5FDPA

Structure of ddr1 receptor tyrosine kinase in complex with d2099 inhibitor at 2.25 angstroms resolution.
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
309
structure length
285
Chain Sequence
DFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDKAAGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDALNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Epithelial discoidin domain-containing receptor 1
publication title Structure-Based Design of Tetrahydroisoquinoline-7-carboxamides as Selective Discoidin Domain Receptor 1 (DDR1) Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 285
sequence length 309
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5fdpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5fdpA01
4KB8A 4IAAA 4NJ3A 5AX3A 3ULZA 3RNYA 3WE4A 4IM3A 4F64A 4QRCA 1H00A 3QTWA 3BZ3A 4ZJVA 4RFZA 2JDOA 3K3JA 3BYOA 2W9ZB 4JR7A 1YHSA 4YZNA 4O0WA 5HBEA 4D2PA 3E93A 4A9YA 4EK4A 3MA3A 1WVWA 4IZ5A 3E3BX 2WFYA 4YTHA 3SRVB 4DTBA 2WZJA 3NIEA 1P4OA 2C5VA 5CALA 2PTKA 4UWYA 4ZLZA 3PSDA 2QC6A 4IFGA 2PK9A 2YIWA 4HNFA 3M11A 2B53A 4PWNA 4AF3A 3UQFA 2UZTA 1FQ1B 4BDBA 1MRYA 2VGPA 2BRBA 5D7AA 2PZ5A 1U5QA 3HRFA 4OTPA 3RI1A 5HNIX 5AUUA 1OL1A 3KXGA 3SHEA 3QTRA 4LRJA 2OKRA 5JZJA 1XJDA 3PVWA 4ZS4A 3AOXA 5JGAA 3OXTA 3ALNA 4FEQA 2XP2A 3QU0A 2UVZA 1FMOE 2QO9A 4GIHA 1UWHA 3UOKA 3ZFYA 4F7LA 5K5XA 2WMWA 5IEVA 5B2KA 1SYKA 3LJ1A 4D1ZA 3IGGA 5AWMA 2R4BA 2PULA 1YWRA 1QPDA 3QHRA 4RIWA 4CT2A 4EK5A 3DDQA 3CXWA 2VWVA 2RGPA 2C1AA 3VS2A 5J87A 3VBTA 4AOTA 2ZMDA 2EWAA 4OT6A 1W83A 3F5GA 5AIRA 2CMWA 4GFMA 5BVOA 3KL8A 4Y95A 5HE2A 1M7QA 2XNOA 3II5A 3KF7A 5CSXA 5HU3A 4XS2A 3BLQA 3DS6A 5L2QA 5AUTA 4LGDA 3F3WA 3MVJA 1AD5A 4EH9A 2R0UA 2R3JA 2G1TA 3C50A 3E3PA 4AFEA 4FKGA 2QVSE 4WIHA 3MDYA 2Z7RA 3DBCA 4G9RA 5HD7A 3M1SA 4NUSA 4YSJA 3KXMA 4QMUA 3HKOA 2ITPA 4KA3A 2ESMA 5EHLA 5FP6A 2BTRA 4OTWA 2I7QA 3IO7A 3ORKA 1YDSE 2ITZA 3R8VA 3T3UA 1O6LA 2PUNA 3MESA 1RJBA 2WMQA 4G3GA 3DU8A 2OGVA 2RFSA 3PXYA 5IQBA 5HHWA 3FMHA 4BDIA 4FI1A 4M15A 3G33A 5FP5A 1NA7A 1WCCA 2QD9A 4QNAA 5LARA 2VTIA 1BMKA 4YJNA 1XHAA 2YDIA 2XS0A 2PVMA 1UNLA 3B8RA 2QOIA 1NVQA 4DFUA 3G0FA 3OT8A 5GZ9A 3AD6A 4C33A 3V04A 3DKOA 2WU6A 4RIXA 1FGKA 4EL9A 2FSLX 2WHBA 4MBIA 5CAOA 4ZIMA 4ONAA 2UW8A 3Q4TA 4OT5A 3TG1A 4E4LA 2XNGA 3UO4A 2OSCA 3NYOA 3DOGA 3FBVA 5G6VA 4FKRA 5LVPA 5E7RA 4ZMEA 5J5SA 3HAVA 1WAKA 4HGTA 4QMTA 3EN9A 4BHZA 4ZMFA 2OICA 3SXSA 2Z2WA 2IZUA 1R78A 3EQGA 2H96A 1J91A 4MYGA 5E8XA 2IW8A 5C8MA 4YU2A 4FV5A 3OCBA 4I41A 3ZO3A 4HCVA 3ZU7A 3GU7A 1QPCA 3WE8A 5HIDA 4O96A 3P4KA 4GT5A 3HMIA 4AZVA 3UMWA 2NP8A 2W1EA 2Y4IB 3DT1A 4U45A 2LGCA 4X21A 5BNJA 4JAIA 5ETFA 5FQDC 4IAIA 5HTIA 3FEGA 4MVFA 3FI2A 4O7RA 4AGWA 3LFQA 4AZSA 4DFNA 4J71A 4WRSA 4L52A 2ZB1A 4TXCA 3GBZA 3C0IA 5DN3A 5C26A 2QU5A 1AQ1A 4EJNA 2CHLA 4OBOA 3ZDUA 1ZWSA 2C47A 3DV3A 1H1SA 4MBJA 4FZDB 1Q5KA 5DH3A 3TI1A 3W18A 4A07A 4ANNA 4RIYB 3R63A 4BDJA 3MJ2A 2JITA 5M57A 4YJVA 5KX8A 1OUKA 2ITNA 2XNPA 4R5YA 2BIKB 2ZYBA 4WHZA 1G8SA 4AG8A 2P3GX 4IB5A 1TQIA 3JXWA 4W4YA 3AC5A 4YZBA 4YZ9A 5F4NA 5A6NA 3P0MA 2GCDA 5JMSA 4LG4A 2A2AA 5AR8A 4YLLA 3ZZEA 4GIIA 1MQBA 3EB0A 2HZ0A 1YWVA 2YIRA 3A7IA 3R28A 5A4LA 2WOUA 3D5XA 4W4XA 1V0OA 2YZLA 2VWUA 3PG3A 2DS1A 4AGCA 2CGUA 3SKCA 2CLXA 3Q5IA 4NM5A 4PL4A 2PUPA 4ZTHA 1DI9A 1XKKA 2E9VA 2CPKE 2R3RA 4MEDA 4ZY4A 4FKVA 5AUXA 3UYSA 4BBEA 3VQUA 4R6VA 4DFLA 1PHKA 1PMEA 1XH4A 4CQGA 4AW5A 4DFZE 1M2PA 2YN8A 2RFEA 3F3ZA 2RKUA 3V5JA 2YM5A 2R3IA 4D0WA 4ITJA 4IM2A 4A4XA 4UALA 3WARA 2FSTX 5BVEA 4JG6A 1BLXA 1Q3DA 4O0TA 4XG3A 3NUYA 3WI6A 3I4BA 4B0GA 4DG2E 5D9HA 4MXCA 4E6CA 4FTUA 4JBQA 3ZO2A 4KBCA 3QX4A 4EHGA 2R3FA 1REJA 5M06A 3IDPA 3HUCA 4F0IA 3PP0A 3QFVA 2JKQA 4O21A 4YJOA 4BCGA 1KE6A 3NYNA 1CSNA 2YERA 3DBEA 4M0ZA 4MH7A 5HBJA 1XBCA 3QQJA 4L3PA 4O2ZA 1WBPA 5LXMA 4IB0A 4MAOA 1X8BA 1HOWA 2X81A 3GNIB 1V0PA 5CF4A 4I4EA 5JEBA 2B4SB 4Y5QA 1F0QA 3R6XA 4Y46A 1IA9A 1M52A 3SG8A 2WTWA 3EFLA 3S2PA 1JKTA 3DZQA 2J0MB 4AAAA 4D1SA 4WUAA 5KKRC 4EH3A 2WU7A 3KEXA 1FVTA 2UZLA 3NS9A 4FT0A 5F1ZA 5AR5A 3QAME 4IB3A 3VHEA 1IR3A 4XMOA 4JT3A 1K9AA 5J79A 4NW6A 5D7VA 4HW7A 2PSQA 3Q9XA 3KMWA 3BU6A 2UUEA 5CYIA 3NUNA 4GEOA 3ZSIA 4BN1A 4CXAA 3WF7A 5CI6A 3QUPA 3R7IA 5L8JA 3O51A 5K5NA 3C1XA 4FVQA 2X1NA 4EZ5A 4RWJA 3B8QA 3WZJA 3OY1A 4AA5A 1H26A 4FG7A 1H1WA 3NUSA 2NO3A 3RALA 3QXPA 2QOQA 5CAQA 3F9NA 3MY5A 5E9EA 3FKLA 4DFYA 2QR7A 4ANBA 4MQ1A 4V0GA 4FA2A 4U6RA 3MPMA 4XP2A 3NSZA 3Q32A 4V05A 4XYFA 1PRYA 2R7BA 4WUNA 3VVHA 3W16A 4BIBA 2GQSA 1VZOA 3UQCA 4U0IA 4ZTSA 1OPLA 3VBQA 3GGFA 2ERKA 4E5AX 4PDPA 3KB7A 3I1AA 3G9NA 3Q4CA 3MTLA 3QQUA 5ITAA 5FTGA 4XG4A 1YI6A 4DCAA 4MCVA 2HXLA 4QYGA 2OJ9A 3ORTA 5IEXA 3C51A 5CENA 1H27A 1ZMVA 5G1XA 4I0RA 1T46A 3OT3A 2XEYA 4GMYA 3GCVA 3OMVA 4K6ZA 5EOBA 5BX0A 3HMOA 1FVVA 4BKJA 1J1CA 4BCNA 5IQAA 4AOJA 3U6JA 5C01A 3U4UA 4A9UA 5EW3A 3FPQA 3R73A 5FLFA 3R2BA 4XV3A 1JBPE 2O2UA 1YW2A 4QP8A 4MWIA 2BRMA 3A99A 4U43A 3E8NA 4QNYA 4RGJA 4XOYA 5EM8A 5KNJA 3QYWA 4IM0A 1GIHA 1SVGA 2OZOA 4RLLA 5E8YA 2GNFA 1JKLA 2VTQA 3CPCA 2GPHA 2GHLA 2CKEA 4MF0A 3NLBA 4CV8A 5FXRA 2VWIA 4NCTC 2OXXA 2UZDA 1U5RA 1ZZ2A 5I9XA 