3MY1A

Structure of cdk9/cyclint1 in complex with drb
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
322
structure length
314
Chain Sequence
b'DSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein kinase 9
publication title Halogen bonds form the basis for selective P-TEFb inhibition by DRB
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding/inhibitor
total genus 84
structure length 314
sequence length 322
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2010-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3my1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3my1A01
4BY9E 3WF9A 2P55A 4KS7A 4O7SA 1YWVA 2QOBA 4C38A 4EYJA 3CC6A 1P14A 4XMOA 4XG7A 2PVKA 2I0YA 3TG1A 4E5WA 2J6MA 3H0ZA 5EQYA 3N9XA 3PJCA 5GHVA 4FTRA 3OG7A 3RAHA 4E6DA 3MH0A 3I0OA 4HNIA 4MD7E 4U40A 3D15A 5EKOA 2W17A 2E9PA 1YI3A 2ITWA 3Q9ZA 3R6XA 2HXLA 3EL7A 4MCVA 4Y83A 3UYTA 4HVDA 2WMAA 4XP3A 2RL5A 1SVEA 3P9JA 4DEEA 3ZM9A 4FSRA 2IVSA 4M97A 4XLVA 3KRLA 4DHFA 2XBJA 4ORKA 2XCHA 2JDSA 3I0QA 3LM5A 4QT1A 5AJQA 3NR9A 2PSQA 2WTVA 2OFUA 2XIZA 4QMSA 3KVWA 3FL5A 1PYEA 5JMSA 3M2WA 1IAHA 3NCZA 4JG8A 4XS2A 4XUFA 2VUWA 1GIJA 2UW4A 4G34A 3F3TA 4F9AA 2BZKB 2QNJA 3A99A 2I1MA 1XH4A 2I40A 2WB8A 4NU1A 5KBQA 5KHWA 2GHGA 5TE0A 5AR2A 4DTKA 2VNWA 1NXKA 3KF7A 3MYGA 3ODZX 2XK3A 3R1YA 2GHLA 1GZKA 1BLXA 3OUNB 4FTTA 4FV4A 3ZEWA 4BDEA 4QYGA 3FLQA 4ASZA 4C57A 5JH6A 2WAJA 1K3AA 3KULB 4FSTA 2WHBA 3CE3A 3QQJA 2VV9A 4IC7A 4I1ZA 4PMPA 4KBCA 2XCKA 3KCFA 2W1GA 3TI1A 4XP2A 4RC4A 2W1DA 2VAGA 3R83A 4O0RA 1VZOA 3EN9A 4LGDA 1E9HA 4FMQA 1YOLA 4Q2AA 3DQXA 4BYIA 2QLQA 3IDBA 3QTIA 3Q5IA 4FYOA 3VC4A 5DWRA 3V8SA 4AP7A 3LLAA 4F6UA 3OVVA 1HCLA 5EKNA 4Q9ZA 3ROYA 3R7EA 5CAUA 3OEZA 4FL2A 3S95A 4A9SA 3TV7A 3Q96A 2QOFA 4WOVA 3VULA 5AV2A 2H96A 2LAVA 5HIDA 5E8SA 5ANJA 4IAKA 4A7CA 4NFNA 5LCJA 3NYNA 3ZSGA 3VS0A 4A4XA 2PE2A 4DGLC 4E4NA 3ZBFA 3QQLA 3UZTA 2A4LA 3UZPA 5CENA 4FTLA 3JR1A 3HV6A 3QGWA 3NGAA 2O0UA 3ZH8A 2AC5A 4DFYA 3H9RA 4U9AA 3UC4A 2R0IA 3VQHA 1L8TA 1JNKA 4N0SA 3FMDA 2YCSA 3W2OA 3QU0A 5I5ZA 4FSNA 5BMMA 4JBVA 3ODYX 2R3LA 2W1CA 5CT7A 3RPRA 3FZPA 2UW9A 3DJ7A 5D7AA 5HU3A 3HAMA 5HLPA 2HAKA 3NPCA 4N4SA 4OAVB 2IZUA 5J5SA 2XNPA 4PPCA 4JQ7A 2ZM4A 1JKKA 3ACJA 2FB8A 4HCTA 4HYSA 4XV3A 3TZMA 3WYYA 4WG5A 4G16A 5AR5A 3VAPA 2VTPA 1ZARA 2X6EA 1WBPA 4MK0A 3BPRA 5AV0A 3UP2A 2BHEA 4GVAA 5HG8A 2NO3A 4LQMA 4IX5A 2W5BA 3PPKA 4EJNA 5J1WA 4JDHA 5M44A 4IWDA 3VRYA 2QOQA 2OH0E 4CFMA 2QKRA 2YABA 5D7VA 3F9NA 3AC8A 3FPMA 4AW2A 3C0GA 3KGAA 2RF9A 4WBOA 4ZAUA 4DLIA 5J8IA 1P2AA 3KK9A 3ANRA 4HGEA 4OTHA 4O2PA 3WOWA 3TJDA 2P3GX 3G51A 2DUVA 4WRGA 5CXZA 4FT0A 4BVUA 2C47A 4I92A 4XG9A 2PMIA 4TW9A 5J1VA 1KSWA 3LFSA 3C0IA 2W1FA 2CNVA 4W4XA 2PVHA 4TYEA 4O84A 2XIXA 4P2KA 2WGJA 3HNGA 4FT3A 4U81A 1WBOA 3RPSA 3THBA 3OT8A 3L9MA 4U42A 4FNXA 3LCSA 2OIDA 4Q5EA 3WZEA 3FXWA 3BV2A 5HCYA 3G0EA 5HTCA 4MXAA 5CZHA 4NJDA 3V8WA 4IZAA 3CJFA 2GFSA 1DAWA 3KULA 1REKA 3PPZA 4YJPA 3ZXZA 4ERWA 3S00A 3UNKA 1B38A 1SNXA 5E8WA 3C1XA 5HICA 4ZK5A 5HE3A 2QLUA 2JKMA 2W1IA 2WU6A 4NM0A 5F4NA 4CFFA 1FBNA 1H1WA 4WKQA 4QP3A 4RZWA 3QQKA 2C30A 4BKYA 4J95A 3KXMA 4CTBA 4MD9E 3FAAA 2V0DA 4CZUA 4O96A 4MX9A 3DK7A 4UV0A 2OXDA 5FXSA 5CSPA 3ZTXA 4IFGA 3AC3A 2QR7A 2BFXA 1BX6A 5T68A 2XMYA 1G5SA 1W0XC 5AR4A 4FGRA 5IQFA 5FXQA 3R9RA 3N51A 3A2CA 4RBLA 3ALNA 3PWYA 4CKJA 3OT3A 4H36A 3IW8A 4FVQA 4O1PA 2XRWA 1U46A 2JKKA 3DXNA 2ZMCA 5CANA 3A60A 1B6CB 2I0VA 3FHRA 3W2CA 4BGHA 1YXTA 2VTJA 1PW2A 2X8IA 3TUBA 3CLYA 4UMQA 2P4IA 3GB2A 2HY0A 4YC6A 2UW3A 3H0YA 3ZO4A 5LMKC 4UXQA 2R3OA 4KSQA 3G9LX 1H28A 3ENHA 3NYXA 5JZNA 3VBXA 3VUMA 4XCUA 2B9FA 3HMMA 5EW8A 4AZSA 4AZVA 4F0IA 2X2KA 2B7AA 2C1BA 4PDPA 4EK3A 1YXUA 3MY0A 4B7TA 4V01A 1FGIA 3GCSA 2XNEA 2W0JA 3K3IA 3EZRA 3MPTA 1UNLA 4P7EA 2VN9A 3C50A 3OHTA 5IMXA 4ZS4A 2BRNA 3COMA 4GT5A 3PP0A 4PF4A 4DYMA 3MY1A 1R1WA 2UZOA 3K5VA 5GNKA 4E8AA 3BE2A 3F69A 3POZA 4XG8A 3TNWA 1K9AA 5JRSA 2HCKA 3GC9A 3IECA 3WIGA 3HRFA 3R30A 1I44A 3PVBA 4F6SA 1YQJA 3E8DA 1F3MC 3C4FA 2R3NA 4HGSA 5HBHA 2J0LA 2XK8A 5AP4A 3LMHA 3O8UA 4JBOA 4JDIA 3SKCA 3DBFA 3V6SA 4DEDA 5J9LA 3QKKA 3ZRMA 2VTNA 2WTKB 3KF4A 4EBVA 5CSVA 5HG7A 5EDRA 2FSLX 2E9NA 4DAWA 5HE0A 4RX9A 1OBGA 3OTVA 4C33A 4RFMA 1G3NA 3D94A 4G31A 2OJIA 4ANMA 4DH7A 4C4FA 5J9YA 1H00A 1M2RA 5EQPA 1YW2A 2BZJA 3HV3A 5K4IA 2EU9A 4DFBA 3ZM4A 3R1SA 4BI0A 3C51A 1YHWA 4X3FC 4FKVA 1J7IA 1S9IA 3FKLA 4AE9A 2R3GA 3QL8A 4AWIA 4EEVA 1T45A 3HV5A 4RQVA 5BPYA 4YJQA 5CU4A 4GS6A 3QD2B 1AQ1A 4AOJA 3BLQA 3WF6A 5KNJA 2X4FA 3LFBA 4EQUA 3UOKA 3D83A 3BYMA 3E3PA 4CT1A 2UW7A 3DDQA 4YP8A 4AT4A 5F95A 4B6LA 3T9IA 3R7GA 1A06A 4EYMA 3EYHA 2CGXA 4LM5A 3F5GA 1WAKA 2VWBA 2ZV2A 4BDGA 5DI1A 4YURA 3VHKA 3I6WA 2JFLA 2HIWA 2OK1A 4J1RA 4L00A 5CTPA 2HWOA 3O8TA 2SRCA 4ZY5A 4DCAA 2XM9A 3RVGA 5F9EA 2UVXA 3AC4A 2GU8A 4QMTA 3I6UA 4IH8A 4NCTA 3TV4A 4P5ZA 3ORMA 2BDFA 3CD3A 3SOAA 4LOPA 5IDNA 4FKIA 2UZUE 4A9TA 2UZEA 5K0KA 1Q3WA 4U7ZA 2GQSA 2VTTA 4FIEA 4L45A 4YC8A 4O7RA 1OZ1A 4UY9A 2RFNA 3RPOA 4IHPA 3AC5A 1CTPE 2WQOA 3HX4A 3I1AA 4TNBA 3QCQA 1UKHA 2V5QA 3RPYA 3D9VA 4ONAA 3ZLYA 3O17A 4M7IA 3GU8A 4BIEA 