3ZFMA

Crystal structure of ephb2
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
279
structure length
248
Chain Sequence
EIDISCVKIEQVIFGEVCSGHLKLPGKREIFVAIKTLTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Completing the Structural Family Portrait of the Human Ephb Tyrosine Kinase Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords EPHRIN TYPE-B RECEPTOR 2
total genus 78
structure length 248
sequence length 279
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zfmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zfmA01
1QMZA 2JDOA 5CEIA 4DH5A 2UVYA 4FTKA 1APME 4C57A 1V0OA 4YC8A 1TQIA 2OF2A 3IDBA 4QMLA 3OBJA 4CKJA 3VIDA 5DPVA 2PZ5A 5GZAA 3CS9A 4OBQA 4BYJA 3R8VA 3DXQA 3FLNC 3WF8A 3LMHA 4D2TA 1RW8A 1J91A 3AC1A 5M4CA 1OB3A 3C0HA 3ZUUA 4UMPA 5DYJA 3UZTA 4EK8A 2J5FA 3KU2A 4JOAA 4K9YA 4M7IA 5GJFA 5IEXA 4KRCA 2ZAZA 3F2RA 3N4TA 3LOKA 2Q0NA 3VNTA 3FI3A 3SGCA 4N57A 3FYJX 4BDIA 4J97A 3VC4A 5BYYA 4L52A 4L7SA 4R1YA 4I6HA 4TYEA 3ZFYA 4EOPA 3VBYA 3TKUA 4DFXE 5AP0A 1J1BA 2GFSA 4PQNA 2JD5A 3RBWA 4F9WA 4V01A 2IO6A 3F82A 4R8QA 2R4BA 3AQVA 4D2PA 5K3YA 3LMGA 4NSTA 3QTSA 5KCVA 3AD4A 2YACA 5L2QA 3LKMA 2YIRA 3C9WA 3ULIA 4DFUA 4JAIA 3FKNA 2WMQA 2QVSE 3DOGA 5CU2A 4QMPA 1Q24A 1GAGA 2XKCA 4AUAA 3AMAA 3TWJA 4ERWA 4G3CA 5HLNA 5L2SA 4ACDA 4FI1A 5E8YA 2WMXA 4MAOA 2DQ7X 3TACA 4XP2A 3FQEA 1UKHA 3MTFA 3QALE 4MWHA 3QKLA 3PSDA 3O51A 4TXCA 3VULA 5C4KA 3BYVA 4FTOA 4GW8A 2PPQA 3FBVA 5IQGA 3PFQA 3R8MA 2W1FA 1H0VA 1SMHA 2B54A 2Z7LA 1YKRA 3KULB 3IDPA 2QOOA 4RA4A 2PE0A 3LXLA 4IAKA 3LE6A 2VU3A 4AZEA 3GU6A 2W9ZB 1M2PA 4M97A 3SG8A 4EONA 1FGIA 3CKXA 5IUHA 4JRVA 2O5KA 4XOYA 2VTLA 2E9NA 2W4OA 5CEMA 4CTBA 3PA3A 3M1SA 3TN8A 3NUNA 4EOSA 3EN4A 4TYJA 1ZOHA 3OXZA 3FLZA 4LYNA 3SW4A 3R1NA 4E7WA 2OBJA 3BV2A 3CKWA 4CFXA 4NCTA 3GQLA 4O0VA 4N6ZA 2UZVA 4UWCA 4C4JA 2OU7A 4OTWA 5C27A 4FZDB 3BWJA 3OWJA 1BI8A 5M57A 3IW7A 1XBCA 5JGAA 2RFEA 3HNGA 1SNXA 1LUFA 4CYIA 4X2NA 3PY1A 4XG4A 2BTSA 4MF1A 5GNKA 4DGMA 5LVPA 3U6HA 5J9LA 2NNWB 4XG7A 3QKKA 1L8TA 5IQIA 3CTHA 4BY9E 2A27A 1V0BA 5BQ0A 5KO1A 4L44A 1ZMUA 1OI9A 3JUHA 2CCHA 2HENA 3NIZA 4YC6A 5AA9A 5CAVA 3AT3A 4A4OA 3Q60A 4APCA 2BZKB 3BU3A 3BEAA 3WBLA 4FV2A 4QYHA 1XH9A 1REKA 2Y6OA 3VBVA 3DDPA 4M66A 5BX0A 3KEXA 2H6DA 4YC3A 1M7QA 4DLIA 5CI7A 4DBXA 1QPEA 1Q61A 3Q32A 1PYXA 4FOCA 4ACHA 4L00A 5FUTA 4LUEA 2BDJA 3R7VA 3ZMMA 5DRDA 2OK1A 2WMSA 3DGKA 5HTBA 1G8AA 5L2TA 2VNYA 1URWA 5JFSA 4NFMA 2R5TA 3VN9A 4JQ7A 3RM6A 4P90A 4I41A 3E93A 4I5PA 3GOPA 2J6MA 3LFQA 3F5PA 5C8MA 2YZLA 3U55A 3G51A 3QYZA 1W84A 2XH5A 3SLSA 2QO2A 4DH3A 5CSVA 5EHOA 5HKMA 2YA9A 1OPLA 3KF7A 3QC4A 3D5VA 4UYNA 4BTMA 4BWPA 4ZP5A 3ZBFA 5HTCA 4AOTA 2OO8X 4KAOA 4BDAA 2XS0A 3U6IA 2HWPA 2HY0A 3F69A 3TUCA 2ETRA 5CANA 3QKMA 2CN5A 4LG4A 3NCZA 3MIAA 5E7RA 3VQUA 2C30A 4GCJA 4FYOA 3H9RA 4PDSA 3O96A 4ANBA 4F9CA 3ATTA 4OTDA 3I5ZA 5KBQA 2YM7A 3AMYA 3UTOA 2B4SB 4PRJA 3PG1A 4CKRA 3BZ3A 5ANOA 4W9WA 5FQDC 5JFXA 4D4YA 3ORIA 4RC4A 3QA8A 4J71A 4AGWA 2O2UA 4ZMFA 4KS8A 3HAMA 3EQRA 3P4KA 1CM8A 3Q3BA 3C0GA 3Q4CA 3L8XA 4Z9LA 2ERKA 3AD6A 3G0EA 3PZEA 4ANMA 3FJQE 2BDWA 3PA4A 3QRTA 4NTTA 4BIEA 3UMWA 1B38A 3ZTXA 3FMKA 3QUPA 2V0DA 2JIIA 3R22A 4IW0A 4U81A 3TJDA 2BFXA 2VWXA 4IB3A 4NIFA 4EH7A 2Q0BA 3D5WA 3F3UA 4D5HA 1K9AA 2QQ7A 4HYUA 3UO5A 5HO6A 4DH7A 4DGOA 4BI2A 2X0GA 3IOPA 1PXLA 3R83A 3T3VA 3UP7A 4KKHA 3V01A 2JKMA 2CGVA 3KCFA 4U9AA 3W16A 4E5AX 1PMNA 2YEXA 4PF4A 1JSUA 3A8XA 3G90X 4FTCA 3SRVA 4IAAA 4M0ZA 3MJ1A 4CT2A 3OP5A 5HD7A 2XM8A 4FNZA 3SAYA 1U59A 3PPZA 3S3IA 3QCSA 4HYHA 5AWMA 5H8EA 3TUDA 2PU8A 4TW9A 1PXJA 5CU6A 2XM9A 2PMLX 4S2ZA 2RL5A 3WF9A 5L8LA 2VWBA 4RJ4A 2ITOA 3ZRLA 2ZV9A 4BKJA 4CLIA 2XUUA 3E63A 3UOKA 2UZEA 4JBPA 2X7OA 3QD3A 3KN6A 3PG3A 4Y5HA 3EQFA 4DCAA 3RCJA 4I93A 4IFCA 3VUKA 3PVUA 5J9ZA 2PE1A 2QOCA 3IKAA 3AG9A 3Q5ZA 4J99A 4NKAA 1KV2A 5A14A 2ZJWA 4I6FA 5HE0A 4AFJA 5AAFA 2IZRA 4QMTA 3ZM4A 1HCLA 2FA2A 4EZ5A 1VR2A 4R78A 4BCJA 3GQIA 3PXZA 1KWPA 4FVQA 5L6WL 3IW4A 1IEPA 3WF6A 3V8TA 3P5KA 2RIOA 5AR7A 5HX8A 3QQHA 3SA0A 4GG7A 4OTFA 5EYCA 2A1AB 5TE0A 2J4ZA 3C13A 2Y4IC 3QX2A 4KSQA 4LV5A 3Q4UA 4W4XA 3VS7A 3QBNA 2WFYA 5CWZA 4F7JA 4RIYB 2CDZA 4XCUA 5AIKA 1OKVA 2J7TA 1GY3A 2O64A 5IKWA 3V5PA 1QPDA 1OIRA 2I6LA 1TQMA 4GYIA 2YIXA 4MKCA 4CFUA 5CASA 3FZ1A 5IQBA 4YTHA 3L1SA 2P55A 2R3PA 4F1MA 4Z7GA 2XK6A 3DK3A 5DEWA 2PE2A 3NRMA 4EHGA 2O65A 3QZFA 3G15A 2YN8A 3AT2A 5L2IA 3DPKA 3LJ2A 4M13A 1GZ8A 1OIYA 2BILB 4CZTA 1M7NA 4IBMA 4BCPA 3UOHA 1P4FA 4G17A 2BIKB 1ZY5A 4FTLA 1GJOA 2PZIA 2XK9A 4BDKA 5TOZA 3TEIA 3KY2A 2J2IB 5D12A 2IVUA 2J50A 4XHKB 3F5GA 3DZOA 4D2VA 2XNOA 3CCNA 5KZ0A 2VTAA 5CF8A 5I4NA 4K11A 4L3PA 4LGGA 4BRXA 3TV6A 3H9FA 4JX7A 4NKSA 4YTIA 2B1PA 5AP3A 4AZSA 3Q2MA 1LP4A 3N4VA 2OZOA 5KX8A 3KF4A 5CS6A 2PZRA 3ZONA 3NVKI 1FMKA 3QLGA 4FEVA 5CQUA 4ONAA 2VO6A 1Z5MA 3C4WA 3FZSA 3ORNA 3QRUA 4FKJA 2WHBA 3GCUA 5TF9A 4EHVA 4CSVA 4FSUA 4DFLA 5AEPA 5DE2A 4ENYA 3KREA 2CNVA 4O7SA 3WIKA 1H1SA 3IOKA 5L6PA 4PDOA 4B6LA 3DBQA 3M2WA 3NMUF 3W2PA 5IUGA 4WUNA 5DR6A 3S00A 2QOKA 1FOTA 4I0RA 4FSZA 4WT6A 2UVXA 5I3RA 2JIVA 4ZK5A 4QO9A 4F65A 1Q8WA 3ODYX 4MBJA 4C58A 