3MY1A

Structure of cdk9/cyclint1 in complex with drb
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
322
structure length
314
Chain Sequence
DSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Halogen bonds form the basis for selective P-TEFb inhibition by DRB
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding/inhibitor
molecule keywords Cell division protein kinase 9
total genus 84
structure length 314
sequence length 322
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2010-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3my1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3my1A01
4PF4A 4RC2A 4BZDA 3O8PA 4JIKA 5CALA 3HV3A 3RPSA 4EZ5A 4FSUA 4RGJA 4HW7A 2GU8A 4K9YA 4CYJA 2ZV9A 1IAJA 4EH8A 3MA3A 3BHYA 2F49A 4GU9A 4R3CA 4S2ZA 4D5KA 4FEWA 2VGPA 5FBNC 1WAKA 5J1WA 3WF5A 4O22A 4XV2A 1WBPA 4YJRA 4C34A 4FI1A 2B9IA 3HP5A 4TXCA 2QLUA 3GU7A 4EK8A 1H4LA 1MRVA 3R63A 3ORLA 4QNYA 4YSMA 4DBNA 4YBJA 2EB2A 4FOBA 1CKJA 3EFLA 4YC6A 1OL1A 2HWPA 4QMSA 4U40A 4ZY5A 1OBDA 4D2TA 4XP2A 1Q4LA 4QYYA 2YWPA 4D1SA 3DKGA 4AT4A 2XYUA 3CS9A 5D12A 2C5XA 2C6LA 3FI2A 4O7ZA 4QTBA 3EN5A 3N4UA 3IGOA 4MWIA 1WBTA 2CN5A 2WTVA 3SV0A 4KB8A 4K18A 4G3DA 3HYHA 4D0XA 4K1BA 4QMLA 2VU3A 1H08A 5ANGA 2YHVA 4ORKA 3BYVA 3FLQA 4WA9A 4YJPA 4MX9A 5AIRA 3UC4A 5DR9A 3ORXA 1OL2A 3A2CA 3AGMA 4RPVA 4YZNA 2P33A 3AT4A 3N51A 3U8WA 4CFNA 3LMHA 3RAIA 4CZTA 3PSDA 5DYJA 3II5A 2WMSA 3NVMB 4PL5A 2C5YA 2ZM1A 3MY5A 4ZXTA 2KULA 5CNNA 3S1HA 2J0MB 2C3IB 3DFCB 2CNQA 5J9LA 4AU8A 3C5IA 5M56A 5L6WL 2VTIA 3JUHA 4ZTRA 2PVHA 1CSNA 2YIQA 5HOAA 4ZTSA 4R1YA 3ZU7A 2CKPA 4EUTA 2WU7A 3UMWA 2HOGA 5M06A 4FKPA 1URWA 3EYGA 2QNJA 2GS2A 3NWWA 4FSQA 4OBOA 5IUIA 5K5NA 2VTRA 3G9LX 5M07A 5HBEA 2V22A 3DBDA 3MFRA 4GIIA 4K77A 4QP2A 2XIRA 4U43A 3UPXA 3LKMA 1PXJA 4EORA 3KRJA 2I0HA 5M4IA 5IQBA 3MH0A 1Q99A 3K2LA 2WZJA 3O71A 4D2SA 2WNTA 3E64A 5DI1A 4XRJA 3TV6A 3MBLA 2WTJA 5IG1A 2Q0NA 4IZAA 3FXXA 2OXDA 2UZDA 2ONLC 4F70A 4CKRA 4D4SA 4F64A 4C3PA 5GNKA 3ZXZA 4FSYA 4EHGA 3Q6UA 5E90A 5TR6A 3QTZA 4JX3A 3A60A 3BLHA 3PY0A 3PVUA 4GH2A 1YOLA 2B7AA 4O86A 1OM1A 1Y6BA 5ETAA 2VTTA 1UNGA 4DGNA 4EJNA 1UVRA 3PP1A 2HXQA 5AUVA 2QO9A 3DT1A 5DFPA 4BIDA 2ZV7A 3QQFA 4D9TA 1M17A 2RFSA 4MNEA 3P5KA 1BKXA 4R8QA 4OTIA 3EKNA 3NAXA 4G5JA 4BBFA 3AMBA 5C26A 2R3IA 3R7YA 2VNYA 5GZ8A 2GTNA 2ZB0A 4YP8A 3LXPA 4M66A 3VS7A 4G34A 4MXYA 4FV2A 3GQIA 4DC2A 2R3MA 4DH7A 2YISA 4G6LA 3SD0A 3JYAA 1OPLA 1SMHA 3COHA 1YHSA 3OZ6A 3EFKA 2B55A 5AP7A 1V0BA 4BI0A 1KE5A 3FMJA 3ZSHA 4OTPA 5BX0A 1O9UA 2QODA 1MUOA 3H10A 1H24A 3IW4A 3D14A 4IM2A 4BIBA 3M11A 3FPMA 4J98A 3RK9A 2GHGA 4WNMA 2UW7A 2IZRA 3W10A 2OK1A 3ORMA 4YC8A 3ZBFA 1IG1A 3RVGA 5IH6A 3UZRA 3AT3A 4AF3A 4ZJIA 2IO6A 4CT1A 4BBMA 3GOKA 3BBWA 3PVWA 5KUPA 5HCXA 1LP4A 2YIRA 4GSBA 3ZRKA 1BX6A 5ANJA 4RLKA 5ANDA 4EBVA 3T9IA 1XHAA 1G5SA 4YMJA 5A9UA 3K5UA 5DN3A 3SDJA 3PSBA 3S2PA 4B4LA 3C4ZA 2X2KA 3L9MA 4MXCA 4HVGA 4YJTA 5BUIA 3FI8A 3QZIA 2NP8A 3KK9A 4M12A 4GG7A 3DJ5A 2R3PA 4DTAA 4R1VA 3LXKA 3MA6A 4RLLA 4P4CA 1H0WA 3AC1A 5JGDA 3HUBA 3V5JA 2X7FA 3MTLA 5AV0A 3DAEA 5GHVA 5IISA 4XUFA 4O7LA 2Y6OA 2YM5A 4R3RA 5A6NA 1M7NA 3O8TA 3DS6A 5HESA 4DEBA 2QOFA 5ETFA 4HOKA 1UU7A 2C3LA 2Z8CA 2C6KA 4NM7A 4KIKB 3P7CA 2GDOA 2Y7JA 3FLWA 2VV9A 5EW3A 2CLQA 3NZ0A 3WZKA 1KOAA 2WQOA 3UO4A 3FEGA 3E8CA 2ERZE 3D0EA 3OHTA 4RVLA 4K2RA 4YC3A 3PXKA 5F4NA 2XK8A 5FP5A 5EHYA 2QU6A 4L7FA 5LWNA 2VAGA 3L9LA 3THBA 4KIPA 3BGPA 4XCUA 5CQWA 1B6CB 4QP8A 3TJDA 2WMUA 5LMKC 4C33A 4K8AA 2BRMA 3PE2A 2GNGA 3EQBA 4ZAUA 2BPMA 3ORNA 4P5QA 3CTHA 3OVVA 4RVTA 3DZOA 4ALVA 5CWZA 2ITQA 3GNIB 5GZAA 4CG8A 4IWPA 3LJ0A 4ZZMA 2W99B 4IX5A 2ITOA 3R73A 4BDGA 4BDHA 3ROYA 1NVSA 4FVQA 2BZKB 3GCQA 4HZSA 5IA1A 4YSJA 5CVFA 4CRLA 5BMSA 5L2QA 3IQ7A 4IB5A 1OKYA 3O0GA 3FQEA 4A06A 3D5UA 2GNJA 2GNLA 1I09A 4GUEA 4KKGA 2RGPA 3AC3A 3FZRA 2NPQA 4QMZA 3C5UA 3QWJA 2PU8A 3DBEA 3TZMA 2Z7SA 5DIAA 5AP6A 2UW3A 5AUZA 2OXXA 3E88A 4YJNA 2FSOX 4KA3A 2FO0A 3ZFMA 4W9XA 2CKQA 3LAUA 3PPKA 4FSRA 3A4OX 4JG7A 4ASXA 4BCHA 3GU8A 1NY3A 4MAOA 4B8LA 2VWIA 4MEDA 4GUBA 3V3VA 2PZYA 4GVJA 4CQGA 2ZMCA 4FT3A 3QYZA 3NEWA 4MTAA 2R3OA 3FZOA 1TQIA 3HDNA 4X2NA 3W32A 4BC6A 3G5DA 4E1ZA 3VUHA 3ZEWA 1DI8A 2YITA 2P4IA 3E62A 3GC9A 2VX1A 4IWQA 5EW9A 1R78A 3AOXA 3FAAA 3PTGA 3ZS5A 5KKRB 3ZLYA 2HWOA 2VNWA 2WMQA 2QD9A 4V0GB 2W17A 3EOCA 3SRVB 4F1OA 5ICPA 4WNKA 2HENA 2VUWA 2C5VA 3LW0A 4BVUA 4N57A 1YI4A 1ZYCA 2YM8A 4C35A 4DYMA 1TQMA 2YCQA 4R5YA 1OPJA 2Y9QA 4DH8A 4WRGA 5J79A 3DXPA 4M14A 4QP6A 4YHJA 2YIYA 3FI3A 5C01A 4WRSA 4IX4A 3BHTA 2PVRA 2XCKA 2YCRA 1ZY5A 2J4ZA 3FZPA 3G2FA 3RZFA 3PSCA 1YDSE 4FTRA 1JQHA 3K5VA 1JPAA 3W2CA 5AJQA 2GHMA 5JRQA 1UV5A 3WF9A 5AR2A 3PIYA 4K11A 5AP1A 4P7EA 5HD7A 1Q61A 4GK4A 2B9JA 4M69B 5J9YA 1PXOA 3LMIA 3UZTA 3EQDA 1ZOEA 2P2IA 4E7WA 2YEXA 3H0YA 5IQHA 4NFNA 1HCKA 2WMVA 2P3GX 3U51A 3AC4A 3FKLA 2R3NA 4AS0A 5EI8A 4DG2E 3UOHA 4H1JA 3C7QA 5EYKA 3C4EA 3PLAE 4UXLA 4GRBA 3CY2A 2JD5A 3BGQA 2G2HA 5AP4A 3V5TA 4FV0A 5A6OA 4O0UA 4XG7A 5HD4A 4FEUA 2PMNX 4BGGA 1XH8A 2EWAA 4FUYA 5HKMA 4F0FA 5L2IA 5CU3A 3DK3A 4E73A 1NT2A 3AXWA 3MJ2A 2FSTX 3VUTA 4X0MA 