1SZMA 3PIZA 3SV0A 1B39A 4GSBA 4D4SA 5I4NA 2YLEA 3QD3A 3H9RA 4EOJA 1E1VA 2B9HA 4I6FA 1TQMA 2OF4A 4KIKA 2PE0A 5I3OA 4L8MA 4QYFA 3FL5A 2X4ZA 4HGEA 1KWPA 3H9FA 4M67A 3DNEA 1UKIA 4EZ7A 3R1QA 5BUJA 3MH0A 4GG7A 3RMFA 1BKXA 2JBPA 4U8ZA 3GVUA 4F7JA 4X3FB 3LIJA 3R22A 3DB6A 4ZJJA 3RPVA 4TPTA 4B99A 4ITIA 3AMAA 3CKXA 3L8SA 3IDCA 4MNEB 4QMSA 5DLSA 2PMIA 4MXXA 4M69A 3TEIA 3ZLSA 4QMYA 2C5XA 3R30A 2X6DA 3Q3BA 5IG1A 1WBOA 1YOLA 4ZSEA 3VUDA 1JNKA 2I0YA 2C68A 5M56A 1GOLA 3W2PA 2V55A 5IQHA 2JIIA 4RSSA 1VYWA 2C6OA 2C6DA 4TYHB 2VN9A 2YZAA 3E8EA 4FZAB 3EQIA 3GEQA 3UE4A 2O64A 1ZYSA 2BR1A 4RFMA 4F1MA 2CKOA 3S3IA 2BRNA 5IA1A 4PMTA 4R5SA 1O6YA 4IE9A 3R9NA 4NWMA 5IUGA 3QZIA 3U9NA 5HQ0A 1ZRZA 5CT7A 2J90A 3BQCA 3DZOA 3R1YA 5F94A 5KCVA 5M44A 3GENA 3PZHA 3QTSA 1U54B 4GFOA 4PY1A 3UYTA 4QP4A 3R2YA 4RC2A 5KKRB 2QOFA 3Q5ZA 2C6LA 1OKZA 5H9BA 3GU8A 1O6KA 3FLQA 2XEZA 4BTJA 3PJ8A 2QHMA 3FI4A 5A54A 4L7SA 3ZUVA 3OG7A 3FZRA 2OJFE 3EOCA 3ZO1A 1Y8GA 4E4XA 2B52A 5H8GA 4HGLA 5E1SA 3W2OA 4AZEA 4F7NA 3BBTB 4G6NA 5J95A 2X6EA 4FIIA 4MQ2A 4OTHA 2X2LA 4N6ZA 3RGFA 3MFRA 4IX6A 4BDEA 2YJSA 4RIOA 1Q62A 1ZMUA 3PE2A 3VS1A 4TWPA 3VIDA 3OUKA 3GXLA 2IG7A 4UMRA 4AT5A 3VRZA 3FSFA 1CKJA 1GAGA 3ENMA 3U54A 3CGFA 3LHJA 4CFMA 2CGWA 2R3OA 4OTFA 3DA6A 2YABA 4R1YA 3HMMA 1KV2A 4QMZA 2R5TA 4W4WA 2DYLA 4BDAA 4DLJA 2ITTA 4ZLOA 1I09A 2VO7A 4MWHA 4EOKA 2E9OA 3GOKA 1PKDA 2VWZA 4FV8A 2V22A 4IACA 2WMRA 5HD4A 4LRKA 3O8UA 2JGZA 3QX2A 4EQMA 3R7YA 3DQWA 4XP0A 5IKWA 3VJNA 2NRUA 3R8UA 1XWSA 5HE0A 3KGAA 3IOPA 1SNXA 2J0IA 4J1RA 4RJ3A 5DEWA 3V5PA 3V5WA 4F6UA 3WZEA 4DH7A 4E73A 3W2CA 4E93A 2UZEA 2O3PA 5M4UA 2XJ0A 3QC4A 3DTCA 4B4LA 4BICA 2XKDA 5KO1A 5GJDA 3H10A 2XCHA 1ZMWA 1Q8YA 3O7LB 3OWPA 4JIKA 4HVGA 2WMTA 2F2UA 4MD9E 4EOPA 4F9CA 4FIGA 5CF8A 5ANEA 3MH2A 3WBLA 2QHNA 5CASA 4O7VA 4OGRA 4ASDA 2WIPA 4PNIA 3V6RA 1YKRA 4RBLA 4PMPA 3H30A 5C8KA 2PZIA 5JGDA 4FGBA 4TYIA 4DE4A 3WIKA 4O0VA 5K9IA 2OLCA 3UC3A 4CMTA 1PF8A 3W8QA 3S0OA 2ZJWA 4C34A 3EQRA 3NEWA 5FBOA 1R3CA 5C27A 5FRIA 3O8TA 4FV7A 3RWPA 5JT2A 2XM8A 2GTMA 4IC7A 4JR3A 4K18A 3NNXA 1KOBA 5AM6A 2HELA 4O86A 5A4TA 4G16A 2FA2A 2GNIA 4IAZA 4JIAA 4YPDA 4LOPA 4Q5EA 4UN0C 5L2SA 3KVXA 4RA5A 5HGIA 4PL5A 3PRIA 5TO8A 4MNFA 2ZDTA 5EYCA 4A9RA 2WGJA 4JQ7A 3RBWA 2C5OA 2WMSA 2JDRA 3CTHA 4I0TA 5AV3A 3F6XA 3OUNB 4QP6A 4FEUA 5AA9A 4DG3E 3PJCA 1DM2A 1PXIA 4FK3A 4NCTA 2BRHA 4IVCA 4MXZA 3KKVA 2BDWA 4RA4A 4WO5A 3FMNA 3OHTA 3QALE 4IWOA 3RZFA 2UW5A 2CSNA 3PPJA 4WSQA 2YIXA 4FVRA 2PVKA 5TOZA 3UIXA 3CJFA 3HV7A 4OBQA 5EFQA 5HU9A 1U59A 3EQDA 3DCVA 4QO9A 4FUXA 4RRVA 4YTIA 3U6HA 2BZJA 2IN6A 1LPUA 4X7QA 4JRNA 2IWIA 3V51A 3KREA 2YAKA 4E3CA 3N4TA 1YVJA 3DK7A 3KRRA 2QO7A 3QD4A 4L3JA 3W33A 3TDWA 5A4CA 5AFVA 3NRMA 3UO6A 3GOPA 3UOJA 2W1GA 3HYHA 3ZONA 3Q6WA 5CI7A 3V5TA 4NU1A 5HTBA 4M66A 4QQ5A 4BKYA 2HW7A 3OBGA 1VEBA 5CQUA 3MN3A 3TZ8A 4EOOA 5M4FA 2W1IA 4IIRA 4ERKA 5ACKA 5EDRA 5BMMA 5KBRA 4L9IA 3F2RA 4ZSJA 4IXPA 3NW7A 1SNUA 3WF5A 3C7QA 2G15A 5EK7A 4HNIA 3TWJA 4M7IA 4OLIA 3KXHA 4JQEA 3POOA 3VUHA 4EHVA 2PPQA 2Y4PA 3R1NA 2X0GA 2UZVA 3I6UA 1IRKA 3DK6A 3EFJA 4FYOA 2BKZA 3ODYX 4FV0A 4C2VA 5L8LA 3QF9A 4UBAA 4MXYA 5CVGA 2X8IA 3QCYA 5GZ8A 4F1TA 4BDFA 3PPKA 4L3LA 4LUDA 3K54A 4C38A 5LVNA 2Q83A 1L8TA 2R3QA 3GUBA 4XG2A 3FXZA 2WMBA 1TKIA 2WTIA 3EKKA 3NPCA 4JL9A 5DG5A 4EZ3A 3OBJA 3UIMA 2OZAA 3ZM4A 4QQCA 5J1VA 4RQKA 3HAMA 4CTBA 2IVSA 1PXPA 5KZ0A 4YJTA 3LQ3A 3ORPA 3VUMA 4DF3A 4R77A 4IWQA 4I21A 2JD5A 4F1OA 2VAGA 1H0WA 2OF2A 4TWCA 3F66A 1YDRE 4YLJA 4J7BA 4Y73A 2LAVA 3RPRA 4N70A 3HUBA 2FYSA 2VX0A 3OC1A 1KUTA 5EQEA 3AGLA 3PXZA 2F4JA 3ANRA 3NGAA 1REKA 1J7IA 3QTIA 4O6LA 4RZVA 5D1JA 2C3IB 4PX6A 2VV9A 3AC3A 3WZKA 4C37A 1RQQA 5K0KA 5L8KA 1W0XC 4KIQA 4D2TA 5HG5A 4YHTA 2BROA 3QCSA 3G90X 4O7YA 3FSKA 4FKQA 3DXPA 1OI9A 5A4QA 3OXIA 4XJ0A 5E1EA 3OF0A 4C4EA 1H1QA 3A60A 3KXXA 3Q9ZA 3Q96A 4TWNA 3NVKI 3NAYA 4WNPA 1JPAA 2CNUA 3BV3A 5L6PA 5CX9A 1B6CB 3EWHA 3R0TA 2QOCA 2XM9A 3IECA 5M4IA 3IW6A 5IQGA 2BFXA 3CE3A 1UU3A 4XH6A 2EXMA 2BAJA 1ZY4A 3AC4A 3W32A 4DTAA 2PZRA 3SXRA 3U8WA 2XK4A 4ZY5A 3CD8A 3IS5A 3ITZA 4P5ZA 2P2IA 5B2MA 2J7TA 3TTJA 2XRUA 2YHVA 2BDFA 4UMPA 1NVSA 2UW4A 1ZAOA 2OH0E 3F3UA 2YIYA 4NKSA 3P08A 5FDXA 3QLFA 4A7CA 4G6OA 4TN6A 2VTLA 3UOHA 2Y4IC 1PXOA 4YTFA 4PDOA 1OIYA 2W4KA 1PW2A 3MGYA 4MXAA 5CEMA 1XH8A 2VWWA 4RWKA 5LVOA 4PMSA 2REIA 4CT1A 4IBMA 2BZIB 4E6DA 4PL3A 5M09A 4FL2A 5J1WA 3QRTA 2B9IA 4Z7HA 5C4LA 4C3RA 3FMJA 3ELJA 4XBRA 4BL1A 3NR9A 3R7VA 5IDPA 4ZOGA 4O84A 5FWKK 1OGUA 2HYYA 3F2AA 3PDTA 4S32A 1Q97A 1RW8A 5KHXA 2B1PA 4HYUA 2ONLC 3GI3A 3SD0A 2VO0A 4FV3A 2F9GA 4ASEA 3RM7A 3ROYA 4QMLA 3I5ZA 3IPHA 3LFFA 3PPZA 4AX8A 2Y7JA 4K8AA 3WYYA 2C6TA 5L6OA 2V7AA 3CEKA 1L3RE 4RZWA 4NFMA 3FKNA 2OJJA 3EMGA 2ZM4A 4FNWA 3UG1A 5CNNA 3H3CA 3PE1A 4C8BA 4EC9A 4W8EA 4ERWA 5FTOA 2V5QA 5FEQA 3TKHA 4C7TA 4DGGA 2C5NA 4ARKA 1IEPA 3KRXA 4LMNA 5C03A 4BGHA 2JKMA 2F2CB 2X8DA 4RC4A 3SXFA 3IOKA 3LCDA 1T45A 3BLHA 2Z60A 1FGIA 5CSPA 3QHWA 4F7SA 3RKBA 5E91A 2PY3A 5AP2A 5LOHA 4E26A 4TT7A 3MA6A 4S31A 4D2SA 3IK3A 4ZP5A 4R7IA 3GFWA 3BPRA 3HRCA 1OPKA 2RFDA 4RX9A 3HGKA 5CT0A 3QRKA 2CGVA 2PE1A 2X9EA 3RPOA 3SC1A 3CTJA 3DLZA 1OPJA 