4Z7HA 2W99B 3CQEA 5M08A 2A1AB 2YWVA 3FWQA 3DA6A 3R04A 2G2FA 2GTNA 4FKUA 4GSBA 4XH6A 4KRDA 4ZMFA 2CHLA 2HK5A 3Q6WA 5LVMA 2QG7A 4G17A 1P5EA 3QYZA 2X7FA 3CTHA 4YR8A 5B2KA 3QRTA 2PZYA 1PXOA 3QD3A 4ITJA 5GZ9A 1J1CA 4PL3A 4H3QA 5ACKA 2BRBA 4F4PA 2C1AA 3SOCA 5AX9A 2C3KA 4PP9A 5M4IA 2H9VA 2W4KA 3I4BA 3QTRA 4KNBA 4QMQA 4HYIA 2CKPA 5A4TA 4ZTQA 3W10A 4FF8A 4FODA 4ZJVA 4ZZNA 5LMBA 4I23A 4I5CA 4FTQA 3L9NA 1Y6AA 2XNNA 1LPUA 2OFVA 3LJ1A 4RWJA 5C4KA 2J0MB 5H3QA 1JSVA 3MVHA 3VBYA 1Y6BA 4BGQA 5BVNA 5J79A 4QMOA 1WBWA 2YM4A 4GK4A 4TWPA 1JWHA 5TT7A 5CF5A 4O7YA 5IQIA 2C6IA 5BVEA 3NCGA 4HGTA 3IW4A 4DGOA 4L42A 3NVKI 1URWA 2ETMA 4K11A 2UZBA 4ALWA 3W1FA 4B4LA 4Y5HA 4QMNA 2LGCA 1PXMA 2W9FB 4EHEA 1DI8A 1QCFA 1FPUA 2O2UA 3P1AA 4V05A 1VJYA 3VUKA 5IH6A 3UO5A 1H26A 4NTTA 4XV2A 4F7SA 4J97A 1R0EA 4CCBA 4IB0A 4M13A 3FKOA 4F7JA 5L3AA 3ORXA 1JSUA 2IW6A 3MB6A 3G5DA 4JXFA 5CF4A 1G8SA 2JBPA 4RX8A 2YM7A 4RJ3A 3B8QA 4F1OA 4FSUA 1UU3A 3WZDA 4IW0A 3T3UA 4BCQA 3GXLA 3TIYA 3OW4A 4QP2A 3RHKA 5GJFA 3ZMMA 4E4XA 5A9UA 1JBPE 3OROA 3NNUA 3QKLA 2WMSA 3DXPA 1PXJA 4P5QA 3PRFA 4FKTA 4QTCA 5CWZA 4C02A 5A6OA 4JIAA 3R2YA 3Q9YA 1PY5A 5HNBA 3D2KA 4FNYA 3ORLA 1Z57A 2HZNA 2AYPA 2Y6OA 5FDXA 4B0GA 3MFRA 4D55A 5LVLA 2BZHB 3F5XA 5E8VA 4CQGA 4RJ7A 3BI6A 5I4NA 3U6IA 4F9BA 3SW7A 1PKGA 3NUUA 4ITIA 3SRVB 3ULZA 4AN2A 4LL5A 2O8YA 2YCFA 3OOGA 4NM5A 3SXRA 4BCIA 2GS2A 4E20A 4QPAA 2JDRA 3HDMA 4RT7A 3KB7A 3A7JA 3OXTA 3LW0A 3PVUA 3Q9XA 1GZ8A 2NRYA 3ZZWA 2YDKA 4RIXA 3EQIA 3BQCA 4B9DA 3QZFA 3LHJA 5EHLA 3BX5A 3DBQA 1H1SA 2OJGA 4C4GA 2JDOA 4YMJA 4E93A 3M11A 3SG8A 2BIYA 3FV8A 4L3LA 5A6NA 1BL7A 2VTLA 4QYYA 1PHKA 4ZSAA 4DGGA 4PDSA 3GENA 5IA2A 5KCVA 3R8VA 2ZAZA 4GIHA 2QHMA 2X7OA 3MVMA 1YDTE 3QA8A 3ZFYA 5K5NA 2W06A 2RFDA 3GU5A 4FZDB 4ZJJA 2IW8A 3U6JA 5AAFA 1UU7A 3SQQA 4BDDA 4BF2A 4N70A 4QP6A 3LFAA 4FX3A 4AACA 4DC2A 3DAEA 2JKOA 5FWKK 4APPA 4FVPA 2UVYA 4FKWA 4FT7A 5DBXA 3W8QA 4CEGA 1OMWA 2ERZE 4CZYB 2YZLA 5CSXA 3A62A 4G6NA 4O82A 1PF8A 3LFQA 3IONA 4UEUA 5DR6A 5TKDA 4DTAA 3GU4A 1IG1A 4IJ9A 1V0OA 5LWNA 4FE2A 3ZS5A 1K2PA 4RWKA 4A4OA 1H24A 5H8BA 4C2WA 4USFA 1APME 2JKQA 4FTJA 3MH3A 3PUPA 4G1WA 4WA9A 2R3FA 5KMJA 3TACA 1A9UA 4IAAA 2ESMA 4BCNA 1PXLA 1ZZLA 2XNMA 5KMLA 4IAFA 4S34A 4EHZA 1UWJA 1WBNA 2HZ4A 2XKEA 3PXFA 3IW6A 4JOAA 2VWUA 4AE6A 2WTDA 5BUJA 4K77A 3NMUF 3ZDIA 3HKOA 1ZRZA 5JEBA 4W4WA 2WTKC 2C5OA 2B55A 4FV6A 1U54B 3R0TA 4IX4A 2R3QA 4I4EA 3BHTA 4I6QA 5DLSA 2WQEA 4BCPA 4IEBA 4M3QA 2HW6A 4L3JA 2UZLA 2P0CA 2F2UA 3JVSA 3JXWA 4HOKA 4ZS0A 4TN6A 4X0MA 5HE2A 4ACDA 2IWIA 1S9JA 4FC0A 4TYGA 2F57A 4E6CA 3IOPA 5CU2A 4MXZA 3PVWA 3VIDA 2JIVA 1H08A 3GEQA 5CAOA 4IVCA 5CI7A 3C0HA 2YFXA 3QTSA 4PPAA 2W5AA 2PZIA 2A19B 5HO7A 4AFJA 3A8WA 4BFMA 3GCQA 3HMOA 3DTWA 4BWXA 2O63A 4YHJA 4MF0A 5BUEA 4PTEA 2ZV8A 5AEPA 3F88A 3W16A 4HVSA 4OTRA 3T8OA 4DT8A 1H1QA 3PZEA 3R00A 4L53A 3QZHA 3SRVA 1RJBA 4EH4A 5CY3A 3BE9A 2PZ5A 3PIZA 4ITHA 3ZO3A 1XR1A 4ZSEA 2R4BA 4MQ2A 2VWIA 4ALUA 1R39A 3FE3A 2VGPA 4R5SA 3FY2A 4EZ7A 1ZWSA 2EVAA 3PA3A 5G6VA 1Q97A 1SVHA 4IBMA 4I4FA 2Q0NA 4X21A 3SXFA 3COKA 3NW6A 5DVRA 3KREA 1H8FA 4M69B 4YBKA 2YDJA 3PIYA 3KXNA 5G1XA 4WIHA 5E90A 2UW5A 3EFLA 4BR3A 5IEVA 2FSTX 2IZTA 4RFZA 1QPJA 3AT4A 2OG8A 4CV8A 4BZDA 5BYLA 1KUTA 1XH8A 3IOKA 4Q9SA 4WSYA 4PPBA 3RI1A 4BN1A 2REIA 3FMEA 5AUTA 3NIEA 3ORZA 4XP0A 4RSSA 5K3YA 5BQ0A 5HX6A 1KE9A 2ITVA 5M4UA 3MVJA 4IQ6A 1UNGA 2PMLX 1JKTA 2WU7A 2C6TA 4E1ZA 1QPCA 4YNOA 2F2CB 3R2BA 2V62A 4QPMA 3O50A 4EUTA 2A0CX 4GRBA 3SGCA 4KIKB 1P4FA 3E8CA 3IG7A 4ANOA 3SXSA 4CKIA 3OXIA 4MYGA 3RM6A 4G6OA 1TVOA 4RJ8A 3PDTA 4QYEA 1RDQE 4BBEA 3NYVA 3FLYA 4AN3A 2E2BA 1IRKA 3CGFA 3HRCA 4D4YA 2BPMA 3MV5A 5M51A 1H25A 5CNOA 1NT2A 4Y72A 3AT2A 1JPAA 5A4EA 2XRUA 1Y91A 2VGOA 4RX5A 2BDJA 2WOTA 3F7ZA 3MIYA 3PA5A 3ZO1A 1W84A 3OP5A 3PE1A 4O27B 4LI5A 4CFXA 3DJ5A 3F3VA 3VS1A 3TZ8A 3Q4TA 4IB1A 3V5WA 4IFCA 4JIKA 5AP0A 3RP9A 4AOIA 2YCQA 5EG3A 1OUYA 5D41A 3LAUA 3HGKA 4FTNA 4UYNA 4CLIA 1U54A 2VWVA 2YAKA 3D5VA 3LVPA 5FP6A 1DM2A 3U4WA 3MIAA 1W83A 1XH5A 2XIKA 4KD1A 5AMNA 4D1ZA 2P2IA 4RZVA 5L8JA 4GFOA 4GKIA 3RWQA 4MBIA 4C2VA 2VO7A 4AZFA 4BDKA 1YVJA 2V22A 5FM2A 2ZVAA 5L6WL 3ZZEA 4DCEA 3IDPA 4DFLA 3DAKA 4BCHA 2R5TA 3QF9A 4F7LA 3EFJA 3O2MA 3AG9A 5CQUA 4HYHA 2FO0A 4KBAA 4BCGA 2IO6A 3FKNA 1J1BA 4AGCA 3VRZA 4NK9A 4X3JA 3V5JA 5IUGA 4X3FB 4FKOA 3RK9A 4HCUA 4C37A 3NAXA 5ANOA 5AUYA 2W05A 5H2UA 3UMWA 4F9YA 3Q3BA 3L8SA 4GFMA 3BGPA 2OSCA 1VYWA 3A7GA 3M1SA 4KKEA 4AF3A 4FV9A 3HA6A 4FZ7A 4IM0A 3FZOA 2PU8A 5FEQA 4UBAA 3EHAA 1PKDA 1UNHA 4JT3A 5EYDA 4USDA 3JUHA 4HGLA 5IA5A 2OZAB 4BCFA 2GS6A 4V0GB 4FKRA 3C9WA 4HPUE 4XX9A 2PMOX 3WYXA 3G0FA 2W5HA 3MWUA 5DH3A 4JNWA 4GCJA 2C5VA 4M69A 2IVVA 5IQHA 4TXCA 4CKRA 2CNQA 1LEZA 1GZNA 2HZIA 5EOLA 4F9WA 2X2LA 4ZY4A 2PVJA 3PVGA 4BHZA 2YA9A 2XKFA 2A2AA 1TKIA 1M7QA 1J7UA 2CCHA 5BVDA 1XBAA 3KRXA 1ND4A 1F5QA 3BZ3A 4RIWB 2R3RA 4O0XA 2CDZA 3F2AA 5AA9A 2EXMA 4KAOA 4U6RA 3BBTB 3C4XA 4BKZA 5I9XA 4FVRA 4QMZA 4G9RA 5A46A 3TTJA 5LMKA 3U9CA 1JQHA 2UZVA 5DEYA 4AT5A 4WRSA 1JSTA 1SZMA 3VBTA 1YXSA 5FDPA 5C8KA 3NS9A 5L2WA 2YZAA 2Y4IB 5M55A 1SM2A 2Y9QA 4KIKA 4FL1A 2ITXA 