3CQEA 4WSYA 3BE9A 2W9FB 2BAJA 4O1PA 3ZLWA 4BDJA 3G33A 4M97A 2BZIB 4QO9A 4TRLA 4AQCA 3BI6A 3F61A 3BYUA 3GP0A 2WTDA 4CYIA 2GFSA 2XK9A 3LFCA 4NKAA 4ZLOA 5HLNA 4YURA 2J5EA 3U54A 4LL5A 3TNWA 3UG1A 3IGGA 3PA4A 5K0XA 1EH4A 5CI7A 4FZFB 4F9BA 2PPQA 3F2RA 3PP0A 1YXVA 4BDIA 3QZGA 1RQQA 4RJ5A 4ZIMA 4EBWA 3VJNA 4O82A 5HBHA 4IMYA 4DBXA 1OKWA 4BCIA 2VTMA 2XCHA 3DJ7A 2XEYA 3EQCA 3NMUF 4IB3A 4BWKA 2GNHA 4IAYA 4D2VA 2IPXA 3SX9A 3KL8A 3V6SA 3R7OA 4CMOA 3Q04A 4ACDA 2HZNA 4IZ5A 4O27B 3TTJA 4I23A 4A4XA 5JFSA 3D5WA 3F82A 4E4MA 5EYCA 1RDQE 3BQRA 2OH4A 2I1MA 3DDQA 5JQ8A 4DGLC 2OIQA 4LOPA 4IJPA 5LOHA 2VTPA 5M44A 4FKJA 1LEZA 3W55A 4FZAB 1XBBA 4F09A 1YWVA 2CLXA 4NM5A 3KMWA 2A4LA 1WBWA 5DR2A 3W2QA 1Y91A 4JG6A 3BPRA 2Z02A 3A7FA 1UNHA 4RFYA 4UYAA 2X0GA 4L68A 4KUJA 2WMWA 4U79A 3TTIA 1YDRE 4PMTA 4EOJA 3ODZX 1YXXA 4EJ7A 3PJ1A 2R5TA 3OXZA 2UZUE 4TNBA 3EL7A 4CZYB 5DRDA 5ITAA 3MIYA 2HY81 2B9HA 2HK5A 2X9FA 3QA8A 3Q96A 5FLFA 5C1QB 4G5PA 2JDTA 2W4JA 3KFAA 4PP9A 4O81A 4JRVA 3CIKA 1SNUA 2OW3A 2JEDA 2VZ6A 1WBOA 1NXKA 3CTJA 1ZZ2A 3G9NA 2F4JA 3PJ8A 4XYFA 1R0PA 2J9MA 3HKOA 3KRLA 4H1MA 4JR7A 2QG7A 4GW8A 3GU5A 3TNIA 3ALOA 3FLNC 3L8SA 4FV1A 2R7BA 2XKFA 4L52A 2XIKA 3F69A 3NUNA 4O0XA 4UMPA 3OROA 5GZ9A 3S0OA 5C8NA 4AZEA 5FDPA 4F9WA 3ZRLA 4LQMA 3UP7A 3BHHA 4PRJA 5H8EA 5HO6A 3NW5A 5A54A 1CM8A 3RM7A 4KRDA 3BGZA 3RPVA 5BYYA 1Q8UA 4ZLZA 3RAHA 3DKFA 3IW7A 2GTMA 3DGKA 3R9HA 4YNEA 4ZTQA 3KU2A 4UEUA 1ZMWA 2C0IA 3DY7A 5CVHA 1AD5A 4IZYA 2ESMA 3EQFA 2XNBA 5G6VA 2F2CB 3DAKA 3MS9A 4WUAA 4X2FA 1JBPE 1P14A 3NW7A 1LUFA 4H58A 3AMAA 4I6HA 4OTFA 2X8EA 3FHRA 4E6AA 5HX8A 5F94A 1YDTE 3E7OA 3ZZWA 4JAJA 2R4BA 5KMIA 3QD2B 4MXZA 3ORKA 1UWHA 4PDOA 4FV8A 2X4FA 3H9FA 3MFTA 3OS3A 1NVRA 4R7HA 1GAGA 4FKLA 4AOJA 4O84A 2HW7A 3LM0A 2QOQA 4GS6A 4UWBA 2ITZA 3HX4A 4OBQA 1PMUA 1U5QA 3N4TA 3QRIA 4S30A 3R1SA 3FMNA 1VEBA 4FKGA 4PTGA 4YJSA 4X21A 4BKZA 4O0VA 4G6NA 2CGWA 4RVMA 4RMZA 2WTCA 5CU0A 1DS5A 3UTOA 4BCGA 5IMEA 5E8TA 4U42A 4KWPA 5BVFA 2R3KA 4CFWA 3SKCA 3IECA 2ITVA 4IH8A 5K3YA 1UU9A 2R64A 3F5GA 1QL6A 4RIOA 3GU4A 4ZSLA 3O8UA 4C4GA 5JQ5A 1RW8A 5EYMA 3RWQA 5CF8A 3VBWA 1PMEA 4RIWB 2BTRA 3QQJA 4IIRA 3KY2A 1XJDA 1G3NA 2UZWE 4CFVA 3E63A 1JWHA 5B7VA 4H05A 3W2SA 4F6UA 5KHXA 4C37A 2CNUA 1SVGA 2Z7QA 5T3QA 4YZ9A 4AN2A 4D9UA 2YERA 4GVAA 4PDYA 3KXHA 3DK6A 5DEWA 3F5XA 5AV1A 4Q9ZA 4FKRA 3E8EA 3QLGA 5CSPA 3TKUA 2B52A 4AT5A 3BV2A 5JFVA 2YN8A 3JVSA 3UIMA 4EOOA 5FTGA 2CCHA 4RIYB 1WBNA 3QQUA 4FTAA 3CGFA 3WF6A 5FDXA 1XO2B 3RAWA 1FGKA 4X6QC 3ZO2A 4RX5A 5LVNA 3BBTB 5CEKA 5E9EA 3ZDUA 3W2RA 1WVXA 4MF1A 3W16A 4EOQA 2YFXA 3DTCA 3ZFYA 4DITA 5HE1A 4UALA 5H8BA 2B1PA 3CR0A 2BFXA 3NAYA 4JQ7A 4UZHA 4BFMA 1Q3DA 3QTSA 4TPTA 5E8SA 4QP1A 3TL8A 3GVUA 4I24A 3KN6A 3RPOA 3QUEA 1MQBA 3R6XA 1CKPA 4L7SA 2YA9A 2OU7A 5D7VA 3SLSA 5LMBA 1REKA 4L42A 4AZSA 2C6IA 2X4ZA 2IWIA 3AD5A 2PHKA 4O38A 4JDHA 3IK3A 4Y5HA 5CQUA 4OAVB 4DCAA 3QQGA 2JDSA 4L53A 3V8SA 4YO4A 3R71A 4A9YA 1WVYA 3VN9A 3LXLA 3FKOA 4NT4A 5E4HA 4ID7A 4FL1A 1UU3A 2JBPA 3GCSA 4PP7A 3DPKA 4DFUA 3KGAA 1XH7A 4PL3A 1H0VA 3OW4A 4MD8E 4AOTA 2YZLA 3RBWA 1YQJA 3FE3A 4CTCA 2JDRA 4BGQA 5GINE 4OGRA 5A3XA 4DHFA 4ZSGA 4CCBA 4TYIA 4FTJA 4Y46A 2JGZA 2WQMA 5CSWA 4KKEA 2CN8A 2UZLA 1RJBA 4AACA 2CKOA 4QP9A 2Y0AA 4XEYA 1Q3WA 4NUSA 3DAJA 3AC8A 3P7BA 4FODA 3LJ1A 4TY1A 2W5HA 3ZONA 1V0OA 4S33A 1S9IA 1QCFA 3CSVA 4M84A 3LLTA 4FA2A 1KOBA 3IKAA 4AFEA 5EQEA 5IQCA 1H26A 2X6EA 3D5XA 2XJ1A 4FTTA 3BYMA 3NUXA 2V55A 5GIPE 3ACJA 4U80A 1U46A 4FTOA 2PMOX 2Z7RA 2FVDA 4FZ6A 5CU2A 4GFMA 4FMQA 1KE8A 3KKVA 4FTCA 4X6RA 4O6EA 3R02A 4D2WA 3SXRA 4MD7E 3DU8A 2HZ4A 3I81A 4L3LA 3BEGA 1F5QA 4MBIA 3U6JA 3QUDA 4NM0A 2XEZA 3FZTA 3B2TA 4I21A 3VRZA 2W06A 2OZAA 3I1AA 3WI6A 2QC6A 3VS3A 3C4WA 4O91A 4S34A 1H25A 5IEXA 4ZSJA 3MB7A 1OITA 3FMMA 4MXXA 1KSWA 3F3ZA 5CAOA 2GSFA 3FPQA 2XKEA 4QMUA 4G6OA 3DTWA 2UVYA 3GCPA 3FLSA 5D11A 5CENA 4DFYA 2HZIA 3BWJA 4BYIA 1TQPA 4D5HA 4DN5A 5AUUA 5KX8A 3QWKA 3JS2A 4RZVA 3OOGA 4ANQA 4M7IA 4I93A 3TWJA 5AR3A 4IX6A 3FMHA 3OY3A 3W8LA 2AYPA 3O7LD 3WYYA 5E1EA 2PMIA 3TNHA 3ULIA 4HYSA 2UZVA 1R39A 4FOCA 3LOKA 3SG8A 5KMKA 2NNWB 4QNAA 2BIKB 2JFMA 3JPVA 5D1JA 3RHXA 4DGGA 4EOKA 5L3AA 2FH9A 5EQYA 2YJSA 2BCJA 2OICA 3NNXA 4LGHA 1XQZA 4L46A 5L8JA 3AD4A 4GIHA 3G0FA 3R2YA 4KBCA 4F0IA 3CQWA 4ZZOA 2WQEA 3ELJA 3A99A 4L3JA 4RIYA 4JRNA 3BYSA 3QGYA 2WD1A 4BYJA 5AA9A 4Y73A 4PV0A 2H9VA 4M67A 5IH5A 4AOIA 1FVVA 3ZYAA 3MPAA 5LMKA 2DYLA 1W0XC 5TKDA 4ASEA 4CEGA 3ZLXA 5BVEA 4CT2A 3DLSA 1ZY4A 2BFYA 2XZSA 4FV9A 1SYKA 2HW6A 3R7UA 2PVMA 2E9NA 1IA9A 3COMA 3DXQA 4F63A 2OBJA 5FBOA 4FYOA 3NX8A 2YZAA 4KSQA 4QMTA 2XNGA 5J5TA 3PRIA 3TIYA 3QZHA 1W83A 4BWPA 2G2IA 4KABA 4ZJVA 2PZPA 3CQUA 2R0UA 2E9VA 2DS1A 5I5ZA 4TKSA 2O65A 4NKSA 5LXMA 5C4LA 4RJ8A 4PPCA 4XP3A 2HCKA 5C8KA 3RK7A 3E3BX 3FXWA 3QRKA 4OT6A 5BVKA 4IX3A 2PL0A 3QX4A 4QQ5A 3VHKA 5JFWA 1JAMA 5F1ZA 3O17A 3SG9A 1IRKA 3W1FA 5IQAA 2DQ7X 3Q9XA 3R2BA 4IAKA 4AE6A 4AGDA 2UZOA 1ZYJA 4E4NA 3VVHA 3F66A 3CTQA 3QU0A 2OIDA 3T9TA 2V5QA 4FT5A 4XBUA 2VTQA 4EH7A 5FXRA 3IDCA 3KXXA 4J96A 2EXEA 4DGOA 2WMAA 2Z60A 3E5AA 4HVDA 1VJYA 1ZZLA 4RIXB 4QP4A 3OCBA 4FNXA 