3TZ7A 3NW6A 5KMOA 1UU8A 2FH9A 3EZVA 3NCZA 3FQHA 4FV6A 4K1BA 5D41A 2WQNA 2NNWB 3TM0A 2X39A 4M68A 3A61A 3D7TB 4AT4A 3LCKA 4FTIA 3BHTA 2QNJA 1OIRA 3EN4A 4QPMA 5DRDA 5HVJA 5TKDA 3VUKA 5IH6A 3EH9A 1M2RA 2OH4A 2XJ1A 4TY1A 2XIRA 4HCTA 4D2RA 2WTCA 4R3CA 4YJSA 2QLQA 4MXOA 3F3VA 3AXWA 3ORXA 2RF9A 2GFSA 5CAUA 4EYJA 2IVUA 4F0FA 1GJOA 1G5SA 4EWHA 1Y8YA 3LXKA 1IAHA 4RWLA 5EG3A 1V1KA 4FMQA 3QQKA 1GZ8A 2GDOA 1XH7A 2W9FB 1Y91A 3RNIA 4K33A 4AW2A 3VBYA 4BIEA 3M42A 1FMKA 4QYYA 4FKSA 3WOWA 4ANSA 5IQEA 5EW9A 4X2GA 3QQHA 4UY9A 3LXPA 5CSWA 4ZTQA 2W96B 4X2FA 3TTIA 5AR7A 2BRGA 3CJGA 3P7CA 4RX5A 3KULB 1YRPA 4NTTA 4LRMA 2GHGA 3QQGA 5L3AA 4CYJA 3BHYA 2R3MA 1BX6A 4XCUA 2J2IB 5HO6A 4HVHA 3PSBA 4W4VA 5ETAA 3HMPA 3COHA 4U3YA 4EOIA 2DWBA 3I60A 2H34A 3DJ7A 5HX6A 3FHRA 4G9CA 4C3PA 2OJGA 2R3HA 4KBKA 1Q3WA 4FSYA 3KA0A 3NYVA 1DAWA 4ANQA 2PVJA 2A27A 1J3HA 3E8CA 4UXQA 3EFWA 5EHYA 2Q0BA 3G0EA 4F65A 4AZTA 4DEHA 4FE2A 2C0IA 4G5PA 4KD1A 5CQWA 3LVPA 4BB4A 3A8WA 1IAJA 3VS7A 3DQXA 2OG8A 2J50A 5HLNA 3NNVA 3L9NA 3IQ7A 3LLAA 1Q8ZA 3LFBA 4GJ2A 4IZYA 2Y6MA 4C4FA 5DYJA 1ND4A 1PYEA 2HCKA 3MVHA 3RCJA 2OWBA 3EN7A 3H0ZA 3BEGA 4NK9A 5ANJA 4FTQA 4CZUA 3DGKA 5ANDA 5FD2A 4ACMA 4TYEA 1SMHA 3VS0A 3LM0A 2OI4X 1KV1A 4WNKA 2W05A 5M51A 4O27B 3R7OA 3DAJA 4S2ZA 5JFSA 3DXQA 5F9EA 4QQJA 4ACDA 1XQZA 1O9UA 4BCFA 4L42A 4APPA 5GIPE 4U79A 3M2WA 3PJ3A 3FMLA 4QYHA 2UZBA 1PY5A 4JAJA 4GT3A 3FAAA 4I5HA 3VHKA 4JJRA 2HZ4A 5CEOA 5KUPA 5CF6A 4KIPA 4WG5A 3FLYA 3P23A 4C4JA 4UWCA 3JR1A 3MW1A 1BI8A 4R1VA 4IANA 4RJ5A 3Q6UA 3OW3A 1JLUE 4L7FA 5F95A 2ZV2A 3DNDA 4N0SA 4JX3A 3MTFA 3UO5A 5JKGA 4B8LA 5EDPA 4E6QA 4F6WA 2V7OA 4QQTA 4RIYA 3CR0A 5CSHA 4M84A 4GS6A 2O5KA 5HCYA 2Y9QA 2PU8A 5HNGA 4CYIA 3MFSA 3HMNA 4RPVA 5JGBA 1OL7A 3I81A 3RAWA 3U4WA 4FV1A 3T3VA 1Q41A 3AC2A 4IDVA 4YZDA 4J97A 4L53A 1QPJA 4FYNA 3DKCA 4I6HA 4V01A 4X3FC 3AC1A 3PTGA 1KE7A 1RE8A 3CQWA 3VF8A 3OWKA 3F69A 3FQSA 3NWWA 4I5CA 5E8WA 2PVNA 4FG8A 3EFKA 4EKLA 4ZAUA 3RK5A 1J1BA 2PVLA 5EH0A 5ETCA 4I23A 2C6EA 2JBOA 3C9WA 2W17A 2WEIA 1OZ1A 1YQJA 3OY3A 4JLCA 4PP7A 5IUHA 1YXTA 2ZB0A 5LVLA 3FZTA 4Q5HA 5HO7A 4G3FA 5HIBA 3EZRA 2HWOA 3VUIA 3FI8A 3V8TA 2JAMA 3S00A 3ORZA 4J95A 3UQGA 3S4QA 1OIQA 5IISA 2BHEA 2WPAA 3SOCA 3Q60A 2DUVA 4IVAA 4AN2A 4RMZA 3ATTA 4I93A 2WMAA 3UZRA 3DK3A 5CVHA 3UP7A 2WTDA 3U6IA 3P78A 3BE2A 4ZZOA 1CM8A 2QOBA 2XA4A 2YCSA 3ZSHA 2B55A 3R04A 3F82A 3FLSA 5E8ZA 3RZBA 4IZ7A 3UZTA 3ORIA 1DI8A 5K4IA 4I0SA 3TUCA 2E9UA 1SVEA 4CFVA 4TRLA 2X7FA 4QP1A 4Y8DA 1H1RA 4FSUA 4X0MA 3RHKA 3E8DA 5LMKC 2Z02A 5HNBA 3C4EA 3LQ8A 4I22A 3ANQA 2VTAA 3BHUA 5GNKA 5J5TA 4XG6A 1ZOEA 3HVCA 3S95A 3RPSA 3THBA 5KMIA 2VD5A 4OBPA 1ZXEA 5LWNA 4OTGA 3MY0A 3SQQA 1OL6A 3AT2A 5EI8A 4UZDA 4U40A 3DTWA 1KE5A 1WVYA 4ASXA 3ZHPC 4C02A 5KMMA 2PMOX 4DGNA 3BWJA 4QT1A 2JIVA 3JYAA 3WF6A 4DH1A 3GU4A 1KE8A 2ZMCA 4L46A 1APME 2BZHB 5GHVA 2QCSA 4G6LA 4V0GB 4NSTA 2VU3A 3HDMA 3PSCA 3QCQA 2Z7QA 4IX4A 3NW5A 4FKOA 4FTTA 2QOHA 3LJ0A 5H2UA 1ZARA 4XBUA 4I5MA 3UTOA 3DB8A 1OL5A 3KMMA 1K2PA 4IMYA 4J52A 3ZLYA 4C3FA 2VZ6A 2P55A 4HYSA 2DQ7X 4J98A 4TWOA 3VS3A 5CS6A 2J0KA 4IAKA 5I9VA 3O50A 3B2WA 4RQVA 4EK3A 4F9BA 4YMJA 4ZXTA 2PVYA 3CIKA 4E20A 2FO0A 4GU6A 1H25A 4L6QA 3BCEA 2YITA 2C30A 1Z9XA 3CQEA 3FY0A 3PJ2A 2XYUA 4M8TA 4P7EA 4CKIA 4O7TA 3OD6X 3RP9A 1GY3A 4X2JA 2VTRA 2KTYA 2RFNA 3LXNA 5HVYA 2G2FA 2XKEA 5FGKA 4H39A 4YHJA 4FSRA 2WNTA 2WMVA 3EN6A 4GW8A 4JOAA 4D4VA 4FEVA 2XNMA 4FK6A 4D55A 3VULA 4PPCA 1GNGA 3PXRA 4HZRA 4U3ZA 4QMXA 4XRJA 2A0CX 3FMDA 4IAFA 4K9YA 2BAQA 2HZIA 4CGAA 1R0EA 1Q61A 2ZOQA 4JDKA 2P0CA 3Q4ZA 3C13A 3C4CA 3Q9WA 5EYMA 5KE0A 2QU6A 4XP3A 4FTLA 2PHKA 4ACHA 4A4OA 5JFWA 5LJJA 4YJPA 5IU2A 1FVRA 4BI1A 5L2TA 4DBNA 4IJPA 1MP8A 3OEFX 4DLIA 4F9WA 3ACKA 2YM4A 4YLKA 2VTNA 4Y85A 5HG9A 1OBDA 5EQYA 3C4FA 5DGZA 2P33A 4RX7A 3KQ7A 5M4CA 4BF2A 2WELA 4BDDA 4BZNA 3EQCA 5EYKA 1P4FA 3BGZA 3EQPA 4GCJA 4HYIA 4BFMA 4FX3A 3FC2A 3WZUA 4ACGA 4FV4A 5TR6A 1MRVA 2BALA 3A7JA 2VTOA 4O7NA 3UG2A 2EVAA 2OXDA 3EKNA 3E63A 5L2IA 4RJ7A 3QGWA 4AW1A 5J9YA 4ZTLA 5IA3A 4G17A 1OUYA 3ORMA 2F7ZE 4K77A 3UNZA 2R3NA 1U46A 5K0XA 5DT0A 4H05A 2YLFA 3KFAA 4N4SA 4RWIA 4LV5A 4D28A 4UX9A 3MH1A 2XZSA 3QGYA 4JDHA 4YBJA 4CD0A 4X3JA 2X7OA 4DITA 2JKOA 5DA3A 4C36A 2BTSA 4FZ6A 4TW9A 3LCSA 2VTSA 3LAUA 4FTCA 4UV0A 4BWKA 1S9IA 2OIBA 1HCLA 3NIZA 5I9ZA 1KSWA 2QKRA 1OL2A 4GRBA 4G31A 2ZV8A 4FKUA 4X3FA 3TKIA 4IH8A 3BU3A 2HWPA 4XRLA 4ID7A 4UYNA 4YSMA 1YDTE 3RWQA 2PE2A 4C59A 4C62A 4WNOA 3FMEA 4UYAA 4KS8A 4MNEA 2I0VA 2VX1A 2R64A 3VO3A 3LFAA 5AP5A 4DGLC 1WFCA 2C5YA 5IPJA 4AN3A 4EH7A 5M07A 4USFA 4FG9A 1WBTA 2R2PA 4L45A 3R8ZA 4ORKA 1P14A 5A46A 3SLSA 3LFDA 4W8DA 2WTVA 3KC3A 4QTDA 3V01A 2VNYA 5JQ5A 5FM3A 2C0OA 4TYHA 4CFXA 3TXOA 1FBNA 3KVWA 4NM7A 5B7VA 3BLRA 2PZYA 4EJ7A 3BYUA 2UW7A 2AC5A 4ANMA 4FTRA 3C4ZA 2ITXA 5BVKA 5IZFA 3EL7A 3ET7A 5HEZA 2FGIA 1PMNA 4OAVB 4JQ8A 2C4GA 3AGMA 1VYZA 3CQUA 5IQDA 4CSVA 3CKWA 3ZDIA 1BUHA 3IKAA 4QD6A 5IF1A 5JFVA 3V5QA 2VTMA 2ZVAA 4JS8A 4IEBA 1JVPP 3QWKA 4DEIA 3QD2B 2ZV7A 3UOLA 2IVVA 2OK1A 2IO6A 4DHFA 3K3IA 3FY2A 3MSSA 5LMKA 4RT7A 5GZAA 4I6QA 1NT2A 3SA0A 1SVHA 2ITWA 4BWPA 1SM2A 4IB1A 5CWZA 5D12A 2IW6A 