3P0MA 4YJSA 3RAWA 2QVSE 4GKHA 2OU7A 4D1SA 5BUIA 3TM0A 2J50A 2XZSA 5HLWA 4JG6A 4CSVA 4IWQA 5IF1A 4FTOA 4FTAA 1WVYA 4BCJA 2FVDA 3FLNC 4BCOA 1QMZA 5HIBA 1G8AA 2X8EA 4FTKA 4WNOA 3PXKA 3QZGA 1URCA 4QMLA 3HP2A 5E8UA 3AGLA 5BVFA 5D10A 1XHAA 3DNEA 4BTMA 4AXAA 3ZYAA 4NYEA 4JAJA 4ZSJA 4UMUA 1REJA 3SLSA 5D12A 3VQUA 5CU6A 1BI7A 3ERKA 4WBBB 5CEQA 2VTMA 4JI9A 2PUPA 2Z7RA 3KY2A 4O1OA 3BEGA 3GP0A 3VF9A 3ZCLA 1QL6A 4E6QA 3KU2A 4RG0A 4Y95A 2J4ZA 3VBVA 4JR7A 3H30A 1JVPP 3BU6A 3CQUA 1Q62A 1OM1A 2BCJA 4X6RA 5FXRA 4HZRA 4R7BA 1YOJA 5CVGA 3PSCA 4GG5A 4O0VA 4KBKA 4YGAA 5EW9A 5BVKA 2WO6A 3N4VA 5DA3A 2RGPA 4FZFB 3WARA 4C8BA 2W7XA 5ICPA 2WMVA 2UZWE 2VTIA 2PVYA 2XF0A 4TKSA 5CX9A 3AMAA 1EH4A 2ETKA 3DB6A 1B39A 4RRVA 5HESA 4A9UA 2GNIA 3FL4A 4ALVA 4C4JA 5AP6A 4X2NA 5J87A 2OJFE 5BMSA 2YN8A 3FSKA 3QAME 4QMYA 4X3FA 5FEDA 2I6LA 4L52A 3VUGA 4CVAA 1PXNA 3IW5A 3QZIA 4RJ5A 4FUXA 3ZUUA 5KHXA 2BIKB 2YM8A 4PP7A 4LUDA 5A4QA 5ANDA 4PL5A 5AR3A 3UYSA 1PMNA 5I3RA 4I3ZA 4II5A 4ZTRA 3R8PA 3LKMA 3TJCA 1VR2A 4M12A 2YM6A 3I5NA 2WTWA 4ZEGA 3DFAA 4D4VA 4Y73A 2OZAA 3VUTA 2PUUA 2RG6A 3FMHA 4RIYB 4V0GA 4XV9A 4BGGA 1CKPA 4Y46A 4DBNA 1VYZA 3Q6UA 5AUZA 4QTBA 4TWCA 4F7NA 4GG7A 4OT5A 3EZVA 4RFYA 5E8XA 5IDPA 5BVWA 2ITTA 2OF2A 4QPSA 3O96A 3MA3A 5ANEA 1J3HA 3OS3A 1BUHA 3PG3A 1T46A 4XV1A 5EM6A 2JIUA 3LFFA 4RIWA 2C6OA 1Q5KA 4S33A 3DAJA 4DG2E 2PWLA 5DMZA 5M57A 2I7QA 4PL4A 3FI4A 4MBLA 2ZV9A 4RJ4A 2HENA 3MH2A 3MI9A 3MSSA 5CQWA 3AMBA 3I5ZA 3LPBA 4YZNA 5DNRA 3UOLA 4IVBA 2BILB 2BDWA 2FYSA 5AUVA 4OLIA 3BHHA 2BHHA 3O8PA 3BGZA 4D58A 3SW4A 4YPDA 2C6MA 4Z3VA 3TDVA 3P86A 1XBBA 4O0YA 3MVLA 4U0IA 2Y8OA 4OR5A 5KUPA 3QXOA 1OECA 3SD0A 1OKWA 3CJGA 3F3UA 1YHSA 2VTSA 3IQ7A 4AW1A 4PUZA 4BICA 5AADA 5CT0A 3RAIA 4M67A 3V5QA 1ZOHA 3UOJA 2VWXA 2C6EA 2CCIA 2WMTA 2QD9A 3NVMB 5F94A 5AP7A 2ITUA 3BHUA 3FQSA 3OCBA 5M09A 3C5IA 2VWWA 5CF8A 3HECA 4L7FA 4A9RA 2V55A 5C4LA 3QCSA 2OZOA 5M06A 4LRKA 3NDMA 5KMIA 4S2ZA 2X9EA 5AA8A 4EONA 3S4QA 3E93A 4FV1A 4BTJA 4D28A 3R63A 4J7BA 2E9VA 3D7ZA 3E64A 3VO3A 2BKKA 3FYJX 4O7LA 5HBJA 2F49A 3H3CA 2OWBA 3RCDA 4AX8A 5DR2A 4IDTA 2CJMA 2YDIA 3QTQA 4IXPA 4BL1A 4W8EA 3FMKA 2O64A 3B2WA 5DIAA 2WPAA 4EOIA 4OAUC 4LRMA 3VN9A 1PXPA 3G90X 4JJRA 3RCJA 4AT3A 3MESA 4DA5A 4H3BA 3FJQE 3GOKA 5IA3A 4EH8A 1WZYA 4GK3A 4W9XA 4TY1A 5HBEA 3TXOA 4NWMA 5JFSA 5E8TA 3UVQA 4JL9A 5IQDA 5IUIA 5LVPA 4G3DA 5CEPA 4ASEA 3Q5ZA 5IA4A 3E7OA 3NSZA 4YTFA 4G3FA 3LIJA 3VHEA 2VTRA 3W18A 5CF6A 3RALA 1Q8ZA 4NM7A 4G5JA 4UN0C 4HZSA 4I24A 4XG4A 1UU9A 3DKCA 4YSMA 3R01A 4LG4A 2YLFA 4S32A 5HQ0A 4E4MA 2BRGA 3MDYA 4OW8A 4IB5A 4QTAA 5AFVA 3AD5A 4FKQA 2BUJA 4AGWA 2WTCA 3UE4A 4EK5A 5IUHA 2FUMA 4GU6A 3S2PA 2QO9A 4YJRA 2X2MA 3LXPA 5F20A 3RINA 5CASA 4FTCA 3U55A 2GQRA 4L7SA 2CLXA 4KSPA 1KE7A 1W8CA 3QD0A 3Q52A 4I0SA 2R64A 3U8WA 4BI1A 5EYKA 5JN2A 3UIXA 3RPVA 3W2QA 2WMWA 4KA3A 5I9WA 4OBPA 1R0PA 4K18A 3OXZA 4RIOA 5HLNA 4UWYA 3TNPC 3R7YA 3PIXA 3CCNA 2R3IA 4GU9A 2AC3A 2CGVA 3QX2A 4GK2A 3MFUA 4GJ2A 5LWMA 4F9CA 3TNQB 2PULA 3OMVA 4EWQA 3QCXA 4PNKA 4EOPA 1GJOA 5KZ0A 1PXIA 4Z7GA 1MP8A 2ZYBA 2IVUA 4EHVA 2XVDA 4O38A 2R3HA 2YCRA 2UVZA 2WMBA 4D0XA 4FUYA 3TCPA 3R73A 2I0EA 2XK4A 4R3CA 3MTLA 5FRIA 4RA4A 3LJ0A 4EBWA 5CALA 5E9EA 5FTGA 4ZLOA 2OKRA 4RLLA 3IKAA 3DZOA 3ORPA 1OL2A 3RNIA 4OBQA 4WD5A 4C4HA 1O6YA 2XK6A 3ANQA 1J91A 3FLZA 4ACMA 5H9BA 5JFWA 2QOHA 4EOQA 4XEYA 2J2IB 4AZEA 4IANA 3VNTA 3QTXA 3I7CA 4AA4A 3OCSA 4O2ZA 3UTOA 3W33A 4EH6A 5M56A 2R7BA 5JT2A 3QCYA 3G33A 4BRXA 4CFVA 3B2TA 4EOKA 3DZQA 4DT9A 4YLKA 1Z5MA 3HDNA 4O7NA 3ORIA 2QQ7A 3SV0A 2Y4IC 3GQIA 2Z7SA 3VUHA 4QQTA 3P78A 3C4ZA 4YLJA 5I9ZA 2XBAA 2WOUA 4IVDA 4ZP5A 5FUTA 4W4YA 5HOAA 2PL0A 5LCKA 3ZLSA 4UXLA 1OBDA 1M2PA 5AAEA 4AA5A 3NX8A 4AFEA 3UO6A 1YXXA 2GNJA 3MBLA 4MWHA 4BKJA 2O5KA 2UUEA 4BHNA 2ZDUA 2PY3A 3D2IA 4IADA 3ZHPC 1P4OA 4C59A 2J5FA 5B2MA 1WFCA 5FLFA 4JR3A 1RW8A 3QHRA 4DBXA 3EMGA 2BMCA 2GMXA 3IDCA 4XJ0A 4FIIA 3VW6A 3HMIA 4U80A 3JYAA 4G5PA 3FHIA 3CPCA 2WIHA 3PJ2A 4PQNA 3R9NA 5LVOA 4J96A 3OZ6A 4HVIA 5JFXA 4I6HA 3LE6A 3VS4A 1SYKA 4F65A 3F2RA 1XQZA 3AGMA 4KABA 4O6LA 4QTEA 3P23A 4DH1A 3EB0A 3EL8A 4UMRA 2OLCA 2B0QA 3ET7A 4TYHB 4EOOA 3GNIB 4N57A 4ANNA 4XRJA 1BKXA 5JZJA 3BYUA 3DOGA 4QP9A 4OT6A 4U79A 1GIHA 3NUPA 4QNYA 3E3BX 1OPJA 3KA0A 2QOKA 4FEWA 2ZJWA 3TUDA 4IZ7A 3CKXA 3V01A 4BDAA 3DLSA 2OI4X 3NIZA 4L43A 3V04A 1OL6A 4MNFA 5EHYA 1FVTA 1PXKA 3GUBA 4LGHA 3HMNA 4J53A 1PMVA 3WIKA 5CLPA 5L8KA 4M8TA 2XYUA 1R78A 4M15A 1JAMA 5IISA 4W4VA 4NKAA 4PTCA 3C5UA 4NL0A 2VO3A 5ETFA 4CFUA 4TZRA 1UWHA 3R1QA 2ACXA 2CPKE 4BDCA 3D14A 4IVAA 3C4CA 4RPVA 2WEIA 3IGGA 5EI6A 3BLRA 4OTFA 3GU6A 4FG7A 4MQ1A 4ZTSA 2DS1A 1CKJA 4FKLA 3OBGA 3OW3A 5CSWA 3VJOA 2Z8CA 5TF9A 3MW1A 4X2FA 3OFMA 4DH8A 2XK7A 4QNAA 2OXXA 1OB3A 3IK3A 4MWIA 1BI8A 4IMYA 4NSTA 3RZBA 3UQFA 4FIFA 5FP5A 2X8DA 2B9JA 2GNLA 2ZMDA 3HP5A 4L46A 5H8GA 4IWPA 5DGZA 4TT7A 4LOOA 5BYZA 2CKQA 1YWNA 4F1MA 4PMSA 4XNEA 2F7ZE 3GCUA 3DB8A 4AUAA 5JGDA 2VWYA 3R9DA 3CY2A 3QUPA 4HVHA 3D5XA 1PYXA 3LMIA 2XH5A 3V51A 5CAVA 2R3KA 3RGFA 3U87A 3RK7A 5C9CA 3TKIA 3R8MA 1BL6A 4PY1A 2XP2A 2JGZA 4CZTA 2HZ0A 3P7CA 3CD8A 2IG7A 5J7HA 