3MY1A

Structure of cdk9/cyclint1 in complex with drb
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
322
structure length
314
Chain Sequence
DSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/protein binding/inhibitor
molecule keywords Cell division protein kinase 9
publication title Halogen bonds form the basis for selective P-TEFb inhibition by DRB
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 314
sequence length 322
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2010-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3my1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3my1A01
3TV4A 3ZLYA 4DFXE 1OVEA 2WU6A 5DRBA 2J51A 4IC8A 3TKHA 3ROCA 2JKKA 2W5BA 3G2FA 5D11A 4ALVA 5AAGA 4ZY5A 2YZAA 3R1YA 5L6WL 3SD0A 3CGOA 3Q9WA 3OD6X 4C0TA 4L68A 4FZDB 5J9LA 3HAMA 2C6KA 2GNFA 4U0IA 4U5JA 5JQ8A 3AC4A 3UO5A 1YI4A 2UVZA 3A60A 4MXZA 4YBKA 5ITAA 4FKGA 4CV9A 3C4FA 3D5UA 4QMPA 5FWKK 2JFMA 4BFMA 3VRZA 1I09A 3U6JA 1R3CA 4GYGA 3UQFA 2UW4A 2BZJA 3AC5A 2VRXA 3R9HA 4WT6A 4ZS0A 3PUPA 1NT2A 2IVTA 4IE9A 3SAYA 3R8VA 4PTGA 5EG3A 2BRNA 3LM0A 3S4QA 2PPQA 4XV9A 3VJNA 2J5FA 4RVLA 3NUAA 4QTBA 5TOZA 1B39A 4I6HA 3AQVA 2C68A 3Q5IA 3LMGA 3GOKA 5TR6A 1HOWA 3TZ7A 3KRRA 3W10A 2XJ1A 5HBEA 3DOGA 5DEWA 4NJ3A 4CMOA 4EBVA 4YU2A 3THBA 4O86A 3DTCA 3O50A 4EHGA 3AMYA 2BDJA 4FYOA 2IG7A 2YM7A 3ZUTA 2B4SB 2R5TA 3GU5A 4RWKA 4O1OA 3MY1A 4D2TA 3SXRA 4NM3A 2LAVA 3GEQA 5GHVA 4L9IA 4U40A 5M55A 4C61A 4GL9A 3ATTA 3VAPA 3WF8A 1PMEA 3Q2MA 4F1MA 2BHHA 4AACA 4ACMA 3DDPA 3LQ5A 1UNLA 3BBWA 3V3VA 4C34A 3TUCA 1PKGA 5KX8A 3QYZA 2BZIB 2EVAA 2C3LA 1JKKA 1YDSE 1YI3A 5CQUA 2OXYA 3UOHA 4ZLYA 2ESMA 2R3IA 3COIA 3HEGA 3TKIA 3DGKA 1QPCA 3NLBA 3O7LB 5FDXA 3V8TA 5EKNA 5E4HA 1H8FA 2Y7JA 4FSMA 1WBPA 1OGUA 3R7VA 3EKNA 4FV9A 5DI1A 3I0OA 3ANQA 2EWAA 3SKCA 2CCIA 4D2WA 4X3FC 2ITQA 4JDJA 1OKZA 4RJ8A 3HV6A 4LGGA 4TWOA 3PG3A 4X7QA 2VTSA 1WVXA 4DCEA 4A4OA 2ERZE 3OY1A 3RI1A 4R7BA 2OLCA 4FTAA 5IUHA 1NXKA 2CCHA 4L00A 2ZDUA 4QMWA 3FMLA 2XKFA 3AGMA 2ZM4A 2C6LA 3PVGA 2A1AB 4L44A 3QWKA 5AR3A 5IUGA 3OT8A 3S3IA 5JKGA 3NW6A 2OZOA 2ZV8A 3HZTA 3NYOA 4BIBA 2Z7LA 5ANEA 3DJ7A 4WNKA 1HCLA 3DBFA 2J0LA 4X3FB 4L67A 5EYDA 4WG5A 4U97A 4AU8A 5JRSA 4RJ6A 4KUJA 2BUJA 3EYHA 4CZYB 4FKQA 4I20A 2B0QA 4X2FA 3R73A 4Q9SA 3VQUA 3ANRA 4E93A 1CMKE 3E88A 3PA3A 4BB4A 2FSMX 1YHWA 2ZAZA 3DB8A 2C0TA 3PXFA 4FC0A 4TYJA 1U5RA 1M7NA 5K4IA 1VZOA 3KCFA 3LE6A 1XWSA 3O2MA 3UC4A 2C6DA 3QUDA 3L9MA 4TYEA 5CU4A 3FXZA 3SRVB 3UP7A 3OXTA 4HCVA 4CMTA 3TTJA 4G6OA 3NGAA 2YIWA 3LFQA 4RVTA 4C62A 4P90A 2B9FA 2PE0A 2WELA 3AC3A 4K11A 4LRKA 3ULZA 4EBWA 4G5PA 4L6QA 4FUXA 3QFVA 4FEQA 2W9FB 4ZSAA 1GIHA 3UYTA 4EOSA 1STCE 2ERKA 2R3FA 5B0XA 4JOAA 4IWQA 5KZ0A 1Q8ZA 4HJOA 4J1RA 2VWUA 3JVSA 3NDMA 3DFAA 3N9XA 3LXKA 3V01A 3VO3A 3RHKA 3LFFA 2WKMA 3LQ8A 5CANA 1ZZLA 2O5KA 5IEYA 4M12A 4DEAA 4DF3A 5DR2A 2JAVA 3ZH8A 2QHMA 4C2VA 3HNGA 3RGFA 3KXZA 3OXIA 4GJ3A 4Y73A 1Y8YA 2HXLA 5HE0A 2OXDA 3ZFXA 4YJOA 5EYMA 2GQSA 3VBVA 2J50A 2Y4IC 3D4QA 3U4WA 2XK6A 2QO9A 3IOKA 4GG5A 3Q9XA 4J99A 2XNMA 2YFXA 3EWHA 3KC3A 3FKOA 4BYJA 2GS7A 1T45A 4O0RA 4S32A 3VUHA 5LVPA 4R78A 5L8KA 2WOUA 3D2KA 5G6VA 4IVAA 3HDMA 1LUFA 4BDBA 3RK7A 3TDWA 3VN9A 5EDRA 2XIXA 4RWJA 2EUFB 1YXXA 4I4FA 4XMOA 2FH9A 4D2VA 2WTIA 4O91A 3C5IA 3FZSA 5D7VA 5FM3A 1XO2B 2GMXA 4FKLA 4JIKA 3LPBA 3F6XA 2Y4PA 4MVFA 4EWHA 2OF2A 5L3AA 2Y4IB 5T6KA 4W4WA 2JKQA 2GPHA 4ENYA 4XG9A 3DU8A 2PMIA 4JXFA 4YZCA 3ZUVA 1W82A 4DH7A 3TNPC 3KRJA 1G8AA 2P2IA 3HAVA 4JJRA 1SZMA 3VUGA 2BHEA 4BCFA 4NM7A 3PDTA 3BGZA 3OW3A 4EH2A 4MF1A 2E9NA 4F7JA 1S9IA 4RIYA 4XV2A 4YZMA 3SC1A 5AUUA 5AP4A 1H4LA 4FSQA 4JQ8A 2HK5A 5F1ZA 3TACA 5KZIA 3NEWA 3MPMA 4H3QA 3FMMA 3BQRA 4XG2A 2IN6A 4GCJA 4XG7A 3GFWA 2I7QA 4E4MA 4HGSA 2WPAA 4PRJA 2H6DA 5JRQA 4G3DA 4ANOA 3COMA 3QCYA 4WO5A 3LJ2A 3OBGA 2R3JA 4DLJA 5IQEA 4ZP5A 4L46A 2VO6A 3C4EA 3Q4TA 5ANDA 1ZYDA 4EH5A 5HTIA 3UNKA 4O7YA 3PYYA 4FK3A 5GJGA 3DZQA 1VR2A 2GNGA 3ALOA 3ZLWA 3F69A 4KBKA 1GZOA 4UMRA 3EN6A 4D2RA 3EYGA 2UZTA 4LFIA 4EJNA 5DA3A 3RM6A 3BLQA 4BCIA 1BKXA 4RGJA 4UMPA 2WQBA 4QQ5A 2HIWA 3BGQA 5KUPA 3HV7A 1I44A 3FSFA 4AT4A 4C4IA 5BQ0A 2JIIA 4WNPA 5FXSA 2QOBA 4DC2A 3HMOA 4Z7HA 1XR1A 2PMLX 5GJDA 3LKMA 3P5KA 5BVKA 4YHJA 4WBOA 3WILA 2YACA 2G2FA 4MTAA 1ZARA 2PSQA 4BIDA 4EEVA 4R3PA 4RZVA 4V0GA 3EQCA 2BCJA 1YOJA 4WHZA 2JKOA 3CR0A 2W06A 2HZ4A 1U5QA 4QP2A 4MD9E 2YA9A 3BHVA 2BIYA 2BTRA 3ETAA 4FOBA 4M84A 2PVLA 2OGVA 3FPMA 1PXKA 5B2LA 5HE3A 4FV2A 3NUYA 2I0YA 4KABA 3BYOA 3QCSA 3FLNC 5CEMA 2PVRA 1XBCA 2J9MA 5ANIA 1O6YA 3TZ9A 4XNEA 3CP9A 1DI9A 3G9NA 5A6OA 1H1WA 1PXJA 4O6EA 5BMSA 1MQ4A 4I5CA 4GMYA 1AD5A 2E9UA 4IZ5A 1R1WA 1OL2A 2JGZA 2ZB1A 2XBAA 2KTYA 3R7GA 3M2WA 4FEWA 5HNGA 5IKWA 1BMKA 4Y5HA 5CWZA 3QQJA 3FEGA 3RP9A 3TV6A 4BIEA 4J7BA 3FL4A 5LWMA 4HYHA 3COKA 3NNVA 5J9YA 2ETMA 3RWQA 3UQGA 3M42A 3PRIA 4YZNA 5EI8A 4IX4A 4O2ZA 4XUFA 5AFVA 2HZ0A 3O8TA 3ET7A 3QRKA 3R7UA 5AEPA 4L53A 1CDKA 3V5LA 4FTMA 4ITIA 3BZ3A 5KKRC 2JDTA 3PXYA 2EXEA 3DAKA 4QP4A 3TJCA 4MXOA 3HMMA 2JC6A 1ZMWA 4M68A 3BBTB 4IMYA 5EHLA 4XBRA 3QKLA 4I23A 4TTHB 2VU3A 4FK6A 5AUZA 4DH5A 1UVRA 4ACGA 