5E8VA 5I9ZA 4DTBA 3TUBA 4I5CA 3B8QA 4FKVA 4IAIA 1JSUA 2UZTA 1OUKA 1YWRA 3ORZA 4NIFA 4MQ1A 5EG3A 3GFEA 2GHLA 4M68A 5D9HA 4X7QA 5JT2A 4O7NA 3NYOA 2A2AA 4USEA 4QTAA 3K3JA 2E9PA 3QTUA 5E91A 3F7WA 3EQRA 4RC4A 5IQIA 1XH9A 1ZYLA 3MYGA 4L9IA 2WPAA 4U5JA 2W1CA 5DMZA 4J8MA 1FMKA 1PKDA 3PIXA 1OZ1A 3C9WA 5CSHA 1BMKA 3NYXA 4PNKA 4D2RA 4I5PA 4XP0A 1OMWA 2O64A 2QHMA 2QR8A 2VWUA 3EQPA 4TWNA 4YPDA 3UYSA 4X3FB 1E9HA 3RAKA 3VQHA 1OIYA 4MF0A 4DEIA 3POZA 4QT1A 2UW0A 5HIBA 3DV3A 2W96B 4GT4A 4ZSEA 5IU2A 3HUCA 5KMLA 3I0OA 5EM5A 3CKXA 1NW1A 3OWPA 2XRUA 4RRVA 2VD5A 4PDSA 4U3ZA 5FG8A 2J0LA 5FEEA 2Y4IB 5EOLA 3NNWA 2UUEA 2VWVA 2XIYA 3ANRA 4WHZA 3SOCA 3ZC6A 2QOHA 3AC5A 4XS2A 1SVEA 4II5A 4E6QA 3NVKI 2ZDUA 2H96A 3NLBA 1Q8WA 4W9WA 3MDYA 4RIXA 4XG4A 5IQFA 1DI9A 4FGRA 3BU3A 4CSVA 4EOLA 4IM0A 2CSNA 5H2UA 1PKGA 4XLVA 1NVQA 2C5OA 1ZARA 3PY3A 4GKIA 3BQCA 3QQKA 3WZDA 3CLYA 2R9SA 2BAKA 4APCA 5I9XA 4FTNA 2Z7LA 3IOKA 4NSTA 4NEUA 5JN2A 3VO3A 3TN8A 3ATSA 4XG8A 4HYIA 4UMQA 5H9BA 2BALA 3Q3BA 4CZUA 4FSNA 4PTCA 4FKOA 2OO8X 3EQGA 3FL5A 5HI2A 3A7JA 3HNGA 2VX0A 3MFUA 3UNJA 5HLWA 5BYLA 2OXYA 3BV3A 1BL7A 1TKIA 4MKCA 3D2KA 1FMOE 3QTXA 4ZSAA 5CAUA 4DCEA 5I0BA 4EK6A 2BAQA 3P9JA 4G3FA 4AE9A 4CGAA 4A7CA 4AP7A 5AIKA 3MFSA 4AA4A 2FYSA 3A62A 4WBOA 3IW6A 4L45A 2KTYA 5J5SA 4GEOA 5EH0A 4C57A 1QPEA 3PJ2A 3QALE 4NTSA 4XOZA 2B0QA 4IAZA 2J0KA 5HX6A 1YHWA 2JC6A 5IA0A 4EQUA 1P4OA 3KA0A 4IQ6A 1FINA 5CEOA 2WOUA 1Y8YA 4B7TA 3V04A 2PYWA 4LRMA 4QMYA 1BL6A 5KE0A 3NPCA 3IOPA 3PIZA 3A4PA 3NW6A 2G1TA 4W4XA 1OL6A 4YTFA 2ZV8A 2R7IA 3BX5A 3E92A 4RQVA 5CF4A 4BZNA 4MD9E 1GZ8A 4I6FA 4EH5A 3EN4A 5T6KA 2QOBA 3FMLA 4FSZA 4BY9E 2XNOA 2QHNA 3GT8A 2WFYA 1FVRA 1A9UA 5TF9A 3EYHA 4LI5A 5IA3A 5JK3A 4ERKA 1PHKA 3A61A 4FGBA 4QP3A 5E92A 3FDNA 3MPMA 4RX8A 4WNPA 2ITPA 4QPMA 1UKIA 5L4QA 5BVWA 2R3JA 3LFDA 4O21A 2YM4A 4O0TA 3SAYA 3UYTA 1H1SA 4EL9A 3Q4UA 5HTBA 4O7SA 2G9XA 3W2PA 1XBAA 4G31A 4IFCA 1DAWA 2VTAA 3QBNA 2WO6A 4HYHA 4WG5A 4YBKA 3ZUVA 4JDKA 2C47A 1RE8A 1JKLA 2F7XE 2EVAA 2F57A 3NUSA 4QQCA 2HAKA 3DCVA 3QTIA 1WBVA 3EWHA 1M2QA 3OXTA 2UVXA 2J51A 4WIHA 3JR1A 4E4LA 4BICA 3G6GA 4UWYA 3VW6A 3R30A 2OG8A 4TYJA 5DGZA 4HNFA 2PUNA 3PG3A 3MIAA 4BIEA 2IVVA 4GL9A 4YJVA 5EM6A 3FYJX 4X2GA 2XA4A 1J91A 4R5SA 3UVQA 1U5RA 1TVOA 4CKIA 5BNJA 3ZSIA 2WIPA 1GNGA 3D2IA 5DT3A 5AAFA 3U6IA 1FVTA 5AAEA 5L2TA 3TKIA 2IJMA 4DG3E 5AUTA 4IM3A 3LQ3A 4F6WA 3Q6WA 3QGWA 5KZIA 4FNZA 3R8MA 4R77A 4HPTE 2WMRA 4AN9A 3RHKA 5IQGA 2F7EE 2WELA 3HDMA 1OKZA 5AAGA 3CCNA 3D83A 3FHIA 2RF9A 4HNIA 4YJQA 2C1AA 4UV0A 4KRCA 3V5PA 4NZWB 4G9RA 3UODA 1W7HA 5DG5A 3I6WA 4DT9A 3QHWA 4FKIA 3KRXA 5K9IA 5AM7A 3DK7A 4NCTC 4UMUA 4I5MA 4ZK5A 3SC1A 3TG1A 3H3CA 2PE0A 5E7RA 2HY0A 4YLLA 5B2MA 4TW9A 4GU6A 3ZFXA 2GCDA 3UNZA 5JH6A 5JGBA 2PZIA 4CNHA 4X2KA 4ITIA 3Q4TA 1E1VA 3DJ6A 3I7BA 5AEPA 3PXZA 3OY1A 3O2MA 5HNIX 3A7IA 5IA5A 4JIAA 2VWXA 5M53A 2ONLA 5CU6A 5B2LA 5FM2A 3PXFA 3GI3A 5DNRA 2NO3A 4IDTA 3IONA 2HYYA 3OCSA 3EMGA 5DR6A 3H9RA 4FUXA 2W5AA 4G2FA 4BDKA 3TCPA 5JKGA 3MI9A 2XP2A 2IZSA 4FG7A 5AX3A 5E8YA 1PXPA 3Q2MA 3Q4ZA 4IB1A 4XH6A 5LWMA 3I5NA 4RWKA 4QTEA 2RFEA 4QP7A 4KAOA 4A4OA 2R3QA 3T8OA 5C4KA 2FUMA 3IG7A 3AC2A 3MTFA 3TEIA 4LFIA 2PVFA 4KS8A 4CV9A 3AT2A 3G0EA 5BQ0A 3H4JA 4W4WA 4I0TA 1GOLA 1SM2A 3W2OA 5L2SA 2CCIA 3QTWA 5HIEA 4RSSA 4MBJA 4AGCA 3QZFA 4FTQA 4NK9A 1YXUA 3VW8A 4XJ0A 4D1ZA 4FT7A 3ZO3A 3LJ2A 3TV7A 3R1NA 3A7HA 3AD6A 3ORTA 4MYGA 3ZRMA 3L8VA 2WEIA 4QTCA 3TNPC 2PUUA 2XRWA 4R6VA 5A14A 3LQ8A 4LRKA 1H1PA 2BILB 5IDNA 1H07A 4G3CA 4O7RA 2Q0BA 4GT5A 1LR4A 4OT5A 4PUZA 2QKWB 5ANIA 4O7VA 1G8AA 4XG3A 5HICA 1PF8A 3RCDA 3UPZA 1Q24A 1OIQA 4OTHA 1VYWA 3KN5A 4ANLA 4EC9A 5FUTA 5AUWA 3OWLA 5CXHA 3OW3A 4FIHA 3LPBA 3HVCA 1K3AA 4HVHA 3KXNA 5AUXA 5FXSA 3LFBA 1ZLTA 4I6BA 4BKYA 4JX7A 2C1BA 5FRIA 5I9WA 4RG0A 1AQ1A 3NUUA 3UNKA 2BMCA 3KCKA 4MXOA 2X7OA 3C4XA 3TZ8A 4ZJJA 2BUJA 4JI9A 2UW5A 3PXRA 4YJOA 4A07A 4BF2A 5IDPA 5KBQA 4UMTA 1R3CA 5A4QA 5AV3A 4FKUA 2BKZA 3AGLA 5TOZA 4FKSA 4DG0E 4JBOA 4ZLYA 3QLFA 4QOXA 4O2ZA 4RA4A 3FXZA 2PVNA 3G6HA 3KULA 3KXMA 4RFMA 1KE7A 3BE2A 3EFWA 3HV7A 3F3VA 3OCTA 5EK7A 4BWXA 4EZ3A 5I3RA 3U55A 5D10A 1OVEA 2QO7A 4HGTA 3ID6C 1UWJA 5EHOA 5CEIA 3OT8A 3CC6A 3ET7A 3DLZA 3GFWA 4HCVA 2YCSA 4HJOA 4FC0A 3VF8A 4ZTHA 4TYHB 2VWZA 5IF1A 4NU1A 1FGIA 1XH5A 2GS7A 3HEGA 4PX6A 2GNFA 2BVAA 4FR4A 2I0YA 4O1OA 2VTOA 1T45A 3RALA 3TZ9A 5HHWA 2C0TA 3EB0A 4ASDA 3Q9ZA 3HRCA 3BU5A 4BCOA 4QMXA 1OPKA 4D4RA 1W82A 4LV8A 1SVHA 2P0CA 3OUKA 3RM6A 4ENXA 1PRYA 3SW4A 4EQCA 4H39A 1XBCA 1IEPA 4KIOA 5DVRA 2O3PA 2OIBA 3O7LB 1VR2A 3CKWA 1YRPA 1AGWA 2C3KA 4XRLA 3E3PA 4EEVA 3E8NA 4EH9A 3VUGA 5HNBA 3LLAA 1Q41A 2O63A 3HV5A 1JSTA 4DEDA 3QD4A 3DQWA 2PY3A 3KCFA 4YTHA 4D0WA 4AX8A 4V04A 5HNGA 4O0RA 4BZOA 4FIIA 2ETMA 4I92A 2OZAB 2VTNA 4FV6A 5EDQA 3TJCA 4LM5A 2P2HA 2UZBA 3WIGA 2VN9A 5HVKA 3PPJA 4PPBA 4DGMA 3HMPA 4HGEA 4QPSA 4JS8A 3MY0A 2ETKA 3D7TA 3F9NA 4JBVA 3PWYA 4JDIA 4EKLA 3HAMA 3U4WA 5A4CA 4OTRA 3ACKA 2B53A 2WQBA 3EIDA 4ZY4A 3PXQA 4FL3A 1UNLA 3R9DA 3NYNA 4EWQA 1M14A 4XV1A 2ZB1A 3PYYA 1MP8A 4ANNA 4BTMA 4RJ7A 3LCDA 4QMOA 4AFJA 3FYKX 3NGAA 3PZHA 4GK3A 4QMPA 