4J98A 5FGKA 4DEIA 2XNBA 4RC2A 4PRJA 3R7UA 2GS7A 3SVVA 4RVMA 4NJ3A 4DGMA 5HORA 4LUEA 3MGYA 4I5MA 5EDPA 4AG8A 2VD5A 5K0XA 5K9IA 4J71A 3N4UA 3FMJA 4FKGA 2Y6MA 4MAOA 2A27A 2YEXA 4BZOA 3OWLA 3PXQA 3E87A 4JBQA 3NNWA 3EKNA 5DPVA 4ZXTA 2YIRA 3SC1A 1YDRE 2ZM3A 4FEUA 4M68A 3HRBA 2IW9A 5E1SA 2W96B 3GC7A 3UIMA 4ZTHA 5TOZA 4QYFA 4R3RA 4TYJA 4ZLYA 5J5TA 4HPTE 4BWPA 4I41A 4EH7A 4BI2A 1OKVA 5FBOA 3E8NA 2QU5A 2RFSA 3BEAA 2BROA 4TYHA 3R02A 1X8BA 3BCEA 3AD6A 4QQCA 5J9ZA 3EN4A 3ALOA 3VBQA 3DKFA 1FVRA 3R8ZA 1H1PA 4O0UA 1FOTA 5CEMA 1GY3A 4EH3A 2IZRA 4BIDA 3AT3A 4DG3E 2JIIA 1WVXA 5IPJA 3KMWA 3F3WA 3MA6A 4WSQA 5CZIA 4XYFA 3UG1A 5LOHA 1Q4LA 3DJ6A 3PPJA 5FM3A 3OWJA 5DHJA 2ZB1A 2C5XA 2XKCA 3O7LB 2OICA 2QC6A 4FT5A 3ZUVA 3RZFA 4CXAA 4ZJIA 2ETRA 2ZV7A 3AQVA 3GFWA 3Q04A 3GCPA 4GT3A 4IM2A 4WNPA 5FQDC 1U59A 4BBMA 3Q4UA 4W9WA 4FSZA 2GSFA 2Y7JA 3RJCA 3DT1A 5CI6A 3CTJA 4JQ8A 1OKYA 4IJPA 4B8LA 3FEGA 5L2TA 3NUNA 4CQEA 3FI2A 2XK9A 3EJ1A 4KRCA 4I93A 2RSVA 2WNTA 2XNGA 3BYVA 3DKOA 4IACA 5HE1A 4EC9A 4X7QA 3HUBA 3V8TA 3KRRA 5IMEA 1VEBA 1ZMVA 2OGVA 3O71A 4D2VA 5A14A 5E4HA 4NKSA 5DEWA 1DAYA 1OIRA 4K6ZA 4MEDA 1U5QA 5CAPA 2PMNX 4ASXA 4BCMA 3UZRA 3RKBA 2VWZA 3DGKA 4YBJA 2YWPA 1Q41A 3G6GA 1YI4A 3TDWA 4G3GA 3NUXA 4DN5A 3QGYA 4Y8DA 3FZSA 2VO0A 2VTAA 5C27A 4QOXA 3TZ7A 3UO4A 4P4CA 4DEBA 4KINA 4PMTA 4WG4A 4ZZOA 3ZDUA 4EK6A 3D4QA 4FKPA 4FTIA 2NRUA 4U43A 2C68A 2XM8A 5DOSA 3PY1A 3S1HA 3BHVA 3TUCA 4ZIMA 4BWKA 3CS9A 4IB3A 2VX0A 5CU0A 2R3MA 2WMQA 1Y8GA 4G3EA 5HD4A 2JLDA 4L68A 1FMKA 2ZB0A 3R71A 4KIQA 4NW6A 5CEOA 3LZBA 3DXQA 3UQGA 3LXNA 2VRXA 4FSWA 4OUCA 5IH4A 4MXOA 4C4IA 2QCSA 1TQIA 3FYKX 3ORKA 5L2SA 1UV5A 1ZMWA 5CU3A 2C0OA 3RMFA 3ZLXA 5ANIA 1O6KA 2R0UA 1NVQA 3PXYA 4RWLA 2QODA 4O7WA 3DY7A 2EUFB 2GFCA 2YJSA 1OGUA 4KKHA 4YTHA 4IZ5A 4CFNA 3BU3A 3F5UA 1YXVA 4XOZA 3FBVA 3KCKA 2BAKA 4UZDA 2X39A 3R7VA 3U4UA 3ZBXA 4I94A 3R7IA 2BAQA 3DU8A 3D7TB 4C35A 3CSVA 5ACBC 3UNJA 1U5RA 4BB4A 1ZYCA 2B9IA 3MS9A 5I9UA 4MH7A 1SVGA 1FQ1B 5A4CA 3BU5A 4YLLA 1IR3A 5L2IA 4D2PA 2IPXA 1STCE 1ZXEA 3ZRKA 2WIPA 4D5KA 2W4OA 5AAGA 3CIKA 3KQ7A 3OY3A 2QG5A 1LEWA 4R5YA 3SA0A 3FC1X 5HO8A 5KO1A 1M14A 4FTUA 4ZSLA 4D2TA 3WZUA 3ZSHA 5I9YA 2V7OA 3R9HA 4RQKA 2PHKA 3F66A 4F08A 4KWPA 3LQ8A 1FMOE 4K2RA 2HWPA 4ACHA 3RNYA 1H27A 4ANSA 3OY1A 3QFVA 3UVRA 4F63A 1OVEA 4FV8A 2ITOA 3REPA 4HW7A 4RVKA 4FIJA 4JRNA 4F6WA 4JDJA 4FSQA 4O0SA 4XBRA 2OF4A 5ITAA 5IEXA 4EQCA 3JVRA 5BVOA 5L2QA 5DRBA 1IEPA 2WQMA 2OIBA 3KXXA 4R6VA 1CMKE 4BBFA 3GOPA 5EYMA 3FQHA 2UZDA 3EQHA 2XKDA 1XKKA 3ZO2A 3BKBA 2QONA 1KV1A 3JPVA 3LFEA 4O0TA 2R7IA 4OTGA 5BNJA 2XJ2A 3TIZA 5HNIX 5KE0A 4F0GA 2QOOA 3PP1A 4WHZA 3UIBA 4HYUA 1L3RE 4QQJA 4M84A 3T9TA 4RVLA 4USEA 3NYOA 4AAAA 5A3XA 4DINA 3QA0A 3K2LA 3R22A 4FA2A 5K5XA 4U3YA 3VF8A 3ROCA 5CYIA 4TWNA 5HG5A 3UQCA 3P79A 3ID6C 3KRWA 4YHFA 4BDBA 1W82A 3I81A 4D2SA 2WD1A 2XS0A 4R3PA 4O86A 4FNWA 2AUHA 3UNZA 3S3IA 4YJTA 2EXEA 5HO6A 3ITZA 1Q24A 4IWOA 4Z55A 5M53A 4ACCA 2XNOA 4APCA 1CM8A 3MH1A 3UG2A 1KWPA 5IU2A 5HIEA 3F3ZA 3KXZA 5ETCA 4DFXE 3I79A 1O9UA 3CBLA 3LFCA 3OD6X 4DG0E 4WUAA 4Q5HA 2B1PA 3E63A 4MNEB 3O23A 4GFGA 4QD6A 4YNEA 5B7VA 2WMUA 2X7GA 4YJVA 5C8MA 4BC6A 4KIOA 4NZWB 4YUQA 1YWRA 3HYHA 2JEDA 1H4LA 1TQMA 2OO8X 3R28A 3EQDA 4RA5A 1ZAOA 2EB3A 4AOTA 5AIKA 1KE6A 4FEVA 3LCDA 4QYHA 2WELA 2UW6A 3EFWA 1Q61A 2WFYA 1NY3A 1OIYA 3GFEA 5EH0A 1QPEA 4M66A 4EOLA 4C61A 3VJNA 3HVCA 3QQUA 4CCUA 2J5EA 2X9FA 3LXKA 5CVFA 3GGFA 5EM7A 2C3IB 3D7TA 3KXHA 5E8YA 2GTMA 3UC3A 2YM5A 1KOAA 4ZZMA 3WBLA 2KTYA 2OJJA 5EDQA 2RFEA 1ZY4A 4DLJA 3NUSA 3NUYA 3NNXA 3VUDA 4C36A 2YIYA 4DFUA 1XO2B 2PE1A 4QMUA 4YC3A 2J7TA 5IEYA 4G3CA 5FBNC 4BIBA 2XB7A 5M4CA 3QLFA 4R7HA 2C0IA 5DN3A 4O0WA 4AS0A 5L6OA 2JDTA 4BYJA 4FSYA 3JS2A 3BELA 2BTRA 2W1EA 4DFNA 2FA2A 2Q0BA 4ERKA 1Y57A 2J0KA 4QO9A 4PDOA 4TPTA 3ZFXA 4EK4A 5HZNA 5E8ZA 4O21A 5ANKA 4EH9A 5T3QA 2B53A 4M0YA 4J52A 4FKJA 4FL3A 3QRIA 5EI2A 1LR4A 2HW7A 3N4TA 1SMHA 3KKVA 3KRJA 3LFNA 3DDPA 4IAYA 2YISA 4W8DA 3EYGA 3W8LA 5HTBA 4DEAA 4LGGA 3R21A 3R1NA 2BKZA 1WVWA 2WXVA 3OUKA 3FXXA 4CNHA 2GNGA 1FINA 4K33A 2C3JA 5B0XA 2PVRA 2WZJA 3F5PA 3KXGA 4DF3A 3OCGA 1IA8A 4ZLZA 2ZM1A 4FG8A 4LYNA 1MRYA 3UJGA 2GCDA 3EN6A 3E88A 4FOCA 4L6QA 4UWCA 4ANBA 4E6AA 4UMTA 5HTIA 4YO4A 1XH7A 5AV3A 5EYCA 4GUBA 1Z9XA 1PMUA 2UW0A 2VTQA 3QQGA 3BLHA 4F64A 2Z60A 1MQ4A 1BYGA 4C7TA 1Q8WA 2X0GA 1AD5A 4I6FA 4QMWA 5DRDA 2YHVA 3TL8A 2C4GA 4WG3A 4A06A 4TNDA 3TN8A 4ACGA 3KC3A 3CTQA 1UA2A 2BVAA 2Y4PA 1IA9A 4FK6A 2QOLA 2VX3A 3NLBA 1UKIA 3ENMA 3QWKA 4RX7A 3F2NA 3ATSA 3ATTA 3PLSA 5EFQA 3PJ3A 4AU8A 3COHA 4XG2A 4U97A 2Y0AA 5TO8A 2WKMA 3COIA 4PX6A 2NP8A 4RGJA 1WCCA 3VS6A 4AN9A 1PRYA 5DYJA 3CEKA 2R9SA 2HYYA 4H3PA 4UYAA 5JGAA 5HVKA 3PTGA 4GW8A 2QU6A 3FDNA 4IZYA 4P90A 2C6LA 4MNEA 2XJ0A 1HOWA 2J9MA 1A48A 4IX6A 2QOIA 4FZAB 3L8XA 3OOMA 4B8MA 3DLZA 4L3PA 4LOQA 4CMUA 3LMGA 5JGBA 1YHVA 4E4LA 3RK5A 2C3LA 5CAQA 3AOXA 1U4DA 5GZ8A 3NW7A 3H4JA 4QMXA 3C4EA 1NVRA 3WE8A 3QTWA 4DGNA 5IQEA 4DEGA 2IN6A 4GUEA 4EUUA 3P4KA 3L9PA 3SDJA 3GBZA 4LL0A 4S30A 4AZTA 4YTCA 2QI8A 4NEUA 2JAMA 3MN3A 4YTIA 2PE0A 3ORTA 3FI3A 4EL9A 3AMYA 3CPBA 3QRKA 