4U45A 4D5KA 3UQCA 5EYKA 1R39A 3VUIA 2BAQA 4BZDA 4R77A 1F0QA 3NYNA 1JQHA 4XG3A 3ZRMA 5AIRA 3LFDA 3TZ8A 5A4CA 3LZBA 5IDPA 2F49A 4XV3A 3F66A 3RKBA 2X7FA 3AT2A 4PTCA 1ERKA 3LLAA 4EYMA 2F2CB 5KKRB 2A2AA 3UC3A 1YQJA 5H3QA 2VTOA 5BUEA 4LGDA 4Y5QA 3MIYA 4ZLZA 1REJA 4LOOA 3BLHA 5IF1A 1OIQA 2W1IA 4FSUA 4N0SA 1PW2A 3AC1A 3ZBFA 4JG6A 3RAKA 3FQSA 5J87A 4OAVB 1Q8UA 4CKJA 3QKKA 3GCUA 4V01A 4I5HA 4IAAA 4BL1A 5EW3A 4CZTA 3DQXA 4H1MA 3ZC6A 3QZGA 4AA0A 3MA3A 3MFSA 2VNWA 3FMJA 2BZKB 4N70A 3FI2A 3GXLA 5AMNA 4NU1A 4QTCA 4FT5A 1JVPP 1OPJA 1ZYCA 2UW5A 3L8SA 4R6VA 3RNYA 2UUEA 2YAKA 4BC6A 3PSCA 5IMEA 3ZDIA 3SHEA 4F08A 2OJFE 4RIXA 4X3JA 4O6LA 5TE0A 3Q9ZA 5A4EA 2R3LA 5LMKA 3RJCA 5HE1A 4AT5A 4YBJA 4PDPA 2VTNA 1QPEA 2XYUA 3SOAA 3HRFA 2WMRA 3GBZA 2X81A 2EB3A 4YP8A 2DWBA 3KK8A 4ZJIA 4C4GA 2C5OA 5JMSA 3PY1A 4WOVA 3GC8A 2R3RA 5E8XA 3W2QA 4FTRA 4QQCA 2CSNA 5C8KA 2WEVA 2XEYA 2XNNA 3L1SA 4G6LA 1VYWA 3G6HA 3HMPA 1Q99A 2YN8A 3VS4A 3E92A 4CRLA 3E5AA 4DBXA 2Y8OA 3QLGA 1OPLA 4OTWA 5CEOA 4BGQA 3MTLA 4DINA 3A7HA 4NFMA 4F64A 3WARA 4BY9E 3LCKA 4I3ZA 4ANBA 5ICPA 4PX6A 4A06A 5CSPA 4E73A 3TTIA 3OMVA 5CSVA 2Y0AA 3GQLA 2X8IA 4EHZA 2P33A 3ZMMA 4J8NA 1PRYA 1W98A 5AM7A 5EW8A 3W16A 5I0BA 1H27A 4EONA 3COHA 5HLWA 3MY5A 4BBFA 4R3RA 3UG1A 4C3FA 4UWBA 3MA6A 2QNJA 3R8MA 3VVHA 4AZTA 2CKOA 1W0XC 4ZSGA 4I6BA 4MAOA 5ETCA 3KMMA 2CNQA 3AD6A 2WQNA 4LYNA 2WB8A 2Z60A 3KB7A 4PMSA 4XX9A 4TYIA 3RMFA 5IQCA 1JSTA 1KE7A 3H30A 4BRXA 4BWPA 3F2RA 5JEBA 3FY0A 4JLCA 5EM8A 2QU5A 3RHXA 4E26A 4FE2A 4F65A 4H58A 3E8DA 3LW0A 3BHHA 4XHKB 3BHUA 2PZPA 2YAAA 3SW4A 5E8VA 1URWA 1IEPA 2GFCA 3OUKA 4LI5A 2JBOA 4PF4A 4FL3A 2PUNA 2GHMA 4OTIA 4II5A 4TT7A 2HYYA 1CM8A 3ROYA 2UVXA 1KV2A 2R7BA 4C57A 3MN3A 4RA4A 3ZUUA 3FJQE 3NAXA 4ZY4A 3LFEA 4E3CA 2CLXA 3FHRA 3GT8A 4JL9A 4DLIA 2VX3A 4RIYB 3L9NA 4O7SA 3V6SA 3FSKA 3FHIA 4O81A 4O7WA 4YJNA 3TZMA 3OEZA 3CKXA 3WIKA 1WZYA 2NRYA 4GK3A 5CI7A 4AW0A 4C59A 3ZSIA 2NO3A 4FG8A 3R1QA 5CYIA 3PWYA 2ITTA 5LVOA 3RM7A 3IO7A 1Q41A 1TVOA 1ATPE 2ZM3A 4MX9A 4FIJA 5C1QB 4LGHA 1GOLA 2J7TA 4YGAA 4FF8A 2PTKA 3FMEA 4YJUA 3A7GA 3IECA 5HVYA 4BHZA 1OI9A 3GGFA 4DA5A 3NUPA 2O3PA 4DGNA 1S9JA 3NYVA 1ZYLA 1YXVA 2YLFA 4GH2A 4KAOA 5L4QA 2G15A 4OTGA 5HLPA 2H9VA 2JBPA 5E92A 5T68A 3W2CA 3WF7A 4H3BA 5GIPE 3KL8A 2AUHA 2GFSA 3LHJA 5M56A 2WGJA 4DEGA 4BCOA 3Q32A 3QA8A 3C4XA 4QMSA 3QUPA 4JVGA 3PXKA 2O2UA 2X6EA 4FSWA 5IUIA 4RLLA 2C6MA 5D1JA 4OUCA 4E5WA 2W7XA 2C5VA 2BFYA 5DOSA 4GKIA 4DCAA 3GC9A 4AZWA 3ORNA 4WRGA 2RF9A 5L6OA 2GNLA 3D14A 1JOWB 2YABA 4V0GB 3ZYAA 4P2KA 3FY2A 2QOLA 3BV3A 4GW8A 5I9YA 2PL0A 4HVHA 5BVNA 5J79A 4J96A 4C37A 4RLKA 4W4XA 4AUAA 5KMMA 3MJ1A 4QPAA 5IA5A 3ORTA 4KBCA 1T46A 3KXMA 1OITA 4IADA 4IVDA 1RW8A 4NWMA 3NUSA 2C30A 5HIBA 3H0YA 1OBGA 3QXOA 2OKRA 4BCGA 3QD4A 3D7TA 4FIIA 5L2QA 2J90A 4F7LA 2VTIA 1H25A 4FTJA 4J53A 2I40A 4BBMA 4NK9A 1H24A 4D1ZA 3R02A 3V5WA 4GIHA 5BMMA 4YUQA 2VO7A 1ZZ2A 4IZ7A 2X1NA 3EH9A 3ZHPC 4WUNA 4B4LA 3ZONA 4TN6A 4YJTA 4AZVA 4BDCA 2J0KA 3PJCA 3V51A 3LXLA 3UZTA 5TF9A 1NVSA 3E7VA 4GT5A 4IJ9A 1A06A 3QXPA 3LLTA 4L3PA 5ETAA 4CKIA 4FKVA 4EOOA 2G2IA 2PU8A 4FEUA 4KD1A 4PMTA 2GCDA 1TQPA 5C26A 3V6RA 3UODA 3ZSGA 2C1AA 3I1AA 3CPCA 3F3VA 4F7NA 3CQEA 3ZEPA 3UPZA 3R6XA 5HHWA 4C4EA 5H8EA 3LJ1A 3CCNA 4YJRA 1LP4A 4DT8A 1UWJA 2WTDA 1Q8YA 3A61A 2GNIA 3C51A 3DJ5A 4FKIA 4FKPA 2RG6A 4KIOA 1FOTA 5DEYA 3UNJA 1K9AA 3LCDA 3HYHA 4LMNA 3CSVA 4O7NA 4U9AA 5HU9A 4TZRA 4I6FA 4CLJA 1ZOHA 1ZWSA 3VBTA 4EOQA 4EORA 2YM3A 4FKRA 4QPMA 4GUEA 2I0EA 4EWQA 2B53A 3HKOA 5A4TA 2VZ6A 4EQUA 3U8WA 5CEIA 3HLLA 2PVKA 1VYZA 3RCDA 2OFVA 3LFAA 2I6LA 3CGFA 4USFA 3VBYA 3R21A 2PZ5A 1XQZA 3OZ6A 4FTCA 4E6CA 3P7BA 4O2PA 4FSZA 1XH8A 3QA0A 5LMKC 4HGTA 4I4EA 1YXUA 4Q5EA 1PMUA 3E3BX 2V22A 3FV8A 5E7RA 1GNGA 3GFEA 2C0IA 3MVMA 2XYNA 3BYSA 2J6MA 3TM0A 3JUHA 4LG4A 1ZY5A 3LFCA 3N51A 4FR4A 5BUIA 3G5DA 2XK9A 4GJ2A 4IIRA 1H1PA 1Q3DA 2IVSA 2WMTA 1ZOGA 1A9UA 3GC0A 2WO6A 3ZDUA 4PPCA 1IAHA 3CD8A 5FRIA 3EB0A 3U6IA 4O27B 4GK4A 3OWLA 2FYSA 1E1XA 4RIXB 3W2OA 2VNYA 2ZJWA 3I81A 5E91A 3UVQA 4EK8A 4TWPA 3PRFA 3VIDA 3DCVA 4IX3A 4LUDA 5LMAA 2X2LA 3C4WA 3RPVA 5C8NA 1P4FA 2XRWA 2JDVA 3RALA 3HUBA 3II5A 2Z7SA 4AFJA 1R0PA 2WMUA 2BDFA 4ZSJA 4QQJA 4C8BA 4WSYA 4GT4A 5I5ZA 3F5UA 3Q53A 2F7XE 1B6CB 5CY3A 2XJ0A 5E9EA 3H9RA 3VBXA 2QKWB 1Q62A 2H96A 2XIKA 3E8EA 2WQEA 4G31A 4ENXA 5GINE 3A2CA 5EDPA 3NUNA 2BFXA 1FVRA 2IW6A 4KIQA 3L8XA 2XCKA 1RJBA 4FODA 4GVJA 3R28A 5HNBA 1A48A 4JQ7A 1P14A 4FVRA 1H1SA 2PE2A 3PJ3A 4K6ZA 3R9NA 5JGDA 2Z7QA 2RSVA 5LCJA 3ZEWA 4FVQA 3O0GA 4I22A 3SG8A 4OTHA 3KA0A 5CEQA 3D0EA 5HBJA 3DXQA 3KXHA 4KIKA 3C4ZA 2C47A 2R3KA 3QTRA 4BR3A 1GY3A 5JH6A 2Q0NA 4WBBB 3HVCA 3UTOA 4XOZA 1BUHA 3QTSA 4FSTA 4OTFA 5EK7A 4AE6A 3N4TA 1G5SA 4PL4A 5CASA 1QCFA 3ZO3A 4BICA 2C6IA 3V8SA 3PY3A 5TKDA 4CVAA 1BL6A 3DKGA 5BUJA 3EOCA 2RKUA 5H8BA 3JVRA 2QR8A 4QMTA 1OIUA 4TWCA 3UMWA 3PXRA 5E8YA 1ZY4A 2B9JA 2VX0A 4K1BA 5BNJA 2OJJA 5M4FA 1KE5A 3CQUA 3ORLA 3C13A 2OJIA 3A7FA 3U54A 4X6QC 1JKTA 4IX5A 3JYAA 4I93A 4DE4A 4YJPA 1Q5KA 4LM5A 1DAWA 3UBDA 3V5QA 1YKRA 2YITA 3FXWA 5L2IA 4ASEA 3LM5A 4XOYA 4I5MA 1B38A 5AUXA 4HVSA 3UZRA 