5FG8A 4DG3E 3GC9A 1WBWA 3VUMA 4FEWA 4YTCA 4KIPA 4HZSA 4ALVA 5LWNA 4F9YA 2XJ0A 3JY0A 4YUQA 2BUJA 5IQHA 2YCFA 4RIOA 3CE3A 3K54A 4EH3A 3DKFA 5KMIA 3PP1A 4YNEA 3ORTA 5EDPA 4S30A 5FGKA 4HVIA 2WTKC 2YITA 4PX6A 4WOVA 4L7FA 2C3JA 1BKXA 2PMOX 3BLHA 3OY3A 5CNNA 4O83A 3OXIA 5C4LA 2OIDA 3D2IA 2OZAA 4QYFA 2R3NA 5CAPA 5AUVA 4XV9A 3THBA 3Q96A 3R01A 3M42A 4O0XA 1PXOA 5J9YA 2AYPA 4U5JA 4UMTA 3C4FA 4BCNA 1QPJA 5KMNA 5HBHA 2WTIA 4BBFA 5K9IA 2PY3A 3FKLA 2BVAA 1Q3WA 1PJKA 4IM3A 4M84A 5BVKA 4NYEA 3HEGA 4X3FC 5AR5A 4C38A 4IB5A 4UMRA 2ZV7A 4AU8A 3ZC5A 3L8SA 1M14A 3QQFA 3Q9YA 3IGOA 5TR6A 2ZM1A 1REJA 4A9YA 1OKYA 1YI6A 3CC6A 3K5UA 3UVPA 2JDTA 4QP6A 5LMKC 3L9MA 4F6WA 2YIYA 3UQGA 4CFFA 4GT5A 5EM5A 3F3TA 4RVMA 4KBKA 3HMPA 3JXWA 3S4QA 4YMJA 5C1QB 4WG4A 2DWBA 3NGAA 4JQ8A 1WZYA 1NY3A 4C34A 3W1FA 4F1OA 5HIEA 4CFWA 5LMAA 3ALOA 3E8CA 3QZHA 4PPAA 4JG7A 4WA9A 3F3ZA 3FAAA 5J7BA 4IANA 2V7OA 2W1GA 2IZSA 4HYSA 5HI2A 3RZFA 1LEZA 4QMYA 3UQCA 3I4BA 3AXWA 2OJJA 5GZ9A 3BHVA 1Q8TA 5J79A 4FKSA 1OKZA 5DI1A 3FXWA 4XNEA 4ZY4A 1GZOA 3FY0A 4XRJA 3HV3A 4IVCA 1NA7A 4FZ7A 4HVDA 4O81A 3GCVA 2GSFA 4DAWA 2PVRA 5E8WA 4XYFA 3V5TA 4CYJA 5KHWA 2CMWA 3BELA 3GNIB 4HCUA 4MNEB 4QOXA 3HGKA 3QC9A 2EXCX 5JGBA 4EQUA 1ZYLA 2HW7A 1Y6AA 4ZY5A 1NVRA 4YZCA 5A4QA 2Y6MA 3RK9A 3U8WA 2C6EA 4QTEA 4DTBA 4EH8A 5EK7A 3C7QA 1OUYA 4JDHA 3TV4A 2WMWA 5B2LA 5AP6A 3BYMA 5IA4A 4E1ZA 4O1PA 4TPTA 2YHVA 3UO6A 4DEDA 1H24A 1OIQA 3BKBA 3RAKA 4UMQA 3I7BA 4RIXA 4WRSA 5CAQA 4IE9A 3I1AA 1WBSA 1YRPA 3S0OA 2YJSA 4FX3A 2I0VA 3DXPA 5FEEA 1ZZLA 2RFSA 3GC8A 3P1AA 3G6HA 4OTRA 2F2UA 5CF5A 3R7YA 1MRVA 2XNGA 3D5XA 4UWYA 4OR5A 3CLYA 4X6RA 3FMMA 5HE1A 1HCKA 4OGRA 4N70A 3PVBA 2PVHA 4A7CA 4DEIA 1WBNA 2AC5A 3MI9A 5EW8A 2VTMA 1Q3DA 2X6DA 4E20A 4EI4A 5HO7A 5LJJA 2WU7A 5FRIA 2UZBA 4BF2A 3ORXA 4J96A 5BUIA 4ZTHA 5CENA 4QMSA 2YCSA 3ORLA 4I24A 4L45A 4LMUA 3R63A 4BL1A 4GKHA 4RX5A 2BRGA 2JAMA 2PTKA 5L3AA 4BCKA 3UPZA 3PP0A 4N0SA 3WZJA 5BVFA 4LFIA 4ZIMA 3LPBA 1RJBA 5AAGA 4XG9A 4GIHA 4YZ9A 4TNDA 4A9SA 2CCIA 4QP1A 5LVOA 2R3FA 1PW2A 5AADA 5J87A 4QP4A 4DC2A 2GHMA 5CTPA 3H9OA 2WO6A 4FNWA 3B8QA 4IX4A 5AV1A 4BWKA 4L8MA 4M67A 3FC1X 4ZTLA 2X7GA 1BYGA 4JG8A 5BVEA 3UNJA 2X4FA 4Y83A 2UZNA 2Z8CA 5ITAA 1SM2A 2NRUA 2W1HA 1YOMA 2UZDA 4HYIA 2JDSA 2PUUA 2F7XE 4EYJA 4MXYA 3ZZEA 3NNWA 3EH9A 3QTIA 4K33A 4YHJA 3EFLA 1FGKA 2XNNA 1R0PA 3UMXA 5K4IA 2OXDA 1YWNA 2G1TA 2YM3A 3II5A 3ORKA 5FDPA 1Q99A 5JK3A 2GNJA 2W5BA 4KIKA 5CT0A 3R7UA 2XKFA 4TTHB 4UN0C 1XKKA 1ZXEA 2I7QA 4IWPA 4O0UA 5IA1A 2HZIA 5F20A 4C59A 1Y8YA 4BZNA 3RPVA 4BVUA 1Q8UA 5HESA 1Q8YA 3KVXA 4EHEA 4HGLA 3QTWA 3KRWA 4G34A 4RIWA 1J3HA 1O9UA 4F0IA 5AAEA 4UB7A 3A61A 3LFDA 4EK6A 4FGRA 5M08A 3DBFA 2X39A 3FHIA 1OKWA 1WAKA 3FZTA 2R0IA 2YWPA 1YDSE 4GT4A 4QMVA 1WBPA 3BV3A 4RVKA 3REPA 4J98A 5T68A 2C6IA 1G3NA 3S95A 5A4CA 4Z16A 3UZRA 3DFAA 5G1XA 5ACKA 1RE8A 3OROA 5JEBA 3QQLA 2W5AA 3MH2A 3OS3A 2VGOA 3TNWA 3V3VA 3ZEWA 4BC6A 5K5XA 3BPRA 4L3LA 5IPJA 4RFYA 3K3IA 4YZDA 1V0PA 1R3CA 3NCGA 3SXSA 4H39A 3PLSA 4LGHA 3BHUA 4NT4A 1T45A 3A7FA 4RIXB 5DT3A 3EL7A 4HVSA 4AW1A 2R3LA 1CKJA 5I0BA 3NVMB 2NPQA 2ZB0A 4W9XA 4Y85A 5ACBC 3VVHA 4Y46A 4ANNA 4D0XA 4GH2A 2HZ0A 5HHWA 4FV1A 3MTLA 4L46A 4JLCA 3GEQA 3VS3A 3IW5A 3DKCA 4L53A 2HCKA 2JAVA 3FMDA 3LQ5A 4FT9A 2VWYA 3OUNB 3RWPA 1YXXA 2WMVA 3EN6A 1XWSA 2BZIB 4ID7A 3C5UA 1V1KA 4NM5A 3F5UA 4EKKA 4IX5A 1SNUA 4D58A 1H26A 3VHEA 3HLLA 5KMOA 3HV5A 1UV5A 3LCDA 4O1OA 2W9FB 3MH0A 5AUXA 5A6OA 1ZARA 2R3RA 2HK5A 2CLQA 2X8EA 3I0QA 4M15A 4AGUA 2HELA 2GS6A 3I6WA 4GYGA 1CKIA 4I6BA 3ZCLA 1YXTA 4G9RA 3KRXA 5HQ0A 3R9NA 5BPYA 4BBMA 2CKEA 4FG9A 5L2WA 4DEHA 3DB8A 4XUFA 2X2LA 3U9CA 2BRBA 5HE2A 3EB0A 3MVJA 2PUPA 5JMSA 2NO3A 4IIRA 4FTRA 4UV0A 4PP9A 4R1VA 3L9LA 4FYNA 4JI9A 5EI6A 2OJGA 1IAHA 2HZ4A 3JVSA 3PTGA 4DEGA 2J0JA 2CGWA 5KHXA 2R9SA 1ZYCA 4IACA 2C1BA 4TN6A 2C3IB 3BBTB 3CP9A 1J7UA 1YVJA 4ALWA 4DFNA 2X7FA 2YAAA 4EOKA 1IAJA 2BAJA 2JEDA 3O8PA 2YIQA 3A4OX 4I6QA 4IHPA 4J8NA 4KSPA 4DF3A 1XQZA 3FLWA 4TY1A 3GUBA 4CCBA 2PVKA 1OUKA 3AC3A 4O6LA 2B55A 3KRLA 4ITIA 2YFXA 4O7VA 4AOIA 2XYUA 2WIHA 3RP9A 5M53A 2BR1A 4BGQA 5EFQA 3TZ7A 3OY1A 4E4MA 4QPAA 5HEZA 1UWJA 3W2QA 4FG7A 3AC8A 3FSFA 4HJOA 4QPSA 4R7HA 4RFZA 5CAOA 2QOLA 2QOIA 2H9VA 1F3MC 3LFSA 3CJGA 4WD5A 4I5CA 3SRVB 3UJGA 4D4RA 5I9WA 4QTDA 2PZPA 3MDYA 3FI2A 4FV7A 3UG1A 3R2YA 2WXVA 1YHVA 4YSJA 4O27B 3QU0A 5E8UA 3MBLA 3TDWA 2AC3A 4QMOA 4DFYA 4PMPA 4RX7A 4A4XA 4ALUA 4ANQA 1VYWA 3DBCA 4YJUA 2QU6A 4W4VA 2YJRA 3K2LA 3QRIA 4WBOA 3SKCA 5EYKA 4KBCA 5AM6A 3TZ8A 2WAJA 4C37A 2X8IA 1B6CB 4K77A 2H8HA 3I7CA 4HCVA 4EK3A 4CLJA 3DTCA 5JFWA 3HRFA 5FTQA 3KFAA 1DM2A 3SX9A 3PXFA 2HXQA 4JDKA 5K4JA 5AUZA 4MVFA 4R77A 5AP1A 2FSLX 2O0UA 1OL7A 4FL2A 4WNMA 2QD9A 4FSNA 4QTCA 2FSTX 2VWVA 4E5WA 4MD8E 3PPJA 3SG9A 3TV7A 1JNKA 3FLYA 3HKOA 3KXXA 1R78A 2P2IA 4XRLA 2G01A 2ERZE 5LOHA 2PVLA 4F7NA 1XBBA 3QWJA 4L42A 3UIMA 5CZIA 3D4QA 3G33A 4XV2A 4LM5A 2GU8A 4LV8A 2OKRA 3ZLYA 4DG0E 5GIOE 3KXGA 3R73A 4C8BA 2BROA 5AUTA 2XK7A 5BNJA 4K0YA 3NDMA 3VUGA 4C3PA 5CU0A 4YLJA 5GINE 2C6MA 3IQ7A 4GL9A 3FMEA 4OAVB 4IMYA 2WQMA 5EM7A 3R7IA 3W33A 2XNEA 3DNEA 5IH4A 