4JDKA 4J99A 4LRJA 1BMKA 3UPXA 4C58A 4EWHA 4ZTMA 5C1QB 1Y8YA 5A54A 1ERKA 5I9VA 4I21A 5BYYA 4F09A 1OUKA 4I5PA 2WEVA 3MFTA 4NUSA 1H0WA 1Q3DA 3PXRA 1Q8UA 3LM0A 5F1ZA 2P2HA 3NW5A 5FD2A 2RIOA 2XJ1A 3CP9A 3TT0A 2J51A 4XG3A 4O22A 3BWJA 5H8EA 1OIUA 3QTUA 4IAIA 3TEIA 2OBJA 3UVPA 4CMOA 1DS5A 3W2RA 2YACA 4S31A 2GDOA 2W1HA 4K9YA 3V5LA 3ZONA 3ZLWA 4FK3A 5IQBA 4HJOA 2QOCA 4RVTA 3W2PA 4A9YA 3KL8A 1JKLA 2EXCX 3FY0A 3K5UA 4PTGA 3QLGA 4H1JA 1FVVA 3E7VA 3PSDA 4FTMA 1XBCA 3HL7A 4QP4A 4C3PA 5JKGA 5FG8A 2W1ZA 3ZFMA 1YKRA 3EN7A 3HZTA 2BZIB 2VTHA 3QALE 4YZCA 4FBXA 5E7RA 4OBOA 4YZ9A 1H0VA 4UALA 5DE2A 4UB7A 5EM5A 3VS7A 2C0TA 3KN6A 4Z9LA 2XA4A 4R1YA 4PNIA 1GNGA 1MUOA 1RQQA 2YLEA 3LCTA 3H9OA 3AC1A 2ITNA 3R9OA 4TL0A 4CTCA 4FR4A 4N6YA 3SX9A 1M17A 2CNUA 2C69A 3GI3A 4MXCA 2J0JA 3Q2JA 3T3VA 5J95A 4U3ZA 2WMXA 4H1MA 3WZJA 2F4JA 3OBJA 4EH5A 1CDKA 1OKZA 4CYIA 4BDIA 4EZ5A 1FGKA 3DBCA 4M0ZA 4XG6A 3DPKA 2G01A 5CEIA 4D2RA 1PJKA 3F61A 4YZBA 4LMUA 2YIWA 4HNFA 4OGRA 4FG9A 2H6DA 1DI9A 3GQLA 1F0QA 3TV6A 4NW5A 4YPSA 2XEZA 3CKWA 3P08A 3WF5A 4RIYA 4E26A 5I0BA 2PVMA 4YJNA 5HKMA 5J7BA 4XLIA 3ZOSA 4JS8A 3QQFA 3L1SA 4B99A 3CY3A 2CKEA 5DT3A 3OC1A 4MKCA 5AP1A 4X2KA 2WMRA 2JITA 2YIXA 4YU2A 2GPHA 3A4OX 3WI6A 2DWBA 4PMMA 1Q99A 3BYOA 4RLKA 2J0IA 2RG5A 3ELJA 3D5WA 5CNNA 2CN5A 5IQAA 5AUXA 3RHXA 4TRLA 4WNMA 3BWFA 4LV8A 2CGUA 3TTIA 3ZXTA 4G6LA 5AP3A 3KFAA 3VUIA 4NIFB 1JKSA 4R7IA 4ZY6A 2CSNA 4AQCA 3MJ2A 4AGUA 1V1KA 4FSMA 1WMKA 3ZC5A 3BBWA 5HX8A 4A07A 2Z7QA 3PY3A 4FV2A 5M07A 2JD5A 4ANQA 3TNIA 5HVYA 4F70A 5HD7A 4PDYA 3D0EA 4XOYA 3RBWA 4MF1A 1ATPE 3B8RA 4FV7A 4WUNA 5HNGA 4XHKB 3QRUA 1GIIA 5IQCA 3SHEA 3Q60A 1Q8TA 4PWNA 3GU7A 2BAJA 3POOA 1XH9A 4GIIA 3NWWA 3AXWA 1OL5A 3LCOA 5CXHA 2B52A 2B4SB 2HOGA 3I60A 3FMNA 2G2IA 3G2FA 3PG1A 4JVGA 3MJ1A 5K4JA 5HHWA 2OJ9A 3E8EA 3QWJA 5AM6A 3QQHA 4EKKA 3FI8A 4QRCA 4U8ZA 4CLJA 2J90A 3Q4CA 2UZNA 2G15A 3RTPA 3JY9A 3PJ8A 3EOCA 5C03A 2JC6A 3IPHA 2PPQA 3HV7A 4E5AX 3DS6A 4ZSGA 2Z7LA 5TR6A 3GVUA 3W32A 3QTZA 3DV3A 3E92A 3V5PA 5GINE 4AGDA 2E9OA 2QURA 3WF7A 2XIYA 3FMMA 4C3FA 4CFWA 3GC8A 2VX1A 3K54A 4FICA 3Q2MA 1ZOGA 3UODA 2JAVA 2OW3A 3QKMA 4NH1A 5EHOA 2X4ZA 1O6LA 4I0TA 4F1TA 5BX0A 3EQFA 4QP7A 3V5TA 3LLTA 2UW8A 4WO5A 3UOHA 3P5KA 1IASA 2ZDTA 3KN5A 4H58A 5GIPE 1NA7A 2BALA 2EWAA 3DKGA 3LCKA 4L01A 5AUUA 2QR8A 2O65A 2UZTA 3KVXA 4KUJA 4EJ7A 1MQBA 5KZIA 3MB7A 1H01A 1KOBA 2RKUA 3DTCA 1OIQA 5E92A 2NPQA 4EHGA 2PTKA 5KMKA 2C5YA 3LXLA 4BCKA 4DE4A 1V0PA 2VO6A 4GEOA 4NM3A 2WQBA 3OCTA 3SAYA 4AW5A 5KMOA 3TKUA 2JBOA 5C26A 5KBRA 3QYWA 2VU3A 2FH9A 3QD4A 4EOSA 4D9TA 3LQ5A 3KEXA 5HVJA 1OPLA 2G1TA 3UDBA 4O7VA 2YERA 3EIDA 4IC8A 5D1JA 2PVNA 4FV3A 3FZ1A 1TQPA 3AC2A 5LMAA 2HXQA 5LJJA 3EQPA 3WILA 2W9ZB 4N6ZA 3RM7A 5KMMA 5JRQA 4BTKA 3BIZA 4MXYA 4O91A 2OXYA 4BTFA 2PUNA 2R3PA 1W98A 4I5HA 3TWJA 3HV4A 4V04A 3L8VA 1H1RA 4RIXB 4TWOA 1YDSE 3PWDA 3FXZA 4L67A 3JY0A 3UBDA 1OI9A 4O81A 4K0YA 2JDVA 3ACKA 2E9UA 4FIHA 2PZPA 2CMWA 4KIPA 3VBWA 3PZHA 5L8LA 4NIFA 5KKRB 3ZEPA 5KX8A 4RJ6A 5I3OA 5HU9A 5GJDA 1H07A 5FTOA 3PXZA 4K1BA 3DK3A 5HI2A 2NNWB 3QX4A 1RE8A 3HUCA 3K3JA 2R2PA 4ANLA 3PY0A 3ORNA 2F9GA 2CLQA 3D5UA 1R3CA 5AP2A 4D4SA 3O51A 4FKSA 2BRHA 4FV0A 4AZWA 4EQMA 4CG8A 3TKHA 1ZYLA 5DT0A 4IM3A 4AW0A 4ZMEA 3U51A 3HA8A 4UWBA 3FZTA 2FGIA 4BDFA 4E3CA 2OIQA 3MPMA 4KS8A 3AD4A 3EQRA 3HEGA 4IX3A 4OTIA 4CD0A 1MRUA 3A61A 4D4RA 2ONLA 3A7IA 3H9FA 4EI4A 4EK8A 3EQGA 3OTUA 5D9HA 5C8NA 3CR0A 3IW7A 1ZYSA 3LJ2A 4I6BA 4IE9A 5AX3A 1QPDA 2VTOA 3IS5A 3QUDA 5IA1A 2X6DA 4K8AA 3C4WA 4L8MA 4GT4A 1ZYJA 4JG7A 4X2JA 4WT6A 5LVNA 3VS3A 3CGOA 2IJMA 5A4LA 1Q8YA 2WQNA 4F0FA 5L4QA 3A7FA 4GJ3A 2ITPA 3DK6A 4H39A 3VWAA 4JQEA 5E91A 4EOMA 4HVGA 3DQWA 3OEFX 2EB2A 3FC2A 4FNZA 2X1NA 4BDJA 3BQRA 3DBEA 4ASDA 4CT2A 4ZTLA 4BZNA 2W4JA 3U6HA 3L8PA 4CV9A 3RAKA 3BYSA 4LMNA 5ETAA 4DEHA 3LOKA 4U44A 5AWMA 1ZMUA 3NEWA 4QMVA 2O3PA 3CXWA 1AGWA 4CMTA 4O7ZA 3OWKA 5C01A 1XWSA 3DNDA 2F7EE 3V6RA 4G9CA 4GH2A 4YJUA 5IKWA 4MBJA 2B9HA 3EWHA 2ITYA 3A4PA 5ETIA 3FLSA 3ZU7A 4EH2A 2FSMX 2V7AA 2PZRA 3U9NA 3FUPA 1GAGA 5L6PA 4AA0A 3KK8A 5LQFA 2VNYA 4FEQA 2IVTA 3VW8A 3BRBA 2PUIA 4JBPA 4RC3A 1ZOEA 5EQEA 3GCVA 4YZDA 4L44A 5IZFA 3QHWA 2ZOQA 3PRIA 4FV5A 3E5AA 2ITQA 5JQ5A 5JQ8A 4QTDA 2G2HA 3PLAE 4IIRA 4FT9A 4CG9A 2XUUA 3PJ1A 4JX7A 3CQWA 3EFKA 3OWPA 3P7AA 4I22A 3ZRLA 4YZMA 1XJDA 2JFMA 4BDHA 3EQCA 4E73A 3IO7A 4GYIA 3C13A 3GT8A 1HCKA 4UMPA 3O7LD 2R3JA 3R8LA 5LXMA 4GV1A 3NUAA 4XBUA 3U54A 4D0WA 3FPQA 2HY81 3MFSA 5CS6A 4ZOGA 4X6QC 3L9LA 4FIGA 3NZ0A 4Y85A 3PA4A 2DYLA 2WTIA 2ITZA 2X81A 3C7QA 3SG9A 1YI6A 4DITA 4OTDA 5AM7A 5DG5A 4F99A 1E1VA 3I7BA 4UX9A 3Q4ZA 5EK7A 4RMZA 2Z02A 4NTSA 2BTSA 4NCTC 3FLWA 4MTAA 5HEZA 2FSOX 3II5A 4FYNA 5FTQA 4MXXA 3Q32A 2IZSA 4ARKA 5IG1A 4D2WA 4DFZE 2P33A 3S0OA 3W2SA 2PYWA 3WZKA 1LP4A 3HLLA 3PSBA 2Q83A 4LFIA 3UP7A 3LQ3A 1ZLTA 3PE2A 3EH9A 4C34A 4R8QA 4EOJA 4DTBA 1GOLA 2BFYA 4FI1A 5JFVA 4R77A 5IH5A 4OTQA 5EM8A 2XIRA 5EI8A 3W55A 4U45A 2KULA 4Y5QA 1OL7A 3ETAA 3H10A 4QMMA 1PMEA 5IA0A 1ZY5A 2GHMA 5D11A 3GC0A 1CKIA 3UGCA 2H34A 2CGWA 5IQGA 3VS2A 3MY5A 4I20A 1YOMA 3R7OA 3Q9WA 2C6KA 2YITA 4H05A 4GMYA 