2QD9A 3BIZA 4MHAA 3R9DA 2YCFA 1H08A 3GU4A 3GU6A 4N57A 2VTAA 4AFEA 4AG8A 5I4NA 2XM9A 1KWPA 4BCHA 4FKOA 2R3OA 5K5NA 5FG8A 2QOIA 4H39A 3SX9A 4A4XA 3CC6A 2PWLA 2WIHA 3MB7A 4HZSA 2OWBA 4X0MA 1PY5A 3B2WA 2X9EA 3S95A 4NTTA 4FL2A 3GB2A 4IFCA 3ODZX 3RPYA 4FNWA 4E6AA 3G33A 4BCNA 4FICA 1UNHA 4D0WA 3RK9A 1X8BA 3ACJA 3P1AA 5CTPA 3CKWA 3KCKA 4C7TA 4QNAA 4JG7A 5JGAA 4H05A 5IH4A 4CG9A 3QQKA 3LMHA 3OOGA 4DFBA 5EI6A 3DKFA 1SVEA 1YDRE 3F88A 2J5EA 4A9UA 3EMGA 5EHOA 3O7LD 4RSSA 5E1EA 4YLJA 5JSMA 1Y91A 1OL7A 4BTMA 5H8GA 1YXTA 3KN5A 1APME 4FIEA 5HD4A 5FBNC 1U46A 3E7OA 3LCSA 3AT3A 3QU0A 3PA4A 5HG5A 2OZAB 4CFXA 4IACA 3AOXA 2XNEA 4RC4A 3QCQA 4IZYA 3IW6A 1OMWA 2W1FA 4YC8A 3NSZA 4APPA 3FMDA 3QHWA 5AV0A 2HZNA 3D2IA 4IWDA 3ERKA 5FBOA 3RZFA 5JFSA 1XHAA 4XYFA 2PHKA 4K33A 5F94A 1YOLA 5HGIA 3ZC5A 2IZUA 2C6OA 4GFMA 3MSSA 4KNBA 5H9BA 2XKEA 5I9VA 2HCKA 3DZOA 3O51A 3R1SA 3UVPA 4YPDA 2YWVA 4GU6A 1MRUA 3P23A 5HKMA 4ZZMA 5KHXA 1M7QA 5CZHA 4QMZA 3D7TB 5DWRA 4MEDA 3OW4A 4EOKA 2UZBA 3UOLA 3PIXA 4D1SA 1TQMA 3UG2A 4IAKA 4BKJA 1F3MC 3PVWA 3I0QA 3O8UA 3DXNA 2PVJA 2REIA 2J2IB 3OF0A 4RC2A 3BU5A 3ORPA 3S1HA 2EXCX 1ZMVA 2BIKB 3OTVA 4O7LA 4MQ2A 4NUSA 4E8AA 3LOKA 4EH3A 1H0WA 4JQEA 3FI8A 2XK8A 3CS9A 4UYNA 5J1WA 3QTIA 3ELJA 2WOTA 2YCRA 4AW1A 2YDIA 3IOPA 3DNDA 4FOCA 4V04A 2SRCA 3VUMA 3DAJA 5L8LA 4FIFA 4ZSEA 2R3QA 2UZWE 4ZS4A 4GV1A 2W17A 3BHYA 4HPTE 3OOMA 4IB3A 1PXIA 5HO7A 4IXPA 4FMQA 4L7SA 3U4UA 3KRLA 3W8QA 4EOLA 5AWMA 1SVHA 4LRJA 3IG7A 4W4YA 4CCUA 2UZNA 4FNZA 4USDA 3VS1A 5IQIA 2VO0A 3EQFA 2BKKA 5CVFA 3CPBA 3E3PA 3HL7A 4L3LA 3C50A 1UU3A 3CY2A 2BZHB 3H3CA 4R1YA 5AV4A 2R0IA 5FP5A 4EYJA 4NSTA 5CU0A 4PPBA 3DDQA 5GJFA 3G51A 5IEXA 5M06A 5J8IA 4D58A 3PPZA 4BDEA 3NS9A 4Q5HA 2PUIA 2WXVA 3E64A 1KOBA 3LXNA 2C5XA 4DH1A 4I0RA 3NW5A 2XJ2A 4AT3A 5LMBA 3K2LA 4O1PA 4LOQA 5JN2A 3HV5A 4JAJA 3Q52A 4DFYA 2XZSA 4TPTA 4AQCA 3BEAA 1Q61A 4D1XA 3O17A 4TNDA 4OW8A 1W84A 4AN9A 3I60A 3S2PA 4CG8A 4HNFA 4Y95A 2PMNX 4U44A 1JKSA 4NKSA 1MP8A 2OIBA 4W8DA 4Y8DA 4ZTNA 4ZTQA 3ZO1A 4F9BA 5IQAA 4J71A 2UVYA 4QTEA 5HBHA 4FZ6A 5FLFA 4AZFA 4ANLA 4M13A 4EZ5A 5J5TA 4U81A 5C03A 4PP9A 2E9PA 1V0PA 1XH4A 3E87A 2XVDA 4D5HA 4P5QA 4XG4A 3N4VA 3E8NA 4FG9A 5JT2A 3PP1A 1UNGA 2G1TA 5DYJA 2WTWA 3R0TA 5EM5A 1M2PA 3VUDA 4E4LA 2I1MA 1BYGA 5BVFA 3PE1A 1XBBA 2ITPA 4D4RA 2BRBA 2VV9A 4RQKA 4CQGA 5IA3A 4MNFA 3Q4ZA 4CNHA 4XEYA 3CEKA 4XP2A 5AA9A 5DT4A 3W2RA 2QKRA 3C0IA 1SYKA 1TQIA 4FV3A 4DTKA 2HY0A 4ERKA 4CT2A 4Z16A 3WOWA 3H10A 3MV5A 4BDKA 5JFVA 4C58A 2W05A 4FTIA 5K9IA 4O0WA 3LFNA 2Y6MA 4J98A 4KBAA 4ZJVA 2VTMA 2UW3A 2R3HA 4DEEA 2QOCA 4BGGA 5IU2A 1BI8A 5BVOA 3L8PA 4ANNA 4W9XA 3GNIB 4EH8A 5IA1A 2R4BA 4P4CA 4RFZA 4ASZA 4M7IA 4AXAA 3IW8A 2X7GA 2PVFA 4XBUA 1URCA 1CSNA 3P86A 4CMUA 3DLSA 3TN8A 4E5BA 3OXZA 4XG6A 1PJKA 3FXXA 2VAGA 3QZHA 3BYVA 3ZO2A 2ONLC 4YJSA 3PFQA 4KIKB 4EC8A 5EYCA 2W4JA 5EOLA 2YWPA 2IO6A 2QO2A 3CY3A 1KSWA 5E90A 4KRCA 4IB1A 4E7WA 4ITJA 3RWPA 4MWHA 5HESA 1KV1A 3IW4A 2OSCA 2O8YA 5HO6A 1JSVA 4UWCA 4BCMA 3F3WA 4FG7A 5C4KA 3M11A 4MK0A 5EHYA 1Y6BA 3ZBXA 2CDZA 4IM0A 2VWXA 2WIPA 2XIZA 5M51A 4XJ0A 1LEWA 4Q2AA 2JIUA 4GEOA 3C0GA 3BI6A 4X2JA 3KY2A 3GP0A 2ZB0A 3IS5A 1M2RA 3KRXA 3FZTA 2XNBA 2FUMA 5DVRA 4ANQA 5M09A 3MIAA 4LV8A 4UX9A 3BEGA 4DTAA 4ZAUA 3PG1A 4M66A 4RG0A 4ASDA 2WTVA 4YHFA 4YMJA 4D9TA 2YM8A 3MVJA 4IWOA 1J1BA 1UU8A 3P0MA 2WEIA 4IH8A 3GENA 5E1SA 5I9XA 4FEXA 2V62A 3PJ1A 2QQ7A 4AZEA 5FXQA 4R1VA 2F4JA 1OIRA 4TYGA 4EHVA 3FLYA 4BDIA 4F0FA 2WTJA 2CGUA 3FC2A 4TW9A 2GDOA 5A54A 4R8QA 1UKIA 3A99A 1R0EA 1Q8TA 4MXXA 4RWLA 4OLIA 3WZEA 3D94A 4E4XA 3Q2JA 4PY1A 1H26A 2QOOA 2KULA 4FV5A 4G6NA 3KF7A 2RFSA 4EUUA 4DFZE 4ZZOA 2YLEA 4RX9A 5HLNA 3TT0A 1H1RA 2HWOA 2VD5A 4BDDA 3VS2A 2JFLA 3HV3A 4KKEA 5DHJA 5DH3A 2CKQA 4G3FA 4CRSA 4QYGA 4E5AX 3RPSA 4C02A 3R01A 4YURA 4LOPA 3UZPA 3DAEA 4LUEA 3WE8A 2WMAA 5F20A 1Q4LA 2P2HA 4UMQA 3TCPA 3V5PA 3WZKA 2YDKA 3NIZA 4JBQA 4DITA 4XLVA 1UU9A 5L2SA 4ALWA 3RPRA 4HGEA 4JG8A 3FMNA 4ARKA 5IZFA 4M0ZA 5BYYA 2FSOX 4RT7A 4GVAA 1J3HA 2EB2A 4UMTA 3NNUA 5D10A 2UV2A 3BRBA 5DLSA 4XG8A 4KKGA 2YM6A 2X4FA 3BWJA 4E6QA 3R83A 4HGLA 4PWNA 3UO4A 2CNUA 2DYLA 2NRUA 5CQWA 3SGCA 3PP0A 3POZA 2HOGA 4LV5A 3QRTA 2HENA 3RVGA 1PXNA 1XH7A 3ZCLA 3EKKA 4WIHA 1OIYA 2C0OA 4FIHA 4KSPA 5HCZA 4KSQA 2QU6A 3QQHA 5EM7A 5DR6A 4A4LA 4HVDA 2IPXA 1NVRA 4F7SA 1QL6A 2BAKA 4GK2A 4AGCA 4DG0E 4FTKA 4QT1A 4AZSA 4C3RA 1ZOEA 3MI9A 3I7BA 3HA8A 4PL3A 4CKRA 3ZLSA 5K3YA 3CQWA 4IB5A 4CSVA 3GCQA 3QTQA 2CN8A 2Z2WA 1YDTE 3OROA 5FTGA 5AV3A 4EKLA 3L9LA 5AX9A 2OG8A 2VTLA 3PSDA 4K18A 4U80A 5AR8A 3WF5A 5HVKA 4G5JA 5FP6A 5IQBA 3W8LA 3PIZA 2A0CX 3TNHA 3R22A 5CEKA 2O0UA 4YPSA 3FLZA 3WZJA 3OFMA 5FM2A 2WNTA 5CSHA 2ZYBA 4WD5A 3OCGA 1AGWA 4MYGA 5F95A 3UVRA 4DH8A 3W1FA 3DQWA 3R7YA 3DK7A 3Q5ZA 3NUXA 2GTNA 2XIRA 5DFPA 4QP8A 3OWJA 4G34A 4RJ3A 2PYWA 3VUKA 2FGIA 2WTCA 4LL0A 5AR4A 5J9ZA 4FYNA 5I3OA 2CJMA 3MWUA 4NJDA 4ZTHA 1ZMUA 4BI0A 2QR7A 2FO0A 1H1QA 4LRMA 4OTRA 3DBCA 2E2BA 3R00A 5JK3A 2IZTA 1UA2A 2B52A 5IG1A 3BWFA 4GU9A 1FBNA 2V55A 4FTUA 4WA9A 5CNNA 4NT4A 2X7OA 4L43A 5HEZA 2PVMA 3LCOA 3W32A 1OBDA 4L45A 3VF9A 5C8MA 4JR7A 