1W83A 1A48A 1AQ1A 3ZLWA 5EOBA 3POZA 4EQCA 4PDYA 2QO9A 5CSWA 3C50A 3KGAA 4JIAA 3EN5A 5CVHA 1QCFA 3W2CA 5IEVA 4NH1A 4L9IA 5ICPA 2BHHA 4BBEA 2OJFE 4RRVA 4QMZA 3LLTA 3DQWA 4WSQA 3UYTA 4P2KA 3SV0A 1BL6A 1O6LA 2X2KA 4FT7A 4RX8A 5HZNA 5E92A 3UVQA 4F7LA 2FSMX 2JBOA 3DXNA 5HCYA 3ROYA 4GK3A 2C6DA 4I20A 4QT1A 2WD1A 2FB8A 3ZFMA 5DLSA 3SC1A 3ZXTA 4ANSA 5CEOA 5CY3A 1ZYJA 5CI6A 3ZSIA 3DTWA 3UVRA 2VTNA 4BTKA 3QWKA 1NW1A 3NYNA 3PJ2A 2IN6A 4PPCA 3TKIA 3EQIA 2BRHA 4LOOA 5AMNA 3E5AA 4G2FA 2W1CA 4DFBA 2I1MA 3MJ2A 4DCEA 4RA5A 4KINA 2CPKE 4BDFA 2HOGA 2R3HA 3G2FA 1CMKE 2PL0A 5HE3A 4QYGA 4MNFA 2V7AA 3DBDA 2C0IA 2CGXA 3DY7A 5IISA 3CY2A 5B7VA 3WZEA 3DNDA 4P5QA 3R8PA 4D1ZA 5IZFA 2QG7A 4U80A 3QQKA 2UZLA 3NW7A 2A0CX 4EHZA 3NUAA 2VGPA 5LMKA 4C0TA 2QURA 4X2FA 4O6EA 5L8JA 3KKVA 4ZSJA 1XR1A 2XMYA 3CJFA 3QTUA 4WBBB 5CAUA 2WOUA 1U4DA 2VTRA 4G9CA 5AX9A 3PDTA 3OFMA 3VBWA 1WVYA 3M11A 5IA0A 3A62A 3WF5A 4XLIA 2R3JA 1GZKA 2UW6A 3QHWA 4H3QA 3LFEA 4BIBA 4RPVA 4D9TA 4FKUA 4TNBA 1PMEA 4I92A 1IASA 3ZEPA 4QYYA 1XH5A 2B0QA 4IAYA 4EOJA 2HW6A 2UZTA 4FVRA 5K5NA 1Y8GA 4RT7A 5CSHA 1WFCA 3DFCB 1H00A 4G6LA 4ZSLA 1YOLA 3GCPA 2J0MB 4KA3A 4Z3VA 5AV3A 4O7NA 5I9UA 1PRYA 5DR9A 1ZWSA 3B8RA 5FXRA 5F1ZA 3P7BA 1PXMA 3DDQA 3MW1A 3TL8A 4AT5A 4UZDA 2EB3A 4OW8A 4ZZMA 4U6RA 3DCVA 4YBKA 2QKWB 3OVVA 3R7OA 2BAQA 3QA0A 2R7BA 4RJ8A 1DI8A 1OM1A 4FV9A 1QPCA 4GUBA 3PJ8A 3CPCA 3RPYA 1K3AA 2RGPA 3FZPA 4BHNA 1P4OA 3DKGA 4FGBA 4JBVA 3F2AA 4C4IA 4YR8A 1MUOA 3MS9A 4GG5A 4TT7A 5LVNA 5BYLA 4P7EA 1UU8A 5HG9A 5DWRA 1Z57A 3OT8A 2IW8A 3DAEA 2X6EA 5J5TA 4YLLA 4HOKA 2JDVA 4JVGA 3O8UA 3FUPA 4AX8A 2HZNA 2RG6A 4FSRA 5HICA 2WQBA 3ET7A 3LMIA 3LCTA 4IAZA 4DBNA 5K0KA 3GCQA 5TT7A 4IVAA 4ERKA 4RIWB 2VTPA 2B9IA 4RWLA 5A9UA 1YXVA 4K1BA 5TO8A 3RI1A 5DH3A 1FINA 5IQFA 1PXNA 1SVHA 3I5NA 3W2OA 5KNJA 4II5A 3R7EA 2WTJA 2FUMA 5HIDA 2BKKA 2UV2A 1KOBA 2HYYA 4PDPA 2F4JA 2IWIA 4AQCA 4XLVA 3T9IA 4IB0A 2GCDA 1R0EA 1MQ4A 2YLEA 4OTGA 3QTQA 3PE1A 4ZJVA 5BYZA 3EHAA 4M3QA 4OT6A 4FT5A 3DU8A 2IW6A 3WI6A 3DJ7A 5ETIA 4ASZA 3TNPC 4C2VA 3D7TB 4U97A 4DITA 1FPUA 5JZJA 2GNIA 4GSBA 4NUSA 3OF0A 4Q2AA 3AGMA 4GS6A 4JG6A 5J8IA 3ANQA 4XV1A 2BZHB 3O71A 4F0GA 4DE4A 3FY2A 3QZIA 2XIXA 3BQRA 5HO8A 2F9GA 4AN3A 4FIEA 4IWQA 3VRZA 4I23A 5DRBA 2PUIA 3FE3A 5EKOA 3EMGA 4XEYA 1LR4A 2KTYA 4USFA 4IQ6A 4I1ZA 3WYYA 3MGYA 4BDCA 2W1ZA 4CQEA 2C6OA 2GTMA 2FGIA 3OG7A 1W7HA 4RFMA 3V5WA 3CY3A 4UALA 4BCOA 3VJNA 4IJPA 1UU7A 4P4CA 3KXNA 3PIXA 3R9RA 3NYVA 2YAKA 3RAIA 3FPQA 5B2MA 3U9NA 3ZFXA 4HW7A 5JSMA 5AR2A 2VTOA 3H30A 4WNOA 1JOWB 3O8TA 4CZUA 2RF9A 4YBJA 4PP7A 3PJ1A 4FV6A 4RSSA 4CFMA 5IDNA 2FYSA 3NW5A 4BZDA 5IH5A 3QYWA 4W4WA 4NJ3A 3KA0A 2XF0A 3R8LA 3UNKA 4M14A 2CKQA 1NXKA 3ZO4A 1XJDA 3OTVA 2WQEA 4Q5HA 4TYHB 5HU3A 4ZLZA 4GKIA 2G2HA 5F9EA 4MXXA 3EQDA 5GJGA 3NEWA 2VTHA 3C4EA 2XNBA 4WSYA 4TKSA 4FTQA 2EB2A 4QMXA 3A8WA 3HUCA 3HUBA 4FT0A 4IZYA 4X3FA 5C03A 3QZGA 4EKLA 1KUTA 3FSKA 4LGDA 3RKBA 4BDBA 4KIOA 3EKKA 3FWQA 3MB7A 3MYGA 3SHEA 4ZLOA 4LOPA 2XK8A 5DOSA 5T3QA 4F63A 5CLPA 3VS2A 4OTIA 3BYOA 3LFBA 1P5EA 5ANDA 3ZLXA 5A4EA 5IG1A 4E3CA 4EL9A 3UP2A 2BALA 3PXKA 3UDBA 4RIYA 2XNPA 4LUDA 5CALA 4BICA 3BYSA 3G5DA 5JZNA 1XH7A 3V5LA 3VF9A 2IVTA 3RAHA 2IVVA 5IUIA 1E1VA 2V22A 2VN9A 3FC2A 3I6UA 5CXHA 4D28A 5C9CA 4AZFA 4YJSA 5JRSA 5ANIA 2B7AA 4MCVA 3HA8A 5AP4A 5TKDA 4EH6A 1U5RA 2OGVA 4I94A 4RZVA 5HU9A 5JH6A 4CMOA 3OWPA 4RG0A 3UOLA 4FV8A 5IMXA 2I40A 2OIQA 3NUUA 3W18A 4AW2A 4DLJA 4FIFA 4JAJA 3PLAE 3ATSA 2C6LA 4HPUE 5CF6A 3UBDA 1XH6A 4GUEA 4FKVA 4U3ZA 2WELA 4BDEA 3U4WA 3OW3A 3RM7A 3BRBA 2IZTA 4FZFB 3D7TA 4AZTA 2ZV2A 3LM5A 3E64A 4PNKA 2FSOX 3BEGA 4X3JA 5IMEA 2PUNA 4PL4A 4FL3A 2GQRA 3D2KA 3EIDA 4RC2A 3R6XA 2GHGA 3OOMA 3R30A 4CXAA 3R71A 4GFOA 4X21A 4AACA 1GNGA 2H34A 3KXZA 3WIGA 4X2JA 4XP0A 3UQFA 1RDQE 4I4EA 1OPKA 4ZTNA 3OEFX 4RC3A 4CRLA 3GVUA 5AR3A 4RWIA 3LCSA 2I0YA 3AC5A 3GB2A 1M2RA 1UNLA 2QOQA 3OMVA 3R02A 3E8DA 4FC0A 4YZBA 4DGNA 4DN5A 5IQDA 1UNGA 5AUWA 4KIKB 2C5XA 3ORMA 3E87A 3V5QA 3PZHA 4BWXA 5M09A 4PTEA 3U4UA 4H36A 5KUPA 4BIDA 2C4GA 4F99A 4ZTMA 3R9HA 1ZAOA 3TCPA 5KMKA 1YWVA 2UZOA 3VS5A 4GFMA 1OIUA 3CBLA 4E26A 4ZY6A 1TQPA 4WG3A 2VV9A 4BN1A 1JQHA 1RQQA 2P2HA 3GC0A 3IW6A 5AV0A 4R3RA 2CNUA 1Q8ZA 2WQOA 3C51A 3DJ6A 3GI3A 4O0YA 4EWQA 4X2KA 4BFMA 2P4IA 3WE8A 5IF1A 3SDJA 4C3RA 4ZZNA 4S33A 4O7RA 4FSWA 1G8SA 4IZ7A 1U54A 4A9RA 2PMIA 4ACMA 2R3IA 2XRUA 3D7ZA 3QXPA 4KKGA 2X8DA 4BI1A 5AV4A 3W10A 1FVVA 3U51A 5CSPA 4LL0A 5D1JA 2Y8OA 4LRMA 4CD0A 4MQ1A 3QAME 3N51A 3QRKA 4WO5A 2UW8A 4QMQA 5M44A 3VUDA 4YJPA 3WZDA 1H1QA 4J7BA 4ZS0A 2CSNA 4OUCA 4BDJA 2FH9A 5E90A 3C0IA 4C62A 1CKPA 2PVNA 2BPMA 3AD5A 2J5EA 3D0EA 3MY0A 4AG8A 3WILA 4RJ6A 4DEAA 4NM0A 5E9EA 1FVTA 4GEOA 4CFNA 3Q9XA 5CU3A 3TIZA 4F9AA 4K18A 4ZJIA 4M68A 5DGZA 4I5MA 3ZU7A 3WOWA 2CNQA 2X2MA 4BDGA 4G5PA 2UW3A 2VWIA 3S2PA 3EJ1A 3LJ1A 3ZO2A 4AXAA 4JRNA 3PPKA 2V55A 4PL3A 2BIYA 4QRCA 3V5JA 3UZPA 2PVFA 2LGCA 1I09A 3JVRA 3RNIA 3W2RA 3CGOA 4XBUA 1DAWA 2CJMA 1SVEA 3UIXA 2CGUA 3HMNA 2YZAA 5I9ZA 1OBDA 4C2WA 4PTGA 5FEQA 5HOAA 5LWMA 5DR2A 1IG1A 2ITUA 4U41A 5D9HA 3OXTA 1OVEA 3EQPA 5HVJA 5L4QA 2QOFA 3EZRA 1YHSA 