3IW4A 4FIHA 3TT0A 3NUAA 3DBFA 1WZYA 3NUXA 3PP1A 5EYDA 3Q2MA 4IC8A 3MI9A 1PMUA 4FSQA 3ZSGA 4P5QA 5BMSA 4LFIA 3R7UA 4TKSA 2IW9A 5JZNA 4FNZA 4M0YA 4NM0A 3ZCLA 5AADA 1LUFA 3P79A 3O96A 5DMZA 2GHMA 4FICA 5DI1A 4WD5A 3TACA 3A7GA 3QCXA 3FMKA 1I44A 4GYIA 4K0YA 3TV6A 4DEGA 4U7ZA 3ZMMA 3COKA 4D1XA 2I1MA 1DAYA 3D4QA 4Z16A 1MQ4A 4JG8A 2YACA 4EORA 3BQRA 3O23A 5HCXA 2Y6OA 4UEUA 3RAIA 4FODA 3HV6A 5E8TA 2WQBA 5IA0A 3KXNA 4YGAA 4A06A 5C4KA 5KMLA 1Y57A 2R0IA 4NIFB 3G5DA 5CLPA 4CKJA 3UP2A 3LQ5A 2W1HA 1NVRA 1UVRA 3ZLWA 1FINA 1W7HA 2OO8X 5A4EA 3LMIA 3AD5A 4ZTMA 4FNXA 2GMXA 2UVYA 4D5KA 1TQPA 3LOKA 4Z7GA 1UU7A 3BEAA 3O7LD 3FL4A 3Q04A 3F7ZA 4PRJA 5ICPA 3VQHA 4QMNA 1F5QA 3HNGA 3IONA 2YDKA 3QRUA 4S34A 4AP7A 3I0QA 4BRXA 4DAWA 5I0BA 4CFWA 4UB7A 4D2WA 5BUEA 2A19B 3BELA 2VO6A 3SVVA 2QLUA 1IASA 4BDHA 2J51A 1OBGA 2E9NA 5EKOA 2W1CA 2GS7A 3EHAA 4BGQA 3CC6A 2BFYA 2W1FA 3ERKA 1W8CA 3HLLA 3I7BA 5AUZA 4QP9A 2XBJA 3GCSA 3ROCA 4Z55A 4GL9A 4UMUA 2IZSA 5KBQA 3QTZA 5I3RA 3HL7A 5J7HA 4KRDA 1H08A 4PV0A 4EC8A 2H8HA 3LJ2A 3VW8A 2GS6A 3VF9A 3ZC5A 3O0GA 2ETMA 2JEDA 3FV8A 3BYMA 3NX8A 3DAKA 3MYGA 3UBDA 3KK9A 2B54A 3I0OA 5T68A 4OTIA 5CEPA 1WBSA 3CCNA 3ATSA 3MFTA 4YURA 1YHWA 5IA2A 4WA9A 4EH5A 3MB6A 4FTNA 4G34A 1Y6BA 1UA2A 5EW8A 3AD4A 4KKEA 4DBXA 4F0GA 4DFBA 3UMXA 5GINE 3AT4A 4RVTA 4YBKA 2WIHA 4PF4A 4ENYA 2UW0A 2O63A 3MVLA 4RJ8A 4EQCA 4O0UA 3G6HA 4AUAA 4NT4A 4N57A 2YM8A 3FZSA 4BBFA 4EUTA 3HP2A 5AAEA 3EL8A 4EOQA 2ACXA 1UNGA 2A4LA 3ODZX 3HDNA 2YJRA 4B8MA 4Q9SA 1M7NA 4P90A 4HPTE 1KOAA 3ZZWA 3BHVA 4EK8A 4YTCA 2IPXA 4GKHA 4IQ6A 3KRWA 4HJOA 2J5EA 4DG0E 4O6EA 4FT9A 4LOQA 5ACBC 3FJQE 4A4LA 1M17A 4BCQA 1QPEA 3P86A 5CU2A 2JDSA 3HEGA 3OXZA 2XK8A 5AJQA 3QRIA 4E1ZA 3KN5A 3ENHA 3FZ1A 4GH2A 5D11A 4ANLA 1LR4A 3RJCA 4B9DA 3D83A 3N51A 4QP2A 4E4MA 1E9HA 3SDJA 3MFUA 4L00A 4C2WA 3SW4A 2GNJA 4NH1A 5DE2A 2VO3A 5DT3A 5HLPA 4BWXA 4CLJA 3C5UA 4I5PA 2UZWE 4QOXA 4XV2A 5CTPA 3Q53A 2QQ7A 3RK7A 1YOMA 2ZAZA 3Q2JA 5CANA 3C0HA 3TV7A 4YNEA 5IUIA 3G2FA 5EM5A 2PMNX 3TJDA 3H9OA 4BCPA 2G9XA 3FE3A 3C4XA 3E87A 5IQIA 1M14A 3SG9A 3GC8A 4IJ9A 4WRGA 3SOAA 1UV5A 4MD8E 4ALUA 4K11A 3PUPA 4FSMA 4N6YA 3V6SA 5EKNA 3MIYA 4HVSA 3WF8A 3DXNA 5ANIA 4CNHA 4BR3A 4EONA 3AC8A 3O8PA 5H3QA 4LL5A 3NVMB 4GKIA 5DPVA 2CN5A 1H01A 4UMTA 5CZIA 2QOKA 2R3KA 4EOLA 4CKRA 2GS2A 4J8MA 5AV4A 5LVMA 4L01A 5CEIA 4NM3A 3TNIA 4FSTA 4FTAA 5ANOA 1S9JA 3QLGA 3W2QA 3PYYA 2W4OA 3K5UA 2BAKA 3ZOSA 3ZBFA 3JPVA 5CNOA 3N4VA 2PVFA 5C1QB 5B0XA 3C4WA 1FOTA 2JIUA 4GU9A 5FM2A 3UVPA 5HCZA 4ALWA 5BYYA 3F3TA 4S30A 4WBOA 4QTBA 5CSVA 4XV1A 3KXZA 3K5VA 2J9MA 3GC0A 4TZRA 2BMCA 5E8SA 4R7BA 3L9PA 4YUQA 4RVKA 5KMJA 3QRJA 4OTDA 3TJCA 4FT5A 4FL1A 2QURA 4FKWA 2CCHA 3P7BA 4DGOA 3GT8A 3RINA 4A9SA 1OKVA 4E6AA 1ZOGA 5I5ZA 3OEZA 3TUDA 3FHIA 3QUEA 2A1AB 3TKUA 3BBWA 3PIXA 3U51A 5I9WA 5IEYA 4EH2A 3KN6A 3D2IA 3PLSA 4FIEA 2NPQA 2J0JA 1PYXA 3OCTA 4GYGA 1JSVA 3ZM9A 5FTQA 1R0PA 3TNWA 1PKGA 2R7IA 4LGGA 4G2FA 5CXHA 4YZCA 3RTPA 4WG4A 3G6GA 4QTAA 4YC6A 4NZWB 3ZUUA 2QOOA 4IWPA 3R00A 4HVDA 1IG1A 3DKFA 4GG5A 4PTGA 4RJ4A 2ITUA 3WZDA 3TZMA 5L6WL 3W8LA 4CVAA 2W99B 3R8MA 3A2CA 5IQCA 1YOJA 3PXQA 2G01A 3LPBA 2VRXA 5EI2A 4O83A 3RAKA 5E92A 1URWA 2XIZA 3CY2A 3JUHA 4GUBA 3ZXZA 4CFNA 2UW9A 2X9FA 2PUUA 4MF1A 2QONA 2XMYA 3OWJA 2RIOA 4KNBA 4D2VA 4FR4A 2GQRA 3BHHA 3R8PA 3D14A 3FMMA 4RG0A 4E5WA 5CAPA 3COMA 1NY3A 2WB8A 4BCHA 4KIOA 2OJIA 4YPSA 4EBVA 5KMNA 4IZAA 4X2KA 2HW6A 3PVGA 5DR9A 1A9UA 4EBWA 4W9WA 4FIFA 5J7BA 3SRVA 5FXSA 3MS9A 1PXMA 2F7EE 4FV9A 2WQOA 2XCKA 5HIEA 4KAOA 3TL8A 2ZDUA 2I0EA 4NKAA 3QWJA 4FF8A 4RIWB 5B2LA 3HECA 3VC4A 3R71A 3VS5A 1XBBA 3GC9A 2OIDA 5LMAA 4DC2A 2VWBA 4RC3A 2JFMA 2VTJA 4G1WA 4GK2A 4E4NA 5CAVA 1M2QA 4UMQA 3DFAA 1V0BA 3D5WA 5FEEA 1PXJA 3UC4A 1OVEA 5AV2A 3OOMA 1J7LA 5CF5A 5L4QA 4O1PA 1GIJA 1STCE 3QC9A 4BDKA 4FSNA 4D4YA 5AP6A 3BWFA 4AA4A 5K3YA 3UIBA 5AV1A 2OFUA 4AU8A 2FB8A 5AP4A 4GUEA 3VJOA 2OU7A 2WTKC 2OBJA 4OUCA 3ZLXA 3ORNA 3E7VA 5CEQA 5HLWA 1K3AA 3PY0A 5AR2A 2PVHA 4IX3A 5KZIA 4GK3A 5C9CA 3CGOA 4C4IA 1H1PA 4WOVA 3LCTA 5FXQA 3D7TA 4M12A 5IH5A 2WKMA 3CS9A 4P4CA 1CKPA 3A7HA 3P9JA 4FKTA 1OECA 2CJMA 1Q24A 3KMUA 3KRJA 1XBAA 4R7HA 4XLIA 5TE0A 3EQBA 4F08A 5J9ZA 1W98A 3QZFA 3KCKA 4FBXA 2W1DA 4C0TA 4F70A 4UZHA 2W7XA 3OVVA 4PDSA 1DS5A 4IHPA 1CKIA 1PJKA 5AP3A 3CY3A 3GP0A 3VS4A 3MBLA 4I24A 4D9UA 2CGXA 4ZS0A 1JSTA 4RIXB 5GIOE 3DJ6A 5IMXA 2XIYA 4CMOA 2CLQA 5L2WA 2YCQA 3LMHA 4ZK5A 3BYSA 2BUJA 2JC6A 3NUUA 4RVLA 1ZYJA 4YC8A 2WXVA 5DEYA 5CXZA 3O2MA 4WT6A 1W82A 2VTTA 3F2NA 3LFCA 2WEVA 5HVKA 2XB7A 4PPAA 3A8XA 3CD3A 2WO6A 4CRLA 4Q2AA 2Z8CA 2IJMA 2XNEA 4IW0A 1JOWB 3E62A 5AAFA 3KULA 4QMPA 4KSPA 5JRSA 3PLAE 3CSVA 4IADA 3QZGA 2XBAA 4DEEA 1TVOA 4FZ7A 4H58A 5DFPA 3LW0A 3V8WA 5DNRA 2HK5A 2VNWA 4IVBA 3ETAA 4BIDA 1VJYA 2XKCA 1XH9A 2E9PA 5AP7A 4CLIA 4II5A 1OM1A 5AIKA 3QXOA 4W9XA 3L1SA 1ZYCA 4RVMA 4JVGA 2V0DA 5H8EA 2FSMX 3UIUA 3SAYA 2BKKA 5EOLA 4D9TA 3D2KA 4AT3A 3ZXTA 2WMXA 3DPKA 2CKPA 4S33A 3Q52A 3WYXA 4FOCA 4YO4A 2XVDA 4FNYA 4EHZA 5HX8A 3OS3A 4YJRA 3DBDA 4KRCA 4FTKA 3DAEA 5ANGA 1PXLA 3ZRKA 3R9HA 4LI5A 4CMUA 4GJ3A 2W5AA 3FYKX 5AM7A 3OWLA 4KKGA 3VAPA 3WILA 4B7TA 