4CYIA 5IPJA 2R3PA 3QL8A 3TWJA 4HVIA 1J7IA 5HORA 3FLWA 3EFWA 3D5XA 5KBQA 1OPKA 3TL8A 4KB8A 4F99A 1Z5MA 4D4YA 1OB3A 4MBLA 4G1WA 2X8DA 4WSQA 3RAHA 5AP6A 4NKAA 5AAEA 4OBQA 1FGKA 4JDHA 4EQCA 5B2MA 4BTJA 4AN2A 3HP2A 2O64A 4UXQA 5M44A 1AQ1A 2Z7RA 4QMVA 2IVVA 3ZU7A 4IAZA 4FZAB 4DH3A 4GKHA 3CTHA 4F6WA 5H2UA 3MH3A 2VTHA 2QG5A 5AJQA 3RPOA 2XUUA 4GYIA 4FTQA 3U55A 3NW7A 3BYMA 3OT3A 4R5SA 1BX6A 3MPAA 2W4KA 2W5HA 4G3EA 4GRBA 5HG9A 5IMXA 1WMKA 4YZBA 1H01A 3UOJA 4L7FA 5AIKA 2OJ9A 5CF6A 5AUWA 4TKSA 2B9HA 4CYJA 5LVNA 3NVKI 2Q0BA 2VWIA 4DGGA 2NP8A 2QOFA 3V5TA 4ACDA 4CCBA 5GZAA 5HX6A 4AGUA 1Y6AA 3R8LA 4IX6A 4AOIA 3SA0A 4TL0A 3EN4A 5AX3A 2BTSA 4E1ZA 4OT6A 2QC6A 4O38A 2VWBA 4JIAA 4XRJA 4YR8A 4TRLA 4E6DA 2OZAA 3FMKA 3H0ZA 5EKOA 4BYIA 3CLYA 2XBJA 2JAMA 4CQEA 3GUBA 4C38A 3DV3A 4A7CA 4DG3E 3SG9A 2B9IA 2YJRA 3FL5A 3NCZA 3VNTA 3SXSA 3C4CA 2YM5A 3L8VA 2C5NA 4AA4A 1W8CA 4AW2A 3R2BA 4IC7A 3SV0A 3NVMB 5DG5A 5EQEA 4XH6A 3QC4A 2ZM1A 3QWJA 3PVUA 5DN3A 4IM2A 1GJOA 5AUVA 4JNWA 1PMNA 2XMYA 3I5NA 4QMOA 1U4DA 2IWIA 2Y9QA 4OGRA 3G9LX 4RX7A 4TWNA 5AP5A 4FL1A 3BCEA 4F0IA 1YWNA 3QRUA 4YSMA 3D15A 3VS3A 2DUVA 2W99B 5AR5A 4K9YA 1L3RE 4CZUA 3I5ZA 3DXPA 4PNIA 2P0CA 3WF6A 4QQTA 4PV0A 2WTKC 4RBLA 4FZFB 3Q04A 2C69A 1SVGA 3KEXA 3E93A 4MQ1A 4RJ5A 4AAAA 2XNPA 3CJFA 2X9FA 3VBQA 1QPJA 2PE1A 3FAAA 4YTIA 4ERWA 4I92A 4BDAA 3BE2A 4FGRA 3R8UA 3GCSA 2B7AA 4FBXA 4V05A 4FTOA 3MJ2A 4AOTA 1GAGA 3FQEA 5CZIA 5FTOA 5HG7A 5L8JA 1Z57A 3HECA 3WF9A 4EHEA 4A9RA 4F0GA 3KULB 5L6PA 2C6EA 4I24A 2FA2A 2GQGA 4FSNA 3CTJA 4I94A 2W1EA 2IW8A 1UKHA 3QHRA 2BRHA 1F5QA 4E20A 3HMIA 3QQUA 4ALUA 2QG7A 2XNGA 2FVDA 1OUKA 2O63A 2WTKB 1PXLA 4BKZA 3ACKA 5FGKA 5M4CA 3S00A 2BRMA 2DQ7X 1FVTA 3UPXA 4D2SA 3TIZA 3PVBA 3GCVA 5BYZA 3F3TA 3REPA 1DS5A 4KINA 5HCXA 3ATSA 4F4PA 4YJVA 2W1ZA 3KQ7A 4G9CA 3NX8A 4XP0A 3TNQB 3R8ZA 3KREA 4IAYA 3F82A 3ULIA 4XS2A 3TXOA 3WZDA 1RE8A 5BPYA 2J4ZA 1E1VA 3V04A 2B55A 4RRVA 3IGGA 4X2NA 4FTNA 4GFOA 3EIDA 1VJYA 4NH1A 3ZFMA 4AX8A 4YZ9A 3HRBA 4FIGA 4HW7A 4BCQA 3PPJA 4FNYA 4G16A 4YTFA 3QKMA 3C0HA 4ZY6A 2YJSA 2HZIA 2UZLA 3MTFA 3QGWA 4ZJJA 3UGCA 4BCJA 3F2NA 5AV1A 1FPUA 4MXYA 2C4GA 4IEBA 3WI6A 5FQDC 5GZ8A 2AC3A 1G8SA 1V0OA 3TUDA 3PY0A 5CAVA 5DPVA 3D5WA 5HICA 4U8ZA 2R64A 1SNXA 1YI6A 1QPDA 3EQHA 3QX2A 4D28A 4O0XA 4O0VA 3ZXZA 3VQHA 4LL5A 5LVLA 2C3KA 3DA6A 3R63A 3W55A 5DR9A 1Q97A 4ZK5A 4DG2E 5IEVA 4PMPA 4YNEA 3T9IA 1Y8GA 3WYXA 2VWZA 1J1CA 2GHGA 3QUEA 4MBJA 1NW1A 5A4QA 5CAPA 5CEPA 5FD2A 2XB7A 4NIFA 4B8LA 4CV8A 5KMJA 4RFMA 2OW3A 4OTPA 4PUZA 5E8ZA 1CTPE 1XH6A 4PQNA 3ORIA 4P7EA 5CAOA 1L8TA 4EQMA 3ID6C 4CLIA 3UIXA 3WIGA 2X4ZA 3KRWA 4FKJA 1EH4A 3KMUA 5HE2A 4Z9LA 4DGMA 1IA9A 5ANJA 5F9EA 5HX8A 3EQBA 4TXCA 2P3GX 1J7LA 1WAKA 5AP3A 4HCUA 3H9OA 3RCJA 3F7WA 3IPHA 5CF8A 2WMXA 4PDYA 1ND4A 4EJ7A 1YXSA 3A8XA 2C5YA 2Y6OA 3I7CA 3H4JA 4FTLA 2GU8A 1CKPA 3QTZA 4EK5A 4FT3A 2W1HA 2DS1A 2VWWA 4I1ZA 1KE6A 4DYMA 5CF4A 4UN0C 5IH6A 1RDQE 3TNIA 4KS8A 5M07A 5IISA 1U54B 4UMUA 4QMMA 4QMYA 3FPQA 3VC4A 4BBEA 4O7ZA 5DIAA 3KGAA 5KHWA 2YIYA 4FKWA 4O7RA 3A7IA 4QMXA 3PZEA 3HMNA 4XLIA 3BELA 2GS2A 3WYYA 2VN9A 3FZ1A 4NM0A 4APCA 2PULA 4O7VA 3OY3A 4RMZA 3TI1A 4ZTSA 1OKYA 2JDOA 2XKCA 5AV2A 1IR3A 3OUNB 2EXMA 1K3AA 4DEBA 4FSYA 4BI2A 3FUPA 4O0SA 2F57A 3KMWA 1V1KA 2VGOA 3OTUA 1G3NA 4RIOA 4QP9A 5DNRA 4ANSA 4O21A 4D4SA 2ETKA 2GS6A 3QQLA 2RFDA 5CENA 3DBQA 1PXMA 2ONLA 2PK9A 3BKBA 4ZTRA 4K0YA 1WBVA 4UALA 3UDBA 3VHEA 3F3UA 4TYHA 3HGKA 2W1GA 4QP3A 1LR4A 4XCUA 3MESA 2YIQA 5KO1A 3P7AA 5CT0A 2VO3A 2YHVA 3TG1A 4CTBA 4EK6A 3VS6A 4EH6A 1ZRZA 5M4IA 2XS0A 1SM2A 2X8EA 4O82A 3PA5A 5HZNA 3AD5A 5GNKA 3VWAA 4RVKA 5KNJA 4MF0A 2ITXA 5LJJA 3B8QA 4K2RA 3Q4CA 2HELA 2UZEA 3EN7A 4IAFA 2XF0A 3EJ1A 4M15A 1KE9A 2RFNA 3LAUA 3QQFA 4RC3A 4Y46A 4FA2A 4M14A 2JKMA 1MQBA 4C3PA 3I6WA 2R3MA 4RVMA 2XCHA 4RQVA 3QX4A 2CNVA 4QOXA 2PVYA 4J97A 3VUTA 4ZEGA 3FI4A 2ITUA 4PTEA 4QP1A 4U6RA 3UJGA 3I4BA 3Q60A 2ZV2A 2UZVA 4O84A 3FE3A 2YM4A 4GS6A 4W9WA 3SVVA 1CKIA 3Q4UA 4JX3A 4QMUA 4RJ4A 5ANOA 1WBOA 5ETIA 4NFNA 3T3UA 4FV1A 5FDPA 1KUTA 2YZLA 3A4PA 2W1CA 3QD3A 4F9WA 3GQIA 5J1VA 3UMXA 2GQRA 4U7ZA 1DAYA 3GU8A 4ZZNA 3NUUA 3R7OA 2RFEA 3F9NA 3PWDA 4J52A 5I9UA 3R7EA 1M14A 3UP2A 4A9SA 4EH9A 4F70A 1M2QA 2FB8A 3EZRA 4P5ZA 2OF4A 5HOAA 5LVMA 1YOMA 3BU3A 3MFRA 4FTTA 4ID7A 3CTQA 4DN5A 2JITA 3NRMA 2R3NA 3TEIA 3Q96A 3IDCA 2UW8A 3RBWA 2BROA 3DBDA 4IBMA 4OTDA 1XH5A 1UWHA 3WZUA 3PE2A 4KWPA 5AR7A 3ZS5A 3JR1A 4QMQA 5EOBA 2GSFA 3V5JA 4BKYA 3FKNA 3AMAA 5AP0A 4FNXA 3ORZA 1Q24A 2XK3A 3EN5A 1Q3WA 4ZSLA 4G9RA 4JT3A 4PMMA 2CGWA 3K5UA 2BPMA 3HDNA 3GCPA 4GT3A 4D0XA 1FQ1B 4JDIA 4RFYA 4W4VA 4M97A 5CVGA 3RZBA 4F09A 3OHTA 3FYKX 2XKDA 3KFAA 1QMZA 3E63A 3T3VA 4F6UA 4LMUA 4J8MA 5DT0A 3VF8A 2VGPA 4QNYA 2IW9A 4B9DA 4Z7GA 5HNIX 4IDTA 5CSXA 2ZV7A 3RNIA 3UIUA 4EK4A 2E9OA 2VTQA 1H0VA 3DKOA 4CEGA 3R7IA 1FVVA 5A46A 5J7BA 3VJOA 4NEUA 3KXNA 5DMZA 4JRVA 4IAIA 2RG5A 4QYFA 2WFYA 2PVNA 3L9PA 4YLLA 1PYXA 2QOKA 3PSBA 4XV1A 2UZOA 3GVUA 5J7HA 5JZNA 3CD3A 5AUYA 2OI4X 2ZOQA 3FDNA 5CU6A 2VTTA 5HQ0A 4YNOA 1PKDA 4IFGA 2VTJA 4QYHA 4RWIA 5CAUA 2F2UA 5CAQA 5HU3A 1XBAA 5AUTA 3LIJA 5K5XA 