4OLIA 1H01A 1W98A 5HG7A 5FBOA 4O7TA 4C4FA 3BIZA 3PY3A 3FXXA 4LOQA 5K0XA 1JWHA 1JVPP 3ACJA 5HX6A 4O84A 3FDNA 4XG3A 1NVSA 3Q53A 4KB8A 4O0TA 3KXHA 3QGWA 2BZJA 4R5YA 1PF8A 3BX5A 2G2FA 2NP8A 3UE4A 4USDA 3HL7A 2GNHA 3A7JA 5LCJA 4FMQA 4CKIA 5ANJA 2IPXA 2XP2A 4AA4A 4BGHA 2WMRA 1Y6BA 3ULZA 2WZJA 5BMMA 4RJ3A 4E4LA 5AX3A 2DUVA 3LLAA 5HNBA 5AP2A 3A4PA 1JKTA 4ZSGA 4F7SA 3QQGA 3QD4A 3QX4A 3FPMA 3VS6A 3QRJA 2YDKA 4YHFA 4CG8A 4AS0A 3D5UA 3OC1A 4ORKA 4CNHA 3ETAA 2WTVA 4CFVA 5HLPA 2W4JA 3DQXA 3LFNA 4EOMA 4D1SA 4S31A 3GGFA 4G3FA 4YPDA 2VTQA 3MB6A 3OTUA 4FIHA 4BYIA 5HCXA 4G3DA 1XBAA 2QC6A 3MVLA 4U44A 3FQHA 1I44A 1OECA 3OEZA 4IWOA 4CRSA 2G15A 2WGJA 4FG8A 1KV1A 1ZRZA 3HMMA 3COHA 4Q9SA 4FICA 3LCKA 4EUTA 2ITQA 4D0WA 4DFZE 5LXMA 4BZOA 2Y4IB 3AMBA 4A9TA 3NLBA 2ESMA 3JYAA 5CT7A 3MVHA 4E5BA 1BLXA 2HIWA 1H27A 1YDRE 3NYXA 3QCQA 4XX9A 4ANOA 4KBAA 5ETFA 2RKUA 4EZ3A 3GU5A 1KOAA 4FKGA 4YU2A 4ZS4A 4C61A 3P7CA 4EUUA 4QP9A 3EZVA 3EQGA 4FA2A 2OFUA 4ZTQA 3BWFA 4F09A 4QTBA 3QTRA 5DMZA 3QFVA 3QHRA 4FZAB 4TYGA 4O7LA 3WYXA 4O21A 4MWIA 2VO3A 2X9FA 4E4XA 4Z7HA 3KN5A 4F08A 1ZY4A 1YI3A 4EORA 3BGZA 3EN9A 2CN8A 1OL1A 5EDRA 5A3XA 5FWKK 4V04A 3MN3A 3POOA 4W8EA 5E8ZA 3ZH8A 3PA5A 4TRLA 3QUEA 3O23A 4FTJA 4C35A 4YURA 3ANRA 1EH4A 3NPCA 3GCSA 3OCTA 3MESA 4EOLA 5AIRA 5JQ8A 5HTIA 1WBVA 2XZSA 2QONA 4KRDA 3OCGA 2J0LA 4BCIA 5I9VA 2Z60A 5L6OA 3E8EA 5H8BA 4EH9A 2UUEA 4HGEA 4UWBA 4Y8DA 4CZYB 2ITPA 1H1WA 2XCHA 1WBOA 3TZMA 1J1CA 4RZWA 1O6YA 3UNZA 2OICA 1OPJA 1PKDA 2XVDA 3TI1A 3CR0A 4WRGA 3RZBA 4ZAUA 1YHWA 3BYUA 3EYHA 3L9PA 2BDFA 2WNTA 4EOQA 1H4LA 1R39A 4FUYA 4JIKA 5FDXA 4USEA 3O50A 4NCTC 4JXFA 4GVAA 3IPHA 4AAAA 5KMMA 1Q4LA 4D2WA 4I4FA 1S9IA 4RJ5A 4YHTA 5LQFA 2Y0AA 3U87A 5H2UA 4HZRA 4NFNA 3V51A 5I9YA 3BLRA 2EXMA 4OAUC 2OF4A 3V04A 3IS5A 4L3JA 4MX9A 4BKZA 4FIJA 4HGTA 4EC8A 2F7ZE 3UIBA 3NWWA 5CXZA 3VBQA 4FKWA 4IFGA 3ZRMA 4RQVA 2EUFB 4IAFA 4EH2A 2QR8A 3NAYA 4ZTRA 3OWLA 3LXNA 3P86A 4FKLA 4QQ5A 4Y5QA 4U43A 3R9OA 3G6GA 4OBOA 5JQ5A 3TG1A 2YM6A 2O3PA 1KE5A 4IX6A 5M4UA 2YISA 3AT4A 1KE8A 2R3GA 3BGPA 3TNIA 4YJQA 1Y57A 5C26A 5FBNC 3FL5A 4LRJA 4KIQA 5EH0A 2W5HA 3E7OA 4FK3A 3PRFA 3Q52A 4RQKA 5GJDA 2Y4PA 1OZ1A 4DYMA 3PRIA 4XG6A 3PIYA 1YQJA 3A60A 2VWWA 3MA3A 2ONLA 4Q9ZA 3NYOA 3P78A 4GV1A 3ZHPC 3JPVA 4YJRA 4EK4A 3DAKA 4FEUA 3UO4A 1PYEA 2VO0A 3DT1A 3R00A 4JX3A 3ODZX 2RFDA 3BE2A 2GQGA 2UW4A 3ZUVA 4GIIA 3HDNA 2O63A 3R21A 1JLUE 4TWNA 3T9TA 2YDIA 3MV5A 4IZAA 2B52A 3VAPA 5D41A 2VTSA 1W82A 3CTJA 2J51A 1DAYA 4EJNA 3FXZA 1XH8A 4U40A 3W8QA 2XEZA 3WE4A 1KSWA 2WB8A 2UW9A 4ACCA 2E9UA 2UW5A 3FMJA 2J0IA 4N4SA 4H1JA 5ETCA 1ZMWA 2R3OA 3DB6A 4LRKA 5A46A 2GQSA 2VUWA 2GDOA 4TWOA 4O0RA 2C3KA 3LJ0A 3P0MA 3WZKA 1L3RE 2NRYA 4MBIA 4DT8A 2CKPA 4O2ZA 4IXPA 2B9HA 3GU8A 1OL5A 4O0SA 5E4HA 2ITWA 2QI8A 3FHRA 3SXRA 3WARA 1H07A 3QUDA 4OBPA 4QNAA 2ZMDA 4R5SA 4RVLA 2GS7A 3L9NA 5BVOA 2C0OA 5C8KA 4I5HA 4YZNA 2Z7QA 2PHKA 3Q5IA 3W55A 5JGDA 4RLKA 5ANKA 5C01A 3RINA 3D15A 1JKLA 2ZM4A 3EQCA 2ZMCA 3CEKA 2R64A 4NL0A 1H08A 4DINA 4HNFA 4RWJA 1U5QA 1PMUA 2E2BA 3FMHA 2YLFA 3BHHA 3IW8A 3PXRA 5JFVA 1Y91A 3ACKA 3PVWA 4RJ7A 3IGGA 3PXQA 2W05A 1KE7A 3F61A 3GOKA 4QMUA 3LXPA 1LEWA 5AM7A 4ASDA 3R1QA 5AFVA 1IA9A 3VJOA 3NIEA 1LPUA 4M0YA 3MIYA 5DIAA 3H0ZA 3LVPA 3ZC6A 3CD3A 5DHJA 5AR8A 2JKQA 5LARA 5LCKA 2W96B 5EM6A 1OITA 1PXPA 2UW0A 3P79A 5KE0A 4AT3A 4ASEA 4C4GA 1Q97A 4H05A 2GNLA 1JSVA 2G2IA 3TM0A 1YXUA 4C33A 4XG8A 5JKGA 2YWVA 2JIUA 2XJ1A 3H3CA 4R7IA 3E8NA 2JGZA 5HVKA 4FKPA 3R7GA 2DS1A 3E62A 5KMLA 4AE9A 2R3MA 4JR3A 2PK9A 3BGQA 5HBEA 2OXXA 1KE6A 3GP0A 3LHJA 3ROCA 4FTIA 2OH4A 3A99A 4TL0A 4CGAA 4LQMA 5D7VA 2VX3A 5IQEA 2W06A 4UXQA 4EEVA 4MQ2A 4JL9A 4PV0A 2FO0A 3MWUA 1M17A 4IVDA 3TDVA 2HY81 1PHKA 3HX4A 1YXSA 3NSZA 3MH1A 4DHFA 1TKIA 4E6DA 3DKOA 1GIHA 1UU3A 2Z02A 2UZWE 1FQ1B 4MEDA 4U0IA 3VBTA 4E8AA 4N6YA 1UKIA 3SW7A 3IK3A 4U42A 5AA8A 3GU4A 3OHTA 4GK2A 2QG5A 1WCCA 5CYIA 3EFWA 1MP8A 4IH8A 4B7TA 1O6KA 4MH7A 3SOAA 3Q2JA 1GZNA 3RNYA 2WU6A 4BCMA 3UODA 3H0YA 5F95A 4ZZOA 2VTIA 3GBZA 4BTJA 1VYZA 4DA5A 4C3FA 5KZIA 3DK7A 4KABA 4TYHA 3BU6A 2VO7A 3KQ7A 4L43A 2IW9A 5AUUA 2QOHA 3H4JA 4QMWA 5M51A 2GPHA 1OMWA 5B2KA 2BFYA 3SD0A 3G9LX 4FR4A 2C5YA 1XO2B 4F6UA 3KCKA 3PWDA 4HCTA 4UMUA 2OXYA 2WTCA 5DNRA 2ZV8A 3ZDIA 4M69B 3MVMA 2VTJA 2PSQA 3QGYA 2XIYA 1ATPE 3HMOA 4X3FB 2ZOQA 2G9XA 5DVRA 3ZDUA 2F57A 3ELJA 5I9XA 5DT0A 3EOCA 4IX3A 4KWPA 4BCQA 1SVGA 4GU6A 4XS2A 2OIBA 4TWCA 2H96A 4XMOA 4X2GA 4X0MA 3GFWA 2YCRA 3F2NA 3MH3A 4BHZA 4H58A 5BVWA 2WKMA 3QD2B 4W4YA 2QLUA 3D94A 2C47A 2GNGA 4FT3A 4I0SA 4NM3A 5I5ZA 2WTKB 3O0GA 4MXZA 3WZUA 2SRCA 3C5IA 5CEPA 3NNVA 3R0TA 5LMBA 4D2SA 2UW7A 4GFGA 2IVSA 2W1EA 4I21A 4YJOA 4QMNA 1BUHA 3FV8A 4IEBA 3NS9A 3KMWA 4D2RA 2OW3A 1W0XC 2VWUA 3HRBA 4BB4A 4KKEA 2YM8A 4AF3A 3V8SA 5J5SA 5KKRC 3OZ6A 3QL8A 3E92A 5HNGA 3VW6A 3ZUTA 5GZ8A 1J7IA 2QLQA 3RJCA 4AGCA 5EHYA 4XBRA 4BKYA 4FZ6A 5JRQA 4FBXA 4AFEA 2C6KA 3KK8A 3NUPA 4AOJA 1TVOA 3EFJA 4E6AA 1H28A 4FK6A 5FTGA 3Q4ZA 4AN9A 4JBQA 4YZMA 3FI4A 3MFSA 4ACGA 5CNOA 4BDHA 2WQNA 3ALNA 3DLSA 4IAIA 3NAXA 4FKIA 1OL6A 4FV5A 2XKDA 3PSBA 3O7LD 4J95A 1A06A 2J90A 3ENHA 