3QD0A 3KB7A 3S3IA 5BVDA 3HGKA 4IZ7A 1H28A 2IW9A 4WD5A 4YU2A 3DBQA 4FICA 5CTPA 4L67A 2JIUA 3FY2A 5EFQA 4GJ2A 4C61A 1FQ1B 3ZSGA 1OBGA 4JG8A 4MHAA 2R3LA 3R8VA 5EI2A 5HZNA 4A9UA 5EW8A 5HEZA 2RG5A 3HAVA 3L8XA 5DE2A 1JKTA 3B8RA 4L00A 3ORIA 4ARKA 5I9UA 1PXMA 2YDKA 3ENMA 3NIZA 3RI1A 3RINA 2IVUA 4DEEA 3HZTA 5A4EA 2PVLA 4TYGA 4XG6A 4OTQA 2DWBA 4ZS4A 2YCFA 4N4SA 1M52A 4R7BA 4WG4A 4AW5A 3RGFA 2IVTA 3LE6A 2I40A 4QMVA 1PY5A 3P23A 1F0QA 1ZOHA 4GYGA 3LZBA 3RJCA 3ZHPC 2OJ9A 3FL4A 4IEBA 4QYHA 5M57A 5DH3A 3CD3A 4E26A 3BKBA 3IW5A 3O51A 4LGGA 1IASA 2YACA 2ZV2A 5JZNA 3VIDA 2J90A 3H9OA 2X2MA 3TDWA 3O96A 2VWBA 4R7IA 5M4CA 1M7QA 5DT0A 1OIUA 2X2LA 4FIFA 3NYVA 2CHLA 4XOYA 4AUAA 4V05A 4Z7HA 4DLJA 3D9VA 1GIHA 4HPUE 2O0UA 4F08A 5ETIA 3R8PA 2WTIA 1WVWA 4KS7A 3H0ZA 3KREA 5EKNA 3EJ1A 3MSSA 2AC3A 4FBXA 5ACKA 2JKQA 2FB8A 3SW7A 4DINA 2B4SB 3LHJA 3MV5A 3RNIA 3L9PA 4DFNA 4XV3A 4QRCA 3UJGA 5J8IA 4WBBB 1L3RE 3CXWA 2JKKA 4B99A 3QYWA 3OMVA 4HYUA 3CE3A 4JAIA 4TWPA 5DHJA 3VBQA 3FSFA 3TI1A 4M0YA 3S95A 2XYNA 3RTPA 4HGSA 5HQ0A 4BHZA 5HG5A 3BHUA 4PTEA 4RJ4A 2IG7A 5FGKA 5L6OA 4FF8A 2WTKC 4XV9A 5IH4A 1T46A 3KVXA 3MPTA 4D1XA 4FNWA 2GQSA 4BTKA 1L8TA 2OSCA 3DKOA 4JL9A 2BDFA 3R04A 4O96A 5EKOA 3ROCA 3W33A 3MVJA 4Q9SA 4RFZA 2ZVAA 4JBQA 5CAVA 4LUDA 4FKQA 3KXGA 2HXLA 2JBOA 2X6DA 4GK2A 3UG2A 2PK9A 4BDCA 2YJRA 4FTKA 4JBPA 3UVPA 2RSVA 1BLXA 4U44A 1H1QA 2C6OA 2GMXA 4YLKA 5M51A 4H3PA 4O0YA 4RJ3A 4AZWA 2H8HA 5E8XA 5FM3A 3ZH8A 2A0CX 3QXOA 1YW2A 3HV4A 5HTCA 5BVNA 4C4FA 5HE2A 2WMBA 5E8ZA 1XWSA 4CD0A 3FV8A 3WF8A 2F7ZE 2ZMDA 4ANMA 2OJJA 2YM6A 4C4IA 3DZQA 5HORA 4QYFA 3R21A 4EYMA 4LRJA 2G01A 4RJ6A 4LYNA 2XNMA 2CMWA 4UZDA 3ZC5A 3Q2JA 1JSVA 5GIOE 1Q5KA 5C9CA 2WKMA 4ZTMA 3QQLA 4YNOA 5AR7A 2F9GA 4U8ZA 2I0VA 4WOVA 2BZJA 3DA6A 2BDJA 4UXQA 3M2WA 4F9CA 2A19B 5HCYA 2X81A 4F1MA 3POOA 4DF3A 5IEVA 3UIXA 5C27A 4J97A 4S32A 4MVFA 2CGVA 3LFFA 4BCQA 2VO7A 3O50A 4X2JA 2ACXA 3DXNA 3P7AA 5HVYA 4KBAA 3SXFA 4BL1A 3S00A 1YI3A 2UV2A 2XF0A 4J71A 4LL0A 3UIBA 4ZMFA 2R3GA 3RNYA 2OFUA 2BKKA 1GZKA 3PPZA 3JY9A 3RCJA 4B9DA 2EXMA 5IEYA 3BZ3A 1IAHA 1U54A 3ALNA 2DUVA 4YTIA 3T3VA 4DLIA 4OUCA 2W1GA 3CJGA 4QMNA 2JKMA 4IACA 3V6RA 3FZ1A 4A4LA 3ORPA 4XG2A 4ITHA 2OJFE 4L01A 4FK6A 4U7ZA 5CZHA 3TKHA 4CFUA 3MVLA 3C4CA 1H27A 4DH1A 3R01A 3OD6X 3RWPA 5CEPA 4V0GA 2J7TA 2O2UA 4PMPA 2JKOA 2YIWA 3E87A 5TT7A 2QR7A 3TT0A 3LFQA 5KMOA 3RPRA 1Q97A 3QQHA 4EZ7A 3R1QA 4AW2A 1PJKA 2V62A 3LIJA 1PYXA 3WZUA 2JAVA 4HVIA 4Z16A 3LFNA 3E93A 5HIDA 4RT7A 3ZZEA 2R3RA 2W5BA 1YXSA 3DOGA 3R00A 4RX9A 3N4VA 3EKKA 4C3RA 1H01A 5AP5A 2XK7A 5LCKA 3ZCLA 2Q83A 4DE4A 5J87A 2PWLA 2BHHA 3C0GA 3K3IA 4UWCA 2JAMA 3I79A 3Q32A 4FV3A 2W1IA 2XNPA 5CT0A 5L6PA 4MBLA 5AR5A 2ETRA 3VWAA 1Y6AA 4NW5A 4EHVA 4BGHA 2A27A 4PMMA 4F7NA 3V8WA 3V51A 3NUPA 1MRUA 3FMDA 3LCOA 4XNEA 4YGAA 4QQTA 4YZMA 5LQFA 2O5KA 3VUKA 3GCUA 5E1SA 1GZOA 5IA2A 3QTQA 3NS9A 4C58A 4I20A 3C13A 1UKHA 1XH4A 5GJFA 3VQUA 1O6KA 3EQHA 4D2PA 4E5BA 3SXSA 3B2WA 5M4UA 1STCE 4EH4A 3QKMA 2XJ2A 3QL8A 3TM0A 3EHAA 3BHVA 3F3WA 2EB3A 3HRBA 3C51A 4IVCA 3ETAA 1GY3A 3R1YA 4GKHA 3R28A 4IW0A 4PWNA 1Q62A 3M1SA 4ACHA 4QYEA 2YLEA 4AW0A 3ZO4A 5L8KA 3KRRA 4UB7A 2W1EA 3OFMA 3CD8A 3ATTA 1MQ4A 4Y72A 2X8IA 2IZTA 4X3FC 3T3UA 3IO7A 3MH2A 2XK4A 4AXAA 4CCUA 2QOCA 5F9EA 3SGCA 5AFVA 5HO7A 3GC0A 3R22A 3ANQA 4MNEB 4C2VA 3VUIA 3Q60A 4D4VA 4YUQA 2XMYA 4LG4A 3UO6A 3WIKA 4NCTA 4Q5EA 4FE2A 3U9CA 3O23A 3F5PA 3OWKA 2GS6A 4AZVA 2GPHA 5CZIA 4JR3A 2WTWA 3HP2A 3IS5A 4M69A 4RQKA 5CS6A 4APPA 1Y8GA 4MH7A 1ZRZA 3PG1A 4PDPA 4EQMA 5CF5A 3F2AA 3TUDA 3L9NA 3Q9YA 4FEVA 4TL0A 2PVYA 3F3TA 5CT7A 3FZSA 5AP3A 4IWOA 3R7IA 5M55A 1O6LA 3TUCA 4B8MA 2I0EA 4W8DA 2YABA 4I5HA 3GUBA 5JFXA 1ZMVA 3KULB 3NNVA 1SNXA 4C3FA 5KCVA 3CP9A 4AT3A 4KKHA 3NSZA 3MW1A 4D58A 5T68A 3JVRA 2OFVA 2Y4IC 4M3QA 3P0MA 5J7HA 2YAKA 5CEQA 3SRVA 4DFZE 3P79A 4GT3A 1YOMA 4BHNA 4NM3A 2LGCA 4CTBA 2VTSA 4I22A 4UMRA 4PNIA 4QTDA 2QOIA 2XUUA 5FXQA 3UQGA 4LV5A 3MN3A 4CLIA 5FQDC 4F6SA 3V5LA 5BPYA 3PDTA 4K33A 5LVLA 4JXFA 5DPVA 3TIZA 4F1TA 4OTGA 3V5WA 4CG9A 3NDMA 2BTSA 4C4HA 5CEMA 4GCJA 1YWNA 5EQPA 5CASA 2NRYA 2V7OA 4RZWA 4I0RA 2XS0A 4ZY6A 4F99A 3VS6A 4XX9A 2PULA 2XB7A 2YM7A 5I3OA 3SHEA 3NUYA 4K6ZA 4ZTLA 4NTTA 1JKSA 3MH3A 2PUPA 5DWRA 5HTIA 2JLDA 1U4DA 4BBEA 4C62A 5M4FA 2ZYBA 4RA5A 4YLJA 1B39A 4A9RA 4IFGA 4AGUA 4UX9A 4IAAA 5DRBA 2OI4X 2E9OA 2YWVA 3TXOA 3UOLA 2OKRA 2R2PA 2HELA 3KVWA 3I0QA 4YHTA 3I60A 3DB8A 3BYOA 4FV4A 4EK4A 2B9FA 1CKIA 2VO3A 3EN6A 4BCMA 4YR8A 3UIUA 2IW8A 4TN6A 3KMUA 3GB2A 4YHFA 3WF7A 4QMMA 3Q9WA 2JIVA 2R0IA 2W1HA 3LVPA 3HA6A 4CV8A 3MH1A 1JNKA 1GZNA 3U6HA 5G1XA 4OAUC 4BDDA 4C02A 3V01A 4ACCA 2C6MA 3HA8A 1Z5MA 1P4FA 3VS5A 3R8ZA 3OUNB 3PY1A 3RZBA 5CVGA 3OC1A 3A8XA 2C0OA 4ONAA 4ZMEA 5H3QA 4QPAA 5LVOA 4FTUA 4I4FA 4W4VA 2UZEA 2YDJA 1W8CA 3KRWA 4EONA 5HO8A 4KIKA 4CVAA 2BR1A 3I4BA 1BYGA 4P90A 2VTJA 3LXNA 3D7ZA 5AV2A 5J95A 4ITJA 3RPYA 4F0GA 4OR5A 5ANKA 1OIRA 3PLSA 3Q5IA 3C0IA 4GV1A 1PMNA 4RC3A 3V8TA 4JDJA 4IC7A 5TO8A 5M09A 1Y57A 4EOIA 3UC3A 4Q2AA 3WZEA 3FSKA 2GNIA 2XBJA 1KWPA 3D94A 3DB6A 3COKA 3KMMA 3QUPA 2AUHA 3LFAA 5HCZA 1KE6A 3WBLA 2W1FA 