4CCBA 3D5UA 1YWNA 4HGSA 4EK6A 4HZSA 4F9YA 4NW5A 3TIYA 3GU6A 2W5BA 3HA6A 3OROA 3GFEA 4O7LA 4TTHB 1GZKA 2B0QA 1QL6A 3CPBA 3PY3A 1CDKA 5ETIA 5GJGA 1ZOHA 3TIZA 5BYLA 3MJ1A 4PTEA 2ITOA 3BU5A 3DKGA 3NYXA 4DEDA 1UU9A 4I4FA 2HIWA 4ZZMA 4AN9A 5IMEA 4JG7A 4M97A 4NTSA 5I9UA 1H4LA 5AP0A 5CU3A 3BX5A 4GFGA 3L9MA 5I9YA 3C0GA 4FOBA 3ZFMA 3I7CA 2EB2A 4D5HA 2XIXA 2ONLA 2YFXA 2OIQA 3HA8A 2X7GA 4BC6A 4GVAA 4NJDA 3LZBA 1JAMA 2YCRA 4G3DA 4QYEA 3CLYA 4V04A 4YC3A 4F09A 1Z5MA 2VTPA 4OR5A 4P2KA 4A9TA 3T9IA 2J4ZA 1WBNA 4EKKA 3QTXA 3TV4A 5J8IA 1CTPE 2EUFB 1F3MC 4O2PA 3R9DA 3DBQA 4L44A 1BL7A 3ZUTA 3GCQA 3HZTA 3MV5A 4JBVA 4LL0A 4DT9A 1WMKA 3N9XA 5HORA 3UPXA 1YI3A 3D15A 4I6BA 4PPBA 3N4UA 4DEBA 2QODA 3NAXA 4ENXA 3A62A 2C69A 2C1BA 1MUOA 4XNEA 5AUYA 4C35A 4DCEA 5FUTA 2RSVA 5AEPA 3F5UA 3UODA 4BZOA 4KBAA 2QOLA 4RJ6A 3VNTA 4DINA 5JH6A 3Q9YA 2R3GA 4M3QA 3MY1A 3QTUA 5DR2A 4XX9A 5LMBA 4BCOA 3BRBA 2WTKB 3QQFA 5M55A 3VUTA 2VTHA 4MBLA 2ZM3A 3Q4UA 4BHNA 4TYGA 5TF9A 4PQNA 4D4RA 3IG7A 3U87A 4AXAA 4O0RA 3E88A 4BCJA 3LM5A 4DGMA 1FPUA 1WBVA 2C3LA 2H6DA 5T3QA 4XV9A 5HTCA 3EQHA 2G2HA 1OKWA 3EYGA 5JQ8A 3G9LX 1P5EA 4PMMA 3VBXA 4ZJIA 2C6IA 3HV4A 1WVXA 4G3EA 4Z9LA 2FUMA 1UNHA 1OMWA 3PXFA 4O38A 1JSUA 3ACJA 2J6MA 4XG7A 5LCKA 2JLDA 4KABA 3W2SA 4HOKA 1XH5A 1PXKA 4OAUC 1HCKA 3QZHA 4QTCA 4CFFA 2Q0NA 4AE6A 4BKZA 5EHOA 4I94A 5TT7A 4QMQA 3FKOA 3SW7A 4EH8A 2HAKA 2CNVA 4YJUA 4ZEGA 3H0YA 5IDNA 3EQFA 2BPMA 3O71A 2UVXA 4LUEA 3T9TA 3VRYA 4U81A 5CU0A 5FDPA 3GC7A 3GQLA 4YNOA 4J99A 5EDQA 5HI2A 2GNHA 2VGOA 3RVGA 2CCIA 4BZDA 1JQHA 4HCUA 3RCDA 3JVSA 4F9AA 3G15A 4DA5A 2ITVA 2W06A 2QKWB 2EB3A 2XNNA 2YM7A 3RHXA 4KKHA 4O0XA 3IW8A 4MD7E 4QPAA 4PUZA 4E7WA 2BHHA 1URCA 4ITHA 3ZS5A 3R9RA 4F4PA 3R02A 3ZTXA 4JDIA 3DDPA 3UGCA 2GQGA 4XG8A 2YISA 5AX9A 5HO8A 4AS0A 3UNKA 1IA8A 4KWPA 4F99A 3HV5A 4O82A 4FTOA 3BI6A 3FLZA 3PWYA 3D5VA 3GQIA 4AFJA 4FKJA 2YWPA 3ZYAA 2R9SA 4M14A 3A4OX 5EI6A 4TYJA 4O7SA 5JSMA 1JKKA 2HOGA 4EQUA 3REPA 3P7AA 2FVDA 3MWUA 3KF4A 3ORLA 3W55A 3F88A 4CCUA 4TL0A 3GU5A 2XF0A 4ZTRA 3MPAA 4USEA 2IZTA 3L8PA 4MHAA 2XJ2A 4HVIA 4U44A 1LEZA 4U97A 2NRYA 3D0EA 4LM5A 3QA0A 2YA9A 4DH5A 4WKQA 3ZEPA 1H07A 3PZEA 2C6MA 2QR8A 1J7UA 2ITYA 3LMGA 2GSFA 4YZMA 5BVNA 4L67A 4FEWA 2EXEA 1Q8TA 1QMZA 2IZRA 5AUVA 2H9VA 3QL8A 3VS6A 5AUWA 2B9FA 4ACCA 4KIKB 4U80A 5E4HA 3BGPA 1ATPE 3KK8A 1XO2B 3CTQA 4AA0A 2JDTA 4FT3A 4ZY6A 3ZC6A 3PVBA 4DFXE 4EUUA 3SGCA 4JXFA 3PG1A 4FUYA 5AR4A 2ETKA 3AMBA 2VUWA 2HY0A 4LGHA 4AW0A 3PA4A 4DTKA 5BPYA 4BBMA 1Q8UA 1RDQE 3A4PA 1GIIA 2QI8A 4M69B 3CBLA 4YJQA 5HESA 4ALVA 5LQFA 2C3KA 4QPSA 4ZSLA 3LKMA 1H0VA 5DWRA 4WSYA 2F57A 4ZSAA 4FIJA 4FKIA 1G8AA 3VBWA 4CZTA 2B7AA 4IAYA 4YHFA 5AAGA 2XK9A 4QMOA 4FZFB 3BGQA 4C61A 4RX8A 2G2IA 1ZYLA 1ERKA 2W1ZA 2F7XE 3FLWA 2ERZE 4H1JA 3LE6A 4QMWA 3T8OA 4OTQA 4APCA 2YWVA 3QA8A 5CU4A 2WAJA 4BYJA 3LLTA 1EH4A 2KULA 3F5PA 2C0TA 3R01A 3QBNA 5JN2A 2AUHA 2C6KA 1XR1A 3PRFA 1R39A 4R3PA 3ZEWA 4I92A 4J96A 2J5FA 2X8EA 2V62A 3DLSA 3PIYA 1UWJA 4FT7A 4AWIA 1YI4A 3UNJA 3EYHA 5M53A 4G5JA 4GVJA 1BL6A 2WQEA 4O0SA 4XOZA 4FV2A 3PA5A 3E64A 1PMVA 3MH3A 4BI0A 4LOOA 4PNKA 3P5KA 3E92A 4IDTA 2HY81 2XIKA 3QUDA 3W1FA 3FQEA 4FTJA 4GT4A 4O7ZA 4H3PA 5JFXA 1U54A 1YXXA 4JDJA 3FZOA 4DT8A 2UW3A 3NNWA 3NNUA 4F6SA 4J8NA 3B2TA 3TNHA 4PDYA 3D94A 2FSOX 4MKCA 5J9LA 5HG8A 3PFQA 3OFMA 4GV1A 3LFEA 4YR8A 1LP4A 4I20A 5DBXA 2XK7A 3U9CA 5JRQA 3R83A 3F61A 4EI4A 2EXCX 5A6OA 5BUIA 4H3BA 1H8FA 3HP5A 2JDVA 2VWXA 4Y72A 5CU6A 5HICA 1GZNA 4JNWA 5T6KA 3IW5A 4IX5A 2CN8A 1A06A 3I6WA 2E2BA 4E5BA 2QO2A 5C8NA 4EOMA 3FLNC 2JKKA 3MB7A 4H36A 5EM7A 3UDBA 2BVAA 4XG9A 3R7EA 4KINA 4L43A 3KCFA 5E8UA 3A7FA 3I79A 2CKQA 3JS2A 3TDVA 1CMKE 2UZOA 3EN5A 3ULIA 3V3VA 4BCIA 3AT3A 2XYNA 3TN8A 3COIA 5AMNA 4EH6A 1OB3A 1U4DA 3G51A 5HE1A 3S1HA 5DT4A 4I3ZA 4ZLYA 2WTJA 2HENA 2PWLA 3GCPA 5D10A 3FPMA 4RFYA 3QYZA 4CG9A 3LCOA 2GFCA 4LYNA 2CDZA 3OZ6A 4X6RA 4B6LA 3QQLA 4BTMA 5AA8A 2X2KA 4QTEA 1Q99A 2QG7A 4FL3A 5LWMA 2ZV9A 5IH4A 1P2AA 2PL0A 2Y8OA 2PVRA 2BDJA 2Z7LA 4R8QA 3KU2A 3ZRMA 4O7WA 2I40A 3FXWA 5EM6A 5KHWA 5BVDA 3V5LA 1QCFA 4CV9A 5KMKA 2O65A 3DFCB 2JFLA 3OP5A 3TNPC 4ANOA 5AR3A 3EIDA 4AOIA 2W5HA 4LMUA 3TUBA 2VX3A 3JY9A 1MRUA 4NIFA 2PMLX 3ZFXA 4MX9A 5HE3A 3UVQA 5E8VA 3RPYA 4F63A 4CG8A 4C57A 3VN9A 3L9LA 2W0JA 3IDBA 1ZZLA 3NUPA 4OW8A 2AC3A 4AQCA 4AE9A 2J0LA 4IFCA 3ZH8A 5DRBA 5CEKA 2I6LA 3OTVA 5FBNC 3TCPA 4DH3A 1NW1A 4O91A 4H3QA 5HZNA 3JY0A 4R78A 4O81A 4BCMA 2B9JA 1LEWA 2YAAA 3PY1A 4LV8A 2Y0AA 3OCGA 4AGUA 4AZFA 4CEGA 4FSZA 4M13A 4O22A 1AGWA 1YXUA 4IVDA 2R3LA 4Y5HA 2P2HA 3FDNA 2RG5A 4CRSA 3RM6A 1XH6A 2UW6A 3MVMA 2ZM1A 4EHEA 5DR6A 5H8BA 4Z3VA 1BYGA 3LFSA 4Y83A 4KSQA 5F20A 1Z57A 4X6QC 3VW6A 3W10A 3POZA 3LXLA 3EJ1A 4EH4A 3L8VA 3AMYA 3IW7A 3WIGA 4QMMA 4C58A 5K4JA 4BDCA 2UZNA 3KRLA 4YP8A 2XKFA 5HBHA 3ZRLA 4BY9E 3HV3A 3IGOA 1G3NA 4MK0A 2XUUA 1Y6AA 4FGRA 4XEYA 4KUJA 2PYWA 4H1MA 2YM6A 4AGDA 3OOGA 5E90A 4ZSGA 4NFNA 4QP3A 3E5AA 3FI3A 3MIAA 4NL0A 5BYZA 2ETRA 4UWBA 1YHVA 2I0HA 2YM3A 4C4HA 3BE9A 3D9VA 1E1XA 1ZYDA 3FUPA 4FC0A 5A3XA 1JKSA 2HXQA 4FSWA 1JWHA 2SRCA 4QP7A 3L8XA 1H24A 2GNLA 3BIZA 2YDJA 3D7ZA 4WBBB 3JVRA 4BDGA 5A9UA 