4AA0A 4PMTA 4H1MA 2R3QA 4UZHA 4FTTA 4IM2A 2YDJA 3QQJA 4ZEGA 4DH8A 3I81A 3PWYA 4IVBA 4AWIA 4FIGA 4D55A 1E1XA 2YERA 4E6CA 3OCSA 5CX9A 4EJ7A 3TTJA 1BI7A 3E3BX 4IJ9A 4WUAA 5E91A 5BVNA 2HXLA 3ITZA 4M8TA 4MHAA 4RWKA 1Q62A 5GHVA 3LIJA 3KL8A 2BCJA 2GS2A 4DG2E 4U8ZA 1URCA 4JS8A 3KMUA 2QCSA 3NUXA 1J7LA 1MQBA 2E9VA 4CV9A 4BDDA 2AUHA 2BRNA 5J95A 3SOCA 3S1HA 2VRXA 4D1XA 3B2WA 4O38A 2BMCA 4YPSA 4XP3A 4AW0A 4AZVA 3DJ5A 4NJDA 3FKOA 4FODA 4IDVA 5CU4A 5F4NA 4FTAA 1H25A 2ZDUA 3PJCA 1F5QA 4E4NA 2CLXA 2P0CA 4ZOGA 2OJ9A 3CQEA 3HP2A 1QL6A 1OBGA 3F5XA 2X1NA 4F4PA 5CVGA 4H3PA 3FZOA 5LVMA 1CTPE 1YOJA 3CGFA 4LI5A 4D4SA 3HMIA 4ITHA 4WG5A 2BKZA 3UG2A 2JKOA 3KVWA 1P2AA 2YCQA 2ITTA 3FMLA 4O82A 3Q6WA 4MBLA 4Y95A 5C8NA 2PVJA 3RPOA 2XA4A 4V0GA 4QTAA 5GIPE 4ZJJA 3EKNA 1IA8A 5J1VA 2JC6A 2HAKA 1PKGA 1BX6A 4OTHA 5JT2A 3TNHA 1ND4A 3VS0A 5HORA 3QF9A 1SYKA 4G5JA 4F70A 4I22A 4AZWA 5EYMA 4J52A 5CSXA 2W4KA 3E7VA 4I3ZA 1E9HA 5ANEA 3V8WA 4UX9A 4FV4A 3DBEA 3ZO3A 2JBPA 5FXQA 3TIYA 3IG7A 2J9MA 4QQTA 3LFFA 3COIA 3D14A 2ITXA 1H1PA 2JDRA 2ZB1A 3TKHA 3LFCA 2OWBA 5H8GA 4QD6A 3MY5A 5FP6A 2ETKA 3P9JA 4YJNA 5DEYA 4MK0A 3ORZA 4X7QA 2YM4A 3EN7A 2XNMA 4ZTSA 3MFUA 4G16A 3BBWA 2RG5A 1FVRA 3ZBXA 4BR3A 3KRJA 2UVZA 5J7HA 3F66A 4CMTA 4O91A 2XK4A 4FSYA 4EZ7A 5DG5A 2PZYA 1H0WA 2C5OA 3F3WA 4HGSA 4U79A 5HG5A 2XRWA 4EBVA 4BGGA 3C4XA 2DYLA 3LQ8A 4C4EA 5EI8A 3BHTA 2E9PA 2WTDA 4D5KA 3CPBA 4QQJA 5HIBA 1JPAA 3AC4A 4BCFA 3DZQA 5M07A 2R7IA 5EM8A 4L68A 4QP3A 5CVFA 5E8VA 4QP2A 4J1RA 3VWAA 2PVYA 4EK5A 4DGGA 3TUBA 4FV0A 2RSVA 4A4LA 2YABA 2W0JA 4IC8A 5DBXA 3NZ0A 5FXSA 2QKRA 5BUJA 1YWRA 3MFTA 3ENMA 3Q4TA 4F9BA 5M06A 3JY9A 4PL5A 4L6QA 5EYDA 1UNHA 4KNBA 3ZLSA 3PE2A 3AC2A 4D9UA 3CTQA 3MPMA 4WKQA 4UY9A 5HGIA 5IEYA 2IG7A 1WVXA 2F2CB 2OI4X 3AGLA 3WF7A 2PWLA 1Q41A 4K8AA 3RMFA 5IQCA 4H3BA 3NUSA 1IR3A 4PMMA 1CSNA 1YW2A 3BE9A 2P33A 3IONA 3KULA 5ETAA 2B9FA 4EC9A 4X6QC 4MTAA 2QHMA 3O2MA 4FSTA 3PSCA 2Z7RA 4IM0A 4NIFB 3C4ZA 3KK9A 3T8OA 3Q9WA 4FUXA 4PWNA 3ORPA 5HBJA 4PY1A 4ITJA 3RVGA 2C68A 4O96A 1H8FA 1FMOE 3NUYA 2RFNA 4E73A 4L01A 2WEVA 4I0TA 3UYSA 5IDPA 2E9OA 1OL2A 4QPMA 2OSCA 2XJ2A 3R8ZA 4G1WA 3HP5A 2VX0A 4BTFA 1K2PA 2CHLA 2I0EA 2IZUA 1UU9A 3U54A 3OT3A 4MXOA 3FLSA 1F0QA 1U46A 5G6VA 5CEKA 2XKEA 5FD2A 2GMXA 3QLFA 3I60A 2YIWA 3CIKA 3PUPA 4Q5EA 3ZO1A 3BQCA 4TZRA 3ZSHA 4EYMA 3LM0A 3P7AA 3RPSA 2ONLC 2OZAB 5H9BA 3V6RA 4IB1A 4V05A 4J53A 5A4TA 3UGCA 1AD5A 4ARKA 4YGAA 4C02A 4C36A 3BCEA 1BMKA 4UYAA 1ZMVA 2Q83A 4JDJA 1PXKA 5B0XA 4A9UA 4V0GB 4AW5A 3L8VA 2V62A 2PYWA 3PVGA 3RK7A 4GJ3A 3DA6A 4FIIA 1GOLA 3FZRA 3O7LB 3MPTA 4UEUA 3UPXA 5CQWA 1WBTA 3OCBA 2VZ6A 4OTQA 2ITVA 2WMUA 3DK6A 3KMMA 1KE9A 4R3CA 4FE2A 5AUYA 3MPAA 1DS5A 4IZ5A 2QHNA 4GMYA 4FKQA 4GRBA 1MRUA 2EVAA 5HLWA 2B9JA 5EW9A 3UC4A 3VS4A 3IO7A 1U54B 3IECA 5D10A 4YO4A 3EQHA 4U7ZA 3RGFA 1VZOA 1ZYSA 3C1XA 5D11A 3A7HA 4CCUA 3PJ3A 1OGUA 5E1SA 2OFVA 3OOGA 3FEGA 2C3LA 3A7GA 4ZXTA 3R2BA 4S34A 2PMNX 3LW0A 4HNIA 5FTOA 2HWOA 3F88A 4JDIA 3SQQA 5EQPA 2R2PA 2Y7JA 4AP7A 2QOBA 3VS1A 2C0TA 5L8KA 5IA2A 1SZMA 3BI6A 3HV7A 4R3PA 2ACXA 4NM7A 5JN2A 1PXIA 3L8PA 5AV2A 3VUTA 2W1IA 1W8CA 4L67A 3R8UA 4GJ2A 3RPRA 1A9UA 3RWQA 4GVJA 5ANGA 4AA5A 4BI0A 4CV8A 5I3OA 4FEXA 4WHZA 4CEGA 3NNUA 1H1RA 2W99B 3F7WA 4NK9A 2W7XA 3GXLA 3RCDA 4EQMA 2ZVAA 3OW4A 2A19B 5EQYA 2JLDA 3VO3A 3HECA 3QCYA 1BL7A 3F9NA 2UZUE 3P08A 4ANLA 4JNWA 5DA3A 5KMJA 4F6SA 4O0WA 3RALA 2C5NA 3RAWA 3A2CA 5EI2A 5T6KA 4U3YA 3UOJA 3VBXA 4F64A 4YLKA 3TZ9A 4GU9A 5HD4A 2J0KA 1ZOGA 5M4FA 3NR9A 1NVQA 3F6XA 4FSQA 4GT3A 4W8DA 5CF4A 2WIPA 4KS7A 4F1TA 4JT3A 3FL4A 4TWPA 3BHYA 2LAVA 4EH5A 3ZS5A 2B53A 2KULA 3A7IA 4FNXA 3RHXA 3ZRKA 4BCGA 4DEEA 4J8MA 3HV6A 2Z7SA 5A6NA 4PUZA 5IU2A 3VHKA 2CKOA 3MA6A 1HOWA 1WVWA 3I79A 3K5VA 2BHEA 5BMSA 4JJRA 4DGLC 3B2TA 4FNYA 4XOZA 2VD5A 2WMBA 5F94A 5AJQA 4RMZA 5H3QA 4B8LA 3AOXA 3MFRA 1UA2A 2XYNA 3QQUA 4WIHA 2OH0E 4XG2A 5LVLA 4P5ZA 2IJMA 1ZZ2A 2ETMA 4XH6A 3N4UA 1JSTA 2ITNA 2XBJA 4EWHA 4K2RA 5DN3A 1UWHA 3G0FA 3Q6UA 3QTZA 4NW6A 3R1SA 4XJ0A 3H10A 5FM2A 4DTKA 4B99A 2VWZA 4NU1A 5M4IA 3FI8A 4PNIA 2WOTA 3GU7A 3RHKA 4FEQA 4DT9A 3MSSA 5EQEA 3NNXA 4QMMA 1FBNA 2REIA 4ASXA 4YP8A 3QD0A 1MRYA 4BCHA 3LZBA 2YM5A 2QO7A 3R04A 2WPAA 2VNWA 5EDQA 3RTPA 2XIKA 4R7BA 3HRCA 3T3UA 5E8XA 3QXOA 3PIZA 2X4ZA 4B9DA 4B0GA 2EU9A 3V6SA 4G3EA 3KC3A 3DLZA 2W17A 3Q04A 4UXLA 2XB7A 4MF0A 3ZOSA 1AGWA 5CEQA 3OWKA 4YSMA 3U6JA 4AT4A 3R28A 3D9VA 2WMAA 4PTCA 2A2AA 2VAGA 2PVMA 3OBGA 5D7AA 3DAJA 4O7ZA 4YNOA 4LL5A 5M56A 1PMVA 2I0HA 4NEUA 5EHLA 2JKKA 4FSMA 2QR7A 4APPA 4FKRA 4D4VA 2XBAA 1PY5A 3VF8A 4RX9A 1UVRA 3PY0A 2GTNA 4YJTA 4YO6A 3D83A 1JBPE 4AGDA 4NTSA 4RVTA 4MD9E 2P3GX 4O2PA 2GFCA 2VX1A 3F3VA 3KB7A 5BVDA 4F0FA 4YJVA 3FYKX 3C4CA 5DT4A 3RK5A 2F49A 3VUHA 4A07A 5J1WA 3W2SA 4ZLYA 3CQUA 4NZWB 3GT8A 3ID6C 3K3JA 2ZYBA 3IDCA 4K6ZA 4O22A 4CQGA 4FL1A 4FTMA 3QTXA 5AR4A 3ZXZA 4E6QA 4IADA 4WNKA 4FKTA 3EWHA 4TYIA 2OG8A 4RBLA 3HZTA 3HAVA 1VJYA 2C6TA 3LQ3A 5HVYA 2EWAA 3E88A 3FQSA 4E93A 2Z2WA 3VUIA 1STCE 2GHLA 2PULA 1ZYDA 1VEBA 3N9XA 3ZSGA 4EOOA 4IDTA 4CMUA 2XCKA 4FKOA 2O8YA 3P23A 1XHAA 4GK4A 3W32A 4ZMEA 4OT5A 2JFMA 