2VZ6A 5AV4A 3QBNA 4CYJA 3A7HA 1I09A 3DBDA 4FOBA 2WTJA 4JAIA 4KB8A 3MPAA 1M52A 3DFCB 3OF0A 3Q53A 1JOWB 2F7XE 2PVFA 3E62A 3EN5A 1WBTA 3PYYA 4HCVA 2CN8A 2BR1A 1XH6A 3HMPA 1ZZ2A 3F82A 4M14A 5FEEA 5EW3A 4G2FA 4XRLA 4GYGA 4X2GA 3F7WA 5EOBA 1M7NA 3IGOA 3V3VA 4DH5A 4EZ3A 3R8UA 4ZTNA 1ZYDA 2ONLC 4C4EA 4QQ5A 4D5HA 3FSFA 4L9IA 2YM3A 5CVHA 3QRJA 5HCZA 4OTWA 5AIRA 5ANGA 4YO6A 1KE8A 1KV2A 3BV3A 5GZAA 3PFQA 4FEXA 2G9XA 3BGQA 2YAAA 3EQBA 3QC4A 5GJGA 3MTFA 2QKWB 4JLCA 1JLUE 3P7BA 4YSJA 5GIOE 4RWIA 4C62A 3NNVA 4C0TA 1WBVA 3G9NA 3NRMA 4GL9A 4IDVA 4U41A 5DFPA 2PVLA 3O0GA 3A8XA 5AUWA 4LV5A 3DCVA 1WBSA 4NFMA 4TTHB 4UZHA 5JK3A 4R78A 2DQ7X 3FMLA 5CEKA 1IAJA 1OL1A 2QO7A 3ZC6A 2QHNA 2XEYA 1SNUA 1V0BA 5LARA 2BRMA 3WE4A 4U5JA 2HELA 4OTPA 1W7HA 3NAYA 4C3RA 3G15A 3RWPA 5AV1A 4CGAA 4ID7A 5AP5A 4GVJA 1UU8A 1M2QA 2QO2A 2B54A 5HG9A 3TNHA 1YRPA 4J8NA 4EC8A 5JSMA 1CSNA 2H8HA 3QUEA 4JX3A 4MVFA 2UV2A 5E1EA 3EKKA 3QC9A 4O7TA 2XYNA 4CRLA 5KMNA 4A4LA 4KKGA 3UMXA 4D9UA 4YHTA 4QP8A 5T6KA 5CSHA 2C5NA 4MHAA 3QXPA 2ERKA 4FZ6A 1NVSA 3VS5A 2GQGA 2YIQA 2C6DA 4O6EA 1J7LA 2Z2WA 3TZ9A 4ENYA 3WF8A 4TYIA 3ZUTA 4ENXA 5AR8A 3VVHA 3FZRA 3KMMA 1KE5A 4D1XA 1LUFA 3G6HA 4PV0A 4FGBA 4EKLA 4YJOA 3LFDA 4QP1A 5KKRC 4EORA 3KMUA 2GNFA 3ZSIA 3FQEA 1OPKA 4WNKA 3ULIA 3HAVA 4JRVA 1UVRA 4E7WA 2I0HA 1E1XA 1GZOA 2GNHA 4CRSA 3BHYA 4IAZA 5B2LA 4QMPA 5M4FA 2YJRA 5HGIA 2OH4A 4NT4A 2CKOA 1NW1A 3UIUA 3UPZA 4DH3A 4MD8E 5AR7A 5DT4A 4O83A 3F6XA 4E5BA 3M42A 5DR9A 4I0RA 1MRVA 1OITA 4J8MA 2PK9A 4Z16A 5HCXA 4R1VA
chains in the Genus database with same CATH superfamily
4BY9E 3WF9A 2P55A 4KS7A 4O7SA 1YWVA 2QOBA 4C38A 4EYJA 3CC6A 1P14A 4XMOA 4XG7A 2PVKA 2I0YA 3TG1A 4E5WA 2J6MA 3H0ZA 4FJVA 5EQYA 3N9XA 3PJCA 5GHVA 4FTRA 3OG7A 3RAHA 4E6DA 3MH0A 3I0OA 4HNIA 4MD7E 4U40A 3D15A 1W2CA 5EKOA 2W17A 2E9PA 1YI3A 2ITWA 3Q9ZA 3R6XA 2HXLA 3EL7A 4MCVA 4Y83A 3UYTA 4HVDA 2WMAA 4XP3A 2RL5A 1SVEA 3P9JA 4DEEA 3ZM9A 4FSRA 2IVSA 4M97A 4XLVA 3KRLA 4DHFA 2XBJA 4ORKA 2XCHA 2JDSA 3I0QA 3LM5A 4QT1A 5AJQA 3NR9A 2PSQA 2WTVA 2OFUA 2XIZA 4QMSA 3KVWA 3FL5A 1PYEA 5JMSA 3M2WA 1IAHA 3NCZA 4JG8A 4XS2A 4XUFA 2VUWA 1GIJA 2UW4A 4G34A 3F3TA 4F9AA 4AXFA 2BZKB 2QNJA 3A99A 2I1MA 1XH4A 2I40A 2WB8A 4NU1A 5KBQA 5KHWA 3ML1A 2GHGA 5TE0A 5AR2A 4DTKA 2VNWA 1NXKA 3KF7A 3MYGA 3ODZX 2XK3A 3R1YA 2GHLA 1GZKA 1BLXA 3OUNB 4FTTA 4FV4A 3ZEWA 4BDEA 4QYGA 3FLQA 4ASZA 4C57A 5JH6A 2WAJA 1K3AA 3KULB 4FSTA 2WHBA 3CE3A 3QQJA 2VV9A 4IC7A 4I1ZA 4PMPA 4KBCA 2XCKA 3KCFA 2W1GA 3TI1A 4XP2A 4RC4A 2W1DA 2VAGA 3R83A 4O0RA 1VZOA 3EN9A 4LGDA 1E9HA 4FMQA 1YOLA 4Q2AA 3DQXA 4BYIA 2QLQA 3IDBA 3QTIA 3Q5IA 4FYOA 3VC4A 5DWRA 3V8SA 4AP7A 3LLAA 4F6UA 3W0OA 3OVVA 1HCLA 5EKNA 4Q9ZA 3ROYA 5BV3A 3R7EA 5CAUA 3OEZA 4FL2A 3S95A 4A9SA 3TV7A 3Q96A 2QOFA 4WOVA 3VULA 5AV2A 2H96A 2LAVA 5HIDA 5E8SA 5ANJA 4IAKA 4A7CA 4NFNA 5LCJA 3NYNA 3ZSGA 3VS0A 4A4XA 2PE2A 4DGLC 4E4NA 3ZBFA 3QQLA 3UZTA 2A4LA 3UZPA 5CENA 4FTLA 3JR1A 3HV6A 3QGWA 3NGAA 2O0UA 3ZH8A 2AC5A 4DFYA 4LDTA 3H9RA 4U9AA 3UC4A 1ST4A 2R0IA 3VQHA 1L8TA 1JNKA 4N0SA 3FMDA 2YCSA 3W2OA 3QU0A 5I5ZA 4FSNA 5BMMA 4JBVA 3ODYX 2R3LA 2W1CA 5CT7A 3RPRA 3FZPA 2UW9A 3DJ7A 5D7AA 2AQXA 5HU3A 3HAMA 5HLPA 2HAKA 3NPCA 4N4SA 4OAVB 2IZUA 5J5SA 2XNPA 4PPCA 4JQ7A 2ZM4A 1JKKA 3ACJA 2FB8A 4HCTA 4HYSA 4XV3A 3TZMA 3WYYA 4WG5A 4G16A 5AR5A 3VAPA 2VTPA 1ZARA 2X6EA 1WBPA 4MK0A 3BPRA 5AV0A 3UP2A 2BHEA 4GVAA 5HG8A 2NO3A 4LQMA 4IX5A 2W5BA 3PPKA 4EJNA 5J1WA 4JDHA 5M44A 4IWDA 3VRYA 2QOQA 2OH0E 4CFMA 2QKRA 2YABA 5D7VA 3F9NA 3AC8A 3FPMA 4AW2A 3C0GA 3KGAA 2RF9A 4WBOA 4ZAUA 4DLIA 5J8IA 1P2AA 3KK9A 3ANRA 4HGEA 4OTHA 4O2PA 3WOWA 3TJDA 2P3GX 3G51A 2DUVA 4WRGA 5CXZA 4FT0A 4BVUA 2C47A 4I92A 4XG9A 2PMIA 4TW9A 5J1VA 3UDTA 1KSWA 3LFSA 3C0IA 2W1FA 2CNVA 4W4XA 2PVHA 3NFFB 4TYEA 4O84A 2XIXA 4P2KA 2WGJA 3HNGA 4FT3A 4U81A 1WBOA 3RPSA 3THBA 3OT8A 3L9MA 4U42A 4FNXA 3LCSA 2OIDA 4Q5EA 3WZEA 3FXWA 3BV2A 5HCYA 3G0EA 5HTCA 4MXAA 5CZHA 4NJDA 3V8WA 4IZAA 4I6LA 3CJFA 2GFSA 1DAWA 3KULA 1REKA 3PPZA 4YJPA 3ZXZA 4ERWA 3S00A 3UNKA 1B38A 1SNXA 5E8WA 3C1XA 5HICA 4ZK5A 5HE3A 2QLUA 2JKMA 2W1IA 2WU6A 4NM0A 5F4NA 4CFFA 1FBNA 1H1WA 4WKQA 4QP3A 4RZWA 3QQKA 2C30A 4BKYA 4J95A 3KXMA 4CTBA 4MD9E 4AAYA 3FAAA 2V0DA 4CZUA 4O96A 4MX9A 3DK7A 4UV0A 2OXDA 5FXSA 5CSPA 3ZTXA 4IFGA 3AC3A 2QR7A 2BFXA 1BX6A 5T68A 2XMYA 1G5SA 1W0XC 5AR4A 4FGRA 5IQFA 5FXQA 3R9RA 3N51A 3A2CA 4RBLA 3ALNA 3PWYA 4CKJA 3OT3A 4H36A 3IW8A 4FVQA 4O1PA 2XRWA 1U46A 2JKKA 3DXNA 2ZMCA 5CANA 3A60A 1B6CB 2I0VA 3FHRA 3W2CA 4BGHA 1YXTA 2VTJA 1PW2A 2X8IA 3TUBA 3CLYA 4UMQA 2P4IA 3GB2A 2HY0A 4YC6A 2UW3A 3H0YA 3ZO4A 5LMKC 4UXQA 2R3OA 4KSQA 3G9LX 1H28A 3ENHA 3NYXA 5JZNA 3VBXA 3VUMA 4XCUA 2B9FA 3HMMA 5EW8A 4AZSA 4AZVA 4F0IA 2X2KA 2B7AA 2C1BA 4PDPA 4EK3A 1YXUA 3MY0A 4B7TA 4V01A 1FGIA 3GCSA 2XNEA 2W0JA 3K3IA 3EZRA 3MPTA 1UNLA 2ZFYA 4P7EA 2VN9A 3C50A 3OHTA 5IMXA 4ZS4A 2BRNA 3COMA 4GT5A 3PP0A 4PF4A 4FRFA 4DYMA 3MY1A 1R1WA 2UZOA 3K5VA 3AKLA 5GNKA 4E8AA 3BE2A 3F69A 3POZA 4XG8A 3TNWA 1K9AA 5JRSA 2HCKA 3GC9A 3IECA 3WIGA 3HRFA 3R30A 1I44A 3PVBA 4F6SA 1YQJA 3E8DA 1F3MC 3C4FA 2R3NA 4HGSA 5HBHA 2J0LA 2XK8A 