA 3QTXA 2JBOA 5IQFA 4ID7A 4KSQA 4UY9A 2YM7A 4U5JA 4KB8A 4BCMA 3DB8A 4RPVA 5E8XA 1EH4A 1PMUA 4PMTA 1DS5A 4EH8A 2XH5A 4FSRA 5H8EA 5CI7A 2SRCA 4IVCA 4WHZA 1XR1A 4YHTA 2WQMA 1JOWB 5IA3A 4NWMA 3WOWA 1GJOA 4JAJA 3ZM9A 3A7GA 3UC4A 4D2TA 3ZXTA 4OW8A 3OUKA 3PXKA 2JAVA 4A9TA 3ORLA 5IDNA 3TXOA 3NUYA 3E92A 5BPYA 5HLWA 4IVAA 3ZUUA 2W1IA 5FEDA 5JZJA 4GH2A 1J7IA 1XH5A 3TTIA 2QOIA 2QLUA 4D5KA 1VEBA 3WIKA 1PXNA 5AIKA 4C3FA 2QOHA 5LVMA 2XP2A 3ZLWA 3TNQB 4USEA 3AMAA 4QMWA 3LFEA 1ZOEA 3JVSA 5HBEA 3P86A 5ANEA 1PYXA 1XH4A 4O0YA 5I9UA 5HICA 3O23A 4DT9A 4ORKA 3AD4A 5IPJA 5A6OA 4KINA 3NUPA 2BIKB 2YAKA 3D5UA 4BGHA 2ZAZA 3KN5A 4RIWB 4AFEA 3IW8A 1RE8A 2ZDUA 5I9WA 5JT2A 1ZZ2A 3Q32A 3GCVA 4M66A 4BCKA 2P2HA 3QALE 3O50A 4I41A 3GXLA 2IW8A 4G1WA 2WZJA 4O22A 3PA5A 5AWMA 5A4TA 3F5GA 5J87A 3VUMA 4RIXB 4YBKA 4YSMA 2B9FA 5AMNA 2R3KA 2ITVA 2UZUE 2Z7LA 3PWDA 3OEZA 2HAKA 3V51A 5AX9A 3VBXA 5AM7A 5I9VA 3C4XA 5FBNC 3WZDA 2PULA 5M09A 4FKSA 1PMNA 3KXXA 4F6WA 5CEPA 3EQBA 5DGZA 3MA3A 3ALNA 3POOA 2OWBA 2XYNA 3BQCA 5FG8A 4H3PA 4AU8A 4NU1A 4FOBA 2HCKA 3MVMA 4I1ZA 3UNZA 2C1BA 4FZAB 2B55A 4BWKA 4C58A 4WNKA 4E5WA 4WSQA 4JVGA 5JFSA 1NVRA 2OH0E 4F9CA 4FTKA 3IGOA 3R8VA 5CSHA 3IS5A 3C51A 4D2WA 4E5BA 5JQ8A 5IEVA 1IG1A 5J95A 4F7JA 2HWOA 1LPUA 4FL3A 5HX8A 3GENA 3CLYA 1ATPE 1AQ1A 5ETAA 3WI6A 1H4LA 3EQCA 2PUPA 3BEGA 3OTVA 1FVVA 1OL5A 2JIVA 3MFUA 4AA4A 4YLLA 3MVJA 4QMYA 2UUEA 2YIQA 3DZQA 3Q6WA 4F08A 3LFBA 2W1EA 5CALA 4PP7A 1JKTA 3BU6A 5E7RA 1OECA 3EQFA 4QP9A 2FSLX 2ONLC 3ZFMA 2VTJA 4UMRA 5HBJA 5CF8A 5HLNA 4NL0A 4KWPA 4WOVA 4I4FA 1FOTA 5AUXA 4APCA 3P5KA 3W16A 3P1AA 5AR5A 4I92A 1H01A 2R3MA 4UALA 2XIYA 1WAKA 2PUIA 4E4NA 5CEMA 4W8DA 1OUYA 4I4EA 5DEYA 3WE8A 4J52A 1AGWA 4X0MA 4QMZA 4AOJA 3SDJA 2A1AB 5KX8A 4KBAA 5EHYA 4C4HA 4CFXA 4J95A 1YXXA 2XK6A 4K33A 2XVDA 3OTUA 2XF0A 4LRJA 5CEKA 4EH6A 4TYEA 3FMHA 2QO7A 4WG4A 4DINA 4MD7E 3GOKA 4G2FA 4LMUA 4MXAA 4FKQA 4EQMA 5FLFA 3TJCA 1APME 4H3QA 4IQ6A 4FV3A 3L8SA 2OXDA 3HRCA 1Q5KA 3TIZA 3SRVA 3HV3A 4DH8A 4UEUA 4YJTA 4AOTA 2BRGA 3OY1A 1TQMA 2GS6A 3FHIA 4U45A 4D1SA 1QPDA 3AG9A 4IAZA 1FVRA 5JRSA 4D4VA 4MXOA 1OB3A 3R02A 4O1PA 4FUYA 2J0IA 2HZNA 3ENHA 5IUGA 1WBOA 2EXCX 5DLSA 2OG8A 1U54A 1YHVA 3PIYA 4RJ5A 3ZO2A 2OF2A 3WZUA 2QR8A 1FQ1B 2YAAA 3Q4CA 5C9CA 4Z16A 5GIOE 3TKUA 4EH7A 4O2PA 4X2NA 4DEDA 2BKZA 4R3RA 5AAGA 5FD2A 1PMEA 3RAKA 3BGZA 2BROA 4O96A 3QC4A 3HRFA 2ZM4A 1VJYA 2ERKA 3FHRA 4RC4A 4HVGA 1YWNA 5L6OA 3MB6A 3NVMB 4BDKA 5KZ0A 3DU8A 2NRUA 2BPMA 2Y4IC 4GUBA 2PL0A 3EJ1A 4C37A 4G3EA 3RWQA 1MQ4A 2YIXA 1L8TA 5I9ZA 4EEVA 2JD5A 2C4GA 3HMMA 4B8MA 5KNJA 3KEXA 5E8SA 2I0EA 5DVRA 5EI8A 5AA8A 4KUJA 2VU3A 4AAAA 2JDTA 1O6YA 3JR1A 4EOMA 1CTPE 2VTHA 4HPTE 3BYSA 4IBMA 2BUJA 4H1JA 2JLDA 3FSKA 2BZKB 2E9NA 4YHJA 5AM6A 4D55A 3LM0A 5DT0A 3R1YA 2R3HA 2YDKA 3R0TA 4DAWA 3B8RA 4PTGA 4WBBB 4IWDA 4PNKA 5M4UA 4IC8A 4P4CA 4XEYA 5ETFA 4CGAA 5FDPA 5EYKA 4BDGA 1IA8A 3OP5A 4FYOA 3VF8A 3QUEA 4CXAA 3R21A 5J1VA 3M11A 4EWHA 2B9HA 3BU5A 2R3LA 3NW5A 1GIJA 2GSFA 3CD8A 4FKPA 3A60A 4GG5A 2WB8A 2H34A 2UZOA 4LRMA 4ZS0A 4QPSA 5JMSA 1M17A 4GV1A 3GNIB 1STCE 3IOPA 3UZRA 4YC8A 4FTLA 2WTIA 1E1XA 5HO6A 3KF4A 2R9SA 3PA4A 4XLIA 3GEQA 3QTRA 4EOKA 3QQUA 4MVFA 4NTSA 2R3QA 3OEFX 5J9YA 2GU8A 5C01A 3L1SA 3MH3A 4J7BA 4YZNA 3SW4A 2EUFB 2J0KA 3VHKA 3PLAE 3IG7A 4E1ZA 2HXQA 4EORA 3VUTA 4XOZA 3RKBA 2IN6A 1Y57A 3GVUA 5E1EA 1ZZLA 5AAEA 2QOBA 3NZ0A 4LGHA 4LQMA 4HOKA 4HPUE 2WU7A 4E4MA 3C50A 5H8GA 1FBNA 3EN5A 3LCDA 3QRIA 3PP1A 3KRWA 4OTWA 5JN2A 4CFNA 4OLIA 4DEHA 1GZNA 5IA0A 2X9EA 3TZMA 5DOSA 3QTUA 2Z02A 