3PXYA 4IWDA 4MYGA 4QP7A 4O7WA 3Q9ZA 1B39A 3ZM9A 2BTRA 3GFEA 1DI9A 1S9JA 5AP5A 4G6NA 2X81A 4O7YA 4JQEA 3KRRA 5EG3A 1M2QA 2XK3A 1X8BA 1M52A 3GC7A 4FOBA 1JKSA 4ENXA 4FTNA 2JITA 2QNJA 4QP8A 1WMKA 2XIRA 3DS6A 3VQHA 5FM3A 3R9DA 4FF8A 1JAMA 4WNPA 4DEBA 1XH4A 2OLCA 2A4LA 4RGJA 2C69A 2EXEA 4LMNA 5M55A 3FLQA 3VRYA 2ITYA 2R3KA 4M69A 2GNFA 5A4LA 4S32A 3ZZWA 3EYGA 4DTAA 3SXFA 2ZDTA 2FVDA 3CQWA 5HG8A 2ITZA 4KD1A 4MXCA 2X9EA 5EW3A 3W8LA 4Y73A 1ZLTA 5AP7A 1YDTE 1Z9XA 3FMNA 2JFLA 4R6VA 5DFPA 3EFKA 4ZSEA 5KKRB 4JBOA 3JR1A 4QQCA 3F7ZA 2BAKA 5EKNA 1R1WA 4MNEA 3JS2A 1Q5KA 1NT2A 4CG9A 3LFAA 4OTPA 3QCXA 4O86A 5HNIX 4B8MA 1G5SA 3HVCA 4YTFA 3LXKA 2QODA 2XEYA 4U45A 5IQAA 3SVVA 3TJCA 4PMSA 3HA6A 4FTUA 3O17A 4EH4A 2Y9QA 4JR7A 3CD8A 5FLFA 4HVGA 1T46A 4FV3A 4G6OA 5FP5A 4G31A 3TXOA 5FEDA 2C5VA 3TT0A 3UIUA 1P14A 2BRMA 4RLLA 3OUKA 4A06A 3ZYAA 2WEIA 3KXMA 4NW5A 5CZHA 1IRKA 2F7EE 5IH6A 2OJIA 2ZM3A 3VW8A 3I0OA 3MY1A 1CDKA 3E3PA 4FVPA 4QNYA 5E1EA 5BUEA 4Z55A 5IA5A 3BU5A 4IC7A 5EOLA 3OD6X 5A54A 1JKKA 4B4LA 3HV4A 4XV3A 4C7TA 1ERKA 4HPTE 3COKA 3TNQB 1GIIA 2XIZA 2QU5A 4QYEA 3NW6A 4NWMA 4AN2A 3LCOA 4CT1A 4MD7E 3GENA 3ERKA 3LAUA 3CSVA 1GIJA 4ZSAA 4Y72A 3HDMA 3COMA 5HCZA 4DH1A 2W1DA 1YI4A 3DV3A 1ZOEA 3G9NA 5KBRA 4KUJA 2R0UA 3BLQA 3CXWA 4EOIA 4AE6A 4C4HA 3TTIA 4M12A 4G3GA 2WMTA 3NX8A 4CTCA 4HVHA 3PYYA 4PPBA 2WTWA 4MXAA 5E8TA 5E8SA 3R1YA 3HYHA 3UC3A 2V5QA 5IA3A 4EBWA 2C1AA 4CVAA 4UBAA 3EL8A 3EQBA 2VTTA
chains in the Genus database with same CATH superfamily
1QMZA 2JDOA 5CEIA 4DH5A 2UVYA 4FTKA 1APME 1TZDA 4C57A 1V0OA 4YC8A 1TQIA 2OF2A 3IDBA 4QMLA 3OBJA 4CKJA 3VIDA 5DPVA 2PZ5A 5GZAA 3CS9A 4OBQA 4BYJA 3R8VA 3DXQA 3FLNC 3WF8A 3LMHA 4D2TA 1RW8A 1J91A 3AC1A 5M4CA 1OB3A 3C0HA 3ZUUA 4UMPA 5DYJA 3UZTA 4EK8A 2J5FA 3KU2A 4JOAA 4K9YA 4M7IA 5GJFA 5IEXA 4KRCA 2ZAZA 3F2RA 3N4TA 3LOKA 2Q0NA 3VNTA 3FI3A 3SGCA 4N57A 3FYJX 4BDIA 4J97A 3VC4A 5BYYA 4L52A 4L7SA 4R1YA 4I6HA 4TYEA 3ZFYA 4EOPA 3VBYA 3TKUA 4DFXE 5AP0A 1J1BA 2GFSA 4PQNA 2JD5A 3RBWA 4F9WA 4V01A 2IO6A 3F82A 4R8QA 2R4BA 3AQVA 4D2PA 5K3YA 3LMGA 4NSTA 3QTSA 5KCVA 3AD4A 2YACA 5L2QA 3LKMA 2YIRA 3C9WA 3ULIA 4DFUA 4JAIA 3FKNA 2WMQA 2QVSE 3DOGA 5CU2A 4QMPA 1Q24A 1GAGA 2XKCA 4AUAA 3AMAA 3TWJA 4ERWA 4G3CA 5HLNA 5L2SA 4ACDA 4FI1A 5E8YA 2WMXA 4MAOA 2DQ7X 3TACA 4XP2A 3FQEA 1UKHA 3MTFA 3QALE 4MWHA 3QKLA 3PSDA 3O51A 4TXCA 3VULA 5C4KA 3BYVA 4FTOA 4GW8A 2PPQA 3FBVA 5IQGA 3PFQA 3R8MA 2W1FA 1H0VA 1SMHA 2B54A 2Z7LA 1YKRA 3KULB 3IDPA 2QOOA 4RA4A 2PE0A 3LXLA 4IAKA 3LE6A 2VU3A 4AZEA 3GU6A 2W9ZB 1M2PA 4M97A 3SG8A 4EONA 1FGIA 3CKXA 5IUHA 4JRVA 2O5KA 4XOYA 2VTLA 2E9NA 2W4OA 5CEMA 4CTBA 3PA3A 3M1SA 3TN8A 3NUNA 4EOSA 3EN4A 3UDZA 3NFGB 4TYJA 1ZOHA 3OXZA 3FLZA 4LYNA 3SW4A 3R1NA 4E7WA 2OBJA 3BV2A 3CKWA 4CFXA 4NCTA 3GQLA 4O0VA 4N6ZA 2UZVA 4UWCA 4C4JA 2OU7A 4OTWA 5C27A 4FZDB 3BWJA 3OWJA 1BI8A 5M57A 3IW7A 1XBCA 5JGAA 2RFEA 3HNGA 1SNXA 1LUFA 4CYIA 4X2NA 2XALA 3PY1A 4XG4A 2BTSA 4MF1A 5GNKA 4DGMA 5LVPA 3U6HA 5J9LA 2NNWB 4XG7A 3QKKA 1L8TA 5IQIA 3CTHA 4BY9E 2A27A 1V0BA 5BQ0A 5KO1A 4L44A 1ZMUA 1OI9A 3JUHA 2CCHA 2HENA 3NIZA 4YC6A 5AA9A 5CAVA 3AT3A 4A4OA 3Q60A 4APCA 2BZKB 3BU3A 3BEAA 3WBLA 4FV2A 4QYHA 1XH9A 1REKA 2Y6OA 3VBVA 3DDPA 4M66A 5BX0A 3KEXA 2H6DA 4YC3A 1M7QA 4DLIA 5CI7A 4DBXA 1QPEA 1Q61A 3Q32A 1PYXA 4FOCA 4ACHA 4L00A 5FUTA 4LUEA 2BDJA 3R7VA 3ZMMA 5DRDA 2OK1A 2WMSA 3DGKA 5HTBA 1G8AA 5L2TA 2VNYA 1URWA 5JFSA 4NFMA 2R5TA 3VN9A 4JQ7A 3RM6A 4P90A 4I41A 3E93A 4I5PA 3GOPA 2J6MA 3LFQA 3F5PA 5C8MA 2YZLA 3U55A 3G51A 3QYZA 1W84A 2XH5A 3SLSA 2QO2A 4DH3A 5CSVA 5EHOA 5HKMA 2YA9A 1OPLA 3W0MA 3KF7A 3QC4A 3D5VA 4UYNA 4BTMA 4BWPA 4ZP5A 3ZBFA 5HTCA 4AOTA 2OO8X 4KAOA 4BDAA 2XS0A 3U6IA 2HWPA 2HY0A 3F69A 3TUCA 2ETRA 5CANA 3QKMA 2CN5A 4LG4A 3NCZA 3MIAA 5E7RA 3VQUA 2C30A 4GCJA 4FYOA 3H9RA 4PDSA 3O96A 4ANBA 4F9CA 3ATTA 4OTDA 3I5ZA 5KBQA 2YM7A 3AMYA 3UTOA 2B4SB 4PRJA 3PG1A 4CKRA 3BZ3A 5ANOA 4W9WA 5FQDC 5JFXA 4D4YA 3ORIA 4RC4A 3QA8A 4J71A 4AGWA 2O2UA 4ZMFA 4KS8A 3HAMA 3EQRA 3P4KA 1CM8A 3Q3BA 3C0GA 3Q4CA 3L8XA 4Z9LA 2ERKA 3AD6A 3G0EA 3PZEA 4ANMA 3FJQE 2BDWA 3PA4A 3QRTA 4NTTA 4BIEA 3UMWA 1B38A 3ZTXA 3FMKA 3QUPA 2V0DA 2JIIA 3R22A 4IW0A 4U81A 3TJDA 2BFXA 2VWXA 4IB3A 4NIFA 4EH7A 2Q0BA 3D5WA 3F3UA 4D5HA 1K9AA 2QQ7A 4HYUA 3UO5A 5HO6A 4DH7A 4DGOA 4BI2A 2X0GA 3IOPA 1PXLA 3R83A 3T3VA 3UP7A 4KKHA 3V01A 2JKMA 2CGVA 3KCFA 4U9AA 3W16A 4E5AX 1PMNA 2YEXA 4PF4A 1JSUA 3A8XA 3G90X 4FTCA 3SRVA 4IAAA 4M0ZA 3MJ1A 4CT2A 3OP5A 5HD7A 2XM8A 4FNZA 3SAYA 1U59A 3PPZA 3S3IA 3QCSA 4HYHA 5AWMA 5H8EA 3TUDA 2PU8A 4TW9A 1PXJA 5CU6A 2XM9A 2PMLX 4S2ZA 2RL5A 3WF9A 5L8LA 2VWBA 4RJ4A 2ITOA 3ZRLA 2ZV9A 4BKJA 4CLIA 2XUUA 3E63A 3UOKA 2UZEA 4JBPA 2X7OA 3QD3A 3KN6A 3PG3A 4Y5HA 3EQFA 4DCAA 3RCJA 4I93A 4IFCA 3VUKA 3PVUA 5J9ZA 2PE1A 2QOCA 3IKAA 3AG9A 3Q5ZA 4J99A 4NKAA 1KV2A 5A14A 2ZJWA 4I6FA 5HE0A 4AFJA 5AAFA 2IZRA 4QMTA 3ZM4A 1HCLA 2FA2A 4EZ5A 1VR2A 4R78A 4BCJA 3GQIA 3PXZA 1KWPA 4FVQA 5L6WL 3IW4A 1IEPA 3WF6A 3V8TA 3P5KA 2RIOA 5AR7A 5HX8A 1OGYA 3QQHA 3SA0A 4GG7A 4OTFA 5EYCA 2A1AB 5TE0A 2J4ZA 3C13A 2Y4IC 3QX2A 4KSQA 4LV5A 3Q4UA 4W4XA 3VS7A 3QBNA 2WFYA 