2G15A 3UE4A 4ZZNA 1NA7A 4ANBA 5KHWA 3HLLA 2UW8A 2JFLA 3GEQA 4IC8A 3DKCA 2ERKA 2REIA 2VTHA 1J3HA 4EKKA 4YZDA 2OF4A 5LVPA 3RKBA 2J0IA 5F95A 2QURA 3ENHA 3TDVA 4O83A 1WMKA 4FIGA 4U0IA 5FWKK 3V5QA 5KBRA 2BIYA 3CPBA 2C4GA 2VGOA 4KSPA 4I94A 4YPSA 4WT6A 4EUUA 2BHEA 3UZPA 4OBPA 2RFDA 2ZOQA 4BB4A 1M2PA 1ZMUA 2EU9A 2J50A 5IKWA 4EC8A 1J7UA 3L8PA 2XBAA 4H36A 3R0TA 5EI6A 3VNTA 4C2WA 2X9EA 3AQVA 3A7GA 4M8TA 4NIFB 2WMTA 2XH5A 3UOKA 4E20A 4EHZA 2YIXA 2OLCA 4WO5A 4JOAA 5AWMA 2XNNA 3OOMA 1DM2A 2ITNA 3GC8A 3MJ1A 4OW8A 3BIZA 5DOSA 2GFCA 1J7IA 3G15A 5FP6A 1LPUA 3HL7A 5ANOA 1BI7A 4AAAA 3BLQA 2QOLA 3DBFA 3PA3A 3FC1X 1J1BA 4DFLA 4FTMA 4LGDA 4DH5A 4EYJA 5J7BA 3COIA 2XM8A 4KD1A 5DA3A 4AGWA 3KC3A 4PMSA 5DBXA 4YZBA 4CMTA 3ZUTA 2QI8A 2WOTA 4L44A 4L43A 4YO6A 3AMYA 5GJGA 3M42A 4C7TA 1FPUA 3LFSA 3GXLA 3BU6A 4MQ2A 1OKVA 3GENA 4M15A 4BTFA 3EN9A 4FX3A 5HE0A 4ALWA 2WQNA 3PFQA 2XM9A 4TT7A 3DNEA 1YVJA 3R9RA 3W8QA 4FG9A 1Q8YA 5AP2A 2W4OA 2XKDA 3NCGA 1H1WA 3EH9A 3ITZA 3D4QA 4J1RA 4TZRA 1LEWA 3TV4A 1WFCA 3ULZA 2BRGA 4NH1A 2JIIA 5AV4A 2WHBA 5GJDA 3IPHA 4FV5A 3LQ5A 4JVGA 4O0WA 5IZFA 3S4QA 4U9AA 2QOKA 5JGAA 5I9VA 2CPKE 4WNOA 5CAPA 3BCEA 2ZAZA 4ASZA 2W7XA 2Y6MA 2P55A 2UW4A 2XIZA 5C8MA 4ERWA 3VC4A 3C1XA 1KE9A 3BRBA 3FC2A 3OTUA 4QQJA 2YAAA 2Z2WA 1PW2A 2J0JA 2R3HA 2Y4PA 3QAME 3FMEA 4NFMA 5FD2A 1APME 2ITYA 2ITUA 3QFVA 5CY3A 5KNJA 3FLZA 3PWDA 4FSMA 5BUEA 4MNFA 4B0GA 5KO1A 3G51A 4JLCA 3C50A 2E9UA 2PVKA 4E5AX 3G90X 3IDBA 4D28A 4FVRA 5J9ZA 4KNBA 3IW8A 5CSVA 4U6RA 3HECA 5BVOA 5C03A 3EZVA 5IQEA 4PQNA 4QD6A 3SQQA 1PXNA 5AMNA 2VTLA 1YKRA 3R83A 5IA4A 2UW6A 2WMXA 5HG8A 5LVMA 1ND4A 3VUDA 2VWYA 3GQLA 1Q8ZA 1OUYA 4FYNA 1J1CA 4V01A 1MRYA 2UW9A 5EDPA 3UDBA 1E1XA 2ZM4A 3QTRA 3OT3A 4EI4A 3UP2A 4IE9A 3CGOA 3GGFA 1ERKA 2QO2A 4DT8A 5D41A 3QKKA 4F4PA 3QCQA 4XMOA 4DTKA 2BDWA 3VBTA 4USDA 2RL5A 3Q52A 2HIWA 1ZYSA 4U45A 5CSXA 3PXYA 1BI8A 1JVPP 4UBAA 2SRCA 4CFMA 4I4EA 1PXLA 2YDIA 3UVRA 3D5VA 3QCXA 4FKWA 5E8UA 2H34A 2OGVA 4IADA 2AC5A 2VO0A 4N0SA 2LAVA 4G3GA 3KXZA 5A4TA 2RFNA 2JITA 4IVBA 2QVSE 1ZWSA 4GJ3A 4ZP5A 4BRXA 5AUYA 3P86A 4E4XA 3D15A 3OWJA 4F7SA 3I6UA 3LMGA 1JOWB 4TTHB 2BRHA 2WEVA 1O6YA 4BDFA 3KQ7A 4N70A 4NJDA 3QC9A 4X3FA 5HGIA 5KKRC 4PL4A 2C69A 2X8DA 2W4KA 3HRFA 3QKLA 1WBSA 4A9TA 4D4YA 4U41A 4RWIA 5EM7A 5IUGA 2I7QA 3WARA 4GMYA 4BDAA 5L8LA 3FMKA 2QU5A 5H8GA 2IZUA 4LOQA 1KV1A 5HU9A 1YHVA 1XH6A 4O6LA 4AG8A 4DEAA 2PVJA 4ENYA 2JDVA 4NW6A 4Z3VA 2NRUA 3FLYA 4IAFA 4MXAA 4ZOGA 2C6TA 3QC4A 3ZTXA 4USFA 4S31A 1FOTA 3HMIA 4QMQA 2OJIA 4MCVA 4EOMA 4RBLA 4CXAA 1P2AA 3KF4A 3VBXA 4LUEA 4AW1A 3VS2A 1Z9XA 4AN3A 4L3PA 4AZFA 4HGLA 3ZXTA 2WIHA 2W9ZB 3EQIA 1S9JA 4FT9A 1U59A 3EL8A 2CKEA 3ZDIA 4E6CA 4J95A 1XKKA 1XR1A 2G2FA 3ODYX 4BCKA 4R3PA 2C3JA 3GU6A 3P78A 3CBLA 4FIJA 3F88A 5EOBA 5KMNA 3MGYA 3WYXA 2XIXA 3I7CA 5ANEA 4CFXA 4CLJA 1H00A 1WCCA 3E7VA 3OBJA 3R7VA 4J8NA 3DDPA 3FQHA 4WSQA 3PA5A 1KUTA 2XK6A 1P5EA 4GG5A 3LCSA 4FG8A 1W84A 3MESA 1V0PA 4P5ZA 4QMWA 2PSQA 4W4YA 5AP0A 4TNDA 4N6ZA 5DEYA 2BRNA 3SVVA 4EOSA 3ZM4A 5EHLA 4R78A 1FBNA 3NRMA 4GYIA 2CNVA 2XVDA 3E8DA 4F7LA 5I9YA 2RG6A 2FSMX 2XKCA 5K4JA 1DAYA 5KMJA 4BCPA 3FUPA 4BKJA 3TACA 4EH2A 5BUJA 4JT3A 4CFFA 4OLIA 3D7TB 3QHRA 3ZBXA 2BZHB 1BUHA 1GJOA 2WU6A 4EHEA 2QQ7A 1OB3A 1YXTA 4UN0C 1A06A 1PYEA 5ETCA 2PTKA 4IJ9A 1ZAOA 3CEKA 4FL2A 4WKQA 3SOAA 2X7GA 4DFXE 1G8SA 3FJQE 3UGCA 5AR4A 2CJMA 3LFEA 1F3MC 3GCVA 2JDOA 4I0SA 2WAJA 3PZEA 5FTOA 5CF6A 5ACBC 2EXCX 3LCTA 2PMLX 4GFOA 3OEFX 3UO5A 1JKKA 2WGJA 4H3BA 4Z9LA 3VS4A 4PY1A 3R9OA 1IA8A 4Q5HA 4Z7GA 4G3EA 4CKJA 5JSMA 5CAQA 3F2NA 4J99A 2C6DA 2W05A 4IDVA 5IMXA 5CXZA 4XHKB 2F2UA 1YI6A 4E8AA 3ERKA 3P4KA 4FK3A 1ZXEA 4RX7A 5K0KA 3R8UA 4CRSA 4EH6A 2ITTA 2OJGA 3RK5A 2J6MA 5LMAA 2I6LA 5A46A 2FSLX 4C4JA 2ZJWA 1YOJA 3QX2A 1J7LA 4DFBA 2VWWA 2EUFB 4E5WA 1B38A 5LJJA 3L1SA 4FSTA 4MK0A 4IANA 4DAWA 3GBZA 3VS0A 5J1VA 3PUPA 4UY9A 3NIEA 4O7TA 4Y83A 4YJUA 4C38A 3NUAA 4Y5QA 1VZOA 3NNUA 1ZYDA 3PRFA 3LCKA 4IB0A 2J2IB 3FY0A 4WG3A 3VS1A 5CLPA 5DT4A 2XNEA 4LMNA 4FZDB 5CI6A 3BLRA 5TE0A 4I3ZA 4AA5A 5F20A 4B6LA 4XLIA 1HCLA 4PPAA 3ZM9A 1OI9A 2V7AA 4HZRA 4NWMA 2GQGA 3QRUA 1QPDA 3QD3A 3RP9A 4E3CA 4JJRA 3DNDA 5HLPA 3MVHA 3R8LA 4AWIA 4F65A 1R0EA 4FVPA 4LOOA 1IR3A 3CY3A 1GIIA 4E6DA 3VUMA 3RMFA 4ALUA 5DLSA 3REPA 1A48A 1GIJA 2O8YA 3I5ZA 3ZLSA 1V1KA 5I4NA 3F5UA 2XK3A 1OGUA 4I6QA 2WTKB 3PVBA 1H1RA 4P2KA 2W0JA 5JRSA 5HBJA 5AADA 2ZM3A 4I41A 3CPCA 4ZS0A 5AX9A 3MWUA 4RIWA 2VRXA 2UZNA 4EOPA 2QONA 4N6YA 4UYNA 5HG7A 1PXKA 5EM8A 3GOPA 3OCGA 3EN7A 3FQSA 4OTDA 1U54B 3Q53A 2YLFA 3BELA 3QA0A 3VHEA 3NCZA 3U4UA 2A1AB 4ZTNA 3MVMA 2B54A 2IN6A 4M0ZA 3PJCA 4Y8DA 4EK3A 1X8BA 2OF2A 3AG9A 5FEDA 3UQCA 2CGUA 1CDKA 4DH3A 5IPJA 3PE1A 3DFAA 3VAPA 5CNOA 4JQEA 3HMOA 4BDEA 3QXPA 3PVGA 2QOOA 3R9NA 1Z57A 4BTJA 3KEXA 4CMUA 4FEXA 1PXIA 4O2PA 4NJ3A 3FKNA 5BYZA 4IHPA 4AA0A 1ZOGA 2Y8OA 1VYZA 3F7ZA 3VBVA 3DBCA 1R1WA 2E2BA 3OBGA 4JNWA 4IVAA 5KMMA 4FIEA 4KBKA 3BEAA 3C0HA 3TZ7A 2R3FA 2C30A 3OXIA 3ZO1A 3OEZA 4FKTA 5JMSA 3U87A 4F7JA 3QCSA 1WZYA 4J7BA 4W8EA 4A9SA 5JZJA 4NYEA 4BCNA 4BR3A 2C68A 3F6XA 3NR9A 2PZRA 2IW6A 4EH3A 3JY0A 4Y85A 