5AP4A 3LMHA 3O8UA 4JBOA 4JDIA 3SKCA 3DBFA 3V6SA 4DEDA 5J9LA 3QKKA 3ZRMA 4O4DA 2VTNA 2WTKB 3KF4A 4EBVA 5CSVA 5HG7A 5EDRA 2FSLX 2E9NA 4DAWA 5HE0A 4RX9A 1OBGA 3OTVA 4C33A 4RFMA 1G3NA 3D94A 4G31A 2OJIA 4ANMA 4DH7A 4C4FA 5J9YA 1H00A 1M2RA 5EQPA 1YW2A 2BZJA 3HV3A 5K4IA 2EU9A 4DFBA 3ZM4A 3R1SA 4BI0A 3C51A 1YHWA 4X3FC 4FKVA 1J7IA 1S9IA 3FKLA 4AE9A 2R3GA 3QL8A 4AWIA 4EEVA 1T45A 3HV5A 4RQVA 5BPYA 4YJQA 5CU4A 4GS6A 3QD2B 1AQ1A 4AOJA 3BLQA 3WF6A 5KNJA 2X4FA 3LFBA 4EQUA 3UOKA 3D83A 3BYMA 3E3PA 4CT1A 2IF8A 2UW7A 3DDQA 4YP8A 4AT4A 5F95A 4B6LA 3T9IA 3R7GA 1A06A 4EYMA 3EYHA 2CGXA 4LM5A 3F5GA 1WAKA 2VWBA 2ZV2A 4BDGA 5DI1A 4YURA 3VHKA 3I6WA 2JFLA 2HIWA 2OK1A 4J1RA 4L00A 5CTPA 2XAMA 2HWOA 3O8TA 2SRCA 4ZY5A 4DCAA 2XM9A 3RVGA 5F9EA 2UVXA 3AC4A 2GU8A 4QMTA 3I6UA 4IH8A 4NCTA 3TV4A 4P5ZA 3ORMA 2BDFA 3CD3A 3SOAA 4LOPA 5IDNA 4FKIA 2UZUE 4A9TA 2UZEA 5K0KA 1Q3WA 4U7ZA 2GQSA 2VTTA 4FIEA 4L45A 4YC8A 4O7RA 1OZ1A 4UY9A 2RFNA 3RPOA 4IHPA 3AC5A 1CTPE 2WQOA 3HX4A 3I1AA 4TNBA 3QCQA 1UKHA 2V5QA 3RPYA 3D9VA 4ONAA 3ZLYA 3O17A 4M7IA 3GU8A 4BIEA 4Z7HA 2W99B 3CQEA 5M08A 2A1AB 2YWVA 3FWQA 3DA6A 3R04A 2G2FA 2GTNA 2X0QA 4FKUA 4GSBA 4XH6A 4KRDA 4ZMFA 2CHLA 2HK5A 3Q6WA 5LVMA 2QG7A 4G17A 1P5EA 3QYZA 2X7FA 3CTHA 4YR8A 5B2KA 3QRTA 2PZYA 1PXOA 3QD3A 4ITJA 5GZ9A 1J1CA 4PL3A 4H3QA 5ACKA 2BRBA 4F4PA 2C1AA 3SOCA 5AX9A 2C3KA 4PP9A 5M4IA 2H9VA 2W4KA 3I4BA 3QTRA 4KNBA 4QMQA 4HYIA 2CKPA 5A4TA 4ZTQA 3W10A 4FF8A 4FODA 4ZJVA 4ZZNA 5LMBA 4I23A 4I5CA 4FTQA 3L9NA 1Y6AA 2XNNA 1LPUA 2OFVA 3LJ1A 4RWJA 5C4KA 2J0MB 5H3QA 1JSVA 3MVHA 3VBYA 1Y6BA 4BGQA 5BVNA 5J79A 4QMOA 1WBWA 2YM4A 4GK4A 4TWPA 1JWHA 5TT7A 5CF5A 4O7YA 5IQIA 2C6IA 5BVEA 3NCGA 4HGTA 3IW4A 4DGOA 4L42A 3NVKI 1URWA 2ETMA 4K11A 2UZBA 4ALWA 3W1FA 4B4LA 4Y5HA 4QMNA 2LGCA 1PXMA 2W9FB 4EHEA 1DI8A 1QCFA 1FPUA 2O2UA 3P1AA 4V05A 1VJYA 3VUKA 5IH6A 3UO5A 1H26A 4NTTA 4XV2A 4F7SA 4J97A 1R0EA 4CCBA 4IB0A 4M13A 3FKOA 4F7JA 5L3AA 3ORXA 1JSUA 2IW6A 3MB6A 3G5DA 4JXFA 5CF4A 1G8SA 2JBPA 2XARA 4RX8A 2YM7A 4RJ3A 3B8QA 4F1OA 4FSUA 1UU3A 3WZDA 4IW0A 3T3UA 4BCQA 3GXLA 3TIYA 3OW4A 4QP2A 3RHKA 5GJFA 3ZMMA 4E4XA 5A9UA 1JBPE 1XMMA 3OROA 3NNUA 3QKLA 2WMSA 3DXPA 1PXJA 4P5QA 3PRFA 4FKTA 4QTCA 5CWZA 4C02A 5A6OA 3BL9A 4JIAA 3R2YA 3Q9YA 1PY5A 5HNBA 3D2KA 4FNYA 3ORLA 1Z57A 2HZNA 2AYPA 2Y6OA 5FDXA 4B0GA 4LV7A 3MFRA 4D55A 5LVLA 2BZHB 3F5XA 5E8VA 4CQGA 4RJ7A 3BI6A 5I4NA 3U6IA 4F9BA 3SW7A 1PKGA 3NUUA 4ITIA 3SRVB 3ULZA 4AN2A 4LL5A 2O8YA 2YCFA 3OOGA 4NM5A 3SXRA 4BCIA 2GS2A 4E20A 4QPAA 2JDRA 3HDMA 4RT7A 3KB7A 3A7JA 3OXTA 3LW0A 3PVUA 3Q9XA 1GZ8A 2NRYA 3ZZWA 2YDKA 4RIXA 3EQIA 3BQCA 4B9DA 3QZFA 3LHJA 5EHLA 3BX5A 1G8KA 3DBQA 1H1SA 2OJGA 4C4GA 2JDOA 4YMJA 4E93A 3M11A 3SG8A 2BIYA 3FV8A 4L3LA 5A6NA 1BL7A 2VTLA 4QYYA 1PHKA 4ZSAA 4DGGA 4PDSA 3GENA 5IA2A 5KCVA 3R8VA 2ZAZA 4GIHA 2QHMA 2X7OA 3MVMA 1YDTE 3QA8A 3ZFYA 5K5NA 2W06A 2RFDA 3GU5A 4FZDB 4ZJJA 2IW8A 3U6JA 5AAFA 1UU7A 3SQQA 4BDDA 4BF2A 4N70A 4QP6A 3LFAA 4FX3A 4AACA 4DC2A 3DAEA 2JKOA 5FWKK 4APPA 4FVPA 2UVYA 4FKWA 4FT7A 5DBXA 3W8QA 4CEGA 1OMWA 2ERZE 4CZYB 2YZLA 5CSXA 3A62A 4G6NA 4O82A 1PF8A 3LFQA 3IONA 3NFGB 4UEUA 5DR6A 5TKDA 4DTAA 3GU4A 1IG1A 4IJ9A 1V0OA 5LWNA 4FE2A 3ZS5A 1K2PA 4RWKA 4A4OA 1H24A 5H8BA 4C2WA 4USFA 1APME 2JKQA 4FTJA 3MH3A 3PUPA 4G1WA 4WA9A 2R3FA 5KMJA 3TACA 1A9UA 4IAAA 2ESMA 4BCNA 1PXLA 1ZZLA 2XNMA 5KMLA 4IAFA 4S34A 4EHZA 1UWJA 1WBNA 2HZ4A 2XKEA 3PXFA 3IW6A 4JOAA 2VWUA 4AE6A 2WTDA 5BUJA 4K77A 3NMUF 3ZDIA 3HKOA 1ZRZA 5JEBA 4W4WA 2WTKC 2C5OA 2B55A 4FV6A 1U54B 3R0TA 4IX4A 2R3QA 4I4EA 3BHTA 4I6QA 5DLSA 2WQEA 4BCPA 4IEBA 4M3QA 2HW6A 3PUFC 4L3JA 2UZLA 2P0CA 2F2UA 3JVSA 3JXWA 4HOKA 4ZS0A 4TN6A 4X0MA 5HE2A 4ACDA 2IWIA 1S9JA 4FC0A 4TYGA 2F57A 4E6CA 3IOPA 5CU2A 4MXZA 3PVWA 3VIDA 2JIVA 1H08A 3GEQA 5CAOA 4IVCA 5CI7A 3C0HA 2YFXA 3QTSA 4PPAA 2W5AA 3BLAA 2PZIA 2A19B 5HO7A 4AFJA 3A8WA 4BFMA 3GCQA 3HMOA 3DTWA 4BWXA 2O63A 3UDZA 4YHJA 4MF0A 5BUEA 4O7TA 4PTEA 2ZV8A 5AEPA 3F88A 3W16A 4HVSA 4OTRA 3T8OA 4DT8A 1H1QA 3PZEA 3R00A 4L53A 3QZHA 3SRVA 1RJBA 4EH4A 5CY3A 3BE9A 2PZ5A 3PIZA 4ITHA 3ZO3A 1XR1A 4ZSEA 2R4BA 4MQ2A 2VWIA 4ALUA 1R39A 3FE3A 2VGPA 4R5SA 3FY2A 4EZ7A 1ZWSA 2EVAA 3PA3A 5G6VA 1Q97A 1SVHA 4IBMA 4I4FA 2Q0NA 4X21A 3SXFA 3COKA 3NW6A 5DVRA 3KREA 1H8FA 4M69B 4YBKA 2YDJA 3PIYA 3KXNA 5G1XA 4WIHA 5E90A 2UW5A 3EFLA 4BR3A 5IEVA 2FSTX 4AXEA 2IZTA 4RFZA 1QPJA 3AT4A 2OG8A 4CV8A 4BZDA 5BYLA 1KUTA 1XH8A 3IOKA 4Q9SA 4WSYA 4PPBA 3RI1A 4BN1A 2REIA 3FMEA 5AUTA 3NIEA 3ORZA 4XP0A 4RSSA 5K3YA 5BQ0A 5HX6A 1KE9A 2ITVA 5M4UA 3MVJA 4IQ6A 1UNGA 2PMLX 1JKTA 2WU7A 2C6TA 4E1ZA 1QPCA 4YNOA 2F2CB 3R2BA 2V62A 4QPMA 3O50A 4EUTA 2A0CX 4GRBA 3SGCA 4KIKB 1P4FA 3E8CA 3IG7A 4ANOA 3SXSA 4CKIA 3OXIA 4MYGA 3RM6A 4G6OA 1TVOA 4RJ8A 3PDTA 4QYEA 1RDQE 4BBEA 3NYVA 3FLYA 4AN3A 2E2BA 1IRKA 2XALA 3CGFA 3HRCA 4D4YA 2BPMA 3MV5A 5M51A 1H25A 5CNOA 1NT2A 4Y72A 3AT2A 1JPAA 5A4EA 2XRUA 1Y91A 2VGOA 4RX5A 2BDJA 2WOTA 3F7ZA 3MIYA 3PA5A 3ZO1A 1W84A 3OP5A 3PE1A 4O27B 4LI5A 4CFXA 1W2FA 3DJ5A 3F3VA 3VS1A 3TZ8A 3Q4TA 4IB1A 3V5WA 4IFCA 4JIKA 5AP0A 3RP9A 4AOIA 2YCQA 5EG3A 1OUYA 5D41A 3LAUA 3HGKA 4FTNA 4UYNA 