4KD1A 5BVOA 1YOMA 3ANRA 3QD4A 2PY3A 2X8EA 4ERWA 3WYYA 4GG7A 5J7HA 1FVTA 2V7AA 4ACMA 1SZMA 4C34A 3NCGA 5DR6A 5CAUA 3QCXA 3IGGA 5BYYA 5L2TA 1V1KA 2VTAA 4UZHA 5JGAA 1BX6A 4FKIA 4J96A 3ZDIA 3B2WA 4PL4A 5JZNA 2XNMA 2O65A 3ZRKA 3BQRA 4AZTA 3OXIA 2GNLA 2QHMA 2VWBA 2PVHA 5T6KA 3ORNA 4A4XA 5LARA 2JDSA 1PXIA 3IDBA 3V6SA 4AXAA 3R22A 3BV2A 4AGWA 2IW6A 3BHYA 4D2RA 4EYJA 4R7IA 2BTRA 3BBWA 4V04A 5CSPA 1ZOGA 3E87A 2BFYA 5CF6A 3KRRA 3U6JA 4JG7A 3ZBFA 1XH7A 4PV0A 5BX0A 3MBLA 1WBWA 4NUSA 4YPSA 4AZSA 2WMSA 4GIHA 3UOHA 4QRCA 4IEBA 3VS0A 4C0TA 2BALA 5FP6A 1KV2A 4NM3A 4Z7HA 3VQHA 4PTEA 3AOXA 2AC3A 4FKRA 3CGFA 5AP6A 5L6WL 3VS3A 3NGAA 3OWLA 1J91A 3D2KA 5HTBA 2PU8A 5D41A 3TNPC 3NMUF 4ANBA 4Z7GA 4ANNA 4EUTA 4KABA 4FGRA 1Y8YA 4BDDA 4Q9SA 2F57A 2JEDA 4U3YA 3TUBA 4ANMA 4WIHA 3Q60A 3EZRA 2IG7A 3S1HA 4C7TA 4G3CA 5EHLA 4F1OA 4C4FA 4E20A 4JRNA 3Q5ZA 3MI9A 3UP7A 3VUGA 4X3FC 4FKGA 2KTYA 3VC4A 2XBJA 3BHUA 2XB7A 4JXFA 5KO1A 3DY7A 4I24A 5A14A 4BBEA 1DI9A 4W8EA 3QTSA 2FGIA 4FNXA 3ZUVA 5A4CA 4C33A 4QOXA 4BWPA 4L7FA 1T45A 4EQUA 3GFEA 3OMVA 4K77A 5D1JA 1OIQA 3BI6A 5I3RA 3R63A 5ACKA 4DG2E 4U44A 3DS6A 4IACA 2XNNA 1UWHA 4UWYA 4B6LA 3I81A 2CNQA 2J6MA 3FL5A 4FIGA 1J1BA 4HYUA 2AC5A 5HG9A 3NRMA 3CPBA 5FTGA 2VX3A 3ET7A 4XH6A 4ANOA 2JFMA 2WHBA 2W1CA 3DKOA 3SOAA 5IQGA 4LUEA 3VBVA 2WEVA 3H0ZA 1Y8GA 3QLGA 4FV0A 4CG8A 1PXJA 5GNKA 3C9WA 4IM2A 2NP8A 1PY5A 2A4LA 2B9IA 4FG7A 2BFXA 2FO0A 1ZWSA 3F66A 5AP7A 4A9RA 5K5NA 2UV2A 4YJVA 4F09A 3TG1A 2CKQA 4XNEA 4II5A 3LQ8A 3VUDA 3KRJA 2Z8CA 3MS9A 3LJ0A 4BCPA 3Q9YA 3ZSGA 4M15A 3TV7A 5C26A 1I09A 2J9MA 4XV1A 4FV5A 1YI3A 2W7XA 4V01A 4QMQA 4R8QA 2YA9A 1R1WA 4O7YA 3GUBA 4DFZE 4LOPA 2BRMA 4QMPA 5A4LA 3HYHA 2AUHA 3DFCB 2QNJA 4KNBA 3V5WA 2PUNA 3AC1A 3DQXA 4KBKA 4TNBA 4YZBA 5HCYA 3NPCA 4ALWA 1FGKA 4F9BA 1PW2A 3MPAA 3LOKA 1R78A 2PVYA 4YJOA 3BYOA 3MJ2A 3TNWA 3F2AA 1Q3DA 3OROA 3C7QA 2VTRA 5JGDA 5L2SA 4DFLA 1M2RA 3KU2A 4QMSA 2XS0A 4FNWA 4AOIA 4D28A 3SVVA 4ZMEA 5CQUA 2YM6A 4FIIA 4A4OA 2OW3A 2XNGA 4FEWA 3SRVB 1WBTA 1OIUA 3U6HA 3BEAA 3I0QA 3IW5A 5J5TA 2XBAA 4CT2A 4A4LA 2QOKA 2WMWA 3K2LA 3Q96A 3W2CA 3R7UA 1G3NA 4TRLA 4WUAA 5EFQA 4ZEGA 2QOCA 4YTHA 3RGFA 5IQCA 1ZOHA 4F4PA 4YTCA 3VNTA 1U46A 4WBOA 2HOGA 4ZSAA 2GDOA 1U54B 4ITIA 2BKKA 5EQEA 4AWIA 2QD9A 1OKYA 5AR4A 5GZAA 4C61A 2XCHA 1H25A 2GNFA 5LWNA 3MTLA 3MPMA 3VO3A 1PXLA 2ITTA 2ZMCA 2PSQA 3BKBA 3R2YA 4E26A 3W1FA 2CKPA 4HYSA 4H05A 4GT5A 4OT6A 4Y85A 5ANGA 3SOCA 5I9XA 2EXMA 2QKWB 2HZ4A 4CCUA 2R3PA 2VTQA 3S3IA 3VUHA 2XNBA 3QTIA 4LG4A 4YO6A 3POZA 2WQNA 4PNIA 3CGOA 2PUUA 1V0BA 3EZVA 3P4KA 5A54A 1FPUA 4PDPA 5EG3A 2X6DA 4BRXA 5BUJA 5LMBA 3BWFA 2YIRA 1SVGA 3H9RA 3ODYX 3FUPA 4MBIA 2YCRA 1CMKE 3EN4A 5TKDA 3N4UA 3E64A 3OCBA 1UKIA 3FJQE 1UNHA 4CKRA 3VRZA 2VNWA 3IOKA 1KOAA 2WELA 1YOLA 2CKEA 2OI4X 3D5VA 3EFLA 3SXSA 1PHKA 4AT3A 4ZY4A 5CQWA 4YTFA 4TWPA 5CXZA 1ZARA 2WTWA 3IQ7A 3ATSA 4CD0A 3TT0A 4JI9A 3FBVA 3HA8A 4ONAA 3UQGA 1SM2A 3FI3A 2Z7RA 3RK5A 5EM8A 2YWVA 3QRTA 5E91A 4F0FA 4L44A 5D7VA 5GJFA 4KS7A 4D9UA 2CLQA 4O21A 3QUPA 3TDVA 3C1XA 4IWQA 2UW4A 4EOLA 4BZDA 3NLBA 3IONA 4N70A 4BR3A 3PVGA 3E8CA 3FMMA 3PVWA 4L3JA 3DJ7A 4BB4A 2X2MA 4E93A 4AQCA 4UWCA 4DGOA 1GZ8A 5C03A 4I6BA 4XV9A 2CHLA 2UVXA 3O2MA 4FK3A 3QHWA 3KMUA 4R3CA 2UZVA 2E9VA 4RWIA 4XCUA 3BYMA 2XYUA 4XYFA 5K0XA 3LLTA 3QL8A 4R5YA 3WF9A 3HUCA 1J1CA 1JSVA 3RMFA 3DXPA 2WIHA 4IIRA 5L6PA 4U9AA 2G2IA 3ENMA 5IMEA 3F3WA 4O2ZA 2YIWA 5A4QA 1Q97A 3D94A 5HHWA 3VS4A 4RC3A 4DFBA 2RFDA 3TZ9A 4DTKA 1YXSA 3VW8A 4F0GA 4R6VA 4CMTA 4KKGA 4LOOA 3CIKA 3PXFA 3QQHA 3DPKA 3E8NA 