4EWHA 4KINA 5FTQA 5CU4A 4EK5A 3TNQB 2PUIA 4BCFA 4TWCA 3WZJA 4DA5A 5B0XA 4C36A 5BMMA 2CDZA 3OG7A 4C4EA 2ZDTA 5AM6A 3WE8A 1HOWA 1UU8A 3KK8A 4C59A 3R7EA 3WILA 2J5FA 1M2RA 2QG5A 3WOWA 5CX9A 4BI1A 4HVSA 4F9AA 4LMUA 5AA8A 4MWHA 1QPCA 2PE2A 4H3QA 4XBRA 3FBVA 4G17A 4ANSA 3UOJA 4FZ7A 4KIQA 2X1NA 3QRJA 2W1DA 2RIOA 2X39A 2BROA 5LCJA 3CJFA 4FT0A 4WUNA 4ANOA 1JLUE 3N9XA 1K9AA 4AZTA 3SA0A 2FA2A 3FWQA 3Q4CA 1W98A 3IDPA 1QMZA 2V0DA 2VX3A 2W1ZA 3ZEPA 4FNYA 4L6QA 2C6EA 5HVJA 3VJOA 4G9CA 4Z55A 5K5XA 1QPJA 3GC7A 3BWFA 5KZ0A 1REJA 3C4FA 5L2WA 2WXVA 3F3UA 4BCJA 4YTCA 4O7YA 2QLQA 4ACMA 3WE4A 3Q5ZA 4JQ8A 4BN1A 1K2PA 2OZOA 3MB6A 5AR8A 3A8WA 4QYGA 4FTIA 1OECA 1Q8TA 2QKRA 3W18A 4HCTA 3HMMA 4U3YA 2CGXA 1OL5A 4GFGA 4I1ZA 4TWOA 3P1AA 4G16A 4YZCA 3OP5A 4ACGA 5FEQA 4L8MA 2HZ0A 4K0YA 5CANA 1UA2A 2WB8A 4FV7A 2H6DA 4O0SA 5EDRA 3HMNA 2FGIA 4ZEGA 3QCYA 3ZMMA 2GQRA 1I44A 1CTPE 1CMKE 3OF0A 4IVDA 5HE3A 4D55A 4M13A 5D7AA 2VO6A 5B2KA 4TYHA 3UBDA 3VF9A 4DEGA 1ATPE 1PMVA 3EFJA 3P08A 2C5NA 4BI2A 4NL0A 2YM3A 4BDBA 4J53A 4RWLA 3UQFA 4IXPA 3VULA 4TYEA 4F9YA 4FEQA 4C0TA 4RWJA 3VRYA 4U81A 4CQEA 4IBMA 4FTLA 5HG9A 4E93A 3R7GA 5IQDA 5M08A 3K54A 4X3JA 2PZ5A 4DEHA 3DQXA 3ZOSA 5LARA 2ITWA 4O7WA 2QCSA 5CYIA 2UVZA 4Y95A 3MY1A 4RVKA 3UMXA 1OL7A 2OWBA 3LM5A 3H30A 1H8FA 4C8BA 3VBYA 3KF7A 5IUHA 3U9NA 5HU3A 5JEBA 5K4IA 2RKUA 4OTWA 3ZUUA 1SZMA 3OTVA 4U97A 2ITXA 3HV6A 3JXWA 4IWDA 5E8WA 1KV2A 4HCUA 3QRTA 2IVSA 2XJ0A 2OH0E 4XG9A 3FI4A 3QF9A 2PE1A 3PJ3A 4J52A 5A4LA 4G1WA 5EYDA 3EZRA 2BRBA 4FSWA 1URCA
chains in the Genus database with same CATH superfamily
4PF4A 4RC2A 4BZDA 3O8PA 4JIKA 5CALA 3HV3A 3RPSA 4EZ5A 4FSUA 4RGJA 4HW7A 2GU8A 4K9YA 4CYJA 2ZV9A 1IAJA 4EH8A 3MA3A 3BHYA 2F49A 4GU9A 4R3CA 4S2ZA 4D5KA 4FEWA 2VGPA 5FBNC 1WAKA 5J1WA 3WF5A 4O22A 4XV2A 1WBPA 3UDSA 4YJRA 4C34A 4FI1A 2B9IA 3HP5A 4TXCA 2QLUA 3GU7A 4EK8A 1H4LA 1MRVA 3R63A 3ORLA 4QNYA 4YSMA 4DBNA 4YBJA 2EB2A 4FOBA 1CKJA 3EFLA 4YC6A 1OL1A 2HWPA 4QMSA 4U40A 4ZY5A 1OBDA 4D2TA 4XP2A 1Q4LA 4QYYA 2YWPA 4D1SA 3DKGA 4AT4A 2XYUA 3CS9A 5D12A 2C5XA 2C6LA 3FI2A 4O7ZA 4QTBA 3EN5A 3N4UA 3IGOA 4MWIA 1WBTA 2CN5A 2WTVA 3SV0A 4KB8A 4K18A 4G3DA 3HYHA 4D0XA 4K1BA 4QMLA 2VU3A 1H08A 5ANGA 2YHVA 4ORKA 3BYVA 3FLQA 4WA9A 4YJPA 4MX9A 5AIRA 3UC4A 4O4CA 3ORXA 5DR9A 1OL2A 3A2CA 3AGMA 4RPVA 4YZNA 2P33A 3AT4A 3N51A 3U8WA 4CFNA 3LMHA 3RAIA 4CZTA 3PSDA 4LV7A 5DYJA 3II5A 2WMSA 3NVMB 4PL5A 2C5YA 2ZM1A 3MY5A 4ZXTA 2KULA 5CNNA 3S1HA 2J0MB 2C3IB 3DFCB 2CNQA 5J9LA 4JMQA 4AU8A 3C5IA 5M56A 5L6WL 2VTIA 3JUHA 4ZTRA 2PVHA 1CSNA 2YIQA 5HOAA 4ZTSA 4R1YA 3ZU7A 2CKPA 4EUTA 2WU7A 3UMWA 2HOGA 5M06A 4FKPA 1URWA 3EYGA 2QNJA 2GS2A 3NWWA 4FSQA 4OBOA 5IUIA 5K5NA 2VTRA 3G9LX 5M07A 5HBEA 2V22A 3DBDA 3MFRA 4GIIA 4K77A 4QP2A 2XIRA 4U43A 3UPXA 3LKMA 1PXJA 4EORA 3KRJA 2I0HA 5M4IA 5IQBA 3MH0A 1Q99A 3K2LA 2WZJA 3O71A 4D2SA 2WNTA 3E64A 5DI1A 4XRJA 3TV6A 3MBLA 2WTJA 5IG1A 2Q0NA 4IZAA 3FXXA 2OXDA 2UZDA 2ONLC 4F70A 4CKRA 4D4SA 4F64A 4C3PA 5GNKA 3ZXZA 4FSYA 4EHGA 4O4FA 3Q6UA 5E90A 5TR6A 3QTZA 4JX3A 3A60A 3BLHA 3PY0A 3PVUA 4GH2A 1YOLA 2B7AA 4O86A 1OM1A 1Y6BA 5ETAA 2VTTA 1UNGA 4DGNA 4EJNA 1UVRA 3PP1A 2HXQA 5AUVA 2QO9A 3DT1A 5DFPA 4BIDA 2ZV7A 3QQFA 3VONA 4D9TA 1M17A 2RFSA 4MNEA 3P5KA 1BKXA 3UDZA 4R8QA 4OTIA 3EKNA 3NAXA 4G5JA 4BBFA 3AMBA 5C26A 2R3IA 3R7YA 2VNYA 5GZ8A 2GTNA 2ZB0A 4YP8A 3LXPA 4M66A 3VS7A 4G34A 4MXYA 4FV2A 3GQIA 4DC2A 2R3MA 4DH7A 2YISA 4G6LA 3SD0A 3JYAA 1OPLA 1SMHA 3COHA 1YHSA 3OZ6A 3EFKA 2B55A 5AP7A 1V0BA 4BI0A 1KE5A 3FMJA 4O4BB 3ZSHA 4OTPA 5BX0A 1O9UA 2QODA 1MUOA 3H10A 1H24A 3IW4A 3D14A 4IM2A 4BIBA 3M11A 3FPMA 4J98A 3RK9A 2GHGA 4WNMA 2UW7A 2IZRA 3W10A 2AQXA 2OK1A 3ORMA 4YC8A 3ZBFA 1IG1A 3RVGA 5IH6A 3UZRA 3AT3A 4AF3A 4ZJIA 2IO6A 4CT1A 4BBMA 3GOKA 3BBWA 3PVWA 5KUPA 5HCXA 1LP4A 2YIRA 4GSBA 3ZRKA 2XALA 1BX6A 5ANJA 4RLKA 5ANDA 4EBVA 3T9IA 1XHAA 1G5SA 4YMJA 5A9UA 3K5UA 5DN3A 3SDJA 3PSBA 3S2PA 4B4LA 3C4ZA 2X2KA 3L9MA 4MXCA 4HVGA 4YJTA 5BUIA 3FI8A 3QZIA 2NP8A 3KK9A 4M12A 4GG7A 3DJ5A 2R3PA 4DTAA 4R1VA 3LXKA 3MA6A 4RLLA 4P4CA 1H0WA 3AC1A 5JGDA 3HUBA 3V5JA 2X7FA 4O4DA 3MTLA 5AV0A 3DAEA 5GHVA 5IISA 4XUFA 4O7LA 2Y6OA 2YM5A 4R3RA 5A6NA 1M7NA 3O8TA 3DS6A 5HESA 4DEBA 2QOFA 5ETFA 4HOKA 1UU7A 2C3LA 2Z8CA 2C6KA 4NM7A 4KIKB 3P7CA 2GDOA 2Y7JA 3FLWA 2VV9A 5EW3A 2CLQA 3NZ0A 3WZKA 1KOAA 2WQOA 3UO4A 3FEGA 3E8CA 2ERZE 3D0EA 3OHTA 4RVLA 4K2RA 4YC3A 3PXKA 5F4NA 2XK8A 5FP5A 5EHYA 2QU6A 4L7FA 5LWNA 3W0SA 2VAGA 3L9LA 3THBA 4KIPA 3BGPA 4XCUA 5CQWA 1B6CB 4QP8A 3TJDA 2WMUA 5LMKC 4C33A 4K8AA 2BRMA 3PE2A 2GNGA 3EQBA 4ZAUA 2BPMA 3ORNA 4P5QA 3CTHA 3OVVA 4RVTA 3DZOA 4ALVA 5CWZA 2ITQA 3GNIB 5GZAA 4CG8A 4IWPA 3LJ0A 4ZZMA 2W99B 4IX5A 2ITOA 3R73A 4BDGA 4BDHA 3ROYA 1NVSA 4FVQA 2BZKB 3GCQA 4HZSA 5IA1A 4YSJA 5CVFA 4CRLA 5BMSA 5L2QA 3IQ7A 4IB5A 1OKYA 3O0GA 3FQEA 4A06A 3D5UA 2GNJA 2GNLA 1I09A 4GUEA 4KKGA 2RGPA 3AC3A 3FZRA 2NPQA 4QMZA 3C5UA 3QWJA 2PU8A 3DBEA 3TZMA 2Z7SA 5DIAA 5AP6A 2UW3A 5AUZA 2OXXA 3E88A 4YJNA 2FSOX 4KA3A 2FO0A 3ZFMA 4W9XA 2CKQA 3LAUA 3PPKA 4FSRA 3A4OX 4JG7A 4ASXA 4BCHA 3GU8A 1NY3A 4MAOA 4B8LA 2VWIA 4MEDA 4GUBA 3V3VA 2PZYA 