4JX7A 4NZWB 1M17A 3DK3A 3NMUF 5D12A 4AGWA 1LPUA 2B1PA 5ACKA 5DRDA 1WBWA 4KRDA 5LXMA 3BE9A 4MH7A 4HCTA 5E8TA 2LGCA 5KMLA 3C5UA 5E8WA 1LEZA 4K8AA 2I0VA 4Y72A 4D9UA 4JR3A 5IA0A 1UV5A 2QOQA 3GU7A 2YCQA 5TT7A 2PY3A 3OBJA 4IHPA 3U9CA 5A3XA 3R30A 2JLDA 2UW0A 2WZJA 3BPRA 4C4FA 4ASXA 4F9CA 1SMHA 5AP7A 1OL1A 4EC9A 1O6KA 2P55A 2W96B 1OKWA 4JAIA 4M69A 4FKSA 5HVJA 2CKEA 5A9UA 4NW6A 2HAKA 3NNXA 3QF9A 4HVGA 5LCKA 4AP7A 1O6LA 2VWYA 3D83A 3PJ2A 2XK4A 4MNEA 5LARA 1H28A 3A4OX 4B7TA 5LWNA 5BX0A 4RIWB 4FZ7A 2E9VA 4M8TA 2JIVA 4ITHA 3ZM4A 4BTKA 3NIEA 4ZMFA 2HW7A 5AADA 4D2PA 5I9ZA 4CGAA 4G3CA 4X21A 3VW8A 4TY1A 5AP1A 3BU6A 1SNUA 2UW9A 3UNZA 1PXOA 3F7ZA 5CU3A 4FI1A 2ITVA 1YHSA 1XJDA 2UW6A 5G1XA 5FTQA 3FZPA 3DTWA 5AA8A 1VEBA 3DBEA 3QZFA 4NIFB 5HIDA 2JDRA 4IVBA 5CF5A 3R9RA 3NAYA 4OTQA 1WCCA 4BI1A 1TKIA 4DGLC 5K0XA 3HA6A 5LOHA 2PZIA 1P2AA 4QP7A 4CFFA 3ZTXA 3DJ6A 1CKJA 4Z55A 5KMOA 4DEHA 1FGIA 4BZOA 4BN1A 4L52A 4S31A 5EFQA 4XRLA 4IB0A 2IJMA 2V5QA 2C3JA 3E8CA 2BMCA 2ITWA 4CXAA 2H8HA 5BVEA 2BAJA 4YHTA 4ZOGA 4YZDA 3ZOSA 5HCYA 4S30A 2RIOA 3ODYX 4NTSA 2WMVA 3BYUA 4W8EA 4BDFA 5B7VA 4YTCA 4MXCA 2WMBA 2JDSA 1YRPA 3SLSA 4C33A 4X2KA 1IASA 4UZHA 3C7QA 2QLQA 4U3YA 3DNEA 4FKUA 4AOJA 5HTBA 1BLXA 1REKA 2W0JA 5L2TA 1BL7A 4HYUA 4YC3A 3RTPA 1YWVA 1H07A 3FZRA 2HY81 2HWPA 4NM5A 4FV0A 5BVWA 5EI2A 4CD0A 3P78A 2GHLA 3PTGA 3ZFYA 4AF3A 2W9ZB 4EKKA 3FZOA 2QI8A 3UO6A 3MH0A 1PMVA 5C01A 4IVCA 3TNWA 5IQGA 4F63A 3SOCA 3P9JA 2R2PA 5M08A 4U43A 3PLAE 4N6YA 1PHKA 1JNKA 1OL5A 5ETFA 4QMNA 3NPCA 2R3GA 3UIBA 2OFUA 5CS6A 2QODA 3MW1A 2F7ZE 3KXGA 4EOJA 4DEIA 3NYXA 4RZWA 2NNWB 4MD7E 4KKHA 4MXAA 2J0JA 4PPAA 4WNMA 4Z3VA 4Q9ZA 1PF8A 3QZIA 2WQOA 4QPSA 3OS3A 3ZZEA 2BILB 3R1NA 4I0TA 4TYHB 5E8UA 1YVJA 4IWPA 1MRYA 4O0YA 4OAUC 3MDYA 3BV2A 3BX5A 4BCKA 3EN9A 5F4NA 4JS8A 3DKCA 3K54A 4KA3A 3KULA 3W18A 2QVSE 4DEDA 3QCXA 1MRVA 2GTMA 2FSTX 4I6QA 5D9HA 2YIRA 3PZHA 1IA8A 3ZRKA 4GG7A 3O8PA 2YISA 5BVDA 5EQPA 4GIIA 3LFBA 4WKQA 4YJQA 3Q6UA 4FKTA 2OJGA 4QD6A 3ENMA 3IDBA 4L42A 3MYGA 3ITZA 4R3CA 2IZSA 1YW2A 3DS6A 4RX5A 5EDQA 4EOIA 5AM6A 5A14A 5BYLA 2PZRA 3IONA 4IQ6A 2X2MA 3GC7A 3EHAA 1W83A 5HI2A 4MCVA 4DFUA 4A9YA 5IA2A 3F5GA 2W5AA 4UEUA 3ZXTA 3MGYA 1Z9XA 4HYIA 2X2KA 3G6GA 1WVYA 1P5EA 5CNOA 4N4SA 4ZIMA 3C9WA 3OG7A 2VUWA 3MS9A 1M52A 2CHLA 4IANA 4YO6A 3IK3A 2ZV9A 3KVXA 5EW9A 4ACCA 3B2TA 4AE9A 4I0SA 3G0EA 3CE3A 3PPKA 4O22A 4HNIA 5K4JA 1OKVA 2ITYA 3Q9YA 3R8PA 4A07A 3S0OA 1P4OA 4R7IA 5CX9A 5DBXA 3AD4A 4HOKA 4ORKA 4F9AA 4ZMEA 4USEA 2RL5A 4R7HA 4ANMA 4JRNA 4O0UA 3H9FA 4NW5A 5CI6A 1J91A 3DB6A 3DK6A 1NA7A 2XRUA 2WAJA 5AP2A 4BTFA 3BLRA 1WBSA 2ZMCA 1DM2A 2F7EE 2BRGA 2O65A 3P08A 3LXPA 3MH2A 1OUYA 4LQMA 3VS5A 2OBJA 5HD7A 3OCBA 5A4LA 4BDHA 5I3RA 4HPUE 4IJPA 4IZAA 4ZLOA 2BVAA 3TV7A 3HRCA 3OCTA 4FT7A 4NCTA 2VX1A 2QONA 3HP5A 3MPTA 4CFUA 5C4LA 4S2ZA 3P7CA 4WG4A 4EK3A 1WBNA 4O83A 2OK1A 4O7TA 5B2KA 2NPQA 4UY9A 2XP2A 3EFJA 4YO4A 4ZTMA 5M4UA 3IQ7A 4U42A 3QALE 3UE4A 2FSLX 5AR2A 5J95A 3UIMA 2AYPA 3FKLA 4WG3A 2J0IA 3Q3BA 2ITOA 4QYEA 4FV4A 4N6ZA 2CGXA 5HO8A 4M3QA 3WBLA 1YHVA 3TUBA 4NYEA 3ZM9A 5DT3A 3AC2A 4OBPA 4PDOA 2WMWA 3VRYA 4KIPA 4S33A 3TJDA 3FQHA 1RQQA 4F1TA 4B6LA 2OU7A 1KE8A 3CBLA 5KMNA 2XM8A 5KMKA 4D55A 4O0TA 1U54A 4I5PA 3U9NA 2QOHA 1ZLTA 1ZYJA 4MKCA 5ANGA 2OICA 4AWIA 4JBVA 1UU7A 4ZTLA 4ACHA 2UW7A 3FYJX 4GSBA 5IA4A 3VHKA 3G90X 4FV7A 5FEEA 4UBAA 4EI4A 3KN6A 4H36A 4JBOA 4UB7A 2W4OA 5GIOE 3AXWA 3JXWA 2IVUA 2R9SA 3K3IA 4RX8A 3NR9A 2XK7A 4X6RA 5CU2A 4BZNA 3VS7A 2UZUE 2EU9A 4IM3A 3FBVA 1GZKA 3R9OA 5A6NA 4BCPA 4BWKA 3TDVA 3QTWA 4FT0A 5E8SA 5AAFA 4HZRA 1JKLA 2OIQA 3Q6WA 4AA5A 5JGBA 4CFNA 4TNBA 3ZLXA 3AT4A 4MD8E 3U6HA 3OVVA 2ETRA 4QTAA 4YTHA 4DBNA 3MH1A 3AGLA 3ORMA 3QYWA 4U79A 1FMOE 3AMBA 4C4HA 3EFLA 4BDGA 5EM6A 3LMIA 3PXZA 4PDSA 4QTDA 3W2SA 3QRIA 2VWVA 5HTCA 4M69B 2QLUA 5D7AA 3BQCA 4DHFA 1BI7A 1IRKA 4EUTA 2I0HA 3ORXA 4L8MA 5JFWA 4RJ7A 3F5XA 2OH0E 2PVHA 4MNEB 4EZ3A 4QP6A 1WVWA 3IKAA 3MFTA 3OC1A 2A19B 3JPVA 2XEZA 3OP5A 3F2AA 4FUYA 4XP3A 5KMIA 3MBLA 1V0BA 4FV6A 3SXFA 3HV4A 4I41A 3NWWA 4RPVA 5HG8A 3EZVA 4CFMA 2ZVAA 4JBPA 4Y85A 2G2HA 3QTUA 3ALNA 2CKPA 3A62A 3EQRA 2OO8X 4FX3A 5ACBC 4PL5A 5FEDA 5D41A 3T9TA 2YEXA 3QD2B 2XIYA 3TIYA 3ZSHA 4AW5A 4BVUA 2AC5A 2OIDA 2VTPA 4C4JA 3KXXA 3ZRLA 4AN3A 4B8MA 4CTCA 1XH9A 4EH7A 4WRSA 5DE2A 4L3JA 4GFGA 4CT1A 1ZAOA 2HW6A 2BKZA 4OT5A 2G9XA 3ZO4A 2GNJA 3PIYA 3P4KA 4DFNA 3F61A 3OCSA 3O96A 1OM1A 4DAWA 4YSJA 3EQIA 5IQDA 1GIIA 5EQYA 5CLPA 4DT9A 3DPKA 2CLQA 3EL8A 5KCVA 4X2GA 3MB6A 3V8WA 3CJGA 5K0KA 4EL9A 3QAME 3FI3A 4H3PA 3EQPA 5CALA 2V7OA 4DTBA 4Y83A 3KK9A 3QLFA 2RGPA 4B99A 4EH4A 2ITZA 1PYEA 1OZ1A 2WD1A 5T3QA 3W2PA 2XH5A 4F6SA 1JPAA 2V0DA 2B54A 4UV0A 4FEVA 3ORKA 3U51A 4C35A 1OL6A 4EOPA 1W7HA 5HIEA 1PXPA 4H1JA 2YERA 3VW6A 2WMSA 5JFXA 4UWYA 5L2WA 1E9HA 5LQFA 2G01A 3MVLA 3ENHA 3OWKA 4ONAA 4X3FA 4J95A 3FLSA 3RK5A 3BGPA 3VULA 2UZDA 2C3IB 3EQGA 2H34A 1Q8WA 3QBNA 1WBTA 1Y57A 4WNOA 2YDJA 3SQQA 5M57A 1J7UA 4OR5A 3F5PA 3A8WA 3K5VA 2GNHA 3MVHA 4CFVA 4U41A 1R78A 1GIJA 2XNOA 1JBPE 2C6TA 4PNKA 4UXLA 5I9WA 4EZ7A 2ITNA 1FINA 1H00A 4O96A 5CVHA 3AG9A 2WMQA 2VTRA 