3FE3A 2BAQA 4MHAA 4QP1A 4CV8A 2UZDA 3FPQA 4GK3A 4NZWB 1RJBA 2JC6A 4TL0A 2W0JA 3WZEA 2GNGA 4IMYA 3KN6A 4YP8A 1YI6A 3FC2A 2QODA 2P3GX 4CZTA 4CTCA 4RIOA 4LUDA 2VWYA 3O0GA 1CM8A 2BZJA 4JQ8A 3D9VA 4FSNA 4JDKA 3FQSA 2UW6A 2VWIA 2VO7A 2FVDA 3E63A 3HP5A 3DV3A 3UBDA 2V0DA 4AE9A 1PMVA 5FM2A 2JKKA 4K6ZA 5HVKA 1R0PA 3FV8A 4EHVA 3JYAA 2PE2A 3PRIA 1XH6A 4UXQA 5C4KA 5EDPA 4P5QA 5ETCA 4N0SA 4O6EA 1SMHA 3C5IA 2HXLA 3NWWA 4FT5A 5CSXA 3FLQA 3ZS5A 3ID6C 1JWHA 4HGEA 1HOWA 4DFUA 3RINA 1JKLA 1OGUA 5AUUA 4JAIA 4WD5A 2F7XE 2XMYA 5AV2A 4AS0A 1Q62A 4BDHA 4CYJA 4RJ4A 5GHVA 4CG9A 3FLSA 3ZYAA 3R7GA 1XH8A 4QTAA 4CRSA 3LLAA 4AT4A 3MPTA 3QQGA 3P0MA 5KMOA 5KBQA 1Q3WA 1F3MC 4FKJA 4NJ3A 3U8WA 3W2SA 1O9UA 3A7JA 1P14A 2H8HA 3LHJA 4ZSEA 1K2PA 2HW6A 4IX6A 4FBXA 4IW0A 4MTAA 3PXQA 4CFWA 3A2CA 4F7LA 3RAIA 3F3UA 3PRFA 3TNIA 3VJNA 3HA6A 4M97A 1BUHA 2C6EA 4NFMA 1H08A 4RLKA 3ATTA 3BPRA 3OBGA 3GC7A 4BCHA 2JDOA 3W2RA 5KMKA 4C62A 3EL7A 4JT3A 1GAGA 5HZNA 1OI9A 4BZNA 1ZLTA 1RW8A 3FI4A 1M2QA 5CVHA 1H8FA 3AC3A 5CEIA 1OL6A 3LZBA 4FL1A 2DUVA 4IDTA 4YJSA 1FGIA 2W1GA 3KA0A 4RMZA 2YIYA 4K11A 5M56A 1QPCA 2IWIA 2JAMA 4D2SA 1BLXA 4DH7A 4F1MA 1M7NA 3HL7A 3DAEA 3PIXA 3BBTB 3WF7A 3R7YA 4C4EA 2W1ZA 3RJCA 4YURA 1W98A 4OTDA 3NYVA 3DKFA 4FV4A 4KBCA 3TJDA 2PTKA 1A9UA 2ZV7A 3NAYA 1Z9XA 5CX9A 3RK7A 5JFXA 1XBAA 2G2HA 4QMMA 5AAFA 5K5XA 2NPQA 1BI7A 1YWRA 2B7AA 4L45A 3HV5A 2CLXA 4U80A 4D1ZA 1R39A 3FXZA 3W10A 3ZXZA 4FTAA 1PXKA 2X8DA 3AC2A 4LL0A 1Q8YA 5GIPE 4RJ7A 2WMBA 5JK3A 2PZYA 4AE6A 3FMDA 3E5AA 4BN1A 3T3UA 5M08A 4DEIA 1YOJA 1YXVA 3OY3A 3SAYA 2J50A 2BHHA 3JVRA 4CZYB 2ZMDA 5FXSA 3UE4A 2R3OA 5CT7A 3PLSA 2CGXA 3O7LD 3P7BA 4QQTA 2C3IB 3DT1A 1YDRE 2C5YA 4UX9A 5DYJA 5BYLA 2WOUA 4XG2A 3FY2A 3UG1A 4MYGA 4O0VA 5K3YA 5BVEA 4HVDA 3OT8A 1OL2A 3QGWA 3PE2A 4FSWA 3RPVA 3UO5A 4JS8A 4E6CA 2YM5A 3PY1A 2E9UA 3FKOA 1J3HA 3ULZA 5HESA 4TZRA 2W9FB 3PJ1A 4YJRA 3G33A 5IQAA 3GC9A 3B2TA 2Y4PA 3W2OA 2C47A 4JR3A 2GQRA 4CQGA 2WOTA 3MIAA 3PFQA 4Q5HA 4YHFA 3RAHA 4L6QA 2XJ2A 3KY2A 5EOLA 3U54A 5IEXA 1GNGA 2LGCA 2PWLA 3VS1A 5FEEA 3ZLSA 5L8KA 1TQPA 5CU6A 3RNYA 5CY3A 2VD5A 4FSYA 4ALUA 2X2KA 3TUDA 4BI2A 4NCTC 3D0EA 2JIIA 5HEZA 2DWBA 2P0CA 5HO8A 3W18A 5M4FA 5JRQA 4IHPA 3Q2JA 4MWIA 4FNYA 3EFWA 3SGCA 4D2VA 1QMZA 4YJUA 4DA5A 5E8WA 4EHZA 4BTFA 1IAHA 4R78A 3QBNA 2XEZA 5CXHA 2ZYBA 2J4ZA 4ENXA 1S9IA 4IM0A 4O27B 1WBNA 5DN3A 4GIIA 2REIA 1KOBA 4H39A 2QR7A 4O84A 3UVRA 5JKGA 1J7UA 3QCSA 1GOLA 5CS6A 2WQOA 5M51A 3OW4A 4MXCA 4FV9A 4YLJA 3OCTA 2OICA 4FSTA 1PKGA 2FYSA 4U79A 5IH6A 3OT3A 1H1RA 3CEKA 3KQ7A 4JIKA 4M12A 3PIZA 3FL4A 3GFWA 4IB3A 4GS6A 2UW9A 3ZEWA 4M14A 3SG9A 2Y0AA 2VTOA 2I40A 1B6CB 3OWJA 3UPXA 1URWA 1W7HA 4IB1A 5EI2A 5LWMA 2ITYA 2I1MA 2BRNA 2QVSE 5FQDC 3RZBA 3V8SA 3S95A 3RM7A 3PXRA 4F7SA 3G2FA 4TYHA 3QYZA 4LGDA 4ZJIA 3UQCA 2UW5A 4BBFA 5CAQA 2YCFA 4AN9A 2YZAA 3HVCA 3Q4TA 3Q9ZA 3FI2A 4RBLA 5AV0A 3ZZEA 1WZYA 2OO8X 2W96B 3KF7A 4JRVA 3QZHA 4GVAA 3UNKA 4WO5A 2UVZA 5C27A 2PVNA 4B0GA 3SLSA 5KCVA 5CU2A 1KE9A 3S4QA 2OJIA 3QXPA 4BGQA 4I21A 3TL8A 2VX1A 4AP7A 3C4WA 4M84A 3COKA 3NS9A 3G0FA 4QMUA 3VVHA 4HNIA 3TACA 3A62A 4UWBA 4M3QA 1PF8A 2V5QA 4NJDA 1K3AA 3FMKA 4QMOA 2VAGA 2PMIA 3FYJX 2Z60A 4I6HA 2F49A 5DE2A 4E6DA 1YXUA 2B4SB 2FH9A 4ZSLA 5LMKA 5FDXA 3A61A 3D2IA 1NVQA 4NW5A 3ORKA 5D12A 4XG6A 3UIUA 3VBQA 3R8ZA 2ZM3A 2IVTA 4RRVA 4HVSA 3K5UA 3O51A 4X6QC 1K9AA 3NEWA 2X7OA 4IAKA 4TYJA 4IVDA 3VS2A 2GFSA 4TWNA 2ZV2A 4C4IA 4DE4A 4C2WA 2IZUA 2JKMA 5CZHA 4TWCA 1BL7A 5L8JA 2XUUA 4R1VA 4IAYA 4K1BA 4LV5A 5B7VA 2QQ7A 4PDSA 5BVDA 4NW6A 2VWVA 