5A14A 4AACA 3FXXA 1YXSA 3VBVA 3QKKA 3BYVA 4XUFA 4PTCA 1B38A 3ZBXA 4JX7A 3GCUA 5M08A 4L68A 4XHKB 4U5JA 2O8YA 4HYHA 5HG7A 5FG8A 5HOAA 4JI9A 4CTCA 4TNBA 2ITQA 3F5XA 1ZY5A 2PZPA 3SX9A 3MPTA 3R21A 4QMVA 5FEDA 2OZAB 4ASZA 1OITA 4WNMA 4Q9ZA 3F7WA 4U41A 2X2MA 4DN5A 3AQVA 4FTMA 3UPZA 3VWAA 2YIQA 5CVFA 4EYMA 4G3CA 3PJ1A 1NXKA 4EOSA 3PVUA 4JBPA 2EU9A 4BTFA 4HPUE 4CFUA 5AP1A 4D0XA 2OW3A 4BYIA 3C5IA 4BVUA 4DEAA 2PUIA 2BIYA 2BZKB 3LFNA 3RK9A 5LCJA 4BCKA 3FWQA 2O0UA 3FYJX 3I5NA 1A48A 5DHJA 3FC1X 4J53A 5IQFA 2XRWA 4FKLA 4K2RA 2VWYA 1W84A 3CP9A 3K2LA 3PA3A 5IA4A 3UVRA 1BI7A 4PP9A 4BGGA 3HRBA 2OXYA 4X2NA 3RAHA 3OTUA 2F49A 4CZYB 1Q4LA 1Q8WA 5EQPA 4O1OA 2OFVA 3UZPA 3PWDA 4O0YA 5CZHA 5BVFA 3U55A 3HX4A 2GU8A 2R3PA 3QKMA 4D58A 5BQ0A 1R1WA 3NDMA 4JRVA 4E8AA 2RG6A 5AV0A 2XK3A 3ALOA 3H4JA 1UKHA 3WF9A 4DH8A 4BI2A 2UZUE 2C3JA 2HZNA 4NYEA 2XNBA 3W2RA 4R3RA 4U9AA 5IA5A 3OCSA 4YO6A 3P1AA 1H28A 3AG9A 2AYPA 4ZZNA 4MTAA 3ZO4A 4OTRA 3V8SA 3FZPA 4JBOA 1PXNA 4RLKA 3O17A 2BCJA 3NMUF 2WQMA 1WBWA 4DYMA 2IVTA 5CY3A 2WD1A 5HKMA 4KS7A 4BTKA 3ID6C 4FEXA 4IWDA 3R1SA 3UJGA 4NEUA 3R9OA 4EEVA 4UXLA 2WMUA 4GK4A 3R8LA 2QG5A 1KE9A 1OKYA 3QKLA 5GJFA 2RL5A 4ZTNA 4CQEA 4LQMA 5JK3A 1YXVA 3PXKA 4I1ZA 4XLVA 3E7OA 2Z7SA 2YCFA 2WOTA 2XK6A 4AZWA 5BVWA 1ZLTA 3BKBA 3NZ0A 5DIAA 2UV2A 3GB2A 3NCGA 2CNQA 4FVPA 4FKPA 5ANKA 3KY2A 2JAVA 4TNDA 1OIUA 2GTNA 3TZ9A 4USDA 5DVRA 3BV2A 3DY7A 1VR2A 3R7GA 4U42A 3QD0A 4WG3A 2XH5A 4C4GA 4EWQA 3QTQA 3DJ5A 2GNGA 5DOSA 1GZOA 2BILB 2YEXA 2W4JA 3OW4A 3TNQB 2P4IA 2X4FA 3VUGA
chains in the Genus database with same CATH superfamily
4KB8A 4IAAA 4NJ3A 5AX3A 3ULZA 3RNYA 3WE4A 4IM3A 4F64A 4QRCA 1H00A 3QTWA 3BZ3A 4ZJVA 4RFZA 2JDOA 3K3JA 3BYOA 2W9ZB 4JR7A 1YHSA 4YZNA 4O0WA 5HBEA 4D2PA 3E93A 4A9YA 4EK4A 3MA3A 1WVWA 4IZ5A 3E3BX 2WFYA 4YTHA 3SRVB 4DTBA 2WZJA 3NIEA 1P4OA 2C5VA 5CALA 2PTKA 4UWYA 4ZLZA 3PSDA 2QC6A 4IFGA 2PK9A 2YIWA 4HNFA 3M11A 2B53A 4PWNA 4AF3A 3UQFA 2UZTA 1FQ1B 4BDBA 1MRYA 2VGPA 2BRBA 5D7AA 2PZ5A 1U5QA 3HRFA 4OTPA 3RI1A 5HNIX 5AUUA 1OL1A 3KXGA 3SHEA 3QTRA 4LRJA 2OKRA 5JZJA 1XJDA 3PVWA 4ZS4A 3AOXA 5JGAA 3OXTA 3ALNA 4FEQA 2XP2A 3QU0A 2UVZA 1FMOE 2QO9A 4GIHA 1UWHA 3UOKA 3ZFYA 4F7LA 5K5XA 2WMWA 5IEVA 5B2KA 1SYKA 3LJ1A 4D1ZA 3P5JC 3IGGA 5AWMA 2R4BA 2PULA 1YWRA 1QPDA 3QHRA 4RIWA 4CT2A 4EK5A 3DDQA 3CXWA 2XAMA 4QDEA 2VWVA 2RGPA 2C1AA 3VS2A 5J87A 3VBTA 4AOTA 2ZMDA 2EWAA 4OT6A 1W83A 3F5GA 5AIRA 2CMWA 4GFMA 5BVOA 3KL8A 4Y95A 5HE2A 1M7QA 2XNOA 3II5A 3KF7A 5CSXA 5HU3A 4XS2A 3BLQA 3DS6A 5L2QA 5AUTA 4LGDA 3F3WA 3MVJA 1AD5A 4EH9A 2R0UA 2R3JA 2G1TA 3C50A 3E3PA 4AFEA 4FKGA 2QVSE 4WIHA 3MDYA 2Z7RA 3DBCA 4G9RA 5HD7A 3M1SA 4NUSA 4YSJA 3KXMA 4QMUA 3HKOA 2ITPA 4KA3A 2ESMA 5EHLA 5FP6A 2BTRA 4OTWA 2I7QA 3IO7A 3ORKA 1YDSE 2ITZA 3R8VA 3T3UA 1O6LA 2PUNA 3MESA 1RJBA 2WMQA 4G3GA 3DU8A 2OGVA 2RFSA 3PXYA 5IQBA 5HHWA 3FMHA 4BDIA 4FI1A 4M15A 3G33A 5FP5A 1NA7A 1WCCA 2QD9A 4QNAA 5LARA 2VTIA 4O4BB 1BMKA 4YJNA 1XHAA 2YDIA 2XS0A 2PVMA 1UNLA 3B8RA 2QOIA 1NVQA 4DFUA 3G0FA 3OT8A 5GZ9A 3AD6A 4C33A 3V04A 3DKOA 2WU6A 4RIXA 1FGKA 4EL9A 2FSLX 2WHBA 4MBIA 5CAOA 4ZIMA 4ONAA 2UW8A 3Q4TA 4OT5A 3TG1A 4E4LA 2XNGA 3UO4A 2OSCA 3NYOA 3DOGA 3FBVA 5G6VA 4FKRA 5LVPA 5E7RA 4ZMEA 5J5SA 3HAVA 1WAKA 4AXDA 4HGTA 4QMTA 3EN9A 4BHZA 4ZMFA 2OICA 3SXSA 2Z2WA 2IZUA 1R78A 3EQGA 2H96A 1J91A 4MYGA 5E8XA 2IW8A 5C8MA 4YU2A 4FV5A 3OCBA 4I41A 3ZO3A 4HCVA 3ZU7A 3GU7A 1QPCA 3WE8A 5HIDA 4O96A 3P4KA 4GT5A 3HMIA 4AZVA 3UMWA 2NP8A 2W1EA 2Y4IB 3DT1A 4U45A 2LGCA 4X21A 4F78A 5BNJA 4JAIA 5ETFA 5FQDC 4IAIA 5HTIA 3FEGA 4MVFA 3FI2A 4O7RA 4AGWA 3LFQA 4AZSA 4DFNA 4J71A 4WRSA 4L52A 2ZB1A 4TXCA 3GBZA 3C0IA 5DN3A 5C26A 2QU5A 1AQ1A 4EJNA 2CHLA 4OBOA 3ZDUA 1ZWSA 2C47A 3DV3A 1H1SA 4MBJA 4FZDB 1Q5KA 5DH3A 3TI1A 3W18A 4A07A 4ANNA 4RIYB 3R63A 4BDJA 3MJ2A 2JITA 5M57A 3AKJA 4YJVA 5KX8A 1OUKA 2ITNA 2XNPA 4R5YA 2BIKB 2ZYBA 4WHZA 1G8SA 4AG8A 2P3GX 4IB5A 1TQIA 3JXWA 4W4YA 3AC5A 4YZBA 4YZ9A 5F4NA 5A6NA 3P0MA 2GCDA 5JMSA 4LG4A 2A2AA 5AR8A 4YLLA 3ZZEA 4GIIA 1MQBA 3EB0A 2HZ0A 1YWVA 2YIRA 3A7IA 1W2CA 3R28A 2WOUA 3D5XA 4W4XA 1V0OA 5A4LA 2YZLA 2VWUA 3PG3A 2DS1A 4AGCA 2CGUA 3SKCA 2CLXA 3Q5IA 4NM5A 4PL4A 2PUPA 4ZTHA 1DI9A 1XKKA 2E9VA 2CPKE 2R3RA 4MEDA 4ZY4A 4FKVA 5AUXA 3UYSA 4BBEA 3VQUA 4R6VA 4DFLA 1PHKA 1PMEA 1XH4A 4CQGA 4AW5A 4DFZE 1M2PA 2YN8A 2RFEA 3F3ZA 2RKUA 3V5JA 2YM5A 2R3IA 4D0WA 4ITJA 4IM2A 4A4XA 4UALA 3WARA 2FSTX 5BVEA 4JG6A 1BLXA 1Q3DA 4O0TA 4XG3A 3NUYA 3WI6A 3I4BA 4B0GA 4DG2E 5D9HA 4MXCA 4E6CA 4FTUA 4JBQA 3ZO2A 4KBCA 3QX4A 4EHGA 2R3FA 1REJA 5M06A 3IDPA 3HUCA 2X0OA 4F0IA 3PP0A 3QFVA 2JKQA 4O21A 4YJOA 4BCGA 1KE6A 3NYNA 1CSNA 2YERA 3DBEA 4M0ZA 4MH7A 5HBJA 1XBCA 3QQJA 4L3PA 4O2ZA 1WBPA 5LXMA 4IB0A 4MAOA 1X8BA 1HOWA 2X81A 3GNIB 1V0PA 5CF4A 4I4EA 5JEBA 2B4SB 4Y5QA 1F0QA 3R6XA 4Y46A 1IA9A 1M52A 3SG8A 2WTWA 3EFLA 3S2PA 1JKTA 3DZQA 2J0MB 4AAAA 4D1SA 4WUAA 5KKRC 4EH3A 2WU7A 3KEXA 1FVTA 2UZLA 3NS9A 4FT0A 5F1ZA 5AR5A 3QAME 4IB3A 3VHEA 1IR3A 4XMOA 4JT3A 1K9AA 5J79A 4NW6A 5D7VA 4HW7A 2PSQA 3Q9XA 3KMWA 3BU6A 2UUEA 5CYIA 2XARA 3NUNA 4GEOA 3ZSIA 4BN1A 4CXAA 3WF7A 5CI6A 3QUPA 3R7IA 5L8JA 3O51A 5K5NA 3C1XA 4FVQA 