4CFWA 1NY3A 3MY0A 3FC1X 3U87A 4FV8A 4D4VA 2WQMA 3BHTA 4FSRA 3SRVA 3HX4A 4KS7A 5CXHA 2C1BA 4BHNA 3POOA 3F3ZA 3QQGA 4QYYA 4R5YA 3JS2A 3JY9A 4UYAA 4IW0A 3D7ZA 4M67A 1NVQA 4A9TA 4I21A 3SW7A 3NNWA 1WFCA 2CMWA 2PUPA 2ZDTA 5IQHA 1O9UA 2CGVA 5CT7A 2A27A 2BDWA 2IZRA 2X0GA 3LCTA 5KE0A 2ACXA 2OXXA 3OEFX 3R71A 4QMLA 3FMHA 2A4LA 4F9YA 4WUAA 3RINA 3QRJA 3N4UA 4YLKA 4E4NA 1ZYSA 3B8RA 3EL7A 2QURA 3MFUA 2BALA 3FLQA 3QD0A 5GZ9A 4HYSA 4RA5A 5IH5A 3IDPA 3E62A 3GOPA 4QRCA 4BDJA 4IDVA 3FWQA 3ZZWA 3R2YA 3CXWA 3I6UA 2X6DA 2QCSA 3NZ0A 4GUBA 4B0GA 5J5SA 5JQ5A 1JLUE 2JEDA 3DLZA 5FEQA 4MBIA 1U59A 3LQ3A 4NCTC 4AGDA 3T8OA 5EH0A 4FVPA 5KBRA 4FT9A 1YWRA 4M0YA 3WE4A 5CXZA 4L01A 2P4IA 4K77A 3IW7A 2J0MB 3D9VA 2OH4A 3PLSA 4PP7A 5M53A 4MWIA 3IW5A 2R7IA 2PUUA 2BR1A 3KU2A 3RAWA 4DFLA 3KKVA 2QHNA 1IAJA 1K2PA 1KOAA 3KVWA 4RIWA 2PMOX 3LFSA 2CPKE 3UYSA 5CSWA 2QO7A 3AC8A 5IQFA 3R04A 1GZNA 2WU7A 3QC9A 4QO9A 2W1DA 3GI3A 3W33A 3LJ0A 3NCGA 3C1XA 3K3JA 2HXQA 3QGYA 4BGHA 2R0UA 3EFKA 3VS0A 3SDJA 3P79A 1GZ8A 5C9CA 3I79A 2PZYA 2YIXA 3M1SA 2XA4A 4C36A 3PJ8A 4UZDA 5IDNA 3DT1A 4G3GA 1ZXEA 3KF4A 3RAIA 1HCKA 4U3ZA 5FUTA 2YCSA 3IGOA 4ZXTA 1JSUA 1MUOA 4AS0A 4FGBA 2Q83A 4BWXA 4G2FA 2WHBA 5FXRA 3PXQA 3G15A 1JAMA 2ZMDA 3EQDA 3VBWA 4NL0A 3TKUA 1DI8A 1XKKA 4S34A 5ANKA 2Z8CA 3JY0A 2V7AA 4JDKA 1FMKA 3UOKA 1IG1A 2CN5A 3G0FA 4YC6A 4EOMA 2X39A 3HUCA 2JD5A 3DFCB 3OWPA 5JZJA 3QTXA 3D5VA 3DY7A 5C27A 4C2WA 4JI9A 4F1OA 5DGZA 1OECA 2F9GA 3O71A 5TO8A 2Z02A 4G17A 4BF2A 3LVPA 4OBOA 1JWHA 3O23A 3CIKA 3A7JA 4DGOA
chains in the Genus database with same CATH superfamily
3TV4A 3ZLYA 4DFXE 1OVEA 2WU6A 5DRBA 2J51A 4IC8A 3TKHA 3ROCA 2JKKA 2W5BA 3G2FA 5D11A 4ALVA 5AAGA 4ZY5A 2YZAA 3R1YA 5L6WL 3SD0A 3CGOA 3Q9WA 3OD6X 4C0TA 4L68A 4FZDB 5J9LA 3HAMA 2C6KA 2GNFA 4U0IA 4U5JA 5JQ8A 3AC4A 3UO5A 1YI4A 2UVZA 3A60A 4MXZA 4YBKA 5ITAA 4FKGA 4CV9A 3C4FA 3D5UA 4QMPA 5FWKK 2JFMA 4BFMA 3VRZA 1I09A 3U6JA 1R3CA 4GYGA 3UQFA 4BJJB 2UW4A 2BZJA 3AC5A 2VRXA 3R9HA 4WT6A 4ZS0A 3PUPA 1NT2A 3TYKA 2IVTA 4IE9A 3SAYA 3R8VA 4PTGA 5EG3A 2BRNA 3LM0A 3S4QA 2PPQA 4XV9A 3VJNA 2J5FA 4RVLA 3NUAA 4QTBA 5TOZA 1B39A 4I6HA 3AQVA 2C68A 3Q5IA 3LMGA 3GOKA 5TR6A 1HOWA 3TZ7A 3KRRA 3W10A 2XJ1A 5HBEA 3DOGA 5DEWA 4NJ3A 4CMOA 4EBVA 2X0QA 4YU2A 2AQXA 3THBA 4O86A 3DTCA 3O50A 4EHGA 3AMYA 2BDJA 4FYOA 2IG7A 2YM7A 3ZUTA 2B4SB 2R5TA 3GU5A 4RWKA 4O1OA 3MY1A 4D2TA 3SXRA 1ST4A 4NM3A 2LAVA 3GEQA 5GHVA 4L9IA 4U40A 5M55A 4C61A 4GL9A 3ATTA 3VAPA 3WF8A 1PMEA 3Q2MA 4F1MA 2BHHA 4AACA 4ACMA 3DDPA 3LQ5A 1UNLA 3BBWA 3V3VA 4C34A 3TUCA 1PKGA 5KX8A 3QYZA 2BZIB 2EVAA 2C3LA 1JKKA 1YDSE 1YI3A 5CQUA 2OXYA 3UOHA 4ZLYA 2ESMA 2R3IA 3COIA 3HEGA 3TKIA 3DGKA 1QPCA 3NLBA 3O7LB 5FDXA 3V8TA 5EKNA 5E4HA 1H8FA 2Y7JA 4FSMA 1WBPA 1OGUA 3R7VA 3EKNA 4FV9A 5DI1A 3I0OA 3ANQA 2EWAA 3SKCA 2CCIA 4D2WA 4X3FC 2ITQA 4JDJA 1OKZA 4RJ8A 3HV6A 4LGGA 4TWOA 3PG3A 4X7QA 2VTSA 1WVXA 4DCEA 4A4OA 2ERZE 3OY1A 2XAMA 3RI1A 4R7BA 2OLCA 4FTAA 5IUHA 3PUFC 1NXKA 2CCHA 4L00A 2ZDUA 4QMWA 3FMLA 2XKFA 4O4FA 3AGMA 2ZM4A 2C6LA 3PVGA 2A1AB 4L44A 3AKLA 3QWKA 5AR3A 5IUGA 3OT8A 4QDVA 3S3IA 5JKGA 3NW6A 2OZOA 2ZV8A 3HZTA 3NYOA 4BIBA 2Z7LA 5ANEA 3DJ7A 4WNKA 1HCLA 3DBFA 2J0LA 4X3FB 4L67A 5EYDA 4WG5A 4U97A 4AU8A 5JRSA 4RJ6A 4KUJA 2BUJA 3EYHA 4CZYB 4FKQA 4I20A 2B0QA 4X2FA 3R73A 4Q9SA 3VQUA 3ANRA 4E93A 1CMKE 3E88A 3PA3A 4BB4A 2FSMX 1YHWA 2ZAZA 3DB8A 2C0TA 3PXFA 4FC0A 4TYJA 1U5RA 1M7NA 5K4IA 1VZOA 3KCFA 3LE6A 1XWSA 3O2MA 3UC4A 2C6DA 3QUDA 3L9MA 4TYEA 5CU4A 3FXZA 3SRVB 3UP7A 3OXTA 4HCVA 4CMTA 3TTJA 4G6OA 3NGAA 2YIWA 3LFQA 4RVTA 4C62A 4P90A 2B9FA 2PE0A 2WELA 3AC3A 4K11A 4LRKA 3ULZA 4EBWA 4G5PA 4L6QA 4FUXA 3QFVA 4FEQA 2W9FB 4ZSAA 1GIHA 3UYTA 4EOSA 1STCE 2ERKA 2R3FA 5B0XA 4JOAA 4IWQA 5KZ0A 1Q8ZA 4HJOA 4J1RA 2VWUA 3JVSA 3NDMA 3DFAA 3N9XA 3LXKA 3V01A 3VO3A 3RHKA 3LFFA 2WKMA 3LQ8A 5CANA 1ZZLA 2O5KA 5IEYA 4M12A 4DEAA 4DF3A 5DR2A 2JAVA 3ZH8A 2QHMA 4C2VA 3HNGA 3RGFA 3KXZA 3OXIA 4GJ3A 4Y73A 1Y8YA 2HXLA 5HE0A 2OXDA 3ZFXA 4YJOA 5EYMA 2GQSA 3VBVA 2J50A 2Y4IC 3D4QA 3U4WA 2XK6A 2QO9A 3IOKA 4GG5A 3Q9XA 4J99A 2XNMA 2YFXA 3EWHA 3KC3A 3FKOA 4BYJA 2GS7A 1T45A 4O0RA 4S32A 3VUHA 5LVPA 4R78A 5L8KA 2WOUA 3D2KA 5G6VA 4IVAA 3HDMA 1LUFA 4BDBA 3RK7A 3TDWA 3VN9A 5EDRA 2XIXA 4RWJA 2EUFB 1YXXA 4I4FA 4XMOA 2FH9A 4D2VA 2WTIA 4O91A 3C5IA 3FZSA 3P5JC 5D7VA 5FM3A 1XO2B 2GMXA 4FKLA 4JIKA 3LPBA 3F6XA 2Y4PA 4MVFA 4EWHA 2OF2A 5L3AA 2Y4IB 5T6KA 4W4WA 2JKQA 2GPHA 4ENYA 4XG9A 3DU8A 2PMIA 4JXFA 4YZCA 3ZUVA 1W82A 4DH7A 3TNPC 3KRJA 1G8AA 2P2IA 3HAVA 4JJRA 1SZMA 3VUGA 2BHEA 4I6LA 4BCFA 4NM7A 3PDTA 3BGZA 3OW3A 4EH2A 4MF1A 2E9NA 4F7JA 1S9IA 4RIYA 4XV2A 4YZMA 3SC1A 5AUUA 5AP4A 1H4LA 4FSQA 4JQ8A 3AKKA 2HK5A 5F1ZA 3TACA 5KZIA 3NEWA 3MPMA 4H3QA 3FMMA 3BQRA 4XG2A 2IN6A 4GCJA 4XG7A 3GFWA 2I7QA 4E4MA 4HGSA 2WPAA 4PRJA 2H6DA 5JRQA 4G3DA 4ANOA 3COMA 3QCYA 4WO5A 3LJ2A 3OBGA 2R3JA 4DLJA 5IQEA 4ZP5A 4L46A 2VO6A 3C4EA 3Q4TA 5ANDA 1ZYDA 4EH5A 5HTIA 3UNKA 4O7YA 3PYYA 4FK3A 5GJGA 3DZQA 1VR2A 2GNGA 3ALOA 3ZLWA 3F69A 4KBKA 1GZOA 4UMRA 3EN6A 4D2RA 3EYGA 2UZTA 4LFIA 4EJNA 5DA3A 3RM6A 3BLQA 4BCIA 1BKXA 4RGJA 4UMPA 2WQBA 