3FAAA 3THBA 4EJNA 5AJQA 3QKMA 3HGKA 3HP2A 3F3ZA 3GU7A 4DBNA 4EQCA 3C4CA 4PPAA 1OKVA 3MVHA 4LFIA 1SNUA 1H27A 4EZ7A 4ZY5A 2XIZA 4FZDB 5HE0A 3AC4A 3UMWA 5I9YA 2O3PA 3MV5A 1ZYJA 3ZM4A 2YN8A 4ZTSA 3K54A 3O17A 3A7HA 5C8MA 1OUKA 4YNOA 3PPZA 1NY3A 1YVJA 1A06A 4PP9A 3V01A 4O0RA 4BZOA 4JX3A 4BF2A 3COMA 4NM7A 5CAVA 2B0QA 4NYEA 3LFAA 3QZGA 3LQ5A 2B54A 4JBOA 4QQJA 4N57A 2VTNA 3SV0A 4QMNA 5H9BA 1Q8ZA 4NTTA 1Q8WA 4TNDA 3AT2A 3LFFA 3BU3A 3DK7A 4CQEA 3MWUA 3ZCLA 5CU0A 4RJ8A 5FXQA 3CTHA 3PJ8A 3NYOA 3KXZA 4FGBA 3EKNA 4IX5A 3EWHA 3ORMA 4K8AA 1OKZA 1DM2A 3RM6A 4KKHA 4G5PA 5CWZA 5IH4A 2UZTA 4DN5A 3CE3A 4FKLA 3L8VA 2ZB1A 3U51A 4FL2A 2QOQA 2JIUA 4QYHA 3OXZA 4QYYA 4FKWA 4CFVA 2CNUA 3MH1A 2J0MB 3QLFA 3QQFA 4TYGA 3LXPA 2OJGA 4Y46A 5HIBA 3UDBA 3ZRMA 4AW1A 4EK5A 5AUZA 4R3PA 2CGUA 3G5DA 3VBYA 1JNKA 3G6GA 1PKDA 5AUWA 2ITXA 3P23A 4TY1A 3CQUA 3A8XA 4XLVA 4FEXA 5A46A 5CI6A 4G9CA 3K5VA 3OWKA 4DEEA 3PWYA 2RG5A 4U97A 2IZRA 2R3GA 4GU9A 1TVOA 4RFYA 5CNNA 4M8TA 2R7IA 3C0HA 2QURA 4PMPA 4TPTA 3IW6A 3V3VA 3OC1A 2XZSA 5IKWA 4O7VA 2ZV8A 2H96A 1SNXA 4QP8A 4RA4A 4ZP5A 3M1SA 5F95A 2CSNA 4FTJA 2G15A 3AMBA 4DYMA 2ETRA 4AA5A 4ASDA 4S2ZA 3ZFYA 1R3CA 4E3CA 2ETMA 3ZC6A 3L9PA 4O7LA 1YQJA 3PXYA 5CU4A 3QKKA 4IZAA 5AUYA 2JBPA 4E6QA 2YCQA 2WO6A 2W1FA 5CASA 4J97A 2E2BA 2EB3A 3EMGA 4E7WA 3G9LX 3RVGA 4R77A 1UV5A 2XRWA 1M14A 2HW7A 4GEOA 2C3LA 4QYEA 4I20A 4IXPA 4EL9A 4PWNA 4Z55A 2O0UA 5J79A 4PTCA 2F7EE 3PUPA 4HCUA 3R9OA 2VV9A 4O7RA 1W0XC 5CSVA 2QO2A 4O7SA 4IFGA 2GCDA 3Q9XA 4IJ9A 3RK9A 4L43A 4D5HA 2H9VA 2PVLA 3OOGA 4CNHA 2J2IB 4TTHB 2WXVA 3UGCA 3UJGA 5CAPA 3MFRA 4RVMA 2VX0A 2ITNA 3DQWA 2O64A 2PVFA 4ZTQA 4NEUA 4YBJA 3VULA 3DBFA 4IZYA 4F6SA 3NUNA 4F9WA 4GVJA 3MY5A 2YERA 4J71A 3F9NA 3AMYA 3ZC5A 2BDJA 4XP2A 1FMOE 4FTRA 4MAOA 5E92A 4BCOA 2BHEA 4LYNA 5C8KA 4QD6A 5L2QA 3GP0A 3IW7A 1PXPA 3SX9A 4GK4A 4DLIA 2C5OA 2EU9A 3OVVA 4YPDA 3F7WA 1OIYA 2WQBA 5K4IA 3LXNA 3PSDA 2X7GA 1KE8A 3VN9A 3QD0A 2BTSA 3OZ6A 2UVYA 3GU8A 1B38A 3Q53A 2HWPA 2BRHA 3P7AA 4FTMA 4AZFA 1BMKA 5J1WA 3FQHA 4X6RA 4GKIA 2UZBA 3IK3A 4LGGA 3ZFXA 2CKOA 4GFGA 3DAJA 2F4JA 5F94A 3DKGA 4MQ2A 4NH1A 3WARA 2R0UA 2RFNA 3UZTA 1LEWA 3KC3A 4FIHA 3Q52A 3RCJA 4I5CA 2WMUA 5AR8A 2EWAA 2HZ0A 5HTCA 3WF5A 4HVHA 2VWZA 3LCKA 4ACGA 3RPOA 1OZ1A 2H6DA 4W4YA 4CKIA 2ZB0A 4XRLA 4FEUA 2X0GA 4L46A 3F61A 2C68A 2OZOA 2I0VA 2J0JA 2PZ5A 2WMTA 1H24A 4LOQA 4DH3A 4DF3A 3FZRA 4JQ7A 3KCKA 2Q0NA 4HJOA 4U41A 3RPSA 2ONLA 2PVRA 4UB7A 3V6RA 1JVPP 2V22A 3R04A 5EHOA 4QP7A 1TKIA 2WPAA 4FICA 3DBQA 4RZVA 5HE3A 3Q2MA 2W05A 2ITPA 4Q5EA 3R1NA 2IW9A 3V5JA 3G9NA 3CKWA 3FSFA 1GZKA 3PZEA 2C30A 4F7NA 2OFVA 4I23A 4AN3A 3R1QA 4M13A 2YISA 3KXMA 4OBOA 3F82A 5HORA 4FTCA 5FP5A 4C38A 1OKWA 4JX7A 3FLYA 2XNOA 4NM0A 2JGZA 4OR5A 5GZ8A 3DLSA 4TYHB 2F9GA 3EQRA 2CNVA 1SVHA 2XM9A 3BIZA 1PXMA 4A9YA 4D4YA 5FUTA 5L2WA 4D2PA 2ACXA 4EI4A 3HV7A 5IA5A 4RC2A 2R5TA 3ORIA 4ZXTA 2I7QA 4WNMA 4LV8A 4RVKA 4FKUA 2WMRA 2VO0A 3E62A 2GHGA 3EL8A 2UZEA 3T9IA 4GMYA 5EYMA 4USFA 3UOJA 2QOOA 4CLIA 4EJ7A 2R3FA 3BX5A 4FTTA 4HGLA 5CANA 3CQWA 4FSUA 2RF9A 3BELA 2WTKB 2CGVA 4P90A 1H0VA 4AZEA 1PYEA 2G1TA 5BVFA 5EM6A 4CVAA 1KSWA 1ZMVA 3RNIA 3PDTA 3VWAA 4JQEA 3A7IA 4D0WA 3CS9A 3COIA 4RWLA 4W9WA 4X21A 3LCTA 5AFVA 3EIDA 1CKPA 4RFZA 2W99B 3H30A 3JXWA 3V5LA 3C0IA 2X2LA 4MBLA 3ZU7A 4O7TA 3OG7A 3HRBA 3R7IA 4H3BA 3F3TA 4UXLA 1ZY4A 3CBLA 3LJ2A 4L00A 5TO8A 3QFVA 4FTNA 4FOCA 3UZPA 3ZTXA 5ANKA 5B2MA 4GT3A 5F20A 5DA3A 3FC1X 4FV6A 3SHEA 4BCIA 4I22A 4GT4A 1UU8A 5F1ZA 2PMOX 3KULA 2NNWB 4BIEA 5M06A 3MH2A 4J8MA 2BVAA 2EXEA 4D0XA 4I6QA 3EYGA 2OXXA 3G90X 2B9JA 4G31A 4UV0A 2XM8A 5KKRB 3ZZWA 4HZSA 4YZDA 4YUQA 4GYGA 4J53A 4MD8E 4JOAA 4Y95A 3P08A 4AX8A 2BCJA 2J51A 4EONA 4DC2A 3F69A 4MBJA 3NUAA 4MXZA 5AR2A 3JUHA 1REKA 1Q8TA 4YJQA 2YHVA 2YM8A 4FT7A 3ACKA 2OFUA 1Q41A 1VZOA 4BCNA 3VRYA 4XG7A 4CKJA 2VZ6A 5EH0A 3LFQA 2P4IA 5HVYA 4OTQA 2R3RA 3QX2A 2YDJA 5TR6A 2QONA