5CWZA 4F7JA 4RIYB 2CDZA 4XCUA 5AIKA 1OKVA 2J7TA 1GY3A 2O64A 5IKWA 3V5PA 1QPDA 2X0OA 1OIRA 2I6LA 1TQMA 4GYIA 2YIXA 4MKCA 4CFUA 5CASA 3FZ1A 5IQBA 4YTHA 3L1SA 2P55A 2R3PA 4F1MA 4Z7GA 2XK6A 3DK3A 5DEWA 2PE2A 3NRMA 4EHGA 3W0QA 2O65A 3QZFA 3G15A 2YN8A 3AT2A 5L2IA 3DPKA 3LJ2A 4M13A 1GZ8A 1OIYA 2BILB 4CZTA 1M7NA 4IBMA 4BCPA 3UOHA 1P4FA 4G17A 2BIKB 1ZY5A 4FTLA 1GJOA 2PZIA 2XK9A 4BDKA 5TOZA 3TEIA 3KY2A 2J2IB 5D12A 2IVUA 2J50A 4XHKB 3F5GA 3DZOA 4D2VA 2XNOA 3CCNA 5KZ0A 2VTAA 5CF8A 5I4NA 4K11A 4L3PA 4LGGA 4BRXA 3TV6A 3H9FA 4JX7A 4NKSA 4YTIA 2B1PA 5AP3A 4AXFA 4AZSA 3Q2MA 1LP4A 3N4VA 2OZOA 5KX8A 3KF4A 5CS6A 2PZRA 3ZONA 3NVKI 1FMKA 3QLGA 4FEVA 5CQUA 4ONAA 2VO6A 1Z5MA 3C4WA 3FZSA 3ORNA 3QRUA 4FKJA 2WHBA 3GCUA 5TF9A 4EHVA 4CSVA 4FSUA 4DFLA 5AEPA 5DE2A 4ENYA 3KREA 2CNVA 4O7SA 3WIKA 1H1SA 3IOKA 5L6PA 4PDOA 4B6LA 3DBQA 3M2WA 3NMUF 3W2PA 5IUGA 4WUNA 5DR6A 3S00A 2QOKA 1FOTA 4I0RA 4FSZA 4WT6A 2UVXA 5I3RA 2JIVA 4ZK5A 4QO9A 4F65A 1Q8WA 3ODYX 4MBJA 4C58A 5FG8A 4DG3E 3GC9A 1WBWA 3VUMA 4FEWA 4YTCA 4KIPA 4HZSA 4ALVA 5LWNA 4F9YA 2XJ0A 3JY0A 4YUQA 2BUJA 5IQHA 2YCFA 4RIOA 3CE3A 3K54A 4EH3A 3DKFA 5KMIA 3PP1A 4YNEA 3ORTA 5EDPA 4S30A 5FGKA 4HVIA 2WTKC 2YITA 4PX6A 4WOVA 4L7FA 2C3JA 1BKXA 2PMOX 3BLHA 3OY3A 5CNNA 4O83A 3OXIA 5C4LA 2OIDA 3D2IA 2OZAA 4QYFA 2R3NA 5CAPA 5AUVA 4XV9A 3THBA 3Q96A 3R01A 3M42A 4O0XA 1PXOA 5J9YA 2AYPA 4U5JA 4UMTA 3C4FA 4BCNA 1QPJA 5KMNA 5HBHA 2WTIA 4BBFA 5K9IA 2PY3A 3FKLA 2BVAA 1Q3WA 1PJKA 4IM3A 4M84A 5BVKA 4NYEA 3HEGA 4X3FC 5AR5A 4C38A 4IB5A 4UMRA 2ZV7A 4AU8A 3ZC5A 3L8SA 1M14A 3QQFA 3Q9YA 3IGOA 5TR6A 2ZM1A 1REJA 4A9YA 3PFYA 1OKYA 1YI6A 3CC6A 3K5UA 3UVPA 2JDTA 4QP6A 5LMKC 3L9MA 4F6WA 2YIYA 3UQGA 4CFFA 4GT5A 5EM5A 3F3TA 4RVMA 4KBKA 3HMPA 3JXWA 3S4QA 4YMJA 4DHZA 5C1QB 4WG4A 2DWBA 3NGAA 4JQ8A 1WZYA 1NY3A 4C34A 3W1FA 4F1OA 5HIEA 4CFWA 5LMAA 3ALOA 3E8CA 3QZHA 4PPAA 4JG7A 4WA9A 3F3ZA 3FAAA 5J7BA 4IANA 2V7OA 2W1GA 2IZSA 4HYSA 5HI2A 3RZFA 1LEZA 4QMYA 3UQCA 3I4BA 3AXWA 2OJJA 5GZ9A 3BHVA 1Q8TA 5J79A 4FKSA 1OKZA 5DI1A 3FXWA 4XNEA 4ZY4A 1GZOA 3FY0A 4XRJA 3HV3A 4IVCA 1NA7A 4FZ7A 4HVDA 4O81A 3GCVA 2GSFA 4DAWA 2PVRA 5E8WA 4XYFA 3V5TA 4CYJA 5KHWA 2CMWA 3BELA 3GNIB 4HCUA 4MNEB 4QOXA 3HGKA 3QC9A 2EXCX 5JGBA 4EQUA 1ZYLA 2HW7A 1Y6AA 4ZY5A 1NVRA 4YZCA 5A4QA 2Y6MA 3RK9A 3U8WA 2C6EA 4QTEA 4DTBA 4EH8A 5EK7A 3C7QA 1OUYA 4JDHA 3TV4A 2WMWA 5B2LA 5AP6A 3BYMA 5IA4A 4E1ZA 4O1PA 4TPTA 2YHVA 3UO6A 4DEDA 1H24A 1OIQA 3BKBA 3RAKA 4UMQA 3I7BA 4RIXA 4WRSA 5CAQA 4IE9A 3I1AA 1WBSA 1YRPA 3S0OA 2YJSA 4FX3A 2I0VA 3DXPA 5FEEA 1ZZLA 2RFSA 3GC8A 3P1AA 3G6HA 4OTRA 2F2UA 5CF5A 3R7YA 1MRVA 2XNGA 3D5XA 4UWYA 4OR5A 3CLYA 4X6RA 3FMMA 5HE1A 1HCKA 4OGRA 4N70A 3PVBA 2PVHA 4A7CA 4DEIA 1WBNA 2AC5A 3MI9A 5EW8A 2VTMA 1Q3DA 2X6DA 4E20A 4EI4A 5HO7A 5LJJA 2WU7A 5FRIA 2UZBA 1ST0A 3KIOC 4BF2A 3ORXA 4J96A 5BUIA 4ZTHA 5CENA 4QMSA 2YCSA 3ORLA 4I24A 4L45A 4LMUA 3R63A 4BL1A 4GKHA 3UDSA 4RX5A 2BRGA 2JAMA 2PTKA 5L3AA 4BCKA 3UPZA 3PP0A 4N0SA 3WZJA 5BVFA 4LFIA 4ZIMA 3LPBA 1RJBA 5AAGA 4XG9A 4GIHA 4YZ9A 4TNDA 4A9SA 2CCIA 4QP1A 5LVOA 2R3FA 1PW2A 5AADA 5J87A 4QP4A 4DC2A 2GHMA 5CTPA 3H9OA 2WO6A 4FNWA 3B8QA 4IX4A 5AV1A 4BWKA 4L8MA 4M67A 3FC1X 4ZTLA 2X7GA 1BYGA 4JG8A 5BVEA 3UNJA 2X4FA 4Y83A 2UZNA 2Z8CA 5ITAA 1SM2A 2NRUA 2W1HA 1YOMA 2UZDA 4HYIA 2JDSA 2PUUA 4DDIA 2F7XE 4EYJA 4MXYA 3ZZEA 3NNWA 3EH9A 3QTIA 4K33A 4YHJA 3EFLA 1FGKA 2XNNA 1R0PA 3UMXA 5K4IA 2OXDA 1YWNA 2G1TA 2YM3A 3II5A 3ORKA 5FDPA 1Q99A 5JK3A 2GNJA 2W5BA 4KIKA 5CT0A 3R7UA 2XKFA 3NFFB 4TTHB 4UN0C 1XKKA 1ZXEA 2I7QA 4IWPA 4O0UA 5IA1A 2HZIA 5F20A 4C59A 1Y8YA 4BZNA 3RPVA 4BVUA 1Q8UA 1XMMA 5HESA 1Q8YA 3KVXA 4EHEA 4HGLA 3QTWA 3KRWA 4G34A 4RIWA 1J3HA 1O9UA 4F0IA 5AAEA 4UB7A 3A61A 3LFDA 4EK6A 4FGRA 5M08A 3DBFA 2X39A 3FHIA 1OKWA 1WAKA 3FZTA 2R0IA 2YWPA 1YDSE 4GT4A 4QMVA 1WBPA 3BV3A 4RVKA 3REPA 4J98A 5T68A 2C6IA 1G3NA 3S95A 5A4CA 4Z16A 3UZRA 3DFAA 5G1XA 5ACKA 1RE8A 2A98A 3OROA 5JEBA 3QQLA 2W5AA 3MH2A 3OS3A 2VGOA 3TNWA 3V3VA 3ZEWA 4BC6A 5K5XA 3BPRA 4L3LA 5IPJA 4RFYA 3K3IA 4YZDA 1V0PA 1R3CA 3NCGA 3SXSA 4H39A 3PLSA 4LGHA 3BHUA 4NT4A 1T45A 3A7FA 4RIXB 5DT3A 3EL7A 4HVSA 4AW1A 2R3LA 1CKJA 5I0BA 3NVMB 2NPQA 2ZB0A 4W9XA 4Y85A 5ACBC 3VVHA 4Y46A 4ANNA 4D0XA 4GH2A 2HZ0A 5HHWA 4FV1A 3MTLA 4L46A 4JLCA 3GEQA 3VS3A 3IW5A 3DKCA 4L53A 4AXCA 2HCKA 2JAVA 1XMLA 3FMDA 3LQ5A 4FT9A 2VWYA 3OUNB 3RWPA 1YXXA 2WMVA 3EN6A 1XWSA 2BZIB 4ID7A 3C5UA 1V1KA 4NM5A 3F5UA 4EKKA 4IX5A 1SNUA 4D58A 1H26A 3VHEA 3HLLA 5KMOA 3HV5A 1UV5A 3LCDA 4O1OA 2W9FB 3MH0A 5AUXA 5A6OA 1ZARA 2R3RA 2HK5A 2CLQA 2X8EA 3I0QA 4QDEA 4M15A 4AGUA 2HELA 2GS6A 3I6WA 4GYGA 1CKIA 4I6BA 3ZCLA 1YXTA 4G9RA 3KRXA 5HQ0A 3R9NA 5BPYA 4BBMA 2CKEA 4FG9A 5L2WA 4DEHA 3DB8A 4XUFA 2X2LA 3U9CA 2BRBA 5HE2A 3EB0A 3MVJA 2PUPA 5JMSA 2NO3A 4IIRA 4FTRA 4UV0A 4PP9A 4R1VA 3L9LA 4FYNA 2XARA 4JI9A 5EI6A 2OJGA 1IAHA 2HZ4A 2X0QA 3JVSA 3PTGA 4DEGA 2J0JA 2CGWA 5KHXA 2R9SA 1ZYCA 4IACA 2C1BA 4TN6A 2C3IB 3BBTB 3CP9A 1J7UA 1YVJA 4ALWA 4DFNA 2X7FA 2YAAA 4EOKA 1IAJA 2BAJA 2JEDA 3O8PA 2YIQA 3A4OX 4I6QA 4IHPA 4J8NA 4KSPA 4DF3A 1W2DA 1XQZA 3FLWA 4TY1A 3GUBA 4CCBA 3W0OA 2PVKA 1OUKA 