2X1NA 4EZ5A 4RWJA 3B8QA 3WZJA 3OY1A 4AA5A 1H26A 4FG7A 1H1WA 3NUSA 2NO3A 3RALA 3QXPA 2QOQA 5CAQA 3F9NA 3MY5A 5E9EA 3FKLA 4DFYA 2QR7A 4ANBA 4MQ1A 4V0GA 4FA2A 4U6RA 3MPMA 4XP2A 3NSZA 3Q32A 4V05A 4XYFA 1PRYA 2R7BA 4WUNA 3VVHA 3W16A 4BIBA 2GQSA 1VZOA 3UQCA 4U0IA 4ZTSA 1OPLA 3VBQA 3GGFA 2ERKA 4E5AX 4PDPA 3KB7A 3I1AA 3G9NA 3Q4CA 3MTLA 3QQUA 3UDZA 5ITAA 5FTGA 4XG4A 1YI6A 4DCAA 4MCVA 2HXLA 4QYGA 2OJ9A 3ORTA 5IEXA 3C51A 5CENA 1H27A 1ZMVA 5G1XA 4I0RA 1T46A 3OT3A 2XEYA 4GMYA 3GCVA 3OMVA 4K6ZA 5EOBA 5BX0A 3HMOA 1FVVA 4BKJA 1OGYA 1J1CA 4BCNA 5IQAA 4AOJA 3U6JA 5C01A 3U4UA 4A9UA 5EW3A 3FPQA 3R73A 5FLFA 3R2BA 4XV3A 1JBPE 2O2UA 1YW2A 4QP8A 4MWIA 2BRMA 3A99A 4U43A 3E8NA 4QNYA 4RGJA 4XOYA 5EM8A 5KNJA 3QYWA 4IM0A 1GIHA 1SVGA 2OZOA 4RLLA 5E8YA 2GNFA 1JKLA 2VTQA 1XMLA 2XALA 3CPCA 2GPHA 2GHLA 3ML1A 2CKEA 4MF0A 3NLBA 4CV8A 5FXRA 2VWIA 4NCTC 2OXXA 2UZDA 1U5RA 1ZZ2A 5I9XA 1SZMA 3PIZA 3SV0A 1B39A 4GSBA 4D4SA 5I4NA 2YLEA 3QD3A 3H9RA 4EOJA 1E1VA 2B9HA 4I6FA 1TQMA 2OF4A 4KIKA 2PE0A 5I3OA 4L8MA 4QYFA 3FL5A 2X4ZA 4HGEA 1KWPA 3H9FA 4M67A 3W0OA 3DNEA 1UKIA 4EZ7A 3R1QA 5BUJA 4LDTA 3MH0A 4GG7A 3RMFA 1BKXA 2JBPA 4U8ZA 3GVUA 4F7JA 4X3FB 3LIJA 3R22A 3DB6A 4ZJJA 3RPVA 4TPTA 4B99A 4ITIA 3AMAA 3CKXA 3L8SA 3IDCA 4MNEB 4QMSA 5DLSA 2PMIA 4MXXA 4M69A 3TEIA 3ZLSA 4QMYA 2C5XA 3R30A 2X6DA 3Q3BA 5IG1A 1WBOA 1YOLA 4ZSEA 3VUDA 1JNKA 2I0YA 2C68A 5M56A 1GOLA 3W2PA 2V55A 5IQHA 2JIIA 4RSSA 4AXCA 1VYWA 2C6OA 2C6DA 4TYHB 2VN9A 2YZAA 3E8EA 4FZAB 3EQIA 3GEQA 3UE4A 2O64A 1ZYSA 2BR1A 4RFMA 4F1MA 2CKOA 3S3IA 2BRNA 5IA1A 4PMTA 4R5SA 1O6YA 4IE9A 3R9NA 4NWMA 5IUGA 3QZIA 3U9NA 5HQ0A 1ZRZA 5CT7A 2J90A 3BQCA 3DZOA 3R1YA 5F94A 5KCVA 5M44A 3GENA 3PZHA 3QTSA 1U54B 4GFOA 4PY1A 3UYTA 4QP4A 3R2YA 4RC2A 5KKRB 2QOFA 3Q5ZA 2C6LA 1OKZA 5H9BA 3GU8A 1O6KA 3FLQA 2XEZA 4BTJA 3PJ8A 2QHMA 3FI4A 5A54A 4L7SA 3ZUVA 3OG7A 3FZRA 2OJFE 3EOCA 3ZO1A 1Y8GA 4E4XA 2B52A 5H8GA 4HGLA 5E1SA 3W2OA 4AZEA 4F7NA 3BBTB 4G6NA 5J95A 2X6EA 4FIIA 4MQ2A 4OTHA 2X2LA 4N6ZA 3RGFA 3MFRA 4IX6A 4BDEA 2YJSA 4RIOA 1Q62A 1ZMUA 3PE2A 3VS1A 4TWPA 3VIDA 4AQKA 3OUKA 3GXLA 2IG7A 4UMRA 4AT5A 3VRZA 3FSFA 1CKJA 1GAGA 3ENMA 3U54A 3CGFA 3LHJA 4CFMA 2CGWA 2R3OA 4OTFA 3DA6A 2YABA 4R1YA 3HMMA 1KV2A 4QMZA 2R5TA 4W4WA 2DYLA 4BDAA 4DLJA 2ITTA 4ZLOA 1I09A 2VO7A 4MWHA 4EOKA 2E9OA 3GOKA 1PKDA 2VWZA 4FV8A 2V22A 4IACA 2WMRA 5HD4A 4LRKA 3O8UA 2JGZA 3QX2A 4EQMA 3R7YA 3DQWA 4XP0A 5IKWA 3VJNA 2NRUA 3R8UA 1XWSA 5HE0A 3KGAA 3IOPA 1SNXA 2J0IA 4J1RA 4RJ3A 5DEWA 3V5PA 3V5WA 4F6UA 3WZEA 4DH7A 4E73A 3W2CA 4E93A 2UZEA 2O3PA 5M4UA 2XJ0A 3QC4A 3DTCA 4B4LA 4BICA 2XKDA 3W0QA 5KO1A 5GJDA 3H10A 2XCHA 1ZMWA 1Q8YA 3O7LB 3OWPA 4JIKA 4HVGA 2WMTA 2F2UA 4MD9E 4EOPA 4F9CA 3VONA 4FIGA 5CF8A 5ANEA 3MH2A 3WBLA 2QHNA 5CASA 4O7VA 4OGRA 4ASDA 5FUTA 2WIPA 4PNIA 3V6RA 1YKRA 4RBLA 4PMPA 3H30A 5C8KA 2PZIA 5JGDA 4FGBA 4TYIA 4DE4A 3WIKA 4O0VA 5K9IA 2OLCA 3UC3A 4CMTA 1PF8A 3W8QA 3S0OA 2ZJWA 4C34A 3BL7A 3EQRA 3NEWA 5FBOA 1R3CA 5C27A 5FRIA 2AQXA 3O8TA 4FV7A 3RWPA 5JT2A 2XM8A 2GTMA 4IC7A 4JR3A 4K18A 3NNXA 1KOBA 5AM6A 2HELA 4O86A 5A4TA 4G16A 2FA2A 2GNIA 4IAZA 4JIAA 4YPDA 4LOPA 4Q5EA 4UN0C 5L2SA 1W2FA 3KVXA 4RA5A 5HGIA 4PL5A 3PRIA 5TO8A 4MNFA 2ZDTA 5EYCA 4A9RA 2WGJA 4JQ7A 3RBWA 2C5OA 2WMSA 2JDRA 3CTHA 4I0TA 5AV3A 3F6XA 3OUNB 4QP6A 4FEUA 5AA9A 4DG3E 3PJCA 1DM2A 1PXIA 4FK3A 4NCTA 2BRHA 4IVCA 4MXZA 3KKVA 2BDWA 4RA4A 4WO5A 3FMNA 3OHTA 3QALE 4IWOA 3RZFA 2UW5A 2CSNA 3PPJA 4WSQA 2YIXA 4FVRA 2PVKA 5TOZA 3UIXA 3CJFA 3HV7A 4OBQA 5EFQA 5HU9A 1U59A 3EQDA 3DCVA 4QO9A 4FUXA 4RRVA 4YTIA 3U6HA 2BZJA 2IN6A 1LPUA 4X7QA 4JRNA 2IWIA 3V51A 3KREA 2YAKA 4E3CA 3N4TA 1YVJA 3DK7A 3KRRA 2QO7A 3QD4A 4L3JA 3W33A 3TDWA 5A4CA 5AFVA 3NRMA 3UO6A 3GOPA 3UOJA 2W1GA 3HYHA 3ZONA 3Q6WA 5CI7A 3V5TA 4NU1A 5HTBA 4M66A 4QQ5A 4BKYA 2HW7A 3OBGA 1VEBA 5CQUA 3MN3A 3TZ8A 4EOOA 5M4FA 2W1IA 4IIRA 4ERKA 5ACKA 5EDRA 5BMMA 5KBRA 4L9IA 3F2RA 4ZSJA 4IXPA 3NW7A 1SNUA 4BJJA 3WF5A 3C7QA 2G15A 5EK7A 4HNIA 3TWJA 4M7IA 4OLIA 3KXHA 4JQEA 3POOA 3VUHA 4EHVA 2PPQA 2Y4PA 3R1NA 2X0GA 2UZVA 3I6UA 1IRKA 3DK6A 3EFJA 4FYOA 4DHIB 2BKZA 3ODYX 4FV0A 4C2VA 5L8LA 3QF9A 4UBAA 4MXYA 5CVGA 3KIOC 2X8IA 3QCYA 5GZ8A 4F1TA 4BDFA 3PPKA 4L3LA 4LUDA 3K54A 4C38A 5LVNA 2Q83A 1L8TA 2R3QA 3GUBA 4XG2A 3FXZA 2WMBA 1TKIA 2WTIA 3EKKA 3NPCA 4JL9A 5DG5A 4EZ3A 3OBJA 3UIMA 2OZAA 3ZM4A 4QQCA 5J1VA 4RQKA 3HAMA 4CTBA 2IVSA 1PXPA 5KZ0A 4YJTA 3LQ3A 3ORPA 4AXFA 3VUMA 4DF3A 4R77A 4IWQA 4I21A 2JD5A 4F1OA 2VAGA 1H0WA 2OF2A 4TWCA 3F66A 1YDRE 4YLJA 4J7BA 4Y73A 2LAVA 3RPRA 4N70A 3HUBA 2FYSA 2VX0A 3OC1A 1KUTA 5EQEA 3AGLA 3PXZA 2F4JA 3ANRA 3NGAA 1REKA 1J7IA 3QTIA 4O6LA 4RZVA 5D1JA 2C3IB 4PX6A 2VV9A 3AC3A 4O4CA 3WZKA 1RQQA 5K0KA 4C37A 1W0XC 5L8KA 4KIQA 4D2TA 5HG5A 4YHTA 2BROA 2A98A 3QCSA 3G90X 4O7YA 3FSKA 4FKQA 3DXPA 1OI9A 5A4QA 3OXIA 4XJ0A 5E1EA 3OF0A 4C4EA 1H1QA 3A60A 3KXXA 3Q9ZA 3Q96A 4TWNA 3NVKI 3NAYA 4WNPA 1JPAA 2CNUA 3BV3A 5L6PA 5CX9A 1B6CB 3EWHA 3R0TA 2QOCA 2XM9A 3IECA 5M4IA 3IW6A 5IQGA 2BFXA 3CE3A 1UU3A 4XH6A 2EXMA 2BAJA 1ZY4A 3AC4A 3W32A 4DTAA 2PZRA 3SXRA 3U8WA 2XK4A 4ZY5A 3CD8A 3IS5A 3ITZA 4P5ZA 2P2IA 5B2MA 2J7TA 3TTJA 2XRUA 2YHVA 2BDFA 