chains in the Genus database with same CATH superfamily
3ZDUA 4X2KA 2R2PA 5HCXA 1V0PA 1CSNA 3Q5IA 4BJJA 1H28A 2WTJA 3EFKA 3R73A 4M68A 5I5ZA 4O38A 4ACCA 3R8MA 3U6IA 2GNIA 4BDIA 1NXKA 1WFCA 2JKQA 5KBRA 3FLZA 2XA4A 4FODA 4B8LA 3RWPA 4MEDA 3FQEA 3ZSIA 4YJNA 2X9FA 4CSVA 4BI1A 3KFAA 3LFDA 5LXMA 4FZ7A 2WEIA 3D5WA 4OUCA 4EH9A 2GMXA 4IVBA 4FTIA 2FSOX 3L9MA 4HCTA 1DI8A 3I6UA 4IFCA 2OIDA 4YLKA 5ETIA 4BIBA 4CLJA 5L3AA 2YDIA 1P4OA 3D7ZA 1ZRZA 4YZ9A 4YTIA 1OPJA 4ANQA 3BGPA 4L53A 4RQKA 2YWPA 4QP6A 3F3VA 5E8YA 2VO3A 4AFJA 4B99A 5HX6A 4I94A 4BTMA 3V04A 4CRLA 1DAYA 3MYGA 3OS3A 4U0IA 3QZIA 2XJ0A 2C6MA 3ZRLA 5CF4A 4FKTA 1OM1A 4BDCA 2QU6A 1M2PA 2YEXA 1Y6BA 2F7ZE 2OK1A 3FLNC 3QD2B 4FRFA 4ZLYA 5KHWA 5TF9A 3GC0A 4EOIA 4Y5QA 3DXNA 4WG3A 3R6XA 3E3PA 4HVIA 5DT4A 5HIEA 3TZ7A 4FMQA 4GL9A 4A9UA 4IADA 4MNFA 3W2PA 4KIQA 3DAKA 4DCEA 4ZLOA 3IDCA 3LAUA 4O0WA 2PVMA 5K4JA 4DTBA 4UN0C 4WRSA 1H26A 1KE7A 3L8PA 4PL5A 4QTCA 5FRIA 1UKHA 4AW5A 3Q3BA 3VONA 3RAWA 1BYGA 3GT8A 3ITZA 3EOCA 2OZAA 3QAME 3JY0A 3ZEPA 2BZIB 1Z5MA 3FWQA 3CD3A 4JDIA 1BKXA 5D11A 2BAJA 3GCQA 5AA9A 3NDMA 4X2GA 1KE6A 1UU9A 1MQBA 3PZHA 2PYWA 2W4KA 2FB8A 3I7CA 3L8XA 4BBMA 5DIAA 3BE2A 4FSZA 5HI2A 2X0QA 3DTWA 3I5NA 3M2WA 5DRBA 4D9TA 4RX8A 4RWKA 3NUXA 4G6OA 1GIHA 1WBSA 2XNPA 3CTJA 4BTKA 4HGSA 2W06A 2IZSA 3CJGA 4CMOA 3BYVA 3PVBA 4G3DA 2DQ7X 3NR9A 3QTZA 3PVUA 2E9OA 3VS6A 4FZ6A 1WMKA 5AP1A 3FMEA 3UVQA 3LFCA 3E93A 4FUXA 4L3LA 1OL7A 3G0EA 4FC0A 2PZRA 3GU5A 3QTWA 4F70A 4L68A 3TTJA 3GCUA 4X3FA 4QPAA 4JG8A 4CV9A 2GHLA 4Y73A 3W8QA 1S9JA 3MB7A 5LVOA 3FEGA 3R30A 1UNLA 5EKOA 1KUTA 1U59A 4FVRA 4RX9A 5CT0A 3TDWA 3LCSA 2RL5A 4EHGA 1AD5A 1XWSA 5DI1A 4EKKA 1OL1A 4XBRA 5K9IA 2VUWA 1YKRA 3QU0A 4RT7A 2A0CX 1Q24A 5DWRA 4O0UA 4EH4A 2R3NA 4YMJA 5HG7A 5E8UA 1ST4A 4MUQA 4D58A 2BR1A 2X81A 3DDPA 5EK7A 2YFXA 3R9HA 4CZUA 5G6VA 5KZIA 3MW1A 3UDSA 2A2AA 2GFCA 1GZOA 4PY1A 4RJ6A 4XUFA 5J8IA 2Z7SA 4ASEA 3UNJA 4BCJA 4DITA 4EH5A 4DHZA 5IQDA 2QOLA 3CY3A 3CR0A 4NIFA 3BHTA 5D7AA 1LUFA 2ETKA 3ZSHA 3HKOA 4WRGA 4A7CA 3R83A 4AACA 1JKKA 1MUOA 3K3JA 5CVFA 1FINA 3MA6A 4ZZNA 2C0TA 2YLFA 3A4OX 4H1MA 1GIIA 5LMKC 4FZFB 4G3GA 3CKXA 1TFFA 2PZPA 5GINE 2F2CB 4FV8A 3WF8A 4XHKB 3BV3A 4IM3A 4RX5A 5HD7A 5IQEA 3QQKA 4NK9A 3ROCA 4YGAA 3H0YA 1O6LA 3F6XA 3AKKA 1H1PA 4RGJA 4WKQA 3MVLA 5DR2A 3TV4A 3UYTA 3DBCA 2XIRA 5BYZA 3N9XA 2VWXA 3E7OA 4BDBA 3HX4A 4GSBA 3MESA 1T46A 5HIDA 5BMSA 2R0IA 5D9HA 3C4FA 1YRPA 3RHXA 3I5ZA 3G6HA 1Q4LA 4OTHA 3DDQA 4XV3A 4RFMA 3FMLA 4M7IA 5AUTA 3E3BX 4IAIA 2BMCA 4UBAA 3R7VA 5AEPA 5M4IA 3NNVA 4JBVA 3UO6A 3SD0A 2E9PA 3LIJA 3HMIA 2WTCA 3FMNA 2GTNA 3HZTA 1WBPA 2C6LA 4RA5A 3RBWA 2C6OA 3UG2A 5L2IA 2FSMX 4MXYA 2R3IA 1OIRA 2C0IA 3BHVA 2CMWA 2PE0A 3HAMA 3CQEA 2OU7A 4G9RA 4QO9A 2X6EA 2C6IA 2C69A 2BDFA 3ZLYA 4JDHA 2JITA 3F5PA 3LFNA 4KIOA 1IAJA 3D5XA 3DB6A 3QUDA 4C4JA 3NSZA 3Q9WA 1JLUE 5EM5A 1P5EA 3H4JA 4V0GA 1Q8UA 2XIKA 4FKOA 4R5SA 3C4EA 4YO4A 2IJMA 4UZDA 1IRKA 4E8AA 4U6RA 2NRYA 4G3FA 3ODZX 3LM5A 3V5PA 3DA6A 2ERZE 4BCFA 1G8AA 2YACA 3SC1A 2VTPA 3F7ZA 4BFMA 5HNBA 1YW2A 2W5BA 2G01A 4GJ3A 1HCKA 3OD6X 3R8UA 2RFSA 4KSPA 2XAMA 4HGTA 2C1AA 2P55A 4IB5A 4QTBA 5CEOA 5KMNA 1PRYA 2HIWA 3FLWA 4QPMA 2Y4IB 4NM5A 5FTQA 