4CLIA 1U54A 3W0SA 2VWVA 2YAKA 3D5VA 3LVPA 5FP6A 1DM2A 3U4WA 3MIAA 1W83A 1XH5A 2XIKA 4KD1A 5AMNA 4D1ZA 2P2IA 4RZVA 5L8JA 4GFOA 4GKIA 3RWQA 4O4FA 4MBIA 4C2VA 2VO7A 4AZFA 4BDKA 1YVJA 2V22A 5FM2A 2ZVAA 5L6WL 3ZZEA 4DCEA 3IDPA 4DFLA 3DAKA 4BCHA 2R5TA 3QF9A 4F7LA 3EFJA 3O2MA 3AG9A 5CQUA 4HYHA 2FO0A 4KBAA 4BCGA 2IO6A 3FKNA 1J1BA 4AGCA 3VRZA 4DHZA 4NK9A 4X3JA 3V5JA 5IUGA 4X3FB 4FKOA 3RK9A 4HCUA 4C37A 3NAXA 5ANOA 5AUYA 2W05A 5H2UA 3UMWA 4F9YA 3Q3BA 3L8SA 4GFMA 3BGPA 2OSCA 1VYWA 3A7GA 3M1SA 4KKEA 4AF3A 4FV9A 3HA6A 4FZ7A 4IM0A 3FZOA 2PU8A 5FEQA 4UBAA 3EHAA 1PKDA 1UNHA 4JT3A 5EYDA 4USDA 3JUHA 4HGLA 5IA5A 2OZAB 4BCFA 2GS6A 4V0GB 4FKRA 3C9WA 4HPUE 4XX9A 2PMOX 3WYXA 3G0FA 2W5HA 3MWUA 5DH3A 4JNWA 4GCJA 2C5VA 4M69A 2IVVA 5IQHA 4TXCA 4CKRA 2CNQA 1LEZA 1GZNA 2HZIA 5EOLA 4F9WA 2X2LA 4ZY4A 2PVJA 3PVGA 4BHZA 2YA9A 2XKFA 2A2AA 1TKIA 1M7QA 1J7UA 2CCHA 5BVDA 1XBAA 3KRXA 1ND4A 1F5QA 3BZ3A 4RIWB 2R3RA 4O0XA 2CDZA 3F2AA 5AA9A 2EXMA 4KAOA 4U6RA 3BBTB 3C4XA 4BKZA 5I9XA 4FVRA 4QMZA 4G9RA 5A46A 3TTJA 5LMKA 3U9CA 1JQHA 2UZVA 5DEYA 4AT5A 4WRSA 1JSTA 1SZMA 3VBTA 1YXSA 5FDPA 5C8KA 3NS9A 5L2WA 2YZAA 2Y4IB 5M55A 1SM2A 2Y9QA 4KIKA 4FL1A 2ITXA 3P0MA 4YJSA 3RAWA 2QVSE 4GKHA 2OU7A 4D1SA 5BUIA 3TM0A 2J50A 2XZSA 5HLWA 4JG6A 4CSVA 4IWQA 5IF1A 4FTOA 4FTAA 1WVYA 4BCJA 2FVDA 3FLNC 4BCOA 1QMZA 5HIBA 1G8AA 2X8EA 4FTKA 4WNOA 3PXKA 3QZGA 1URCA 4QMLA 3HP2A 5E8UA 3AGLA 5BVFA 5D10A 1XHAA 3DNEA 4BTMA 4AXAA 3ZYAA 4NYEA 4JAJA 4ZSJA 4UMUA 1REJA 3SLSA 5D12A 3VQUA 5CU6A 1BI7A 3ERKA 4WBBB 5CEQA 2VTMA 4JI9A 2PUPA 2Z7RA 3KY2A 4O1OA 3BEGA 3GP0A 3VF9A 3ZCLA 1QL6A 4E6QA 3KU2A 4RG0A 4Y95A 2J4ZA 3VBVA 4JR7A 3H30A 1JVPP 3BU6A 3CQUA 1Q62A 1OM1A 2BCJA 4X6RA 5FXRA 4HZRA 4R7BA 1YOJA 5CVGA 3PSCA 4GG5A 4O0VA 4KBKA 4YGAA 5EW9A 5BVKA 2WO6A 3N4VA 5DA3A 2RGPA 4FZFB 3WARA 4C8BA 2W7XA 5ICPA 2WMVA 2UZWE 2VTIA 2PVYA 2XF0A 4TKSA 5CX9A 3AMAA 1EH4A 2ETKA 3DB6A 1B39A 4RRVA 5HESA 4A9UA 2GNIA 3FL4A 4ALVA 4C4JA 5AP6A 4DHIB 4X2NA 5J87A 2OJFE 5BMSA 2YN8A 3FSKA 3QAME 4QMYA 4X3FA 5FEDA 2I6LA 4L52A 3VUGA 4CVAA 1PXNA 3IW5A 3QZIA 4RJ5A 4FUXA 3ZUUA 5KHXA 2BIKB 2YM8A 4PP7A 4LUDA 5A4QA 5ANDA 4PL5A 5AR3A 3UYSA 1PMNA 5I3RA 4I3ZA 4II5A 4ZTRA 3R8PA 3LKMA 3TJCA 1VR2A 4M12A 2YM6A 3I5NA 2WTWA 4ZEGA 3DFAA 4D4VA 4Y73A 2OZAA 3VUTA 2PUUA 2RG6A 3FMHA 4RIYB 4V0GA 4XV9A 4BGGA 1CKPA 4Y46A 4DBNA 1VYZA 3Q6UA 5AUZA 4QTBA 4TWCA 4F7NA 4GG7A 4OT5A 3EZVA 4RFYA 5E8XA 5IDPA 5BVWA 2ITTA 2OF2A 4QPSA 3O96A 3MA3A 5ANEA 1J3HA 3OS3A 1BUHA 3PG3A 1T46A 4XV1A 5EM6A 2JIUA 3LFFA 4RIWA 2C6OA 1Q5KA 4S33A 3DAJA 4DG2E 2PWLA 5DMZA 5M57A 2I7QA 4PL4A 3FI4A 4MBLA 2ZV9A 4RJ4A 2HENA 3MH2A 3MI9A 3MSSA 5CQWA 3AMBA 3I5ZA 3LPBA 4YZNA 5DNRA 3UOLA 4IVBA 2BILB 2BDWA 2FYSA 5AUVA 4OLIA 3BHHA 2BHHA 3O8PA 3BGZA 4D58A 3SW4A 4YPDA 2C6MA 4Z3VA 3TDVA 3P86A 1XBBA 4O0YA 3MVLA 4U0IA 2Y8OA 4OR5A 5KUPA 3QXOA 1OECA 3SD0A 1OKWA 3CJGA 3F3UA 1YHSA 2VTSA 3IQ7A 4AW1A 4PUZA 2NYAA 4BICA 5AADA 5CT0A 3RAIA 4M67A 3V5QA 1ZOHA 3UOJA 2VWXA 2C6EA 2CCIA 2WMTA 2QD9A 3NVMB 5F94A 5AP7A 2ITUA 3BHUA 3FQSA 3OCBA 5M09A 3C5IA 2VWWA 5CF8A 3HECA 4L7FA 4A9RA 2V55A 5C4LA 3QCSA 2OZOA 5M06A 4LRKA 3NDMA 5KMIA 4S2ZA 2X9EA 5AA8A 4EONA 3S4QA 3E93A 4FV1A 4BTJA 4D28A 3R63A 4J7BA 2E9VA 3D7ZA 3E64A 3VO3A 2BKKA 3FYJX 4O7LA 5HBJA 2F49A 3H3CA 2OWBA 3RCDA 4AX8A 5DR2A 4IDTA 2CJMA 2YDIA 3QTQA 4IXPA 4BL1A 4W8EA 3FMKA 2O64A 3B2WA 5DIAA 2WPAA 4EOIA 4OAUC 4LRMA 3VN9A 1PXPA 3G90X 4JJRA 3RCJA 4AT3A 3MESA 4DA5A 4H3BA 3FJQE 3GOKA 5IA3A 4EH8A 1WZYA 4GK3A 4W9XA 4TY1A 5HBEA 3TXOA 4NWMA 5JFSA 5E8TA 3UVQA 4JL9A 5IQDA 5IUIA 5LVPA 4G3DA 5CEPA 4ASEA 3Q5ZA 5IA4A 3E7OA 3NSZA 4YTFA 4G3FA 3LIJA 3VHEA 2VTRA 3W18A 5CF6A 3RALA 1Q8ZA 4NM7A 4G5JA 4UN0C 4HZSA 4I24A 4MUQA 4XG4A 1UU9A 3DKCA 4YSMA 3R01A 4LG4A 2YLFA 4S32A 5HQ0A 4E4MA 2BRGA 3MDYA 4OW8A 4IB5A 4QTAA 5AFVA 3AD5A 4FKQA 2BUJA 4AGWA 2WTCA 3UE4A 4EK5A 5IUHA 2FUMA 4GU6A 3S2PA 2QO9A 4YJRA 2X2MA 3LXPA 5F20A 3RINA 5CASA 4FTCA 3U55A 2GQRA 4L7SA 2CLXA 4KSPA 1KE7A 1W8CA 3QD0A 3Q52A 4I0SA 2R64A 3U8WA 4BI1A 5EYKA 5JN2A 3UIXA 3RPVA 3W2QA 2WMWA 4KA3A 5I9WA 4OBPA 1R0PA 4K18A 3OXZA 4RIOA 5HLNA 4UWYA 3TNPC 3P5JC 3R7YA 3PIXA 3CCNA 2R3IA 4GU9A 2AC3A 2CGVA 3QX2A 4GK2A 3MFUA 4GJ2A 5LWMA 4F9CA 3TNQB 2PULA 3OMVA 4EWQA 3QCXA 4PNKA 4EOPA 1GJOA 5KZ0A 1PXIA 4Z7GA 1MP8A 2ZYBA 2IVUA 4EHVA 2XVDA 4O38A 2R3HA 2YCRA 2UVZA 2WMBA 4D0XA 4FUYA 3TCPA 3R73A 2I0EA 2XK4A 4R3CA 3MTLA 5FRIA 4RA4A 3LJ0A 4EBWA 5CALA 5E9EA 5FTGA 4ZLOA 2OKRA 3W0QA 4RLLA 3IKAA 3DZOA 3ORPA 1OL2A 3RNIA 3W0PA 4OBQA 4WD5A 4C4HA 1O6YA 2XK6A 3ANQA 1J91A 3FLZA 4ACMA 5H9BA 5JFWA 2QOHA 4EOQA 4XEYA 2J2IB 4AZEA 4IANA 3VNTA 3QTXA 3I7CA 4AA4A 3OCSA 4O2ZA 3UTOA 3W33A 4EH6A 5M56A 2XANA 2R7BA 5JT2A 3QCYA 3G33A 4BRXA 4CFVA 3B2TA 4EOKA 3DZQA 4DT9A 4YLKA 1Z5MA 3HDNA 4O7NA 3ORIA 2QQ7A 3SV0A 2Y4IC 3GQIA 2Z7SA 3VUHA 4QQTA 3P78A 3C4ZA 4YLJA 5I9ZA 4JMQA 2XBAA 2WOUA 4IVDA 4ZP5A 5FUTA 4W4YA 5HOAA 2PL0A 5LCKA 3ZLSA 4UXLA 1OBDA 3W0NA 1M2PA 5AAEA 4AA5A 3NX8A 4AFEA 3UO6A 1YXXA 2GNJA 3MBLA 4MWHA 4BKJA 2O5KA 2UUEA 4BHNA 2ZDUA 2PY3A 3D2IA 4IADA 3ZHPC 1P4OA 4C59A 2J5FA 5B2MA 1WFCA 5FLFA 4JR3A 1RW8A 3QHRA