4UMPA 1NVSA 2UW4A 1ZAOA 2OH0E 3F3UA 2YIYA 4NKSA 3P08A 5FDXA 3QLFA 4A7CA 4G6OA 4TN6A 2VTLA 3UOHA 2Y4IC 1PXOA 4YTFA 4PDOA 1OIYA 2W4KA 1PW2A 3MGYA 4MXAA 5CEMA 1XH8A 2VWWA 4RWKA 5LVOA 4PMSA 2REIA 4CT1A 4IBMA 2BZIB 4E6DA 4PL3A 5M09A 4FL2A 5J1WA 3QRTA 2B9IA 4Z7HA 5C4LA 4C3RA 3FMJA 3ELJA 4XBRA 4BL1A 3NR9A 3R7VA 5IDPA 4ZOGA 4O84A 5FWKK 1OGUA 2HYYA 3F2AA 3PDTA 4S32A 4DDGA 1Q97A 1RW8A 5KHXA 2B1PA 4HYUA 2ONLC 3GI3A 3SD0A 2VO0A 4FV3A 2F9GA 4ASEA 3RM7A 3ROYA 4QMLA 3I5ZA 3IPHA 3LFFA 3PPZA 4AX8A 2Y7JA 4K8AA 3WYYA 2C6TA 5L6OA 2V7AA 3CEKA 1L3RE 4RZWA 4NFMA 3FKNA 2OJJA 3EMGA 2ZM4A 4FNWA 3UG1A 5CNNA 1XMMA 3H3CA 3PE1A 4C8BA 4EC9A 4W8EA 4ERWA 5FTOA 2V5QA 5FEQA 3TKHA 4C7TA 4DGGA 2C5NA 4ARKA 1IEPA 3KRXA 4LMNA 5C03A 4BGHA 2JKMA 2F2CB 2X8DA 4RC4A 3SXFA 3IOKA 3LCDA 1T45A 3BLHA 2Z60A 1FGIA 5CSPA 3TYKA 3QHWA 4F7SA 3RKBA 5E91A 2PY3A 5AP2A 5LOHA 4E26A 4TT7A 3MA6A 4S31A 4D2SA 3IK3A 4ZP5A 4R7IA 3GFWA 3BPRA 3HRCA 1OPKA 2RFDA 4RX9A 3HGKA 5CT0A 3QRKA 2CGVA 2PE1A 2X9EA 3RPOA 3SC1A 3CTJA 3DLZA 1OPJA 3TZ7A 3NW6A 5KMOA 1UU8A 2FH9A 3EZVA 3NCZA 3FQHA 4FV6A 4K1BA 5D41A 2WQNA 2NNWB 3TM0A 2X39A 4M68A 3A61A 3D7TB 4AT4A 3LCKA 4FTIA 3BHTA 2QNJA 1OIRA 3EN4A 4QPMA 5DRDA 5HVJA 5TKDA 3VUKA 5IH6A 3EH9A 1M2RA 4QEBA 2OH4A 2XJ1A 4TY1A 2XIRA 4HCTA 4D2RA 2WTCA 4R3CA 4YJSA 2QLQA 4MXOA 3F3VA 3AXWA 3ORXA 2RF9A 2GFSA 5CAUA 4EYJA 2IVUA 4F0FA 1GJOA 1G5SA 4EWHA 1Y8YA 3LXKA 1IAHA 4RWLA 5EG3A 1V1KA 4FMQA 3QQKA 1GZ8A 2GDOA 1XH7A 2W9FB 1Y91A 3RNIA 4K33A 4AW2A 3VBYA 4BIEA 3M42A 1FMKA 4QYYA 4FKSA 3WOWA 4ANSA 5IQEA 5EW9A 4X2GA 3QQHA 4UY9A 3LXPA 5CSWA 4ZTQA 2W96B 4X2FA 3TTIA 5AR7A 2BRGA 3CJGA 3P7CA 4RX5A 3KULB 1YRPA 4NTTA 4LRMA 2GHGA 3QQGA 5L3AA 4CYJA 3BHYA 2R3MA 1BX6A 4XCUA 2J2IB 5HO6A 4HVHA 3PSBA 4W4VA 5ETAA 3HMPA 3COHA 4U3YA 3NFFB 4EOIA 2DWBA 3I60A 2H34A 3DJ7A 5HX6A 3FHRA 4G9CA 4C3PA 2OJGA 2R3HA 4KBKA 1Q3WA 4FSYA 3KA0A 3NYVA 1DAWA 4ANQA 2PVJA 2A27A 1J3HA 3E8CA 4UXQA 3EFWA 5EHYA 2Q0BA 4DDIA 3G0EA 4F65A 4AZTA 4DEHA 4FE2A 2C0IA 4G5PA 4KD1A 5CQWA 3LVPA 4BB4A 3A8WA 1IAJA 3VS7A 3DQXA 2OG8A 2J50A 5HLNA 2ZFYA 3NNVA 3L9NA 3IQ7A 3LLAA 1Q8ZA 3LFBA 4GJ2A 4IZYA 2Y6MA 4C4FA 5DYJA 1ND4A 1PYEA 2HCKA 3MVHA 3RCJA 2OWBA 3EN7A 3H0ZA 3BEGA 4NK9A 5ANJA 4FTQA 4CZUA 3DGKA 5ANDA 5FD2A 4ACMA 4TYEA 1SMHA 3VS0A 3LM0A 2OI4X 1KV1A 4WNKA 2W05A 5M51A 4O27B 3R7OA 3DAJA 4S2ZA 5JFSA 3DXQA 5F9EA 4QQJA 4ACDA 1XQZA 1O9UA 4BCFA 4L42A 4APPA 5GIPE 4U79A 3M2WA 3PJ3A 3FMLA 4QYHA 2UZBA 1PY5A 4JAJA 4GT3A 3FAAA 4I5HA 3VHKA 3UDTA 4JJRA 2HZ4A 5CEOA 5KUPA 5CF6A 4KIPA 4WG5A 3FLYA 3P23A 4C4JA 4UWCA 3JR1A 3MW1A 1BI8A 4R1VA 4IANA 4RJ5A 3Q6UA 3OW3A 1JLUE 4L7FA 5F95A 2ZV2A 3DNDA 4N0SA 4JX3A 3MTFA 3UO5A 5JKGA 4B8LA 5EDPA 4E6QA 4F6WA 2V7OA 4QQTA 4RIYA 3CR0A 5CSHA 4M84A 4GS6A 2O5KA 5HCYA 2Y9QA 2PU8A 5HNGA 4CYIA 3MFSA 3HMNA 4RPVA 5JGBA 1OL7A 1VLRA 3I81A 3RAWA 3U4WA 4FV1A 3T3VA 1Q41A 3AC2A 4IDVA 4YZDA 4J97A 4L53A 1QPJA 4FYNA 3DKCA 4I6HA 4V01A 4X3FC 3AC1A 3PTGA 1KE7A 1RE8A 3CQWA 3VF8A 3OWKA 3F69A 3FQSA 3NWWA 4I5CA 5E8WA 2PVNA 4FG8A 3EFKA 4EKLA 4ZAUA 3RK5A 1J1BA 2PVLA 5EH0A 5ETCA 4I23A 2C6EA 2JBOA 3C9WA 2W17A 2WEIA 1OZ1A 1YQJA 3OY3A 4JLCA 4PP7A 5IUHA 1YXTA 2ZB0A 5LVLA 3FZTA 4Q5HA 5HO7A 4G3FA 5HIBA 3EZRA 2HWOA 3VUIA 3FI8A 3V8TA 3O5AA 2JAMA 3S00A 3ORZA 4J95A 3UQGA 3S4QA 1OIQA 5IISA 2BHEA 2WPAA 3SOCA 3Q60A 2DUVA 4IVAA 3W0PA 4AN2A 4RMZA 3ATTA 4I93A 2WMAA 3UZRA 3DK3A 5CVHA 3UP7A 2WTDA 3U6IA 3P78A 3BE2A 4ZZOA 1CM8A 2QOBA 2XA4A 2YCSA 3ZSHA 2B55A 3R04A 3F82A 3FLSA 5E8ZA 3RZBA 4IZ7A 3UZTA 3ORIA 1DI8A 5K4IA 4I0SA 3TUCA 2E9UA 1SVEA 4CFVA 4TRLA 2X7FA 4QP1A 4Y8DA 1H1RA 4FSUA 4X0MA 3RHKA 3E8DA 5LMKC 2Z02A 5HNBA 3C4EA 3LQ8A 4I22A 3ANQA 2VTAA 3BHUA 5GNKA 5J5TA 4XG6A 1ZOEA 3HVCA 3S95A 3RPSA 3THBA 5KMIA 2VD5A 4O4DA 4OBPA 1ZXEA 5LWNA 4OTGA 3MY0A 3SQQA 1OL6A 3AT2A 5EI8A 4UZDA 4U40A 3DTWA 1KE5A 1WVYA 4ASXA 3ZHPC 4C02A 5KMMA 2PMOX 4DGNA 3BWJA 4QT1A 2JIVA 3JYAA 3WF6A 4DH1A 3GU4A 1KE8A 2ZMCA 4L46A 1APME 2BZHB 5GHVA 2QCSA 4G6LA 4V0GB 4NSTA 2VU3A 3HDMA 3PSCA 3QCQA 2Z7QA 4IX4A 3NW5A 3W0MA 4FKOA 4FTTA 2QOHA 3LJ0A 5H2UA 1ZARA 4XBUA 4I5MA 3UTOA 3DB8A 1OL5A 3KMMA 1K2PA 4IMYA 4J52A 3ZLYA 4C3FA 2VZ6A 4MUQA 2P55A 4HYSA 2DQ7X 4J98A 4TWOA 3VS3A 5CS6A 2J0KA 4IAKA 5I9VA 3O50A 3B2WA 4RQVA 4EK3A 4F9BA 4YMJA 4ZXTA 2PVYA 3CIKA 4E20A 2FO0A 4GU6A 1H25A 4L6QA 3BCEA 2YITA 2C30A 1Z9XA 3CQEA 3FY0A 3PJ2A 2XYUA 4M8TA 4P7EA 4CKIA 4O7TA 3OD6X 3RP9A 1GY3A 4X2JA 2VTRA 2KTYA 2RFNA 3LXNA 5HVYA 2G2FA 2XKEA 5FGKA 4H39A 4YHJA 4FSRA 2WNTA 2WMVA 3EN6A 4GW8A 4JOAA 4D4VA 4FEVA 2XNMA 4FK6A 4D55A 3VULA 4PPCA 1GNGA 3PXRA 4HZRA 4U3ZA 4QMXA 4XRJA 2A0CX 3FMDA 4IAFA 4K9YA 2BAQA 2HZIA 4CGAA 1R0EA 1Q61A 2ZOQA 4JDKA 2P0CA 3Q4ZA 3C13A 3C4CA 3Q9WA 5EYMA 5KE0A 2QU6A 4XP3A 4FTLA 2PHKA 4ACHA 4A4OA 5JFWA 5LJJA 4YJPA 5IU2A 1FVRA 4BI1A 5L2TA 4DBNA 4IJPA 1MP8A 3OEFX 4DLIA 4F9WA 3ACKA 2YM4A 4YLKA 2VTNA 4Y85A 5HG9A 1OBDA 5EQYA 3C4FA 5DGZA 2P33A 4RX7A 3KQ7A 5M4CA 4BF2A 2WELA 4BDDA 4BZNA 3EQCA 5EYKA 1P4FA 4QDVA 3BGZA 3EQPA 4GCJA 4HYIA 4BFMA 4FX3A 3FC2A 3WZUA 4ACGA 4FV4A 4AXEA 5TR6A 1MRVA 2BALA 3A7JA 2VTOA 4O7NA 3UG2A 2EVAA 2OXDA 3EKNA 3E63A 5L2IA 4RJ7A 3QGWA 4AW1A 5J9YA 4ZTLA