5AX3A 3GGFA 4D1XA 1OBDA 4Y72A 1JQHA 3PE1A 2B1PA 2V62A 4BYJA 3R9NA 4CEGA 3R7OA 4BDEA 4E4XA 5KUPA 2VGPA 3UOLA 3FXWA 3KK8A 4W9XA 4NKAA 5AP2A 5H3QA 3RZFA 4TKSA 4UMPA 2DS1A 3KULB 4S30A 4G16A 4FIEA 4KRDA 2GTMA 2QHNA 2XK8A 1YDTE 5DR9A 3AD5A 3OFMA 1JPAA 1LEZA 2WFYA 3A99A 4KIKA 3VAPA 1Z57A 3NUUA 1E1VA 5T68A 2C6TA 3LJ1A 4BDJA 1ND4A 4O82A 5M44A 5JEBA 4I0TA 3TIYA 3T8OA 4ENYA 3DLZA 5EM7A 3MSSA 5G1XA 3VS5A 4QP4A 5JFVA 1Q99A 5JFWA 4RZWA 4EBVA 3WF6A 4JG6A 3RALA 2BRBA 5L8LA 4QNYA 2JDRA 3PJCA 3LKMA 2OGVA 1KV1A 1OPKA 3R1SA 4ASXA 3HV6A 3IKAA 4FTOA 2X1NA 3OUNB 1UU7A 5HD4A 3DXQA 3FZ1A 1MRYA 1I44A 3E88A 3C4ZA 4BHZA 2VN9A 3AGLA 3GOPA 4JJRA 4BHNA 2VGOA 2OIQA 2XKEA 3D7TA 5EKNA 2HY0A 2OJFE 1ZYDA 4FR4A 3BRBA 3EQIA 3TCPA 4L8MA 4OAUC 4H36A 5IUIA 3L9NA 2CDZA 3DTCA 2Y6OA 3MGYA 4UMTA 3PP0A 4BCGA 2XRUA 4F9AA 4AQKA 3OOMA 4DFYA 1H1WA 3BL9A 4BJJB 2IVUA 2OH4A 4O4BB 4MF1A 4NKSA 1XO2B 4PDOA 3DNEA 3UIBA 4NSTA 1UU3A 4APPA 5E4HA 3PG3A 4BY9E 3Q4ZA 5BVKA 5BQ0A 3F5UA 4L01A 5GJGA 1W82A 3R71A 2RG6A 3NW6A 1OPLA 1MP8A 3FMJA 3SKCA 2R7BA 2C5XA 4F65A 3AC5A 4GJ2A 2Y7JA 3H3CA 5L4QA 5GJDA 5JQ5A 3GC8A 5HKMA 4OGRA 4EOPA 5IA1A 1QPEA 3E7VA 2C3JA 1YDSE 3LW0A 3CXWA 4GK2A 4LDTA 3OHTA 3SQQA 4E4LA 2G9XA 4KKEA 3OCGA 3SW7A 5AV3A 4FEVA 1BI8A 5HU3A 3FZPA 1TQIA 3OXTA 5IDPA 2LAVA 3S0OA 4DG3E 3NNUA 3QYWA 3FI8A 3F5XA 5D10A 5HG8A 1IASA 2WGJA 1BL6A 3O71A 3O8PA 3PTGA 2FUMA 3EQGA 3GCSA 1ZXEA 5CNOA 3C13A 4NT4A 4RG0A 5GZ9A 4X7QA 2WMQA 3N4VA 2RSVA 4C57A 4PQNA 1WBVA 4I5PA 2PMNX 4HCVA 2VRXA 2BIYA 2OXYA 3LXKA 4MXXA 2C5NA 2F2UA 2J7TA 2P33A 4HNFA 5CZIA 5ANDA 5FM3A 5CYIA 5B0XA 4DGMA 4M67A 3AKJA 3MH0A 4FK6A 1WVYA 4I6LA 2GQSA 2XKCA 2WQEA 3PSCA 4J99A 3NYXA 5TT7A 4C3PA 2W1HA 4FV7A 3FDNA 5KMJA 1V0OA 3TUCA 3SA0A 4XMOA 3PPJA 2FA2A 2OF4A 2KULA 2OZAB 2C3KA 4JDJA 4ASZA 5FTOA 3CJFA 1QPJA 3FXXA 4FIFA 3CTQA 3DKCA 3TYKA 4B7TA 2HELA 5BMMA 4EWQA 3BLHA 2GQGA 4PL3A 2XK7A 1NW1A 4GRBA 4P7EA 4XJ0A 4CFFA 4N6YA 1W84A 5LOHA 5TOZA 4AG8A 5KHXA 3GQIA 4GKHA 2QCSA 4CMUA 5AP0A 4EC8A 4DH1A 4R7HA 1OMWA 4ZTMA 3VIDA 4L7SA 3R7EA 3ALOA 3CY2A 5FEQA 3NVKI 5AV4A 2PK9A 2Q0BA 1NVSA 2AYPA 2J5FA 4O1OA 5EYCA 4D4RA 4U3ZA 5FGKA 4EK6A 2Q83A 3KREA 2YM4A 3OF0A 4TWOA 4EZ3A 3WYXA 4DDIA 1ST0A 4EOSA 4BDAA 3U4UA 4EHEA 3T3VA 3DBDA 5EW9A 3KCFA 5LJJA 3P78A 4I6FA 4RLLA 2OKRA 1W8CA 3BCEA 3R8PA 4ZMFA 4X3FB 1XJDA 4U8ZA 5ICPA 4F1TA 4MKCA 2WKMA 4ZOGA 1REJA 4H58A 4ZTHA 4XV2A 5DEWA 3WIGA 2G2FA 4FG8A 3ANQA 5AUVA 4HZRA 4O7ZA 2OSCA 5EYDA 4AT5A 1J7LA 3IECA 3GU6A 4OBQA 5CENA 3QF9A 4IWPA 5ACBC 3G51A 5IU2A 5M07A 2YM3A 5DMZA 3Q4UA 3LVPA 4G34A 4ZK5A 4ANSA 4BKYA 4DG0E 1H07A 4PRJA 2CJMA 3EB0A 3VUKA 3R9DA 3BYUA 4BI0A 2IZTA 1YHSA 1WVWA 4ZIMA 4AGUA 5C8NA 2BZHB 5JSMA 2UZWE 4NIFB 4D4SA 4FYNA 4DHJA 1ZAOA 5CSWA 4WNPA 4ZTLA 4ANLA 2WD1A 2X7FA 1L3RE 3UYSA 4O0TA 4OTFA 3NCZA 4JNWA 2Z2WA 3QGYA 3CP9A 5M53A 3KXGA 4XRJA 1U5RA 2O63A 3PXZA 4O0SA 3PPKA 2V7OA 3PSBA 5CTPA 3HLLA 3ULIA 4ACHA 3UMXA 3BLRA 3GQLA 4ZTNA 4AUAA 4DGLC 4O6LA 2RGPA 4DEAA 4L9IA 2FSTX 3O8UA 4IWOA 1CKJA 5KE0A 2QI8A 4JIAA 4C3RA 4DLJA 3LXLA 4QP2A 4BL1A 4EOJA 3KK9A 2VTSA 4C02A 4EK8A 3PJ2A 4BTJA 4DBXA 2XCKA 4QYGA 4RJ3A 4ZY6A 3EN7A 4KRCA 3HEGA 3TZ8A 3UPZA 2ZVAA 3I4BA 3HV4A 4CYIA 2HENA 4LL5A 4EK4A 4ZLZA 5A9UA 1UNGA 1LP4A 4F9YA 5B2LA 5EOBA 2WMXA 4C4GA 4WG5A 3U87A 5I3OA 3M42A 5KMLA 4NCTA 3O96A 4BYIA 1VR2A 2EB2A 4IJPA 3BHHA 4IX4A 3OWPA 3GI3A 3DGKA 4GYIA 2YABA 2OJJA 3E8EA 2WTDA 3KMWA 3D4QA 2IO6A 3RPYA 5AADA 4FT3A 4B4LA 2A19B 3A8WA 4DTAA 5IQHA 1MRVA 4UYAA 5C4LA 1W2DA 3P7CA 1VYWA 5FBOA 3U9CA 3I6WA 5KMIA 3R01A 4ZSGA 4U7ZA 