4GVJA 4O4EA 4CQGA 2ZMCA 4FT3A 3QYZA 3NEWA 4MTAA 2R3OA 3FZOA 1TQIA 3HDNA 4X2NA 3W32A 4BC6A 3G5DA 4E1ZA 3VUHA 3ZEWA 1DI8A 2YITA 2P4IA 3E62A 3GC9A 2VX1A 4IWQA 5EW9A 1R78A 3AOXA 3FAAA 3PTGA 3ZS5A 5KKRB 3ZLYA 2HWOA 2VNWA 2WMQA 2QD9A 4V0GB 2W17A 3EOCA 3SRVB 4F1OA 5ICPA 4WNKA 2HENA 2VUWA 2C5VA 3LW0A 4BVUA 2XAOA 4N57A 1YI4A 1ZYCA 2YM8A 4C35A 4DYMA 1TQMA 2YCQA 4R5YA 1OPJA 2Y9QA 4DH8A 4WRGA 5J79A 3DXPA 4M14A 4QP6A 4YHJA 2YIYA 3FI3A 5C01A 4WRSA 4IX4A 3BHTA 2PVRA 2XCKA 2YCRA 1ZY5A 2J4ZA 3FZPA 3G2FA 3RZFA 3PSCA 1YDSE 4FTRA 1JQHA 3K5VA 1JPAA 3W2CA 5AJQA 2GHMA 5JRQA 1UV5A 3WF9A 5AR2A 3PIYA 4K11A 5AP1A 4P7EA 5HD7A 1Q61A 4GK4A 2B9JA 4M69B 5J9YA 1PXOA 3LMIA 3UZTA 3EQDA 1ZOEA 2P2IA 4E7WA 2YEXA 3H0YA 5IQHA 4NFNA 1HCKA 2WMVA 2P3GX 3U51A 3AC4A 3FKLA 2R3NA 4AS0A 5EI8A 4DG2E 3UOHA 4H1JA 3C7QA 5EYKA 3C4EA 3PLAE 4UXLA 4GRBA 3CY2A 2JD5A 3BGQA 2G2HA 5AP4A 3V5TA 4FV0A 5A6OA 4O0UA 4XG7A 5HD4A 4FEUA 2PMNX 4BGGA 1XH8A 2EWAA 4FUYA 5HKMA 4F0FA 5L2IA 5CU3A 3DK3A 4E73A 1NT2A 3AXWA 3MJ2A 2FSTX 3VUTA 4X0MA 3CQEA 4WSYA 3BE9A 2W9FB 2BAJA 4O1PA 3ZLWA 4BDJA 3G33A 4M97A 2BZIB 4QO9A 4TRLA 4AQCA 3BI6A 3F61A 3BYUA 3GP0A 2WTDA 4CYIA 2GFSA 2XK9A 3LFCA 4NKAA 4ZLOA 5HLNA 4YURA 2J5EA 3U54A 4LL5A 3TNWA 3UG1A 3IGGA 3PA4A 5K0XA 1EH4A 5CI7A 4FZFB 4F9BA 2PPQA 3F2RA 3PP0A 1YXVA 4BDIA 3QZGA 1RQQA 4RJ5A 4ZIMA 4EBWA 3VJNA 4O82A 5HBHA 4IMYA 4DBXA 1OKWA 4BCIA 2VTMA 2XCHA 3DJ7A 2XEYA 3EQCA 3NMUF 4IB3A 4BWKA 2GNHA 4IAYA 4D2VA 2IPXA 3SX9A 3KL8A 3V6SA 3R7OA 4CMOA 3Q04A 4ACDA 2HZNA 4IZ5A 4O27B 3TTJA 4I23A 4A4XA 5JFSA 3D5WA 3F82A 4E4MA 5EYCA 1RDQE 3BQRA 2OH4A 2I1MA 3DDQA 5JQ8A 4DGLC 2OIQA 4LOPA 4IJPA 5LOHA 2VTPA 5M44A 4FKJA 1LEZA 3W55A 4FZAB 1XBBA 4F09A 1YWVA 2CLXA 4NM5A 3KMWA 2A4LA 1WBWA 5DR2A 3W2QA 3ML1A 1Y91A 4JG6A 3BPRA 2Z02A 3A7FA 1UNHA 4RFYA 4UYAA 2X0GA 2XARA 4L68A 4KUJA 2WMWA 4U79A 3TTIA 1YDRE 4PMTA 4EOJA 3ODZX 1YXXA 4EJ7A 3PJ1A 2R5TA 3OXZA 2UZUE 4TNBA 3EL7A 4CZYB 5DRDA 5ITAA 3MIYA 3W0RA 2HY81 2B9HA 2HK5A 2X9FA 3QA8A 3Q96A 5FLFA 5C1QB 4G5PA 2JDTA 2W4JA 3KFAA 4PP9A 4O81A 4JRVA 3CIKA 1SNUA 2OW3A 2JEDA 2VZ6A 1WBOA 1NXKA 1W2CA 3CTJA 1ZZ2A 3G9NA 2F4JA 3PJ8A 4XYFA 1R0PA 2J9MA 3HKOA 3KRLA 4H1MA 4JR7A 2QG7A 4GW8A 3GU5A 3TNIA 3ALOA 3FLNC 3L8SA 4FV1A 2R7BA 2XKFA 4L52A 2XIKA 3F69A 3NUNA 4O0XA 4UMPA 3OROA 5GZ9A 3S0OA 5C8NA 4AZEA 5FDPA 4F9WA 3ZRLA 4LQMA 3UP7A 3BHHA 4FJVA 4PRJA 5H8EA 5HO6A 3NW5A 5A54A 1CM8A 3RM7A 4KRDA 3BGZA 3RPVA 5BYYA 1Q8UA 4ZLZA 3RAHA 3DKFA 3IW7A 2GTMA 3DGKA 3R9HA 4YNEA 4ZTQA 3KU2A 4UEUA 1ZMWA 2C0IA 3DY7A 5CVHA 1AD5A 4IZYA 2ESMA 3EQFA 2XNBA 5G6VA 2F2CB 3DAKA 3MS9A 4WUAA 4X2FA 1JBPE 1P14A 3NW7A 1LUFA 4FRFA 3AMAA 4H58A 4I6HA 4OTFA 2X8EA 3FHRA 4E6AA 5HX8A 5F94A 1YDTE 3E7OA 3ZZWA 4JAJA 2R4BA 5KMIA 3QD2B 4MXZA 3ORKA 1UWHA 4PDOA 4FV8A 2X4FA 3H9FA 3MFTA 3OS3A 1NVRA 4R7HA 1GAGA 4FKLA 4AOJA 4O84A 4QDEA 2HW7A 3LM0A 2QOQA 4GS6A 4UWBA 2ITZA 3HX4A 4OBQA 1PMUA 1U5QA 3N4TA 3QRIA 4S30A 3R1SA 3FMNA 1VEBA 4FKGA 4PTGA 4YJSA 4X21A 4BKZA 4O0VA 4G6NA 2CGWA 4RVMA 4RMZA 2WTCA 5CU0A 1DS5A 3UTOA 4BCGA 5IMEA 5E8TA 4U42A 4KWPA 5BVFA 2R3KA 4CFWA 3SKCA 3IECA 2ITVA 4IH8A 5K3YA 1UU9A 2R64A 3F5GA 1QL6A 4RIOA 3GU4A 4ZSLA 3O8UA 4C4GA 5JQ5A 1RW8A 5EYMA 3RWQA 5CF8A 3VBWA 1PMEA 4RIWB 2BTRA 3QQJA 4IIRA 3KY2A 1XJDA 1G3NA 2UZWE 4CFVA 3E63A 1JWHA 5B7VA 4H05A 3W2SA 4F6UA 5KHXA 4C37A 2CNUA 1SVGA 2Z7QA 5T3QA 4YZ9A 4AN2A 4D9UA 2YERA 4GVAA 4PDYA 3KXHA 3DK6A 5DEWA 3F5XA 5AV1A 4Q9ZA 4FKRA 3E8EA 3QLGA 5CSPA 3TKUA 2B52A 4AXEA 4AT5A 3BV2A 5JFVA 2YN8A 3JVSA 3UIMA 4EOOA 5FTGA 2CCHA 4RIYB 1WBNA 3QQUA 4FTAA 3CGFA 3WF6A 5FDXA 1XO2B 3RAWA 1FGKA 4X6QC 3ZO2A 4RX5A 5LVNA 3BBTB 5CEKA 5E9EA 3ZDUA 3W2RA 1WVXA 4MF1A 3W16A 4EOQA 2YFXA 3DTCA 3ZFYA 4DITA 5HE1A 4UALA 5H8BA 2B1PA 3CR0A 2BFXA 3NAYA 4JQ7A 4UZHA 4BFMA 1Q3DA 3QTSA 4TPTA 5E8SA 4QP1A 3TL8A 3GVUA 4I24A 3KN6A 3RPOA 3QUEA 1MQBA 3R6XA 1CKPA 4L7SA 2YA9A 2OU7A 5D7VA 3SLSA 5LMBA 3W0PA 1REKA 4L42A 4AZSA 2C6IA 2X4ZA 2IWIA 3AD5A 2PHKA 4O38A 4JDHA 3IK3A 4Y5HA 5CQUA 4OAVB 4DCAA 3QQGA 2JDSA 4L53A 3V8SA 4YO4A 3R71A 4A9YA 1WVYA 3VN9A 3LXLA 3FKOA 4NT4A 5E4HA 4ID7A 4FL1A 1UU3A 2JBPA 3GCSA 4PP7A 3DPKA 4DFUA 3KGAA 1XH7A 4PL3A 1H0VA 3OW4A 4MD8E 4AOTA 2YZLA 3RBWA 1YQJA 3FE3A 4CTCA 2JDRA 4BGQA 5GINE 4OGRA 5A3XA 4DHFA 4ZSGA 4CCBA 4TYIA 4FTJA 4Y46A 2JGZA 2WQMA 5CSWA 4KKEA 2CN8A 2UZLA 1RJBA 4AACA 2CKOA 4QP9A 2Y0AA 4XEYA 1Q3WA 4NUSA 3DAJA 3AC8A 3P7BA 4FODA 3LJ1A 4TY1A 2W5HA 3ZONA 1V0OA 4S33A 1S9IA 1QCFA 3CSVA 4M84A 3LLTA 4FA2A 1KOBA 3IKAA 4AFEA 5EQEA 5IQCA 1H26A 2X6EA 3D5XA 2XJ1A 4FTTA 3BYMA 3NUXA 2V55A 5GIPE 3ACJA 4U80A 1U46A 4FTOA 2PMOX 4BJJA 2Z7RA 2FVDA 4FZ6A 5CU2A 4GFMA 4FMQA 1KE8A 3KKVA 4FTCA 4X6RA 4O6EA 3R02A 4D2WA 3SXRA 4MD7E 3DU8A 2HZ4A 3I81A 4L3LA 3BEGA 1F5QA 4MBIA 3U6JA 3QUDA 4NM0A 2XEZA 3FZTA 3B2TA 4I21A 3VRZA 2W06A 2OZAA 3I1AA 3WI6A 2QC6A 3VS3A 3C4WA 4O91A 4S34A 1H25A 5IEXA 4ZSJA 3MB7A 1OITA 3FMMA 4DHZA 4MXXA 1KSWA 3F3ZA 5CAOA 2GSFA 3FPQA 2XKEA 4QMUA 4G6OA 3DTWA 2UVYA 3GCPA 3FLSA 5D11A 5CENA 4DFYA 2HZIA 3BWJA 4BYIA 1TQPA 4D5HA 4DN5A 5AUUA 5KX8A 3QWKA 3JS2A 4RZVA 3OOGA 4ANQA 4M7IA 4I93A 3TWJA 5AR3A 4IX6A 3FMHA 3OY3A 