4QQ5A 2HIWA 3BGQA 5KUPA 3HV7A 1I44A 3FSFA 4AT4A 4C4IA 5BQ0A 2JIIA 4WNPA 5FXSA 2QOBA 4DC2A 3HMOA 4Z7HA 1XR1A 2PMLX 5GJDA 3LKMA 3P5KA 5BVKA 4YHJA 4WBOA 3WILA 2YACA 2G2FA 4MTAA 1ZARA 2PSQA 4BIDA 4EEVA 4R3PA 4RZVA 4V0GA 3EQCA 2BCJA 1YOJA 4WHZA 2JKOA 3CR0A 2W06A 2HZ4A 1U5QA 4QP2A 4MD9E 2YA9A 3BHVA 2BIYA 2BTRA 3ETAA 4FOBA 4M84A 2PVLA 2OGVA 3FPMA 1PXKA 5B2LA 5HE3A 4FV2A 3NUYA 2I0YA 4KABA 3BYOA 3QCSA 3FLNC 5CEMA 2PVRA 1XBCA 2J9MA 5ANIA 1O6YA 3TZ9A 4XNEA 3CP9A 1DI9A 3G9NA 5A6OA 1H1WA 1PXJA 4O6EA 5BMSA 1MQ4A 4I5CA 4GMYA 1AD5A 2E9UA 4IZ5A 1R1WA 1OL2A 2JGZA 2ZB1A 2XBAA 2KTYA 3R7GA 3M2WA 4FEWA 5HNGA 5IKWA 1BMKA 4Y5HA 5CWZA 3QQJA 3FEGA 3RP9A 3TV6A 4BIEA 4J7BA 3FL4A 5LWMA 4HYHA 3COKA 3NNVA 5J9YA 2ETMA 3RWQA 3UQGA 3M42A 3PRIA 4YZNA 5EI8A 4IX4A 4O2ZA 4XUFA 5AFVA 2HZ0A 3O8TA 3ET7A 3QRKA 3R7UA 5AEPA 4L53A 1CDKA 3V5LA 4FTMA 4ITIA 3BZ3A 5KKRC 2JDTA 3PXYA 2EXEA 3DAKA 4QP4A 3TJCA 4MXOA 3HMMA 2JC6A 1ZMWA 4M68A 3BBTB 4IMYA 5EHLA 2X0OA 4XBRA 3QKLA 4I23A 4TTHB 3TMOA 5BV3A 2VU3A 4FK6A 5AUZA 4DH5A 1UVRA 4ACGA 4U45A 4D5KA 3UQCA 5EYKA 1R39A 3VUIA 2BAQA 4BZDA 4R77A 1F0QA 3NYNA 1JQHA 4XG3A 3ZRMA 5AIRA 3LFDA 3TZ8A 5A4CA 3LZBA 5IDPA 2F49A 4XV3A 3F66A 3RKBA 2X7FA 3AT2A 4PTCA 1ERKA 3LLAA 4EYMA 2F2CB 5KKRB 2A2AA 3UC3A 1YQJA 5H3QA 2VTOA 5BUEA 4LGDA 4Y5QA 3MIYA 4ZLZA 1REJA 4LOOA 3BLHA 5IF1A 1OIQA 2W1IA 4FSUA 4N0SA 1PW2A 3AC1A 3ZBFA 4JG6A 3RAKA 3FQSA 5J87A 4OAVB 1Q8UA 4CKJA 3QKKA 3GCUA 4V01A 4I5HA 4IAAA 4BL1A 5EW3A 4CZTA 3DQXA 4H1MA 3ZC6A 3W0MA 3QZGA 4AA0A 3MA3A 3MFSA 2VNWA 3FMJA 2BZKB 4N70A 3FI2A 3GXLA 5AMNA 4NU1A 4QTCA 4FT5A 1JVPP 1OPJA 1ZYCA 2UW5A 3L8SA 4R6VA 3RNYA 2UUEA 2YAKA 4BC6A 3PSCA 5IMEA 3BL9A 3ZDIA 3SHEA 4F08A 2OJFE 4RIXA 4X3JA 4O6LA 5TE0A 3Q9ZA 5A4EA 2R3LA 5LMKA 3RJCA 5HE1A 4AT5A 4YBJA 4PDPA 2VTNA 1QPEA 2XYUA 3SOAA 3HRFA 2WMRA 3GBZA 2X81A 2EB3A 4YP8A 2DWBA 3KK8A 4ZJIA 4C4GA 2C5OA 5JMSA 3PY1A 4WOVA 3GC8A 2R3RA 5E8XA 3W2QA 4FTRA 4QQCA 2CSNA 5C8KA 2WEVA 2XEYA 2XNNA 3L1SA 4G6LA 1VYWA 3G6HA 3HMPA 1Q99A 2YN8A 3VS4A 3E92A 4CRLA 3E5AA 4DBXA 2Y8OA 3QLGA 1OPLA 4OTWA 5CEOA 4BGQA 3MTLA 4DINA 3A7HA 4NFMA 4F64A 3WARA 4BY9E 3LCKA 4I3ZA 4ANBA 5ICPA 4PX6A 4A06A 5CSPA 4E73A 3TTIA 3OMVA 5CSVA 2Y0AA 3GQLA 2X8IA 4EHZA 2P33A 3ZMMA 4J8NA 1PRYA 1W98A 5AM7A 5EW8A 3W16A 5I0BA 1H27A 4EONA 3COHA 5HLWA 3MY5A 4BBFA 4R3RA 3UG1A 4C3FA 4UWBA 3MA6A 2QNJA 3R8MA 3VVHA 4AZTA 2CKOA 1W0XC 4ZSGA 4I6BA 4MAOA 5ETCA 3KMMA 2CNQA 3AD6A 2WQNA 4LYNA 2WB8A 2Z60A 3KB7A 4PMSA 4XX9A 4TYIA 3RMFA 5IQCA 1JSTA 1KE7A 3H30A 4BRXA 4BWPA 3F2RA 5JEBA 2X0PA 3FY0A 4JLCA 5EM8A 2QU5A 3RHXA 4E26A 4FE2A 4F65A 4H58A 3E8DA 3LW0A 3BHHA 4XHKB 3BHUA 2PZPA 2YAAA 3SW4A 5E8VA 1URWA 1IEPA 2GFCA 3OUKA 4LI5A 2JBOA 4PF4A 4FL3A 2PUNA 2GHMA 4OTIA 4II5A 4TT7A 2HYYA 1CM8A 3ROYA 2UVXA 1KV2A 2R7BA 4C57A 3MN3A 4RA4A 3ZUUA 3FJQE 3NAXA 4ZY4A 3LFEA 4E3CA 2CLXA 3FHRA 3GT8A 4JL9A 4DLIA 2VX3A 4RIYB 3L9NA 4O7SA 3V6SA 3FSKA 3FHIA 4O81A 4O7WA 4YJNA 3TZMA 3OEZA 3CKXA 3WIKA 1WZYA 2NRYA 4GK3A 5CI7A 4AW0A 4C59A 3ZSIA 2NO3A 4FG8A 3R1QA 5CYIA 3PWYA 2ITTA 5LVOA 3RM7A 3IO7A 1Q41A 1TVOA 1ATPE 2ZM3A 4MX9A 4FIJA 5C1QB 4LGHA 1GOLA 2J7TA 4YGAA 4FF8A 2PTKA 3FMEA 4YJUA 3A7GA 3IECA 5HVYA 4BHZA 1OI9A 3GGFA 4DA5A 3NUPA 2O3PA 4DGNA 1S9JA 3NYVA 1ZYLA 1YXVA 2YLFA 4GH2A 4KAOA 5L4QA 2G15A 4OTGA 5HLPA 2H9VA 2JBPA 5E92A 5T68A 3W2CA 3WF7A 4H3BA 5GIPE 3KL8A 2AUHA 2GFSA 3LHJA 5M56A 2WGJA 4DEGA 4BCOA 3Q32A 3QA8A 3C4XA 4AXCA 4QMSA 3QUPA 4JVGA 3PXKA 2O2UA 2X6EA 4FSWA 5IUIA 4RLLA 2C6MA 5D1JA 4OUCA 4E5WA 2W7XA 2C5VA 2BFYA 5DOSA 4GKIA 4DCAA 3GC9A 4AZWA 3ORNA 4WRGA 2RF9A 5L6OA 2GNLA 3D14A 1JOWB 2YABA 4V0GB 3ZYAA 4P2KA 3FY2A 2QOLA 3BV3A 4GW8A 5I9YA 2PL0A 4HVHA 5BVNA 5J79A 4J96A 4C37A 4RLKA 4W4XA 4AUAA 5KMMA 3MJ1A 4QPAA 5IA5A 3ORTA 4KBCA 4O4CA 1T46A 3KXMA 1OITA 4IADA 4IVDA 3UDZA 1RW8A 4NWMA 3NUSA 2C30A 5HIBA 3H0YA 1OBGA 3QXOA 2OKRA 4BCGA 3QD4A 3D7TA 4FIIA 5L2QA 2J90A 4F7LA 2VTIA 1H25A 4FTJA 4J53A 2I40A 4BBMA 4NK9A 1H24A 4D1ZA 3R02A 3V5WA 4GIHA 5BMMA 4YUQA 2VO7A 1ZZ2A 4IZ7A 2X1NA 3EH9A 3ZHPC 4WUNA 4B4LA 3ZONA 4TN6A 4YJTA 4AZVA 4BDCA 2J0KA 3PJCA 3V51A 3LXLA 3UZTA 5TF9A 1NVSA 3E7VA 4GT5A 4IJ9A 1A06A 3QXPA 3LLTA 4L3PA 5ETAA 4CKIA 4FKVA 4EOOA 2G2IA 2PU8A 4FEUA 4KD1A 4PMTA 2GCDA 1TQPA 5C26A 3V6RA 3UODA 3ZSGA 2C1AA 3I1AA 3CPCA 3F3VA 4F7NA 3CQEA 3ZEPA 3UPZA 3R6XA 5HHWA 4C4EA 5H8EA 3LJ1A 3CCNA 4YJRA 1LP4A 4DT8A 1UWJA 2WTDA 1Q8YA 3A61A 2GNIA 3C51A 3DJ5A 4FKIA 4FKPA 2RG6A 4KIOA 1FOTA 5DEYA 3UNJA 1K9AA 3LCDA 3HYHA 4LMNA 3CSVA 4O7NA 4U9AA 5HU9A 3UDTA 4TZRA 4I6FA 4CLJA 1ZOHA 1ZWSA 3VBTA 4EOQA 4EORA 2YM3A 4FKRA 4QPMA 4GUEA 2I0EA 4EWQA 2B53A 3HKOA 5A4TA 2VZ6A 4EQUA 3U8WA 5CEIA 3HLLA 2PVKA 1VYZA 3RCDA 2OFVA 3LFAA 2I6LA 3CGFA 4USFA 3VBYA 3R21A 2PZ5A 1XQZA 3OZ6A 4FTCA 4E6CA 3P7BA 4O2PA 4FSZA 1XH8A 3QA0A 5LMKC 4HGTA 4I4EA 1YXUA 4Q5EA 1PMUA 3E3BX 2V22A 3FV8A 5E7RA 1GNGA 3GFEA 2C0IA 1XMMA 3W0OA 3MVMA 2XYNA 3BYSA 2J6MA 3TM0A 3JUHA 4LG4A 1ZY5A 3LFCA 3N51A 4FR4A 5BUIA 3G5DA 2XK9A 4GJ2A 4IIRA 1H1PA 1Q3DA 2IVSA 2WMTA 1ZOGA 1A9UA 3GC0A 2WO6A 3ZDUA 4PPCA 1IAHA 3CD8A 5FRIA 3EB0A 3U6IA 4O27B 4GK4A 3OWLA 2FYSA 1E1XA 4RIXB 3W2OA 