1MRUA 3NIZA 4QTEA 3AD6A 1OGYA 3VBWA 3IDPA 4I3ZA 4ZSJA 3VF9A 4V0GB 2X8IA 4L3PA 4ZZOA 2GHMA 1JBPE 1M7QA 2ITQA 3R2BA 1IR3A 4S31A 4BDFA 4BCQA 3WZJA 4A06A 2J0LA 2BDWA 3PG1A 5IA4A 5ANOA 3QRKA 3TV6A 2ITUA 4Z3VA 4IC7A 2YJRA 3W32A 5M55A 4XP0A 1UWJA 3LCOA 3QCQA 3QX4A 5LCJA 5EQYA 3E8DA 4O7WA 2CN8A 4L42A 4S34A 5A3XA 3MFTA 2OBJA 1JAMA 4K18A 4FVPA 4U40A 3HMNA 5IA2A 4UMUA 4S32A 3MN3A 3PJ3A 1QL6A 3WILA 4EH2A 4BKJA 5M57A 3HNGA 4EOOA 3AC8A 5DPVA 2W4JA 4J8NA 4YJPA 4OTPA 3ZH8A 3NX8A 4P2KA 4ZAUA 4MX9A 2HYYA 4TW9A 3VQUA 3P79A 4GFOA 4W4WA 4MNEA 3WE4A 3ZLXA 2C5VA 2O5KA 4MK0A 5A4EA 2XEYA 5IG1A 3ETAA 3QCYA 2WMVA 3AKLA 3V8WA 1YHWA 4B9DA 4FT9A 2OJ9A 3OBJA 4WT6A 1XBCA 4KIKB 2Y9QA 4MF0A 5B2KA 2R64A 1H0WA 4LI5A 4Y83A 2YITA 4JR7A 4DH5A 2UZLA 3U4WA 3RP9A 4XOYA 4L67A 4WSYA 5AP3A 2HZIA 3VW6A 2R4BA 3EQHA 3QA0A 4Z9LA 4GFMA 4E6AA 5J5SA 2PVJA 3MDYA 4HYIA 3QQLA 4FG9A 3O8TA 2RFEA 4RIYA 2IVVA 4RVLA 4ZJVA 3ORPA 3D7TB 3EQPA 3FPMA 5J7BA 3W8LA 2J5EA 2I0YA 3DJ5A 1JKSA 4FE2A 2W17A 3EN6A 3UVPA 4F64A 3NNXA 3N4TA 1RDQE 3KKVA 3RCDA 4HW7A 1H00A 2ITOA 3ORXA 4IAAA 5AIRA 5LVNA 4XP3A 3V5TA 3KVWA 5HTIA 2VWWA 1O6KA 3W55A 5HO7A 3D14A 4MQ1A 3GBZA 2NO3A 5TE0A 1ZY5A 4GW8A 5DT3A 1OVEA 4YC3A 4ALVA 4DGGA 4O81A 4FV2A 4QDEA 3R9RA 3SG8A 4O4CA 4O91A 2YZLA 4TT7A 2O2UA 1FMKA 3V5QA 4E5AX 5F4NA 4IZ7A 1XQZA 3D83A 1W2FA 3UQFA 3AGMA 4Q9ZA 4GCJA 3KGAA 3EYHA 4PF4A 5ANJA 4YU2A 4E73A 2I0HA 1ZYCA 5AP4A 2JDVA 1ZYLA 2WTVA 2YLEA 3TKHA 4KIPA 5DFPA 3G15A 2VTIA 1W2CA 3CPCA 4O83A 4I5HA 3LPBA 3UTOA 4DGNA 4QMLA 5I0BA 3KRLA 3FZOA 4HYHA 2W5HA 4M69A 4R1YA 1Q61A 2W9ZB 4G6NA 5HE1A 4YZCA 3DZOA 3HUBA 1Y6AA 2PZIA 5E8VA 5HOAA 3I1AA 3EN9A 3IW4A 3W33A 4FIJA 4XG9A 4DDGA 3O7LB 5CLPA 3H9OA 1PJKA 3QWKA 4CT1A 4EOQA 2HY81 4BGGA 2OIBA 3EHAA 4AW0A 4JL9A 1F5QA 3QKLA 3UO4A 1E9HA 5J9LA 3U55A 2XNEA 3F2NA 3DCVA 3ERKA 4I93A 2QU5A 2QLQA 3NW7A 5E8ZA 3T9TA 3VUIA 4FA2A 5HQ0A 2UZNA 3VJOA 2ZM1A 2PMLX 5HLPA 4YC6A 3KRXA 2ITWA 5IUHA 3CC6A 4ARKA 3TN8A 2BILB 3JS2A 3VHEA 2YJSA 3RPRA 4C36A 3VS7A 1SYKA 3S00A 3H10A 5FWKK 2GPHA 5IISA 1XH9A 5HGIA 4QDVA 1LR4A 2Z7QA 2BAKA 3DOGA 3HMPA 5CU3A 5IEYA 1DAWA 4BICA 5DNRA 3NIEA 5BUEA 3ZMMA 3FKLA 4RX7A 4J98A 3CSVA 3HDMA 4F6UA 3TM0A 4U81A 3QD3A 3LMGA 5H2UA 3CCNA 3JY9A 3FYKX 4C8BA 4CCBA 3LMIA 4MWHA 2C6KA 3LE6A 4X2FA 4IDVA 4XBUA 5BNJA 3ORZA 4QQ5A 2X39A 5E1SA 2GS7A 3FKNA 4AA0A 3QRJA 2WMAA 3UIMA 4S33A 3BWJA 3PYYA 5EW8A 4QT1A 2GNJA 2WU6A 1NT2A 1ZMUA 3TI1A 3HAVA 5A6NA 2ESMA 3R8LA 2GS2A 2YCSA 3UIXA 3D15A 4Y8DA 2VTTA 5JGBA 2QG5A 5IQIA 2X4ZA 3FZSA 3ZO1A 2HK5A 3I60A 4IH8A 4XS2A 4RIWA 1OBGA 3IPHA 4K0YA 4MH7A 2WNTA 3AXWA 4JBQA 4TXCA 4FJVA 3EFJA 4TYIA 4ERKA 3IO7A 3AT4A 3MY0A 4C35A 5ITAA 5IF1A 1W83A 3ACJA 4A07A 1WVXA 3KVXA 3QQJA 4FV1A 3TEIA 2R3JA 4O0XA 1KWPA 3GCPA 3MJ1A 3Q04A 4DEGA 2AQXA 2VNYA 4AGCA 1H1SA 3TWJA 5EDQA 4RIXA 5DG5A 5BUIA 3MIYA 4RQVA 1NA7A 5DH3A 4G5JA 4KAOA 1R0EA 4IANA 2UW0A 4YR8A 1X8BA 2Y6MA 5AR3A 4OAVB 3I79A 3LFSA 4EK3A 2DYLA 3QC9A 5AP5A 4OTRA 2A27A 2JFLA 4R7BA 4XX9A 4FX3A 2VO6A 4EKLA 4Q2AA 2I6LA 5IZFA 5JH6A 1U5QA 4ZZMA 4FKVA 5EDRA 4BWXA 4OBPA 3DNDA 2PHKA 5CEQA 3R00A 2XK3A 4M0YA 4UMQA 5EW3A 5BVWA 5DHJA 5I4NA 5IQBA 3MFSA 3QRUA 3I7BA 3PY0A 3KMMA 4WA9A 2ZJWA 3II5A 4A9SA 3BZ3A 4KS8A 3AT3A 2VTLA 5FXRA 4DT8A 2GNHA 4JBPA 4W4VA 5E8TA 2B52A 4USDA 4DHFA 1H1QA 5CAOA 4GU6A 4RVTA 4I5MA 3GU4A 1CKIA 3LMHA 3UODA 5HU9A 4FNZA 2C6DA 3UOKA 4V05A 3ZONA 2P2IA 3HDNA 4QP3A 4UYNA 1GY3A 1JSUA 1ZMWA 4XG4A 1XBBA 2UW8A 1P2AA 4BC6A 4DFXE 4F63A 2PE1A 1U4DA 1JSTA 2RKUA 2QG7A 2VTMA 4ITHA 5AP7A 3KIOC 4QYFA 5LQFA 5M4CA 