3AC3A 4O6LA 2B55A 3KRLA 4ITIA 2YFXA 4O7VA 4AOIA 2XYUA 2WIHA 3RP9A 5M53A 2BR1A 4BGQA 5EFQA 3TZ7A 3OY1A 4E4MA 4QPAA 5HEZA 1UWJA 3W2QA 4FG7A 3AC8A 3FSFA 4HJOA 4QPSA 4R7HA 4RFZA 5CAOA 2QOLA 2QOIA 2H9VA 1F3MC 3LFSA 3AKLA 3CJGA 4WD5A 4I5CA 3SRVB 3UJGA 4D4RA 5I9WA 4QTDA 2PZPA 3MDYA 3FI2A 4FV7A 3UG1A 3R2YA 2WXVA 1YHVA 4YSJA 4O27B 3QU0A 5E8UA 3MBLA 3TDWA 2AC3A 4QMOA 4DFYA 4PMPA 4RX7A 4A4XA 4ALUA 4ANQA 1VYWA 3DBCA 4YJUA 2QU6A 4W4VA 2YJRA 3K2LA 3QRIA 4WBOA 3SKCA 5EYKA 4KBCA 5AM6A 3TZ8A 2WAJA 4C37A 2X8IA 1B6CB 4K77A 2H8HA 3I7CA 4HCVA 4EK3A 4CLJA 2X0PA 3DTCA 3BL9A 5JFWA 3HRFA 5FTQA 3KFAA 1DM2A 3SX9A 3PXFA 2HXQA 4JDKA 5K4JA 5AUZA 4MVFA 4R77A 5AP1A 2FSLX 2O0UA 1OL7A 4FL2A 4WNMA 2QD9A 4FSNA 4QTCA 3UDTA 2FSTX 2VWVA 4E5WA 4MD8E 3PPJA 3SG9A 3TV7A 1JNKA 3FLYA 3HKOA 3KXXA 1R78A 2P2IA 4QDVA 4XRLA 2G01A 2ERZE 5LOHA 2PVLA 4F7NA 1XBBA 3QWJA 4L42A 3UIMA 5CZIA 3D4QA 3G33A 4XV2A 4LM5A 2GU8A 4LV8A 2OKRA 3ZLYA 4DG0E 5GIOE 3KXGA 3R73A 4C8BA 2BROA 5AUTA 2XK7A 5BNJA 4K0YA 3NDMA 3VUGA 4C3PA 5CU0A 4YLJA 5GINE 2C6MA 3IQ7A 4GL9A 3FMEA 4OAVB 4IMYA 2WQMA 5EM7A 3R7IA 3W33A 2XNEA 3DNEA 5IH4A 1W83A 1A48A 1AQ1A 3ZLWA 5EOBA 3POZA 4EQCA 4PDYA 2QO9A 5CSWA 3C50A 3KGAA 4JIAA 3EN5A 5CVHA 1QCFA 3W2CA 5IEVA 4NH1A 4L9IA 5ICPA 2BHHA 4BBEA 2OJFE 4RRVA 4QMZA 3LLTA 3DQWA 4WSQA 3UYTA 4P2KA 3SV0A 1BL6A 1O6LA 2X2KA 4FT7A 4RX8A 5HZNA 5E92A 3UVQA 4F7LA 2FSMX 2JBOA 3DXNA 5HCYA 3ROYA 4GK3A 2C6DA 4I20A 4QT1A 2WD1A 2FB8A 3ZFMA 5DLSA 3SC1A 3ZXTA 4ANSA 5CEOA 5CY3A 1ZYJA 5CI6A 3ZSIA 3DTWA 3UVRA 2VTNA 4BTKA 3QWKA 1NW1A 3NYNA 3PJ2A 2IN6A 4PPCA 3TKIA 3EQIA 2BRHA 4LOOA 5AMNA 3E5AA 4G2FA 2W1CA 4DFBA 2I1MA 3MJ2A 4DCEA 4RA5A 4KINA 2CPKE 4BDFA 2HOGA 2R3HA 3G2FA 1CMKE 2PL0A 5HE3A 4QYGA 4MNFA 2V7AA 3DBDA 2C0IA 2CGXA 3DY7A 5IISA 3CY2A 5B7VA 3WZEA 3DNDA 4P5QA 3R8PA 4D1ZA 5IZFA 2QG7A 4U80A 3QQKA 2UZLA 3NW7A 2A0CX 4EHZA 3NUAA 2VGPA 5LMKA 4C0TA 2QURA 4X2FA 4O6EA 5L8JA 3KKVA 4ZSJA 1XR1A 2XMYA 3CJFA 3QTUA 4WBBB 5CAUA 2WOUA 1U4DA 2VTRA 4G9CA 5AX9A 3PDTA 3OFMA 3VBWA 1WVYA 3M11A 5IA0A 4AXDA 3A62A 3WF5A 4XLIA 2R3JA 1GZKA 2UW6A 3QHWA 4H3QA 3LFEA 4BIBA 4RPVA 4D9TA 4FKUA 4TNBA 1PMEA 4I92A 1IASA 3ZEPA 4QYYA 1XH5A 2B0QA 4IAYA 4EOJA 2HW6A 2UZTA 4FVRA 5K5NA 1Y8GA 4RT7A 5CSHA 4DDGA 1WFCA 3DFCB 1H00A 4G6LA 4ZSLA 1YOLA 3GCPA 2J0MB 4KA3A 4Z3VA 5AV3A 4O7NA 5I9UA 1PRYA 5DR9A 1ZWSA 3B8RA 5FXRA 5F1ZA 3P7BA 1PXMA 3DDQA 3MW1A 3TL8A 4AT5A 4UZDA 2EB3A 4OW8A 4ZZMA 4U6RA 3DCVA 4YBKA 2QKWB 3OVVA 3R7OA 2BAQA 3QA0A 2R7BA 4RJ8A 1DI8A 1OM1A 4FV9A 1QPCA 4GUBA 3PJ8A 3CPCA 3RPYA 1K3AA 2RGPA 3FZPA 4BHNA 1P4OA 3DKGA 4FGBA 4JBVA 3F2AA 4C4IA 4YR8A 1MUOA 3MS9A 4GG5A 4TT7A 5LVNA 5BYLA 4P7EA 1UU8A 5HG9A 5DWRA 1Z57A 3OT8A 2IW8A 3DAEA 2X6EA 5J5TA 4YLLA 4HOKA 2JDVA 4JVGA 3O8UA 3FUPA 4AX8A 2HZNA 2RG6A 4FSRA 5HICA 2WQBA 3ET7A 3LMIA 3LCTA 4IAZA 4DBNA 5K0KA 3GCQA 5TT7A 4IVAA 4ERKA 4RIWB 2VTPA 2B9IA 4RWLA 5A9UA 1YXVA 4K1BA 5TO8A 3RI1A 5DH3A 1FINA 5IQFA 1PXNA 1SVHA 3I5NA 3W2OA 5KNJA 4II5A 3R7EA 2WTJA 2FUMA 5HIDA 2BKKA 2UV2A 1KOBA 2HYYA 4PDPA 2F4JA 2IWIA 4AQCA 4XLVA 3T9IA 4IB0A 2GCDA 1R0EA 4O4BB 1MQ4A 2YLEA 4OTGA 3QTQA 3PE1A 4ZJVA 5BYZA 3EHAA 4M3QA 4OT6A 4FT5A 3DU8A 2IW6A 3WI6A 3DJ7A 5ETIA 4ASZA 3TNPC 4C2VA 3D7TB 4U97A 4DITA 1FPUA 5JZJA 2GNIA 4GSBA 4NUSA 3OF0A 4Q2AA 3AGMA 4GS6A 4JG6A 5J8IA 3ANQA 4XV1A 2BZHB 3O71A 4F0GA 4DE4A 3FY2A 3QZIA 2XIXA 3BQRA 5HO8A 2F9GA 4AN3A 4FIEA 4IWQA 3VRZA 4I23A 5DRBA 2PUIA 3FE3A 5EKOA 3EMGA 4XEYA 1LR4A 3O5AA 2KTYA 4USFA 4IQ6A 4I1ZA 3WYYA 3MGYA 4BDCA 2W1ZA 4CQEA 2C6OA 2GTMA 2FGIA 3OG7A 1W7HA 4RFMA 3V5WA 3CY3A 4UALA 4BCOA 3VJNA 4IJPA 1UU7A 4P4CA 3KXNA 3PIXA 3R9RA 3NYVA 2YAKA 3RAIA 3FPQA 5B2MA 3U9NA 3ZFXA 4HW7A 5JSMA 5AR2A 2VTOA 3H30A 4WNOA 1JOWB 3O8TA 4CZUA 2RF9A 4YBJA 4PP7A 3PJ1A 4FV6A 4RSSA 4CFMA 5IDNA 2FYSA 3NW5A 4BZDA 5IH5A 3QYWA 4W4WA 4NJ3A 3KA0A 2XF0A 3R8LA 3UNKA 4M14A 2CKQA 1NXKA 3ZO4A 1XJDA 3OTVA 2WQEA 4Q5HA 4TYHB 5HU3A 4ZLZA 4GKIA 2G2HA 5F9EA 4MXXA 3EQDA 5GJGA 3NEWA 2VTHA 3C4EA 2XNBA 4WSYA 4TKSA 4FTQA 2EB2A 4QMXA 3A8WA 3HUCA 3HUBA 4FT0A 4IZYA 4X3FA 5C03A 3QZGA 4EKLA 1KUTA 3FSKA 4LGDA 3RKBA 4BDBA 4KIOA 3EKKA 3FWQA 3MB7A 3MYGA 3SHEA 4ZLOA 4LOPA 2XK8A 5DOSA 5T3QA 4F63A 5CLPA 3VS2A 4OTIA 3BYOA 3LFBA 1P5EA 5ANDA 3ZLXA 5A4EA 5IG1A 4E3CA 4EL9A 2AEGA 3UP2A 2BALA 3PXKA 3UDBA 4RIYA 2XNPA 4LUDA 5CALA 4BICA 3BYSA 3G5DA 5JZNA 1XH7A 3V5LA 3VF9A 2IVTA 3RAHA 2IVVA 5IUIA 1E1VA 2V22A 2VN9A 3FC2A 3I6UA 5CXHA 4D28A 5C9CA 4AZFA 4YJSA 5JRSA 5ANIA 2B7AA 4MCVA 3HA8A 5AP4A 5TKDA 4EH6A 1U5RA 2OGVA 4I94A 4RZVA 5HU9A 5JH6A 3BL7A 4CMOA 3OWPA 4RG0A 3UOLA 4FV8A 5IMXA 2I40A 2OIQA 3NUUA 3W18A 4AW2A 4DLJA 4FIFA 4JAJA 3PLAE 3ATSA 2C6LA 4HPUE 5CF6A 3UBDA 1XH6A 4GUEA 4FKVA 4U3ZA 2WELA 4BDEA 3U4WA 3OW3A 3RM7A 3BRBA 2IZTA 4FZFB 3D7TA 4AZTA 2ZV2A 3LM5A 3E64A 4PNKA 2FSOX 3BEGA 4X3JA 5IMEA 2PUNA 4PL4A 4FL3A 2GQRA 3D2KA 3EIDA 4RC2A 3R6XA 2GHGA 3OOMA 3R30A 4CXAA 3R71A 4GFOA 4X21A 4AACA 1GNGA 2H34A 3KXZA 3WIGA 4X2JA 4XP0A 3UQFA 1RDQE 4I4EA 1OPKA 4ZTNA 3OEFX 4RC3A 4CRLA 3GVUA 5AR3A 4RWIA 3LCSA 2I0YA 3AC5A 3GB2A 1M2RA 1UNLA 2QOQA 3OMVA 3R02A 3E8DA 4FC0A 4YZBA 4DGNA 4DN5A 5IQDA 1UNGA