3W8LA 2AYPA 3O7LD 3WYYA 5E1EA 2PMIA 3TNHA 3ULIA 4HYSA 2UZVA 1R39A 4FOCA 3LOKA 3SG8A 5KMKA 2NNWB 4QNAA 2BIKB 2JFMA 3JPVA 5D1JA 3RHXA 4DGGA 4EOKA 5L3AA 2FH9A 5EQYA 2YJSA 2BCJA 2OICA 3NNXA 4LGHA 1XQZA 4L46A 5L8JA 3AD4A 4GIHA 3G0FA 3R2YA 4KBCA 4F0IA 3CQWA 4ZZOA 2WQEA 3ELJA 3A99A 4L3JA 4RIYA 4JRNA 3BYSA 3QGYA 2WD1A 4BYJA 5AA9A 4Y73A 4PV0A 2H9VA 4M67A 5IH5A 4AOIA 1FVVA 3ZYAA 3MPAA 5LMKA 2DYLA 1W0XC 5TKDA 4ASEA 4CEGA 3ZLXA 5BVEA 4CT2A 1OGYA 3DLSA 3W0OA 1ZY4A 2BFYA 2XZSA 4FV9A 1SYKA 2HW6A 3R7UA 2PVMA 2E9NA 1IA9A 3COMA 3DXQA 4F63A 2OBJA 5FBOA 4FYOA 3NX8A 2YZAA 4KSQA 4QMTA 2XNGA 5J5TA 3PRIA 1W2FA 3TIYA 3QZHA 1W83A 4BWPA 2G2IA 4KABA 4ZJVA 2PZPA 3CQUA 2R0UA 2E9VA 2DS1A 5I5ZA 4TKSA 2O65A 4NKSA 5LXMA 5C4LA 4RJ8A 4PPCA 4XP3A 2HCKA 5C8KA 3RK7A 3E3BX 3FXWA 3QRKA 4OT6A 5BVKA 4IX3A 2PL0A 3QX4A 4QQ5A 3VHKA 5JFWA 1JAMA 5F1ZA 3O17A 3SG9A 1IRKA 3W1FA 5IQAA 2DQ7X 3Q9XA 3R2BA 4IAKA 4AE6A 4AGDA 2UZOA 1ZYJA 4E4NA 3VVHA 3NFFB 3F66A 3CTQA 3QU0A 2OIDA 3T9TA 2V5QA 4FT5A 4XBUA 2VTQA 4EH7A 5FXRA 3IDCA 3KXXA 4J96A 2EXEA 4DGOA 2WMAA 2Z60A 3E5AA 4HVDA 1VJYA 1ZZLA 4RIXB 4QP4A 3OCBA 4FNXA 5E8VA 5I9ZA 4DTBA 3TUBA 4I5CA 3TMOA 3B8QA 4FKVA 4IAIA 1JSUA 2UZTA 1OUKA 1YWRA 3ORZA 4NIFA 4MQ1A 5EG3A 3GFEA 2GHLA 4M68A 5D9HA 4X7QA 5JT2A 4O7NA 3NYOA 2A2AA 4USEA 4QTAA 3K3JA 2E9PA 3QTUA 5E91A 3F7WA 3EQRA 4RC4A 5IQIA 1XH9A 1ZYLA 3MYGA 1W2DA 4L9IA 2NYAA 2WPAA 4U5JA 2W1CA 5DMZA 4J8MA 1FMKA 1PKDA 3PIXA 1OZ1A 3C9WA 5CSHA 1BMKA 3NYXA 4PNKA 4D2RA 4I5PA 4XP0A 1OMWA 2O64A 2QHMA 2QR8A 2VWUA 3EQPA 4TWNA 4YPDA 3UYSA 4X3FB 1E9HA 3RAKA 3VQHA 1OIYA 4MF0A 4DEIA 3POZA 4QT1A 2UW0A 5HIBA 3DV3A 2W96B 4GT4A 4ZSEA 5IU2A 3HUCA 5KMLA 3I0OA 5EM5A 3CKXA 1NW1A 3OWPA 2XRUA 4RRVA 2VD5A 4PDSA 4U3ZA 5FG8A 2J0LA 5FEEA 2Y4IB 5EOLA 3NNWA 2UUEA 2VWVA 2XIYA 3ANRA 4WHZA 3SOCA 3ZC6A 2QOHA 3AC5A 4XS2A 1SVEA 4II5A 4E6QA 3NVKI 2ZDUA 2H96A 3NLBA 1Q8WA 4W9WA 3MDYA 4RIXA 4XG4A 5IQFA 1DI9A 4FGRA 3BU3A 4CSVA 4EOLA 4IM0A 2CSNA 5H2UA 1PKGA 4XLVA 1NVQA 2C5OA 1ZARA 3PY3A 4GKIA 3BQCA 3QQKA 3WZDA 3CLYA 2R9SA 2BAKA 4APCA 5I9XA 4FTNA 2Z7LA 3IOKA 4NSTA 4NEUA 5JN2A 3VO3A 3TN8A 3ATSA 4XG8A 4HYIA 4UMQA 4AXCA 5H9BA 2BALA 3Q3BA 4CZUA 4FSNA 4PTCA 4FKOA 2OO8X 3EQGA 3FL5A 5HI2A 3A7JA 3HNGA 2VX0A 3MFUA 3UNJA 5HLWA 5BYLA 2OXYA 3BV3A 1BL7A 1TKIA 4MKCA 3D2KA 1FMOE 3QTXA 4ZSAA 5CAUA 4DCEA 5I0BA 4EK6A 2BAQA 3P9JA 4G3FA 4AE9A 4CGAA 4A7CA 4AP7A 5AIKA 3MFSA 4AA4A 2FYSA 3A62A 4WBOA 3IW6A 1G8JA 4L45A 2KTYA 5J5SA 4GEOA 5EH0A 4C57A 1QPEA 3PJ2A 3QALE 4NTSA 4XOZA 2B0QA 4IAZA 2J0KA 5HX6A 1YHWA 2JC6A 5IA0A 4EQUA 1P4OA 3KA0A 4IQ6A 1FINA 5CEOA 2WOUA 1Y8YA 4B7TA 3V04A 2PYWA 4LRMA 4QMYA 1BL6A 5KE0A 3NPCA 3IOPA 3PIZA 3A4PA 3NW6A 3BLAA 2G1TA 4QDVA 4W4XA 1OL6A 4YTFA 2ZV8A 2R7IA 3BX5A 3E92A 4RQVA 5CF4A 4BZNA 4MD9E 1GZ8A 4I6FA 4EH5A 3EN4A 5T6KA 2QOBA 3FMLA 4FSZA 4BY9E 2XNOA 2QHNA 3GT8A 2WFYA 1FVRA 1A9UA 5TF9A 3EYHA 4LI5A 5IA3A 5JK3A 4ERKA 1PHKA 3A61A 4FGBA 4QP3A 5E92A 3FDNA 3MPMA 4RX8A 4WNPA 2ITPA 4QPMA 1UKIA 5L4QA 5BVWA 2R3JA 3LFDA 4O21A 2YM4A 4O0TA 3SAYA 3UYTA 1H1SA 4EL9A 3Q4UA 5HTBA 4O7SA 2G9XA 3W2PA 4DDGA 1XBAA 4G31A 4IFCA 1DAWA 2VTAA 2X0OA 2WO6A 3QBNA 4HYHA 4WG5A 4YBKA 3ZUVA 4JDKA 2C47A 1RE8A 1JKLA 2F7XE 2EVAA 2F57A 3NUSA 4QQCA 2HAKA 3DCVA 3QTIA 1WBVA 3EWHA 1M2QA 3OXTA 2UVXA 1ST4A 2J51A 4WIHA 3JR1A 4E4LA 4BICA 3G6GA 4UWYA 3VW6A 3R30A 2OG8A 4TYJA 5DGZA 4HNFA 2PUNA 3PG3A 3MIAA 4BIEA 2IVVA 4GL9A 4YJVA 5EM6A 3FYJX 4X2GA 2XA4A 1J91A 4R5SA 3UVQA 1U5RA 1TVOA 4CKIA 5BNJA 3ZSIA 2WIPA 1GNGA 3D2IA 5DT3A 5AAFA 3U6IA 1FVTA 5AAEA 5L2TA 3TKIA 2IJMA 4DG3E 5AUTA 4IM3A 3LQ3A 4F6WA 3Q6WA 3QGWA 5KZIA 4FNZA 3R8MA 4R77A 4HPTE 2WMRA 4AN9A 3RHKA 5IQGA 2F7EE 2WELA 3HDMA 1OKZA 5AAGA 3CCNA 3D83A 3FHIA 2RF9A 4HNIA 4YJQA 2C1AA 4UV0A 4KRCA 3V5PA 4NZWB 4G9RA 3UODA 1W7HA 5DG5A 3I6WA 4DT9A 3QHWA 4FKIA 3KRXA 5K9IA 5AM7A 3DK7A 4NCTC 4UMUA 4I5MA 4ZK5A 3SC1A 3TG1A 3H3CA 2PE0A 5E7RA 2HY0A 4YLLA 5B2MA 4TW9A 5BV3A 4GU6A 3ZFXA 2GCDA 3UNZA 5JH6A 5JGBA 2PZIA 4CNHA 4X2KA 4ITIA 3Q4TA 1E1VA 3DJ6A 3I7BA 5AEPA 3PXZA 3OY1A 3O2MA 5HNIX 3A7IA 5IA5A 4JIAA 2VWXA 5M53A 3AKJA 2ONLA 5CU6A 5B2LA 5FM2A 3PXFA 3GI3A 5DNRA 2NO3A 4IDTA 3IONA 2HYYA 3OCSA 3EMGA 5DR6A 3H9RA 1G8KA 4FUXA 2W5AA 4G2FA 4BDKA 3TCPA 5JKGA 3MI9A 2XP2A 2IZSA 4FG7A 5AX3A 5E8YA 1PXPA 3Q2MA 3Q4ZA 4IB1A 4XH6A 5LWMA 3I5NA 4RWKA 4QTEA 2RFEA 4QP7A 4KAOA 4A4OA 2R3QA 3T8OA 5C4KA 2FUMA 3IG7A 3AC2A 3MTFA 3TEIA 4LFIA 2PVFA 4KS8A 4CV9A 3AT2A 3G0EA 5BQ0A 3H4JA 4W4WA 4I0TA 1GOLA 1SM2A 3W2OA 5L2SA 2CCIA 3QTWA 5HIEA 4RSSA 4MBJA 4AGCA 3QZFA 4FTQA 4NK9A 1YXUA 3VW8A 4XJ0A 4D1ZA 4FT7A 3ZO3A 3LJ2A 3TV7A 3R1NA 3A7HA 3AD6A 3ORTA 4MYGA 3ZRMA 3L8VA 2WEIA 4QTCA 3TNPC 2PUUA 2XRWA 4R6VA 5A14A 3LQ8A 4LRKA 1H1PA 2BILB 5IDNA 1H07A 4G3CA 4O7RA 2Q0BA 4GT5A 1LR4A 4OT5A 2IF8A 2QKWB 4PUZA 5ANIA 4O7VA 1G8AA 4XG3A 5HICA 1PF8A 3RCDA 3UPZA 1Q24A 1OIQA 4OTHA 1VYWA 3KN5A 4ANLA 4EC9A 5FUTA 3KIOC 5AUWA 3OWLA 5CXHA 3OW3A 4FIHA 3LPBA 3HVCA 1K3AA 4HVHA 3KXNA 5AUXA 5FXSA 3LFBA 1ZLTA 4I6BA 4BKYA 4JX7A 2C1BA 5FRIA 5I9WA 4RG0A 1AQ1A 3AKKA 3NUUA 3UNKA 2BMCA 3KCKA 4MXOA 2X7OA 3C4XA 3TZ8A 4ZJJA 2BUJA 4JI9A 2UW5A