4FTUA 3TNHA 2IPXA 3BE9A 4KA3A 4YSJA 3UP2A 3NYNA 3R28A 3HECA 2QOFA 5AR7A 2XIXA 4QMXA 3QHRA 3A7FA 4TN6A 5HG5A 2ZV9A 3EQDA 3MY1A 3ML1A 4PPCA 3U9NA 4RWJA 5H8BA 1KE5A 3ZOSA 1HCLA 5EQPA 2CGWA 3KL8A 3ZBXA 4F99A 2XK9A 4OTIA 3PY3A 1SVEA 3B8QA 3K3IA 5BV3A 3JPVA 3L9LA 2XJ1A 3DFAA 3GB2A 3QZFA 4W4XA 3F2RA 4IE9A 4K2RA 3ZUTA 3QWJA 4CFMA 1ZYSA 5DRDA 3FZTA 4MNEB 4OTGA 1CDKA 2X4FA 4IAFA 4MCVA 4OT5A 4WNOA 3RTPA 4AZWA 4FVQA 5AV1A 2PVKA 2WIPA 4FI1A 3OCSA 4X3JA 3BLQA 3QTQA 3FY0A 2CCIA 2B53A 4MD9E 4ZJJA 4EC9A 1YXTA 4EBWA 1B39A 5IH5A 2O8YA 3ROYA 4EYMA 5LVPA 5E9EA 4IX3A 2WTKC 2W5AA 5EI6A 1OITA 3V8TA 4X2JA 4FT0A 2PPQA 3MTFA 4ACDA 3KB7A 5KMMA 5HBHA 4LV7A 4PX6A 5F9EA 2CN5A 1P4FA 4QNAA 3OW3A 1G8SA 3DBEA 3N51A 2VWUA 5CF5A 3QA8A 4J1RA 3NNWA 5E90A 2ZFYA 2W4OA 2RIOA 3DK3A 3WZKA 4RIYB 4AW2A 3C0GA 1YWVA 4YNEA 2WAJA 4AF3A 3EKKA 4NFNA 4P5ZA 3QXOA 1A48A 4O7NA 2XKFA 4PDYA 3COHA 5J9ZA 4U43A 4N6ZA 2ZOQA 5LCKA 4BIDA 2QO9A 4JLCA 1F0QA 5C1QB 4LRKA 3A4PA 5CVGA 1G5SA 3REPA 4EUUA 4QMTA 1Y91A 2IVSA 4U42A 3ZHPC 4BKZA 2OLCA 4F0IA 2XKDA 4XG8A 1XHAA 4QMVA 4I0RA 1M52A 5HVJA 4FSQA 3DK6A 3F88A 4PMSA 5LVLA 4C2VA 4CTBA 1UA2A 5KKRC 1G8JA 4RSSA 4FSMA 3TKIA 3BGQA 3KXNA 4M0ZA 1XMMA 3HMOA 4FF8A 4FTQA 2XK4A 4L52A 1ERKA 3RHKA 3ZO3A 5HNIX 3DJ6A 1URCA 4BVUA 2QC6A 4WUNA 4ZTRA 4XG3A 2JKOA 4FEQA 2CCHA 5HE2A 3RI1A 2UW7A 5LMAA 2ZDTA 3LQ3A 4PPBA 4I0SA 4IZ5A 4LM5A 1RQQA 3P9JA 5DBXA 1IA9A 4PUZA 2C0OA 4IB0A 3VBTA 5ANIA 3W0QA 3Q6UA 2ITZA 2J90A 4Y5HA 3KXHA 3PA3A 4QTDA 1QCFA 2EVAA 5HCZA 2QKRA 4C59A 3I0OA 4CFUA 4DCAA 1PXOA 1XKKA 4QQCA 3W2QA 5HNGA 3C5UA 4M69B 2CPKE 3NUSA 4AN2A 4ITJA 1VYZA 2V55A 4G6LA 5K0KA 4DEBA 3AQVA 4N4SA 4AZVA 4K9YA 4AGDA 1IEPA 3ORTA 4DFNA 4GUEA 4ZS4A 2Y8OA 5T3QA 4EZ5A 1WCCA 3SXRA 5IMXA 1YI4A 3NAXA 4O86A 2UW3A 3ELJA 2W1DA 3H9FA 4G17A 3UC3A 3ZO4A 3WBLA 4EH3A 3SXFA 4YZMA 5BVNA 1UVRA 3EH9A 4LMNA 4PMMA 3S2PA 3QTXA 2JBOA 5IQFA 4ID7A 4KSQA 4F78A 4UY9A 2YM7A 4U5JA 4KB8A 4BCMA 3DB8A 4RPVA 5E8XA 1EH4A 1PMUA 4PMTA 1DS5A 4EH8A 2XH5A 4FSRA 5H8EA 5CI7A 2SRCA 4IVCA 4WHZA 1XR1A 4YHTA 2WQMA 1JOWB 5IA3A 4NWMA 3WOWA 1GJOA 4JAJA 3ZM9A 3A7GA 3UC4A 4D2TA 3ZXTA 4OW8A 3OUKA 3PXKA 2JAVA 4A9TA 3ORLA 5IDNA 3TXOA 3NUYA 3E92A 5BPYA 5HLWA 4IVAA 3ZUUA 2W1IA 5FEDA 5JZJA 4GH2A 1J7IA 1XH5A 3TTIA 2QOIA 2QLUA 4D5KA 1VEBA 3WIKA 1PXNA 5AIKA 4C3FA 2QOHA 5LVMA 2XP2A 3ZLWA 3TNQB 4USEA 3AMAA 4QMWA 3LFEA 1ZOEA 3JVSA 5HBEA 3P86A 5ANEA 1PYXA 1XH4A 4O0YA 5I9UA 5HICA 3O23A 4DT9A 4ORKA 4AXDA 3W0MA 3AD4A 5IPJA 5A6OA 4KINA 3NUPA 2BIKB 2YAKA 3D5UA 4BGHA 2ZAZA 3KN5A 4RIWB 4AFEA 1VLRA 3IW8A 1RE8A 2ZDUA 5I9WA 5JT2A 1ZZ2A 3Q32A 3GCVA 4M66A 4BCKA 2P2HA 4DHIB 3QALE 3O50A 4I41A 3GXLA 2IW8A 4G1WA 2WZJA 4O22A 3PA5A 5AWMA 5A4TA 3F5GA 5J87A 3VUMA 4RIXB 4YBKA 4YSMA 2B9FA 5AMNA 2R3KA 2ITVA 2UZUE 2Z7LA 3PWDA 3OEZA 2HAKA 3V51A 5AX9A 3VBXA 5AM7A 5I9VA 3C4XA 5FBNC 3WZDA 2PULA 5M09A 4FKSA 1PMNA 3KXXA 4F6WA 5CEPA 3EQBA 5DGZA 3MA3A 3ALNA 3POOA 2OWBA 2XYNA 3BQCA 5FG8A 4H3PA 4AU8A 4NU1A 4FOBA 2HCKA 3MVMA 4I1ZA 3UNZA 2C1BA 4FZAB 2B55A 4BWKA 4C58A 4WNKA 4E5WA 4WSQA 4JVGA 5JFSA 1NVRA 2OH0E 4F9CA 4FTKA 3IGOA 3R8VA 5CSHA 3IS5A 3C51A 4D2WA 4E5BA 2A98A 4O4EA 5JQ8A 5IEVA 1IG1A 5J95A 4F7JA 2HWOA 1LPUA 4FL3A 5HX8A 3GENA 3CLYA 1ATPE 1AQ1A 5ETAA 3WI6A 1H4LA 3EQCA 2PUPA 3BEGA 3OTVA 1FVVA 1OL5A 2JIVA 3MFUA 4AA4A 4YLLA 3MVJA 4QMYA 2UUEA 2YIQA 3DZQA 3Q6WA 4F08A 3LFBA 2W1EA 5CALA 4PP7A 1JKTA 3BU6A 5E7RA 1OECA 3EQFA 4QP9A 2FSLX 2ONLC 3ZFMA 2VTJA 4UMRA 5HBJA 5CF8A 5HLNA 4NL0A 4KWPA 4WOVA 4I4FA 1FOTA 5AUXA 4APCA 3P5KA 3W16A 3P1AA 5AR5A 4I92A 1H01A