2VNYA 2ZJWA 3I81A 5E91A 3UVQA 4EK8A 4TWPA 3PRFA 3VIDA 3DCVA 4IX3A 4LUDA 5LMAA 2X2LA 3C4WA 3RPVA 5C8NA 1OGYA 1P4FA 2XRWA 2JDVA 3RALA 3HUBA 3II5A 2Z7SA 4AFJA 1R0PA 2WMUA 2BDFA 4ZSJA 4QQJA 4C8BA 4WSYA 4GT4A 5I5ZA 3F5UA 3Q53A 2F7XE 1B6CB 5CY3A 2XJ0A 5E9EA 3H9RA 3VBXA 2QKWB 1Q62A 2H96A 2XIKA 3E8EA 2WQEA 4G31A 4ENXA 5GINE 3A2CA 5EDPA 3NUNA 2BFXA 1FVRA 2IW6A 4KIQA 3L8XA 2XCKA 1RJBA 4FODA 4GVJA 3R28A 5HNBA 1A48A 4JQ7A 1P14A 4FVRA 1H1SA 2PE2A 3PJ3A 4K6ZA 3R9NA 5JGDA 2Z7QA 2RSVA 5LCJA 2IEWA 3ZEWA 4FVQA 3O0GA 4I22A 3SG8A 4OTHA 3KA0A 5CEQA 3D0EA 5HBJA 3DXQA 3KXHA 4KIKA 3C4ZA 2C47A 2R3KA 3QTRA 4BR3A 1GY3A 5JH6A 2Q0NA 4WBBB 3HVCA 3UTOA 4XOZA 1BUHA 3QTSA 4FSTA 4OTFA 5EK7A 4AE6A 3N4TA 1G5SA 4PL4A 5CASA 1QCFA 3ZO3A 4BICA 2C6IA 3V8SA 3PY3A 5TKDA 4CVAA 1BL6A 3DKGA 5BUJA 3EOCA 2RKUA 5H8BA 3JVRA 3ML1A 2QR8A 4QMTA 1OIUA 4TWCA 3UMWA 3PXRA 4DHJA 5E8YA 1ZY4A 2B9JA 2VX0A 4K1BA 2XARA 5BNJA 2OJJA 5M4FA 1KE5A 3CQUA 3ORLA 3C13A 2OJIA 3A7FA 3U54A 4X6QC 1JKTA 4IX5A 3JYAA 4I93A 4DE4A 4YJPA 1Q5KA 4LM5A 1DAWA 3UBDA 3V5QA 1YKRA 2YITA 3FXWA 5L2IA 4ASEA 3LM5A 4XOYA 4I5MA 1B38A 5AUXA 4HVSA 3UZRA 2QD9A 3BIZA 4MHAA 3R9DA 1W2FA 4AXDA 2YCFA 1H08A 3GU4A 3GU6A 4N57A 2VTAA 4AFEA 4AG8A 5I4NA 2XM9A 1KWPA 4BCHA 4FKOA 2R3OA 5K5NA 5FG8A 2QOIA 4H39A 3SX9A 4A4XA 3CC6A 2PWLA 2WIHA 3MB7A 4HZSA 2OWBA 4X0MA 1PY5A 3B2WA 2X9EA 3S95A 4NTTA 4FL2A 3GB2A 4IFCA 3ODZX 3RPYA 4FNWA 4E6AA 3G33A 4BCNA 4FICA 1UNHA 4D0WA 3RK9A 1X8BA 3ACJA 3P1AA 5CTPA 3CKWA 3KCKA 4C7TA 4QNAA 4JG7A 5JGAA 4FJVA 4H05A 5IH4A 4CG9A 3QQKA 3LMHA 3OOGA 4DFBA 5EI6A 3DKFA 1SVEA 1YDRE 3F88A 2J5EA 4A9UA 3EMGA 5EHOA 3O7LD 4RSSA 5E1EA 4YLJA 5JSMA 1Y91A 1OL7A 4BTMA 5H8GA 1YXTA 3KN5A 1APME 4FIEA 5HD4A 5FBNC 1U46A 3E7OA 3LCSA 3AT3A 3QU0A 3PA4A 5HG5A 2OZAB 4CFXA 4IACA 3AOXA 2XNEA 4RC4A 3QCQA 4IZYA 3IW6A 1OMWA 2W1FA 4YC8A 3NSZA 4APPA 3FMDA 3QHWA 5AV0A 2HZNA 3D2IA 4IWDA 3ERKA 5FBOA 3RZFA 5JFSA 1XHAA 4XYFA 2PHKA 4K33A 5F94A 3W0PA 1YOLA 5HGIA 3ZC5A 2IZUA 2C6OA 4GFMA 3MSSA 4KNBA 5H9BA 2XKEA 5I9VA 2HCKA 3DZOA 3O51A 3R1SA 3UVPA 4YPDA 2YWVA 4GU6A 1MRUA 3P23A 5HKMA 4ZZMA 5KHXA 1M7QA 5CZHA 4QMZA 3D7TB 5DWRA 4MEDA 3OW4A 4EOKA 2UZBA 3UOLA 3PIXA 4D1SA 1TQMA 3UG2A 4IAKA 4BKJA 1F3MC 3PVWA 3I0QA 3O8UA 3DXNA 2PVJA 2REIA 2J2IB 3OF0A 4RC2A 3BU5A 3ORPA 3S1HA 2EXCX 1ZMVA 2BIKB 3OTVA 4O7LA 4MQ2A 4NUSA 4E8AA 3LOKA 4EH3A 1H0WA 4JQEA 3FI8A 2XK8A 3CS9A 4UYNA 5J1WA 3QTIA 3ELJA 2WOTA 2YCRA 4AW1A 2YDIA 3IOPA 3DNDA 4FOCA 4V04A 2SRCA 3VUMA 3DAJA 5L8LA 4FIFA 4ZSEA 2R3QA 2UZWE 4ZS4A 3BLAA 4GV1A 2W17A 3BHYA 4HPTE 3OOMA 4IB3A 1PXIA 5HO7A 4IXPA 4FMQA 4L7SA 3U4UA 3KRLA 3W8QA 4EOLA 5AWMA 1SVHA 4LRJA 3IG7A 4W4YA 4CCUA 2UZNA 4FNZA 4USDA 3VS1A 4MUQA 2VO0A 3EQFA 5IQIA 2BKKA 5CVFA 3CPBA 3E3PA 3HL7A 4L3LA 3C50A 1UU3A 3CY2A 2BZHB 3H3CA 4R1YA 5AV4A 2R0IA 5FP5A 1G8KA 4EYJA 4NSTA 5CU0A 4PPBA 3DDQA 5GJFA 3G51A 5IEXA 5M06A 5J8IA 4D58A 3PPZA 4BDEA 3NS9A 4Q5HA 1ST0A 2WXVA 3E64A 2PUIA 1KOBA 3LXNA 2C5XA 4DH1A 4I0RA 3NW5A 2XJ2A 4AT3A 5LMBA 3K2LA 4O1PA 4LOQA 5JN2A 3HV5A 4JAJA 3Q52A 4DFYA 2XZSA 4TPTA 4AQCA 3BEAA 1Q61A 4D1XA 3O17A 4TNDA 4OW8A 1W84A 4AN9A 3I60A 3S2PA 4CG8A 4HNFA 4Y95A 2PMNX 4U44A 1JKSA 4NKSA 1MP8A 2OIBA 4W8DA 4Y8DA 4ZTNA 4ZTQA 3ZO1A 4F9BA 5IQAA 4J71A 2UVYA 4QTEA 5HBHA 4FZ6A 5FLFA 4AZFA 4ANLA 4M13A 4EZ5A 5J5TA 4U81A 5C03A 4PP9A 2E9PA 1V0PA 1XH4A 3E87A 2XVDA 4D5HA 4P5QA 4XG4A 3N4VA 3E8NA 4FG9A 5JT2A 3PP1A 1UNGA 2G1TA 5DYJA 2WTWA 3R0TA 5EM5A 1M2PA 3VUDA 4E4LA 2I1MA 1BYGA 5BVFA 3PE1A 1XBBA 2ITPA 4D4RA 2BRBA 2VV9A 4RQKA 4CQGA 5IA3A 4MNFA 3Q4ZA 4CNHA 4XEYA 4DDIA 3CEKA 4XP2A 5AA9A 5DT4A 3W2RA 2QKRA 3C0IA 1SYKA 1TQIA 4FV3A 4DTKA 2HY0A 4ERKA 4CT2A 4Z16A 3WOWA 3H10A 3MV5A 4BDKA 5JFVA 4C58A 2W05A 4FTIA 5K9IA 4O0WA 3LFNA 2Y6MA 4J98A 4KBAA 4DHZA 4ZJVA 2VTMA 2UW3A 2R3HA 4DEEA 2QOCA 4BGGA 5IU2A 3VONA 1BI8A 5BVOA 3L8PA 4ANNA 4W9XA 3GNIB 4EH8A 5IA1A 2R4BA 4P4CA 4RFZA 4ASZA 4M7IA 4AXAA 3IW8A 2X7GA 2PVFA 4XBUA 1URCA 1CSNA 3P86A 4CMUA 3DLSA 3TN8A 4E5BA 3OXZA 4XG6A 1PJKA 3FXXA 2VAGA 3QZHA 3BYVA 3ZO2A 2ONLC 4YJSA 3PFQA 4KIKB 4EC8A 5EYCA 2W4JA 5EOLA 2YWPA 2IO6A 2QO2A 3CY3A 1KSWA 5E90A 4KRCA 4IB1A 4E7WA 4ITJA 3RWPA 4MWHA 5HESA 1KV1A 4LV7A 3IW4A 4JMQA 2OSCA 2O8YA 4QDEA 5HO6A 1JSVA 4UWCA 4BCMA 3F3WA 4FG7A 5C4KA 3M11A 4MK0A 5EHYA 1Y6BA 3ZBXA 2CDZA 4IM0A 2VWXA 2WIPA 2XIZA 5M51A 4XJ0A 1LEWA 4Q2AA 2JIUA 4GEOA 3C0GA 3BI6A 4X2JA 3KY2A 3GP0A 2ZB0A 3IS5A 1M2RA 3KRXA 3FZTA 2XNBA 2FUMA 5DVRA 4ANQA 5M09A 3MIAA 4LV8A 4UX9A 3BEGA 4DTAA 4ZAUA 3PG1A 4M66A 4RG0A 4ASDA 2WTVA 4YHFA 4YMJA 4AXFA 4D9TA 2YM8A 3MVJA 4IWOA 1J1BA 1UU8A 3PFYA 3P0MA 2WEIA 4IH8A 3GENA 5E1SA 5I9XA 4FEXA 2V62A 3PJ1A 2QQ7A 4AZEA 5FXQA 4R1VA 2F4JA 1OIRA 4TYGA 4EHVA 3FLYA 4BDIA 4F0FA 2WTJA 2CGUA 3FC2A 4TW9A 2GDOA 5A54A 4R8QA 1UKIA 3A99A 1R0EA 1Q8TA 4MXXA 4RWLA 4OLIA 3WZEA 3D94A 4E4XA 3Q2JA 4PY1A 1H26A 2QOOA 2KULA 4FV5A 4G6NA 3KF7A 2RFSA 4EUUA 4DFZE 4ZZOA 2YLEA 4RX9A 5HLNA 3TT0A 1H1RA 2HWOA 2VD5A 4BDDA 3VS2A 2JFLA 3HV3A 4KKEA 5DHJA 5DH3A 2CKQA 4G3FA 4CRSA 4QYGA 4E5AX 3RPSA 4C02A 3R01A 4YURA 4LOPA 3UZPA 3DAEA 4LUEA 3WE8A 2WMAA 5F20A 1Q4LA 2P2HA 4UMQA 3TCPA